data_4BTL
# 
_entry.id   4BTL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BTL         
PDBE  EBI-57320    
WWPDB D_1290057320 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BTL 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-06-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Andersson, C.D.' 1 
'Forsgren, N.'    2 
'Akfur, C.'       3 
'Allgardsson, A.' 4 
'Qian, W.'        5 
'Engdahl, C.'     6 
'Berg, L.'        7 
'Ekstrom, F.'     8 
'Linusson, A.'    9 
# 
_citation.id                        primary 
_citation.title                     
'Divergent Structure-Activity Relationships of Structurally Similar Acetylcholinesterase Inhibitors.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            56 
_citation.page_first                7615 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23984975 
_citation.pdbx_database_id_DOI      10.1021/JM400990P 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Andersson, C.D.' 1 ? 
primary 'Forsgren, N.'    2 ? 
primary 'Akfur, C.'       3 ? 
primary 'Allgardsson, A.' 4 ? 
primary 'Berg, L.'        5 ? 
primary 'Engdahl, C.'     6 ? 
primary 'Qian, W.'        7 ? 
primary 'Ekstrom, F.J.'   8 ? 
primary 'Linusson, A.'    9 ? 
# 
_cell.entry_id           4BTL 
_cell.length_a           78.671 
_cell.length_b           110.824 
_cell.length_c           227.112 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BTL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                                                      59764.488 2   3.1.1.7 ? 
'CATALYTIC DOMAIN, RESIDUES 32-574' ? 
2 non-polymer syn '4-(2-chloro-6-nitrophenoxy)-N-[2-(diethylamino)ethyl]benzenesulfonamide' 427.902   4   ?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                  221.208   4   ?       ? ? ? 
4 non-polymer syn 3,6,9,12,15,18,21,24,27,30,33,36,39-TRIDECAOXAHENTETRACONTANE-1,41-DIOL   634.751   11  ?       ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                            62.068    4   ?       ? ? ? 
6 water       nat water                                                                     18.015    318 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'HOUSE MOUSE' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293F' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4BTL A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 4BTL B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5GZ non-polymer                  . '4-(2-chloro-6-nitrophenoxy)-N-[2-(diethylamino)ethyl]benzenesulfonamide' ?                     
'C18 H22 Cl N3 O5 S' 427.902 
ALA 'L-peptide linking'          y ALANINE                                                                   ?                     
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking'          y ARGININE                                                                  ?                     
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                ?                     
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                           ?                     
'C4 H7 N O4'         133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                                  ?                     
'C3 H7 N O2 S'       121.158 
EDO non-polymer                  . 1,2-ETHANEDIOL                                                            'ETHYLENE GLYCOL'     
'C2 H6 O2'           62.068  
GLN 'L-peptide linking'          y GLUTAMINE                                                                 ?                     
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                           ?                     
'C5 H9 N O4'         147.129 
GLY 'peptide linking'            y GLYCINE                                                                   ?                     
'C2 H5 N O2'         75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                 ?                     
'C6 H10 N3 O2 1'     156.162 
HOH non-polymer                  . WATER                                                                     ?                     
'H2 O'               18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                ?                     
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                   ?                     
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking'          y LYSINE                                                                    ?                     
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking'          y METHIONINE                                                                ?                     
'C5 H11 N O2 S'      149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                  ?                     
'C8 H15 N O6'        221.208 
PE3 non-polymer                  . 3,6,9,12,15,18,21,24,27,30,33,36,39-TRIDECAOXAHENTETRACONTANE-1,41-DIOL   'POLYETHYLENE GLYCOL' 
'C28 H58 O15'        634.751 
PHE 'L-peptide linking'          y PHENYLALANINE                                                             ?                     
'C9 H11 N O2'        165.189 
PRO 'L-peptide linking'          y PROLINE                                                                   ?                     
'C5 H9 N O2'         115.130 
SER 'L-peptide linking'          y SERINE                                                                    ?                     
'C3 H7 N O3'         105.093 
THR 'L-peptide linking'          y THREONINE                                                                 ?                     
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                ?                     
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                  ?                     
'C9 H11 N O3'        181.189 
VAL 'L-peptide linking'          y VALINE                                                                    ?                     
'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          4BTL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '27-31 %(W/V) PEG750MME, 0.1 M HEPES PH 7.0-7.1' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2013-01-13 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9805 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             0.9805 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BTL 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.05 
_reflns.d_resolution_high            2.50 
_reflns.number_obs                   69367 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.70 
_reflns.B_iso_Wilson_estimate        44.02 
_reflns.pdbx_redundancy              6.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.45 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.40 
_reflns_shell.pdbx_redundancy        6.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BTL 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     68722 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.813 
_refine.ls_d_res_high                            2.500 
_refine.ls_percent_reflns_obs                    98.86 
_refine.ls_R_factor_obs                          0.1916 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1908 
_refine.ls_R_factor_R_free                       0.2316 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1384 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               55.01 
_refine.aniso_B[1][1]                            3.4814 
_refine.aniso_B[2][2]                            14.3665 
_refine.aniso_B[3][3]                            -17.8480 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.310 
_refine.solvent_model_param_bsol                 40.932 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.98 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 258-264 WERE EXCLUDED FROM THE MODEL DUE TO LACK OF ELECTRON DENSITY.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.37 
_refine.pdbx_overall_phase_error                 26.77 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8325 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         263 
_refine_hist.number_atoms_solvent             318 
_refine_hist.number_atoms_total               8906 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        28.813 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 8896  'X-RAY DIFFRACTION' ? 
f_angle_d          1.094  ? ? 12115 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.667 ? ? 3284  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 1287  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1576  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.5000 2.5893  6608 0.2818 99.00 0.3357 . . 146 . . 
'X-RAY DIFFRACTION' . 2.5893 2.6929  6636 0.2620 99.00 0.3242 . . 149 . . 
'X-RAY DIFFRACTION' . 2.6929 2.8154  6678 0.2601 99.00 0.3000 . . 131 . . 
'X-RAY DIFFRACTION' . 2.8154 2.9637  6640 0.2279 99.00 0.2714 . . 136 . . 
'X-RAY DIFFRACTION' . 2.9637 3.1491  6678 0.2235 99.00 0.2672 . . 154 . . 
'X-RAY DIFFRACTION' . 3.1491 3.3919  6735 0.2231 99.00 0.2804 . . 115 . . 
'X-RAY DIFFRACTION' . 3.3919 3.7326  6730 0.1992 99.00 0.2435 . . 149 . . 
'X-RAY DIFFRACTION' . 3.7326 4.2712  6724 0.1581 98.00 0.2162 . . 133 . . 
'X-RAY DIFFRACTION' . 4.2712 5.3756  6816 0.1440 99.00 0.1559 . . 131 . . 
'X-RAY DIFFRACTION' . 5.3756 28.8148 7093 0.1712 99.00 0.1988 . . 140 . . 
# 
_struct.entry_id                  4BTL 
_struct.title                     'Aromatic interactions in acetylcholinesterase-inhibitor complexes' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BTL 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'ACETYLCHOLINESTERASE, HYDROLASE, INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 4 ? 
F  N N 4 ? 
G  N N 3 ? 
H  N N 5 ? 
I  N N 2 ? 
J  N N 4 ? 
K  N N 5 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 2 ? 
O  N N 4 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 3 ? 
S  N N 5 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 2 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 4 ? 
Z  N N 6 ? 
AA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P2  2  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P3  3  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P4  4  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P5  5  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P6  6  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P7  7  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P8  8  SER A 203 ? SER A 215 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P9  9  LEU A 216 ? PHE A 222 ? LEU A 216 PHE A 222 5 ? 7  
HELX_P HELX_P10 10 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P11 11 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P12 12 PRO A 277 ? HIS A 284 ? PRO A 277 HIS A 284 1 ? 8  
HELX_P HELX_P13 13 GLU A 285 ? LEU A 289 ? GLU A 285 LEU A 289 5 ? 5  
HELX_P HELX_P14 14 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P15 15 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P16 16 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P17 17 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P18 18 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P19 19 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P20 20 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P21 21 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P22 22 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P23 23 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 PHE A 535 ? SER A 541 ? PHE A 535 SER A 541 1 ? 7  
HELX_P HELX_P27 27 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P28 28 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 29 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 30 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 31 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P32 32 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P33 33 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P34 34 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 35 SER B 203 ? SER B 215 ? SER B 203 SER B 215 1 ? 13 
HELX_P HELX_P36 36 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P37 37 ALA B 241 ? GLY B 256 ? ALA B 241 GLY B 256 1 ? 16 
HELX_P HELX_P38 38 GLY B 264 ? THR B 275 ? GLY B 264 THR B 275 1 ? 12 
HELX_P HELX_P39 39 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P40 40 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P41 41 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P42 42 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P43 43 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 44 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 45 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 46 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 47 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 48 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 49 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 50 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P51 51 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P52 52 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P53 53 PHE B 535 ? SER B 541 ? PHE B 535 SER B 541 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf2 disulf ?   ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf3 disulf ?   ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf4 disulf ?   ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf5 disulf ?   ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf6 disulf ?   ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.055 ? ?               
covale1 covale one ? A ASN 350 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 350 A NAG 1544 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale2 covale one ? A ASN 464 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 464 A NAG 1547 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3 covale one ? B ASN 350 ND2 ? ? ? 1_555 R NAG .   C1 ? ? B ASN 350 B NAG 1548 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale4 covale one ? B ASN 464 ND2 ? ? ? 1_555 P NAG .   C1 ? ? B ASN 464 B NAG 1546 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -4.18 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 5.53  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
BD ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
BD 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
BD 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
BD 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
BD 1  2  O VAL B 239 ? O VAL B 239 N VAL B 303 ? N VAL B 303 
# 
_database_PDB_matrix.entry_id          4BTL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BTL 
_atom_sites.fract_transf_matrix[1][1]   0.012711 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009023 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004403 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A  1 1   ? 31.573  13.936  56.446  1.00 89.08  ?  1    GLU A N   1 
ATOM   2    C  CA  . GLU A  1 1   ? 30.431  14.326  55.623  1.00 86.46  ?  1    GLU A CA  1 
ATOM   3    C  C   . GLU A  1 1   ? 29.501  15.214  56.429  1.00 88.97  ?  1    GLU A C   1 
ATOM   4    O  O   . GLU A  1 1   ? 29.732  16.417  56.561  1.00 101.37 ?  1    GLU A O   1 
ATOM   5    C  CB  . GLU A  1 1   ? 29.671  13.091  55.135  1.00 82.50  ?  1    GLU A CB  1 
ATOM   6    C  CG  . GLU A  1 1   ? 30.541  12.083  54.404  1.00 77.23  ?  1    GLU A CG  1 
ATOM   7    C  CD  . GLU A  1 1   ? 29.840  10.757  54.173  1.00 75.82  ?  1    GLU A CD  1 
ATOM   8    O  OE1 . GLU A  1 1   ? 28.773  10.522  54.790  1.00 69.56  ?  1    GLU A OE1 1 
ATOM   9    O  OE2 . GLU A  1 1   ? 30.365  9.950   53.371  1.00 75.32  ?  1    GLU A OE2 1 
ATOM   10   N  N   . GLY A  1 2   ? 28.435  14.615  56.950  1.00 74.86  ?  2    GLY A N   1 
ATOM   11   C  CA  . GLY A  1 2   ? 27.620  15.259  57.958  1.00 69.56  ?  2    GLY A CA  1 
ATOM   12   C  C   . GLY A  1 2   ? 26.380  16.007  57.531  1.00 70.98  ?  2    GLY A C   1 
ATOM   13   O  O   . GLY A  1 2   ? 25.263  15.584  57.832  1.00 66.39  ?  2    GLY A O   1 
ATOM   14   N  N   . ARG A  1 3   ? 26.576  17.125  56.837  1.00 81.89  ?  3    ARG A N   1 
ATOM   15   C  CA  . ARG A  1 3   ? 25.489  18.068  56.582  1.00 82.51  ?  3    ARG A CA  1 
ATOM   16   C  C   . ARG A  1 3   ? 24.990  18.129  55.144  1.00 69.57  ?  3    ARG A C   1 
ATOM   17   O  O   . ARG A  1 3   ? 24.141  18.960  54.844  1.00 73.78  ?  3    ARG A O   1 
ATOM   18   C  CB  . ARG A  1 3   ? 25.887  19.485  57.014  1.00 86.67  ?  3    ARG A CB  1 
ATOM   19   C  CG  . ARG A  1 3   ? 26.018  19.688  58.501  1.00 97.66  ?  3    ARG A CG  1 
ATOM   20   C  CD  . ARG A  1 3   ? 27.394  19.297  59.002  1.00 104.01 ?  3    ARG A CD  1 
ATOM   21   N  NE  . ARG A  1 3   ? 27.552  19.607  60.421  1.00 114.99 ?  3    ARG A NE  1 
ATOM   22   C  CZ  . ARG A  1 3   ? 28.637  19.310  61.127  1.00 116.75 ?  3    ARG A CZ  1 
ATOM   23   N  NH1 . ARG A  1 3   ? 29.658  18.694  60.540  1.00 118.47 ?  3    ARG A NH1 1 
ATOM   24   N  NH2 . ARG A  1 3   ? 28.701  19.625  62.413  1.00 113.89 ?  3    ARG A NH2 1 
ATOM   25   N  N   . GLU A  1 4   ? 25.499  17.274  54.260  1.00 63.92  ?  4    GLU A N   1 
ATOM   26   C  CA  . GLU A  1 4   ? 25.090  17.340  52.849  1.00 71.01  ?  4    GLU A CA  1 
ATOM   27   C  C   . GLU A  1 4   ? 23.899  16.447  52.559  1.00 74.79  ?  4    GLU A C   1 
ATOM   28   O  O   . GLU A  1 4   ? 23.475  15.674  53.416  1.00 82.66  ?  4    GLU A O   1 
ATOM   29   C  CB  . GLU A  1 4   ? 26.215  16.918  51.904  1.00 78.65  ?  4    GLU A CB  1 
ATOM   30   C  CG  . GLU A  1 4   ? 27.579  17.444  52.232  1.00 84.98  ?  4    GLU A CG  1 
ATOM   31   C  CD  . GLU A  1 4   ? 28.573  16.317  52.363  1.00 90.25  ?  4    GLU A CD  1 
ATOM   32   O  OE1 . GLU A  1 4   ? 28.620  15.709  53.457  1.00 90.40  ?  4    GLU A OE1 1 
ATOM   33   O  OE2 . GLU A  1 4   ? 29.283  16.027  51.371  1.00 87.52  ?  4    GLU A OE2 1 
ATOM   34   N  N   . ASP A  1 5   ? 23.376  16.548  51.336  1.00 66.18  ?  5    ASP A N   1 
ATOM   35   C  CA  . ASP A  1 5   ? 22.311  15.667  50.887  1.00 61.35  ?  5    ASP A CA  1 
ATOM   36   C  C   . ASP A  1 5   ? 22.880  14.264  50.774  1.00 62.54  ?  5    ASP A C   1 
ATOM   37   O  O   . ASP A  1 5   ? 23.818  14.038  50.020  1.00 62.06  ?  5    ASP A O   1 
ATOM   38   C  CB  . ASP A  1 5   ? 21.780  16.118  49.528  1.00 59.41  ?  5    ASP A CB  1 
ATOM   39   C  CG  . ASP A  1 5   ? 20.461  15.442  49.150  1.00 66.29  ?  5    ASP A CG  1 
ATOM   40   O  OD1 . ASP A  1 5   ? 20.124  14.380  49.721  1.00 74.96  ?  5    ASP A OD1 1 
ATOM   41   O  OD2 . ASP A  1 5   ? 19.751  15.982  48.274  1.00 59.81  ?  5    ASP A OD2 1 
ATOM   42   N  N   . PRO A  1 6   ? 22.323  13.314  51.538  1.00 63.18  ?  6    PRO A N   1 
ATOM   43   C  CA  . PRO A  1 6   ? 22.778  11.922  51.470  1.00 59.65  ?  6    PRO A CA  1 
ATOM   44   C  C   . PRO A  1 6   ? 22.351  11.216  50.185  1.00 56.64  ?  6    PRO A C   1 
ATOM   45   O  O   . PRO A  1 6   ? 22.774  10.088  49.943  1.00 53.10  ?  6    PRO A O   1 
ATOM   46   C  CB  . PRO A  1 6   ? 22.097  11.273  52.675  1.00 66.15  ?  6    PRO A CB  1 
ATOM   47   C  CG  . PRO A  1 6   ? 20.895  12.112  52.925  1.00 68.35  ?  6    PRO A CG  1 
ATOM   48   C  CD  . PRO A  1 6   ? 21.299  13.513  52.577  1.00 66.35  ?  6    PRO A CD  1 
ATOM   49   N  N   . GLN A  1 7   ? 21.521  11.847  49.366  1.00 61.54  ?  7    GLN A N   1 
ATOM   50   C  CA  . GLN A  1 7   ? 21.164  11.217  48.102  1.00 72.34  ?  7    GLN A CA  1 
ATOM   51   C  C   . GLN A  1 7   ? 22.169  11.547  46.989  1.00 65.60  ?  7    GLN A C   1 
ATOM   52   O  O   . GLN A  1 7   ? 22.090  11.013  45.889  1.00 70.43  ?  7    GLN A O   1 
ATOM   53   C  CB  . GLN A  1 7   ? 19.725  11.553  47.702  1.00 91.57  ?  7    GLN A CB  1 
ATOM   54   C  CG  . GLN A  1 7   ? 18.723  10.422  47.976  1.00 103.23 ?  7    GLN A CG  1 
ATOM   55   C  CD  . GLN A  1 7   ? 18.863  9.253   46.998  1.00 102.81 ?  7    GLN A CD  1 
ATOM   56   O  OE1 . GLN A  1 7   ? 19.397  9.409   45.898  1.00 94.77  ?  7    GLN A OE1 1 
ATOM   57   N  NE2 . GLN A  1 7   ? 18.378  8.077   47.399  1.00 106.66 ?  7    GLN A NE2 1 
ATOM   58   N  N   . LEU A  1 8   ? 23.137  12.400  47.303  1.00 57.27  ?  8    LEU A N   1 
ATOM   59   C  CA  . LEU A  1 8   ? 24.121  12.852  46.328  1.00 50.06  ?  8    LEU A CA  1 
ATOM   60   C  C   . LEU A  1 8   ? 25.506  12.252  46.551  1.00 56.36  ?  8    LEU A C   1 
ATOM   61   O  O   . LEU A  1 8   ? 26.448  12.584  45.828  1.00 60.30  ?  8    LEU A O   1 
ATOM   62   C  CB  . LEU A  1 8   ? 24.212  14.380  46.350  1.00 43.41  ?  8    LEU A CB  1 
ATOM   63   C  CG  . LEU A  1 8   ? 22.869  15.044  46.045  1.00 46.05  ?  8    LEU A CG  1 
ATOM   64   C  CD1 . LEU A  1 8   ? 22.959  16.555  46.113  1.00 48.77  ?  8    LEU A CD1 1 
ATOM   65   C  CD2 . LEU A  1 8   ? 22.388  14.590  44.682  1.00 45.97  ?  8    LEU A CD2 1 
ATOM   66   N  N   . LEU A  1 9   ? 25.637  11.372  47.543  1.00 50.06  ?  9    LEU A N   1 
ATOM   67   C  CA  . LEU A  1 9   ? 26.923  10.734  47.811  1.00 44.86  ?  9    LEU A CA  1 
ATOM   68   C  C   . LEU A  1 9   ? 26.928  9.288   47.328  1.00 41.99  ?  9    LEU A C   1 
ATOM   69   O  O   . LEU A  1 9   ? 26.046  8.497   47.682  1.00 40.41  ?  9    LEU A O   1 
ATOM   70   C  CB  . LEU A  1 9   ? 27.286  10.814  49.296  1.00 42.59  ?  9    LEU A CB  1 
ATOM   71   C  CG  . LEU A  1 9   ? 27.055  12.183  49.942  1.00 55.40  ?  9    LEU A CG  1 
ATOM   72   C  CD1 . LEU A  1 9   ? 27.388  12.177  51.460  1.00 46.89  ?  9    LEU A CD1 1 
ATOM   73   C  CD2 . LEU A  1 9   ? 27.822  13.272  49.201  1.00 50.20  ?  9    LEU A CD2 1 
ATOM   74   N  N   . VAL A  1 10  ? 27.943  8.957   46.532  1.00 35.03  ?  10   VAL A N   1 
ATOM   75   C  CA  . VAL A  1 10  ? 28.010  7.700   45.793  1.00 37.72  ?  10   VAL A CA  1 
ATOM   76   C  C   . VAL A  1 10  ? 29.473  7.279   45.654  1.00 46.94  ?  10   VAL A C   1 
ATOM   77   O  O   . VAL A  1 10  ? 30.351  8.132   45.477  1.00 45.46  ?  10   VAL A O   1 
ATOM   78   C  CB  . VAL A  1 10  ? 27.402  7.906   44.368  1.00 47.97  ?  10   VAL A CB  1 
ATOM   79   C  CG1 . VAL A  1 10  ? 27.887  6.855   43.379  1.00 43.40  ?  10   VAL A CG1 1 
ATOM   80   C  CG2 . VAL A  1 10  ? 25.872  7.941   44.431  1.00 41.96  ?  10   VAL A CG2 1 
ATOM   81   N  N   . ARG A  1 11  ? 29.744  5.977   45.745  1.00 43.12  ?  11   ARG A N   1 
ATOM   82   C  CA  . ARG A  1 11  ? 31.099  5.478   45.512  1.00 40.34  ?  11   ARG A CA  1 
ATOM   83   C  C   . ARG A  1 11  ? 31.191  4.677   44.211  1.00 45.78  ?  11   ARG A C   1 
ATOM   84   O  O   . ARG A  1 11  ? 30.347  3.832   43.929  1.00 48.91  ?  11   ARG A O   1 
ATOM   85   C  CB  . ARG A  1 11  ? 31.599  4.627   46.686  1.00 32.97  ?  11   ARG A CB  1 
ATOM   86   C  CG  . ARG A  1 11  ? 32.927  3.932   46.417  1.00 35.15  ?  11   ARG A CG  1 
ATOM   87   C  CD  . ARG A  1 11  ? 33.432  3.116   47.604  1.00 37.41  ?  11   ARG A CD  1 
ATOM   88   N  NE  . ARG A  1 11  ? 33.803  3.974   48.733  1.00 46.45  ?  11   ARG A NE  1 
ATOM   89   C  CZ  . ARG A  1 11  ? 35.023  4.465   48.932  1.00 48.87  ?  11   ARG A CZ  1 
ATOM   90   N  NH1 . ARG A  1 11  ? 35.995  4.184   48.078  1.00 53.44  ?  11   ARG A NH1 1 
ATOM   91   N  NH2 . ARG A  1 11  ? 35.274  5.233   49.987  1.00 43.46  ?  11   ARG A NH2 1 
ATOM   92   N  N   . VAL A  1 12  ? 32.227  4.953   43.426  1.00 45.70  ?  12   VAL A N   1 
ATOM   93   C  CA  . VAL A  1 12  ? 32.535  4.180   42.228  1.00 46.66  ?  12   VAL A CA  1 
ATOM   94   C  C   . VAL A  1 12  ? 33.936  3.602   42.408  1.00 49.16  ?  12   VAL A C   1 
ATOM   95   O  O   . VAL A  1 12  ? 34.632  3.984   43.336  1.00 46.55  ?  12   VAL A O   1 
ATOM   96   C  CB  . VAL A  1 12  ? 32.465  5.061   40.967  1.00 34.36  ?  12   VAL A CB  1 
ATOM   97   C  CG1 . VAL A  1 12  ? 31.090  5.672   40.840  1.00 33.12  ?  12   VAL A CG1 1 
ATOM   98   C  CG2 . VAL A  1 12  ? 33.472  6.171   41.057  1.00 40.06  ?  12   VAL A CG2 1 
ATOM   99   N  N   . ARG A  1 13  ? 34.341  2.691   41.527  1.00 50.88  ?  13   ARG A N   1 
ATOM   100  C  CA  . ARG A  1 13  ? 35.637  2.012   41.619  1.00 45.31  ?  13   ARG A CA  1 
ATOM   101  C  C   . ARG A  1 13  ? 36.823  2.939   41.890  1.00 41.21  ?  13   ARG A C   1 
ATOM   102  O  O   . ARG A  1 13  ? 37.798  2.554   42.533  1.00 37.57  ?  13   ARG A O   1 
ATOM   103  C  CB  . ARG A  1 13  ? 35.899  1.230   40.330  1.00 43.39  ?  13   ARG A CB  1 
ATOM   104  C  CG  . ARG A  1 13  ? 37.205  0.466   40.333  1.00 43.13  ?  13   ARG A CG  1 
ATOM   105  C  CD  . ARG A  1 13  ? 37.251  -0.534  41.467  1.00 41.61  ?  13   ARG A CD  1 
ATOM   106  N  NE  . ARG A  1 13  ? 38.479  -1.323  41.442  1.00 51.54  ?  13   ARG A NE  1 
ATOM   107  C  CZ  . ARG A  1 13  ? 39.641  -0.918  41.956  1.00 54.02  ?  13   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A  1 13  ? 39.741  0.282   42.523  1.00 43.43  ?  13   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A  1 13  ? 40.711  -1.708  41.896  1.00 50.50  ?  13   ARG A NH2 1 
ATOM   110  N  N   . GLY A  1 14  ? 36.738  4.165   41.392  1.00 40.95  ?  14   GLY A N   1 
ATOM   111  C  CA  . GLY A  1 14  ? 37.814  5.117   41.564  1.00 43.25  ?  14   GLY A CA  1 
ATOM   112  C  C   . GLY A  1 14  ? 37.773  5.915   42.852  1.00 50.03  ?  14   GLY A C   1 
ATOM   113  O  O   . GLY A  1 14  ? 38.750  6.564   43.213  1.00 53.80  ?  14   GLY A O   1 
ATOM   114  N  N   . GLY A  1 15  ? 36.640  5.889   43.542  1.00 55.51  ?  15   GLY A N   1 
ATOM   115  C  CA  . GLY A  1 15  ? 36.517  6.597   44.803  1.00 49.76  ?  15   GLY A CA  1 
ATOM   116  C  C   . GLY A  1 15  ? 35.140  7.185   45.032  1.00 47.21  ?  15   GLY A C   1 
ATOM   117  O  O   . GLY A  1 15  ? 34.178  6.813   44.375  1.00 45.79  ?  15   GLY A O   1 
ATOM   118  N  N   . GLN A  1 16  ? 35.048  8.116   45.969  1.00 54.19  ?  16   GLN A N   1 
ATOM   119  C  CA  . GLN A  1 16  ? 33.761  8.687   46.336  1.00 54.26  ?  16   GLN A CA  1 
ATOM   120  C  C   . GLN A  1 16  ? 33.424  9.893   45.485  1.00 44.08  ?  16   GLN A C   1 
ATOM   121  O  O   . GLN A  1 16  ? 34.314  10.614  45.049  1.00 49.78  ?  16   GLN A O   1 
ATOM   122  C  CB  . GLN A  1 16  ? 33.753  9.067   47.820  1.00 53.28  ?  16   GLN A CB  1 
ATOM   123  C  CG  . GLN A  1 16  ? 33.708  7.871   48.733  1.00 49.49  ?  16   GLN A CG  1 
ATOM   124  C  CD  . GLN A  1 16  ? 33.936  8.242   50.164  1.00 55.97  ?  16   GLN A CD  1 
ATOM   125  O  OE1 . GLN A  1 16  ? 35.084  8.356   50.611  1.00 64.84  ?  16   GLN A OE1 1 
ATOM   126  N  NE2 . GLN A  1 16  ? 32.849  8.440   50.904  1.00 52.97  ?  16   GLN A NE2 1 
ATOM   127  N  N   . LEU A  1 17  ? 32.131  10.112  45.267  1.00 39.65  ?  17   LEU A N   1 
ATOM   128  C  CA  . LEU A  1 17  ? 31.666  11.225  44.456  1.00 42.73  ?  17   LEU A CA  1 
ATOM   129  C  C   . LEU A  1 17  ? 30.567  11.983  45.154  1.00 39.54  ?  17   LEU A C   1 
ATOM   130  O  O   . LEU A  1 17  ? 29.679  11.379  45.747  1.00 45.45  ?  17   LEU A O   1 
ATOM   131  C  CB  . LEU A  1 17  ? 31.084  10.724  43.128  1.00 44.56  ?  17   LEU A CB  1 
ATOM   132  C  CG  . LEU A  1 17  ? 31.899  9.852   42.187  1.00 43.28  ?  17   LEU A CG  1 
ATOM   133  C  CD1 . LEU A  1 17  ? 30.973  9.277   41.124  1.00 37.10  ?  17   LEU A CD1 1 
ATOM   134  C  CD2 . LEU A  1 17  ? 33.001  10.674  41.564  1.00 48.31  ?  17   LEU A CD2 1 
ATOM   135  N  N   . ARG A  1 18  ? 30.604  13.304  45.034  1.00 40.74  ?  18   ARG A N   1 
ATOM   136  C  CA  . ARG A  1 18  ? 29.485  14.142  45.430  1.00 42.09  ?  18   ARG A CA  1 
ATOM   137  C  C   . ARG A  1 18  ? 28.831  14.788  44.196  1.00 47.77  ?  18   ARG A C   1 
ATOM   138  O  O   . ARG A  1 18  ? 29.454  15.574  43.481  1.00 52.07  ?  18   ARG A O   1 
ATOM   139  C  CB  . ARG A  1 18  ? 29.933  15.215  46.431  1.00 40.32  ?  18   ARG A CB  1 
ATOM   140  C  CG  . ARG A  1 18  ? 28.801  16.153  46.846  1.00 46.99  ?  18   ARG A CG  1 
ATOM   141  C  CD  . ARG A  1 18  ? 29.245  17.185  47.877  1.00 59.02  ?  18   ARG A CD  1 
ATOM   142  N  NE  . ARG A  1 18  ? 30.539  17.787  47.560  1.00 65.40  ?  18   ARG A NE  1 
ATOM   143  C  CZ  . ARG A  1 18  ? 31.656  17.561  48.251  1.00 70.32  ?  18   ARG A CZ  1 
ATOM   144  N  NH1 . ARG A  1 18  ? 31.642  16.747  49.300  1.00 60.28  ?  18   ARG A NH1 1 
ATOM   145  N  NH2 . ARG A  1 18  ? 32.792  18.148  47.893  1.00 75.16  ?  18   ARG A NH2 1 
ATOM   146  N  N   . GLY A  1 19  ? 27.569  14.456  43.956  1.00 40.37  ?  19   GLY A N   1 
ATOM   147  C  CA  . GLY A  1 19  ? 26.840  15.007  42.829  1.00 37.42  ?  19   GLY A CA  1 
ATOM   148  C  C   . GLY A  1 19  ? 25.960  16.185  43.207  1.00 53.11  ?  19   GLY A C   1 
ATOM   149  O  O   . GLY A  1 19  ? 26.096  16.763  44.292  1.00 55.48  ?  19   GLY A O   1 
ATOM   150  N  N   . ILE A  1 20  ? 25.037  16.539  42.318  1.00 55.30  ?  20   ILE A N   1 
ATOM   151  C  CA  . ILE A  1 20  ? 24.214  17.719  42.542  1.00 48.90  ?  20   ILE A CA  1 
ATOM   152  C  C   . ILE A  1 20  ? 22.739  17.480  42.217  1.00 49.91  ?  20   ILE A C   1 
ATOM   153  O  O   . ILE A  1 20  ? 22.393  16.707  41.325  1.00 59.22  ?  20   ILE A O   1 
ATOM   154  C  CB  . ILE A  1 20  ? 24.779  18.927  41.768  1.00 44.90  ?  20   ILE A CB  1 
ATOM   155  C  CG1 . ILE A  1 20  ? 23.985  20.198  42.066  1.00 42.82  ?  20   ILE A CG1 1 
ATOM   156  C  CG2 . ILE A  1 20  ? 24.843  18.628  40.263  1.00 37.07  ?  20   ILE A CG2 1 
ATOM   157  C  CD1 . ILE A  1 20  ? 24.553  21.426  41.369  1.00 43.02  ?  20   ILE A CD1 1 
ATOM   158  N  N   . ARG A  1 21  ? 21.876  18.130  42.983  1.00 42.99  ?  21   ARG A N   1 
ATOM   159  C  CA  . ARG A  1 21  ? 20.440  18.019  42.817  1.00 46.82  ?  21   ARG A CA  1 
ATOM   160  C  C   . ARG A  1 21  ? 20.004  19.071  41.811  1.00 49.34  ?  21   ARG A C   1 
ATOM   161  O  O   . ARG A  1 21  ? 19.922  20.253  42.140  1.00 50.48  ?  21   ARG A O   1 
ATOM   162  C  CB  . ARG A  1 21  ? 19.757  18.269  44.165  1.00 47.21  ?  21   ARG A CB  1 
ATOM   163  C  CG  . ARG A  1 21  ? 18.249  18.082  44.192  1.00 55.82  ?  21   ARG A CG  1 
ATOM   164  C  CD  . ARG A  1 21  ? 17.664  18.791  45.408  1.00 62.50  ?  21   ARG A CD  1 
ATOM   165  N  NE  . ARG A  1 21  ? 16.359  18.275  45.820  1.00 75.11  ?  21   ARG A NE  1 
ATOM   166  C  CZ  . ARG A  1 21  ? 15.188  18.854  45.553  1.00 83.94  ?  21   ARG A CZ  1 
ATOM   167  N  NH1 . ARG A  1 21  ? 15.138  19.982  44.852  1.00 83.19  ?  21   ARG A NH1 1 
ATOM   168  N  NH2 . ARG A  1 21  ? 14.058  18.301  45.986  1.00 86.19  ?  21   ARG A NH2 1 
ATOM   169  N  N   . LEU A  1 22  ? 19.739  18.657  40.578  1.00 46.95  ?  22   LEU A N   1 
ATOM   170  C  CA  . LEU A  1 22  ? 19.325  19.626  39.567  1.00 49.51  ?  22   LEU A CA  1 
ATOM   171  C  C   . LEU A  1 22  ? 17.820  19.744  39.525  1.00 50.91  ?  22   LEU A C   1 
ATOM   172  O  O   . LEU A  1 22  ? 17.107  18.775  39.770  1.00 53.47  ?  22   LEU A O   1 
ATOM   173  C  CB  . LEU A  1 22  ? 19.855  19.254  38.181  1.00 48.05  ?  22   LEU A CB  1 
ATOM   174  C  CG  . LEU A  1 22  ? 21.375  19.255  38.046  1.00 44.98  ?  22   LEU A CG  1 
ATOM   175  C  CD1 . LEU A  1 22  ? 21.744  19.145  36.601  1.00 38.28  ?  22   LEU A CD1 1 
ATOM   176  C  CD2 . LEU A  1 22  ? 21.955  20.509  38.652  1.00 46.58  ?  22   LEU A CD2 1 
ATOM   177  N  N   . LYS A  1 23  ? 17.345  20.944  39.220  1.00 53.67  ?  23   LYS A N   1 
ATOM   178  C  CA  . LYS A  1 23  ? 15.929  21.164  38.986  1.00 58.28  ?  23   LYS A CA  1 
ATOM   179  C  C   . LYS A  1 23  ? 15.589  20.858  37.523  1.00 55.29  ?  23   LYS A C   1 
ATOM   180  O  O   . LYS A  1 23  ? 16.316  21.244  36.612  1.00 56.81  ?  23   LYS A O   1 
ATOM   181  C  CB  . LYS A  1 23  ? 15.556  22.605  39.338  1.00 67.45  ?  23   LYS A CB  1 
ATOM   182  C  CG  . LYS A  1 23  ? 14.197  22.750  40.010  1.00 86.41  ?  23   LYS A CG  1 
ATOM   183  C  CD  . LYS A  1 23  ? 13.061  22.791  38.984  1.00 94.76  ?  23   LYS A CD  1 
ATOM   184  C  CE  . LYS A  1 23  ? 11.694  22.617  39.641  1.00 95.50  ?  23   LYS A CE  1 
ATOM   185  N  NZ  . LYS A  1 23  ? 11.567  21.282  40.300  1.00 91.47  ?  23   LYS A NZ  1 
ATOM   186  N  N   . ALA A  1 24  ? 14.505  20.122  37.314  1.00 53.12  ?  24   ALA A N   1 
ATOM   187  C  CA  . ALA A  1 24  ? 13.932  19.914  35.992  1.00 58.39  ?  24   ALA A CA  1 
ATOM   188  C  C   . ALA A  1 24  ? 12.473  20.303  36.141  1.00 64.00  ?  24   ALA A C   1 
ATOM   189  O  O   . ALA A  1 24  ? 11.951  20.294  37.248  1.00 73.12  ?  24   ALA A O   1 
ATOM   190  C  CB  . ALA A  1 24  ? 14.070  18.450  35.554  1.00 43.31  ?  24   ALA A CB  1 
ATOM   191  N  N   . PRO A  1 25  ? 11.807  20.653  35.035  1.00 64.15  ?  25   PRO A N   1 
ATOM   192  C  CA  . PRO A  1 25  ? 10.436  21.160  35.124  1.00 56.23  ?  25   PRO A CA  1 
ATOM   193  C  C   . PRO A  1 25  ? 9.499   20.292  35.961  1.00 59.34  ?  25   PRO A C   1 
ATOM   194  O  O   . PRO A  1 25  ? 8.619   20.825  36.635  1.00 62.18  ?  25   PRO A O   1 
ATOM   195  C  CB  . PRO A  1 25  ? 9.984   21.163  33.672  1.00 55.49  ?  25   PRO A CB  1 
ATOM   196  C  CG  . PRO A  1 25  ? 11.236  21.379  32.905  1.00 57.08  ?  25   PRO A CG  1 
ATOM   197  C  CD  . PRO A  1 25  ? 12.304  20.651  33.649  1.00 58.20  ?  25   PRO A CD  1 
ATOM   198  N  N   . GLY A  1 26  ? 9.693   18.978  35.938  1.00 56.29  ?  26   GLY A N   1 
ATOM   199  C  CA  . GLY A  1 26  ? 8.778   18.079  36.622  1.00 59.08  ?  26   GLY A CA  1 
ATOM   200  C  C   . GLY A  1 26  ? 9.198   17.639  38.018  1.00 61.19  ?  26   GLY A C   1 
ATOM   201  O  O   . GLY A  1 26  ? 8.410   17.018  38.734  1.00 56.61  ?  26   GLY A O   1 
ATOM   202  N  N   . GLY A  1 27  ? 10.435  17.951  38.401  1.00 57.53  ?  27   GLY A N   1 
ATOM   203  C  CA  . GLY A  1 27  ? 10.968  17.570  39.701  1.00 51.76  ?  27   GLY A CA  1 
ATOM   204  C  C   . GLY A  1 27  ? 12.482  17.514  39.674  1.00 55.38  ?  27   GLY A C   1 
ATOM   205  O  O   . GLY A  1 27  ? 13.102  17.825  38.649  1.00 57.48  ?  27   GLY A O   1 
ATOM   206  N  N   . PRO A  1 28  ? 13.097  17.118  40.796  1.00 48.86  ?  28   PRO A N   1 
ATOM   207  C  CA  . PRO A  1 28  ? 14.568  17.048  40.861  1.00 45.77  ?  28   PRO A CA  1 
ATOM   208  C  C   . PRO A  1 28  ? 15.194  15.832  40.154  1.00 51.92  ?  28   PRO A C   1 
ATOM   209  O  O   . PRO A  1 28  ? 14.539  14.803  39.970  1.00 55.53  ?  28   PRO A O   1 
ATOM   210  C  CB  . PRO A  1 28  ? 14.850  16.984  42.364  1.00 44.24  ?  28   PRO A CB  1 
ATOM   211  C  CG  . PRO A  1 28  ? 13.571  16.445  42.965  1.00 46.95  ?  28   PRO A CG  1 
ATOM   212  C  CD  . PRO A  1 28  ? 12.462  16.964  42.117  1.00 49.26  ?  28   PRO A CD  1 
ATOM   213  N  N   . VAL A  1 29  ? 16.458  15.968  39.758  1.00 44.89  ?  29   VAL A N   1 
ATOM   214  C  CA  . VAL A  1 29  ? 17.240  14.852  39.245  1.00 43.44  ?  29   VAL A CA  1 
ATOM   215  C  C   . VAL A  1 29  ? 18.606  14.933  39.891  1.00 43.21  ?  29   VAL A C   1 
ATOM   216  O  O   . VAL A  1 29  ? 19.045  16.015  40.290  1.00 41.92  ?  29   VAL A O   1 
ATOM   217  C  CB  . VAL A  1 29  ? 17.458  14.898  37.680  1.00 37.30  ?  29   VAL A CB  1 
ATOM   218  C  CG1 . VAL A  1 29  ? 16.150  14.839  36.942  1.00 38.67  ?  29   VAL A CG1 1 
ATOM   219  C  CG2 . VAL A  1 29  ? 18.241  16.129  37.276  1.00 35.67  ?  29   VAL A CG2 1 
ATOM   220  N  N   . SER A  1 30  ? 19.288  13.793  39.960  1.00 44.63  ?  30   SER A N   1 
ATOM   221  C  CA  . SER A  1 30  ? 20.669  13.756  40.413  1.00 45.33  ?  30   SER A CA  1 
ATOM   222  C  C   . SER A  1 30  ? 21.639  13.824  39.227  1.00 41.61  ?  30   SER A C   1 
ATOM   223  O  O   . SER A  1 30  ? 21.526  13.066  38.270  1.00 47.18  ?  30   SER A O   1 
ATOM   224  C  CB  . SER A  1 30  ? 20.922  12.492  41.234  1.00 53.88  ?  30   SER A CB  1 
ATOM   225  O  OG  . SER A  1 30  ? 19.920  12.308  42.228  1.00 65.81  ?  30   SER A OG  1 
ATOM   226  N  N   . ALA A  1 31  ? 22.591  14.741  39.292  1.00 37.11  ?  31   ALA A N   1 
ATOM   227  C  CA  . ALA A  1 31  ? 23.639  14.805  38.294  1.00 38.79  ?  31   ALA A CA  1 
ATOM   228  C  C   . ALA A  1 31  ? 25.018  14.567  38.909  1.00 46.22  ?  31   ALA A C   1 
ATOM   229  O  O   . ALA A  1 31  ? 25.376  15.154  39.936  1.00 48.88  ?  31   ALA A O   1 
ATOM   230  C  CB  . ALA A  1 31  ? 23.602  16.141  37.576  1.00 33.88  ?  31   ALA A CB  1 
ATOM   231  N  N   . PHE A  1 32  ? 25.782  13.695  38.263  1.00 48.59  ?  32   PHE A N   1 
ATOM   232  C  CA  . PHE A  1 32  ? 27.172  13.462  38.607  1.00 37.06  ?  32   PHE A CA  1 
ATOM   233  C  C   . PHE A  1 32  ? 28.022  13.850  37.409  1.00 41.89  ?  32   PHE A C   1 
ATOM   234  O  O   . PHE A  1 32  ? 28.151  13.099  36.447  1.00 56.76  ?  32   PHE A O   1 
ATOM   235  C  CB  . PHE A  1 32  ? 27.368  12.006  39.008  1.00 26.49  ?  32   PHE A CB  1 
ATOM   236  C  CG  . PHE A  1 32  ? 26.575  11.625  40.225  1.00 32.27  ?  32   PHE A CG  1 
ATOM   237  C  CD1 . PHE A  1 32  ? 25.273  11.197  40.107  1.00 30.59  ?  32   PHE A CD1 1 
ATOM   238  C  CD2 . PHE A  1 32  ? 27.123  11.750  41.495  1.00 37.75  ?  32   PHE A CD2 1 
ATOM   239  C  CE1 . PHE A  1 32  ? 24.527  10.874  41.228  1.00 38.44  ?  32   PHE A CE1 1 
ATOM   240  C  CE2 . PHE A  1 32  ? 26.387  11.430  42.615  1.00 43.79  ?  32   PHE A CE2 1 
ATOM   241  C  CZ  . PHE A  1 32  ? 25.088  10.988  42.484  1.00 41.99  ?  32   PHE A CZ  1 
ATOM   242  N  N   . LEU A  1 33  ? 28.578  15.050  37.477  1.00 42.17  ?  33   LEU A N   1 
ATOM   243  C  CA  . LEU A  1 33  ? 29.219  15.693  36.345  1.00 34.93  ?  33   LEU A CA  1 
ATOM   244  C  C   . LEU A  1 33  ? 30.732  15.740  36.530  1.00 41.77  ?  33   LEU A C   1 
ATOM   245  O  O   . LEU A  1 33  ? 31.216  16.005  37.628  1.00 46.08  ?  33   LEU A O   1 
ATOM   246  C  CB  . LEU A  1 33  ? 28.656  17.108  36.206  1.00 31.86  ?  33   LEU A CB  1 
ATOM   247  C  CG  . LEU A  1 33  ? 27.129  17.178  36.053  1.00 33.08  ?  33   LEU A CG  1 
ATOM   248  C  CD1 . LEU A  1 33  ? 26.671  18.606  35.800  1.00 37.07  ?  33   LEU A CD1 1 
ATOM   249  C  CD2 . LEU A  1 33  ? 26.649  16.269  34.930  1.00 31.14  ?  33   LEU A CD2 1 
ATOM   250  N  N   . GLY A  1 34  ? 31.482  15.468  35.466  1.00 37.52  ?  34   GLY A N   1 
ATOM   251  C  CA  . GLY A  1 34  ? 32.933  15.516  35.549  1.00 30.18  ?  34   GLY A CA  1 
ATOM   252  C  C   . GLY A  1 34  ? 33.633  14.351  36.248  1.00 35.59  ?  34   GLY A C   1 
ATOM   253  O  O   . GLY A  1 34  ? 34.754  14.506  36.741  1.00 36.15  ?  34   GLY A O   1 
ATOM   254  N  N   . ILE A  1 35  ? 33.002  13.179  36.275  1.00 37.18  ?  35   ILE A N   1 
ATOM   255  C  CA  . ILE A  1 35  ? 33.670  11.957  36.737  1.00 34.86  ?  35   ILE A CA  1 
ATOM   256  C  C   . ILE A  1 35  ? 34.799  11.552  35.786  1.00 46.61  ?  35   ILE A C   1 
ATOM   257  O  O   . ILE A  1 35  ? 34.556  11.265  34.608  1.00 48.59  ?  35   ILE A O   1 
ATOM   258  C  CB  . ILE A  1 35  ? 32.689  10.778  36.756  1.00 34.96  ?  35   ILE A CB  1 
ATOM   259  C  CG1 . ILE A  1 35  ? 31.438  11.103  37.570  1.00 34.39  ?  35   ILE A CG1 1 
ATOM   260  C  CG2 . ILE A  1 35  ? 33.375  9.514   37.241  1.00 29.76  ?  35   ILE A CG2 1 
ATOM   261  C  CD1 . ILE A  1 35  ? 30.406  9.992   37.517  1.00 36.77  ?  35   ILE A CD1 1 
ATOM   262  N  N   . PRO A  1 36  ? 36.042  11.519  36.279  1.00 48.51  ?  36   PRO A N   1 
ATOM   263  C  CA  . PRO A  1 36  ? 37.135  11.066  35.405  1.00 46.47  ?  36   PRO A CA  1 
ATOM   264  C  C   . PRO A  1 36  ? 37.071  9.561   35.204  1.00 50.67  ?  36   PRO A C   1 
ATOM   265  O  O   . PRO A  1 36  ? 36.820  8.836   36.170  1.00 55.48  ?  36   PRO A O   1 
ATOM   266  C  CB  . PRO A  1 36  ? 38.392  11.429  36.201  1.00 48.08  ?  36   PRO A CB  1 
ATOM   267  C  CG  . PRO A  1 36  ? 37.940  11.477  37.637  1.00 40.16  ?  36   PRO A CG  1 
ATOM   268  C  CD  . PRO A  1 36  ? 36.519  11.958  37.603  1.00 43.82  ?  36   PRO A CD  1 
ATOM   269  N  N   . PHE A  1 37  ? 37.292  9.092   33.979  1.00 47.05  ?  37   PHE A N   1 
ATOM   270  C  CA  . PHE A  1 37  ? 37.225  7.658   33.708  1.00 40.64  ?  37   PHE A CA  1 
ATOM   271  C  C   . PHE A  1 37  ? 38.532  7.114   33.149  1.00 38.65  ?  37   PHE A C   1 
ATOM   272  O  O   . PHE A  1 37  ? 38.682  5.902   32.988  1.00 43.59  ?  37   PHE A O   1 
ATOM   273  C  CB  . PHE A  1 37  ? 36.038  7.305   32.798  1.00 50.35  ?  37   PHE A CB  1 
ATOM   274  C  CG  . PHE A  1 37  ? 36.144  7.860   31.401  1.00 53.68  ?  37   PHE A CG  1 
ATOM   275  C  CD1 . PHE A  1 37  ? 35.629  9.114   31.098  1.00 50.27  ?  37   PHE A CD1 1 
ATOM   276  C  CD2 . PHE A  1 37  ? 36.737  7.118   30.384  1.00 48.59  ?  37   PHE A CD2 1 
ATOM   277  C  CE1 . PHE A  1 37  ? 35.719  9.618   29.818  1.00 48.41  ?  37   PHE A CE1 1 
ATOM   278  C  CE2 . PHE A  1 37  ? 36.832  7.620   29.106  1.00 44.55  ?  37   PHE A CE2 1 
ATOM   279  C  CZ  . PHE A  1 37  ? 36.327  8.870   28.821  1.00 47.02  ?  37   PHE A CZ  1 
ATOM   280  N  N   . ALA A  1 38  ? 39.478  8.015   32.885  1.00 39.43  ?  38   ALA A N   1 
ATOM   281  C  CA  . ALA A  1 38  ? 40.803  7.661   32.367  1.00 37.43  ?  38   ALA A CA  1 
ATOM   282  C  C   . ALA A  1 38  ? 41.868  8.608   32.917  1.00 38.66  ?  38   ALA A C   1 
ATOM   283  O  O   . ALA A  1 38  ? 41.558  9.740   33.293  1.00 46.24  ?  38   ALA A O   1 
ATOM   284  C  CB  . ALA A  1 38  ? 40.806  7.723   30.847  1.00 41.65  ?  38   ALA A CB  1 
ATOM   285  N  N   . GLU A  1 39  ? 43.120  8.155   32.952  1.00 35.48  ?  39   GLU A N   1 
ATOM   286  C  CA  . GLU A  1 39  ? 44.231  9.051   33.262  1.00 42.54  ?  39   GLU A CA  1 
ATOM   287  C  C   . GLU A  1 39  ? 44.306  10.106  32.168  1.00 53.34  ?  39   GLU A C   1 
ATOM   288  O  O   . GLU A  1 39  ? 44.139  9.784   30.991  1.00 55.86  ?  39   GLU A O   1 
ATOM   289  C  CB  . GLU A  1 39  ? 45.555  8.289   33.326  1.00 43.76  ?  39   GLU A CB  1 
ATOM   290  C  CG  . GLU A  1 39  ? 45.769  7.504   34.607  1.00 59.10  ?  39   GLU A CG  1 
ATOM   291  C  CD  . GLU A  1 39  ? 45.931  8.396   35.832  1.00 58.95  ?  39   GLU A CD  1 
ATOM   292  O  OE1 . GLU A  1 39  ? 46.987  9.057   35.952  1.00 59.09  ?  39   GLU A OE1 1 
ATOM   293  O  OE2 . GLU A  1 39  ? 45.001  8.435   36.667  1.00 50.78  ?  39   GLU A OE2 1 
ATOM   294  N  N   . PRO A  1 40  ? 44.566  11.366  32.550  1.00 54.50  ?  40   PRO A N   1 
ATOM   295  C  CA  . PRO A  1 40  ? 44.616  12.462  31.580  1.00 53.77  ?  40   PRO A CA  1 
ATOM   296  C  C   . PRO A  1 40  ? 45.631  12.171  30.479  1.00 55.55  ?  40   PRO A C   1 
ATOM   297  O  O   . PRO A  1 40  ? 46.817  12.035  30.762  1.00 59.61  ?  40   PRO A O   1 
ATOM   298  C  CB  . PRO A  1 40  ? 45.073  13.659  32.421  1.00 58.02  ?  40   PRO A CB  1 
ATOM   299  C  CG  . PRO A  1 40  ? 44.779  13.284  33.837  1.00 49.86  ?  40   PRO A CG  1 
ATOM   300  C  CD  . PRO A  1 40  ? 44.977  11.801  33.896  1.00 49.62  ?  40   PRO A CD  1 
ATOM   301  N  N   . PRO A  1 41  ? 45.165  12.080  29.227  1.00 54.56  ?  41   PRO A N   1 
ATOM   302  C  CA  . PRO A  1 41  ? 45.999  11.659  28.100  1.00 56.84  ?  41   PRO A CA  1 
ATOM   303  C  C   . PRO A  1 41  ? 46.898  12.792  27.631  1.00 56.92  ?  41   PRO A C   1 
ATOM   304  O  O   . PRO A  1 41  ? 46.788  13.229  26.486  1.00 60.87  ?  41   PRO A O   1 
ATOM   305  C  CB  . PRO A  1 41  ? 44.967  11.332  27.026  1.00 54.73  ?  41   PRO A CB  1 
ATOM   306  C  CG  . PRO A  1 41  ? 43.859  12.294  27.292  1.00 53.06  ?  41   PRO A CG  1 
ATOM   307  C  CD  . PRO A  1 41  ? 43.825  12.507  28.790  1.00 48.77  ?  41   PRO A CD  1 
ATOM   308  N  N   . VAL A  1 42  ? 47.783  13.255  28.505  1.00 49.65  ?  42   VAL A N   1 
ATOM   309  C  CA  . VAL A  1 42  ? 48.602  14.431  28.217  1.00 42.44  ?  42   VAL A CA  1 
ATOM   310  C  C   . VAL A  1 42  ? 50.091  14.093  28.219  1.00 43.10  ?  42   VAL A C   1 
ATOM   311  O  O   . VAL A  1 42  ? 50.491  13.021  28.676  1.00 43.15  ?  42   VAL A O   1 
ATOM   312  C  CB  . VAL A  1 42  ? 48.322  15.569  29.237  1.00 49.07  ?  42   VAL A CB  1 
ATOM   313  C  CG1 . VAL A  1 42  ? 46.818  15.804  29.378  1.00 44.47  ?  42   VAL A CG1 1 
ATOM   314  C  CG2 . VAL A  1 42  ? 48.926  15.235  30.599  1.00 43.51  ?  42   VAL A CG2 1 
ATOM   315  N  N   . GLY A  1 43  ? 50.911  15.005  27.708  1.00 45.05  ?  43   GLY A N   1 
ATOM   316  C  CA  . GLY A  1 43  ? 52.340  14.773  27.632  1.00 49.61  ?  43   GLY A CA  1 
ATOM   317  C  C   . GLY A  1 43  ? 52.655  13.570  26.764  1.00 60.13  ?  43   GLY A C   1 
ATOM   318  O  O   . GLY A  1 43  ? 52.145  13.451  25.648  1.00 64.20  ?  43   GLY A O   1 
ATOM   319  N  N   . SER A  1 44  ? 53.466  12.659  27.298  1.00 59.69  ?  44   SER A N   1 
ATOM   320  C  CA  . SER A  1 44  ? 53.887  11.452  26.589  1.00 58.43  ?  44   SER A CA  1 
ATOM   321  C  C   . SER A  1 44  ? 52.730  10.477  26.355  1.00 53.20  ?  44   SER A C   1 
ATOM   322  O  O   . SER A  1 44  ? 52.910  9.422   25.751  1.00 59.20  ?  44   SER A O   1 
ATOM   323  C  CB  . SER A  1 44  ? 55.010  10.743  27.353  1.00 62.67  ?  44   SER A CB  1 
ATOM   324  O  OG  . SER A  1 44  ? 54.522  10.167  28.557  1.00 66.77  ?  44   SER A OG  1 
ATOM   325  N  N   . ARG A  1 45  ? 51.545  10.833  26.828  1.00 44.99  ?  45   ARG A N   1 
ATOM   326  C  CA  . ARG A  1 45  ? 50.356  10.033  26.567  1.00 48.13  ?  45   ARG A CA  1 
ATOM   327  C  C   . ARG A  1 45  ? 49.508  10.529  25.387  1.00 49.10  ?  45   ARG A C   1 
ATOM   328  O  O   . ARG A  1 45  ? 48.563  9.858   24.971  1.00 40.90  ?  45   ARG A O   1 
ATOM   329  C  CB  . ARG A  1 45  ? 49.500  9.929   27.824  1.00 41.09  ?  45   ARG A CB  1 
ATOM   330  C  CG  . ARG A  1 45  ? 50.029  8.934   28.833  1.00 42.24  ?  45   ARG A CG  1 
ATOM   331  C  CD  . ARG A  1 45  ? 48.880  8.497   29.751  1.00 66.30  ?  45   ARG A CD  1 
ATOM   332  N  NE  . ARG A  1 45  ? 49.135  8.753   31.168  1.00 69.51  ?  45   ARG A NE  1 
ATOM   333  C  CZ  . ARG A  1 45  ? 49.315  7.796   32.072  1.00 74.91  ?  45   ARG A CZ  1 
ATOM   334  N  NH1 . ARG A  1 45  ? 49.263  6.522   31.707  1.00 68.93  ?  45   ARG A NH1 1 
ATOM   335  N  NH2 . ARG A  1 45  ? 49.539  8.111   33.341  1.00 85.11  ?  45   ARG A NH2 1 
ATOM   336  N  N   . ARG A  1 46  ? 49.832  11.706  24.861  1.00 48.07  ?  46   ARG A N   1 
ATOM   337  C  CA  . ARG A  1 46  ? 49.173  12.206  23.653  1.00 41.92  ?  46   ARG A CA  1 
ATOM   338  C  C   . ARG A  1 46  ? 49.266  11.138  22.566  1.00 41.50  ?  46   ARG A C   1 
ATOM   339  O  O   . ARG A  1 46  ? 50.299  10.475  22.451  1.00 43.95  ?  46   ARG A O   1 
ATOM   340  C  CB  . ARG A  1 46  ? 49.859  13.484  23.189  1.00 35.92  ?  46   ARG A CB  1 
ATOM   341  C  CG  . ARG A  1 46  ? 49.156  14.211  22.090  1.00 38.09  ?  46   ARG A CG  1 
ATOM   342  C  CD  . ARG A  1 46  ? 50.006  15.391  21.631  1.00 39.73  ?  46   ARG A CD  1 
ATOM   343  N  NE  . ARG A  1 46  ? 49.663  16.624  22.329  1.00 41.60  ?  46   ARG A NE  1 
ATOM   344  C  CZ  . ARG A  1 46  ? 50.283  17.782  22.129  1.00 42.47  ?  46   ARG A CZ  1 
ATOM   345  N  NH1 . ARG A  1 46  ? 51.278  17.855  21.256  1.00 42.92  ?  46   ARG A NH1 1 
ATOM   346  N  NH2 . ARG A  1 46  ? 49.911  18.867  22.799  1.00 38.02  ?  46   ARG A NH2 1 
ATOM   347  N  N   . PHE A  1 47  ? 48.176  10.952  21.817  1.00 30.68  ?  47   PHE A N   1 
ATOM   348  C  CA  . PHE A  1 47  ? 48.052  9.923   20.772  1.00 36.56  ?  47   PHE A CA  1 
ATOM   349  C  C   . PHE A  1 47  ? 48.008  8.472   21.272  1.00 44.22  ?  47   PHE A C   1 
ATOM   350  O  O   . PHE A  1 47  ? 47.838  7.552   20.476  1.00 48.46  ?  47   PHE A O   1 
ATOM   351  C  CB  . PHE A  1 47  ? 49.134  10.051  19.672  1.00 38.80  ?  47   PHE A CB  1 
ATOM   352  C  CG  . PHE A  1 47  ? 49.407  11.459  19.237  1.00 36.35  ?  47   PHE A CG  1 
ATOM   353  C  CD1 . PHE A  1 47  ? 48.416  12.229  18.670  1.00 41.11  ?  47   PHE A CD1 1 
ATOM   354  C  CD2 . PHE A  1 47  ? 50.662  12.009  19.392  1.00 37.60  ?  47   PHE A CD2 1 
ATOM   355  C  CE1 . PHE A  1 47  ? 48.668  13.534  18.260  1.00 39.07  ?  47   PHE A CE1 1 
ATOM   356  C  CE2 . PHE A  1 47  ? 50.917  13.309  18.987  1.00 35.76  ?  47   PHE A CE2 1 
ATOM   357  C  CZ  . PHE A  1 47  ? 49.915  14.073  18.423  1.00 33.04  ?  47   PHE A CZ  1 
ATOM   358  N  N   . MET A  1 48  ? 48.172  8.258   22.574  1.00 43.04  ?  48   MET A N   1 
ATOM   359  C  CA  . MET A  1 48  ? 48.142  6.904   23.121  1.00 42.92  ?  48   MET A CA  1 
ATOM   360  C  C   . MET A  1 48  ? 46.724  6.470   23.515  1.00 46.77  ?  48   MET A C   1 
ATOM   361  O  O   . MET A  1 48  ? 45.859  7.315   23.775  1.00 42.86  ?  48   MET A O   1 
ATOM   362  C  CB  . MET A  1 48  ? 49.098  6.789   24.317  1.00 50.26  ?  48   MET A CB  1 
ATOM   363  C  CG  . MET A  1 48  ? 50.555  7.023   23.955  1.00 58.87  ?  48   MET A CG  1 
ATOM   364  S  SD  . MET A  1 48  ? 51.217  5.748   22.862  1.00 70.86  ?  48   MET A SD  1 
ATOM   365  C  CE  . MET A  1 48  ? 51.172  4.332   23.975  1.00 52.38  ?  48   MET A CE  1 
ATOM   366  N  N   . PRO A  1 49  ? 46.479  5.143   23.533  1.00 50.71  ?  49   PRO A N   1 
ATOM   367  C  CA  . PRO A  1 49  ? 45.253  4.561   24.099  1.00 42.91  ?  49   PRO A CA  1 
ATOM   368  C  C   . PRO A  1 49  ? 45.066  5.049   25.525  1.00 45.73  ?  49   PRO A C   1 
ATOM   369  O  O   . PRO A  1 49  ? 46.052  5.243   26.228  1.00 43.06  ?  49   PRO A O   1 
ATOM   370  C  CB  . PRO A  1 49  ? 45.560  3.062   24.143  1.00 39.85  ?  49   PRO A CB  1 
ATOM   371  C  CG  . PRO A  1 49  ? 46.599  2.855   23.085  1.00 46.96  ?  49   PRO A CG  1 
ATOM   372  C  CD  . PRO A  1 49  ? 47.392  4.116   22.989  1.00 47.00  ?  49   PRO A CD  1 
ATOM   373  N  N   . PRO A  1 50  ? 43.816  5.233   25.957  1.00 46.52  ?  50   PRO A N   1 
ATOM   374  C  CA  . PRO A  1 50  ? 43.599  5.689   27.326  1.00 53.13  ?  50   PRO A CA  1 
ATOM   375  C  C   . PRO A  1 50  ? 43.995  4.608   28.324  1.00 57.77  ?  50   PRO A C   1 
ATOM   376  O  O   . PRO A  1 50  ? 43.783  3.415   28.070  1.00 55.29  ?  50   PRO A O   1 
ATOM   377  C  CB  . PRO A  1 50  ? 42.090  5.920   27.374  1.00 46.15  ?  50   PRO A CB  1 
ATOM   378  C  CG  . PRO A  1 50  ? 41.547  4.953   26.394  1.00 46.12  ?  50   PRO A CG  1 
ATOM   379  C  CD  . PRO A  1 50  ? 42.556  4.887   25.285  1.00 45.10  ?  50   PRO A CD  1 
ATOM   380  N  N   . GLU A  1 51  ? 44.597  5.028   29.430  1.00 59.73  ?  51   GLU A N   1 
ATOM   381  C  CA  . GLU A  1 51  ? 44.764  4.160   30.587  1.00 59.63  ?  51   GLU A CA  1 
ATOM   382  C  C   . GLU A  1 51  ? 43.711  4.531   31.625  1.00 52.18  ?  51   GLU A C   1 
ATOM   383  O  O   . GLU A  1 51  ? 43.460  5.711   31.872  1.00 51.07  ?  51   GLU A O   1 
ATOM   384  C  CB  . GLU A  1 51  ? 46.166  4.289   31.180  1.00 75.32  ?  51   GLU A CB  1 
ATOM   385  C  CG  . GLU A  1 51  ? 47.284  3.810   30.260  1.00 88.49  ?  51   GLU A CG  1 
ATOM   386  C  CD  . GLU A  1 51  ? 48.609  3.632   30.995  1.00 98.88  ?  51   GLU A CD  1 
ATOM   387  O  OE1 . GLU A  1 51  ? 48.632  3.796   32.240  1.00 95.87  ?  51   GLU A OE1 1 
ATOM   388  O  OE2 . GLU A  1 51  ? 49.627  3.327   30.327  1.00 101.12 ?  51   GLU A OE2 1 
ATOM   389  N  N   . PRO A  1 52  ? 43.073  3.517   32.215  1.00 53.14  ?  52   PRO A N   1 
ATOM   390  C  CA  . PRO A  1 52  ? 42.056  3.643   33.265  1.00 53.97  ?  52   PRO A CA  1 
ATOM   391  C  C   . PRO A  1 52  ? 42.479  4.591   34.397  1.00 54.05  ?  52   PRO A C   1 
ATOM   392  O  O   . PRO A  1 52  ? 43.633  4.543   34.841  1.00 47.04  ?  52   PRO A O   1 
ATOM   393  C  CB  . PRO A  1 52  ? 41.970  2.218   33.820  1.00 54.70  ?  52   PRO A CB  1 
ATOM   394  C  CG  . PRO A  1 52  ? 42.325  1.359   32.671  1.00 59.89  ?  52   PRO A CG  1 
ATOM   395  C  CD  . PRO A  1 52  ? 43.378  2.109   31.909  1.00 54.89  ?  52   PRO A CD  1 
ATOM   396  N  N   . LYS A  1 53  ? 41.543  5.422   34.856  1.00 53.60  ?  53   LYS A N   1 
ATOM   397  C  CA  . LYS A  1 53  ? 41.789  6.372   35.936  1.00 51.12  ?  53   LYS A CA  1 
ATOM   398  C  C   . LYS A  1 53  ? 42.261  5.676   37.210  1.00 54.31  ?  53   LYS A C   1 
ATOM   399  O  O   . LYS A  1 53  ? 41.708  4.661   37.617  1.00 64.82  ?  53   LYS A O   1 
ATOM   400  C  CB  . LYS A  1 53  ? 40.533  7.200   36.221  1.00 45.48  ?  53   LYS A CB  1 
ATOM   401  C  CG  . LYS A  1 53  ? 40.695  8.220   37.356  1.00 54.42  ?  53   LYS A CG  1 
ATOM   402  C  CD  . LYS A  1 53  ? 41.733  9.290   37.036  1.00 52.27  ?  53   LYS A CD  1 
ATOM   403  C  CE  . LYS A  1 53  ? 41.763  10.389  38.106  1.00 51.68  ?  53   LYS A CE  1 
ATOM   404  N  NZ  . LYS A  1 53  ? 42.913  11.323  37.891  1.00 49.47  ?  53   LYS A NZ  1 
ATOM   405  N  N   . ARG A  1 54  ? 43.307  6.218   37.816  1.00 50.60  ?  54   ARG A N   1 
ATOM   406  C  CA  . ARG A  1 54  ? 43.798  5.717   39.088  1.00 53.87  ?  54   ARG A CA  1 
ATOM   407  C  C   . ARG A  1 54  ? 42.970  6.289   40.235  1.00 57.94  ?  54   ARG A C   1 
ATOM   408  O  O   . ARG A  1 54  ? 42.706  7.491   40.250  1.00 59.76  ?  54   ARG A O   1 
ATOM   409  C  CB  . ARG A  1 54  ? 45.264  6.099   39.278  1.00 53.90  ?  54   ARG A CB  1 
ATOM   410  C  CG  . ARG A  1 54  ? 46.216  5.306   38.423  1.00 64.26  ?  54   ARG A CG  1 
ATOM   411  C  CD  . ARG A  1 54  ? 47.627  5.399   38.963  1.00 78.04  ?  54   ARG A CD  1 
ATOM   412  N  NE  . ARG A  1 54  ? 48.583  5.729   37.914  1.00 91.60  ?  54   ARG A NE  1 
ATOM   413  C  CZ  . ARG A  1 54  ? 48.981  6.966   37.638  1.00 103.03 ?  54   ARG A CZ  1 
ATOM   414  N  NH1 . ARG A  1 54  ? 48.507  7.991   38.343  1.00 100.14 ?  54   ARG A NH1 1 
ATOM   415  N  NH2 . ARG A  1 54  ? 49.855  7.177   36.658  1.00 107.35 ?  54   ARG A NH2 1 
ATOM   416  N  N   . PRO A  1 55  ? 42.567  5.430   41.196  1.00 52.06  ?  55   PRO A N   1 
ATOM   417  C  CA  . PRO A  1 55  ? 41.746  5.812   42.359  1.00 50.42  ?  55   PRO A CA  1 
ATOM   418  C  C   . PRO A  1 55  ? 42.188  7.110   43.003  1.00 49.26  ?  55   PRO A C   1 
ATOM   419  O  O   . PRO A  1 55  ? 43.379  7.397   43.062  1.00 50.51  ?  55   PRO A O   1 
ATOM   420  C  CB  . PRO A  1 55  ? 41.971  4.660   43.343  1.00 40.89  ?  55   PRO A CB  1 
ATOM   421  C  CG  . PRO A  1 55  ? 42.174  3.487   42.467  1.00 50.65  ?  55   PRO A CG  1 
ATOM   422  C  CD  . PRO A  1 55  ? 42.893  3.992   41.212  1.00 39.36  ?  55   PRO A CD  1 
ATOM   423  N  N   . TRP A  1 56  ? 41.229  7.893   43.469  1.00 49.09  ?  56   TRP A N   1 
ATOM   424  C  CA  . TRP A  1 56  ? 41.549  9.119   44.190  1.00 58.86  ?  56   TRP A CA  1 
ATOM   425  C  C   . TRP A  1 56  ? 41.207  9.006   45.675  1.00 63.36  ?  56   TRP A C   1 
ATOM   426  O  O   . TRP A  1 56  ? 40.476  8.096   46.104  1.00 60.43  ?  56   TRP A O   1 
ATOM   427  C  CB  . TRP A  1 56  ? 40.822  10.313  43.570  1.00 59.02  ?  56   TRP A CB  1 
ATOM   428  C  CG  . TRP A  1 56  ? 39.338  10.141  43.527  1.00 59.41  ?  56   TRP A CG  1 
ATOM   429  C  CD1 . TRP A  1 56  ? 38.441  10.528  44.477  1.00 55.67  ?  56   TRP A CD1 1 
ATOM   430  C  CD2 . TRP A  1 56  ? 38.574  9.533   42.479  1.00 53.33  ?  56   TRP A CD2 1 
ATOM   431  N  NE1 . TRP A  1 56  ? 37.169  10.201  44.087  1.00 51.39  ?  56   TRP A NE1 1 
ATOM   432  C  CE2 . TRP A  1 56  ? 37.222  9.590   42.862  1.00 50.65  ?  56   TRP A CE2 1 
ATOM   433  C  CE3 . TRP A  1 56  ? 38.901  8.949   41.255  1.00 56.96  ?  56   TRP A CE3 1 
ATOM   434  C  CZ2 . TRP A  1 56  ? 36.195  9.085   42.061  1.00 46.71  ?  56   TRP A CZ2 1 
ATOM   435  C  CZ3 . TRP A  1 56  ? 37.878  8.443   40.463  1.00 56.38  ?  56   TRP A CZ3 1 
ATOM   436  C  CH2 . TRP A  1 56  ? 36.542  8.513   40.874  1.00 46.58  ?  56   TRP A CH2 1 
ATOM   437  N  N   . SER A  1 57  ? 41.746  9.927   46.464  1.00 65.08  ?  57   SER A N   1 
ATOM   438  C  CA  . SER A  1 57  ? 41.386  9.993   47.873  1.00 65.49  ?  57   SER A CA  1 
ATOM   439  C  C   . SER A  1 57  ? 40.362  11.096  48.087  1.00 61.04  ?  57   SER A C   1 
ATOM   440  O  O   . SER A  1 57  ? 40.292  12.052  47.308  1.00 61.14  ?  57   SER A O   1 
ATOM   441  C  CB  . SER A  1 57  ? 42.619  10.185  48.767  1.00 68.64  ?  57   SER A CB  1 
ATOM   442  O  OG  . SER A  1 57  ? 43.472  11.201  48.270  1.00 68.36  ?  57   SER A OG  1 
ATOM   443  N  N   . GLY A  1 58  ? 39.558  10.945  49.133  1.00 58.90  ?  58   GLY A N   1 
ATOM   444  C  CA  . GLY A  1 58  ? 38.526  11.913  49.432  1.00 45.99  ?  58   GLY A CA  1 
ATOM   445  C  C   . GLY A  1 58  ? 37.312  11.856  48.519  1.00 57.28  ?  58   GLY A C   1 
ATOM   446  O  O   . GLY A  1 58  ? 37.122  10.928  47.711  1.00 43.15  ?  58   GLY A O   1 
ATOM   447  N  N   . VAL A  1 59  ? 36.466  12.869  48.657  1.00 48.59  ?  59   VAL A N   1 
ATOM   448  C  CA  . VAL A  1 59  ? 35.238  12.929  47.891  1.00 45.80  ?  59   VAL A CA  1 
ATOM   449  C  C   . VAL A  1 59  ? 35.449  13.896  46.758  1.00 53.31  ?  59   VAL A C   1 
ATOM   450  O  O   . VAL A  1 59  ? 35.576  15.103  46.986  1.00 59.11  ?  59   VAL A O   1 
ATOM   451  C  CB  . VAL A  1 59  ? 34.063  13.420  48.759  1.00 46.46  ?  59   VAL A CB  1 
ATOM   452  C  CG1 . VAL A  1 59  ? 32.751  13.341  47.974  1.00 42.36  ?  59   VAL A CG1 1 
ATOM   453  C  CG2 . VAL A  1 59  ? 33.980  12.604  50.051  1.00 45.11  ?  59   VAL A CG2 1 
ATOM   454  N  N   . LEU A  1 60  ? 35.530  13.349  45.549  1.00 43.66  ?  60   LEU A N   1 
ATOM   455  C  CA  . LEU A  1 60  ? 35.592  14.128  44.321  1.00 52.86  ?  60   LEU A CA  1 
ATOM   456  C  C   . LEU A  1 60  ? 34.329  14.959  44.127  1.00 51.11  ?  60   LEU A C   1 
ATOM   457  O  O   . LEU A  1 60  ? 33.218  14.426  44.137  1.00 50.96  ?  60   LEU A O   1 
ATOM   458  C  CB  . LEU A  1 60  ? 35.762  13.192  43.125  1.00 47.48  ?  60   LEU A CB  1 
ATOM   459  C  CG  . LEU A  1 60  ? 36.063  13.843  41.780  1.00 50.34  ?  60   LEU A CG  1 
ATOM   460  C  CD1 . LEU A  1 60  ? 37.276  13.187  41.149  1.00 46.86  ?  60   LEU A CD1 1 
ATOM   461  C  CD2 . LEU A  1 60  ? 34.866  13.712  40.860  1.00 53.04  ?  60   LEU A CD2 1 
ATOM   462  N  N   . ASP A  1 61  ? 34.491  16.267  43.966  1.00 44.03  ?  61   ASP A N   1 
ATOM   463  C  CA  . ASP A  1 61  ? 33.346  17.085  43.620  1.00 43.22  ?  61   ASP A CA  1 
ATOM   464  C  C   . ASP A  1 61  ? 32.972  16.817  42.161  1.00 49.78  ?  61   ASP A C   1 
ATOM   465  O  O   . ASP A  1 61  ? 33.809  16.920  41.261  1.00 52.30  ?  61   ASP A O   1 
ATOM   466  C  CB  . ASP A  1 61  ? 33.624  18.569  43.840  1.00 50.03  ?  61   ASP A CB  1 
ATOM   467  C  CG  . ASP A  1 61  ? 32.374  19.410  43.691  1.00 63.67  ?  61   ASP A CG  1 
ATOM   468  O  OD1 . ASP A  1 61  ? 31.968  19.650  42.531  1.00 65.63  ?  61   ASP A OD1 1 
ATOM   469  O  OD2 . ASP A  1 61  ? 31.787  19.807  44.730  1.00 65.87  ?  61   ASP A OD2 1 
ATOM   470  N  N   . ALA A  1 62  ? 31.712  16.451  41.953  1.00 47.74  ?  62   ALA A N   1 
ATOM   471  C  CA  . ALA A  1 62  ? 31.181  16.120  40.643  1.00 40.16  ?  62   ALA A CA  1 
ATOM   472  C  C   . ALA A  1 62  ? 29.933  16.939  40.405  1.00 43.89  ?  62   ALA A C   1 
ATOM   473  O  O   . ALA A  1 62  ? 28.895  16.398  40.022  1.00 38.92  ?  62   ALA A O   1 
ATOM   474  C  CB  . ALA A  1 62  ? 30.848  14.649  40.558  1.00 33.95  ?  62   ALA A CB  1 
ATOM   475  N  N   . THR A  1 63  ? 30.037  18.244  40.644  1.00 44.79  ?  63   THR A N   1 
ATOM   476  C  CA  . THR A  1 63  ? 28.893  19.141  40.513  1.00 45.74  ?  63   THR A CA  1 
ATOM   477  C  C   . THR A  1 63  ? 28.976  20.010  39.252  1.00 54.61  ?  63   THR A C   1 
ATOM   478  O  O   . THR A  1 63  ? 27.989  20.612  38.838  1.00 53.95  ?  63   THR A O   1 
ATOM   479  C  CB  . THR A  1 63  ? 28.738  20.040  41.758  1.00 53.20  ?  63   THR A CB  1 
ATOM   480  O  OG1 . THR A  1 63  ? 29.877  20.898  41.877  1.00 55.05  ?  63   THR A OG1 1 
ATOM   481  C  CG2 . THR A  1 63  ? 28.615  19.190  43.037  1.00 53.42  ?  63   THR A CG2 1 
ATOM   482  N  N   . THR A  1 64  ? 30.149  20.070  38.630  1.00 58.14  ?  64   THR A N   1 
ATOM   483  C  CA  . THR A  1 64  ? 30.300  20.882  37.424  1.00 49.76  ?  64   THR A CA  1 
ATOM   484  C  C   . THR A  1 64  ? 30.828  20.084  36.240  1.00 51.04  ?  64   THR A C   1 
ATOM   485  O  O   . THR A  1 64  ? 31.423  19.023  36.408  1.00 47.76  ?  64   THR A O   1 
ATOM   486  C  CB  . THR A  1 64  ? 31.208  22.104  37.660  1.00 51.41  ?  64   THR A CB  1 
ATOM   487  O  OG1 . THR A  1 64  ? 32.571  21.681  37.779  1.00 55.03  ?  64   THR A OG1 1 
ATOM   488  C  CG2 . THR A  1 64  ? 30.782  22.862  38.929  1.00 48.01  ?  64   THR A CG2 1 
ATOM   489  N  N   . PHE A  1 65  ? 30.585  20.596  35.036  1.00 53.21  ?  65   PHE A N   1 
ATOM   490  C  CA  . PHE A  1 65  ? 31.123  19.978  33.839  1.00 44.49  ?  65   PHE A CA  1 
ATOM   491  C  C   . PHE A  1 65  ? 32.626  20.182  33.784  1.00 45.43  ?  65   PHE A C   1 
ATOM   492  O  O   . PHE A  1 65  ? 33.137  21.220  34.209  1.00 46.82  ?  65   PHE A O   1 
ATOM   493  C  CB  . PHE A  1 65  ? 30.468  20.549  32.586  1.00 44.11  ?  65   PHE A CB  1 
ATOM   494  C  CG  . PHE A  1 65  ? 29.118  19.967  32.291  1.00 42.34  ?  65   PHE A CG  1 
ATOM   495  C  CD1 . PHE A  1 65  ? 28.988  18.616  31.979  1.00 34.58  ?  65   PHE A CD1 1 
ATOM   496  C  CD2 . PHE A  1 65  ? 27.978  20.768  32.324  1.00 36.51  ?  65   PHE A CD2 1 
ATOM   497  C  CE1 . PHE A  1 65  ? 27.751  18.065  31.712  1.00 34.79  ?  65   PHE A CE1 1 
ATOM   498  C  CE2 . PHE A  1 65  ? 26.730  20.228  32.061  1.00 38.55  ?  65   PHE A CE2 1 
ATOM   499  C  CZ  . PHE A  1 65  ? 26.611  18.868  31.754  1.00 39.27  ?  65   PHE A CZ  1 
ATOM   500  N  N   . GLN A  1 66  ? 33.329  19.183  33.263  1.00 42.53  ?  66   GLN A N   1 
ATOM   501  C  CA  . GLN A  1 66  ? 34.774  19.261  33.109  1.00 44.98  ?  66   GLN A CA  1 
ATOM   502  C  C   . GLN A  1 66  ? 35.213  19.807  31.751  1.00 49.60  ?  66   GLN A C   1 
ATOM   503  O  O   . GLN A  1 66  ? 34.385  20.097  30.868  1.00 44.16  ?  66   GLN A O   1 
ATOM   504  C  CB  . GLN A  1 66  ? 35.401  17.890  33.332  1.00 48.22  ?  66   GLN A CB  1 
ATOM   505  C  CG  . GLN A  1 66  ? 35.811  17.651  34.767  1.00 61.97  ?  66   GLN A CG  1 
ATOM   506  C  CD  . GLN A  1 66  ? 37.111  18.358  35.134  1.00 64.96  ?  66   GLN A CD  1 
ATOM   507  O  OE1 . GLN A  1 66  ? 37.840  18.852  34.267  1.00 59.97  ?  66   GLN A OE1 1 
ATOM   508  N  NE2 . GLN A  1 66  ? 37.406  18.404  36.427  1.00 64.57  ?  66   GLN A NE2 1 
ATOM   509  N  N   . ASN A  1 67  ? 36.530  19.933  31.602  1.00 50.03  ?  67   ASN A N   1 
ATOM   510  C  CA  . ASN A  1 67  ? 37.153  20.444  30.384  1.00 41.30  ?  67   ASN A CA  1 
ATOM   511  C  C   . ASN A  1 67  ? 36.672  19.782  29.107  1.00 42.86  ?  67   ASN A C   1 
ATOM   512  O  O   . ASN A  1 67  ? 36.354  18.593  29.076  1.00 39.74  ?  67   ASN A O   1 
ATOM   513  C  CB  . ASN A  1 67  ? 38.668  20.309  30.465  1.00 37.20  ?  67   ASN A CB  1 
ATOM   514  C  CG  . ASN A  1 67  ? 39.268  21.169  31.542  1.00 45.29  ?  67   ASN A CG  1 
ATOM   515  O  OD1 . ASN A  1 67  ? 38.766  22.256  31.850  1.00 45.74  ?  67   ASN A OD1 1 
ATOM   516  N  ND2 . ASN A  1 67  ? 40.357  20.691  32.131  1.00 52.50  ?  67   ASN A ND2 1 
ATOM   517  N  N   . VAL A  1 68  ? 36.625  20.580  28.050  1.00 45.11  ?  68   VAL A N   1 
ATOM   518  C  CA  . VAL A  1 68  ? 36.271  20.096  26.727  1.00 35.79  ?  68   VAL A CA  1 
ATOM   519  C  C   . VAL A  1 68  ? 37.538  19.688  25.986  1.00 38.02  ?  68   VAL A C   1 
ATOM   520  O  O   . VAL A  1 68  ? 38.555  20.387  26.029  1.00 43.25  ?  68   VAL A O   1 
ATOM   521  C  CB  . VAL A  1 68  ? 35.512  21.174  25.966  1.00 41.46  ?  68   VAL A CB  1 
ATOM   522  C  CG1 . VAL A  1 68  ? 35.289  20.770  24.515  1.00 42.94  ?  68   VAL A CG1 1 
ATOM   523  C  CG2 . VAL A  1 68  ? 34.195  21.429  26.669  1.00 40.32  ?  68   VAL A CG2 1 
ATOM   524  N  N   . CYS A  1 69  ? 37.488  18.523  25.355  1.00 36.96  ?  69   CYS A N   1 
ATOM   525  C  CA  . CYS A  1 69  ? 38.638  17.993  24.638  1.00 39.44  ?  69   CYS A CA  1 
ATOM   526  C  C   . CYS A  1 69  ? 39.130  18.997  23.604  1.00 42.77  ?  69   CYS A C   1 
ATOM   527  O  O   . CYS A  1 69  ? 38.325  19.634  22.910  1.00 35.48  ?  69   CYS A O   1 
ATOM   528  C  CB  . CYS A  1 69  ? 38.276  16.656  23.994  1.00 37.82  ?  69   CYS A CB  1 
ATOM   529  S  SG  . CYS A  1 69  ? 38.157  15.337  25.230  1.00 53.17  ?  69   CYS A SG  1 
ATOM   530  N  N   . TYR A  1 70  ? 40.447  19.160  23.531  1.00 33.06  ?  70   TYR A N   1 
ATOM   531  C  CA  . TYR A  1 70  ? 41.020  20.205  22.708  1.00 37.83  ?  70   TYR A CA  1 
ATOM   532  C  C   . TYR A  1 70  ? 40.552  20.093  21.247  1.00 46.44  ?  70   TYR A C   1 
ATOM   533  O  O   . TYR A  1 70  ? 40.610  19.015  20.638  1.00 43.76  ?  70   TYR A O   1 
ATOM   534  C  CB  . TYR A  1 70  ? 42.544  20.202  22.801  1.00 37.39  ?  70   TYR A CB  1 
ATOM   535  C  CG  . TYR A  1 70  ? 43.091  21.596  22.926  1.00 41.33  ?  70   TYR A CG  1 
ATOM   536  C  CD1 . TYR A  1 70  ? 43.083  22.464  21.836  1.00 42.52  ?  70   TYR A CD1 1 
ATOM   537  C  CD2 . TYR A  1 70  ? 43.588  22.062  24.139  1.00 38.98  ?  70   TYR A CD2 1 
ATOM   538  C  CE1 . TYR A  1 70  ? 43.567  23.756  21.946  1.00 43.58  ?  70   TYR A CE1 1 
ATOM   539  C  CE2 . TYR A  1 70  ? 44.079  23.351  24.259  1.00 48.16  ?  70   TYR A CE2 1 
ATOM   540  C  CZ  . TYR A  1 70  ? 44.062  24.194  23.158  1.00 55.21  ?  70   TYR A CZ  1 
ATOM   541  O  OH  . TYR A  1 70  ? 44.548  25.475  23.272  1.00 67.76  ?  70   TYR A OH  1 
ATOM   542  N  N   . GLN A  1 71  ? 40.066  21.205  20.700  1.00 42.01  ?  71   GLN A N   1 
ATOM   543  C  CA  . GLN A  1 71  ? 39.396  21.159  19.407  1.00 38.20  ?  71   GLN A CA  1 
ATOM   544  C  C   . GLN A  1 71  ? 39.292  22.501  18.687  1.00 45.79  ?  71   GLN A C   1 
ATOM   545  O  O   . GLN A  1 71  ? 39.427  23.581  19.291  1.00 37.04  ?  71   GLN A O   1 
ATOM   546  C  CB  . GLN A  1 71  ? 38.001  20.552  19.553  1.00 35.95  ?  71   GLN A CB  1 
ATOM   547  C  CG  . GLN A  1 71  ? 37.007  21.452  20.275  1.00 36.66  ?  71   GLN A CG  1 
ATOM   548  C  CD  . GLN A  1 71  ? 35.746  20.716  20.652  1.00 40.82  ?  71   GLN A CD  1 
ATOM   549  O  OE1 . GLN A  1 71  ? 34.654  21.019  20.155  1.00 45.99  ?  71   GLN A OE1 1 
ATOM   550  N  NE2 . GLN A  1 71  ? 35.886  19.725  21.526  1.00 37.33  ?  71   GLN A NE2 1 
ATOM   551  N  N   . TYR A  1 72  ? 39.060  22.396  17.378  1.00 55.09  ?  72   TYR A N   1 
ATOM   552  C  CA  . TYR A  1 72  ? 38.851  23.535  16.506  1.00 49.78  ?  72   TYR A CA  1 
ATOM   553  C  C   . TYR A  1 72  ? 37.554  24.230  16.886  1.00 47.39  ?  72   TYR A C   1 
ATOM   554  O  O   . TYR A  1 72  ? 36.537  23.574  17.095  1.00 48.64  ?  72   TYR A O   1 
ATOM   555  C  CB  . TYR A  1 72  ? 38.787  23.065  15.050  1.00 52.19  ?  72   TYR A CB  1 
ATOM   556  C  CG  . TYR A  1 72  ? 38.424  24.166  14.082  1.00 48.27  ?  72   TYR A CG  1 
ATOM   557  C  CD1 . TYR A  1 72  ? 39.368  25.108  13.697  1.00 46.82  ?  72   TYR A CD1 1 
ATOM   558  C  CD2 . TYR A  1 72  ? 37.131  24.283  13.576  1.00 47.29  ?  72   TYR A CD2 1 
ATOM   559  C  CE1 . TYR A  1 72  ? 39.044  26.134  12.822  1.00 51.17  ?  72   TYR A CE1 1 
ATOM   560  C  CE2 . TYR A  1 72  ? 36.797  25.306  12.691  1.00 52.90  ?  72   TYR A CE2 1 
ATOM   561  C  CZ  . TYR A  1 72  ? 37.762  26.226  12.318  1.00 55.00  ?  72   TYR A CZ  1 
ATOM   562  O  OH  . TYR A  1 72  ? 37.457  27.250  11.454  1.00 60.89  ?  72   TYR A OH  1 
ATOM   563  N  N   . VAL A  1 73  ? 37.588  25.556  16.981  1.00 48.56  ?  73   VAL A N   1 
ATOM   564  C  CA  . VAL A  1 73  ? 36.377  26.319  17.289  1.00 53.55  ?  73   VAL A CA  1 
ATOM   565  C  C   . VAL A  1 73  ? 35.848  27.130  16.093  1.00 51.59  ?  73   VAL A C   1 
ATOM   566  O  O   . VAL A  1 73  ? 36.582  27.878  15.454  1.00 50.25  ?  73   VAL A O   1 
ATOM   567  C  CB  . VAL A  1 73  ? 36.579  27.215  18.522  1.00 50.68  ?  73   VAL A CB  1 
ATOM   568  C  CG1 . VAL A  1 73  ? 35.310  27.973  18.846  1.00 44.28  ?  73   VAL A CG1 1 
ATOM   569  C  CG2 . VAL A  1 73  ? 36.993  26.362  19.703  1.00 48.78  ?  73   VAL A CG2 1 
ATOM   570  N  N   . ASP A  1 74  ? 34.559  26.973  15.814  1.00 56.12  ?  74   ASP A N   1 
ATOM   571  C  CA  . ASP A  1 74  ? 33.927  27.561  14.639  1.00 54.58  ?  74   ASP A CA  1 
ATOM   572  C  C   . ASP A  1 74  ? 33.866  29.090  14.633  1.00 57.43  ?  74   ASP A C   1 
ATOM   573  O  O   . ASP A  1 74  ? 33.452  29.716  15.610  1.00 54.09  ?  74   ASP A O   1 
ATOM   574  C  CB  . ASP A  1 74  ? 32.520  27.012  14.463  1.00 61.14  ?  74   ASP A CB  1 
ATOM   575  C  CG  . ASP A  1 74  ? 31.936  27.380  13.127  1.00 75.92  ?  74   ASP A CG  1 
ATOM   576  O  OD1 . ASP A  1 74  ? 32.298  26.702  12.148  1.00 77.85  ?  74   ASP A OD1 1 
ATOM   577  O  OD2 . ASP A  1 74  ? 31.148  28.352  13.048  1.00 78.21  ?  74   ASP A OD2 1 
ATOM   578  N  N   . THR A  1 75  ? 34.234  29.675  13.495  1.00 57.26  ?  75   THR A N   1 
ATOM   579  C  CA  . THR A  1 75  ? 34.376  31.123  13.375  1.00 57.14  ?  75   THR A CA  1 
ATOM   580  C  C   . THR A  1 75  ? 33.537  31.724  12.243  1.00 57.97  ?  75   THR A C   1 
ATOM   581  O  O   . THR A  1 75  ? 33.580  32.940  12.017  1.00 53.69  ?  75   THR A O   1 
ATOM   582  C  CB  . THR A  1 75  ? 35.848  31.498  13.137  1.00 55.90  ?  75   THR A CB  1 
ATOM   583  O  OG1 . THR A  1 75  ? 36.361  30.728  12.038  1.00 59.18  ?  75   THR A OG1 1 
ATOM   584  C  CG2 . THR A  1 75  ? 36.676  31.203  14.382  1.00 41.88  ?  75   THR A CG2 1 
ATOM   585  N  N   . LEU A  1 76  ? 32.775  30.877  11.547  1.00 52.21  ?  76   LEU A N   1 
ATOM   586  C  CA  . LEU A  1 76  ? 31.994  31.317  10.394  1.00 49.75  ?  76   LEU A CA  1 
ATOM   587  C  C   . LEU A  1 76  ? 31.030  32.441  10.748  1.00 52.33  ?  76   LEU A C   1 
ATOM   588  O  O   . LEU A  1 76  ? 31.054  33.499  10.121  1.00 56.93  ?  76   LEU A O   1 
ATOM   589  C  CB  . LEU A  1 76  ? 31.241  30.153  9.737   1.00 42.27  ?  76   LEU A CB  1 
ATOM   590  C  CG  . LEU A  1 76  ? 30.543  30.533  8.422   1.00 56.75  ?  76   LEU A CG  1 
ATOM   591  C  CD1 . LEU A  1 76  ? 31.529  31.202  7.466   1.00 56.21  ?  76   LEU A CD1 1 
ATOM   592  C  CD2 . LEU A  1 76  ? 29.873  29.342  7.732   1.00 54.34  ?  76   LEU A CD2 1 
ATOM   593  N  N   . TYR A  1 77  ? 30.192  32.217  11.752  1.00 50.63  ?  77   TYR A N   1 
ATOM   594  C  CA  . TYR A  1 77  ? 29.246  33.242  12.185  1.00 56.49  ?  77   TYR A CA  1 
ATOM   595  C  C   . TYR A  1 77  ? 29.380  33.537  13.683  1.00 60.08  ?  77   TYR A C   1 
ATOM   596  O  O   . TYR A  1 77  ? 28.661  32.968  14.511  1.00 52.54  ?  77   TYR A O   1 
ATOM   597  C  CB  . TYR A  1 77  ? 27.813  32.828  11.869  1.00 48.63  ?  77   TYR A CB  1 
ATOM   598  C  CG  . TYR A  1 77  ? 27.537  32.526  10.420  1.00 46.63  ?  77   TYR A CG  1 
ATOM   599  C  CD1 . TYR A  1 77  ? 27.486  33.544  9.474   1.00 47.88  ?  77   TYR A CD1 1 
ATOM   600  C  CD2 . TYR A  1 77  ? 27.289  31.224  10.000  1.00 46.23  ?  77   TYR A CD2 1 
ATOM   601  C  CE1 . TYR A  1 77  ? 27.220  33.272  8.146   1.00 41.38  ?  77   TYR A CE1 1 
ATOM   602  C  CE2 . TYR A  1 77  ? 27.018  30.943  8.679   1.00 46.91  ?  77   TYR A CE2 1 
ATOM   603  C  CZ  . TYR A  1 77  ? 26.985  31.967  7.754   1.00 51.18  ?  77   TYR A CZ  1 
ATOM   604  O  OH  . TYR A  1 77  ? 26.712  31.680  6.430   1.00 61.94  ?  77   TYR A OH  1 
ATOM   605  N  N   . PRO A  1 78  ? 30.305  34.438  14.030  1.00 60.18  ?  78   PRO A N   1 
ATOM   606  C  CA  . PRO A  1 78  ? 30.621  34.779  15.421  1.00 61.02  ?  78   PRO A CA  1 
ATOM   607  C  C   . PRO A  1 78  ? 29.413  35.331  16.177  1.00 67.05  ?  78   PRO A C   1 
ATOM   608  O  O   . PRO A  1 78  ? 28.801  36.298  15.717  1.00 66.54  ?  78   PRO A O   1 
ATOM   609  C  CB  . PRO A  1 78  ? 31.686  35.869  15.273  1.00 58.30  ?  78   PRO A CB  1 
ATOM   610  C  CG  . PRO A  1 78  ? 32.267  35.654  13.906  1.00 54.87  ?  78   PRO A CG  1 
ATOM   611  C  CD  . PRO A  1 78  ? 31.117  35.205  13.073  1.00 52.03  ?  78   PRO A CD  1 
ATOM   612  N  N   . GLY A  1 79  ? 29.083  34.720  17.317  1.00 68.08  ?  79   GLY A N   1 
ATOM   613  C  CA  . GLY A  1 79  ? 27.987  35.172  18.161  1.00 58.53  ?  79   GLY A CA  1 
ATOM   614  C  C   . GLY A  1 79  ? 26.610  34.701  17.719  1.00 55.53  ?  79   GLY A C   1 
ATOM   615  O  O   . GLY A  1 79  ? 25.603  34.968  18.379  1.00 58.35  ?  79   GLY A O   1 
ATOM   616  N  N   . PHE A  1 80  ? 26.564  34.000  16.596  1.00 48.06  ?  80   PHE A N   1 
ATOM   617  C  CA  . PHE A  1 80  ? 25.313  33.490  16.062  1.00 46.80  ?  80   PHE A CA  1 
ATOM   618  C  C   . PHE A  1 80  ? 24.933  32.203  16.777  1.00 50.12  ?  80   PHE A C   1 
ATOM   619  O  O   . PHE A  1 80  ? 25.710  31.249  16.823  1.00 53.98  ?  80   PHE A O   1 
ATOM   620  C  CB  . PHE A  1 80  ? 25.446  33.248  14.554  1.00 49.01  ?  80   PHE A CB  1 
ATOM   621  C  CG  . PHE A  1 80  ? 24.267  32.549  13.938  1.00 48.38  ?  80   PHE A CG  1 
ATOM   622  C  CD1 . PHE A  1 80  ? 23.022  33.157  13.903  1.00 48.56  ?  80   PHE A CD1 1 
ATOM   623  C  CD2 . PHE A  1 80  ? 24.410  31.290  13.375  1.00 42.31  ?  80   PHE A CD2 1 
ATOM   624  C  CE1 . PHE A  1 80  ? 21.941  32.520  13.327  1.00 46.86  ?  80   PHE A CE1 1 
ATOM   625  C  CE2 . PHE A  1 80  ? 23.331  30.648  12.785  1.00 37.67  ?  80   PHE A CE2 1 
ATOM   626  C  CZ  . PHE A  1 80  ? 22.099  31.261  12.761  1.00 47.57  ?  80   PHE A CZ  1 
ATOM   627  N  N   . GLU A  1 81  ? 23.719  32.194  17.314  1.00 49.46  ?  81   GLU A N   1 
ATOM   628  C  CA  . GLU A  1 81  ? 23.199  31.109  18.137  1.00 49.09  ?  81   GLU A CA  1 
ATOM   629  C  C   . GLU A  1 81  ? 23.218  29.749  17.431  1.00 51.39  ?  81   GLU A C   1 
ATOM   630  O  O   . GLU A  1 81  ? 23.426  28.713  18.068  1.00 48.15  ?  81   GLU A O   1 
ATOM   631  C  CB  . GLU A  1 81  ? 21.771  31.441  18.582  1.00 60.00  ?  81   GLU A CB  1 
ATOM   632  C  CG  . GLU A  1 81  ? 21.565  32.887  19.081  1.00 82.70  ?  81   GLU A CG  1 
ATOM   633  C  CD  . GLU A  1 81  ? 21.485  33.940  17.956  1.00 92.10  ?  81   GLU A CD  1 
ATOM   634  O  OE1 . GLU A  1 81  ? 20.904  33.656  16.881  1.00 92.69  ?  81   GLU A OE1 1 
ATOM   635  O  OE2 . GLU A  1 81  ? 22.011  35.060  18.151  1.00 92.58  ?  81   GLU A OE2 1 
ATOM   636  N  N   . GLY A  1 82  ? 23.006  29.754  16.118  1.00 47.16  ?  82   GLY A N   1 
ATOM   637  C  CA  . GLY A  1 82  ? 22.879  28.514  15.372  1.00 49.01  ?  82   GLY A CA  1 
ATOM   638  C  C   . GLY A  1 82  ? 24.182  27.747  15.259  1.00 44.44  ?  82   GLY A C   1 
ATOM   639  O  O   . GLY A  1 82  ? 24.186  26.524  15.095  1.00 42.43  ?  82   GLY A O   1 
ATOM   640  N  N   . THR A  1 83  ? 25.294  28.464  15.341  1.00 37.92  ?  83   THR A N   1 
ATOM   641  C  CA  . THR A  1 83  ? 26.593  27.811  15.382  1.00 41.30  ?  83   THR A CA  1 
ATOM   642  C  C   . THR A  1 83  ? 27.094  27.672  16.832  1.00 45.93  ?  83   THR A C   1 
ATOM   643  O  O   . THR A  1 83  ? 27.509  26.592  17.246  1.00 46.58  ?  83   THR A O   1 
ATOM   644  C  CB  . THR A  1 83  ? 27.632  28.546  14.491  1.00 41.86  ?  83   THR A CB  1 
ATOM   645  O  OG1 . THR A  1 83  ? 27.686  29.933  14.842  1.00 51.23  ?  83   THR A OG1 1 
ATOM   646  C  CG2 . THR A  1 83  ? 27.228  28.447  13.046  1.00 41.92  ?  83   THR A CG2 1 
ATOM   647  N  N   . GLU A  1 84  ? 27.029  28.764  17.592  1.00 40.82  ?  84   GLU A N   1 
ATOM   648  C  CA  . GLU A  1 84  ? 27.513  28.795  18.968  1.00 43.85  ?  84   GLU A CA  1 
ATOM   649  C  C   . GLU A  1 84  ? 27.003  27.651  19.849  1.00 49.38  ?  84   GLU A C   1 
ATOM   650  O  O   . GLU A  1 84  ? 27.748  27.130  20.675  1.00 53.02  ?  84   GLU A O   1 
ATOM   651  C  CB  . GLU A  1 84  ? 27.218  30.147  19.635  1.00 40.93  ?  84   GLU A CB  1 
ATOM   652  C  CG  . GLU A  1 84  ? 28.009  31.332  19.082  1.00 52.97  ?  84   GLU A CG  1 
ATOM   653  C  CD  . GLU A  1 84  ? 29.518  31.251  19.339  1.00 68.55  ?  84   GLU A CD  1 
ATOM   654  O  OE1 . GLU A  1 84  ? 29.984  30.293  19.999  1.00 71.02  ?  84   GLU A OE1 1 
ATOM   655  O  OE2 . GLU A  1 84  ? 30.246  32.161  18.875  1.00 70.77  ?  84   GLU A OE2 1 
ATOM   656  N  N   . MET A  1 85  ? 25.750  27.249  19.661  1.00 48.42  ?  85   MET A N   1 
ATOM   657  C  CA  . MET A  1 85  ? 25.166  26.157  20.439  1.00 44.21  ?  85   MET A CA  1 
ATOM   658  C  C   . MET A  1 85  ? 25.948  24.852  20.300  1.00 50.67  ?  85   MET A C   1 
ATOM   659  O  O   . MET A  1 85  ? 25.760  23.925  21.089  1.00 57.32  ?  85   MET A O   1 
ATOM   660  C  CB  . MET A  1 85  ? 23.725  25.911  20.005  1.00 37.94  ?  85   MET A CB  1 
ATOM   661  C  CG  . MET A  1 85  ? 23.612  25.398  18.547  1.00 41.41  ?  85   MET A CG  1 
ATOM   662  S  SD  . MET A  1 85  ? 21.905  25.315  17.942  1.00 56.14  ?  85   MET A SD  1 
ATOM   663  C  CE  . MET A  1 85  ? 21.201  24.027  18.973  1.00 39.91  ?  85   MET A CE  1 
ATOM   664  N  N   . TRP A  1 86  ? 26.820  24.780  19.297  1.00 38.46  ?  86   TRP A N   1 
ATOM   665  C  CA  . TRP A  1 86  ? 27.619  23.583  19.078  1.00 35.79  ?  86   TRP A CA  1 
ATOM   666  C  C   . TRP A  1 86  ? 29.051  23.762  19.554  1.00 36.97  ?  86   TRP A C   1 
ATOM   667  O  O   . TRP A  1 86  ? 29.802  22.793  19.641  1.00 43.38  ?  86   TRP A O   1 
ATOM   668  C  CB  . TRP A  1 86  ? 27.609  23.180  17.604  1.00 37.47  ?  86   TRP A CB  1 
ATOM   669  C  CG  . TRP A  1 86  ? 26.233  23.006  17.040  1.00 41.99  ?  86   TRP A CG  1 
ATOM   670  C  CD1 . TRP A  1 86  ? 25.613  23.813  16.137  1.00 45.70  ?  86   TRP A CD1 1 
ATOM   671  C  CD2 . TRP A  1 86  ? 25.305  21.955  17.347  1.00 42.40  ?  86   TRP A CD2 1 
ATOM   672  N  NE1 . TRP A  1 86  ? 24.356  23.332  15.861  1.00 50.56  ?  86   TRP A NE1 1 
ATOM   673  C  CE2 . TRP A  1 86  ? 24.142  22.194  16.596  1.00 43.81  ?  86   TRP A CE2 1 
ATOM   674  C  CE3 . TRP A  1 86  ? 25.347  20.837  18.192  1.00 45.07  ?  86   TRP A CE3 1 
ATOM   675  C  CZ2 . TRP A  1 86  ? 23.033  21.355  16.654  1.00 42.44  ?  86   TRP A CZ2 1 
ATOM   676  C  CZ3 . TRP A  1 86  ? 24.245  20.009  18.255  1.00 40.30  ?  86   TRP A CZ3 1 
ATOM   677  C  CH2 . TRP A  1 86  ? 23.105  20.269  17.487  1.00 47.90  ?  86   TRP A CH2 1 
ATOM   678  N  N   . ASN A  1 87  ? 29.417  25.000  19.875  1.00 35.98  ?  87   ASN A N   1 
ATOM   679  C  CA  . ASN A  1 87  ? 30.770  25.319  20.327  1.00 39.85  ?  87   ASN A CA  1 
ATOM   680  C  C   . ASN A  1 87  ? 31.044  24.858  21.765  1.00 45.49  ?  87   ASN A C   1 
ATOM   681  O  O   . ASN A  1 87  ? 30.115  24.719  22.562  1.00 49.61  ?  87   ASN A O   1 
ATOM   682  C  CB  . ASN A  1 87  ? 31.022  26.827  20.196  1.00 43.33  ?  87   ASN A CB  1 
ATOM   683  C  CG  . ASN A  1 87  ? 31.509  27.218  18.810  1.00 51.81  ?  87   ASN A CG  1 
ATOM   684  O  OD1 . ASN A  1 87  ? 31.917  26.370  18.019  1.00 54.59  ?  87   ASN A OD1 1 
ATOM   685  N  ND2 . ASN A  1 87  ? 31.488  28.510  18.522  1.00 56.58  ?  87   ASN A ND2 1 
ATOM   686  N  N   . PRO A  1 88  ? 32.321  24.618  22.099  1.00 43.71  ?  88   PRO A N   1 
ATOM   687  C  CA  . PRO A  1 88  ? 32.729  24.263  23.475  1.00 38.10  ?  88   PRO A CA  1 
ATOM   688  C  C   . PRO A  1 88  ? 32.219  25.248  24.529  1.00 44.44  ?  88   PRO A C   1 
ATOM   689  O  O   . PRO A  1 88  ? 32.435  26.456  24.394  1.00 40.59  ?  88   PRO A O   1 
ATOM   690  C  CB  . PRO A  1 88  ? 34.256  24.333  23.415  1.00 34.13  ?  88   PRO A CB  1 
ATOM   691  C  CG  . PRO A  1 88  ? 34.588  24.010  21.971  1.00 39.47  ?  88   PRO A CG  1 
ATOM   692  C  CD  . PRO A  1 88  ? 33.450  24.580  21.147  1.00 36.86  ?  88   PRO A CD  1 
ATOM   693  N  N   . ASN A  1 89  ? 31.564  24.736  25.573  1.00 46.90  ?  89   ASN A N   1 
ATOM   694  C  CA  . ASN A  1 89  ? 31.049  25.581  26.653  1.00 36.88  ?  89   ASN A CA  1 
ATOM   695  C  C   . ASN A  1 89  ? 31.828  25.458  27.970  1.00 45.52  ?  89   ASN A C   1 
ATOM   696  O  O   . ASN A  1 89  ? 31.371  25.916  29.011  1.00 58.33  ?  89   ASN A O   1 
ATOM   697  C  CB  . ASN A  1 89  ? 29.576  25.301  26.891  1.00 38.76  ?  89   ASN A CB  1 
ATOM   698  C  CG  . ASN A  1 89  ? 29.328  23.882  27.359  1.00 43.99  ?  89   ASN A CG  1 
ATOM   699  O  OD1 . ASN A  1 89  ? 30.153  22.991  27.135  1.00 37.74  ?  89   ASN A OD1 1 
ATOM   700  N  ND2 . ASN A  1 89  ? 28.181  23.659  28.005  1.00 42.39  ?  89   ASN A ND2 1 
ATOM   701  N  N   . ARG A  1 90  ? 32.986  24.811  27.917  1.00 41.18  ?  90   ARG A N   1 
ATOM   702  C  CA  A ARG A  1 90  ? 33.921  24.835  29.034  0.46 42.53  ?  90   ARG A CA  1 
ATOM   703  C  CA  B ARG A  1 90  ? 33.928  24.758  29.031  0.54 42.68  ?  90   ARG A CA  1 
ATOM   704  C  C   . ARG A  1 90  ? 35.323  24.994  28.471  1.00 46.15  ?  90   ARG A C   1 
ATOM   705  O  O   . ARG A  1 90  ? 35.521  24.963  27.256  1.00 52.70  ?  90   ARG A O   1 
ATOM   706  C  CB  A ARG A  1 90  ? 33.826  23.567  29.894  0.46 42.60  ?  90   ARG A CB  1 
ATOM   707  C  CB  B ARG A  1 90  ? 33.904  23.388  29.723  0.54 43.20  ?  90   ARG A CB  1 
ATOM   708  C  CG  A ARG A  1 90  ? 32.545  23.435  30.728  0.46 40.02  ?  90   ARG A CG  1 
ATOM   709  C  CG  B ARG A  1 90  ? 32.532  22.900  30.172  0.54 41.37  ?  90   ARG A CG  1 
ATOM   710  C  CD  A ARG A  1 90  ? 32.346  24.599  31.698  0.46 38.70  ?  90   ARG A CD  1 
ATOM   711  C  CD  B ARG A  1 90  ? 31.951  23.776  31.267  0.54 38.40  ?  90   ARG A CD  1 
ATOM   712  N  NE  A ARG A  1 90  ? 31.087  24.480  32.434  0.46 39.84  ?  90   ARG A NE  1 
ATOM   713  N  NE  B ARG A  1 90  ? 32.564  23.511  32.559  0.54 37.31  ?  90   ARG A NE  1 
ATOM   714  C  CZ  A ARG A  1 90  ? 29.940  25.054  32.073  0.46 42.99  ?  90   ARG A CZ  1 
ATOM   715  C  CZ  B ARG A  1 90  ? 32.603  24.385  33.557  0.54 38.99  ?  90   ARG A CZ  1 
ATOM   716  N  NH1 A ARG A  1 90  ? 29.879  25.806  30.982  0.46 43.56  ?  90   ARG A NH1 1 
ATOM   717  N  NH1 B ARG A  1 90  ? 32.070  25.593  33.405  0.54 37.02  ?  90   ARG A NH1 1 
ATOM   718  N  NH2 A ARG A  1 90  ? 28.848  24.878  32.807  0.46 43.94  ?  90   ARG A NH2 1 
ATOM   719  N  NH2 B ARG A  1 90  ? 33.183  24.052  34.703  0.54 37.40  ?  90   ARG A NH2 1 
ATOM   720  N  N   . GLU A  1 91  ? 36.288  25.193  29.356  1.00 48.95  ?  91   GLU A N   1 
ATOM   721  C  CA  . GLU A  1 91  ? 37.679  25.361  28.970  1.00 42.42  ?  91   GLU A CA  1 
ATOM   722  C  C   . GLU A  1 91  ? 38.204  24.182  28.139  1.00 47.68  ?  91   GLU A C   1 
ATOM   723  O  O   . GLU A  1 91  ? 37.844  23.026  28.388  1.00 46.51  ?  91   GLU A O   1 
ATOM   724  C  CB  . GLU A  1 91  ? 38.518  25.509  30.240  1.00 40.76  ?  91   GLU A CB  1 
ATOM   725  C  CG  . GLU A  1 91  ? 40.002  25.571  29.981  1.00 56.55  ?  91   GLU A CG  1 
ATOM   726  C  CD  . GLU A  1 91  ? 40.790  25.763  31.249  1.00 63.07  ?  91   GLU A CD  1 
ATOM   727  O  OE1 . GLU A  1 91  ? 40.151  25.958  32.299  1.00 56.49  ?  91   GLU A OE1 1 
ATOM   728  O  OE2 . GLU A  1 91  ? 42.039  25.721  31.197  1.00 69.20  ?  91   GLU A OE2 1 
ATOM   729  N  N   . LEU A  1 92  ? 39.061  24.476  27.161  1.00 50.86  ?  92   LEU A N   1 
ATOM   730  C  CA  . LEU A  1 92  ? 39.641  23.444  26.298  1.00 43.97  ?  92   LEU A CA  1 
ATOM   731  C  C   . LEU A  1 92  ? 40.927  22.895  26.893  1.00 42.18  ?  92   LEU A C   1 
ATOM   732  O  O   . LEU A  1 92  ? 41.807  23.657  27.289  1.00 38.22  ?  92   LEU A O   1 
ATOM   733  C  CB  . LEU A  1 92  ? 39.955  23.999  24.913  1.00 42.57  ?  92   LEU A CB  1 
ATOM   734  C  CG  . LEU A  1 92  ? 38.816  24.499  24.038  1.00 46.53  ?  92   LEU A CG  1 
ATOM   735  C  CD1 . LEU A  1 92  ? 39.356  24.817  22.662  1.00 37.81  ?  92   LEU A CD1 1 
ATOM   736  C  CD2 . LEU A  1 92  ? 37.752  23.440  23.956  1.00 51.99  ?  92   LEU A CD2 1 
ATOM   737  N  N   . SER A  1 93  ? 41.049  21.574  26.922  1.00 34.74  ?  93   SER A N   1 
ATOM   738  C  CA  . SER A  1 93  ? 42.216  20.946  27.510  1.00 32.74  ?  93   SER A CA  1 
ATOM   739  C  C   . SER A  1 93  ? 42.391  19.548  26.952  1.00 37.48  ?  93   SER A C   1 
ATOM   740  O  O   . SER A  1 93  ? 41.424  18.901  26.563  1.00 37.94  ?  93   SER A O   1 
ATOM   741  C  CB  . SER A  1 93  ? 42.049  20.875  29.040  1.00 37.40  ?  93   SER A CB  1 
ATOM   742  O  OG  . SER A  1 93  ? 43.183  20.291  29.666  1.00 35.94  ?  93   SER A OG  1 
ATOM   743  N  N   . GLU A  1 94  ? 43.629  19.080  26.922  1.00 42.45  ?  94   GLU A N   1 
ATOM   744  C  CA  . GLU A  1 94  ? 43.890  17.686  26.610  1.00 40.61  ?  94   GLU A CA  1 
ATOM   745  C  C   . GLU A  1 94  ? 43.495  16.805  27.791  1.00 46.82  ?  94   GLU A C   1 
ATOM   746  O  O   . GLU A  1 94  ? 43.263  15.606  27.628  1.00 51.31  ?  94   GLU A O   1 
ATOM   747  C  CB  . GLU A  1 94  ? 45.361  17.479  26.272  1.00 43.09  ?  94   GLU A CB  1 
ATOM   748  C  CG  . GLU A  1 94  ? 45.723  17.818  24.847  1.00 47.17  ?  94   GLU A CG  1 
ATOM   749  C  CD  . GLU A  1 94  ? 47.148  17.443  24.523  1.00 51.90  ?  94   GLU A CD  1 
ATOM   750  O  OE1 . GLU A  1 94  ? 47.387  16.294  24.078  1.00 52.72  ?  94   GLU A OE1 1 
ATOM   751  O  OE2 . GLU A  1 94  ? 48.029  18.301  24.731  1.00 49.62  ?  94   GLU A OE2 1 
ATOM   752  N  N   . ASP A  1 95  ? 43.439  17.405  28.981  1.00 34.90  ?  95   ASP A N   1 
ATOM   753  C  CA  . ASP A  1 95  ? 42.917  16.728  30.167  1.00 41.94  ?  95   ASP A CA  1 
ATOM   754  C  C   . ASP A  1 95  ? 41.406  16.883  30.153  1.00 40.86  ?  95   ASP A C   1 
ATOM   755  O  O   . ASP A  1 95  ? 40.883  17.893  30.620  1.00 52.21  ?  95   ASP A O   1 
ATOM   756  C  CB  . ASP A  1 95  ? 43.515  17.365  31.428  1.00 55.02  ?  95   ASP A CB  1 
ATOM   757  C  CG  . ASP A  1 95  ? 42.939  16.805  32.714  1.00 54.15  ?  95   ASP A CG  1 
ATOM   758  O  OD1 . ASP A  1 95  ? 42.278  15.746  32.687  1.00 51.06  ?  95   ASP A OD1 1 
ATOM   759  O  OD2 . ASP A  1 95  ? 43.168  17.435  33.766  1.00 62.05  ?  95   ASP A OD2 1 
ATOM   760  N  N   . CYS A  1 96  ? 40.710  15.877  29.627  1.00 39.85  ?  96   CYS A N   1 
ATOM   761  C  CA  . CYS A  1 96  ? 39.300  16.017  29.270  1.00 35.50  ?  96   CYS A CA  1 
ATOM   762  C  C   . CYS A  1 96  ? 38.540  14.702  29.241  1.00 34.56  ?  96   CYS A C   1 
ATOM   763  O  O   . CYS A  1 96  ? 37.398  14.661  28.779  1.00 36.57  ?  96   CYS A O   1 
ATOM   764  C  CB  . CYS A  1 96  ? 39.175  16.639  27.874  1.00 39.20  ?  96   CYS A CB  1 
ATOM   765  S  SG  . CYS A  1 96  ? 39.742  15.527  26.514  1.00 47.83  ?  96   CYS A SG  1 
ATOM   766  N  N   . LEU A  1 97  ? 39.159  13.621  29.691  1.00 35.67  ?  97   LEU A N   1 
ATOM   767  C  CA  . LEU A  1 97  ? 38.455  12.340  29.704  1.00 37.72  ?  97   LEU A CA  1 
ATOM   768  C  C   . LEU A  1 97  ? 37.536  12.180  30.950  1.00 42.05  ?  97   LEU A C   1 
ATOM   769  O  O   . LEU A  1 97  ? 37.862  11.500  31.914  1.00 41.93  ?  97   LEU A O   1 
ATOM   770  C  CB  . LEU A  1 97  ? 39.441  11.182  29.513  1.00 38.97  ?  97   LEU A CB  1 
ATOM   771  C  CG  . LEU A  1 97  ? 40.062  11.239  28.102  1.00 46.40  ?  97   LEU A CG  1 
ATOM   772  C  CD1 . LEU A  1 97  ? 40.962  10.044  27.749  1.00 39.55  ?  97   LEU A CD1 1 
ATOM   773  C  CD2 . LEU A  1 97  ? 38.969  11.379  27.072  1.00 45.14  ?  97   LEU A CD2 1 
ATOM   774  N  N   . TYR A  1 98  ? 36.376  12.828  30.899  1.00 33.77  ?  98   TYR A N   1 
ATOM   775  C  CA  . TYR A  1 98  ? 35.417  12.800  31.980  1.00 36.31  ?  98   TYR A CA  1 
ATOM   776  C  C   . TYR A  1 98  ? 34.065  12.402  31.420  1.00 36.86  ?  98   TYR A C   1 
ATOM   777  O  O   . TYR A  1 98  ? 33.807  12.588  30.244  1.00 40.11  ?  98   TYR A O   1 
ATOM   778  C  CB  . TYR A  1 98  ? 35.344  14.175  32.671  1.00 40.68  ?  98   TYR A CB  1 
ATOM   779  C  CG  . TYR A  1 98  ? 36.682  14.635  33.234  1.00 45.89  ?  98   TYR A CG  1 
ATOM   780  C  CD1 . TYR A  1 98  ? 37.620  15.273  32.425  1.00 42.14  ?  98   TYR A CD1 1 
ATOM   781  C  CD2 . TYR A  1 98  ? 37.019  14.401  34.566  1.00 38.98  ?  98   TYR A CD2 1 
ATOM   782  C  CE1 . TYR A  1 98  ? 38.849  15.677  32.928  1.00 41.30  ?  98   TYR A CE1 1 
ATOM   783  C  CE2 . TYR A  1 98  ? 38.245  14.816  35.082  1.00 38.69  ?  98   TYR A CE2 1 
ATOM   784  C  CZ  . TYR A  1 98  ? 39.152  15.449  34.258  1.00 46.65  ?  98   TYR A CZ  1 
ATOM   785  O  OH  . TYR A  1 98  ? 40.369  15.850  34.755  1.00 47.71  ?  98   TYR A OH  1 
ATOM   786  N  N   . LEU A  1 99  ? 33.213  11.839  32.265  1.00 35.74  ?  99   LEU A N   1 
ATOM   787  C  CA  . LEU A  1 99  ? 31.863  11.509  31.872  1.00 31.62  ?  99   LEU A CA  1 
ATOM   788  C  C   . LEU A  1 99  ? 30.852  12.043  32.885  1.00 40.64  ?  99   LEU A C   1 
ATOM   789  O  O   . LEU A  1 99  ? 31.203  12.368  34.030  1.00 41.38  ?  99   LEU A O   1 
ATOM   790  C  CB  . LEU A  1 99  ? 31.703  9.996   31.658  1.00 34.26  ?  99   LEU A CB  1 
ATOM   791  C  CG  . LEU A  1 99  ? 32.119  8.967   32.711  1.00 35.51  ?  99   LEU A CG  1 
ATOM   792  C  CD1 . LEU A  1 99  ? 31.115  8.883   33.852  1.00 30.81  ?  99   LEU A CD1 1 
ATOM   793  C  CD2 . LEU A  1 99  ? 32.269  7.608   32.056  1.00 41.63  ?  99   LEU A CD2 1 
ATOM   794  N  N   . ASN A  1 100 ? 29.600  12.127  32.443  1.00 38.68  ?  100  ASN A N   1 
ATOM   795  C  CA  . ASN A  1 100 ? 28.517  12.680  33.232  1.00 38.14  ?  100  ASN A CA  1 
ATOM   796  C  C   . ASN A  1 100 ? 27.409  11.654  33.376  1.00 41.55  ?  100  ASN A C   1 
ATOM   797  O  O   . ASN A  1 100 ? 27.244  10.800  32.510  1.00 41.68  ?  100  ASN A O   1 
ATOM   798  C  CB  . ASN A  1 100 ? 27.962  13.939  32.565  1.00 39.55  ?  100  ASN A CB  1 
ATOM   799  C  CG  . ASN A  1 100 ? 29.052  14.859  32.049  1.00 40.77  ?  100  ASN A CG  1 
ATOM   800  O  OD1 . ASN A  1 100 ? 29.723  15.543  32.822  1.00 46.82  ?  100  ASN A OD1 1 
ATOM   801  N  ND2 . ASN A  1 100 ? 29.223  14.892  30.732  1.00 39.03  ?  100  ASN A ND2 1 
ATOM   802  N  N   . VAL A  1 101 ? 26.670  11.728  34.485  1.00 44.34  ?  101  VAL A N   1 
ATOM   803  C  CA  . VAL A  1 101 ? 25.564  10.813  34.757  1.00 38.04  ?  101  VAL A CA  1 
ATOM   804  C  C   . VAL A  1 101 ? 24.379  11.572  35.343  1.00 42.43  ?  101  VAL A C   1 
ATOM   805  O  O   . VAL A  1 101 ? 24.539  12.332  36.302  1.00 46.04  ?  101  VAL A O   1 
ATOM   806  C  CB  . VAL A  1 101 ? 25.960  9.728   35.786  1.00 37.62  ?  101  VAL A CB  1 
ATOM   807  C  CG1 . VAL A  1 101 ? 24.818  8.725   35.982  1.00 34.83  ?  101  VAL A CG1 1 
ATOM   808  C  CG2 . VAL A  1 101 ? 27.218  9.008   35.367  1.00 30.40  ?  101  VAL A CG2 1 
ATOM   809  N  N   . TRP A  1 102 ? 23.193  11.362  34.779  1.00 33.49  ?  102  TRP A N   1 
ATOM   810  C  CA  . TRP A  1 102 ? 21.964  11.889  35.361  1.00 33.22  ?  102  TRP A CA  1 
ATOM   811  C  C   . TRP A  1 102 ? 21.060  10.724  35.747  1.00 40.82  ?  102  TRP A C   1 
ATOM   812  O  O   . TRP A  1 102 ? 20.908  9.763   34.985  1.00 40.61  ?  102  TRP A O   1 
ATOM   813  C  CB  . TRP A  1 102 ? 21.206  12.783  34.381  1.00 44.90  ?  102  TRP A CB  1 
ATOM   814  C  CG  . TRP A  1 102 ? 21.873  14.067  33.958  1.00 45.90  ?  102  TRP A CG  1 
ATOM   815  C  CD1 . TRP A  1 102 ? 21.666  15.314  34.483  1.00 45.34  ?  102  TRP A CD1 1 
ATOM   816  C  CD2 . TRP A  1 102 ? 22.810  14.233  32.888  1.00 39.05  ?  102  TRP A CD2 1 
ATOM   817  N  NE1 . TRP A  1 102 ? 22.432  16.241  33.817  1.00 50.14  ?  102  TRP A NE1 1 
ATOM   818  C  CE2 . TRP A  1 102 ? 23.139  15.606  32.830  1.00 41.70  ?  102  TRP A CE2 1 
ATOM   819  C  CE3 . TRP A  1 102 ? 23.402  13.357  31.971  1.00 45.94  ?  102  TRP A CE3 1 
ATOM   820  C  CZ2 . TRP A  1 102 ? 24.038  16.124  31.891  1.00 43.11  ?  102  TRP A CZ2 1 
ATOM   821  C  CZ3 . TRP A  1 102 ? 24.299  13.876  31.027  1.00 41.32  ?  102  TRP A CZ3 1 
ATOM   822  C  CH2 . TRP A  1 102 ? 24.608  15.246  31.003  1.00 40.47  ?  102  TRP A CH2 1 
ATOM   823  N  N   . THR A  1 103 ? 20.460  10.809  36.930  1.00 39.91  ?  103  THR A N   1 
ATOM   824  C  CA  . THR A  1 103 ? 19.561  9.766   37.417  1.00 46.09  ?  103  THR A CA  1 
ATOM   825  C  C   . THR A  1 103 ? 18.347  10.418  38.053  1.00 44.80  ?  103  THR A C   1 
ATOM   826  O  O   . THR A  1 103 ? 18.396  11.582  38.438  1.00 51.69  ?  103  THR A O   1 
ATOM   827  C  CB  . THR A  1 103 ? 20.238  8.868   38.481  1.00 47.11  ?  103  THR A CB  1 
ATOM   828  O  OG1 . THR A  1 103 ? 20.641  9.674   39.591  1.00 51.29  ?  103  THR A OG1 1 
ATOM   829  C  CG2 . THR A  1 103 ? 21.461  8.184   37.925  1.00 44.27  ?  103  THR A CG2 1 
ATOM   830  N  N   . PRO A  1 104 ? 17.240  9.681   38.138  1.00 41.50  ?  104  PRO A N   1 
ATOM   831  C  CA  . PRO A  1 104 ? 16.103  10.137  38.941  1.00 46.40  ?  104  PRO A CA  1 
ATOM   832  C  C   . PRO A  1 104 ? 16.540  10.513  40.347  1.00 54.73  ?  104  PRO A C   1 
ATOM   833  O  O   . PRO A  1 104 ? 17.520  9.971   40.858  1.00 58.28  ?  104  PRO A O   1 
ATOM   834  C  CB  . PRO A  1 104 ? 15.212  8.897   38.998  1.00 45.13  ?  104  PRO A CB  1 
ATOM   835  C  CG  . PRO A  1 104 ? 15.447  8.243   37.662  1.00 50.17  ?  104  PRO A CG  1 
ATOM   836  C  CD  . PRO A  1 104 ? 16.900  8.514   37.307  1.00 39.59  ?  104  PRO A CD  1 
ATOM   837  N  N   . TYR A  1 105 ? 15.818  11.450  40.948  1.00 52.50  ?  105  TYR A N   1 
ATOM   838  C  CA  . TYR A  1 105 ? 16.043  11.841  42.323  1.00 50.12  ?  105  TYR A CA  1 
ATOM   839  C  C   . TYR A  1 105 ? 14.789  11.523  43.103  1.00 58.71  ?  105  TYR A C   1 
ATOM   840  O  O   . TYR A  1 105 ? 13.730  12.067  42.808  1.00 63.27  ?  105  TYR A O   1 
ATOM   841  C  CB  . TYR A  1 105 ? 16.322  13.336  42.421  1.00 47.60  ?  105  TYR A CB  1 
ATOM   842  C  CG  . TYR A  1 105 ? 16.674  13.828  43.812  1.00 44.47  ?  105  TYR A CG  1 
ATOM   843  C  CD1 . TYR A  1 105 ? 15.688  14.025  44.777  1.00 41.63  ?  105  TYR A CD1 1 
ATOM   844  C  CD2 . TYR A  1 105 ? 17.989  14.116  44.152  1.00 39.83  ?  105  TYR A CD2 1 
ATOM   845  C  CE1 . TYR A  1 105 ? 16.001  14.489  46.038  1.00 46.69  ?  105  TYR A CE1 1 
ATOM   846  C  CE2 . TYR A  1 105 ? 18.318  14.585  45.426  1.00 42.12  ?  105  TYR A CE2 1 
ATOM   847  C  CZ  . TYR A  1 105 ? 17.318  14.767  46.366  1.00 45.21  ?  105  TYR A CZ  1 
ATOM   848  O  OH  . TYR A  1 105 ? 17.624  15.225  47.640  1.00 47.16  ?  105  TYR A OH  1 
ATOM   849  N  N   . PRO A  1 106 ? 14.899  10.645  44.109  1.00 60.97  ?  106  PRO A N   1 
ATOM   850  C  CA  . PRO A  1 106 ? 16.101  9.890   44.482  1.00 54.82  ?  106  PRO A CA  1 
ATOM   851  C  C   . PRO A  1 106 ? 16.404  8.791   43.471  1.00 54.11  ?  106  PRO A C   1 
ATOM   852  O  O   . PRO A  1 106 ? 15.566  8.521   42.599  1.00 49.11  ?  106  PRO A O   1 
ATOM   853  C  CB  . PRO A  1 106 ? 15.704  9.251   45.814  1.00 55.71  ?  106  PRO A CB  1 
ATOM   854  C  CG  . PRO A  1 106 ? 14.229  9.140   45.749  1.00 53.95  ?  106  PRO A CG  1 
ATOM   855  C  CD  . PRO A  1 106 ? 13.771  10.362  45.014  1.00 62.71  ?  106  PRO A CD  1 
ATOM   856  N  N   . ARG A  1 107 ? 17.580  8.176   43.587  1.00 52.48  ?  107  ARG A N   1 
ATOM   857  C  CA  . ARG A  1 107 ? 18.000  7.142   42.644  1.00 54.01  ?  107  ARG A CA  1 
ATOM   858  C  C   . ARG A  1 107 ? 17.027  5.973   42.668  1.00 54.58  ?  107  ARG A C   1 
ATOM   859  O  O   . ARG A  1 107 ? 16.540  5.602   43.721  1.00 72.42  ?  107  ARG A O   1 
ATOM   860  C  CB  . ARG A  1 107 ? 19.434  6.687   42.933  1.00 52.13  ?  107  ARG A CB  1 
ATOM   861  C  CG  . ARG A  1 107 ? 20.469  7.813   42.793  1.00 54.25  ?  107  ARG A CG  1 
ATOM   862  C  CD  . ARG A  1 107 ? 21.886  7.277   42.899  1.00 59.09  ?  107  ARG A CD  1 
ATOM   863  N  NE  . ARG A  1 107 ? 22.108  6.555   44.151  1.00 56.38  ?  107  ARG A NE  1 
ATOM   864  C  CZ  . ARG A  1 107 ? 22.559  7.131   45.259  1.00 59.54  ?  107  ARG A CZ  1 
ATOM   865  N  NH1 . ARG A  1 107 ? 22.836  8.425   45.244  1.00 54.40  ?  107  ARG A NH1 1 
ATOM   866  N  NH2 . ARG A  1 107 ? 22.730  6.420   46.375  1.00 65.44  ?  107  ARG A NH2 1 
ATOM   867  N  N   . PRO A  1 108 ? 16.725  5.411   41.491  1.00 69.22  ?  108  PRO A N   1 
ATOM   868  C  CA  . PRO A  1 108 ? 15.682  4.386   41.334  1.00 73.34  ?  108  PRO A CA  1 
ATOM   869  C  C   . PRO A  1 108 ? 15.825  3.165   42.243  1.00 77.77  ?  108  PRO A C   1 
ATOM   870  O  O   . PRO A  1 108 ? 16.927  2.811   42.664  1.00 72.91  ?  108  PRO A O   1 
ATOM   871  C  CB  . PRO A  1 108 ? 15.801  3.980   39.858  1.00 64.70  ?  108  PRO A CB  1 
ATOM   872  C  CG  . PRO A  1 108 ? 17.064  4.628   39.352  1.00 58.07  ?  108  PRO A CG  1 
ATOM   873  C  CD  . PRO A  1 108 ? 17.276  5.831   40.189  1.00 60.50  ?  108  PRO A CD  1 
ATOM   874  N  N   . ALA A  1 109 ? 14.689  2.537   42.532  1.00 88.76  ?  109  ALA A N   1 
ATOM   875  C  CA  . ALA A  1 109 ? 14.619  1.411   43.460  1.00 94.73  ?  109  ALA A CA  1 
ATOM   876  C  C   . ALA A  1 109 ? 15.138  0.132   42.820  1.00 90.75  ?  109  ALA A C   1 
ATOM   877  O  O   . ALA A  1 109 ? 15.878  -0.631  43.440  1.00 90.71  ?  109  ALA A O   1 
ATOM   878  C  CB  . ALA A  1 109 ? 13.189  1.213   43.926  1.00 96.10  ?  109  ALA A CB  1 
ATOM   879  N  N   . SER A  1 110 ? 14.732  -0.095  41.577  1.00 81.20  ?  110  SER A N   1 
ATOM   880  C  CA  . SER A  1 110 ? 15.151  -1.267  40.825  1.00 76.89  ?  110  SER A CA  1 
ATOM   881  C  C   . SER A  1 110 ? 16.087  -0.850  39.685  1.00 72.18  ?  110  SER A C   1 
ATOM   882  O  O   . SER A  1 110 ? 16.132  0.326   39.320  1.00 69.83  ?  110  SER A O   1 
ATOM   883  C  CB  . SER A  1 110 ? 13.916  -2.004  40.299  1.00 81.33  ?  110  SER A CB  1 
ATOM   884  O  OG  . SER A  1 110 ? 12.883  -1.094  39.971  1.00 86.93  ?  110  SER A OG  1 
ATOM   885  N  N   . PRO A  1 111 ? 16.865  -1.805  39.144  1.00 65.54  ?  111  PRO A N   1 
ATOM   886  C  CA  . PRO A  1 111 ? 17.797  -1.550  38.026  1.00 60.79  ?  111  PRO A CA  1 
ATOM   887  C  C   . PRO A  1 111 ? 17.141  -0.946  36.762  1.00 55.78  ?  111  PRO A C   1 
ATOM   888  O  O   . PRO A  1 111 ? 16.224  -1.530  36.197  1.00 57.45  ?  111  PRO A O   1 
ATOM   889  C  CB  . PRO A  1 111 ? 18.356  -2.941  37.719  1.00 60.74  ?  111  PRO A CB  1 
ATOM   890  C  CG  . PRO A  1 111 ? 18.293  -3.659  39.058  1.00 60.90  ?  111  PRO A CG  1 
ATOM   891  C  CD  . PRO A  1 111 ? 17.039  -3.155  39.719  1.00 54.18  ?  111  PRO A CD  1 
ATOM   892  N  N   . THR A  1 112 ? 17.646  0.203   36.320  1.00 51.73  ?  112  THR A N   1 
ATOM   893  C  CA  . THR A  1 112 ? 17.003  0.995   35.281  1.00 53.47  ?  112  THR A CA  1 
ATOM   894  C  C   . THR A  1 112 ? 17.803  0.978   33.967  1.00 43.11  ?  112  THR A C   1 
ATOM   895  O  O   . THR A  1 112 ? 19.020  1.117   33.982  1.00 40.85  ?  112  THR A O   1 
ATOM   896  C  CB  . THR A  1 112 ? 16.852  2.451   35.767  1.00 57.20  ?  112  THR A CB  1 
ATOM   897  O  OG1 . THR A  1 112 ? 16.257  2.451   37.069  1.00 64.91  ?  112  THR A OG1 1 
ATOM   898  C  CG2 . THR A  1 112 ? 15.995  3.272   34.812  1.00 48.17  ?  112  THR A CG2 1 
ATOM   899  N  N   . PRO A  1 113 ? 17.121  0.801   32.832  1.00 39.83  ?  113  PRO A N   1 
ATOM   900  C  CA  . PRO A  1 113 ? 17.877  0.783   31.573  1.00 40.99  ?  113  PRO A CA  1 
ATOM   901  C  C   . PRO A  1 113 ? 18.691  2.056   31.432  1.00 44.55  ?  113  PRO A C   1 
ATOM   902  O  O   . PRO A  1 113 ? 18.234  3.139   31.827  1.00 48.19  ?  113  PRO A O   1 
ATOM   903  C  CB  . PRO A  1 113 ? 16.787  0.708   30.504  1.00 39.25  ?  113  PRO A CB  1 
ATOM   904  C  CG  . PRO A  1 113 ? 15.635  0.034   31.202  1.00 47.01  ?  113  PRO A CG  1 
ATOM   905  C  CD  . PRO A  1 113 ? 15.686  0.536   32.627  1.00 43.70  ?  113  PRO A CD  1 
ATOM   906  N  N   . VAL A  1 114 ? 19.910  1.896   30.930  1.00 36.84  ?  114  VAL A N   1 
ATOM   907  C  CA  . VAL A  1 114 ? 20.876  2.979   30.830  1.00 35.31  ?  114  VAL A CA  1 
ATOM   908  C  C   . VAL A  1 114 ? 20.993  3.462   29.384  1.00 41.66  ?  114  VAL A C   1 
ATOM   909  O  O   . VAL A  1 114 ? 20.950  2.668   28.456  1.00 41.28  ?  114  VAL A O   1 
ATOM   910  C  CB  . VAL A  1 114 ? 22.250  2.482   31.279  1.00 42.42  ?  114  VAL A CB  1 
ATOM   911  C  CG1 . VAL A  1 114 ? 23.303  3.583   31.138  1.00 39.71  ?  114  VAL A CG1 1 
ATOM   912  C  CG2 . VAL A  1 114 ? 22.175  1.946   32.717  1.00 43.75  ?  114  VAL A CG2 1 
ATOM   913  N  N   . LEU A  1 115 ? 21.128  4.769   29.202  1.00 47.59  ?  115  LEU A N   1 
ATOM   914  C  CA  . LEU A  1 115 ? 21.315  5.349   27.883  1.00 39.62  ?  115  LEU A CA  1 
ATOM   915  C  C   . LEU A  1 115 ? 22.654  6.045   27.833  1.00 42.09  ?  115  LEU A C   1 
ATOM   916  O  O   . LEU A  1 115 ? 22.935  6.896   28.673  1.00 53.91  ?  115  LEU A O   1 
ATOM   917  C  CB  . LEU A  1 115 ? 20.217  6.362   27.592  1.00 42.71  ?  115  LEU A CB  1 
ATOM   918  C  CG  . LEU A  1 115 ? 18.846  5.806   27.233  1.00 55.06  ?  115  LEU A CG  1 
ATOM   919  C  CD1 . LEU A  1 115 ? 17.819  6.901   27.352  1.00 62.70  ?  115  LEU A CD1 1 
ATOM   920  C  CD2 . LEU A  1 115 ? 18.890  5.271   25.817  1.00 60.65  ?  115  LEU A CD2 1 
ATOM   921  N  N   . ILE A  1 116 ? 23.475  5.689   26.849  1.00 38.78  ?  116  ILE A N   1 
ATOM   922  C  CA  . ILE A  1 116 ? 24.780  6.320   26.676  1.00 38.25  ?  116  ILE A CA  1 
ATOM   923  C  C   . ILE A  1 116 ? 24.869  7.174   25.412  1.00 39.06  ?  116  ILE A C   1 
ATOM   924  O  O   . ILE A  1 116 ? 24.757  6.658   24.293  1.00 32.19  ?  116  ILE A O   1 
ATOM   925  C  CB  . ILE A  1 116 ? 25.898  5.288   26.616  1.00 36.68  ?  116  ILE A CB  1 
ATOM   926  C  CG1 . ILE A  1 116 ? 25.773  4.303   27.780  1.00 33.82  ?  116  ILE A CG1 1 
ATOM   927  C  CG2 . ILE A  1 116 ? 27.244  5.993   26.603  1.00 40.55  ?  116  ILE A CG2 1 
ATOM   928  C  CD1 . ILE A  1 116 ? 27.011  3.439   27.993  1.00 34.04  ?  116  ILE A CD1 1 
ATOM   929  N  N   . TRP A  1 117 ? 25.089  8.473   25.600  1.00 34.46  ?  117  TRP A N   1 
ATOM   930  C  CA  . TRP A  1 117 ? 25.158  9.416   24.496  1.00 32.90  ?  117  TRP A CA  1 
ATOM   931  C  C   . TRP A  1 117 ? 26.571  9.592   23.968  1.00 43.19  ?  117  TRP A C   1 
ATOM   932  O  O   . TRP A  1 117 ? 27.512  9.821   24.729  1.00 45.60  ?  117  TRP A O   1 
ATOM   933  C  CB  . TRP A  1 117 ? 24.622  10.772  24.929  1.00 35.83  ?  117  TRP A CB  1 
ATOM   934  C  CG  . TRP A  1 117 ? 24.768  11.853  23.866  1.00 45.00  ?  117  TRP A CG  1 
ATOM   935  C  CD1 . TRP A  1 117 ? 25.602  12.936  23.904  1.00 43.27  ?  117  TRP A CD1 1 
ATOM   936  C  CD2 . TRP A  1 117 ? 24.046  11.951  22.629  1.00 40.17  ?  117  TRP A CD2 1 
ATOM   937  N  NE1 . TRP A  1 117 ? 25.443  13.699  22.771  1.00 47.19  ?  117  TRP A NE1 1 
ATOM   938  C  CE2 . TRP A  1 117 ? 24.492  13.116  21.975  1.00 42.50  ?  117  TRP A CE2 1 
ATOM   939  C  CE3 . TRP A  1 117 ? 23.063  11.168  22.016  1.00 39.20  ?  117  TRP A CE3 1 
ATOM   940  C  CZ2 . TRP A  1 117 ? 23.986  13.515  20.744  1.00 39.13  ?  117  TRP A CZ2 1 
ATOM   941  C  CZ3 . TRP A  1 117 ? 22.569  11.561  20.792  1.00 42.28  ?  117  TRP A CZ3 1 
ATOM   942  C  CH2 . TRP A  1 117 ? 23.030  12.724  20.167  1.00 41.75  ?  117  TRP A CH2 1 
ATOM   943  N  N   . ILE A  1 118 ? 26.728  9.499   22.657  1.00 35.63  ?  118  ILE A N   1 
ATOM   944  C  CA  . ILE A  1 118 ? 28.031  9.758   22.056  1.00 31.22  ?  118  ILE A CA  1 
ATOM   945  C  C   . ILE A  1 118 ? 27.900  10.933  21.118  1.00 29.61  ?  118  ILE A C   1 
ATOM   946  O  O   . ILE A  1 118 ? 27.264  10.802  20.075  1.00 39.45  ?  118  ILE A O   1 
ATOM   947  C  CB  . ILE A  1 118 ? 28.521  8.571   21.247  1.00 24.59  ?  118  ILE A CB  1 
ATOM   948  C  CG1 . ILE A  1 118 ? 28.565  7.307   22.107  1.00 29.23  ?  118  ILE A CG1 1 
ATOM   949  C  CG2 . ILE A  1 118 ? 29.893  8.870   20.716  1.00 31.63  ?  118  ILE A CG2 1 
ATOM   950  C  CD1 . ILE A  1 118 ? 28.804  6.037   21.294  1.00 32.05  ?  118  ILE A CD1 1 
ATOM   951  N  N   . TYR A  1 119 ? 28.471  12.084  21.472  1.00 25.06  ?  119  TYR A N   1 
ATOM   952  C  CA  . TYR A  1 119 ? 28.270  13.281  20.643  1.00 36.14  ?  119  TYR A CA  1 
ATOM   953  C  C   . TYR A  1 119 ? 28.929  13.163  19.269  1.00 39.04  ?  119  TYR A C   1 
ATOM   954  O  O   . TYR A  1 119 ? 29.911  12.445  19.097  1.00 38.16  ?  119  TYR A O   1 
ATOM   955  C  CB  . TYR A  1 119 ? 28.755  14.553  21.334  1.00 30.97  ?  119  TYR A CB  1 
ATOM   956  C  CG  . TYR A  1 119 ? 30.222  14.539  21.747  1.00 34.90  ?  119  TYR A CG  1 
ATOM   957  C  CD1 . TYR A  1 119 ? 31.242  14.777  20.818  1.00 38.37  ?  119  TYR A CD1 1 
ATOM   958  C  CD2 . TYR A  1 119 ? 30.583  14.328  23.071  1.00 28.72  ?  119  TYR A CD2 1 
ATOM   959  C  CE1 . TYR A  1 119 ? 32.580  14.782  21.199  1.00 33.61  ?  119  TYR A CE1 1 
ATOM   960  C  CE2 . TYR A  1 119 ? 31.903  14.329  23.458  1.00 36.87  ?  119  TYR A CE2 1 
ATOM   961  C  CZ  . TYR A  1 119 ? 32.900  14.551  22.530  1.00 39.15  ?  119  TYR A CZ  1 
ATOM   962  O  OH  . TYR A  1 119 ? 34.214  14.535  22.952  1.00 35.40  ?  119  TYR A OH  1 
ATOM   963  N  N   . GLY A  1 120 ? 28.364  13.870  18.301  1.00 45.69  ?  120  GLY A N   1 
ATOM   964  C  CA  . GLY A  1 120 ? 28.959  14.010  16.986  1.00 45.07  ?  120  GLY A CA  1 
ATOM   965  C  C   . GLY A  1 120 ? 29.740  15.303  16.905  1.00 45.63  ?  120  GLY A C   1 
ATOM   966  O  O   . GLY A  1 120 ? 29.989  15.947  17.929  1.00 42.24  ?  120  GLY A O   1 
ATOM   967  N  N   . GLY A  1 121 ? 30.117  15.685  15.687  1.00 51.61  ?  121  GLY A N   1 
ATOM   968  C  CA  . GLY A  1 121 ? 31.000  16.818  15.452  1.00 41.95  ?  121  GLY A CA  1 
ATOM   969  C  C   . GLY A  1 121 ? 32.196  16.399  14.606  1.00 42.06  ?  121  GLY A C   1 
ATOM   970  O  O   . GLY A  1 121 ? 33.325  16.849  14.839  1.00 39.91  ?  121  GLY A O   1 
ATOM   971  N  N   . GLY A  1 122 ? 31.949  15.511  13.643  1.00 32.96  ?  122  GLY A N   1 
ATOM   972  C  CA  . GLY A  1 122 ? 32.935  15.145  12.628  1.00 39.89  ?  122  GLY A CA  1 
ATOM   973  C  C   . GLY A  1 122 ? 34.262  14.580  13.122  1.00 42.16  ?  122  GLY A C   1 
ATOM   974  O  O   . GLY A  1 122 ? 35.273  14.661  12.417  1.00 36.97  ?  122  GLY A O   1 
ATOM   975  N  N   . PHE A  1 123 ? 34.255  14.008  14.327  1.00 38.48  ?  123  PHE A N   1 
ATOM   976  C  CA  . PHE A  1 123 ? 35.476  13.547  15.011  1.00 27.39  ?  123  PHE A CA  1 
ATOM   977  C  C   . PHE A  1 123 ? 36.536  14.630  15.252  1.00 30.00  ?  123  PHE A C   1 
ATOM   978  O  O   . PHE A  1 123 ? 37.678  14.313  15.571  1.00 39.71  ?  123  PHE A O   1 
ATOM   979  C  CB  . PHE A  1 123 ? 36.111  12.348  14.296  1.00 26.06  ?  123  PHE A CB  1 
ATOM   980  C  CG  . PHE A  1 123 ? 35.187  11.168  14.132  1.00 34.63  ?  123  PHE A CG  1 
ATOM   981  C  CD1 . PHE A  1 123 ? 35.018  10.250  15.163  1.00 32.80  ?  123  PHE A CD1 1 
ATOM   982  C  CD2 . PHE A  1 123 ? 34.500  10.965  12.940  1.00 37.43  ?  123  PHE A CD2 1 
ATOM   983  C  CE1 . PHE A  1 123 ? 34.176  9.158   15.015  1.00 37.53  ?  123  PHE A CE1 1 
ATOM   984  C  CE2 . PHE A  1 123 ? 33.651  9.870   12.782  1.00 37.86  ?  123  PHE A CE2 1 
ATOM   985  C  CZ  . PHE A  1 123 ? 33.493  8.965   13.814  1.00 44.44  ?  123  PHE A CZ  1 
ATOM   986  N  N   . TYR A  1 124 ? 36.168  15.902  15.116  1.00 35.76  ?  124  TYR A N   1 
ATOM   987  C  CA  . TYR A  1 124 ? 37.113  16.993  15.369  1.00 38.35  ?  124  TYR A CA  1 
ATOM   988  C  C   . TYR A  1 124 ? 36.576  17.978  16.406  1.00 40.80  ?  124  TYR A C   1 
ATOM   989  O  O   . TYR A  1 124 ? 37.241  18.946  16.771  1.00 46.54  ?  124  TYR A O   1 
ATOM   990  C  CB  . TYR A  1 124 ? 37.411  17.744  14.065  1.00 43.95  ?  124  TYR A CB  1 
ATOM   991  C  CG  . TYR A  1 124 ? 36.327  18.717  13.668  1.00 39.21  ?  124  TYR A CG  1 
ATOM   992  C  CD1 . TYR A  1 124 ? 35.247  18.306  12.896  1.00 36.57  ?  124  TYR A CD1 1 
ATOM   993  C  CD2 . TYR A  1 124 ? 36.383  20.052  14.070  1.00 30.31  ?  124  TYR A CD2 1 
ATOM   994  C  CE1 . TYR A  1 124 ? 34.245  19.195  12.547  1.00 37.95  ?  124  TYR A CE1 1 
ATOM   995  C  CE2 . TYR A  1 124 ? 35.394  20.945  13.725  1.00 31.08  ?  124  TYR A CE2 1 
ATOM   996  C  CZ  . TYR A  1 124 ? 34.330  20.515  12.959  1.00 39.47  ?  124  TYR A CZ  1 
ATOM   997  O  OH  . TYR A  1 124 ? 33.355  21.415  12.610  1.00 45.76  ?  124  TYR A OH  1 
ATOM   998  N  N   . SER A  1 125 ? 35.357  17.747  16.861  1.00 43.94  ?  125  SER A N   1 
ATOM   999  C  CA  . SER A  1 125 ? 34.712  18.664  17.786  1.00 43.55  ?  125  SER A CA  1 
ATOM   1000 C  C   . SER A  1 125 ? 33.600  17.945  18.544  1.00 37.00  ?  125  SER A C   1 
ATOM   1001 O  O   . SER A  1 125 ? 33.289  16.780  18.261  1.00 27.07  ?  125  SER A O   1 
ATOM   1002 C  CB  . SER A  1 125 ? 34.135  19.861  17.023  1.00 44.04  ?  125  SER A CB  1 
ATOM   1003 O  OG  . SER A  1 125 ? 33.112  19.443  16.125  1.00 45.97  ?  125  SER A OG  1 
ATOM   1004 N  N   . GLY A  1 126 ? 32.990  18.652  19.488  1.00 35.35  ?  126  GLY A N   1 
ATOM   1005 C  CA  . GLY A  1 126 ? 31.922  18.084  20.289  1.00 38.37  ?  126  GLY A CA  1 
ATOM   1006 C  C   . GLY A  1 126 ? 32.273  18.075  21.761  1.00 43.95  ?  126  GLY A C   1 
ATOM   1007 O  O   . GLY A  1 126 ? 33.435  18.257  22.129  1.00 44.85  ?  126  GLY A O   1 
ATOM   1008 N  N   . ALA A  1 127 ? 31.264  17.845  22.596  1.00 43.37  ?  127  ALA A N   1 
ATOM   1009 C  CA  . ALA A  1 127 ? 31.404  17.865  24.052  1.00 39.12  ?  127  ALA A CA  1 
ATOM   1010 C  C   . ALA A  1 127 ? 30.133  17.305  24.675  1.00 43.18  ?  127  ALA A C   1 
ATOM   1011 O  O   . ALA A  1 127 ? 29.038  17.546  24.168  1.00 38.06  ?  127  ALA A O   1 
ATOM   1012 C  CB  . ALA A  1 127 ? 31.629  19.296  24.547  1.00 34.42  ?  127  ALA A CB  1 
ATOM   1013 N  N   . ALA A  1 128 ? 30.260  16.581  25.785  1.00 43.59  ?  128  ALA A N   1 
ATOM   1014 C  CA  . ALA A  1 128 ? 29.078  16.024  26.434  1.00 42.49  ?  128  ALA A CA  1 
ATOM   1015 C  C   . ALA A  1 128 ? 28.357  17.069  27.288  1.00 39.73  ?  128  ALA A C   1 
ATOM   1016 O  O   . ALA A  1 128 ? 27.311  16.789  27.871  1.00 42.55  ?  128  ALA A O   1 
ATOM   1017 C  CB  . ALA A  1 128 ? 29.443  14.801  27.264  1.00 43.69  ?  128  ALA A CB  1 
ATOM   1018 N  N   . SER A  1 129 ? 28.912  18.278  27.335  1.00 33.78  ?  129  SER A N   1 
ATOM   1019 C  CA  . SER A  1 129 ? 28.432  19.322  28.238  1.00 33.04  ?  129  SER A CA  1 
ATOM   1020 C  C   . SER A  1 129 ? 27.569  20.375  27.565  1.00 40.61  ?  129  SER A C   1 
ATOM   1021 O  O   . SER A  1 129 ? 27.138  21.329  28.216  1.00 44.58  ?  129  SER A O   1 
ATOM   1022 C  CB  . SER A  1 129 ? 29.616  20.018  28.912  1.00 39.65  ?  129  SER A CB  1 
ATOM   1023 O  OG  . SER A  1 129 ? 30.542  20.489  27.948  1.00 39.09  ?  129  SER A OG  1 
ATOM   1024 N  N   . LEU A  1 130 ? 27.327  20.212  26.265  1.00 44.84  ?  130  LEU A N   1 
ATOM   1025 C  CA  . LEU A  1 130 ? 26.465  21.127  25.527  1.00 39.26  ?  130  LEU A CA  1 
ATOM   1026 C  C   . LEU A  1 130 ? 25.052  21.094  26.084  1.00 39.65  ?  130  LEU A C   1 
ATOM   1027 O  O   . LEU A  1 130 ? 24.557  20.044  26.495  1.00 41.74  ?  130  LEU A O   1 
ATOM   1028 C  CB  . LEU A  1 130 ? 26.441  20.783  24.038  1.00 43.06  ?  130  LEU A CB  1 
ATOM   1029 C  CG  . LEU A  1 130 ? 27.790  20.704  23.327  1.00 44.05  ?  130  LEU A CG  1 
ATOM   1030 C  CD1 . LEU A  1 130 ? 27.572  20.473  21.848  1.00 50.21  ?  130  LEU A CD1 1 
ATOM   1031 C  CD2 . LEU A  1 130 ? 28.583  21.970  23.560  1.00 33.30  ?  130  LEU A CD2 1 
ATOM   1032 N  N   . ASP A  1 131 ? 24.411  22.256  26.087  1.00 37.64  ?  131  ASP A N   1 
ATOM   1033 C  CA  . ASP A  1 131 ? 23.045  22.396  26.565  1.00 42.13  ?  131  ASP A CA  1 
ATOM   1034 C  C   . ASP A  1 131 ? 22.097  21.384  25.964  1.00 48.35  ?  131  ASP A C   1 
ATOM   1035 O  O   . ASP A  1 131 ? 21.246  20.831  26.663  1.00 58.75  ?  131  ASP A O   1 
ATOM   1036 C  CB  . ASP A  1 131 ? 22.540  23.807  26.276  1.00 42.07  ?  131  ASP A CB  1 
ATOM   1037 C  CG  . ASP A  1 131 ? 23.046  24.808  27.290  1.00 55.80  ?  131  ASP A CG  1 
ATOM   1038 O  OD1 . ASP A  1 131 ? 23.902  24.417  28.107  1.00 61.33  ?  131  ASP A OD1 1 
ATOM   1039 O  OD2 . ASP A  1 131 ? 22.592  25.969  27.282  1.00 65.42  ?  131  ASP A OD2 1 
ATOM   1040 N  N   . VAL A  1 132 ? 22.275  21.128  24.673  1.00 40.21  ?  132  VAL A N   1 
ATOM   1041 C  CA  . VAL A  1 132 ? 21.338  20.338  23.888  1.00 38.06  ?  132  VAL A CA  1 
ATOM   1042 C  C   . VAL A  1 132 ? 21.491  18.840  24.192  1.00 40.72  ?  132  VAL A C   1 
ATOM   1043 O  O   . VAL A  1 132 ? 20.697  18.010  23.731  1.00 41.42  ?  132  VAL A O   1 
ATOM   1044 C  CB  . VAL A  1 132 ? 21.510  20.658  22.363  1.00 40.30  ?  132  VAL A CB  1 
ATOM   1045 C  CG1 . VAL A  1 132 ? 22.814  20.071  21.810  1.00 28.19  ?  132  VAL A CG1 1 
ATOM   1046 C  CG2 . VAL A  1 132 ? 20.329  20.179  21.570  1.00 50.22  ?  132  VAL A CG2 1 
ATOM   1047 N  N   . TYR A  1 133 ? 22.502  18.505  24.993  1.00 34.44  ?  133  TYR A N   1 
ATOM   1048 C  CA  . TYR A  1 133 ? 22.722  17.126  25.424  1.00 39.44  ?  133  TYR A CA  1 
ATOM   1049 C  C   . TYR A  1 133 ? 22.345  16.917  26.907  1.00 47.22  ?  133  TYR A C   1 
ATOM   1050 O  O   . TYR A  1 133 ? 22.739  15.921  27.510  1.00 41.13  ?  133  TYR A O   1 
ATOM   1051 C  CB  . TYR A  1 133 ? 24.191  16.707  25.206  1.00 40.08  ?  133  TYR A CB  1 
ATOM   1052 C  CG  . TYR A  1 133 ? 24.711  16.821  23.776  1.00 42.32  ?  133  TYR A CG  1 
ATOM   1053 C  CD1 . TYR A  1 133 ? 23.851  16.736  22.683  1.00 40.20  ?  133  TYR A CD1 1 
ATOM   1054 C  CD2 . TYR A  1 133 ? 26.062  17.024  23.525  1.00 35.51  ?  133  TYR A CD2 1 
ATOM   1055 C  CE1 . TYR A  1 133 ? 24.318  16.848  21.395  1.00 31.59  ?  133  TYR A CE1 1 
ATOM   1056 C  CE2 . TYR A  1 133 ? 26.543  17.135  22.244  1.00 36.72  ?  133  TYR A CE2 1 
ATOM   1057 C  CZ  . TYR A  1 133 ? 25.669  17.045  21.174  1.00 41.53  ?  133  TYR A CZ  1 
ATOM   1058 O  OH  . TYR A  1 133 ? 26.147  17.155  19.880  1.00 32.96  ?  133  TYR A OH  1 
ATOM   1059 N  N   . ASP A  1 134 ? 21.593  17.857  27.482  1.00 49.13  ?  134  ASP A N   1 
ATOM   1060 C  CA  . ASP A  1 134 ? 21.183  17.828  28.904  1.00 44.45  ?  134  ASP A CA  1 
ATOM   1061 C  C   . ASP A  1 134 ? 20.285  16.633  29.245  1.00 42.80  ?  134  ASP A C   1 
ATOM   1062 O  O   . ASP A  1 134 ? 19.115  16.596  28.873  1.00 44.25  ?  134  ASP A O   1 
ATOM   1063 C  CB  . ASP A  1 134 ? 20.441  19.129  29.249  1.00 36.25  ?  134  ASP A CB  1 
ATOM   1064 C  CG  . ASP A  1 134 ? 20.356  19.392  30.734  1.00 52.47  ?  134  ASP A CG  1 
ATOM   1065 O  OD1 . ASP A  1 134 ? 20.240  18.433  31.526  1.00 56.08  ?  134  ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A  1 134 ? 20.384  20.582  31.111  1.00 59.38  ?  134  ASP A OD2 1 
ATOM   1067 N  N   . GLY A  1 135 ? 20.820  15.671  29.984  1.00 43.50  ?  135  GLY A N   1 
ATOM   1068 C  CA  . GLY A  1 135 ? 20.071  14.467  30.278  1.00 38.37  ?  135  GLY A CA  1 
ATOM   1069 C  C   . GLY A  1 135 ? 19.058  14.602  31.407  1.00 40.34  ?  135  GLY A C   1 
ATOM   1070 O  O   . GLY A  1 135 ? 18.489  13.600  31.834  1.00 33.76  ?  135  GLY A O   1 
ATOM   1071 N  N   . ARG A  1 136 ? 18.806  15.820  31.884  1.00 38.81  ?  136  ARG A N   1 
ATOM   1072 C  CA  . ARG A  1 136 ? 17.966  15.972  33.073  1.00 42.00  ?  136  ARG A CA  1 
ATOM   1073 C  C   . ARG A  1 136 ? 16.507  15.678  32.746  1.00 51.15  ?  136  ARG A C   1 
ATOM   1074 O  O   . ARG A  1 136 ? 15.750  15.221  33.610  1.00 54.52  ?  136  ARG A O   1 
ATOM   1075 C  CB  . ARG A  1 136 ? 18.108  17.362  33.711  1.00 39.50  ?  136  ARG A CB  1 
ATOM   1076 C  CG  . ARG A  1 136 ? 17.302  18.451  33.016  1.00 46.36  ?  136  ARG A CG  1 
ATOM   1077 C  CD  . ARG A  1 136 ? 17.496  19.803  33.673  1.00 45.49  ?  136  ARG A CD  1 
ATOM   1078 N  NE  . ARG A  1 136 ? 18.885  20.226  33.607  1.00 47.76  ?  136  ARG A NE  1 
ATOM   1079 C  CZ  . ARG A  1 136 ? 19.407  21.186  34.364  1.00 54.71  ?  136  ARG A CZ  1 
ATOM   1080 N  NH1 . ARG A  1 136 ? 18.651  21.822  35.254  1.00 53.15  ?  136  ARG A NH1 1 
ATOM   1081 N  NH2 . ARG A  1 136 ? 20.691  21.505  34.243  1.00 54.54  ?  136  ARG A NH2 1 
ATOM   1082 N  N   . PHE A  1 137 ? 16.116  15.930  31.499  1.00 50.84  ?  137  PHE A N   1 
ATOM   1083 C  CA  . PHE A  1 137 ? 14.729  15.754  31.099  1.00 43.83  ?  137  PHE A CA  1 
ATOM   1084 C  C   . PHE A  1 137 ? 14.403  14.282  30.901  1.00 42.34  ?  137  PHE A C   1 
ATOM   1085 O  O   . PHE A  1 137 ? 13.342  13.818  31.319  1.00 47.76  ?  137  PHE A O   1 
ATOM   1086 C  CB  . PHE A  1 137 ? 14.413  16.555  29.844  1.00 43.56  ?  137  PHE A CB  1 
ATOM   1087 C  CG  . PHE A  1 137 ? 14.719  18.017  29.970  1.00 50.22  ?  137  PHE A CG  1 
ATOM   1088 C  CD1 . PHE A  1 137 ? 13.853  18.865  30.650  1.00 48.32  ?  137  PHE A CD1 1 
ATOM   1089 C  CD2 . PHE A  1 137 ? 15.875  18.549  29.411  1.00 45.38  ?  137  PHE A CD2 1 
ATOM   1090 C  CE1 . PHE A  1 137 ? 14.128  20.225  30.769  1.00 45.45  ?  137  PHE A CE1 1 
ATOM   1091 C  CE2 . PHE A  1 137 ? 16.159  19.905  29.534  1.00 42.45  ?  137  PHE A CE2 1 
ATOM   1092 C  CZ  . PHE A  1 137 ? 15.279  20.744  30.212  1.00 44.72  ?  137  PHE A CZ  1 
ATOM   1093 N  N   . LEU A  1 138 ? 15.315  13.546  30.280  1.00 37.39  ?  138  LEU A N   1 
ATOM   1094 C  CA  . LEU A  1 138 ? 15.126  12.109  30.111  1.00 45.07  ?  138  LEU A CA  1 
ATOM   1095 C  C   . LEU A  1 138 ? 15.085  11.412  31.463  1.00 46.52  ?  138  LEU A C   1 
ATOM   1096 O  O   . LEU A  1 138 ? 14.285  10.502  31.683  1.00 53.19  ?  138  LEU A O   1 
ATOM   1097 C  CB  . LEU A  1 138 ? 16.227  11.512  29.232  1.00 42.62  ?  138  LEU A CB  1 
ATOM   1098 C  CG  . LEU A  1 138 ? 16.056  11.755  27.727  1.00 44.64  ?  138  LEU A CG  1 
ATOM   1099 C  CD1 . LEU A  1 138 ? 17.336  11.430  26.979  1.00 45.05  ?  138  LEU A CD1 1 
ATOM   1100 C  CD2 . LEU A  1 138 ? 14.894  10.935  27.179  1.00 42.41  ?  138  LEU A CD2 1 
ATOM   1101 N  N   . ALA A  1 139 ? 15.938  11.866  32.373  1.00 42.89  ?  139  ALA A N   1 
ATOM   1102 C  CA  . ALA A  1 139 ? 16.049  11.262  33.688  1.00 46.63  ?  139  ALA A CA  1 
ATOM   1103 C  C   . ALA A  1 139 ? 14.787  11.512  34.510  1.00 52.70  ?  139  ALA A C   1 
ATOM   1104 O  O   . ALA A  1 139 ? 14.227  10.586  35.085  1.00 52.38  ?  139  ALA A O   1 
ATOM   1105 C  CB  . ALA A  1 139 ? 17.282  11.793  34.412  1.00 46.03  ?  139  ALA A CB  1 
ATOM   1106 N  N   . GLN A  1 140 ? 14.334  12.762  34.549  1.00 55.62  ?  140  GLN A N   1 
ATOM   1107 C  CA  . GLN A  1 140 ? 13.153  13.111  35.326  1.00 61.99  ?  140  GLN A CA  1 
ATOM   1108 C  C   . GLN A  1 140 ? 11.899  12.505  34.725  1.00 67.11  ?  140  GLN A C   1 
ATOM   1109 O  O   . GLN A  1 140 ? 11.105  11.870  35.429  1.00 69.46  ?  140  GLN A O   1 
ATOM   1110 C  CB  . GLN A  1 140 ? 12.979  14.629  35.415  1.00 63.95  ?  140  GLN A CB  1 
ATOM   1111 C  CG  . GLN A  1 140 ? 12.183  15.094  36.641  1.00 63.64  ?  140  GLN A CG  1 
ATOM   1112 C  CD  . GLN A  1 140 ? 10.671  14.884  36.514  1.00 64.63  ?  140  GLN A CD  1 
ATOM   1113 O  OE1 . GLN A  1 140 ? 10.094  15.023  35.426  1.00 54.57  ?  140  GLN A OE1 1 
ATOM   1114 N  NE2 . GLN A  1 140 ? 10.021  14.553  37.639  1.00 62.05  ?  140  GLN A NE2 1 
ATOM   1115 N  N   . VAL A  1 141 ? 11.713  12.710  33.425  1.00 58.57  ?  141  VAL A N   1 
ATOM   1116 C  CA  . VAL A  1 141 ? 10.448  12.358  32.801  1.00 59.05  ?  141  VAL A CA  1 
ATOM   1117 C  C   . VAL A  1 141 ? 10.328  10.865  32.495  1.00 53.31  ?  141  VAL A C   1 
ATOM   1118 O  O   . VAL A  1 141 ? 9.267   10.265  32.713  1.00 49.34  ?  141  VAL A O   1 
ATOM   1119 C  CB  . VAL A  1 141 ? 10.162  13.226  31.557  1.00 61.16  ?  141  VAL A CB  1 
ATOM   1120 C  CG1 . VAL A  1 141 ? 8.820   12.859  30.949  1.00 54.65  ?  141  VAL A CG1 1 
ATOM   1121 C  CG2 . VAL A  1 141 ? 10.163  14.695  31.949  1.00 63.27  ?  141  VAL A CG2 1 
ATOM   1122 N  N   . GLU A  1 142 ? 11.407  10.251  32.026  1.00 42.99  ?  142  GLU A N   1 
ATOM   1123 C  CA  . GLU A  1 142 ? 11.340  8.829   31.702  1.00 49.19  ?  142  GLU A CA  1 
ATOM   1124 C  C   . GLU A  1 142 ? 11.949  7.902   32.762  1.00 54.98  ?  142  GLU A C   1 
ATOM   1125 O  O   . GLU A  1 142 ? 11.817  6.679   32.676  1.00 50.80  ?  142  GLU A O   1 
ATOM   1126 C  CB  . GLU A  1 142 ? 11.942  8.554   30.321  1.00 45.99  ?  142  GLU A CB  1 
ATOM   1127 C  CG  . GLU A  1 142 ? 11.093  9.083   29.161  1.00 50.42  ?  142  GLU A CG  1 
ATOM   1128 C  CD  . GLU A  1 142 ? 9.711   8.455   29.123  1.00 68.40  ?  142  GLU A CD  1 
ATOM   1129 O  OE1 . GLU A  1 142 ? 9.543   7.348   29.678  1.00 73.28  ?  142  GLU A OE1 1 
ATOM   1130 O  OE2 . GLU A  1 142 ? 8.787   9.063   28.540  1.00 78.34  ?  142  GLU A OE2 1 
ATOM   1131 N  N   . GLY A  1 143 ? 12.610  8.484   33.758  1.00 51.42  ?  143  GLY A N   1 
ATOM   1132 C  CA  . GLY A  1 143 ? 13.235  7.698   34.804  1.00 51.04  ?  143  GLY A CA  1 
ATOM   1133 C  C   . GLY A  1 143 ? 14.536  7.089   34.334  1.00 52.54  ?  143  GLY A C   1 
ATOM   1134 O  O   . GLY A  1 143 ? 15.089  6.202   34.973  1.00 57.24  ?  143  GLY A O   1 
ATOM   1135 N  N   . ALA A  1 144 ? 15.036  7.579   33.209  1.00 49.30  ?  144  ALA A N   1 
ATOM   1136 C  CA  . ALA A  1 144 ? 16.209  6.982   32.576  1.00 50.18  ?  144  ALA A CA  1 
ATOM   1137 C  C   . ALA A  1 144 ? 17.505  7.298   33.323  1.00 47.97  ?  144  ALA A C   1 
ATOM   1138 O  O   . ALA A  1 144 ? 17.621  8.336   33.970  1.00 45.59  ?  144  ALA A O   1 
ATOM   1139 C  CB  . ALA A  1 144 ? 16.313  7.450   31.126  1.00 44.22  ?  144  ALA A CB  1 
ATOM   1140 N  N   . VAL A  1 145 ? 18.477  6.398   33.232  1.00 41.41  ?  145  VAL A N   1 
ATOM   1141 C  CA  . VAL A  1 145 ? 19.835  6.728   33.632  1.00 35.40  ?  145  VAL A CA  1 
ATOM   1142 C  C   . VAL A  1 145 ? 20.622  7.054   32.362  1.00 45.05  ?  145  VAL A C   1 
ATOM   1143 O  O   . VAL A  1 145 ? 20.725  6.228   31.455  1.00 48.84  ?  145  VAL A O   1 
ATOM   1144 C  CB  . VAL A  1 145 ? 20.519  5.589   34.441  1.00 43.52  ?  145  VAL A CB  1 
ATOM   1145 C  CG1 . VAL A  1 145 ? 21.957  5.953   34.753  1.00 44.56  ?  145  VAL A CG1 1 
ATOM   1146 C  CG2 . VAL A  1 145 ? 19.755  5.298   35.747  1.00 39.20  ?  145  VAL A CG2 1 
ATOM   1147 N  N   . LEU A  1 146 ? 21.159  8.269   32.303  1.00 48.07  ?  146  LEU A N   1 
ATOM   1148 C  CA  . LEU A  1 146 ? 21.796  8.804   31.104  1.00 48.70  ?  146  LEU A CA  1 
ATOM   1149 C  C   . LEU A  1 146 ? 23.275  9.075   31.390  1.00 52.38  ?  146  LEU A C   1 
ATOM   1150 O  O   . LEU A  1 146 ? 23.611  9.753   32.365  1.00 53.43  ?  146  LEU A O   1 
ATOM   1151 C  CB  . LEU A  1 146 ? 21.086  10.101  30.695  1.00 47.01  ?  146  LEU A CB  1 
ATOM   1152 C  CG  . LEU A  1 146 ? 21.157  10.710  29.287  1.00 47.50  ?  146  LEU A CG  1 
ATOM   1153 C  CD1 . LEU A  1 146 ? 22.580  10.941  28.797  1.00 40.04  ?  146  LEU A CD1 1 
ATOM   1154 C  CD2 . LEU A  1 146 ? 20.370  9.881   28.278  1.00 56.40  ?  146  LEU A CD2 1 
ATOM   1155 N  N   . VAL A  1 147 ? 24.148  8.545   30.534  1.00 43.02  ?  147  VAL A N   1 
ATOM   1156 C  CA  . VAL A  1 147 ? 25.588  8.722   30.672  1.00 36.20  ?  147  VAL A CA  1 
ATOM   1157 C  C   . VAL A  1 147 ? 26.137  9.300   29.381  1.00 47.12  ?  147  VAL A C   1 
ATOM   1158 O  O   . VAL A  1 147 ? 25.913  8.751   28.302  1.00 45.12  ?  147  VAL A O   1 
ATOM   1159 C  CB  . VAL A  1 147 ? 26.311  7.367   30.883  1.00 42.80  ?  147  VAL A CB  1 
ATOM   1160 C  CG1 . VAL A  1 147 ? 27.822  7.563   30.995  1.00 36.14  ?  147  VAL A CG1 1 
ATOM   1161 C  CG2 . VAL A  1 147 ? 25.772  6.636   32.095  1.00 44.18  ?  147  VAL A CG2 1 
ATOM   1162 N  N   . SER A  1 148 ? 26.868  10.399  29.481  1.00 42.85  ?  148  SER A N   1 
ATOM   1163 C  CA  . SER A  1 148 ? 27.538  10.939  28.309  1.00 30.60  ?  148  SER A CA  1 
ATOM   1164 C  C   . SER A  1 148 ? 29.002  11.126  28.637  1.00 39.46  ?  148  SER A C   1 
ATOM   1165 O  O   . SER A  1 148 ? 29.354  11.516  29.763  1.00 39.34  ?  148  SER A O   1 
ATOM   1166 C  CB  . SER A  1 148 ? 26.927  12.273  27.908  1.00 36.01  ?  148  SER A CB  1 
ATOM   1167 O  OG  . SER A  1 148 ? 27.216  13.272  28.870  1.00 33.72  ?  148  SER A OG  1 
ATOM   1168 N  N   . MET A  1 149 ? 29.861  10.840  27.665  1.00 31.58  ?  149  MET A N   1 
ATOM   1169 C  CA  . MET A  1 149 ? 31.295  10.938  27.896  1.00 35.27  ?  149  MET A CA  1 
ATOM   1170 C  C   . MET A  1 149 ? 31.964  11.890  26.915  1.00 39.44  ?  149  MET A C   1 
ATOM   1171 O  O   . MET A  1 149 ? 31.480  12.083  25.790  1.00 37.72  ?  149  MET A O   1 
ATOM   1172 C  CB  . MET A  1 149 ? 31.949  9.552   27.826  1.00 34.25  ?  149  MET A CB  1 
ATOM   1173 C  CG  . MET A  1 149 ? 32.450  9.130   26.443  1.00 35.86  ?  149  MET A CG  1 
ATOM   1174 S  SD  . MET A  1 149 ? 31.126  8.791   25.274  1.00 45.05  ?  149  MET A SD  1 
ATOM   1175 C  CE  . MET A  1 149 ? 30.679  7.103   25.705  1.00 23.80  ?  149  MET A CE  1 
ATOM   1176 N  N   . ASN A  1 150 ? 33.060  12.498  27.361  1.00 32.90  ?  150  ASN A N   1 
ATOM   1177 C  CA  . ASN A  1 150 ? 33.989  13.162  26.456  1.00 37.21  ?  150  ASN A CA  1 
ATOM   1178 C  C   . ASN A  1 150 ? 34.918  12.109  25.883  1.00 42.43  ?  150  ASN A C   1 
ATOM   1179 O  O   . ASN A  1 150 ? 35.281  11.152  26.569  1.00 38.82  ?  150  ASN A O   1 
ATOM   1180 C  CB  . ASN A  1 150 ? 34.825  14.226  27.171  1.00 31.80  ?  150  ASN A CB  1 
ATOM   1181 C  CG  . ASN A  1 150 ? 34.062  15.518  27.416  1.00 36.10  ?  150  ASN A CG  1 
ATOM   1182 O  OD1 . ASN A  1 150 ? 32.878  15.623  27.106  1.00 31.49  ?  150  ASN A OD1 1 
ATOM   1183 N  ND2 . ASN A  1 150 ? 34.745  16.510  27.983  1.00 35.12  ?  150  ASN A ND2 1 
ATOM   1184 N  N   . TYR A  1 151 ? 35.280  12.270  24.615  1.00 44.21  ?  151  TYR A N   1 
ATOM   1185 C  CA  . TYR A  1 151 ? 36.314  11.442  24.019  1.00 40.89  ?  151  TYR A CA  1 
ATOM   1186 C  C   . TYR A  1 151 ? 37.198  12.344  23.179  1.00 38.81  ?  151  TYR A C   1 
ATOM   1187 O  O   . TYR A  1 151 ? 36.763  13.415  22.739  1.00 37.53  ?  151  TYR A O   1 
ATOM   1188 C  CB  . TYR A  1 151 ? 35.707  10.296  23.202  1.00 37.59  ?  151  TYR A CB  1 
ATOM   1189 C  CG  . TYR A  1 151 ? 34.845  10.744  22.057  1.00 44.79  ?  151  TYR A CG  1 
ATOM   1190 C  CD1 . TYR A  1 151 ? 33.509  11.069  22.246  1.00 39.77  ?  151  TYR A CD1 1 
ATOM   1191 C  CD2 . TYR A  1 151 ? 35.372  10.848  20.773  1.00 46.58  ?  151  TYR A CD2 1 
ATOM   1192 C  CE1 . TYR A  1 151 ? 32.724  11.479  21.189  1.00 34.81  ?  151  TYR A CE1 1 
ATOM   1193 C  CE2 . TYR A  1 151 ? 34.601  11.260  19.719  1.00 30.37  ?  151  TYR A CE2 1 
ATOM   1194 C  CZ  . TYR A  1 151 ? 33.282  11.576  19.920  1.00 35.23  ?  151  TYR A CZ  1 
ATOM   1195 O  OH  . TYR A  1 151 ? 32.531  11.986  18.833  1.00 33.47  ?  151  TYR A OH  1 
ATOM   1196 N  N   . ARG A  1 152 ? 38.447  11.944  22.989  1.00 38.04  ?  152  ARG A N   1 
ATOM   1197 C  CA  . ARG A  1 152 ? 39.386  12.783  22.253  1.00 39.26  ?  152  ARG A CA  1 
ATOM   1198 C  C   . ARG A  1 152 ? 38.985  12.922  20.781  1.00 41.44  ?  152  ARG A C   1 
ATOM   1199 O  O   . ARG A  1 152 ? 38.589  11.947  20.129  1.00 34.20  ?  152  ARG A O   1 
ATOM   1200 C  CB  . ARG A  1 152 ? 40.814  12.258  22.383  1.00 39.80  ?  152  ARG A CB  1 
ATOM   1201 C  CG  . ARG A  1 152 ? 41.541  12.738  23.636  1.00 45.71  ?  152  ARG A CG  1 
ATOM   1202 C  CD  . ARG A  1 152 ? 42.883  12.004  23.812  1.00 42.03  ?  152  ARG A CD  1 
ATOM   1203 N  NE  . ARG A  1 152 ? 42.639  10.580  23.999  1.00 35.49  ?  152  ARG A NE  1 
ATOM   1204 C  CZ  . ARG A  1 152 ? 43.585  9.653   24.048  1.00 36.95  ?  152  ARG A CZ  1 
ATOM   1205 N  NH1 . ARG A  1 152 ? 44.859  9.993   23.918  1.00 36.31  ?  152  ARG A NH1 1 
ATOM   1206 N  NH2 . ARG A  1 152 ? 43.247  8.380   24.221  1.00 38.16  ?  152  ARG A NH2 1 
ATOM   1207 N  N   . VAL A  1 153 ? 39.055  14.155  20.285  1.00 39.07  ?  153  VAL A N   1 
ATOM   1208 C  CA  . VAL A  1 153 ? 38.756  14.441  18.897  1.00 43.57  ?  153  VAL A CA  1 
ATOM   1209 C  C   . VAL A  1 153 ? 39.981  14.996  18.180  1.00 50.04  ?  153  VAL A C   1 
ATOM   1210 O  O   . VAL A  1 153 ? 40.971  15.373  18.813  1.00 55.95  ?  153  VAL A O   1 
ATOM   1211 C  CB  . VAL A  1 153 ? 37.617  15.444  18.759  1.00 35.98  ?  153  VAL A CB  1 
ATOM   1212 C  CG1 . VAL A  1 153 ? 36.340  14.841  19.276  1.00 32.03  ?  153  VAL A CG1 1 
ATOM   1213 C  CG2 . VAL A  1 153 ? 37.966  16.774  19.460  1.00 23.81  ?  153  VAL A CG2 1 
ATOM   1214 N  N   . GLY A  1 154 ? 39.904  15.034  16.854  1.00 42.96  ?  154  GLY A N   1 
ATOM   1215 C  CA  . GLY A  1 154 ? 40.953  15.625  16.053  1.00 40.55  ?  154  GLY A CA  1 
ATOM   1216 C  C   . GLY A  1 154 ? 42.228  14.807  16.025  1.00 39.03  ?  154  GLY A C   1 
ATOM   1217 O  O   . GLY A  1 154 ? 42.205  13.570  16.030  1.00 42.44  ?  154  GLY A O   1 
ATOM   1218 N  N   . THR A  1 155 ? 43.351  15.509  15.976  1.00 30.57  ?  155  THR A N   1 
ATOM   1219 C  CA  . THR A  1 155 ? 44.645  14.857  15.984  1.00 41.90  ?  155  THR A CA  1 
ATOM   1220 C  C   . THR A  1 155 ? 44.800  13.996  17.247  1.00 49.54  ?  155  THR A C   1 
ATOM   1221 O  O   . THR A  1 155 ? 45.196  12.827  17.168  1.00 51.73  ?  155  THR A O   1 
ATOM   1222 C  CB  . THR A  1 155 ? 45.780  15.892  15.907  1.00 40.56  ?  155  THR A CB  1 
ATOM   1223 O  OG1 . THR A  1 155 ? 45.591  16.874  16.932  1.00 47.03  ?  155  THR A OG1 1 
ATOM   1224 C  CG2 . THR A  1 155 ? 45.760  16.590  14.579  1.00 40.20  ?  155  THR A CG2 1 
ATOM   1225 N  N   . PHE A  1 156 ? 44.463  14.575  18.401  1.00 46.53  ?  156  PHE A N   1 
ATOM   1226 C  CA  . PHE A  1 156 ? 44.633  13.910  19.702  1.00 40.65  ?  156  PHE A CA  1 
ATOM   1227 C  C   . PHE A  1 156 ? 43.823  12.627  19.777  1.00 38.04  ?  156  PHE A C   1 
ATOM   1228 O  O   . PHE A  1 156 ? 44.235  11.662  20.398  1.00 40.27  ?  156  PHE A O   1 
ATOM   1229 C  CB  . PHE A  1 156 ? 44.219  14.850  20.827  1.00 33.29  ?  156  PHE A CB  1 
ATOM   1230 C  CG  . PHE A  1 156 ? 44.658  16.267  20.610  1.00 37.37  ?  156  PHE A CG  1 
ATOM   1231 C  CD1 . PHE A  1 156 ? 45.901  16.685  21.024  1.00 32.43  ?  156  PHE A CD1 1 
ATOM   1232 C  CD2 . PHE A  1 156 ? 43.829  17.172  19.952  1.00 35.20  ?  156  PHE A CD2 1 
ATOM   1233 C  CE1 . PHE A  1 156 ? 46.313  17.981  20.816  1.00 44.83  ?  156  PHE A CE1 1 
ATOM   1234 C  CE2 . PHE A  1 156 ? 44.234  18.467  19.741  1.00 31.80  ?  156  PHE A CE2 1 
ATOM   1235 C  CZ  . PHE A  1 156 ? 45.482  18.874  20.178  1.00 38.17  ?  156  PHE A CZ  1 
ATOM   1236 N  N   . GLY A  1 157 ? 42.679  12.612  19.109  1.00 37.52  ?  157  GLY A N   1 
ATOM   1237 C  CA  . GLY A  1 157 ? 41.855  11.423  19.078  1.00 37.59  ?  157  GLY A CA  1 
ATOM   1238 C  C   . GLY A  1 157 ? 42.126  10.469  17.934  1.00 40.71  ?  157  GLY A C   1 
ATOM   1239 O  O   . GLY A  1 157 ? 41.944  9.262   18.093  1.00 39.02  ?  157  GLY A O   1 
ATOM   1240 N  N   . PHE A  1 158 ? 42.555  10.987  16.779  1.00 40.39  ?  158  PHE A N   1 
ATOM   1241 C  CA  . PHE A  1 158 ? 42.560  10.155  15.580  1.00 28.47  ?  158  PHE A CA  1 
ATOM   1242 C  C   . PHE A  1 158 ? 43.788  10.192  14.663  1.00 43.43  ?  158  PHE A C   1 
ATOM   1243 O  O   . PHE A  1 158 ? 43.857  9.439   13.681  1.00 46.31  ?  158  PHE A O   1 
ATOM   1244 C  CB  . PHE A  1 158 ? 41.269  10.371  14.791  1.00 27.10  ?  158  PHE A CB  1 
ATOM   1245 C  CG  . PHE A  1 158 ? 40.030  10.053  15.577  1.00 32.98  ?  158  PHE A CG  1 
ATOM   1246 C  CD1 . PHE A  1 158 ? 39.589  8.739   15.695  1.00 33.46  ?  158  PHE A CD1 1 
ATOM   1247 C  CD2 . PHE A  1 158 ? 39.329  11.057  16.228  1.00 33.28  ?  158  PHE A CD2 1 
ATOM   1248 C  CE1 . PHE A  1 158 ? 38.461  8.429   16.423  1.00 33.35  ?  158  PHE A CE1 1 
ATOM   1249 C  CE2 . PHE A  1 158 ? 38.194  10.760  16.970  1.00 38.71  ?  158  PHE A CE2 1 
ATOM   1250 C  CZ  . PHE A  1 158 ? 37.760  9.441   17.070  1.00 42.06  ?  158  PHE A CZ  1 
ATOM   1251 N  N   . LEU A  1 159 ? 44.761  11.039  14.972  1.00 47.20  ?  159  LEU A N   1 
ATOM   1252 C  CA  . LEU A  1 159 ? 46.003  11.009  14.209  1.00 44.28  ?  159  LEU A CA  1 
ATOM   1253 C  C   . LEU A  1 159 ? 46.625  9.630   14.346  1.00 41.88  ?  159  LEU A C   1 
ATOM   1254 O  O   . LEU A  1 159 ? 46.714  9.086   15.431  1.00 55.19  ?  159  LEU A O   1 
ATOM   1255 C  CB  . LEU A  1 159 ? 46.977  12.094  14.664  1.00 31.96  ?  159  LEU A CB  1 
ATOM   1256 C  CG  . LEU A  1 159 ? 48.306  12.225  13.902  1.00 50.01  ?  159  LEU A CG  1 
ATOM   1257 C  CD1 . LEU A  1 159 ? 48.778  13.670  13.864  1.00 45.68  ?  159  LEU A CD1 1 
ATOM   1258 C  CD2 . LEU A  1 159 ? 49.403  11.359  14.504  1.00 52.30  ?  159  LEU A CD2 1 
ATOM   1259 N  N   . ALA A  1 160 ? 47.049  9.063   13.232  1.00 45.41  ?  160  ALA A N   1 
ATOM   1260 C  CA  . ALA A  1 160 ? 47.555  7.707   13.236  1.00 45.05  ?  160  ALA A CA  1 
ATOM   1261 C  C   . ALA A  1 160 ? 48.701  7.518   12.261  1.00 44.99  ?  160  ALA A C   1 
ATOM   1262 O  O   . ALA A  1 160 ? 48.635  7.912   11.099  1.00 53.20  ?  160  ALA A O   1 
ATOM   1263 C  CB  . ALA A  1 160 ? 46.436  6.723   12.921  1.00 46.74  ?  160  ALA A CB  1 
ATOM   1264 N  N   . LEU A  1 161 ? 49.759  6.912   12.765  1.00 43.92  ?  161  LEU A N   1 
ATOM   1265 C  CA  . LEU A  1 161 ? 50.773  6.325   11.932  1.00 44.77  ?  161  LEU A CA  1 
ATOM   1266 C  C   . LEU A  1 161 ? 50.569  4.838   12.104  1.00 49.30  ?  161  LEU A C   1 
ATOM   1267 O  O   . LEU A  1 161 ? 51.213  4.215   12.949  1.00 52.30  ?  161  LEU A O   1 
ATOM   1268 C  CB  . LEU A  1 161 ? 52.148  6.753   12.412  1.00 48.65  ?  161  LEU A CB  1 
ATOM   1269 C  CG  . LEU A  1 161 ? 52.339  8.250   12.195  1.00 58.01  ?  161  LEU A CG  1 
ATOM   1270 C  CD1 . LEU A  1 161 ? 53.742  8.663   12.548  1.00 71.59  ?  161  LEU A CD1 1 
ATOM   1271 C  CD2 . LEU A  1 161 ? 52.057  8.569   10.752  1.00 57.19  ?  161  LEU A CD2 1 
ATOM   1272 N  N   . PRO A  1 162 ? 49.634  4.272   11.324  1.00 47.74  ?  162  PRO A N   1 
ATOM   1273 C  CA  . PRO A  1 162 ? 49.175  2.889   11.473  1.00 47.08  ?  162  PRO A CA  1 
ATOM   1274 C  C   . PRO A  1 162 ? 50.328  1.898   11.552  1.00 51.37  ?  162  PRO A C   1 
ATOM   1275 O  O   . PRO A  1 162 ? 51.272  1.965   10.758  1.00 56.85  ?  162  PRO A O   1 
ATOM   1276 C  CB  . PRO A  1 162 ? 48.346  2.665   10.204  1.00 48.57  ?  162  PRO A CB  1 
ATOM   1277 C  CG  . PRO A  1 162 ? 47.848  4.034   9.852   1.00 45.44  ?  162  PRO A CG  1 
ATOM   1278 C  CD  . PRO A  1 162 ? 48.998  4.936   10.169  1.00 46.69  ?  162  PRO A CD  1 
ATOM   1279 N  N   . GLY A  1 163 ? 50.256  0.997   12.525  1.00 49.62  ?  163  GLY A N   1 
ATOM   1280 C  CA  . GLY A  1 163 ? 51.303  0.016   12.735  1.00 49.18  ?  163  GLY A CA  1 
ATOM   1281 C  C   . GLY A  1 163 ? 52.303  0.422   13.799  1.00 58.62  ?  163  GLY A C   1 
ATOM   1282 O  O   . GLY A  1 163 ? 53.004  -0.425  14.355  1.00 67.34  ?  163  GLY A O   1 
ATOM   1283 N  N   . SER A  1 164 ? 52.390  1.716   14.084  1.00 57.42  ?  164  SER A N   1 
ATOM   1284 C  CA  . SER A  1 164 ? 53.286  2.181   15.142  1.00 59.01  ?  164  SER A CA  1 
ATOM   1285 C  C   . SER A  1 164 ? 52.636  1.955   16.512  1.00 63.68  ?  164  SER A C   1 
ATOM   1286 O  O   . SER A  1 164 ? 51.426  1.724   16.602  1.00 65.96  ?  164  SER A O   1 
ATOM   1287 C  CB  . SER A  1 164 ? 53.625  3.661   14.952  1.00 50.60  ?  164  SER A CB  1 
ATOM   1288 O  OG  . SER A  1 164 ? 52.515  4.482   15.280  1.00 54.17  ?  164  SER A OG  1 
ATOM   1289 N  N   . ARG A  1 165 ? 53.428  2.019   17.576  1.00 66.46  ?  165  ARG A N   1 
ATOM   1290 C  CA  . ARG A  1 165 ? 52.861  1.899   18.915  1.00 71.84  ?  165  ARG A CA  1 
ATOM   1291 C  C   . ARG A  1 165 ? 52.585  3.265   19.551  1.00 66.18  ?  165  ARG A C   1 
ATOM   1292 O  O   . ARG A  1 165 ? 51.751  3.380   20.458  1.00 61.71  ?  165  ARG A O   1 
ATOM   1293 C  CB  . ARG A  1 165 ? 53.746  1.041   19.824  1.00 81.85  ?  165  ARG A CB  1 
ATOM   1294 C  CG  . ARG A  1 165 ? 55.202  1.454   19.863  1.00 93.24  ?  165  ARG A CG  1 
ATOM   1295 C  CD  . ARG A  1 165 ? 55.861  0.982   21.160  1.00 104.05 ?  165  ARG A CD  1 
ATOM   1296 N  NE  . ARG A  1 165 ? 55.297  1.662   22.325  1.00 102.68 ?  165  ARG A NE  1 
ATOM   1297 C  CZ  . ARG A  1 165 ? 55.838  2.732   22.901  1.00 102.50 ?  165  ARG A CZ  1 
ATOM   1298 N  NH1 . ARG A  1 165 ? 56.971  3.241   22.427  1.00 105.07 ?  165  ARG A NH1 1 
ATOM   1299 N  NH2 . ARG A  1 165 ? 55.251  3.290   23.953  1.00 97.98  ?  165  ARG A NH2 1 
ATOM   1300 N  N   . GLU A  1 166 ? 53.263  4.300   19.057  1.00 58.55  ?  166  GLU A N   1 
ATOM   1301 C  CA  . GLU A  1 166 ? 53.147  5.626   19.656  1.00 58.14  ?  166  GLU A CA  1 
ATOM   1302 C  C   . GLU A  1 166 ? 51.932  6.405   19.175  1.00 54.59  ?  166  GLU A C   1 
ATOM   1303 O  O   . GLU A  1 166 ? 51.548  7.405   19.787  1.00 55.49  ?  166  GLU A O   1 
ATOM   1304 C  CB  . GLU A  1 166 ? 54.421  6.436   19.433  1.00 71.91  ?  166  GLU A CB  1 
ATOM   1305 C  CG  . GLU A  1 166 ? 55.689  5.743   19.901  1.00 77.20  ?  166  GLU A CG  1 
ATOM   1306 C  CD  . GLU A  1 166 ? 56.358  4.951   18.788  1.00 87.55  ?  166  GLU A CD  1 
ATOM   1307 O  OE1 . GLU A  1 166 ? 55.653  4.478   17.862  1.00 81.17  ?  166  GLU A OE1 1 
ATOM   1308 O  OE2 . GLU A  1 166 ? 57.599  4.815   18.837  1.00 94.17  ?  166  GLU A OE2 1 
ATOM   1309 N  N   . ALA A  1 167 ? 51.334  5.941   18.080  1.00 55.17  ?  167  ALA A N   1 
ATOM   1310 C  CA  . ALA A  1 167 ? 50.108  6.527   17.536  1.00 50.36  ?  167  ALA A CA  1 
ATOM   1311 C  C   . ALA A  1 167 ? 49.394  5.500   16.672  1.00 54.66  ?  167  ALA A C   1 
ATOM   1312 O  O   . ALA A  1 167 ? 49.443  5.568   15.446  1.00 54.23  ?  167  ALA A O   1 
ATOM   1313 C  CB  . ALA A  1 167 ? 50.417  7.776   16.723  1.00 44.27  ?  167  ALA A CB  1 
ATOM   1314 N  N   . PRO A  1 168 ? 48.738  4.531   17.315  1.00 58.18  ?  168  PRO A N   1 
ATOM   1315 C  CA  . PRO A  1 168 ? 48.102  3.415   16.611  1.00 56.78  ?  168  PRO A CA  1 
ATOM   1316 C  C   . PRO A  1 168 ? 46.797  3.826   15.939  1.00 51.07  ?  168  PRO A C   1 
ATOM   1317 O  O   . PRO A  1 168 ? 46.252  3.061   15.136  1.00 52.20  ?  168  PRO A O   1 
ATOM   1318 C  CB  . PRO A  1 168 ? 47.808  2.432   17.744  1.00 57.21  ?  168  PRO A CB  1 
ATOM   1319 C  CG  . PRO A  1 168 ? 47.565  3.323   18.930  1.00 55.35  ?  168  PRO A CG  1 
ATOM   1320 C  CD  . PRO A  1 168 ? 48.572  4.430   18.776  1.00 56.01  ?  168  PRO A CD  1 
ATOM   1321 N  N   . GLY A  1 169 ? 46.310  5.017   16.276  1.00 41.78  ?  169  GLY A N   1 
ATOM   1322 C  CA  . GLY A  1 169 ? 45.030  5.497   15.789  1.00 41.63  ?  169  GLY A CA  1 
ATOM   1323 C  C   . GLY A  1 169 ? 43.800  4.982   16.521  1.00 41.87  ?  169  GLY A C   1 
ATOM   1324 O  O   . GLY A  1 169 ? 43.883  4.055   17.330  1.00 53.92  ?  169  GLY A O   1 
ATOM   1325 N  N   . ASN A  1 170 ? 42.656  5.594   16.227  1.00 40.95  ?  170  ASN A N   1 
ATOM   1326 C  CA  . ASN A  1 170 ? 41.381  5.241   16.850  1.00 43.75  ?  170  ASN A CA  1 
ATOM   1327 C  C   . ASN A  1 170 ? 41.320  5.440   18.388  1.00 40.34  ?  170  ASN A C   1 
ATOM   1328 O  O   . ASN A  1 170 ? 40.351  5.020   19.025  1.00 42.30  ?  170  ASN A O   1 
ATOM   1329 C  CB  . ASN A  1 170 ? 40.967  3.801   16.500  1.00 42.77  ?  170  ASN A CB  1 
ATOM   1330 C  CG  . ASN A  1 170 ? 40.840  3.555   14.995  1.00 48.74  ?  170  ASN A CG  1 
ATOM   1331 O  OD1 . ASN A  1 170 ? 40.383  4.417   14.242  1.00 45.70  ?  170  ASN A OD1 1 
ATOM   1332 N  ND2 . ASN A  1 170 ? 41.224  2.353   14.560  1.00 41.00  ?  170  ASN A ND2 1 
ATOM   1333 N  N   . VAL A  1 171 ? 42.321  6.087   18.981  1.00 36.78  ?  171  VAL A N   1 
ATOM   1334 C  CA  . VAL A  1 171 ? 42.353  6.236   20.440  1.00 34.43  ?  171  VAL A CA  1 
ATOM   1335 C  C   . VAL A  1 171 ? 41.145  7.005   20.944  1.00 42.77  ?  171  VAL A C   1 
ATOM   1336 O  O   . VAL A  1 171 ? 40.728  6.822   22.092  1.00 41.37  ?  171  VAL A O   1 
ATOM   1337 C  CB  . VAL A  1 171 ? 43.632  6.904   20.957  1.00 34.78  ?  171  VAL A CB  1 
ATOM   1338 C  CG1 . VAL A  1 171 ? 44.858  6.233   20.363  1.00 32.20  ?  171  VAL A CG1 1 
ATOM   1339 C  CG2 . VAL A  1 171 ? 43.624  8.409   20.683  1.00 37.26  ?  171  VAL A CG2 1 
ATOM   1340 N  N   . GLY A  1 172 ? 40.557  7.827   20.075  1.00 36.21  ?  172  GLY A N   1 
ATOM   1341 C  CA  . GLY A  1 172 ? 39.296  8.482   20.391  1.00 34.92  ?  172  GLY A CA  1 
ATOM   1342 C  C   . GLY A  1 172 ? 38.190  7.464   20.607  1.00 35.89  ?  172  GLY A C   1 
ATOM   1343 O  O   . GLY A  1 172 ? 37.382  7.598   21.521  1.00 30.06  ?  172  GLY A O   1 
ATOM   1344 N  N   . LEU A  1 173 ? 38.158  6.434   19.762  1.00 35.24  ?  173  LEU A N   1 
ATOM   1345 C  CA  . LEU A  1 173 ? 37.193  5.348   19.920  1.00 38.44  ?  173  LEU A CA  1 
ATOM   1346 C  C   . LEU A  1 173 ? 37.454  4.509   21.178  1.00 41.20  ?  173  LEU A C   1 
ATOM   1347 O  O   . LEU A  1 173 ? 36.531  3.983   21.790  1.00 42.47  ?  173  LEU A O   1 
ATOM   1348 C  CB  . LEU A  1 173 ? 37.202  4.442   18.695  1.00 32.94  ?  173  LEU A CB  1 
ATOM   1349 C  CG  . LEU A  1 173 ? 36.637  5.075   17.425  1.00 37.40  ?  173  LEU A CG  1 
ATOM   1350 C  CD1 . LEU A  1 173 ? 36.795  4.120   16.264  1.00 27.59  ?  173  LEU A CD1 1 
ATOM   1351 C  CD2 . LEU A  1 173 ? 35.183  5.417   17.630  1.00 38.18  ?  173  LEU A CD2 1 
ATOM   1352 N  N   . LEU A  1 174 ? 38.720  4.375   21.539  1.00 38.39  ?  174  LEU A N   1 
ATOM   1353 C  CA  . LEU A  1 174 ? 39.109  3.620   22.710  1.00 40.40  ?  174  LEU A CA  1 
ATOM   1354 C  C   . LEU A  1 174 ? 38.741  4.383   23.992  1.00 48.28  ?  174  LEU A C   1 
ATOM   1355 O  O   . LEU A  1 174 ? 38.464  3.770   25.023  1.00 48.39  ?  174  LEU A O   1 
ATOM   1356 C  CB  . LEU A  1 174 ? 40.606  3.301   22.652  1.00 31.22  ?  174  LEU A CB  1 
ATOM   1357 C  CG  . LEU A  1 174 ? 40.974  2.231   21.618  1.00 42.80  ?  174  LEU A CG  1 
ATOM   1358 C  CD1 . LEU A  1 174 ? 42.478  2.022   21.508  1.00 32.57  ?  174  LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A  1 174 ? 40.292  0.921   21.971  1.00 35.61  ?  174  LEU A CD2 1 
ATOM   1360 N  N   . ASP A  1 175 ? 38.737  5.715   23.911  1.00 46.26  ?  175  ASP A N   1 
ATOM   1361 C  CA  . ASP A  1 175 ? 38.221  6.556   24.990  1.00 40.90  ?  175  ASP A CA  1 
ATOM   1362 C  C   . ASP A  1 175 ? 36.760  6.193   25.246  1.00 46.64  ?  175  ASP A C   1 
ATOM   1363 O  O   . ASP A  1 175 ? 36.347  5.952   26.382  1.00 50.82  ?  175  ASP A O   1 
ATOM   1364 C  CB  . ASP A  1 175 ? 38.338  8.042   24.631  1.00 33.33  ?  175  ASP A CB  1 
ATOM   1365 C  CG  . ASP A  1 175 ? 39.786  8.525   24.597  1.00 43.51  ?  175  ASP A CG  1 
ATOM   1366 O  OD1 . ASP A  1 175 ? 40.664  7.775   25.072  1.00 45.87  ?  175  ASP A OD1 1 
ATOM   1367 O  OD2 . ASP A  1 175 ? 40.055  9.651   24.111  1.00 36.82  ?  175  ASP A OD2 1 
ATOM   1368 N  N   . GLN A  1 176 ? 35.986  6.127   24.172  1.00 40.37  ?  176  GLN A N   1 
ATOM   1369 C  CA  . GLN A  1 176 ? 34.585  5.767   24.272  1.00 37.35  ?  176  GLN A CA  1 
ATOM   1370 C  C   . GLN A  1 176 ? 34.384  4.364   24.850  1.00 46.09  ?  176  GLN A C   1 
ATOM   1371 O  O   . GLN A  1 176 ? 33.513  4.163   25.699  1.00 50.44  ?  176  GLN A O   1 
ATOM   1372 C  CB  . GLN A  1 176 ? 33.900  5.883   22.910  1.00 31.67  ?  176  GLN A CB  1 
ATOM   1373 C  CG  . GLN A  1 176 ? 33.915  7.281   22.289  1.00 28.52  ?  176  GLN A CG  1 
ATOM   1374 C  CD  . GLN A  1 176 ? 33.349  7.265   20.861  1.00 36.84  ?  176  GLN A CD  1 
ATOM   1375 O  OE1 . GLN A  1 176 ? 32.925  6.209   20.364  1.00 29.59  ?  176  GLN A OE1 1 
ATOM   1376 N  NE2 . GLN A  1 176 ? 33.331  8.436   20.201  1.00 27.40  ?  176  GLN A NE2 1 
ATOM   1377 N  N   . ARG A  1 177 ? 35.177  3.399   24.393  1.00 38.90  ?  177  ARG A N   1 
ATOM   1378 C  CA  . ARG A  1 177 ? 35.026  2.030   24.866  1.00 38.68  ?  177  ARG A CA  1 
ATOM   1379 C  C   . ARG A  1 177 ? 35.347  1.923   26.363  1.00 49.02  ?  177  ARG A C   1 
ATOM   1380 O  O   . ARG A  1 177 ? 34.725  1.140   27.080  1.00 50.54  ?  177  ARG A O   1 
ATOM   1381 C  CB  . ARG A  1 177 ? 35.907  1.074   24.069  1.00 35.91  ?  177  ARG A CB  1 
ATOM   1382 C  CG  . ARG A  1 177 ? 35.789  -0.385  24.507  1.00 43.87  ?  177  ARG A CG  1 
ATOM   1383 C  CD  . ARG A  1 177 ? 36.770  -1.294  23.767  1.00 39.70  ?  177  ARG A CD  1 
ATOM   1384 N  NE  . ARG A  1 177 ? 36.292  -1.607  22.426  1.00 49.45  ?  177  ARG A NE  1 
ATOM   1385 C  CZ  . ARG A  1 177 ? 37.064  -2.025  21.425  1.00 44.88  ?  177  ARG A CZ  1 
ATOM   1386 N  NH1 . ARG A  1 177 ? 38.370  -2.181  21.591  1.00 39.65  ?  177  ARG A NH1 1 
ATOM   1387 N  NH2 . ARG A  1 177 ? 36.522  -2.290  20.256  1.00 41.28  ?  177  ARG A NH2 1 
ATOM   1388 N  N   . LEU A  1 178 ? 36.310  2.720   26.823  1.00 46.70  ?  178  LEU A N   1 
ATOM   1389 C  CA  . LEU A  1 178 ? 36.710  2.717   28.231  1.00 44.87  ?  178  LEU A CA  1 
ATOM   1390 C  C   . LEU A  1 178 ? 35.586  3.241   29.104  1.00 46.63  ?  178  LEU A C   1 
ATOM   1391 O  O   . LEU A  1 178 ? 35.347  2.721   30.188  1.00 51.96  ?  178  LEU A O   1 
ATOM   1392 C  CB  . LEU A  1 178 ? 37.958  3.565   28.454  1.00 41.16  ?  178  LEU A CB  1 
ATOM   1393 C  CG  . LEU A  1 178 ? 38.443  3.706   29.899  1.00 46.92  ?  178  LEU A CG  1 
ATOM   1394 C  CD1 . LEU A  1 178 ? 38.660  2.345   30.556  1.00 46.39  ?  178  LEU A CD1 1 
ATOM   1395 C  CD2 . LEU A  1 178 ? 39.719  4.525   29.936  1.00 45.22  ?  178  LEU A CD2 1 
ATOM   1396 N  N   . ALA A  1 179 ? 34.901  4.273   28.629  1.00 38.39  ?  179  ALA A N   1 
ATOM   1397 C  CA  . ALA A  1 179 ? 33.722  4.752   29.319  1.00 31.87  ?  179  ALA A CA  1 
ATOM   1398 C  C   . ALA A  1 179 ? 32.645  3.674   29.333  1.00 39.42  ?  179  ALA A C   1 
ATOM   1399 O  O   . ALA A  1 179 ? 31.896  3.565   30.303  1.00 54.72  ?  179  ALA A O   1 
ATOM   1400 C  CB  . ALA A  1 179 ? 33.202  6.050   28.700  1.00 25.95  ?  179  ALA A CB  1 
ATOM   1401 N  N   . LEU A  1 180 ? 32.568  2.866   28.277  1.00 34.57  ?  180  LEU A N   1 
ATOM   1402 C  CA  . LEU A  1 180 ? 31.555  1.810   28.244  1.00 43.11  ?  180  LEU A CA  1 
ATOM   1403 C  C   . LEU A  1 180 ? 31.860  0.757   29.309  1.00 44.55  ?  180  LEU A C   1 
ATOM   1404 O  O   . LEU A  1 180 ? 30.949  0.210   29.919  1.00 42.37  ?  180  LEU A O   1 
ATOM   1405 C  CB  . LEU A  1 180 ? 31.409  1.152   26.860  1.00 41.42  ?  180  LEU A CB  1 
ATOM   1406 C  CG  . LEU A  1 180 ? 31.050  2.013   25.637  1.00 48.87  ?  180  LEU A CG  1 
ATOM   1407 C  CD1 . LEU A  1 180 ? 30.758  1.156   24.399  1.00 47.91  ?  180  LEU A CD1 1 
ATOM   1408 C  CD2 . LEU A  1 180 ? 29.901  2.947   25.914  1.00 45.35  ?  180  LEU A CD2 1 
ATOM   1409 N  N   . GLN A  1 181 ? 33.141  0.483   29.527  1.00 39.46  ?  181  GLN A N   1 
ATOM   1410 C  CA  . GLN A  1 181 ? 33.547  -0.484  30.536  1.00 53.83  ?  181  GLN A CA  1 
ATOM   1411 C  C   . GLN A  1 181 ? 33.329  0.101   31.923  1.00 52.42  ?  181  GLN A C   1 
ATOM   1412 O  O   . GLN A  1 181 ? 33.004  -0.618  32.865  1.00 43.44  ?  181  GLN A O   1 
ATOM   1413 C  CB  . GLN A  1 181 ? 35.018  -0.851  30.372  1.00 60.22  ?  181  GLN A CB  1 
ATOM   1414 C  CG  . GLN A  1 181 ? 35.344  -1.551  29.078  1.00 63.86  ?  181  GLN A CG  1 
ATOM   1415 C  CD  . GLN A  1 181 ? 36.819  -1.470  28.744  1.00 62.86  ?  181  GLN A CD  1 
ATOM   1416 O  OE1 . GLN A  1 181 ? 37.513  -0.560  29.189  1.00 59.99  ?  181  GLN A OE1 1 
ATOM   1417 N  NE2 . GLN A  1 181 ? 37.304  -2.419  27.954  1.00 62.08  ?  181  GLN A NE2 1 
ATOM   1418 N  N   . TRP A  1 182 ? 33.522  1.412   32.027  1.00 52.11  ?  182  TRP A N   1 
ATOM   1419 C  CA  . TRP A  1 182 ? 33.295  2.137   33.257  1.00 42.59  ?  182  TRP A CA  1 
ATOM   1420 C  C   . TRP A  1 182 ? 31.838  1.983   33.650  1.00 43.41  ?  182  TRP A C   1 
ATOM   1421 O  O   . TRP A  1 182 ? 31.519  1.692   34.807  1.00 48.12  ?  182  TRP A O   1 
ATOM   1422 C  CB  . TRP A  1 182 ? 33.622  3.621   33.087  1.00 37.13  ?  182  TRP A CB  1 
ATOM   1423 C  CG  . TRP A  1 182 ? 33.483  4.370   34.381  1.00 37.24  ?  182  TRP A CG  1 
ATOM   1424 C  CD1 . TRP A  1 182 ? 34.462  4.584   35.320  1.00 33.69  ?  182  TRP A CD1 1 
ATOM   1425 C  CD2 . TRP A  1 182 ? 32.294  4.983   34.898  1.00 37.22  ?  182  TRP A CD2 1 
ATOM   1426 N  NE1 . TRP A  1 182 ? 33.954  5.299   36.382  1.00 42.29  ?  182  TRP A NE1 1 
ATOM   1427 C  CE2 . TRP A  1 182 ? 32.628  5.556   36.152  1.00 45.03  ?  182  TRP A CE2 1 
ATOM   1428 C  CE3 . TRP A  1 182 ? 30.982  5.111   34.424  1.00 39.49  ?  182  TRP A CE3 1 
ATOM   1429 C  CZ2 . TRP A  1 182 ? 31.697  6.242   36.937  1.00 45.65  ?  182  TRP A CZ2 1 
ATOM   1430 C  CZ3 . TRP A  1 182 ? 30.053  5.801   35.209  1.00 42.65  ?  182  TRP A CZ3 1 
ATOM   1431 C  CH2 . TRP A  1 182 ? 30.419  6.355   36.449  1.00 47.87  ?  182  TRP A CH2 1 
ATOM   1432 N  N   . VAL A  1 183 ? 30.955  2.178   32.680  1.00 37.63  ?  183  VAL A N   1 
ATOM   1433 C  CA  . VAL A  1 183 ? 29.533  1.991   32.911  1.00 34.19  ?  183  VAL A CA  1 
ATOM   1434 C  C   . VAL A  1 183 ? 29.253  0.547   33.375  1.00 46.59  ?  183  VAL A C   1 
ATOM   1435 O  O   . VAL A  1 183 ? 28.491  0.334   34.324  1.00 34.31  ?  183  VAL A O   1 
ATOM   1436 C  CB  . VAL A  1 183 ? 28.698  2.363   31.659  1.00 38.45  ?  183  VAL A CB  1 
ATOM   1437 C  CG1 . VAL A  1 183 ? 27.301  1.764   31.732  1.00 37.70  ?  183  VAL A CG1 1 
ATOM   1438 C  CG2 . VAL A  1 183 ? 28.632  3.900   31.468  1.00 28.52  ?  183  VAL A CG2 1 
ATOM   1439 N  N   . GLN A  1 184 ? 29.882  -0.439  32.733  1.00 40.40  ?  184  GLN A N   1 
ATOM   1440 C  CA  . GLN A  1 184 ? 29.678  -1.836  33.130  1.00 46.32  ?  184  GLN A CA  1 
ATOM   1441 C  C   . GLN A  1 184 ? 30.043  -2.082  34.594  1.00 49.27  ?  184  GLN A C   1 
ATOM   1442 O  O   . GLN A  1 184 ? 29.337  -2.795  35.311  1.00 51.31  ?  184  GLN A O   1 
ATOM   1443 C  CB  . GLN A  1 184 ? 30.463  -2.804  32.235  1.00 44.81  ?  184  GLN A CB  1 
ATOM   1444 C  CG  . GLN A  1 184 ? 29.872  -2.992  30.857  1.00 52.58  ?  184  GLN A CG  1 
ATOM   1445 C  CD  . GLN A  1 184 ? 28.487  -3.620  30.881  1.00 56.86  ?  184  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A  1 184 ? 28.324  -4.807  31.196  1.00 63.70  ?  184  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A  1 184 ? 27.478  -2.823  30.542  1.00 42.49  ?  184  GLN A NE2 1 
ATOM   1448 N  N   . GLU A  1 185 ? 31.144  -1.495  35.046  1.00 46.53  ?  185  GLU A N   1 
ATOM   1449 C  CA  . GLU A  1 185 ? 31.570  -1.747  36.410  1.00 53.61  ?  185  GLU A CA  1 
ATOM   1450 C  C   . GLU A  1 185 ? 30.806  -0.923  37.441  1.00 52.57  ?  185  GLU A C   1 
ATOM   1451 O  O   . GLU A  1 185 ? 30.548  -1.400  38.545  1.00 54.41  ?  185  GLU A O   1 
ATOM   1452 C  CB  . GLU A  1 185 ? 33.078  -1.541  36.593  1.00 56.39  ?  185  GLU A CB  1 
ATOM   1453 C  CG  . GLU A  1 185 ? 33.558  -2.090  37.938  1.00 65.90  ?  185  GLU A CG  1 
ATOM   1454 C  CD  . GLU A  1 185 ? 35.057  -2.010  38.141  1.00 73.94  ?  185  GLU A CD  1 
ATOM   1455 O  OE1 . GLU A  1 185 ? 35.740  -1.377  37.305  1.00 73.12  ?  185  GLU A OE1 1 
ATOM   1456 O  OE2 . GLU A  1 185 ? 35.546  -2.587  39.146  1.00 80.04  ?  185  GLU A OE2 1 
ATOM   1457 N  N   . ASN A  1 186 ? 30.427  0.295   37.068  1.00 49.88  ?  186  ASN A N   1 
ATOM   1458 C  CA  . ASN A  1 186 ? 30.052  1.309   38.050  1.00 46.29  ?  186  ASN A CA  1 
ATOM   1459 C  C   . ASN A  1 186 ? 28.605  1.781   38.069  1.00 47.13  ?  186  ASN A C   1 
ATOM   1460 O  O   . ASN A  1 186 ? 28.160  2.349   39.069  1.00 57.65  ?  186  ASN A O   1 
ATOM   1461 C  CB  . ASN A  1 186 ? 30.956  2.533   37.898  1.00 38.90  ?  186  ASN A CB  1 
ATOM   1462 C  CG  . ASN A  1 186 ? 32.396  2.221   38.200  1.00 43.94  ?  186  ASN A CG  1 
ATOM   1463 O  OD1 . ASN A  1 186 ? 32.751  1.962   39.352  1.00 51.38  ?  186  ASN A OD1 1 
ATOM   1464 N  ND2 . ASN A  1 186 ? 33.245  2.248   37.173  1.00 38.15  ?  186  ASN A ND2 1 
ATOM   1465 N  N   . ILE A  1 187 ? 27.873  1.567   36.983  1.00 40.64  ?  187  ILE A N   1 
ATOM   1466 C  CA  . ILE A  1 187 ? 26.575  2.217   36.828  1.00 39.57  ?  187  ILE A CA  1 
ATOM   1467 C  C   . ILE A  1 187 ? 25.546  1.721   37.844  1.00 44.48  ?  187  ILE A C   1 
ATOM   1468 O  O   . ILE A  1 187 ? 24.618  2.448   38.199  1.00 45.42  ?  187  ILE A O   1 
ATOM   1469 C  CB  . ILE A  1 187 ? 26.018  2.103   35.382  1.00 36.17  ?  187  ILE A CB  1 
ATOM   1470 C  CG1 . ILE A  1 187 ? 25.032  3.249   35.082  1.00 39.23  ?  187  ILE A CG1 1 
ATOM   1471 C  CG2 . ILE A  1 187 ? 25.375  0.733   35.152  1.00 36.40  ?  187  ILE A CG2 1 
ATOM   1472 C  CD1 . ILE A  1 187 ? 25.619  4.648   35.280  1.00 31.12  ?  187  ILE A CD1 1 
ATOM   1473 N  N   . ALA A  1 188 ? 25.723  0.490   38.312  1.00 38.58  ?  188  ALA A N   1 
ATOM   1474 C  CA  . ALA A  1 188 ? 24.790  -0.096  39.252  1.00 43.20  ?  188  ALA A CA  1 
ATOM   1475 C  C   . ALA A  1 188 ? 24.796  0.684   40.564  1.00 44.21  ?  188  ALA A C   1 
ATOM   1476 O  O   . ALA A  1 188 ? 23.812  0.667   41.289  1.00 44.68  ?  188  ALA A O   1 
ATOM   1477 C  CB  . ALA A  1 188 ? 25.094  -1.588  39.486  1.00 42.44  ?  188  ALA A CB  1 
ATOM   1478 N  N   . ALA A  1 189 ? 25.891  1.385   40.852  1.00 43.86  ?  189  ALA A N   1 
ATOM   1479 C  CA  . ALA A  1 189 ? 25.978  2.227   42.052  1.00 46.68  ?  189  ALA A CA  1 
ATOM   1480 C  C   . ALA A  1 189 ? 25.060  3.451   41.986  1.00 48.99  ?  189  ALA A C   1 
ATOM   1481 O  O   . ALA A  1 189 ? 24.849  4.134   42.986  1.00 61.21  ?  189  ALA A O   1 
ATOM   1482 C  CB  . ALA A  1 189 ? 27.422  2.666   42.303  1.00 43.51  ?  189  ALA A CB  1 
ATOM   1483 N  N   . PHE A  1 190 ? 24.525  3.726   40.805  1.00 43.90  ?  190  PHE A N   1 
ATOM   1484 C  CA  . PHE A  1 190 ? 23.633  4.856   40.597  1.00 45.10  ?  190  PHE A CA  1 
ATOM   1485 C  C   . PHE A  1 190 ? 22.223  4.338   40.379  1.00 49.81  ?  190  PHE A C   1 
ATOM   1486 O  O   . PHE A  1 190 ? 21.299  5.123   40.176  1.00 52.69  ?  190  PHE A O   1 
ATOM   1487 C  CB  . PHE A  1 190 ? 24.062  5.662   39.357  1.00 47.53  ?  190  PHE A CB  1 
ATOM   1488 C  CG  . PHE A  1 190 ? 25.425  6.287   39.469  1.00 43.34  ?  190  PHE A CG  1 
ATOM   1489 C  CD1 . PHE A  1 190 ? 26.559  5.571   39.126  1.00 46.70  ?  190  PHE A CD1 1 
ATOM   1490 C  CD2 . PHE A  1 190 ? 25.569  7.594   39.909  1.00 42.18  ?  190  PHE A CD2 1 
ATOM   1491 C  CE1 . PHE A  1 190 ? 27.813  6.148   39.218  1.00 44.63  ?  190  PHE A CE1 1 
ATOM   1492 C  CE2 . PHE A  1 190 ? 26.815  8.175   40.011  1.00 41.70  ?  190  PHE A CE2 1 
ATOM   1493 C  CZ  . PHE A  1 190 ? 27.940  7.452   39.665  1.00 43.32  ?  190  PHE A CZ  1 
ATOM   1494 N  N   . GLY A  1 191 ? 22.066  3.014   40.394  1.00 39.88  ?  191  GLY A N   1 
ATOM   1495 C  CA  . GLY A  1 191 ? 20.780  2.398   40.117  1.00 40.23  ?  191  GLY A CA  1 
ATOM   1496 C  C   . GLY A  1 191 ? 20.544  2.067   38.646  1.00 43.17  ?  191  GLY A C   1 
ATOM   1497 O  O   . GLY A  1 191 ? 19.445  1.662   38.268  1.00 51.95  ?  191  GLY A O   1 
ATOM   1498 N  N   . GLY A  1 192 ? 21.563  2.240   37.802  1.00 42.05  ?  192  GLY A N   1 
ATOM   1499 C  CA  . GLY A  1 192 ? 21.469  1.787   36.428  1.00 42.55  ?  192  GLY A CA  1 
ATOM   1500 C  C   . GLY A  1 192 ? 21.642  0.279   36.299  1.00 48.37  ?  192  GLY A C   1 
ATOM   1501 O  O   . GLY A  1 192 ? 22.217  -0.376  37.173  1.00 52.29  ?  192  GLY A O   1 
ATOM   1502 N  N   . ASP A  1 193 ? 21.139  -0.261  35.195  1.00 48.60  ?  193  ASP A N   1 
ATOM   1503 C  CA  . ASP A  1 193 ? 21.178  -1.685  34.891  1.00 49.28  ?  193  ASP A CA  1 
ATOM   1504 C  C   . ASP A  1 193 ? 22.289  -1.907  33.864  1.00 50.92  ?  193  ASP A C   1 
ATOM   1505 O  O   . ASP A  1 193 ? 22.160  -1.511  32.709  1.00 50.28  ?  193  ASP A O   1 
ATOM   1506 C  CB  . ASP A  1 193 ? 19.821  -2.085  34.296  1.00 53.75  ?  193  ASP A CB  1 
ATOM   1507 C  CG  . ASP A  1 193 ? 19.654  -3.589  34.117  1.00 56.28  ?  193  ASP A CG  1 
ATOM   1508 O  OD1 . ASP A  1 193 ? 20.649  -4.340  34.240  1.00 57.42  ?  193  ASP A OD1 1 
ATOM   1509 O  OD2 . ASP A  1 193 ? 18.504  -4.012  33.839  1.00 50.42  ?  193  ASP A OD2 1 
ATOM   1510 N  N   . PRO A  1 194 ? 23.392  -2.540  34.276  1.00 45.88  ?  194  PRO A N   1 
ATOM   1511 C  CA  . PRO A  1 194 ? 24.481  -2.722  33.306  1.00 39.07  ?  194  PRO A CA  1 
ATOM   1512 C  C   . PRO A  1 194 ? 24.154  -3.754  32.220  1.00 55.04  ?  194  PRO A C   1 
ATOM   1513 O  O   . PRO A  1 194 ? 24.828  -3.805  31.187  1.00 58.05  ?  194  PRO A O   1 
ATOM   1514 C  CB  . PRO A  1 194 ? 25.655  -3.188  34.168  1.00 44.87  ?  194  PRO A CB  1 
ATOM   1515 C  CG  . PRO A  1 194 ? 25.002  -3.823  35.421  1.00 39.71  ?  194  PRO A CG  1 
ATOM   1516 C  CD  . PRO A  1 194 ? 23.693  -3.098  35.611  1.00 38.41  ?  194  PRO A CD  1 
ATOM   1517 N  N   . MET A  1 195 ? 23.124  -4.561  32.438  1.00 57.14  ?  195  MET A N   1 
ATOM   1518 C  CA  . MET A  1 195 ? 22.750  -5.559  31.447  1.00 55.85  ?  195  MET A CA  1 
ATOM   1519 C  C   . MET A  1 195 ? 21.725  -5.027  30.450  1.00 58.49  ?  195  MET A C   1 
ATOM   1520 O  O   . MET A  1 195 ? 21.265  -5.757  29.568  1.00 59.85  ?  195  MET A O   1 
ATOM   1521 C  CB  . MET A  1 195 ? 22.256  -6.829  32.133  1.00 55.49  ?  195  MET A CB  1 
ATOM   1522 C  CG  . MET A  1 195 ? 23.360  -7.535  32.890  1.00 53.34  ?  195  MET A CG  1 
ATOM   1523 S  SD  . MET A  1 195 ? 22.978  -9.248  33.245  1.00 93.30  ?  195  MET A SD  1 
ATOM   1524 C  CE  . MET A  1 195 ? 21.624  -9.059  34.399  1.00 54.89  ?  195  MET A CE  1 
ATOM   1525 N  N   . SER A  1 196 ? 21.386  -3.747  30.585  1.00 51.41  ?  196  SER A N   1 
ATOM   1526 C  CA  . SER A  1 196 ? 20.502  -3.074  29.638  1.00 46.77  ?  196  SER A CA  1 
ATOM   1527 C  C   . SER A  1 196 ? 21.086  -1.717  29.289  1.00 50.14  ?  196  SER A C   1 
ATOM   1528 O  O   . SER A  1 196 ? 20.771  -0.705  29.926  1.00 50.49  ?  196  SER A O   1 
ATOM   1529 C  CB  . SER A  1 196 ? 19.107  -2.898  30.235  1.00 54.65  ?  196  SER A CB  1 
ATOM   1530 O  OG  . SER A  1 196 ? 18.183  -2.462  29.256  1.00 49.01  ?  196  SER A OG  1 
ATOM   1531 N  N   . VAL A  1 197 ? 21.954  -1.705  28.283  1.00 53.02  ?  197  VAL A N   1 
ATOM   1532 C  CA  . VAL A  1 197 ? 22.656  -0.497  27.879  1.00 47.23  ?  197  VAL A CA  1 
ATOM   1533 C  C   . VAL A  1 197 ? 22.464  -0.220  26.395  1.00 49.08  ?  197  VAL A C   1 
ATOM   1534 O  O   . VAL A  1 197 ? 22.730  -1.074  25.537  1.00 55.27  ?  197  VAL A O   1 
ATOM   1535 C  CB  . VAL A  1 197 ? 24.164  -0.578  28.212  1.00 41.67  ?  197  VAL A CB  1 
ATOM   1536 C  CG1 . VAL A  1 197 ? 24.902  0.614   27.627  1.00 36.01  ?  197  VAL A CG1 1 
ATOM   1537 C  CG2 . VAL A  1 197 ? 24.376  -0.655  29.726  1.00 37.98  ?  197  VAL A CG2 1 
ATOM   1538 N  N   . THR A  1 198 ? 21.988  0.985   26.103  1.00 47.31  ?  198  THR A N   1 
ATOM   1539 C  CA  . THR A  1 198 ? 21.664  1.390   24.742  1.00 36.97  ?  198  THR A CA  1 
ATOM   1540 C  C   . THR A  1 198 ? 22.539  2.580   24.373  1.00 46.16  ?  198  THR A C   1 
ATOM   1541 O  O   . THR A  1 198 ? 22.499  3.614   25.049  1.00 51.38  ?  198  THR A O   1 
ATOM   1542 C  CB  . THR A  1 198 ? 20.195  1.802   24.630  1.00 36.24  ?  198  THR A CB  1 
ATOM   1543 O  OG1 . THR A  1 198 ? 19.357  0.675   24.906  1.00 36.96  ?  198  THR A OG1 1 
ATOM   1544 C  CG2 . THR A  1 198 ? 19.879  2.313   23.218  1.00 42.09  ?  198  THR A CG2 1 
ATOM   1545 N  N   . LEU A  1 199 ? 23.353  2.420   23.329  1.00 37.74  ?  199  LEU A N   1 
ATOM   1546 C  CA  . LEU A  1 199 ? 24.144  3.528   22.814  1.00 36.32  ?  199  LEU A CA  1 
ATOM   1547 C  C   . LEU A  1 199 ? 23.281  4.362   21.889  1.00 38.97  ?  199  LEU A C   1 
ATOM   1548 O  O   . LEU A  1 199 ? 22.454  3.827   21.150  1.00 45.05  ?  199  LEU A O   1 
ATOM   1549 C  CB  . LEU A  1 199 ? 25.350  3.025   22.035  1.00 34.05  ?  199  LEU A CB  1 
ATOM   1550 C  CG  . LEU A  1 199 ? 26.180  1.923   22.677  1.00 43.41  ?  199  LEU A CG  1 
ATOM   1551 C  CD1 . LEU A  1 199 ? 27.367  1.612   21.800  1.00 37.20  ?  199  LEU A CD1 1 
ATOM   1552 C  CD2 . LEU A  1 199 ? 26.622  2.332   24.081  1.00 54.43  ?  199  LEU A CD2 1 
ATOM   1553 N  N   . PHE A  1 200 ? 23.448  5.675   21.955  1.00 37.38  ?  200  PHE A N   1 
ATOM   1554 C  CA  . PHE A  1 200 ? 22.835  6.555   20.975  1.00 36.67  ?  200  PHE A CA  1 
ATOM   1555 C  C   . PHE A  1 200 ? 23.685  7.776   20.771  1.00 41.70  ?  200  PHE A C   1 
ATOM   1556 O  O   . PHE A  1 200 ? 24.270  8.294   21.716  1.00 42.93  ?  200  PHE A O   1 
ATOM   1557 C  CB  . PHE A  1 200 ? 21.372  6.906   21.291  1.00 34.09  ?  200  PHE A CB  1 
ATOM   1558 C  CG  . PHE A  1 200 ? 21.169  7.910   22.415  1.00 36.88  ?  200  PHE A CG  1 
ATOM   1559 C  CD1 . PHE A  1 200 ? 21.758  7.741   23.657  1.00 48.46  ?  200  PHE A CD1 1 
ATOM   1560 C  CD2 . PHE A  1 200 ? 20.325  8.998   22.234  1.00 34.79  ?  200  PHE A CD2 1 
ATOM   1561 C  CE1 . PHE A  1 200 ? 21.533  8.660   24.692  1.00 45.25  ?  200  PHE A CE1 1 
ATOM   1562 C  CE2 . PHE A  1 200 ? 20.098  9.919   23.259  1.00 42.34  ?  200  PHE A CE2 1 
ATOM   1563 C  CZ  . PHE A  1 200 ? 20.707  9.752   24.489  1.00 36.34  ?  200  PHE A CZ  1 
ATOM   1564 N  N   . GLY A  1 201 ? 23.760  8.209   19.516  1.00 41.24  ?  201  GLY A N   1 
ATOM   1565 C  CA  . GLY A  1 201 ? 24.630  9.290   19.119  1.00 37.75  ?  201  GLY A CA  1 
ATOM   1566 C  C   . GLY A  1 201 ? 24.200  9.833   17.779  1.00 41.80  ?  201  GLY A C   1 
ATOM   1567 O  O   . GLY A  1 201 ? 23.511  9.167   17.007  1.00 38.58  ?  201  GLY A O   1 
ATOM   1568 N  N   . GLU A  1 202 ? 24.601  11.064  17.506  1.00 43.03  ?  202  GLU A N   1 
ATOM   1569 C  CA  . GLU A  1 202 ? 24.210  11.716  16.280  1.00 36.54  ?  202  GLU A CA  1 
ATOM   1570 C  C   . GLU A  1 202 ? 25.445  12.021  15.430  1.00 39.07  ?  202  GLU A C   1 
ATOM   1571 O  O   . GLU A  1 202 ? 26.533  12.250  15.961  1.00 39.01  ?  202  GLU A O   1 
ATOM   1572 C  CB  . GLU A  1 202 ? 23.427  12.977  16.620  1.00 37.55  ?  202  GLU A CB  1 
ATOM   1573 C  CG  . GLU A  1 202 ? 22.746  13.631  15.455  1.00 52.50  ?  202  GLU A CG  1 
ATOM   1574 C  CD  . GLU A  1 202 ? 23.615  14.679  14.833  1.00 56.88  ?  202  GLU A CD  1 
ATOM   1575 O  OE1 . GLU A  1 202 ? 24.648  15.014  15.454  1.00 51.98  ?  202  GLU A OE1 1 
ATOM   1576 O  OE2 . GLU A  1 202 ? 23.261  15.163  13.735  1.00 56.99  ?  202  GLU A OE2 1 
ATOM   1577 N  N   . SER A  1 203 ? 25.276  11.996  14.110  1.00 41.11  ?  203  SER A N   1 
ATOM   1578 C  CA  . SER A  1 203 ? 26.356  12.336  13.172  1.00 39.13  ?  203  SER A CA  1 
ATOM   1579 C  C   . SER A  1 203 ? 27.599  11.455  13.405  1.00 36.11  ?  203  SER A C   1 
ATOM   1580 O  O   . SER A  1 203 ? 27.506  10.218  13.353  1.00 32.16  ?  203  SER A O   1 
ATOM   1581 C  CB  . SER A  1 203 ? 26.676  13.837  13.261  1.00 42.27  ?  203  SER A CB  1 
ATOM   1582 O  OG  . SER A  1 203 ? 27.516  14.258  12.207  1.00 58.30  ?  203  SER A OG  1 
ATOM   1583 N  N   . ALA A  1 204 ? 28.750  12.067  13.685  1.00 34.34  ?  204  ALA A N   1 
ATOM   1584 C  CA  . ALA A  1 204 ? 29.947  11.279  14.003  1.00 40.05  ?  204  ALA A CA  1 
ATOM   1585 C  C   . ALA A  1 204 ? 29.726  10.367  15.215  1.00 43.48  ?  204  ALA A C   1 
ATOM   1586 O  O   . ALA A  1 204 ? 30.307  9.279   15.300  1.00 43.22  ?  204  ALA A O   1 
ATOM   1587 C  CB  . ALA A  1 204 ? 31.146  12.177  14.235  1.00 42.95  ?  204  ALA A CB  1 
ATOM   1588 N  N   . GLY A  1 205 ? 28.883  10.814  16.147  1.00 42.31  ?  205  GLY A N   1 
ATOM   1589 C  CA  . GLY A  1 205 ? 28.531  10.015  17.308  1.00 35.08  ?  205  GLY A CA  1 
ATOM   1590 C  C   . GLY A  1 205 ? 27.823  8.745   16.876  1.00 42.23  ?  205  GLY A C   1 
ATOM   1591 O  O   . GLY A  1 205 ? 28.138  7.646   17.366  1.00 36.47  ?  205  GLY A O   1 
ATOM   1592 N  N   . ALA A  1 206 ? 26.876  8.896   15.946  1.00 40.16  ?  206  ALA A N   1 
ATOM   1593 C  CA  . ALA A  1 206 ? 26.207  7.751   15.329  1.00 39.72  ?  206  ALA A CA  1 
ATOM   1594 C  C   . ALA A  1 206 ? 27.207  6.806   14.659  1.00 41.48  ?  206  ALA A C   1 
ATOM   1595 O  O   . ALA A  1 206 ? 27.130  5.592   14.850  1.00 40.46  ?  206  ALA A O   1 
ATOM   1596 C  CB  . ALA A  1 206 ? 25.151  8.210   14.334  1.00 41.17  ?  206  ALA A CB  1 
ATOM   1597 N  N   . ALA A  1 207 ? 28.147  7.358   13.890  1.00 37.80  ?  207  ALA A N   1 
ATOM   1598 C  CA  . ALA A  1 207 ? 29.189  6.539   13.265  1.00 34.81  ?  207  ALA A CA  1 
ATOM   1599 C  C   . ALA A  1 207 ? 29.952  5.760   14.334  1.00 40.06  ?  207  ALA A C   1 
ATOM   1600 O  O   . ALA A  1 207 ? 30.183  4.551   14.204  1.00 40.54  ?  207  ALA A O   1 
ATOM   1601 C  CB  . ALA A  1 207 ? 30.150  7.404   12.454  1.00 22.34  ?  207  ALA A CB  1 
ATOM   1602 N  N   . SER A  1 208 ? 30.331  6.467   15.392  1.00 40.62  ?  208  SER A N   1 
ATOM   1603 C  CA  . SER A  1 208 ? 30.975  5.852   16.557  1.00 40.52  ?  208  SER A CA  1 
ATOM   1604 C  C   . SER A  1 208 ? 30.195  4.646   17.072  1.00 37.54  ?  208  SER A C   1 
ATOM   1605 O  O   . SER A  1 208 ? 30.780  3.581   17.319  1.00 32.51  ?  208  SER A O   1 
ATOM   1606 C  CB  . SER A  1 208 ? 31.161  6.884   17.673  1.00 32.21  ?  208  SER A CB  1 
ATOM   1607 O  OG  . SER A  1 208 ? 32.205  7.789   17.353  1.00 37.35  ?  208  SER A OG  1 
ATOM   1608 N  N   . VAL A  1 209 ? 28.877  4.809   17.212  1.00 29.39  ?  209  VAL A N   1 
ATOM   1609 C  CA  . VAL A  1 209 ? 28.028  3.719   17.676  1.00 33.61  ?  209  VAL A CA  1 
ATOM   1610 C  C   . VAL A  1 209 ? 28.203  2.553   16.713  1.00 45.14  ?  209  VAL A C   1 
ATOM   1611 O  O   . VAL A  1 209 ? 28.401  1.403   17.129  1.00 38.56  ?  209  VAL A O   1 
ATOM   1612 C  CB  . VAL A  1 209 ? 26.533  4.131   17.725  1.00 37.05  ?  209  VAL A CB  1 
ATOM   1613 C  CG1 . VAL A  1 209 ? 25.656  2.948   18.073  1.00 34.62  ?  209  VAL A CG1 1 
ATOM   1614 C  CG2 . VAL A  1 209 ? 26.307  5.259   18.713  1.00 34.12  ?  209  VAL A CG2 1 
ATOM   1615 N  N   . GLY A  1 210 ? 28.170  2.873   15.418  1.00 39.72  ?  210  GLY A N   1 
ATOM   1616 C  CA  . GLY A  1 210 ? 28.341  1.876   14.378  1.00 34.96  ?  210  GLY A CA  1 
ATOM   1617 C  C   . GLY A  1 210 ? 29.666  1.147   14.491  1.00 38.00  ?  210  GLY A C   1 
ATOM   1618 O  O   . GLY A  1 210 ? 29.716  -0.081  14.377  1.00 43.90  ?  210  GLY A O   1 
ATOM   1619 N  N   . MET A  1 211 ? 30.741  1.896   14.722  1.00 30.36  ?  211  MET A N   1 
ATOM   1620 C  CA  . MET A  1 211 ? 32.053  1.278   14.938  1.00 34.09  ?  211  MET A CA  1 
ATOM   1621 C  C   . MET A  1 211 ? 32.009  0.280   16.096  1.00 40.57  ?  211  MET A C   1 
ATOM   1622 O  O   . MET A  1 211 ? 32.665  -0.769  16.029  1.00 37.35  ?  211  MET A O   1 
ATOM   1623 C  CB  . MET A  1 211 ? 33.116  2.331   15.247  1.00 41.86  ?  211  MET A CB  1 
ATOM   1624 C  CG  . MET A  1 211 ? 33.013  3.608   14.422  1.00 46.44  ?  211  MET A CG  1 
ATOM   1625 S  SD  . MET A  1 211 ? 34.100  3.623   12.991  1.00 60.31  ?  211  MET A SD  1 
ATOM   1626 C  CE  . MET A  1 211 ? 33.485  5.047   12.080  1.00 41.19  ?  211  MET A CE  1 
ATOM   1627 N  N   . HIS A  1 212 ? 31.246  0.604   17.153  1.00 33.04  ?  212  HIS A N   1 
ATOM   1628 C  CA  . HIS A  1 212 ? 31.195  -0.284  18.320  1.00 38.19  ?  212  HIS A CA  1 
ATOM   1629 C  C   . HIS A  1 212 ? 30.427  -1.568  18.013  1.00 39.47  ?  212  HIS A C   1 
ATOM   1630 O  O   . HIS A  1 212 ? 30.760  -2.635  18.510  1.00 41.91  ?  212  HIS A O   1 
ATOM   1631 C  CB  . HIS A  1 212 ? 30.629  0.420   19.562  1.00 36.16  ?  212  HIS A CB  1 
ATOM   1632 C  CG  . HIS A  1 212 ? 31.526  1.486   20.109  1.00 34.28  ?  212  HIS A CG  1 
ATOM   1633 N  ND1 . HIS A  1 212 ? 32.707  1.203   20.758  1.00 29.26  ?  212  HIS A ND1 1 
ATOM   1634 C  CD2 . HIS A  1 212 ? 31.417  2.837   20.097  1.00 34.48  ?  212  HIS A CD2 1 
ATOM   1635 C  CE1 . HIS A  1 212 ? 33.291  2.333   21.115  1.00 34.34  ?  212  HIS A CE1 1 
ATOM   1636 N  NE2 . HIS A  1 212 ? 32.532  3.340   20.718  1.00 33.80  ?  212  HIS A NE2 1 
ATOM   1637 N  N   . ILE A  1 213 ? 29.403  -1.456  17.179  1.00 37.72  ?  213  ILE A N   1 
ATOM   1638 C  CA  . ILE A  1 213 ? 28.694  -2.629  16.695  1.00 42.08  ?  213  ILE A CA  1 
ATOM   1639 C  C   . ILE A  1 213 ? 29.641  -3.516  15.885  1.00 49.71  ?  213  ILE A C   1 
ATOM   1640 O  O   . ILE A  1 213 ? 29.566  -4.741  15.942  1.00 49.65  ?  213  ILE A O   1 
ATOM   1641 C  CB  . ILE A  1 213 ? 27.495  -2.204  15.821  1.00 45.21  ?  213  ILE A CB  1 
ATOM   1642 C  CG1 . ILE A  1 213 ? 26.499  -1.404  16.665  1.00 44.58  ?  213  ILE A CG1 1 
ATOM   1643 C  CG2 . ILE A  1 213 ? 26.820  -3.415  15.157  1.00 43.50  ?  213  ILE A CG2 1 
ATOM   1644 C  CD1 . ILE A  1 213 ? 25.274  -0.957  15.911  1.00 40.55  ?  213  ILE A CD1 1 
ATOM   1645 N  N   . LEU A  1 214 ? 30.549  -2.891  15.143  1.00 48.35  ?  214  LEU A N   1 
ATOM   1646 C  CA  . LEU A  1 214 ? 31.437  -3.641  14.264  1.00 47.88  ?  214  LEU A CA  1 
ATOM   1647 C  C   . LEU A  1 214 ? 32.747  -4.067  14.922  1.00 50.45  ?  214  LEU A C   1 
ATOM   1648 O  O   . LEU A  1 214 ? 33.557  -4.756  14.297  1.00 53.63  ?  214  LEU A O   1 
ATOM   1649 C  CB  . LEU A  1 214 ? 31.727  -2.840  12.995  1.00 44.95  ?  214  LEU A CB  1 
ATOM   1650 C  CG  . LEU A  1 214 ? 30.472  -2.513  12.193  1.00 44.34  ?  214  LEU A CG  1 
ATOM   1651 C  CD1 . LEU A  1 214 ? 30.780  -1.530  11.070  1.00 37.22  ?  214  LEU A CD1 1 
ATOM   1652 C  CD2 . LEU A  1 214 ? 29.857  -3.805  11.659  1.00 42.01  ?  214  LEU A CD2 1 
ATOM   1653 N  N   . SER A  1 215 ? 32.962  -3.659  16.170  1.00 47.46  ?  215  SER A N   1 
ATOM   1654 C  CA  . SER A  1 215 ? 34.202  -4.006  16.861  1.00 45.98  ?  215  SER A CA  1 
ATOM   1655 C  C   . SER A  1 215 ? 33.978  -4.997  17.991  1.00 52.79  ?  215  SER A C   1 
ATOM   1656 O  O   . SER A  1 215 ? 33.368  -4.665  19.008  1.00 50.91  ?  215  SER A O   1 
ATOM   1657 C  CB  . SER A  1 215 ? 34.887  -2.757  17.399  1.00 44.15  ?  215  SER A CB  1 
ATOM   1658 O  OG  . SER A  1 215 ? 36.261  -3.015  17.610  1.00 43.26  ?  215  SER A OG  1 
ATOM   1659 N  N   . LEU A  1 216 ? 34.492  -6.207  17.810  1.00 58.01  ?  216  LEU A N   1 
ATOM   1660 C  CA  . LEU A  1 216 ? 34.271  -7.296  18.761  1.00 64.06  ?  216  LEU A CA  1 
ATOM   1661 C  C   . LEU A  1 216 ? 34.360  -6.938  20.258  1.00 64.47  ?  216  LEU A C   1 
ATOM   1662 O  O   . LEU A  1 216 ? 33.447  -7.269  21.027  1.00 57.89  ?  216  LEU A O   1 
ATOM   1663 C  CB  . LEU A  1 216 ? 35.175  -8.491  18.439  1.00 68.62  ?  216  LEU A CB  1 
ATOM   1664 C  CG  . LEU A  1 216 ? 34.405  -9.761  18.090  1.00 74.26  ?  216  LEU A CG  1 
ATOM   1665 C  CD1 . LEU A  1 216 ? 33.548  -10.214 19.273  1.00 68.90  ?  216  LEU A CD1 1 
ATOM   1666 C  CD2 . LEU A  1 216 ? 33.547  -9.519  16.848  1.00 73.18  ?  216  LEU A CD2 1 
ATOM   1667 N  N   . PRO A  1 217 ? 35.448  -6.262  20.682  1.00 59.46  ?  217  PRO A N   1 
ATOM   1668 C  CA  . PRO A  1 217 ? 35.515  -6.023  22.133  1.00 49.12  ?  217  PRO A CA  1 
ATOM   1669 C  C   . PRO A  1 217 ? 34.413  -5.102  22.667  1.00 48.80  ?  217  PRO A C   1 
ATOM   1670 O  O   . PRO A  1 217 ? 34.078  -5.207  23.835  1.00 60.97  ?  217  PRO A O   1 
ATOM   1671 C  CB  . PRO A  1 217 ? 36.902  -5.392  22.324  1.00 39.51  ?  217  PRO A CB  1 
ATOM   1672 C  CG  . PRO A  1 217 ? 37.703  -5.864  21.136  1.00 47.15  ?  217  PRO A CG  1 
ATOM   1673 C  CD  . PRO A  1 217 ? 36.701  -5.878  20.002  1.00 46.22  ?  217  PRO A CD  1 
ATOM   1674 N  N   . SER A  1 218 ? 33.845  -4.234  21.836  1.00 44.52  ?  218  SER A N   1 
ATOM   1675 C  CA  . SER A  1 218 ? 32.797  -3.338  22.308  1.00 44.73  ?  218  SER A CA  1 
ATOM   1676 C  C   . SER A  1 218 ? 31.478  -4.061  22.511  1.00 54.77  ?  218  SER A C   1 
ATOM   1677 O  O   . SER A  1 218 ? 30.617  -3.598  23.257  1.00 51.25  ?  218  SER A O   1 
ATOM   1678 C  CB  . SER A  1 218 ? 32.584  -2.183  21.329  1.00 37.62  ?  218  SER A CB  1 
ATOM   1679 O  OG  . SER A  1 218 ? 33.634  -1.249  21.433  1.00 40.94  ?  218  SER A OG  1 
ATOM   1680 N  N   . ARG A  1 219 ? 31.331  -5.200  21.844  1.00 60.59  ?  219  ARG A N   1 
ATOM   1681 C  CA  . ARG A  1 219 ? 30.033  -5.846  21.692  1.00 58.44  ?  219  ARG A CA  1 
ATOM   1682 C  C   . ARG A  1 219 ? 29.405  -6.331  22.991  1.00 57.58  ?  219  ARG A C   1 
ATOM   1683 O  O   . ARG A  1 219 ? 28.179  -6.374  23.112  1.00 60.51  ?  219  ARG A O   1 
ATOM   1684 C  CB  . ARG A  1 219 ? 30.128  -6.990  20.684  1.00 60.59  ?  219  ARG A CB  1 
ATOM   1685 C  CG  . ARG A  1 219 ? 30.188  -6.495  19.256  1.00 66.20  ?  219  ARG A CG  1 
ATOM   1686 C  CD  . ARG A  1 219 ? 29.016  -5.579  18.973  1.00 73.64  ?  219  ARG A CD  1 
ATOM   1687 N  NE  . ARG A  1 219 ? 27.936  -6.262  18.264  1.00 83.50  ?  219  ARG A NE  1 
ATOM   1688 C  CZ  . ARG A  1 219 ? 26.760  -6.571  18.802  1.00 90.10  ?  219  ARG A CZ  1 
ATOM   1689 N  NH1 . ARG A  1 219 ? 26.494  -6.255  20.069  1.00 92.24  ?  219  ARG A NH1 1 
ATOM   1690 N  NH2 . ARG A  1 219 ? 25.845  -7.194  18.065  1.00 87.45  ?  219  ARG A NH2 1 
ATOM   1691 N  N   . SER A  1 220 ? 30.238  -6.699  23.958  1.00 51.07  ?  220  SER A N   1 
ATOM   1692 C  CA  . SER A  1 220 ? 29.724  -7.149  25.242  1.00 61.25  ?  220  SER A CA  1 
ATOM   1693 C  C   . SER A  1 220 ? 29.443  -5.975  26.170  1.00 55.09  ?  220  SER A C   1 
ATOM   1694 O  O   . SER A  1 220 ? 29.070  -6.182  27.312  1.00 64.22  ?  220  SER A O   1 
ATOM   1695 C  CB  . SER A  1 220 ? 30.722  -8.084  25.916  1.00 69.92  ?  220  SER A CB  1 
ATOM   1696 O  OG  . SER A  1 220 ? 31.876  -7.364  26.307  1.00 72.15  ?  220  SER A OG  1 
ATOM   1697 N  N   . LEU A  1 221 ? 29.631  -4.751  25.681  1.00 46.87  ?  221  LEU A N   1 
ATOM   1698 C  CA  . LEU A  1 221 ? 29.466  -3.558  26.508  1.00 40.83  ?  221  LEU A CA  1 
ATOM   1699 C  C   . LEU A  1 221 ? 28.124  -2.884  26.324  1.00 43.52  ?  221  LEU A C   1 
ATOM   1700 O  O   . LEU A  1 221 ? 27.799  -1.955  27.062  1.00 50.08  ?  221  LEU A O   1 
ATOM   1701 C  CB  . LEU A  1 221 ? 30.579  -2.542  26.248  1.00 40.56  ?  221  LEU A CB  1 
ATOM   1702 C  CG  . LEU A  1 221 ? 31.981  -3.102  26.475  1.00 46.77  ?  221  LEU A CG  1 
ATOM   1703 C  CD1 . LEU A  1 221 ? 33.043  -2.043  26.191  1.00 45.19  ?  221  LEU A CD1 1 
ATOM   1704 C  CD2 . LEU A  1 221 ? 32.099  -3.654  27.894  1.00 41.04  ?  221  LEU A CD2 1 
ATOM   1705 N  N   . PHE A  1 222 ? 27.346  -3.333  25.340  1.00 35.56  ?  222  PHE A N   1 
ATOM   1706 C  CA  . PHE A  1 222 ? 26.019  -2.758  25.123  1.00 34.17  ?  222  PHE A CA  1 
ATOM   1707 C  C   . PHE A  1 222 ? 25.064  -3.783  24.512  1.00 43.81  ?  222  PHE A C   1 
ATOM   1708 O  O   . PHE A  1 222 ? 25.477  -4.894  24.187  1.00 49.86  ?  222  PHE A O   1 
ATOM   1709 C  CB  . PHE A  1 222 ? 26.106  -1.479  24.289  1.00 35.41  ?  222  PHE A CB  1 
ATOM   1710 C  CG  . PHE A  1 222 ? 26.617  -1.700  22.893  1.00 37.90  ?  222  PHE A CG  1 
ATOM   1711 C  CD1 . PHE A  1 222 ? 27.975  -1.880  22.652  1.00 36.98  ?  222  PHE A CD1 1 
ATOM   1712 C  CD2 . PHE A  1 222 ? 25.742  -1.729  21.820  1.00 37.81  ?  222  PHE A CD2 1 
ATOM   1713 C  CE1 . PHE A  1 222 ? 28.446  -2.085  21.360  1.00 41.24  ?  222  PHE A CE1 1 
ATOM   1714 C  CE2 . PHE A  1 222 ? 26.207  -1.933  20.528  1.00 40.41  ?  222  PHE A CE2 1 
ATOM   1715 C  CZ  . PHE A  1 222 ? 27.560  -2.102  20.299  1.00 38.52  ?  222  PHE A CZ  1 
ATOM   1716 N  N   . HIS A  1 223 ? 23.790  -3.424  24.370  1.00 43.98  ?  223  HIS A N   1 
ATOM   1717 C  CA  . HIS A  1 223 ? 22.793  -4.398  23.921  1.00 48.97  ?  223  HIS A CA  1 
ATOM   1718 C  C   . HIS A  1 223 ? 21.941  -3.925  22.740  1.00 52.40  ?  223  HIS A C   1 
ATOM   1719 O  O   . HIS A  1 223 ? 21.370  -4.733  22.007  1.00 60.32  ?  223  HIS A O   1 
ATOM   1720 C  CB  . HIS A  1 223 ? 21.913  -4.785  25.103  1.00 45.94  ?  223  HIS A CB  1 
ATOM   1721 C  CG  . HIS A  1 223 ? 22.702  -5.090  26.330  1.00 55.53  ?  223  HIS A CG  1 
ATOM   1722 N  ND1 . HIS A  1 223 ? 23.207  -4.101  27.151  1.00 55.58  ?  223  HIS A ND1 1 
ATOM   1723 C  CD2 . HIS A  1 223 ? 23.135  -6.265  26.843  1.00 49.92  ?  223  HIS A CD2 1 
ATOM   1724 C  CE1 . HIS A  1 223 ? 23.901  -4.656  28.125  1.00 42.87  ?  223  HIS A CE1 1 
ATOM   1725 N  NE2 . HIS A  1 223 ? 23.869  -5.967  27.963  1.00 47.73  ?  223  HIS A NE2 1 
ATOM   1726 N  N   . ARG A  1 224 ? 21.875  -2.612  22.565  1.00 43.66  ?  224  ARG A N   1 
ATOM   1727 C  CA  . ARG A  1 224 ? 21.001  -1.993  21.590  1.00 35.51  ?  224  ARG A CA  1 
ATOM   1728 C  C   . ARG A  1 224 ? 21.648  -0.697  21.156  1.00 39.38  ?  224  ARG A C   1 
ATOM   1729 O  O   . ARG A  1 224 ? 22.446  -0.122  21.892  1.00 43.89  ?  224  ARG A O   1 
ATOM   1730 C  CB  . ARG A  1 224 ? 19.630  -1.714  22.214  1.00 40.42  ?  224  ARG A CB  1 
ATOM   1731 C  CG  . ARG A  1 224 ? 18.696  -2.903  22.177  1.00 48.66  ?  224  ARG A CG  1 
ATOM   1732 C  CD  . ARG A  1 224 ? 17.452  -2.658  22.983  1.00 54.84  ?  224  ARG A CD  1 
ATOM   1733 N  NE  . ARG A  1 224 ? 17.732  -2.703  24.411  1.00 65.94  ?  224  ARG A NE  1 
ATOM   1734 C  CZ  . ARG A  1 224 ? 17.861  -3.824  25.112  1.00 69.08  ?  224  ARG A CZ  1 
ATOM   1735 N  NH1 . ARG A  1 224 ? 17.739  -5.007  24.524  1.00 72.55  ?  224  ARG A NH1 1 
ATOM   1736 N  NH2 . ARG A  1 224 ? 18.115  -3.761  26.405  1.00 72.08  ?  224  ARG A NH2 1 
ATOM   1737 N  N   . ALA A  1 225 ? 21.308  -0.229  19.964  1.00 44.16  ?  225  ALA A N   1 
ATOM   1738 C  CA  . ALA A  1 225 ? 21.971  0.937   19.420  1.00 43.16  ?  225  ALA A CA  1 
ATOM   1739 C  C   . ALA A  1 225 ? 21.016  1.799   18.620  1.00 41.73  ?  225  ALA A C   1 
ATOM   1740 O  O   . ALA A  1 225 ? 20.113  1.283   17.970  1.00 33.79  ?  225  ALA A O   1 
ATOM   1741 C  CB  . ALA A  1 225 ? 23.123  0.505   18.556  1.00 44.51  ?  225  ALA A CB  1 
ATOM   1742 N  N   . VAL A  1 226 ? 21.221  3.114   18.699  1.00 39.29  ?  226  VAL A N   1 
ATOM   1743 C  CA  . VAL A  1 226 ? 20.493  4.088   17.900  1.00 35.48  ?  226  VAL A CA  1 
ATOM   1744 C  C   . VAL A  1 226 ? 21.495  4.948   17.136  1.00 44.43  ?  226  VAL A C   1 
ATOM   1745 O  O   . VAL A  1 226 ? 22.428  5.479   17.739  1.00 45.00  ?  226  VAL A O   1 
ATOM   1746 C  CB  . VAL A  1 226 ? 19.670  5.028   18.767  1.00 41.40  ?  226  VAL A CB  1 
ATOM   1747 C  CG1 . VAL A  1 226 ? 19.012  6.094   17.892  1.00 39.49  ?  226  VAL A CG1 1 
ATOM   1748 C  CG2 . VAL A  1 226 ? 18.639  4.250   19.598  1.00 41.21  ?  226  VAL A CG2 1 
ATOM   1749 N  N   . LEU A  1 227 ? 21.314  5.069   15.816  1.00 38.44  ?  227  LEU A N   1 
ATOM   1750 C  CA  . LEU A  1 227 ? 22.202  5.880   14.983  1.00 36.46  ?  227  LEU A CA  1 
ATOM   1751 C  C   . LEU A  1 227 ? 21.423  7.004   14.315  1.00 39.23  ?  227  LEU A C   1 
ATOM   1752 O  O   . LEU A  1 227 ? 20.607  6.761   13.419  1.00 41.46  ?  227  LEU A O   1 
ATOM   1753 C  CB  . LEU A  1 227 ? 22.906  5.028   13.919  1.00 38.98  ?  227  LEU A CB  1 
ATOM   1754 C  CG  . LEU A  1 227 ? 23.910  3.960   14.388  1.00 43.06  ?  227  LEU A CG  1 
ATOM   1755 C  CD1 . LEU A  1 227 ? 23.204  2.724   14.876  1.00 41.62  ?  227  LEU A CD1 1 
ATOM   1756 C  CD2 . LEU A  1 227 ? 24.899  3.586   13.295  1.00 36.54  ?  227  LEU A CD2 1 
ATOM   1757 N  N   . GLN A  1 228 ? 21.673  8.234   14.754  1.00 38.98  ?  228  GLN A N   1 
ATOM   1758 C  CA  . GLN A  1 228 ? 20.955  9.392   14.227  1.00 41.16  ?  228  GLN A CA  1 
ATOM   1759 C  C   . GLN A  1 228 ? 21.820  10.142  13.203  1.00 42.20  ?  228  GLN A C   1 
ATOM   1760 O  O   . GLN A  1 228 ? 22.851  10.717  13.565  1.00 38.23  ?  228  GLN A O   1 
ATOM   1761 C  CB  . GLN A  1 228 ? 20.527  10.317  15.374  1.00 39.66  ?  228  GLN A CB  1 
ATOM   1762 C  CG  . GLN A  1 228 ? 19.705  9.613   16.446  1.00 45.03  ?  228  GLN A CG  1 
ATOM   1763 C  CD  . GLN A  1 228 ? 19.498  10.436  17.723  1.00 45.06  ?  228  GLN A CD  1 
ATOM   1764 O  OE1 . GLN A  1 228 ? 19.301  9.872   18.798  1.00 39.33  ?  228  GLN A OE1 1 
ATOM   1765 N  NE2 . GLN A  1 228 ? 19.524  11.764  17.604  1.00 43.81  ?  228  GLN A NE2 1 
ATOM   1766 N  N   . SER A  1 229 ? 21.415  10.102  11.930  1.00 32.45  ?  229  SER A N   1 
ATOM   1767 C  CA  . SER A  1 229 ? 22.118  10.818  10.858  1.00 27.95  ?  229  SER A CA  1 
ATOM   1768 C  C   . SER A  1 229 ? 23.622  10.571  10.804  1.00 31.66  ?  229  SER A C   1 
ATOM   1769 O  O   . SER A  1 229 ? 24.403  11.516  10.678  1.00 31.01  ?  229  SER A O   1 
ATOM   1770 C  CB  . SER A  1 229 ? 21.894  12.322  10.964  1.00 28.56  ?  229  SER A CB  1 
ATOM   1771 O  OG  . SER A  1 229 ? 20.572  12.614  11.358  1.00 34.55  ?  229  SER A OG  1 
ATOM   1772 N  N   . GLY A  1 230 ? 24.026  9.312   10.903  1.00 25.65  ?  230  GLY A N   1 
ATOM   1773 C  CA  . GLY A  1 230 ? 25.421  8.974   10.747  1.00 24.35  ?  230  GLY A CA  1 
ATOM   1774 C  C   . GLY A  1 230 ? 25.599  7.471   10.702  1.00 35.75  ?  230  GLY A C   1 
ATOM   1775 O  O   . GLY A  1 230 ? 24.792  6.727   11.263  1.00 34.83  ?  230  GLY A O   1 
ATOM   1776 N  N   . THR A  1 231 ? 26.660  7.020   10.040  1.00 32.11  ?  231  THR A N   1 
ATOM   1777 C  CA  . THR A  1 231 ? 26.902  5.596   9.860   1.00 34.69  ?  231  THR A CA  1 
ATOM   1778 C  C   . THR A  1 231 ? 28.397  5.359   9.857   1.00 35.56  ?  231  THR A C   1 
ATOM   1779 O  O   . THR A  1 231 ? 29.162  6.262   9.536   1.00 36.82  ?  231  THR A O   1 
ATOM   1780 C  CB  . THR A  1 231 ? 26.327  5.080   8.502   1.00 42.63  ?  231  THR A CB  1 
ATOM   1781 O  OG1 . THR A  1 231 ? 26.842  5.876   7.434   1.00 41.47  ?  231  THR A OG1 1 
ATOM   1782 C  CG2 . THR A  1 231 ? 24.797  5.124   8.467   1.00 33.26  ?  231  THR A CG2 1 
ATOM   1783 N  N   . PRO A  1 232 ? 28.825  4.141   10.219  1.00 43.08  ?  232  PRO A N   1 
ATOM   1784 C  CA  . PRO A  1 232 ? 30.261  3.848   10.160  1.00 42.90  ?  232  PRO A CA  1 
ATOM   1785 C  C   . PRO A  1 232 ? 30.716  3.697   8.702   1.00 45.88  ?  232  PRO A C   1 
ATOM   1786 O  O   . PRO A  1 232 ? 31.817  4.120   8.332   1.00 43.12  ?  232  PRO A O   1 
ATOM   1787 C  CB  . PRO A  1 232 ? 30.381  2.531   10.947  1.00 38.55  ?  232  PRO A CB  1 
ATOM   1788 C  CG  . PRO A  1 232 ? 29.025  1.891   10.836  1.00 30.88  ?  232  PRO A CG  1 
ATOM   1789 C  CD  . PRO A  1 232 ? 28.046  3.030   10.804  1.00 38.62  ?  232  PRO A CD  1 
ATOM   1790 N  N   . ASN A  1 233 ? 29.857  3.108   7.874   1.00 48.33  ?  233  ASN A N   1 
ATOM   1791 C  CA  . ASN A  1 233 ? 30.065  3.113   6.429   1.00 42.76  ?  233  ASN A CA  1 
ATOM   1792 C  C   . ASN A  1 233 ? 29.886  4.529   5.857   1.00 43.06  ?  233  ASN A C   1 
ATOM   1793 O  O   . ASN A  1 233 ? 29.494  5.455   6.567   1.00 43.56  ?  233  ASN A O   1 
ATOM   1794 C  CB  . ASN A  1 233 ? 29.119  2.122   5.740   1.00 37.91  ?  233  ASN A CB  1 
ATOM   1795 C  CG  . ASN A  1 233 ? 27.660  2.299   6.166   1.00 42.79  ?  233  ASN A CG  1 
ATOM   1796 O  OD1 . ASN A  1 233 ? 27.339  2.295   7.352   1.00 56.29  ?  233  ASN A OD1 1 
ATOM   1797 N  ND2 . ASN A  1 233 ? 26.775  2.458   5.195   1.00 39.27  ?  233  ASN A ND2 1 
ATOM   1798 N  N   . GLY A  1 234 ? 30.182  4.707   4.577   1.00 45.46  ?  234  GLY A N   1 
ATOM   1799 C  CA  . GLY A  1 234 ? 30.016  6.014   3.965   1.00 41.00  ?  234  GLY A CA  1 
ATOM   1800 C  C   . GLY A  1 234 ? 31.332  6.675   3.635   1.00 41.59  ?  234  GLY A C   1 
ATOM   1801 O  O   . GLY A  1 234 ? 32.398  6.115   3.882   1.00 51.09  ?  234  GLY A O   1 
ATOM   1802 N  N   . PRO A  1 235 ? 31.266  7.888   3.086   1.00 41.63  ?  235  PRO A N   1 
ATOM   1803 C  CA  . PRO A  1 235 ? 32.437  8.541   2.489   1.00 40.75  ?  235  PRO A CA  1 
ATOM   1804 C  C   . PRO A  1 235 ? 33.327  9.322   3.459   1.00 46.01  ?  235  PRO A C   1 
ATOM   1805 O  O   . PRO A  1 235 ? 34.464  9.643   3.099   1.00 46.91  ?  235  PRO A O   1 
ATOM   1806 C  CB  . PRO A  1 235 ? 31.807  9.491   1.470   1.00 37.61  ?  235  PRO A CB  1 
ATOM   1807 C  CG  . PRO A  1 235 ? 30.479  9.847   2.063   1.00 41.15  ?  235  PRO A CG  1 
ATOM   1808 C  CD  . PRO A  1 235 ? 30.022  8.641   2.850   1.00 43.79  ?  235  PRO A CD  1 
ATOM   1809 N  N   . TRP A  1 236 ? 32.836  9.612   4.663   1.00 44.31  ?  236  TRP A N   1 
ATOM   1810 C  CA  . TRP A  1 236 ? 33.564  10.488  5.582   1.00 40.04  ?  236  TRP A CA  1 
ATOM   1811 C  C   . TRP A  1 236 ? 34.001  9.860   6.925   1.00 45.23  ?  236  TRP A C   1 
ATOM   1812 O  O   . TRP A  1 236 ? 34.900  10.375  7.583   1.00 46.64  ?  236  TRP A O   1 
ATOM   1813 C  CB  . TRP A  1 236 ? 32.740  11.747  5.853   1.00 28.90  ?  236  TRP A CB  1 
ATOM   1814 C  CG  . TRP A  1 236 ? 31.408  11.444  6.506   1.00 37.28  ?  236  TRP A CG  1 
ATOM   1815 C  CD1 . TRP A  1 236 ? 30.213  11.289  5.884   1.00 36.25  ?  236  TRP A CD1 1 
ATOM   1816 C  CD2 . TRP A  1 236 ? 31.156  11.249  7.905   1.00 44.41  ?  236  TRP A CD2 1 
ATOM   1817 N  NE1 . TRP A  1 236 ? 29.230  11.019  6.798   1.00 36.60  ?  236  TRP A NE1 1 
ATOM   1818 C  CE2 . TRP A  1 236 ? 29.779  10.987  8.049   1.00 43.76  ?  236  TRP A CE2 1 
ATOM   1819 C  CE3 . TRP A  1 236 ? 31.958  11.282  9.049   1.00 41.17  ?  236  TRP A CE3 1 
ATOM   1820 C  CZ2 . TRP A  1 236 ? 29.179  10.751  9.294   1.00 40.12  ?  236  TRP A CZ2 1 
ATOM   1821 C  CZ3 . TRP A  1 236 ? 31.363  11.051  10.279  1.00 47.41  ?  236  TRP A CZ3 1 
ATOM   1822 C  CH2 . TRP A  1 236 ? 29.984  10.791  10.391  1.00 42.05  ?  236  TRP A CH2 1 
ATOM   1823 N  N   . ALA A  1 237 ? 33.376  8.762   7.332   1.00 42.53  ?  237  ALA A N   1 
ATOM   1824 C  CA  . ALA A  1 237 ? 33.576  8.261   8.700   1.00 39.42  ?  237  ALA A CA  1 
ATOM   1825 C  C   . ALA A  1 237 ? 34.900  7.530   8.933   1.00 39.90  ?  237  ALA A C   1 
ATOM   1826 O  O   . ALA A  1 237 ? 35.381  7.472   10.059  1.00 46.58  ?  237  ALA A O   1 
ATOM   1827 C  CB  . ALA A  1 237 ? 32.376  7.401   9.159   1.00 23.41  ?  237  ALA A CB  1 
ATOM   1828 N  N   . THR A  1 238 ? 35.492  6.981   7.879   1.00 37.19  ?  238  THR A N   1 
ATOM   1829 C  CA  . THR A  1 238 ? 36.789  6.309   7.994   1.00 39.33  ?  238  THR A CA  1 
ATOM   1830 C  C   . THR A  1 238 ? 37.769  6.734   6.904   1.00 51.17  ?  238  THR A C   1 
ATOM   1831 O  O   . THR A  1 238 ? 37.371  7.248   5.860   1.00 57.84  ?  238  THR A O   1 
ATOM   1832 C  CB  . THR A  1 238 ? 36.655  4.766   7.921   1.00 41.66  ?  238  THR A CB  1 
ATOM   1833 O  OG1 . THR A  1 238 ? 36.119  4.387   6.645   1.00 56.28  ?  238  THR A OG1 1 
ATOM   1834 C  CG2 . THR A  1 238 ? 35.743  4.253   9.005   1.00 43.10  ?  238  THR A CG2 1 
ATOM   1835 N  N   . VAL A  1 239 ? 39.055  6.508   7.149   1.00 49.49  ?  239  VAL A N   1 
ATOM   1836 C  CA  . VAL A  1 239 ? 40.073  6.629   6.109   1.00 39.11  ?  239  VAL A CA  1 
ATOM   1837 C  C   . VAL A  1 239 ? 40.927  5.367   6.156   1.00 44.67  ?  239  VAL A C   1 
ATOM   1838 O  O   . VAL A  1 239 ? 40.993  4.690   7.185   1.00 51.25  ?  239  VAL A O   1 
ATOM   1839 C  CB  . VAL A  1 239 ? 40.966  7.881   6.293   1.00 38.86  ?  239  VAL A CB  1 
ATOM   1840 C  CG1 . VAL A  1 239 ? 40.172  9.158   6.032   1.00 28.23  ?  239  VAL A CG1 1 
ATOM   1841 C  CG2 . VAL A  1 239 ? 41.591  7.903   7.696   1.00 36.91  ?  239  VAL A CG2 1 
ATOM   1842 N  N   . SER A  1 240 ? 41.560  5.032   5.041   1.00 42.46  ?  240  SER A N   1 
ATOM   1843 C  CA  . SER A  1 240 ? 42.407  3.846   4.980   1.00 41.86  ?  240  SER A CA  1 
ATOM   1844 C  C   . SER A  1 240 ? 43.680  4.082   5.786   1.00 35.49  ?  240  SER A C   1 
ATOM   1845 O  O   . SER A  1 240 ? 44.000  5.223   6.128   1.00 40.40  ?  240  SER A O   1 
ATOM   1846 C  CB  . SER A  1 240 ? 42.789  3.576   3.531   1.00 38.34  ?  240  SER A CB  1 
ATOM   1847 O  OG  . SER A  1 240 ? 43.339  4.764   2.963   1.00 42.60  ?  240  SER A OG  1 
ATOM   1848 N  N   . ALA A  1 241 ? 44.427  3.018   6.058   1.00 38.34  ?  241  ALA A N   1 
ATOM   1849 C  CA  . ALA A  1 241 ? 45.711  3.178   6.738   1.00 51.61  ?  241  ALA A CA  1 
ATOM   1850 C  C   . ALA A  1 241 ? 46.605  4.114   5.932   1.00 51.55  ?  241  ALA A C   1 
ATOM   1851 O  O   . ALA A  1 241 ? 47.250  5.005   6.486   1.00 45.48  ?  241  ALA A O   1 
ATOM   1852 C  CB  . ALA A  1 241 ? 46.389  1.831   6.946   1.00 54.02  ?  241  ALA A CB  1 
ATOM   1853 N  N   . GLY A  1 242 ? 46.612  3.920   4.616   1.00 53.38  ?  242  GLY A N   1 
ATOM   1854 C  CA  . GLY A  1 242 ? 47.427  4.731   3.733   1.00 49.34  ?  242  GLY A CA  1 
ATOM   1855 C  C   . GLY A  1 242 ? 47.127  6.213   3.850   1.00 46.10  ?  242  GLY A C   1 
ATOM   1856 O  O   . GLY A  1 242 ? 48.028  7.039   3.989   1.00 45.67  ?  242  GLY A O   1 
ATOM   1857 N  N   . GLU A  1 243 ? 45.853  6.558   3.808   1.00 31.96  ?  243  GLU A N   1 
ATOM   1858 C  CA  . GLU A  1 243 ? 45.485  7.957   3.809   1.00 40.93  ?  243  GLU A CA  1 
ATOM   1859 C  C   . GLU A  1 243 ? 45.782  8.611   5.146   1.00 49.68  ?  243  GLU A C   1 
ATOM   1860 O  O   . GLU A  1 243 ? 46.180  9.774   5.197   1.00 51.67  ?  243  GLU A O   1 
ATOM   1861 C  CB  . GLU A  1 243 ? 44.014  8.137   3.422   1.00 41.83  ?  243  GLU A CB  1 
ATOM   1862 C  CG  . GLU A  1 243 ? 43.513  9.584   3.509   1.00 50.40  ?  243  GLU A CG  1 
ATOM   1863 C  CD  . GLU A  1 243 ? 44.167  10.531  2.491   1.00 52.27  ?  243  GLU A CD  1 
ATOM   1864 O  OE1 . GLU A  1 243 ? 44.905  10.062  1.594   1.00 48.74  ?  243  GLU A OE1 1 
ATOM   1865 O  OE2 . GLU A  1 243 ? 43.946  11.759  2.597   1.00 53.49  ?  243  GLU A OE2 1 
ATOM   1866 N  N   . ALA A  1 244 ? 45.601  7.865   6.232   1.00 51.35  ?  244  ALA A N   1 
ATOM   1867 C  CA  . ALA A  1 244 ? 45.818  8.436   7.553   1.00 43.59  ?  244  ALA A CA  1 
ATOM   1868 C  C   . ALA A  1 244 ? 47.301  8.717   7.741   1.00 42.80  ?  244  ALA A C   1 
ATOM   1869 O  O   . ALA A  1 244 ? 47.689  9.736   8.317   1.00 47.55  ?  244  ALA A O   1 
ATOM   1870 C  CB  . ALA A  1 244 ? 45.287  7.510   8.651   1.00 40.73  ?  244  ALA A CB  1 
ATOM   1871 N  N   . ARG A  1 245 ? 48.133  7.817   7.239   1.00 40.93  ?  245  ARG A N   1 
ATOM   1872 C  CA  . ARG A  1 245 ? 49.572  8.021   7.314   1.00 44.61  ?  245  ARG A CA  1 
ATOM   1873 C  C   . ARG A  1 245 ? 49.945  9.308   6.585   1.00 50.96  ?  245  ARG A C   1 
ATOM   1874 O  O   . ARG A  1 245 ? 50.677  10.141  7.115   1.00 54.18  ?  245  ARG A O   1 
ATOM   1875 C  CB  . ARG A  1 245 ? 50.343  6.830   6.729   1.00 37.96  ?  245  ARG A CB  1 
ATOM   1876 C  CG  . ARG A  1 245 ? 51.865  7.005   6.805   1.00 38.92  ?  245  ARG A CG  1 
ATOM   1877 C  CD  . ARG A  1 245 ? 52.598  5.703   6.544   1.00 39.97  ?  245  ARG A CD  1 
ATOM   1878 N  NE  . ARG A  1 245 ? 52.485  4.808   7.684   1.00 58.15  ?  245  ARG A NE  1 
ATOM   1879 C  CZ  . ARG A  1 245 ? 53.323  4.814   8.715   1.00 61.80  ?  245  ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A  1 245 ? 54.347  5.658   8.737   1.00 53.94  ?  245  ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A  1 245 ? 53.141  3.972   9.722   1.00 71.60  ?  245  ARG A NH2 1 
ATOM   1882 N  N   . ARG A  1 246 ? 49.422  9.468   5.373   1.00 44.85  ?  246  ARG A N   1 
ATOM   1883 C  CA  . ARG A  1 246 ? 49.712  10.645  4.568   1.00 44.38  ?  246  ARG A CA  1 
ATOM   1884 C  C   . ARG A  1 246 ? 49.326  11.939  5.285   1.00 48.97  ?  246  ARG A C   1 
ATOM   1885 O  O   . ARG A  1 246 ? 50.042  12.939  5.214   1.00 50.01  ?  246  ARG A O   1 
ATOM   1886 C  CB  . ARG A  1 246 ? 48.985  10.566  3.232   1.00 50.05  ?  246  ARG A CB  1 
ATOM   1887 C  CG  . ARG A  1 246 ? 49.363  11.689  2.288   1.00 56.21  ?  246  ARG A CG  1 
ATOM   1888 C  CD  . ARG A  1 246 ? 48.429  11.753  1.109   1.00 48.26  ?  246  ARG A CD  1 
ATOM   1889 N  NE  . ARG A  1 246 ? 47.096  12.235  1.464   1.00 47.10  ?  246  ARG A NE  1 
ATOM   1890 C  CZ  . ARG A  1 246 ? 46.801  13.506  1.738   1.00 45.12  ?  246  ARG A CZ  1 
ATOM   1891 N  NH1 . ARG A  1 246 ? 47.752  14.432  1.732   1.00 41.96  ?  246  ARG A NH1 1 
ATOM   1892 N  NH2 . ARG A  1 246 ? 45.550  13.853  2.026   1.00 40.40  ?  246  ARG A NH2 1 
ATOM   1893 N  N   . ARG A  1 247 ? 48.194  11.914  5.981   1.00 45.89  ?  247  ARG A N   1 
ATOM   1894 C  CA  . ARG A  1 247 ? 47.719  13.101  6.678   1.00 45.72  ?  247  ARG A CA  1 
ATOM   1895 C  C   . ARG A  1 247 ? 48.506  13.396  7.963   1.00 50.14  ?  247  ARG A C   1 
ATOM   1896 O  O   . ARG A  1 247 ? 48.801  14.551  8.262   1.00 50.83  ?  247  ARG A O   1 
ATOM   1897 C  CB  . ARG A  1 247 ? 46.229  12.988  6.971   1.00 37.46  ?  247  ARG A CB  1 
ATOM   1898 C  CG  . ARG A  1 247 ? 45.362  12.874  5.732   1.00 39.04  ?  247  ARG A CG  1 
ATOM   1899 C  CD  . ARG A  1 247 ? 43.904  12.694  6.157   1.00 41.04  ?  247  ARG A CD  1 
ATOM   1900 N  NE  . ARG A  1 247 ? 42.969  12.556  5.050   1.00 40.21  ?  247  ARG A NE  1 
ATOM   1901 C  CZ  . ARG A  1 247 ? 41.650  12.553  5.203   1.00 50.05  ?  247  ARG A CZ  1 
ATOM   1902 N  NH1 . ARG A  1 247 ? 41.127  12.687  6.421   1.00 52.38  ?  247  ARG A NH1 1 
ATOM   1903 N  NH2 . ARG A  1 247 ? 40.852  12.430  4.147   1.00 34.46  ?  247  ARG A NH2 1 
ATOM   1904 N  N   . ALA A  1 248 ? 48.845  12.359  8.719   1.00 50.51  ?  248  ALA A N   1 
ATOM   1905 C  CA  . ALA A  1 248 ? 49.657  12.543  9.921   1.00 50.05  ?  248  ALA A CA  1 
ATOM   1906 C  C   . ALA A  1 248 ? 51.025  13.089  9.533   1.00 52.29  ?  248  ALA A C   1 
ATOM   1907 O  O   . ALA A  1 248 ? 51.552  14.015  10.153  1.00 52.32  ?  248  ALA A O   1 
ATOM   1908 C  CB  . ALA A  1 248 ? 49.809  11.235  10.652  1.00 44.22  ?  248  ALA A CB  1 
ATOM   1909 N  N   . THR A  1 249 ? 51.576  12.509  8.478   1.00 50.33  ?  249  THR A N   1 
ATOM   1910 C  CA  . THR A  1 249 ? 52.887  12.866  7.972   1.00 47.27  ?  249  THR A CA  1 
ATOM   1911 C  C   . THR A  1 249 ? 52.911  14.311  7.499   1.00 44.08  ?  249  THR A C   1 
ATOM   1912 O  O   . THR A  1 249 ? 53.863  15.045  7.756   1.00 52.27  ?  249  THR A O   1 
ATOM   1913 C  CB  . THR A  1 249 ? 53.270  11.919  6.824   1.00 53.22  ?  249  THR A CB  1 
ATOM   1914 O  OG1 . THR A  1 249 ? 53.410  10.586  7.342   1.00 60.64  ?  249  THR A OG1 1 
ATOM   1915 C  CG2 . THR A  1 249 ? 54.556  12.352  6.172   1.00 46.42  ?  249  THR A CG2 1 
ATOM   1916 N  N   . LEU A  1 250 ? 51.843  14.727  6.831   1.00 46.18  ?  250  LEU A N   1 
ATOM   1917 C  CA  . LEU A  1 250 ? 51.761  16.086  6.309   1.00 48.68  ?  250  LEU A CA  1 
ATOM   1918 C  C   . LEU A  1 250 ? 51.582  17.104  7.434   1.00 55.18  ?  250  LEU A C   1 
ATOM   1919 O  O   . LEU A  1 250 ? 52.206  18.174  7.423   1.00 54.93  ?  250  LEU A O   1 
ATOM   1920 C  CB  . LEU A  1 250 ? 50.636  16.211  5.283   1.00 39.57  ?  250  LEU A CB  1 
ATOM   1921 C  CG  . LEU A  1 250 ? 50.385  17.636  4.781   1.00 47.65  ?  250  LEU A CG  1 
ATOM   1922 C  CD1 . LEU A  1 250 ? 51.670  18.301  4.298   1.00 46.24  ?  250  LEU A CD1 1 
ATOM   1923 C  CD2 . LEU A  1 250 ? 49.359  17.633  3.673   1.00 40.04  ?  250  LEU A CD2 1 
ATOM   1924 N  N   . LEU A  1 251 ? 50.736  16.765  8.404   1.00 55.41  ?  251  LEU A N   1 
ATOM   1925 C  CA  . LEU A  1 251 ? 50.498  17.645  9.543   1.00 47.99  ?  251  LEU A CA  1 
ATOM   1926 C  C   . LEU A  1 251 ? 51.767  17.840  10.355  1.00 46.19  ?  251  LEU A C   1 
ATOM   1927 O  O   . LEU A  1 251 ? 52.058  18.953  10.792  1.00 51.60  ?  251  LEU A O   1 
ATOM   1928 C  CB  . LEU A  1 251 ? 49.391  17.112  10.437  1.00 47.25  ?  251  LEU A CB  1 
ATOM   1929 C  CG  . LEU A  1 251 ? 49.241  17.968  11.697  1.00 49.01  ?  251  LEU A CG  1 
ATOM   1930 C  CD1 . LEU A  1 251 ? 48.191  19.076  11.530  1.00 45.84  ?  251  LEU A CD1 1 
ATOM   1931 C  CD2 . LEU A  1 251 ? 48.937  17.085  12.872  1.00 50.46  ?  251  LEU A CD2 1 
ATOM   1932 N  N   . ALA A  1 252 ? 52.522  16.759  10.540  1.00 47.44  ?  252  ALA A N   1 
ATOM   1933 C  CA  . ALA A  1 252 ? 53.860  16.848  11.135  1.00 47.09  ?  252  ALA A CA  1 
ATOM   1934 C  C   . ALA A  1 252 ? 54.722  17.884  10.421  1.00 51.64  ?  252  ALA A C   1 
ATOM   1935 O  O   . ALA A  1 252 ? 55.288  18.754  11.075  1.00 50.76  ?  252  ALA A O   1 
ATOM   1936 C  CB  . ALA A  1 252 ? 54.558  15.490  11.133  1.00 38.94  ?  252  ALA A CB  1 
ATOM   1937 N  N   . ARG A  1 253 ? 54.814  17.797  9.088   1.00 47.48  ?  253  ARG A N   1 
ATOM   1938 C  CA  . ARG A  1 253 ? 55.584  18.775  8.315   1.00 52.70  ?  253  ARG A CA  1 
ATOM   1939 C  C   . ARG A  1 253 ? 55.104  20.199  8.585   1.00 54.11  ?  253  ARG A C   1 
ATOM   1940 O  O   . ARG A  1 253 ? 55.903  21.085  8.881   1.00 56.40  ?  253  ARG A O   1 
ATOM   1941 C  CB  . ARG A  1 253 ? 55.511  18.502  6.802   1.00 51.21  ?  253  ARG A CB  1 
ATOM   1942 C  CG  . ARG A  1 253 ? 56.244  17.263  6.316   1.00 65.01  ?  253  ARG A CG  1 
ATOM   1943 C  CD  . ARG A  1 253 ? 56.365  17.278  4.781   1.00 84.16  ?  253  ARG A CD  1 
ATOM   1944 N  NE  . ARG A  1 253 ? 56.823  16.007  4.216   1.00 91.55  ?  253  ARG A NE  1 
ATOM   1945 C  CZ  . ARG A  1 253 ? 56.022  15.067  3.708   1.00 88.92  ?  253  ARG A CZ  1 
ATOM   1946 N  NH1 . ARG A  1 253 ? 54.701  15.237  3.691   1.00 75.05  ?  253  ARG A NH1 1 
ATOM   1947 N  NH2 . ARG A  1 253 ? 56.546  13.947  3.216   1.00 89.48  ?  253  ARG A NH2 1 
ATOM   1948 N  N   . LEU A  1 254 ? 53.793  20.407  8.490   1.00 51.55  ?  254  LEU A N   1 
ATOM   1949 C  CA  . LEU A  1 254 ? 53.205  21.738  8.638   1.00 48.88  ?  254  LEU A CA  1 
ATOM   1950 C  C   . LEU A  1 254 ? 53.499  22.375  9.990   1.00 57.92  ?  254  LEU A C   1 
ATOM   1951 O  O   . LEU A  1 254 ? 53.457  23.595  10.123  1.00 63.41  ?  254  LEU A O   1 
ATOM   1952 C  CB  . LEU A  1 254 ? 51.698  21.690  8.409   1.00 46.34  ?  254  LEU A CB  1 
ATOM   1953 C  CG  . LEU A  1 254 ? 51.268  21.281  7.010   1.00 49.10  ?  254  LEU A CG  1 
ATOM   1954 C  CD1 . LEU A  1 254 ? 49.755  21.358  6.875   1.00 45.04  ?  254  LEU A CD1 1 
ATOM   1955 C  CD2 . LEU A  1 254 ? 51.957  22.180  5.995   1.00 52.81  ?  254  LEU A CD2 1 
ATOM   1956 N  N   . VAL A  1 255 ? 53.795  21.548  10.987  1.00 53.57  ?  255  VAL A N   1 
ATOM   1957 C  CA  . VAL A  1 255 ? 54.165  22.057  12.301  1.00 61.43  ?  255  VAL A CA  1 
ATOM   1958 C  C   . VAL A  1 255 ? 55.644  21.814  12.616  1.00 67.22  ?  255  VAL A C   1 
ATOM   1959 O  O   . VAL A  1 255 ? 56.063  21.915  13.765  1.00 63.70  ?  255  VAL A O   1 
ATOM   1960 C  CB  . VAL A  1 255 ? 53.276  21.467  13.429  1.00 50.32  ?  255  VAL A CB  1 
ATOM   1961 C  CG1 . VAL A  1 255 ? 51.821  21.805  13.180  1.00 48.90  ?  255  VAL A CG1 1 
ATOM   1962 C  CG2 . VAL A  1 255 ? 53.462  19.960  13.549  1.00 42.23  ?  255  VAL A CG2 1 
ATOM   1963 N  N   . GLY A  1 256 ? 56.426  21.486  11.591  1.00 73.63  ?  256  GLY A N   1 
ATOM   1964 C  CA  . GLY A  1 256 ? 57.871  21.377  11.733  1.00 68.72  ?  256  GLY A CA  1 
ATOM   1965 C  C   . GLY A  1 256 ? 58.425  20.068  12.266  1.00 60.42  ?  256  GLY A C   1 
ATOM   1966 O  O   . GLY A  1 256 ? 59.363  20.085  13.035  1.00 65.66  ?  256  GLY A O   1 
ATOM   1967 N  N   . CYS A  1 257 ? 57.861  18.938  11.847  1.00 63.68  ?  257  CYS A N   1 
ATOM   1968 C  CA  . CYS A  1 257 ? 58.327  17.622  12.279  1.00 59.15  ?  257  CYS A CA  1 
ATOM   1969 C  C   . CYS A  1 257 ? 58.557  16.705  11.072  1.00 58.87  ?  257  CYS A C   1 
ATOM   1970 O  O   . CYS A  1 257 ? 59.696  16.517  10.617  1.00 68.81  ?  257  CYS A O   1 
ATOM   1971 C  CB  . CYS A  1 257 ? 57.317  16.978  13.238  1.00 61.78  ?  257  CYS A CB  1 
ATOM   1972 S  SG  . CYS A  1 257 ? 57.093  17.791  14.864  1.00 79.32  ?  257  CYS A SG  1 
ATOM   1973 N  N   . ASN A  1 265 ? 61.374  7.021   10.295  1.00 89.99  ?  265  ASN A N   1 
ATOM   1974 C  CA  . ASN A  1 265 ? 61.134  6.492   11.635  1.00 83.44  ?  265  ASN A CA  1 
ATOM   1975 C  C   . ASN A  1 265 ? 59.943  7.183   12.317  1.00 72.47  ?  265  ASN A C   1 
ATOM   1976 O  O   . ASN A  1 265 ? 59.945  8.396   12.527  1.00 75.51  ?  265  ASN A O   1 
ATOM   1977 C  CB  . ASN A  1 265 ? 62.408  6.607   12.485  1.00 85.66  ?  265  ASN A CB  1 
ATOM   1978 C  CG  . ASN A  1 265 ? 62.255  5.989   13.871  1.00 83.07  ?  265  ASN A CG  1 
ATOM   1979 O  OD1 . ASN A  1 265 ? 61.424  6.426   14.664  1.00 72.47  ?  265  ASN A OD1 1 
ATOM   1980 N  ND2 . ASN A  1 265 ? 63.079  4.985   14.175  1.00 83.89  ?  265  ASN A ND2 1 
ATOM   1981 N  N   . ASP A  1 266 ? 58.929  6.403   12.670  1.00 59.49  ?  266  ASP A N   1 
ATOM   1982 C  CA  . ASP A  1 266 ? 57.709  6.955   13.253  1.00 55.63  ?  266  ASP A CA  1 
ATOM   1983 C  C   . ASP A  1 266 ? 57.877  7.483   14.677  1.00 56.24  ?  266  ASP A C   1 
ATOM   1984 O  O   . ASP A  1 266 ? 57.155  8.392   15.092  1.00 48.09  ?  266  ASP A O   1 
ATOM   1985 C  CB  . ASP A  1 266 ? 56.597  5.910   13.240  1.00 59.45  ?  266  ASP A CB  1 
ATOM   1986 C  CG  . ASP A  1 266 ? 56.020  5.697   11.867  1.00 68.19  ?  266  ASP A CG  1 
ATOM   1987 O  OD1 . ASP A  1 266 ? 56.300  6.522   10.971  1.00 78.62  ?  266  ASP A OD1 1 
ATOM   1988 O  OD2 . ASP A  1 266 ? 55.277  4.712   11.685  1.00 69.43  ?  266  ASP A OD2 1 
ATOM   1989 N  N   . THR A  1 267 ? 58.812  6.894   15.425  1.00 57.27  ?  267  THR A N   1 
ATOM   1990 C  CA  . THR A  1 267 ? 59.061  7.283   16.807  1.00 52.89  ?  267  THR A CA  1 
ATOM   1991 C  C   . THR A  1 267 ? 59.520  8.731   16.919  1.00 50.40  ?  267  THR A C   1 
ATOM   1992 O  O   . THR A  1 267 ? 58.943  9.509   17.666  1.00 54.68  ?  267  THR A O   1 
ATOM   1993 C  CB  . THR A  1 267 ? 60.106  6.370   17.466  1.00 56.63  ?  267  THR A CB  1 
ATOM   1994 O  OG1 . THR A  1 267 ? 59.688  5.005   17.361  1.00 59.97  ?  267  THR A OG1 1 
ATOM   1995 C  CG2 . THR A  1 267 ? 60.285  6.733   18.928  1.00 47.47  ?  267  THR A CG2 1 
ATOM   1996 N  N   . GLU A  1 268 ? 60.553  9.083   16.165  1.00 61.45  ?  268  GLU A N   1 
ATOM   1997 C  CA  . GLU A  1 268 ? 61.059  10.454  16.107  1.00 70.25  ?  268  GLU A CA  1 
ATOM   1998 C  C   . GLU A  1 268 ? 59.964  11.448  15.734  1.00 67.20  ?  268  GLU A C   1 
ATOM   1999 O  O   . GLU A  1 268 ? 59.780  12.475  16.395  1.00 67.62  ?  268  GLU A O   1 
ATOM   2000 C  CB  . GLU A  1 268 ? 62.196  10.539  15.089  1.00 71.07  ?  268  GLU A CB  1 
ATOM   2001 C  CG  . GLU A  1 268 ? 63.325  9.571   15.376  1.00 92.13  ?  268  GLU A CG  1 
ATOM   2002 C  CD  . GLU A  1 268 ? 64.313  9.460   14.229  1.00 113.14 ?  268  GLU A CD  1 
ATOM   2003 O  OE1 . GLU A  1 268 ? 64.238  10.285  13.290  1.00 119.16 ?  268  GLU A OE1 1 
ATOM   2004 O  OE2 . GLU A  1 268 ? 65.161  8.541   14.267  1.00 119.71 ?  268  GLU A OE2 1 
ATOM   2005 N  N   . LEU A  1 269 ? 59.243  11.127  14.667  1.00 56.73  ?  269  LEU A N   1 
ATOM   2006 C  CA  . LEU A  1 269 ? 58.157  11.962  14.192  1.00 57.20  ?  269  LEU A CA  1 
ATOM   2007 C  C   . LEU A  1 269 ? 57.148  12.221  15.303  1.00 54.34  ?  269  LEU A C   1 
ATOM   2008 O  O   . LEU A  1 269 ? 56.857  13.370  15.626  1.00 60.47  ?  269  LEU A O   1 
ATOM   2009 C  CB  . LEU A  1 269 ? 57.478  11.297  12.995  1.00 51.20  ?  269  LEU A CB  1 
ATOM   2010 C  CG  . LEU A  1 269 ? 56.542  12.114  12.109  1.00 56.81  ?  269  LEU A CG  1 
ATOM   2011 C  CD1 . LEU A  1 269 ? 56.318  11.364  10.810  1.00 60.78  ?  269  LEU A CD1 1 
ATOM   2012 C  CD2 . LEU A  1 269 ? 55.205  12.346  12.773  1.00 62.45  ?  269  LEU A CD2 1 
ATOM   2013 N  N   . ILE A  1 270 ? 56.611  11.149  15.876  1.00 47.57  ?  270  ILE A N   1 
ATOM   2014 C  CA  . ILE A  1 270 ? 55.587  11.260  16.908  1.00 45.49  ?  270  ILE A CA  1 
ATOM   2015 C  C   . ILE A  1 270 ? 56.120  11.972  18.146  1.00 50.31  ?  270  ILE A C   1 
ATOM   2016 O  O   . ILE A  1 270 ? 55.412  12.779  18.758  1.00 49.23  ?  270  ILE A O   1 
ATOM   2017 C  CB  . ILE A  1 270 ? 55.025  9.880   17.283  1.00 52.39  ?  270  ILE A CB  1 
ATOM   2018 C  CG1 . ILE A  1 270 ? 54.295  9.275   16.088  1.00 63.43  ?  270  ILE A CG1 1 
ATOM   2019 C  CG2 . ILE A  1 270 ? 54.053  9.983   18.438  1.00 44.00  ?  270  ILE A CG2 1 
ATOM   2020 C  CD1 . ILE A  1 270 ? 54.013  7.800   16.232  1.00 67.39  ?  270  ILE A CD1 1 
ATOM   2021 N  N   . ALA A  1 271 ? 57.372  11.688  18.503  1.00 42.59  ?  271  ALA A N   1 
ATOM   2022 C  CA  . ALA A  1 271 ? 57.986  12.328  19.657  1.00 47.68  ?  271  ALA A CA  1 
ATOM   2023 C  C   . ALA A  1 271 ? 58.045  13.841  19.454  1.00 50.20  ?  271  ALA A C   1 
ATOM   2024 O  O   . ALA A  1 271 ? 57.885  14.617  20.399  1.00 58.01  ?  271  ALA A O   1 
ATOM   2025 C  CB  . ALA A  1 271 ? 59.384  11.759  19.928  1.00 38.84  ?  271  ALA A CB  1 
ATOM   2026 N  N   . CYS A  1 272 ? 58.265  14.268  18.218  1.00 49.90  ?  272  CYS A N   1 
ATOM   2027 C  CA  . CYS A  1 272 ? 58.365  15.697  17.967  1.00 50.90  ?  272  CYS A CA  1 
ATOM   2028 C  C   . CYS A  1 272 ? 56.987  16.331  18.056  1.00 48.46  ?  272  CYS A C   1 
ATOM   2029 O  O   . CYS A  1 272 ? 56.842  17.417  18.619  1.00 58.45  ?  272  CYS A O   1 
ATOM   2030 C  CB  . CYS A  1 272 ? 59.057  16.003  16.629  1.00 43.07  ?  272  CYS A CB  1 
ATOM   2031 S  SG  . CYS A  1 272 ? 58.792  17.703  16.022  1.00 91.57  ?  272  CYS A SG  1 
ATOM   2032 N  N   . LEU A  1 273 ? 55.976  15.647  17.525  1.00 42.50  ?  273  LEU A N   1 
ATOM   2033 C  CA  . LEU A  1 273 ? 54.593  16.119  17.651  1.00 48.39  ?  273  LEU A CA  1 
ATOM   2034 C  C   . LEU A  1 273 ? 54.176  16.304  19.119  1.00 52.00  ?  273  LEU A C   1 
ATOM   2035 O  O   . LEU A  1 273 ? 53.500  17.275  19.457  1.00 54.03  ?  273  LEU A O   1 
ATOM   2036 C  CB  . LEU A  1 273 ? 53.618  15.175  16.951  1.00 45.09  ?  273  LEU A CB  1 
ATOM   2037 C  CG  . LEU A  1 273 ? 53.550  15.215  15.425  1.00 51.59  ?  273  LEU A CG  1 
ATOM   2038 C  CD1 . LEU A  1 273 ? 52.665  14.096  14.887  1.00 45.83  ?  273  LEU A CD1 1 
ATOM   2039 C  CD2 . LEU A  1 273 ? 53.052  16.569  14.927  1.00 54.73  ?  273  LEU A CD2 1 
ATOM   2040 N  N   A ARG A  1 274 ? 54.587  15.380  19.984  0.51 48.15  ?  274  ARG A N   1 
ATOM   2041 N  N   B ARG A  1 274 ? 54.592  15.380  19.982  0.49 48.18  ?  274  ARG A N   1 
ATOM   2042 C  CA  A ARG A  1 274 ? 54.227  15.462  21.397  0.51 47.39  ?  274  ARG A CA  1 
ATOM   2043 C  CA  B ARG A  1 274 ? 54.230  15.454  21.394  0.49 47.40  ?  274  ARG A CA  1 
ATOM   2044 C  C   A ARG A  1 274 ? 54.806  16.720  22.038  0.51 52.65  ?  274  ARG A C   1 
ATOM   2045 C  C   B ARG A  1 274 ? 54.844  16.683  22.064  0.49 52.60  ?  274  ARG A C   1 
ATOM   2046 O  O   A ARG A  1 274 ? 54.330  17.163  23.083  0.51 53.64  ?  274  ARG A O   1 
ATOM   2047 O  O   B ARG A  1 274 ? 54.430  17.069  23.156  0.49 53.83  ?  274  ARG A O   1 
ATOM   2048 C  CB  A ARG A  1 274 ? 54.673  14.215  22.169  0.51 43.05  ?  274  ARG A CB  1 
ATOM   2049 C  CB  B ARG A  1 274 ? 54.618  14.171  22.144  0.49 42.60  ?  274  ARG A CB  1 
ATOM   2050 C  CG  A ARG A  1 274 ? 53.972  12.937  21.747  0.51 41.40  ?  274  ARG A CG  1 
ATOM   2051 C  CG  B ARG A  1 274 ? 53.892  12.921  21.662  0.49 39.93  ?  274  ARG A CG  1 
ATOM   2052 C  CD  A ARG A  1 274 ? 54.160  11.838  22.780  0.51 46.52  ?  274  ARG A CD  1 
ATOM   2053 C  CD  B ARG A  1 274 ? 53.648  11.947  22.807  0.49 44.61  ?  274  ARG A CD  1 
ATOM   2054 N  NE  A ARG A  1 274 ? 55.569  11.592  23.073  0.51 50.58  ?  274  ARG A NE  1 
ATOM   2055 N  NE  B ARG A  1 274 ? 54.329  10.669  22.621  0.49 48.45  ?  274  ARG A NE  1 
ATOM   2056 C  CZ  A ARG A  1 274 ? 56.336  10.755  22.387  0.51 44.56  ?  274  ARG A CZ  1 
ATOM   2057 C  CZ  B ARG A  1 274 ? 53.735  9.550   22.214  0.49 52.55  ?  274  ARG A CZ  1 
ATOM   2058 N  NH1 A ARG A  1 274 ? 55.825  10.082  21.366  0.51 40.86  ?  274  ARG A NH1 1 
ATOM   2059 N  NH1 B ARG A  1 274 ? 52.440  9.536   21.942  0.49 34.46  ?  274  ARG A NH1 1 
ATOM   2060 N  NH2 A ARG A  1 274 ? 57.610  10.592  22.719  0.51 39.70  ?  274  ARG A NH2 1 
ATOM   2061 N  NH2 B ARG A  1 274 ? 54.441  8.438   22.085  0.49 58.77  ?  274  ARG A NH2 1 
ATOM   2062 N  N   . THR A  1 275 ? 55.825  17.297  21.405  1.00 52.16  ?  275  THR A N   1 
ATOM   2063 C  CA  . THR A  1 275 ? 56.408  18.544  21.900  1.00 47.98  ?  275  THR A CA  1 
ATOM   2064 C  C   . THR A  1 275 ? 55.610  19.775  21.459  1.00 47.54  ?  275  THR A C   1 
ATOM   2065 O  O   . THR A  1 275 ? 55.871  20.879  21.916  1.00 58.29  ?  275  THR A O   1 
ATOM   2066 C  CB  . THR A  1 275 ? 57.886  18.734  21.473  1.00 45.80  ?  275  THR A CB  1 
ATOM   2067 O  OG1 . THR A  1 275 ? 57.977  18.804  20.043  1.00 56.96  ?  275  THR A OG1 1 
ATOM   2068 C  CG2 . THR A  1 275 ? 58.746  17.594  21.984  1.00 41.02  ?  275  THR A CG2 1 
ATOM   2069 N  N   . ARG A  1 276 ? 54.639  19.592  20.575  1.00 55.40  ?  276  ARG A N   1 
ATOM   2070 C  CA  . ARG A  1 276 ? 53.913  20.736  20.036  1.00 56.35  ?  276  ARG A CA  1 
ATOM   2071 C  C   . ARG A  1 276 ? 52.763  21.196  20.928  1.00 55.75  ?  276  ARG A C   1 
ATOM   2072 O  O   . ARG A  1 276 ? 52.000  20.377  21.442  1.00 48.84  ?  276  ARG A O   1 
ATOM   2073 C  CB  . ARG A  1 276 ? 53.415  20.448  18.612  1.00 48.02  ?  276  ARG A CB  1 
ATOM   2074 C  CG  . ARG A  1 276 ? 54.530  20.389  17.585  1.00 49.70  ?  276  ARG A CG  1 
ATOM   2075 C  CD  . ARG A  1 276 ? 55.141  21.769  17.384  1.00 57.82  ?  276  ARG A CD  1 
ATOM   2076 N  NE  . ARG A  1 276 ? 56.436  21.707  16.722  1.00 63.71  ?  276  ARG A NE  1 
ATOM   2077 C  CZ  . ARG A  1 276 ? 57.597  21.660  17.366  1.00 81.85  ?  276  ARG A CZ  1 
ATOM   2078 N  NH1 . ARG A  1 276 ? 57.624  21.672  18.696  1.00 84.66  ?  276  ARG A NH1 1 
ATOM   2079 N  NH2 . ARG A  1 276 ? 58.734  21.604  16.683  1.00 87.99  ?  276  ARG A NH2 1 
ATOM   2080 N  N   . PRO A  1 277 ? 52.632  22.521  21.101  1.00 56.24  ?  277  PRO A N   1 
ATOM   2081 C  CA  . PRO A  1 277 ? 51.495  23.074  21.832  1.00 51.43  ?  277  PRO A CA  1 
ATOM   2082 C  C   . PRO A  1 277 ? 50.231  22.595  21.139  1.00 56.49  ?  277  PRO A C   1 
ATOM   2083 O  O   . PRO A  1 277 ? 50.239  22.510  19.911  1.00 66.69  ?  277  PRO A O   1 
ATOM   2084 C  CB  . PRO A  1 277 ? 51.643  24.586  21.627  1.00 55.83  ?  277  PRO A CB  1 
ATOM   2085 C  CG  . PRO A  1 277 ? 53.027  24.801  21.120  1.00 56.21  ?  277  PRO A CG  1 
ATOM   2086 C  CD  . PRO A  1 277 ? 53.413  23.561  20.408  1.00 55.53  ?  277  PRO A CD  1 
ATOM   2087 N  N   . ALA A  1 278 ? 49.177  22.288  21.887  1.00 52.12  ?  278  ALA A N   1 
ATOM   2088 C  CA  . ALA A  1 278 ? 47.965  21.721  21.293  1.00 51.72  ?  278  ALA A CA  1 
ATOM   2089 C  C   . ALA A  1 278 ? 47.336  22.610  20.218  1.00 48.35  ?  278  ALA A C   1 
ATOM   2090 O  O   . ALA A  1 278 ? 46.754  22.115  19.254  1.00 46.69  ?  278  ALA A O   1 
ATOM   2091 C  CB  . ALA A  1 278 ? 46.946  21.381  22.370  1.00 47.80  ?  278  ALA A CB  1 
ATOM   2092 N  N   . GLN A  1 279 ? 47.468  23.921  20.384  1.00 49.86  ?  279  GLN A N   1 
ATOM   2093 C  CA  . GLN A  1 279 ? 46.863  24.862  19.452  1.00 44.36  ?  279  GLN A CA  1 
ATOM   2094 C  C   . GLN A  1 279 ? 47.518  24.837  18.069  1.00 49.87  ?  279  GLN A C   1 
ATOM   2095 O  O   . GLN A  1 279 ? 46.846  25.077  17.071  1.00 60.25  ?  279  GLN A O   1 
ATOM   2096 C  CB  . GLN A  1 279 ? 46.874  26.285  20.015  1.00 48.24  ?  279  GLN A CB  1 
ATOM   2097 C  CG  . GLN A  1 279 ? 46.003  27.259  19.222  1.00 54.38  ?  279  GLN A CG  1 
ATOM   2098 C  CD  . GLN A  1 279 ? 44.520  26.932  19.336  1.00 53.62  ?  279  GLN A CD  1 
ATOM   2099 O  OE1 . GLN A  1 279 ? 44.023  26.607  20.420  1.00 55.04  ?  279  GLN A OE1 1 
ATOM   2100 N  NE2 . GLN A  1 279 ? 43.810  27.003  18.219  1.00 40.44  ?  279  GLN A NE2 1 
ATOM   2101 N  N   . ASP A  1 280 ? 48.816  24.549  18.004  1.00 48.35  ?  280  ASP A N   1 
ATOM   2102 C  CA  . ASP A  1 280 ? 49.497  24.459  16.711  1.00 54.05  ?  280  ASP A CA  1 
ATOM   2103 C  C   . ASP A  1 280 ? 48.942  23.293  15.902  1.00 48.99  ?  280  ASP A C   1 
ATOM   2104 O  O   . ASP A  1 280 ? 48.734  23.423  14.711  1.00 50.13  ?  280  ASP A O   1 
ATOM   2105 C  CB  . ASP A  1 280 ? 51.020  24.312  16.865  1.00 57.65  ?  280  ASP A CB  1 
ATOM   2106 C  CG  . ASP A  1 280 ? 51.689  25.584  17.364  1.00 72.54  ?  280  ASP A CG  1 
ATOM   2107 O  OD1 . ASP A  1 280 ? 50.963  26.556  17.688  1.00 77.44  ?  280  ASP A OD1 1 
ATOM   2108 O  OD2 . ASP A  1 280 ? 52.944  25.605  17.442  1.00 76.77  ?  280  ASP A OD2 1 
ATOM   2109 N  N   . LEU A  1 281 ? 48.699  22.156  16.550  1.00 48.09  ?  281  LEU A N   1 
ATOM   2110 C  CA  . LEU A  1 281 ? 48.132  21.009  15.849  1.00 47.35  ?  281  LEU A CA  1 
ATOM   2111 C  C   . LEU A  1 281 ? 46.720  21.336  15.333  1.00 53.40  ?  281  LEU A C   1 
ATOM   2112 O  O   . LEU A  1 281 ? 46.347  20.972  14.217  1.00 58.59  ?  281  LEU A O   1 
ATOM   2113 C  CB  . LEU A  1 281 ? 48.088  19.770  16.751  1.00 47.77  ?  281  LEU A CB  1 
ATOM   2114 C  CG  . LEU A  1 281 ? 49.354  19.165  17.363  1.00 44.75  ?  281  LEU A CG  1 
ATOM   2115 C  CD1 . LEU A  1 281 ? 49.096  17.715  17.715  1.00 45.48  ?  281  LEU A CD1 1 
ATOM   2116 C  CD2 . LEU A  1 281 ? 50.578  19.284  16.464  1.00 44.15  ?  281  LEU A CD2 1 
ATOM   2117 N  N   . VAL A  1 282 ? 45.946  22.038  16.150  1.00 50.88  ?  282  VAL A N   1 
ATOM   2118 C  CA  . VAL A  1 282 ? 44.599  22.452  15.776  1.00 44.83  ?  282  VAL A CA  1 
ATOM   2119 C  C   . VAL A  1 282 ? 44.628  23.468  14.626  1.00 47.91  ?  282  VAL A C   1 
ATOM   2120 O  O   . VAL A  1 282 ? 43.801  23.408  13.709  1.00 52.68  ?  282  VAL A O   1 
ATOM   2121 C  CB  . VAL A  1 282 ? 43.841  23.006  17.015  1.00 41.91  ?  282  VAL A CB  1 
ATOM   2122 C  CG1 . VAL A  1 282 ? 42.501  23.619  16.639  1.00 37.75  ?  282  VAL A CG1 1 
ATOM   2123 C  CG2 . VAL A  1 282 ? 43.646  21.893  18.034  1.00 43.00  ?  282  VAL A CG2 1 
ATOM   2124 N  N   . ASP A  1 283 ? 45.592  24.383  14.661  1.00 44.88  ?  283  ASP A N   1 
ATOM   2125 C  CA  . ASP A  1 283 ? 45.670  25.445  13.655  1.00 51.99  ?  283  ASP A CA  1 
ATOM   2126 C  C   . ASP A  1 283 ? 45.894  24.925  12.227  1.00 54.86  ?  283  ASP A C   1 
ATOM   2127 O  O   . ASP A  1 283 ? 45.531  25.596  11.258  1.00 45.84  ?  283  ASP A O   1 
ATOM   2128 C  CB  . ASP A  1 283 ? 46.747  26.482  14.012  1.00 53.91  ?  283  ASP A CB  1 
ATOM   2129 C  CG  . ASP A  1 283 ? 46.324  27.413  15.154  1.00 59.69  ?  283  ASP A CG  1 
ATOM   2130 O  OD1 . ASP A  1 283 ? 45.110  27.485  15.460  1.00 51.54  ?  283  ASP A OD1 1 
ATOM   2131 O  OD2 . ASP A  1 283 ? 47.214  28.078  15.738  1.00 66.13  ?  283  ASP A OD2 1 
ATOM   2132 N  N   . HIS A  1 284 ? 46.476  23.732  12.104  1.00 52.58  ?  284  HIS A N   1 
ATOM   2133 C  CA  . HIS A  1 284 ? 46.822  23.182  10.798  1.00 55.18  ?  284  HIS A CA  1 
ATOM   2134 C  C   . HIS A  1 284 ? 46.016  21.950  10.429  1.00 58.26  ?  284  HIS A C   1 
ATOM   2135 O  O   . HIS A  1 284 ? 46.227  21.348  9.375   1.00 58.52  ?  284  HIS A O   1 
ATOM   2136 C  CB  . HIS A  1 284 ? 48.319  22.892  10.716  1.00 57.21  ?  284  HIS A CB  1 
ATOM   2137 C  CG  . HIS A  1 284 ? 49.161  24.118  10.841  1.00 61.05  ?  284  HIS A CG  1 
ATOM   2138 N  ND1 . HIS A  1 284 ? 49.549  24.631  12.061  1.00 61.40  ?  284  HIS A ND1 1 
ATOM   2139 C  CD2 . HIS A  1 284 ? 49.640  24.969  9.904   1.00 62.27  ?  284  HIS A CD2 1 
ATOM   2140 C  CE1 . HIS A  1 284 ? 50.260  25.728  11.867  1.00 70.84  ?  284  HIS A CE1 1 
ATOM   2141 N  NE2 . HIS A  1 284 ? 50.329  25.955  10.566  1.00 71.17  ?  284  HIS A NE2 1 
ATOM   2142 N  N   . GLU A  1 285 ? 45.074  21.602  11.291  1.00 57.05  ?  285  GLU A N   1 
ATOM   2143 C  CA  . GLU A  1 285 ? 44.274  20.401  11.118  1.00 58.27  ?  285  GLU A CA  1 
ATOM   2144 C  C   . GLU A  1 285 ? 43.522  20.325  9.770   1.00 52.77  ?  285  GLU A C   1 
ATOM   2145 O  O   . GLU A  1 285 ? 43.555  19.295  9.093   1.00 52.42  ?  285  GLU A O   1 
ATOM   2146 C  CB  . GLU A  1 285 ? 43.310  20.280  12.286  1.00 57.13  ?  285  GLU A CB  1 
ATOM   2147 C  CG  . GLU A  1 285 ? 42.486  19.041  12.274  1.00 65.58  ?  285  GLU A CG  1 
ATOM   2148 C  CD  . GLU A  1 285 ? 41.309  19.152  13.210  1.00 68.99  ?  285  GLU A CD  1 
ATOM   2149 O  OE1 . GLU A  1 285 ? 41.499  19.635  14.350  1.00 58.10  ?  285  GLU A OE1 1 
ATOM   2150 O  OE2 . GLU A  1 285 ? 40.194  18.774  12.792  1.00 74.38  ?  285  GLU A OE2 1 
ATOM   2151 N  N   . TRP A  1 286 ? 42.862  21.405  9.372   1.00 41.13  ?  286  TRP A N   1 
ATOM   2152 C  CA  . TRP A  1 286 ? 42.115  21.395  8.112   1.00 37.72  ?  286  TRP A CA  1 
ATOM   2153 C  C   . TRP A  1 286 ? 43.007  21.346  6.864   1.00 43.20  ?  286  TRP A C   1 
ATOM   2154 O  O   . TRP A  1 286 ? 42.550  20.981  5.786   1.00 39.28  ?  286  TRP A O   1 
ATOM   2155 C  CB  . TRP A  1 286 ? 41.152  22.585  8.032   1.00 35.51  ?  286  TRP A CB  1 
ATOM   2156 C  CG  . TRP A  1 286 ? 40.092  22.491  9.058   1.00 50.71  ?  286  TRP A CG  1 
ATOM   2157 C  CD1 . TRP A  1 286 ? 40.088  23.078  10.293  1.00 49.44  ?  286  TRP A CD1 1 
ATOM   2158 C  CD2 . TRP A  1 286 ? 38.892  21.719  8.975   1.00 55.15  ?  286  TRP A CD2 1 
ATOM   2159 N  NE1 . TRP A  1 286 ? 38.946  22.738  10.970  1.00 52.18  ?  286  TRP A NE1 1 
ATOM   2160 C  CE2 . TRP A  1 286 ? 38.197  21.899  10.188  1.00 55.94  ?  286  TRP A CE2 1 
ATOM   2161 C  CE3 . TRP A  1 286 ? 38.336  20.892  7.994   1.00 52.23  ?  286  TRP A CE3 1 
ATOM   2162 C  CZ2 . TRP A  1 286 ? 36.976  21.289  10.442  1.00 58.33  ?  286  TRP A CZ2 1 
ATOM   2163 C  CZ3 . TRP A  1 286 ? 37.125  20.288  8.244   1.00 54.19  ?  286  TRP A CZ3 1 
ATOM   2164 C  CH2 . TRP A  1 286 ? 36.453  20.491  9.458   1.00 64.25  ?  286  TRP A CH2 1 
ATOM   2165 N  N   . HIS A  1 287 ? 44.280  21.693  7.015   1.00 51.17  ?  287  HIS A N   1 
ATOM   2166 C  CA  . HIS A  1 287 ? 45.156  21.833  5.853   1.00 49.55  ?  287  HIS A CA  1 
ATOM   2167 C  C   . HIS A  1 287 ? 45.615  20.521  5.224   1.00 44.44  ?  287  HIS A C   1 
ATOM   2168 O  O   . HIS A  1 287 ? 46.267  20.544  4.207   1.00 45.41  ?  287  HIS A O   1 
ATOM   2169 C  CB  . HIS A  1 287 ? 46.377  22.688  6.192   1.00 52.12  ?  287  HIS A CB  1 
ATOM   2170 C  CG  . HIS A  1 287 ? 46.033  24.057  6.683   1.00 63.29  ?  287  HIS A CG  1 
ATOM   2171 N  ND1 . HIS A  1 287 ? 45.233  24.922  5.972   1.00 71.93  ?  287  HIS A ND1 1 
ATOM   2172 C  CD2 . HIS A  1 287 ? 46.381  24.712  7.815   1.00 65.15  ?  287  HIS A CD2 1 
ATOM   2173 C  CE1 . HIS A  1 287 ? 45.100  26.051  6.644   1.00 73.73  ?  287  HIS A CE1 1 
ATOM   2174 N  NE2 . HIS A  1 287 ? 45.790  25.950  7.766   1.00 68.58  ?  287  HIS A NE2 1 
ATOM   2175 N  N   . VAL A  1 288 ? 45.280  19.380  5.811   1.00 48.22  ?  288  VAL A N   1 
ATOM   2176 C  CA  . VAL A  1 288 ? 45.749  18.111  5.256   1.00 39.25  ?  288  VAL A CA  1 
ATOM   2177 C  C   . VAL A  1 288 ? 44.747  17.373  4.370   1.00 46.13  ?  288  VAL A C   1 
ATOM   2178 O  O   . VAL A  1 288 ? 45.078  16.311  3.852   1.00 54.73  ?  288  VAL A O   1 
ATOM   2179 C  CB  . VAL A  1 288 ? 46.233  17.129  6.362   1.00 43.95  ?  288  VAL A CB  1 
ATOM   2180 C  CG1 . VAL A  1 288 ? 47.313  17.763  7.203   1.00 34.32  ?  288  VAL A CG1 1 
ATOM   2181 C  CG2 . VAL A  1 288 ? 45.086  16.689  7.207   1.00 31.19  ?  288  VAL A CG2 1 
ATOM   2182 N  N   . LEU A  1 289 ? 43.532  17.907  4.205   1.00 47.03  ?  289  LEU A N   1 
ATOM   2183 C  CA  . LEU A  1 289 ? 42.548  17.310  3.281   1.00 45.76  ?  289  LEU A CA  1 
ATOM   2184 C  C   . LEU A  1 289 ? 43.041  17.268  1.819   1.00 46.92  ?  289  LEU A C   1 
ATOM   2185 O  O   . LEU A  1 289 ? 43.585  18.245  1.307   1.00 45.10  ?  289  LEU A O   1 
ATOM   2186 C  CB  . LEU A  1 289 ? 41.190  18.023  3.358   1.00 38.31  ?  289  LEU A CB  1 
ATOM   2187 C  CG  . LEU A  1 289 ? 40.424  17.839  4.669   1.00 40.73  ?  289  LEU A CG  1 
ATOM   2188 C  CD1 . LEU A  1 289 ? 39.220  18.764  4.724   1.00 35.34  ?  289  LEU A CD1 1 
ATOM   2189 C  CD2 . LEU A  1 289 ? 40.007  16.381  4.868   1.00 36.47  ?  289  LEU A CD2 1 
ATOM   2190 N  N   . PRO A  1 290 ? 42.846  16.125  1.148   1.00 44.85  ?  290  PRO A N   1 
ATOM   2191 C  CA  . PRO A  1 290 ? 43.338  15.944  -0.219  1.00 52.10  ?  290  PRO A CA  1 
ATOM   2192 C  C   . PRO A  1 290 ? 42.672  16.874  -1.245  1.00 56.24  ?  290  PRO A C   1 
ATOM   2193 O  O   . PRO A  1 290 ? 43.339  17.333  -2.181  1.00 47.89  ?  290  PRO A O   1 
ATOM   2194 C  CB  . PRO A  1 290 ? 43.016  14.473  -0.511  1.00 53.75  ?  290  PRO A CB  1 
ATOM   2195 C  CG  . PRO A  1 290 ? 41.900  14.127  0.427   1.00 42.38  ?  290  PRO A CG  1 
ATOM   2196 C  CD  . PRO A  1 290 ? 42.173  14.918  1.659   1.00 42.07  ?  290  PRO A CD  1 
ATOM   2197 N  N   . GLN A  1 291 ? 41.383  17.157  -1.080  1.00 53.89  ?  291  GLN A N   1 
ATOM   2198 C  CA  . GLN A  1 291 ? 40.708  18.053  -2.022  1.00 55.69  ?  291  GLN A CA  1 
ATOM   2199 C  C   . GLN A  1 291 ? 39.932  19.125  -1.281  1.00 56.08  ?  291  GLN A C   1 
ATOM   2200 O  O   . GLN A  1 291 ? 39.666  18.989  -0.096  1.00 55.20  ?  291  GLN A O   1 
ATOM   2201 C  CB  . GLN A  1 291 ? 39.746  17.285  -2.936  1.00 44.95  ?  291  GLN A CB  1 
ATOM   2202 C  CG  . GLN A  1 291 ? 40.348  16.086  -3.637  1.00 56.17  ?  291  GLN A CG  1 
ATOM   2203 C  CD  . GLN A  1 291 ? 40.171  14.803  -2.849  1.00 65.67  ?  291  GLN A CD  1 
ATOM   2204 O  OE1 . GLN A  1 291 ? 39.444  14.764  -1.847  1.00 68.95  ?  291  GLN A OE1 1 
ATOM   2205 N  NE2 . GLN A  1 291 ? 40.840  13.741  -3.295  1.00 59.37  ?  291  GLN A NE2 1 
ATOM   2206 N  N   . GLU A  1 292 ? 39.569  20.188  -1.990  1.00 60.09  ?  292  GLU A N   1 
ATOM   2207 C  CA  . GLU A  1 292 ? 38.603  21.145  -1.476  1.00 56.58  ?  292  GLU A CA  1 
ATOM   2208 C  C   . GLU A  1 292 ? 37.283  20.405  -1.276  1.00 49.78  ?  292  GLU A C   1 
ATOM   2209 O  O   . GLU A  1 292 ? 36.759  19.814  -2.216  1.00 53.59  ?  292  GLU A O   1 
ATOM   2210 C  CB  . GLU A  1 292 ? 38.431  22.291  -2.471  1.00 58.11  ?  292  GLU A CB  1 
ATOM   2211 C  CG  . GLU A  1 292 ? 37.488  23.387  -2.012  1.00 72.47  ?  292  GLU A CG  1 
ATOM   2212 C  CD  . GLU A  1 292 ? 37.667  24.672  -2.801  1.00 85.95  ?  292  GLU A CD  1 
ATOM   2213 O  OE1 . GLU A  1 292 ? 37.151  24.756  -3.946  1.00 79.85  ?  292  GLU A OE1 1 
ATOM   2214 O  OE2 . GLU A  1 292 ? 38.337  25.594  -2.273  1.00 92.29  ?  292  GLU A OE2 1 
ATOM   2215 N  N   . SER A  1 293 ? 36.750  20.410  -0.058  1.00 43.77  ?  293  SER A N   1 
ATOM   2216 C  CA  . SER A  1 293 ? 35.541  19.635  0.213   1.00 43.22  ?  293  SER A CA  1 
ATOM   2217 C  C   . SER A  1 293 ? 34.630  20.239  1.256   1.00 48.50  ?  293  SER A C   1 
ATOM   2218 O  O   . SER A  1 293 ? 34.993  21.204  1.927   1.00 55.50  ?  293  SER A O   1 
ATOM   2219 C  CB  . SER A  1 293 ? 35.893  18.204  0.633   1.00 38.67  ?  293  SER A CB  1 
ATOM   2220 O  OG  . SER A  1 293 ? 37.123  18.163  1.323   1.00 51.29  ?  293  SER A OG  1 
ATOM   2221 N  N   . ILE A  1 294 ? 33.427  19.673  1.349   1.00 46.65  ?  294  ILE A N   1 
ATOM   2222 C  CA  . ILE A  1 294 ? 32.597  19.777  2.547   1.00 40.86  ?  294  ILE A CA  1 
ATOM   2223 C  C   . ILE A  1 294 ? 32.248  18.357  3.012   1.00 44.52  ?  294  ILE A C   1 
ATOM   2224 O  O   . ILE A  1 294 ? 32.301  17.407  2.216   1.00 41.62  ?  294  ILE A O   1 
ATOM   2225 C  CB  . ILE A  1 294 ? 31.307  20.569  2.312   1.00 37.39  ?  294  ILE A CB  1 
ATOM   2226 C  CG1 . ILE A  1 294 ? 30.477  19.910  1.214   1.00 41.62  ?  294  ILE A CG1 1 
ATOM   2227 C  CG2 . ILE A  1 294 ? 31.613  22.023  1.993   1.00 37.87  ?  294  ILE A CG2 1 
ATOM   2228 C  CD1 . ILE A  1 294 ? 29.216  20.688  0.856   1.00 51.71  ?  294  ILE A CD1 1 
ATOM   2229 N  N   . PHE A  1 295 ? 31.912  18.229  4.298   1.00 44.17  ?  295  PHE A N   1 
ATOM   2230 C  CA  . PHE A  1 295 ? 31.579  16.953  4.938   1.00 37.69  ?  295  PHE A CA  1 
ATOM   2231 C  C   . PHE A  1 295 ? 32.745  15.984  4.866   1.00 41.58  ?  295  PHE A C   1 
ATOM   2232 O  O   . PHE A  1 295 ? 32.560  14.777  4.704   1.00 45.94  ?  295  PHE A O   1 
ATOM   2233 C  CB  . PHE A  1 295 ? 30.316  16.337  4.333   1.00 43.47  ?  295  PHE A CB  1 
ATOM   2234 C  CG  . PHE A  1 295 ? 29.408  15.688  5.344   1.00 45.14  ?  295  PHE A CG  1 
ATOM   2235 C  CD1 . PHE A  1 295 ? 29.927  14.864  6.342   1.00 44.05  ?  295  PHE A CD1 1 
ATOM   2236 C  CD2 . PHE A  1 295 ? 28.036  15.913  5.305   1.00 32.54  ?  295  PHE A CD2 1 
ATOM   2237 C  CE1 . PHE A  1 295 ? 29.092  14.270  7.276   1.00 32.80  ?  295  PHE A CE1 1 
ATOM   2238 C  CE2 . PHE A  1 295 ? 27.192  15.314  6.232   1.00 37.12  ?  295  PHE A CE2 1 
ATOM   2239 C  CZ  . PHE A  1 295 ? 27.716  14.499  7.219   1.00 35.76  ?  295  PHE A CZ  1 
ATOM   2240 N  N   . ARG A  1 296 ? 33.951  16.537  4.970   1.00 35.28  ?  296  ARG A N   1 
ATOM   2241 C  CA  . ARG A  1 296 ? 35.169  15.746  5.088   1.00 32.15  ?  296  ARG A CA  1 
ATOM   2242 C  C   . ARG A  1 296 ? 35.956  16.264  6.278   1.00 40.84  ?  296  ARG A C   1 
ATOM   2243 O  O   . ARG A  1 296 ? 36.040  17.476  6.505   1.00 39.91  ?  296  ARG A O   1 
ATOM   2244 C  CB  . ARG A  1 296 ? 36.051  15.841  3.836   1.00 28.74  ?  296  ARG A CB  1 
ATOM   2245 C  CG  . ARG A  1 296 ? 35.526  15.093  2.632   1.00 41.56  ?  296  ARG A CG  1 
ATOM   2246 C  CD  . ARG A  1 296 ? 35.082  13.670  2.959   1.00 45.84  ?  296  ARG A CD  1 
ATOM   2247 N  NE  . ARG A  1 296 ? 34.600  13.007  1.749   1.00 52.57  ?  296  ARG A NE  1 
ATOM   2248 C  CZ  . ARG A  1 296 ? 33.329  12.953  1.362   1.00 50.53  ?  296  ARG A CZ  1 
ATOM   2249 N  NH1 . ARG A  1 296 ? 32.374  13.498  2.101   1.00 51.09  ?  296  ARG A NH1 1 
ATOM   2250 N  NH2 . ARG A  1 296 ? 33.015  12.335  0.236   1.00 51.83  ?  296  ARG A NH2 1 
ATOM   2251 N  N   . PHE A  1 297 ? 36.553  15.345  7.024   1.00 34.52  ?  297  PHE A N   1 
ATOM   2252 C  CA  . PHE A  1 297 ? 37.277  15.725  8.228   1.00 35.15  ?  297  PHE A CA  1 
ATOM   2253 C  C   . PHE A  1 297 ? 38.618  15.023  8.228   1.00 42.41  ?  297  PHE A C   1 
ATOM   2254 O  O   . PHE A  1 297 ? 38.719  13.862  7.812   1.00 50.48  ?  297  PHE A O   1 
ATOM   2255 C  CB  . PHE A  1 297 ? 36.433  15.395  9.460   1.00 28.19  ?  297  PHE A CB  1 
ATOM   2256 C  CG  . PHE A  1 297 ? 34.953  15.640  9.252   1.00 31.37  ?  297  PHE A CG  1 
ATOM   2257 C  CD1 . PHE A  1 297 ? 34.452  16.940  9.179   1.00 26.64  ?  297  PHE A CD1 1 
ATOM   2258 C  CD2 . PHE A  1 297 ? 34.076  14.576  9.091   1.00 26.96  ?  297  PHE A CD2 1 
ATOM   2259 C  CE1 . PHE A  1 297 ? 33.100  17.176  8.977   1.00 27.88  ?  297  PHE A CE1 1 
ATOM   2260 C  CE2 . PHE A  1 297 ? 32.709  14.797  8.890   1.00 27.18  ?  297  PHE A CE2 1 
ATOM   2261 C  CZ  . PHE A  1 297 ? 32.219  16.101  8.839   1.00 27.69  ?  297  PHE A CZ  1 
ATOM   2262 N  N   . SER A  1 298 ? 39.646  15.745  8.666   1.00 37.24  ?  298  SER A N   1 
ATOM   2263 C  CA  . SER A  1 298 ? 41.025  15.319  8.489   1.00 34.56  ?  298  SER A CA  1 
ATOM   2264 C  C   . SER A  1 298 ? 41.390  14.084  9.307   1.00 44.57  ?  298  SER A C   1 
ATOM   2265 O  O   . SER A  1 298 ? 42.078  13.187  8.815   1.00 51.78  ?  298  SER A O   1 
ATOM   2266 C  CB  . SER A  1 298 ? 41.970  16.465  8.831   1.00 40.45  ?  298  SER A CB  1 
ATOM   2267 O  OG  . SER A  1 298 ? 41.643  17.622  8.092   1.00 47.19  ?  298  SER A OG  1 
ATOM   2268 N  N   . PHE A  1 299 ? 40.926  14.032  10.551  1.00 45.35  ?  299  PHE A N   1 
ATOM   2269 C  CA  . PHE A  1 299 ? 41.318  12.950  11.449  1.00 47.25  ?  299  PHE A CA  1 
ATOM   2270 C  C   . PHE A  1 299 ? 40.125  12.225  12.046  1.00 43.02  ?  299  PHE A C   1 
ATOM   2271 O  O   . PHE A  1 299 ? 39.426  12.759  12.899  1.00 41.92  ?  299  PHE A O   1 
ATOM   2272 C  CB  . PHE A  1 299 ? 42.265  13.472  12.526  1.00 39.54  ?  299  PHE A CB  1 
ATOM   2273 C  CG  . PHE A  1 299 ? 43.557  13.994  11.971  1.00 34.44  ?  299  PHE A CG  1 
ATOM   2274 C  CD1 . PHE A  1 299 ? 44.588  13.129  11.658  1.00 30.16  ?  299  PHE A CD1 1 
ATOM   2275 C  CD2 . PHE A  1 299 ? 43.725  15.345  11.721  1.00 37.72  ?  299  PHE A CD2 1 
ATOM   2276 C  CE1 . PHE A  1 299 ? 45.769  13.600  11.134  1.00 31.41  ?  299  PHE A CE1 1 
ATOM   2277 C  CE2 . PHE A  1 299 ? 44.907  15.824  11.188  1.00 37.06  ?  299  PHE A CE2 1 
ATOM   2278 C  CZ  . PHE A  1 299 ? 45.929  14.951  10.901  1.00 31.41  ?  299  PHE A CZ  1 
ATOM   2279 N  N   . VAL A  1 300 ? 39.920  11.000  11.572  1.00 35.33  ?  300  VAL A N   1 
ATOM   2280 C  CA  . VAL A  1 300 ? 38.719  10.221  11.822  1.00 32.88  ?  300  VAL A CA  1 
ATOM   2281 C  C   . VAL A  1 300 ? 39.189  8.784   12.028  1.00 29.75  ?  300  VAL A C   1 
ATOM   2282 O  O   . VAL A  1 300 ? 40.361  8.508   11.837  1.00 29.30  ?  300  VAL A O   1 
ATOM   2283 C  CB  . VAL A  1 300 ? 37.772  10.281  10.587  1.00 36.88  ?  300  VAL A CB  1 
ATOM   2284 C  CG1 . VAL A  1 300 ? 37.339  11.706  10.294  1.00 34.45  ?  300  VAL A CG1 1 
ATOM   2285 C  CG2 . VAL A  1 300 ? 38.457  9.679   9.386   1.00 33.94  ?  300  VAL A CG2 1 
ATOM   2286 N  N   . PRO A  1 301 ? 38.286  7.866   12.422  1.00 38.57  ?  301  PRO A N   1 
ATOM   2287 C  CA  . PRO A  1 301 ? 38.715  6.468   12.568  1.00 34.85  ?  301  PRO A CA  1 
ATOM   2288 C  C   . PRO A  1 301 ? 39.436  5.935   11.331  1.00 36.90  ?  301  PRO A C   1 
ATOM   2289 O  O   . PRO A  1 301 ? 39.057  6.251   10.219  1.00 37.61  ?  301  PRO A O   1 
ATOM   2290 C  CB  . PRO A  1 301 ? 37.390  5.726   12.749  1.00 38.53  ?  301  PRO A CB  1 
ATOM   2291 C  CG  . PRO A  1 301 ? 36.508  6.718   13.450  1.00 37.88  ?  301  PRO A CG  1 
ATOM   2292 C  CD  . PRO A  1 301 ? 36.901  8.068   12.905  1.00 37.68  ?  301  PRO A CD  1 
ATOM   2293 N  N   . VAL A  1 302 ? 40.486  5.158   11.538  1.00 38.97  ?  302  VAL A N   1 
ATOM   2294 C  CA  . VAL A  1 302 ? 41.241  4.568   10.450  1.00 41.60  ?  302  VAL A CA  1 
ATOM   2295 C  C   . VAL A  1 302 ? 40.917  3.073   10.384  1.00 52.72  ?  302  VAL A C   1 
ATOM   2296 O  O   . VAL A  1 302 ? 40.592  2.454   11.399  1.00 55.13  ?  302  VAL A O   1 
ATOM   2297 C  CB  . VAL A  1 302 ? 42.778  4.807   10.636  1.00 36.70  ?  302  VAL A CB  1 
ATOM   2298 C  CG1 . VAL A  1 302 ? 43.241  4.396   12.027  1.00 35.34  ?  302  VAL A CG1 1 
ATOM   2299 C  CG2 . VAL A  1 302 ? 43.603  4.074   9.575   1.00 36.94  ?  302  VAL A CG2 1 
ATOM   2300 N  N   . VAL A  1 303 ? 40.976  2.495   9.189   1.00 52.18  ?  303  VAL A N   1 
ATOM   2301 C  CA  . VAL A  1 303 ? 40.845  1.053   9.055   1.00 46.55  ?  303  VAL A CA  1 
ATOM   2302 C  C   . VAL A  1 303 ? 42.200  0.427   9.369   1.00 50.39  ?  303  VAL A C   1 
ATOM   2303 O  O   . VAL A  1 303 ? 43.072  0.319   8.512   1.00 58.36  ?  303  VAL A O   1 
ATOM   2304 C  CB  . VAL A  1 303 ? 40.316  0.659   7.665   1.00 45.36  ?  303  VAL A CB  1 
ATOM   2305 C  CG1 . VAL A  1 303 ? 40.193  -0.847  7.545   1.00 50.86  ?  303  VAL A CG1 1 
ATOM   2306 C  CG2 . VAL A  1 303 ? 38.960  1.301   7.441   1.00 38.37  ?  303  VAL A CG2 1 
ATOM   2307 N  N   . ASP A  1 304 ? 42.371  0.045   10.628  1.00 52.57  ?  304  ASP A N   1 
ATOM   2308 C  CA  . ASP A  1 304 ? 43.659  -0.395  11.140  1.00 49.35  ?  304  ASP A CA  1 
ATOM   2309 C  C   . ASP A  1 304 ? 43.803  -1.909  11.126  1.00 50.46  ?  304  ASP A C   1 
ATOM   2310 O  O   . ASP A  1 304 ? 44.888  -2.429  11.343  1.00 53.59  ?  304  ASP A O   1 
ATOM   2311 C  CB  . ASP A  1 304 ? 43.910  0.170   12.557  1.00 49.38  ?  304  ASP A CB  1 
ATOM   2312 C  CG  . ASP A  1 304 ? 42.847  -0.264  13.590  1.00 57.94  ?  304  ASP A CG  1 
ATOM   2313 O  OD1 . ASP A  1 304 ? 41.802  -0.828  13.182  1.00 48.84  ?  304  ASP A OD1 1 
ATOM   2314 O  OD2 . ASP A  1 304 ? 43.053  -0.015  14.818  1.00 57.97  ?  304  ASP A OD2 1 
ATOM   2315 N  N   . GLY A  1 305 ? 42.710  -2.613  10.861  1.00 51.75  ?  305  GLY A N   1 
ATOM   2316 C  CA  . GLY A  1 305 ? 42.717  -4.061  10.949  1.00 54.79  ?  305  GLY A CA  1 
ATOM   2317 C  C   . GLY A  1 305 ? 42.809  -4.531  12.388  1.00 58.85  ?  305  GLY A C   1 
ATOM   2318 O  O   . GLY A  1 305 ? 43.198  -5.671  12.645  1.00 59.26  ?  305  GLY A O   1 
ATOM   2319 N  N   . ASP A  1 306 ? 42.448  -3.651  13.325  1.00 56.21  ?  306  ASP A N   1 
ATOM   2320 C  CA  . ASP A  1 306 ? 42.515  -3.946  14.764  1.00 57.20  ?  306  ASP A CA  1 
ATOM   2321 C  C   . ASP A  1 306 ? 41.182  -3.637  15.456  1.00 57.83  ?  306  ASP A C   1 
ATOM   2322 O  O   . ASP A  1 306 ? 40.370  -4.538  15.664  1.00 61.65  ?  306  ASP A O   1 
ATOM   2323 C  CB  . ASP A  1 306 ? 43.651  -3.162  15.413  1.00 58.99  ?  306  ASP A CB  1 
ATOM   2324 C  CG  . ASP A  1 306 ? 43.865  -3.531  16.870  1.00 73.88  ?  306  ASP A CG  1 
ATOM   2325 O  OD1 . ASP A  1 306 ? 43.379  -4.600  17.305  1.00 77.91  ?  306  ASP A OD1 1 
ATOM   2326 O  OD2 . ASP A  1 306 ? 44.540  -2.749  17.579  1.00 76.94  ?  306  ASP A OD2 1 
ATOM   2327 N  N   . PHE A  1 307 ? 40.965  -2.370  15.814  1.00 50.14  ?  307  PHE A N   1 
ATOM   2328 C  CA  . PHE A  1 307 ? 39.632  -1.906  16.194  1.00 45.29  ?  307  PHE A CA  1 
ATOM   2329 C  C   . PHE A  1 307 ? 38.638  -2.220  15.066  1.00 50.06  ?  307  PHE A C   1 
ATOM   2330 O  O   . PHE A  1 307 ? 37.593  -2.830  15.293  1.00 56.55  ?  307  PHE A O   1 
ATOM   2331 C  CB  . PHE A  1 307 ? 39.639  -0.403  16.485  1.00 40.39  ?  307  PHE A CB  1 
ATOM   2332 C  CG  . PHE A  1 307 ? 38.417  0.079   17.226  1.00 49.54  ?  307  PHE A CG  1 
ATOM   2333 C  CD1 . PHE A  1 307 ? 37.255  0.393   16.546  1.00 45.28  ?  307  PHE A CD1 1 
ATOM   2334 C  CD2 . PHE A  1 307 ? 38.437  0.223   18.616  1.00 59.14  ?  307  PHE A CD2 1 
ATOM   2335 C  CE1 . PHE A  1 307 ? 36.139  0.823   17.226  1.00 49.16  ?  307  PHE A CE1 1 
ATOM   2336 C  CE2 . PHE A  1 307 ? 37.323  0.664   19.306  1.00 54.06  ?  307  PHE A CE2 1 
ATOM   2337 C  CZ  . PHE A  1 307 ? 36.170  0.962   18.612  1.00 48.21  ?  307  PHE A CZ  1 
ATOM   2338 N  N   . LEU A  1 308 ? 38.969  -1.792  13.851  1.00 49.21  ?  308  LEU A N   1 
ATOM   2339 C  CA  . LEU A  1 308 ? 38.178  -2.131  12.669  1.00 49.66  ?  308  LEU A CA  1 
ATOM   2340 C  C   . LEU A  1 308 ? 38.920  -3.163  11.836  1.00 52.58  ?  308  LEU A C   1 
ATOM   2341 O  O   . LEU A  1 308 ? 39.847  -2.815  11.107  1.00 56.56  ?  308  LEU A O   1 
ATOM   2342 C  CB  . LEU A  1 308 ? 37.935  -0.890  11.820  1.00 46.80  ?  308  LEU A CB  1 
ATOM   2343 C  CG  . LEU A  1 308 ? 36.961  0.138   12.387  1.00 52.32  ?  308  LEU A CG  1 
ATOM   2344 C  CD1 . LEU A  1 308 ? 36.941  1.357   11.493  1.00 41.83  ?  308  LEU A CD1 1 
ATOM   2345 C  CD2 . LEU A  1 308 ? 35.555  -0.456  12.553  1.00 53.65  ?  308  LEU A CD2 1 
ATOM   2346 N  N   . SER A  1 309 ? 38.520  -4.427  11.935  1.00 52.83  ?  309  SER A N   1 
ATOM   2347 C  CA  . SER A  1 309 ? 39.264  -5.506  11.278  1.00 54.94  ?  309  SER A CA  1 
ATOM   2348 C  C   . SER A  1 309 ? 39.261  -5.414  9.746   1.00 59.94  ?  309  SER A C   1 
ATOM   2349 O  O   . SER A  1 309 ? 40.079  -6.044  9.082   1.00 68.24  ?  309  SER A O   1 
ATOM   2350 C  CB  . SER A  1 309 ? 38.757  -6.876  11.736  1.00 51.89  ?  309  SER A CB  1 
ATOM   2351 O  OG  . SER A  1 309 ? 37.400  -7.067  11.380  1.00 58.04  ?  309  SER A OG  1 
ATOM   2352 N  N   . ASP A  1 310 ? 38.344  -4.617  9.204   1.00 57.53  ?  310  ASP A N   1 
ATOM   2353 C  CA  . ASP A  1 310 ? 38.215  -4.400  7.768   1.00 54.92  ?  310  ASP A CA  1 
ATOM   2354 C  C   . ASP A  1 310 ? 37.405  -3.110  7.584   1.00 54.30  ?  310  ASP A C   1 
ATOM   2355 O  O   . ASP A  1 310 ? 37.054  -2.468  8.571   1.00 56.55  ?  310  ASP A O   1 
ATOM   2356 C  CB  . ASP A  1 310 ? 37.497  -5.588  7.120   1.00 59.80  ?  310  ASP A CB  1 
ATOM   2357 C  CG  . ASP A  1 310 ? 37.782  -5.713  5.622   1.00 74.42  ?  310  ASP A CG  1 
ATOM   2358 O  OD1 . ASP A  1 310 ? 37.913  -4.671  4.941   1.00 74.11  ?  310  ASP A OD1 1 
ATOM   2359 O  OD2 . ASP A  1 310 ? 37.871  -6.860  5.128   1.00 77.33  ?  310  ASP A OD2 1 
ATOM   2360 N  N   . THR A  1 311 ? 37.111  -2.724  6.342   1.00 44.31  ?  311  THR A N   1 
ATOM   2361 C  CA  . THR A  1 311 ? 36.319  -1.523  6.089   1.00 41.03  ?  311  THR A CA  1 
ATOM   2362 C  C   . THR A  1 311 ? 34.921  -1.758  6.635   1.00 49.59  ?  311  THR A C   1 
ATOM   2363 O  O   . THR A  1 311 ? 34.450  -2.899  6.637   1.00 54.30  ?  311  THR A O   1 
ATOM   2364 C  CB  . THR A  1 311 ? 36.193  -1.210  4.574   1.00 47.74  ?  311  THR A CB  1 
ATOM   2365 O  OG1 . THR A  1 311 ? 35.421  -2.236  3.935   1.00 50.91  ?  311  THR A OG1 1 
ATOM   2366 C  CG2 . THR A  1 311 ? 37.563  -1.117  3.907   1.00 38.17  ?  311  THR A CG2 1 
ATOM   2367 N  N   . PRO A  1 312 ? 34.262  -0.694  7.133   1.00 51.75  ?  312  PRO A N   1 
ATOM   2368 C  CA  . PRO A  1 312 ? 32.874  -0.831  7.594   1.00 53.43  ?  312  PRO A CA  1 
ATOM   2369 C  C   . PRO A  1 312 ? 31.972  -1.433  6.529   1.00 51.69  ?  312  PRO A C   1 
ATOM   2370 O  O   . PRO A  1 312 ? 31.059  -2.174  6.880   1.00 49.00  ?  312  PRO A O   1 
ATOM   2371 C  CB  . PRO A  1 312 ? 32.461  0.613   7.888   1.00 46.75  ?  312  PRO A CB  1 
ATOM   2372 C  CG  . PRO A  1 312 ? 33.715  1.249   8.331   1.00 44.05  ?  312  PRO A CG  1 
ATOM   2373 C  CD  . PRO A  1 312 ? 34.839  0.600   7.539   1.00 43.31  ?  312  PRO A CD  1 
ATOM   2374 N  N   . GLU A  1 313 ? 32.238  -1.129  5.259   1.00 60.78  ?  313  GLU A N   1 
ATOM   2375 C  CA  . GLU A  1 313 ? 31.437  -1.643  4.145   1.00 61.75  ?  313  GLU A CA  1 
ATOM   2376 C  C   . GLU A  1 313 ? 31.507  -3.164  4.070   1.00 55.13  ?  313  GLU A C   1 
ATOM   2377 O  O   . GLU A  1 313 ? 30.481  -3.836  4.031   1.00 55.90  ?  313  GLU A O   1 
ATOM   2378 C  CB  . GLU A  1 313 ? 31.881  -1.030  2.810   1.00 66.56  ?  313  GLU A CB  1 
ATOM   2379 C  CG  . GLU A  1 313 ? 31.188  0.283   2.450   1.00 76.69  ?  313  GLU A CG  1 
ATOM   2380 C  CD  . GLU A  1 313 ? 31.832  1.510   3.090   1.00 83.51  ?  313  GLU A CD  1 
ATOM   2381 O  OE1 . GLU A  1 313 ? 32.857  1.358   3.803   1.00 87.34  ?  313  GLU A OE1 1 
ATOM   2382 O  OE2 . GLU A  1 313 ? 31.310  2.630   2.868   1.00 77.98  ?  313  GLU A OE2 1 
ATOM   2383 N  N   . ALA A  1 314 ? 32.724  -3.693  4.047   1.00 46.32  ?  314  ALA A N   1 
ATOM   2384 C  CA  . ALA A  1 314 ? 32.939  -5.133  4.115   1.00 49.66  ?  314  ALA A CA  1 
ATOM   2385 C  C   . ALA A  1 314 ? 32.208  -5.745  5.311   1.00 55.06  ?  314  ALA A C   1 
ATOM   2386 O  O   . ALA A  1 314 ? 31.438  -6.689  5.153   1.00 60.44  ?  314  ALA A O   1 
ATOM   2387 C  CB  . ALA A  1 314 ? 34.437  -5.444  4.193   1.00 46.01  ?  314  ALA A CB  1 
ATOM   2388 N  N   . LEU A  1 315 ? 32.439  -5.182  6.497   1.00 47.01  ?  315  LEU A N   1 
ATOM   2389 C  CA  . LEU A  1 315 ? 31.883  -5.726  7.736   1.00 48.92  ?  315  LEU A CA  1 
ATOM   2390 C  C   . LEU A  1 315 ? 30.356  -5.799  7.740   1.00 55.46  ?  315  LEU A C   1 
ATOM   2391 O  O   . LEU A  1 315 ? 29.790  -6.850  8.032   1.00 66.25  ?  315  LEU A O   1 
ATOM   2392 C  CB  . LEU A  1 315 ? 32.407  -4.962  8.960   1.00 44.50  ?  315  LEU A CB  1 
ATOM   2393 C  CG  . LEU A  1 315 ? 33.915  -5.096  9.206   1.00 48.08  ?  315  LEU A CG  1 
ATOM   2394 C  CD1 . LEU A  1 315 ? 34.367  -4.216  10.348  1.00 38.69  ?  315  LEU A CD1 1 
ATOM   2395 C  CD2 . LEU A  1 315 ? 34.303  -6.551  9.447   1.00 42.38  ?  315  LEU A CD2 1 
ATOM   2396 N  N   . ILE A  1 316 ? 29.684  -4.703  7.403   1.00 51.33  ?  316  ILE A N   1 
ATOM   2397 C  CA  . ILE A  1 316 ? 28.223  -4.739  7.337   1.00 52.79  ?  316  ILE A CA  1 
ATOM   2398 C  C   . ILE A  1 316 ? 27.697  -5.664  6.231   1.00 60.16  ?  316  ILE A C   1 
ATOM   2399 O  O   . ILE A  1 316 ? 26.620  -6.234  6.371   1.00 66.58  ?  316  ILE A O   1 
ATOM   2400 C  CB  . ILE A  1 316 ? 27.582  -3.330  7.206   1.00 51.53  ?  316  ILE A CB  1 
ATOM   2401 C  CG1 . ILE A  1 316 ? 27.747  -2.769  5.793   1.00 49.18  ?  316  ILE A CG1 1 
ATOM   2402 C  CG2 . ILE A  1 316 ? 28.147  -2.372  8.251   1.00 49.57  ?  316  ILE A CG2 1 
ATOM   2403 C  CD1 . ILE A  1 316 ? 27.015  -1.447  5.574   1.00 48.93  ?  316  ILE A CD1 1 
ATOM   2404 N  N   . ASN A  1 317 ? 28.452  -5.825  5.144   1.00 58.23  ?  317  ASN A N   1 
ATOM   2405 C  CA  . ASN A  1 317 ? 28.021  -6.706  4.054   1.00 66.81  ?  317  ASN A CA  1 
ATOM   2406 C  C   . ASN A  1 317 ? 28.154  -8.204  4.368   1.00 72.71  ?  317  ASN A C   1 
ATOM   2407 O  O   . ASN A  1 317 ? 27.534  -9.037  3.706   1.00 79.52  ?  317  ASN A O   1 
ATOM   2408 C  CB  . ASN A  1 317 ? 28.761  -6.387  2.741   1.00 64.43  ?  317  ASN A CB  1 
ATOM   2409 C  CG  . ASN A  1 317 ? 28.327  -5.057  2.118   1.00 68.33  ?  317  ASN A CG  1 
ATOM   2410 O  OD1 . ASN A  1 317 ? 27.322  -4.457  2.511   1.00 73.63  ?  317  ASN A OD1 1 
ATOM   2411 N  ND2 . ASN A  1 317 ? 29.088  -4.600  1.131   1.00 64.46  ?  317  ASN A ND2 1 
ATOM   2412 N  N   . THR A  1 318 ? 28.958  -8.544  5.372   1.00 68.08  ?  318  THR A N   1 
ATOM   2413 C  CA  . THR A  1 318 ? 29.300  -9.941  5.633   1.00 70.23  ?  318  THR A CA  1 
ATOM   2414 C  C   . THR A  1 318 ? 29.094  -10.378 7.082   1.00 73.56  ?  318  THR A C   1 
ATOM   2415 O  O   . THR A  1 318 ? 29.369  -11.526 7.424   1.00 75.40  ?  318  THR A O   1 
ATOM   2416 C  CB  . THR A  1 318 ? 30.776  -10.222 5.313   1.00 71.77  ?  318  THR A CB  1 
ATOM   2417 O  OG1 . THR A  1 318 ? 31.602  -9.657  6.346   1.00 69.75  ?  318  THR A OG1 1 
ATOM   2418 C  CG2 . THR A  1 318 ? 31.161  -9.642  3.947   1.00 69.56  ?  318  THR A CG2 1 
ATOM   2419 N  N   . GLY A  1 319 ? 28.626  -9.472  7.933   1.00 76.00  ?  319  GLY A N   1 
ATOM   2420 C  CA  . GLY A  1 319 ? 28.450  -9.787  9.339   1.00 71.39  ?  319  GLY A CA  1 
ATOM   2421 C  C   . GLY A  1 319 ? 27.110  -10.408 9.701   1.00 74.32  ?  319  GLY A C   1 
ATOM   2422 O  O   . GLY A  1 319 ? 26.093  -10.140 9.060   1.00 72.44  ?  319  GLY A O   1 
ATOM   2423 N  N   . ASP A  1 320 ? 27.116  -11.248 10.735  1.00 77.67  ?  320  ASP A N   1 
ATOM   2424 C  CA  . ASP A  1 320 ? 25.890  -11.794 11.305  1.00 76.11  ?  320  ASP A CA  1 
ATOM   2425 C  C   . ASP A  1 320 ? 25.366  -10.809 12.346  1.00 77.37  ?  320  ASP A C   1 
ATOM   2426 O  O   . ASP A  1 320 ? 26.111  -10.373 13.221  1.00 85.68  ?  320  ASP A O   1 
ATOM   2427 C  CB  . ASP A  1 320 ? 26.175  -13.154 11.948  1.00 79.98  ?  320  ASP A CB  1 
ATOM   2428 C  CG  . ASP A  1 320 ? 24.919  -13.843 12.465  1.00 86.03  ?  320  ASP A CG  1 
ATOM   2429 O  OD1 . ASP A  1 320 ? 24.147  -13.210 13.212  1.00 84.71  ?  320  ASP A OD1 1 
ATOM   2430 O  OD2 . ASP A  1 320 ? 24.706  -15.029 12.128  1.00 92.02  ?  320  ASP A OD2 1 
ATOM   2431 N  N   . PHE A  1 321 ? 24.088  -10.454 12.258  1.00 70.88  ?  321  PHE A N   1 
ATOM   2432 C  CA  . PHE A  1 321 ? 23.511  -9.522  13.225  1.00 66.60  ?  321  PHE A CA  1 
ATOM   2433 C  C   . PHE A  1 321 ? 22.201  -10.004 13.841  1.00 68.62  ?  321  PHE A C   1 
ATOM   2434 O  O   . PHE A  1 321 ? 21.324  -9.193  14.150  1.00 66.05  ?  321  PHE A O   1 
ATOM   2435 C  CB  . PHE A  1 321 ? 23.312  -8.141  12.604  1.00 64.10  ?  321  PHE A CB  1 
ATOM   2436 C  CG  . PHE A  1 321 ? 24.558  -7.557  12.019  1.00 60.66  ?  321  PHE A CG  1 
ATOM   2437 C  CD1 . PHE A  1 321 ? 25.569  -7.092  12.837  1.00 60.20  ?  321  PHE A CD1 1 
ATOM   2438 C  CD2 . PHE A  1 321 ? 24.717  -7.465  10.647  1.00 66.89  ?  321  PHE A CD2 1 
ATOM   2439 C  CE1 . PHE A  1 321 ? 26.720  -6.549  12.300  1.00 60.25  ?  321  PHE A CE1 1 
ATOM   2440 C  CE2 . PHE A  1 321 ? 25.866  -6.922  10.101  1.00 64.34  ?  321  PHE A CE2 1 
ATOM   2441 C  CZ  . PHE A  1 321 ? 26.867  -6.461  10.931  1.00 60.28  ?  321  PHE A CZ  1 
ATOM   2442 N  N   . GLN A  1 322 ? 22.076  -11.319 14.013  1.00 73.21  ?  322  GLN A N   1 
ATOM   2443 C  CA  . GLN A  1 322 ? 20.994  -11.896 14.800  1.00 78.86  ?  322  GLN A CA  1 
ATOM   2444 C  C   . GLN A  1 322 ? 20.957  -11.223 16.163  1.00 80.62  ?  322  GLN A C   1 
ATOM   2445 O  O   . GLN A  1 322 ? 22.002  -10.883 16.727  1.00 75.94  ?  322  GLN A O   1 
ATOM   2446 C  CB  . GLN A  1 322 ? 21.218  -13.396 15.007  1.00 88.43  ?  322  GLN A CB  1 
ATOM   2447 C  CG  . GLN A  1 322 ? 21.230  -14.224 13.736  1.00 100.67 ?  322  GLN A CG  1 
ATOM   2448 C  CD  . GLN A  1 322 ? 19.838  -14.577 13.261  1.00 110.31 ?  322  GLN A CD  1 
ATOM   2449 O  OE1 . GLN A  1 322 ? 19.196  -13.804 12.548  1.00 112.31 ?  322  GLN A OE1 1 
ATOM   2450 N  NE2 . GLN A  1 322 ? 19.360  -15.754 13.657  1.00 113.63 ?  322  GLN A NE2 1 
ATOM   2451 N  N   . ASP A  1 323 ? 19.751  -11.022 16.681  1.00 89.81  ?  323  ASP A N   1 
ATOM   2452 C  CA  . ASP A  1 323 ? 19.561  -10.537 18.047  1.00 97.68  ?  323  ASP A CA  1 
ATOM   2453 C  C   . ASP A  1 323 ? 20.204  -9.169  18.294  1.00 89.73  ?  323  ASP A C   1 
ATOM   2454 O  O   . ASP A  1 323 ? 20.490  -8.797  19.429  1.00 89.49  ?  323  ASP A O   1 
ATOM   2455 C  CB  . ASP A  1 323 ? 20.071  -11.571 19.063  1.00 109.57 ?  323  ASP A CB  1 
ATOM   2456 C  CG  . ASP A  1 323 ? 19.560  -12.979 18.776  1.00 116.56 ?  323  ASP A CG  1 
ATOM   2457 O  OD1 . ASP A  1 323 ? 18.478  -13.111 18.162  1.00 117.89 ?  323  ASP A OD1 1 
ATOM   2458 O  OD2 . ASP A  1 323 ? 20.242  -13.954 19.164  1.00 117.45 ?  323  ASP A OD2 1 
ATOM   2459 N  N   . LEU A  1 324 ? 20.440  -8.428  17.221  1.00 84.55  ?  324  LEU A N   1 
ATOM   2460 C  CA  . LEU A  1 324 ? 20.864  -7.046  17.348  1.00 73.71  ?  324  LEU A CA  1 
ATOM   2461 C  C   . LEU A  1 324 ? 19.666  -6.170  17.051  1.00 67.25  ?  324  LEU A C   1 
ATOM   2462 O  O   . LEU A  1 324 ? 18.964  -6.400  16.068  1.00 72.97  ?  324  LEU A O   1 
ATOM   2463 C  CB  . LEU A  1 324 ? 21.989  -6.728  16.368  1.00 64.57  ?  324  LEU A CB  1 
ATOM   2464 C  CG  . LEU A  1 324 ? 22.263  -5.227  16.258  1.00 65.76  ?  324  LEU A CG  1 
ATOM   2465 C  CD1 . LEU A  1 324 ? 22.849  -4.677  17.546  1.00 60.67  ?  324  LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A  1 324 ? 23.167  -4.918  15.081  1.00 74.73  ?  324  LEU A CD2 1 
ATOM   2467 N  N   . GLN A  1 325 ? 19.424  -5.179  17.902  1.00 55.95  ?  325  GLN A N   1 
ATOM   2468 C  CA  . GLN A  1 325 ? 18.336  -4.236  17.677  1.00 52.79  ?  325  GLN A CA  1 
ATOM   2469 C  C   . GLN A  1 325 ? 18.825  -2.809  17.491  1.00 52.96  ?  325  GLN A C   1 
ATOM   2470 O  O   . GLN A  1 325 ? 19.547  -2.272  18.330  1.00 53.22  ?  325  GLN A O   1 
ATOM   2471 C  CB  . GLN A  1 325 ? 17.336  -4.290  18.817  1.00 54.25  ?  325  GLN A CB  1 
ATOM   2472 C  CG  . GLN A  1 325 ? 16.616  -5.591  18.888  1.00 61.08  ?  325  GLN A CG  1 
ATOM   2473 C  CD  . GLN A  1 325 ? 16.623  -6.163  20.275  1.00 64.58  ?  325  GLN A CD  1 
ATOM   2474 O  OE1 . GLN A  1 325 ? 17.314  -5.658  21.166  1.00 61.13  ?  325  GLN A OE1 1 
ATOM   2475 N  NE2 . GLN A  1 325 ? 15.855  -7.226  20.475  1.00 67.98  ?  325  GLN A NE2 1 
ATOM   2476 N  N   . VAL A  1 326 ? 18.416  -2.195  16.385  1.00 50.07  ?  326  VAL A N   1 
ATOM   2477 C  CA  . VAL A  1 326 ? 18.897  -0.867  16.032  1.00 45.93  ?  326  VAL A CA  1 
ATOM   2478 C  C   . VAL A  1 326 ? 17.776  0.063   15.587  1.00 46.91  ?  326  VAL A C   1 
ATOM   2479 O  O   . VAL A  1 326 ? 16.836  -0.349  14.908  1.00 50.23  ?  326  VAL A O   1 
ATOM   2480 C  CB  . VAL A  1 326 ? 19.938  -0.919  14.900  1.00 43.27  ?  326  VAL A CB  1 
ATOM   2481 C  CG1 . VAL A  1 326 ? 20.616  0.400   14.785  1.00 44.31  ?  326  VAL A CG1 1 
ATOM   2482 C  CG2 . VAL A  1 326 ? 20.980  -1.990  15.158  1.00 44.52  ?  326  VAL A CG2 1 
ATOM   2483 N  N   . LEU A  1 327 ? 17.880  1.319   15.993  1.00 41.98  ?  327  LEU A N   1 
ATOM   2484 C  CA  . LEU A  1 327 ? 17.004  2.366   15.515  1.00 43.77  ?  327  LEU A CA  1 
ATOM   2485 C  C   . LEU A  1 327 ? 17.896  3.293   14.721  1.00 50.36  ?  327  LEU A C   1 
ATOM   2486 O  O   . LEU A  1 327 ? 18.955  3.699   15.195  1.00 54.03  ?  327  LEU A O   1 
ATOM   2487 C  CB  . LEU A  1 327 ? 16.384  3.120   16.685  1.00 48.63  ?  327  LEU A CB  1 
ATOM   2488 C  CG  . LEU A  1 327 ? 15.336  4.180   16.341  1.00 57.53  ?  327  LEU A CG  1 
ATOM   2489 C  CD1 . LEU A  1 327 ? 13.961  3.573   16.423  1.00 63.71  ?  327  LEU A CD1 1 
ATOM   2490 C  CD2 . LEU A  1 327 ? 15.425  5.362   17.278  1.00 60.06  ?  327  LEU A CD2 1 
ATOM   2491 N  N   . VAL A  1 328 ? 17.489  3.609   13.499  1.00 49.15  ?  328  VAL A N   1 
ATOM   2492 C  CA  . VAL A  1 328 ? 18.285  4.464   12.626  1.00 38.19  ?  328  VAL A CA  1 
ATOM   2493 C  C   . VAL A  1 328 ? 17.378  5.482   11.986  1.00 39.78  ?  328  VAL A C   1 
ATOM   2494 O  O   . VAL A  1 328 ? 16.163  5.275   11.880  1.00 49.53  ?  328  VAL A O   1 
ATOM   2495 C  CB  . VAL A  1 328 ? 18.955  3.654   11.514  1.00 38.47  ?  328  VAL A CB  1 
ATOM   2496 C  CG1 . VAL A  1 328 ? 19.972  2.701   12.095  1.00 41.37  ?  328  VAL A CG1 1 
ATOM   2497 C  CG2 . VAL A  1 328 ? 17.914  2.876   10.745  1.00 39.45  ?  328  VAL A CG2 1 
ATOM   2498 N  N   . GLY A  1 329 ? 17.953  6.589   11.547  1.00 30.95  ?  329  GLY A N   1 
ATOM   2499 C  CA  . GLY A  1 329 ? 17.142  7.584   10.886  1.00 33.19  ?  329  GLY A CA  1 
ATOM   2500 C  C   . GLY A  1 329 ? 17.898  8.816   10.482  1.00 35.93  ?  329  GLY A C   1 
ATOM   2501 O  O   . GLY A  1 329 ? 19.117  8.890   10.638  1.00 43.42  ?  329  GLY A O   1 
ATOM   2502 N  N   . VAL A  1 330 ? 17.163  9.792   9.962   1.00 27.99  ?  330  VAL A N   1 
ATOM   2503 C  CA  . VAL A  1 330 ? 17.767  10.948  9.317   1.00 27.42  ?  330  VAL A CA  1 
ATOM   2504 C  C   . VAL A  1 330 ? 16.843  12.134  9.489   1.00 32.40  ?  330  VAL A C   1 
ATOM   2505 O  O   . VAL A  1 330 ? 15.652  11.960  9.762   1.00 41.49  ?  330  VAL A O   1 
ATOM   2506 C  CB  . VAL A  1 330 ? 17.968  10.700  7.782   1.00 43.24  ?  330  VAL A CB  1 
ATOM   2507 C  CG1 . VAL A  1 330 ? 19.038  9.626   7.519   1.00 36.75  ?  330  VAL A CG1 1 
ATOM   2508 C  CG2 . VAL A  1 330 ? 16.646  10.335  7.118   1.00 28.59  ?  330  VAL A CG2 1 
ATOM   2509 N  N   . VAL A  1 331 ? 17.375  13.342  9.342   1.00 28.31  ?  331  VAL A N   1 
ATOM   2510 C  CA  . VAL A  1 331 ? 16.500  14.513  9.305   1.00 36.22  ?  331  VAL A CA  1 
ATOM   2511 C  C   . VAL A  1 331 ? 16.135  14.799  7.841   1.00 41.34  ?  331  VAL A C   1 
ATOM   2512 O  O   . VAL A  1 331 ? 16.689  14.182  6.935   1.00 38.47  ?  331  VAL A O   1 
ATOM   2513 C  CB  . VAL A  1 331 ? 17.138  15.736  9.991   1.00 30.92  ?  331  VAL A CB  1 
ATOM   2514 C  CG1 . VAL A  1 331 ? 17.499  15.399  11.428  1.00 31.70  ?  331  VAL A CG1 1 
ATOM   2515 C  CG2 . VAL A  1 331 ? 18.370  16.170  9.253   1.00 29.54  ?  331  VAL A CG2 1 
ATOM   2516 N  N   . LYS A  1 332 ? 15.200  15.716  7.612   1.00 46.58  ?  332  LYS A N   1 
ATOM   2517 C  CA  . LYS A  1 332 ? 14.660  15.928  6.274   1.00 49.25  ?  332  LYS A CA  1 
ATOM   2518 C  C   . LYS A  1 332 ? 15.647  16.633  5.345   1.00 49.13  ?  332  LYS A C   1 
ATOM   2519 O  O   . LYS A  1 332 ? 15.637  16.403  4.140   1.00 41.01  ?  332  LYS A O   1 
ATOM   2520 C  CB  . LYS A  1 332 ? 13.331  16.689  6.324   1.00 52.16  ?  332  LYS A CB  1 
ATOM   2521 C  CG  . LYS A  1 332 ? 12.588  16.721  4.996   1.00 49.23  ?  332  LYS A CG  1 
ATOM   2522 C  CD  . LYS A  1 332 ? 11.216  17.368  5.121   1.00 62.13  ?  332  LYS A CD  1 
ATOM   2523 C  CE  . LYS A  1 332 ? 11.216  18.827  4.650   1.00 75.78  ?  332  LYS A CE  1 
ATOM   2524 N  NZ  . LYS A  1 332 ? 12.066  19.742  5.483   1.00 76.54  ?  332  LYS A NZ  1 
ATOM   2525 N  N   . ASP A  1 333 ? 16.515  17.466  5.909   1.00 46.83  ?  333  ASP A N   1 
ATOM   2526 C  CA  . ASP A  1 333 ? 17.493  18.204  5.106   1.00 33.44  ?  333  ASP A CA  1 
ATOM   2527 C  C   . ASP A  1 333 ? 18.922  18.023  5.621   1.00 40.57  ?  333  ASP A C   1 
ATOM   2528 O  O   . ASP A  1 333 ? 19.542  18.961  6.143   1.00 44.71  ?  333  ASP A O   1 
ATOM   2529 C  CB  . ASP A  1 333 ? 17.106  19.687  5.059   1.00 32.22  ?  333  ASP A CB  1 
ATOM   2530 C  CG  . ASP A  1 333 ? 15.686  19.889  4.559   1.00 42.53  ?  333  ASP A CG  1 
ATOM   2531 O  OD1 . ASP A  1 333 ? 14.744  19.827  5.376   1.00 53.61  ?  333  ASP A OD1 1 
ATOM   2532 O  OD2 . ASP A  1 333 ? 15.508  20.076  3.342   1.00 48.63  ?  333  ASP A OD2 1 
ATOM   2533 N  N   . GLU A  1 334 ? 19.440  16.808  5.464   1.00 39.18  ?  334  GLU A N   1 
ATOM   2534 C  CA  . GLU A  1 334 ? 20.757  16.466  5.981   1.00 34.42  ?  334  GLU A CA  1 
ATOM   2535 C  C   . GLU A  1 334 ? 21.857  17.372  5.432   1.00 41.58  ?  334  GLU A C   1 
ATOM   2536 O  O   . GLU A  1 334 ? 22.817  17.687  6.138   1.00 41.73  ?  334  GLU A O   1 
ATOM   2537 C  CB  . GLU A  1 334 ? 21.084  14.991  5.690   1.00 39.10  ?  334  GLU A CB  1 
ATOM   2538 C  CG  . GLU A  1 334 ? 20.222  13.978  6.456   1.00 45.24  ?  334  GLU A CG  1 
ATOM   2539 C  CD  . GLU A  1 334 ? 20.528  13.930  7.959   1.00 52.39  ?  334  GLU A CD  1 
ATOM   2540 O  OE1 . GLU A  1 334 ? 21.582  14.458  8.374   1.00 48.59  ?  334  GLU A OE1 1 
ATOM   2541 O  OE2 . GLU A  1 334 ? 19.709  13.371  8.730   1.00 50.96  ?  334  GLU A OE2 1 
ATOM   2542 N  N   . GLY A  1 335 ? 21.724  17.802  4.178   1.00 35.64  ?  335  GLY A N   1 
ATOM   2543 C  CA  . GLY A  1 335 ? 22.830  18.468  3.525   1.00 27.56  ?  335  GLY A CA  1 
ATOM   2544 C  C   . GLY A  1 335 ? 22.965  19.966  3.737   1.00 32.35  ?  335  GLY A C   1 
ATOM   2545 O  O   . GLY A  1 335 ? 24.067  20.496  3.624   1.00 38.64  ?  335  GLY A O   1 
ATOM   2546 N  N   . SER A  1 336 ? 21.871  20.658  4.040   1.00 30.38  ?  336  SER A N   1 
ATOM   2547 C  CA  . SER A  1 336 ? 21.880  22.122  3.934   1.00 35.68  ?  336  SER A CA  1 
ATOM   2548 C  C   . SER A  1 336 ? 22.937  22.839  4.777   1.00 44.79  ?  336  SER A C   1 
ATOM   2549 O  O   . SER A  1 336 ? 23.591  23.765  4.301   1.00 46.92  ?  336  SER A O   1 
ATOM   2550 C  CB  . SER A  1 336 ? 20.491  22.699  4.206   1.00 40.80  ?  336  SER A CB  1 
ATOM   2551 O  OG  . SER A  1 336 ? 20.057  22.403  5.509   1.00 43.19  ?  336  SER A OG  1 
ATOM   2552 N  N   . TYR A  1 337 ? 23.097  22.400  6.023   1.00 45.66  ?  337  TYR A N   1 
ATOM   2553 C  CA  . TYR A  1 337 ? 24.050  22.984  6.967   1.00 41.91  ?  337  TYR A CA  1 
ATOM   2554 C  C   . TYR A  1 337 ? 25.474  23.070  6.392   1.00 43.74  ?  337  TYR A C   1 
ATOM   2555 O  O   . TYR A  1 337 ? 26.202  24.042  6.612   1.00 39.67  ?  337  TYR A O   1 
ATOM   2556 C  CB  . TYR A  1 337 ? 24.059  22.129  8.241   1.00 40.60  ?  337  TYR A CB  1 
ATOM   2557 C  CG  . TYR A  1 337 ? 24.666  22.781  9.458   1.00 34.36  ?  337  TYR A CG  1 
ATOM   2558 C  CD1 . TYR A  1 337 ? 26.039  22.916  9.584   1.00 36.18  ?  337  TYR A CD1 1 
ATOM   2559 C  CD2 . TYR A  1 337 ? 23.863  23.255  10.490  1.00 37.52  ?  337  TYR A CD2 1 
ATOM   2560 C  CE1 . TYR A  1 337 ? 26.605  23.510  10.685  1.00 39.62  ?  337  TYR A CE1 1 
ATOM   2561 C  CE2 . TYR A  1 337 ? 24.426  23.857  11.612  1.00 43.52  ?  337  TYR A CE2 1 
ATOM   2562 C  CZ  . TYR A  1 337 ? 25.799  23.974  11.702  1.00 41.63  ?  337  TYR A CZ  1 
ATOM   2563 O  OH  . TYR A  1 337 ? 26.379  24.557  12.805  1.00 42.82  ?  337  TYR A OH  1 
ATOM   2564 N  N   . PHE A  1 338 ? 25.864  22.046  5.648   1.00 41.28  ?  338  PHE A N   1 
ATOM   2565 C  CA  . PHE A  1 338 ? 27.222  21.964  5.141   1.00 39.97  ?  338  PHE A CA  1 
ATOM   2566 C  C   . PHE A  1 338 ? 27.535  22.959  4.029   1.00 41.34  ?  338  PHE A C   1 
ATOM   2567 O  O   . PHE A  1 338 ? 28.676  23.401  3.903   1.00 41.43  ?  338  PHE A O   1 
ATOM   2568 C  CB  . PHE A  1 338 ? 27.531  20.523  4.741   1.00 38.77  ?  338  PHE A CB  1 
ATOM   2569 C  CG  . PHE A  1 338 ? 27.480  19.592  5.900   1.00 40.31  ?  338  PHE A CG  1 
ATOM   2570 C  CD1 . PHE A  1 338 ? 26.289  19.011  6.280   1.00 44.09  ?  338  PHE A CD1 1 
ATOM   2571 C  CD2 . PHE A  1 338 ? 28.606  19.381  6.681   1.00 43.60  ?  338  PHE A CD2 1 
ATOM   2572 C  CE1 . PHE A  1 338 ? 26.226  18.191  7.401   1.00 47.72  ?  338  PHE A CE1 1 
ATOM   2573 C  CE2 . PHE A  1 338 ? 28.554  18.550  7.789   1.00 42.83  ?  338  PHE A CE2 1 
ATOM   2574 C  CZ  . PHE A  1 338 ? 27.362  17.960  8.152   1.00 42.69  ?  338  PHE A CZ  1 
ATOM   2575 N  N   . LEU A  1 339 ? 26.514  23.341  3.261   1.00 35.98  ?  339  LEU A N   1 
ATOM   2576 C  CA  . LEU A  1 339 ? 26.712  24.203  2.104   1.00 35.72  ?  339  LEU A CA  1 
ATOM   2577 C  C   . LEU A  1 339 ? 27.299  25.579  2.443   1.00 40.63  ?  339  LEU A C   1 
ATOM   2578 O  O   . LEU A  1 339 ? 28.075  26.113  1.661   1.00 42.36  ?  339  LEU A O   1 
ATOM   2579 C  CB  . LEU A  1 339 ? 25.408  24.354  1.303   1.00 38.34  ?  339  LEU A CB  1 
ATOM   2580 C  CG  . LEU A  1 339 ? 24.738  23.030  0.926   1.00 41.75  ?  339  LEU A CG  1 
ATOM   2581 C  CD1 . LEU A  1 339 ? 23.552  23.265  0.003   1.00 49.30  ?  339  LEU A CD1 1 
ATOM   2582 C  CD2 . LEU A  1 339 ? 25.741  22.061  0.293   1.00 36.68  ?  339  LEU A CD2 1 
ATOM   2583 N  N   . VAL A  1 340 ? 26.950  26.150  3.600   1.00 41.74  ?  340  VAL A N   1 
ATOM   2584 C  CA  . VAL A  1 340 ? 27.439  27.495  3.934   1.00 42.32  ?  340  VAL A CA  1 
ATOM   2585 C  C   . VAL A  1 340 ? 28.905  27.469  4.371   1.00 43.62  ?  340  VAL A C   1 
ATOM   2586 O  O   . VAL A  1 340 ? 29.547  28.510  4.500   1.00 51.00  ?  340  VAL A O   1 
ATOM   2587 C  CB  . VAL A  1 340 ? 26.565  28.207  4.991   1.00 45.06  ?  340  VAL A CB  1 
ATOM   2588 C  CG1 . VAL A  1 340 ? 25.162  28.416  4.454   1.00 49.93  ?  340  VAL A CG1 1 
ATOM   2589 C  CG2 . VAL A  1 340 ? 26.515  27.406  6.284   1.00 49.08  ?  340  VAL A CG2 1 
ATOM   2590 N  N   . TYR A  1 341 ? 29.435  26.268  4.561   1.00 34.38  ?  341  TYR A N   1 
ATOM   2591 C  CA  . TYR A  1 341 ? 30.821  26.105  4.970   1.00 47.76  ?  341  TYR A CA  1 
ATOM   2592 C  C   . TYR A  1 341 ? 31.767  25.716  3.837   1.00 54.59  ?  341  TYR A C   1 
ATOM   2593 O  O   . TYR A  1 341 ? 32.851  25.177  4.093   1.00 56.25  ?  341  TYR A O   1 
ATOM   2594 C  CB  . TYR A  1 341 ? 30.925  25.048  6.072   1.00 46.82  ?  341  TYR A CB  1 
ATOM   2595 C  CG  . TYR A  1 341 ? 30.486  25.543  7.413   1.00 43.83  ?  341  TYR A CG  1 
ATOM   2596 C  CD1 . TYR A  1 341 ? 31.369  26.229  8.238   1.00 46.74  ?  341  TYR A CD1 1 
ATOM   2597 C  CD2 . TYR A  1 341 ? 29.187  25.343  7.857   1.00 38.21  ?  341  TYR A CD2 1 
ATOM   2598 C  CE1 . TYR A  1 341 ? 30.973  26.696  9.470   1.00 49.52  ?  341  TYR A CE1 1 
ATOM   2599 C  CE2 . TYR A  1 341 ? 28.781  25.805  9.098   1.00 48.91  ?  341  TYR A CE2 1 
ATOM   2600 C  CZ  . TYR A  1 341 ? 29.677  26.481  9.900   1.00 53.03  ?  341  TYR A CZ  1 
ATOM   2601 O  OH  . TYR A  1 341 ? 29.279  26.944  11.137  1.00 60.10  ?  341  TYR A OH  1 
ATOM   2602 N  N   . GLY A  1 342 ? 31.378  25.968  2.592   1.00 49.96  ?  342  GLY A N   1 
ATOM   2603 C  CA  . GLY A  1 342 ? 32.257  25.593  1.504   1.00 52.14  ?  342  GLY A CA  1 
ATOM   2604 C  C   . GLY A  1 342 ? 31.798  25.746  0.068   1.00 48.87  ?  342  GLY A C   1 
ATOM   2605 O  O   . GLY A  1 342 ? 32.644  25.859  -0.819  1.00 48.16  ?  342  GLY A O   1 
ATOM   2606 N  N   . VAL A  1 343 ? 30.493  25.729  -0.185  1.00 39.67  ?  343  VAL A N   1 
ATOM   2607 C  CA  . VAL A  1 343 ? 30.022  25.856  -1.562  1.00 46.65  ?  343  VAL A CA  1 
ATOM   2608 C  C   . VAL A  1 343 ? 29.645  27.292  -1.903  1.00 50.98  ?  343  VAL A C   1 
ATOM   2609 O  O   . VAL A  1 343 ? 28.702  27.839  -1.332  1.00 55.68  ?  343  VAL A O   1 
ATOM   2610 C  CB  . VAL A  1 343 ? 28.840  24.938  -1.867  1.00 42.69  ?  343  VAL A CB  1 
ATOM   2611 C  CG1 . VAL A  1 343 ? 28.473  25.061  -3.346  1.00 42.45  ?  343  VAL A CG1 1 
ATOM   2612 C  CG2 . VAL A  1 343 ? 29.187  23.506  -1.525  1.00 39.11  ?  343  VAL A CG2 1 
ATOM   2613 N  N   . PRO A  1 344 ? 30.385  27.905  -2.840  1.00 45.83  ?  344  PRO A N   1 
ATOM   2614 C  CA  . PRO A  1 344 ? 30.161  29.323  -3.151  1.00 45.31  ?  344  PRO A CA  1 
ATOM   2615 C  C   . PRO A  1 344 ? 28.728  29.532  -3.595  1.00 46.55  ?  344  PRO A C   1 
ATOM   2616 O  O   . PRO A  1 344 ? 28.185  28.663  -4.276  1.00 47.40  ?  344  PRO A O   1 
ATOM   2617 C  CB  . PRO A  1 344 ? 31.145  29.602  -4.300  1.00 33.92  ?  344  PRO A CB  1 
ATOM   2618 C  CG  . PRO A  1 344 ? 32.213  28.537  -4.166  1.00 35.88  ?  344  PRO A CG  1 
ATOM   2619 C  CD  . PRO A  1 344 ? 31.486  27.319  -3.629  1.00 43.27  ?  344  PRO A CD  1 
ATOM   2620 N  N   . GLY A  1 345 ? 28.122  30.641  -3.180  1.00 46.00  ?  345  GLY A N   1 
ATOM   2621 C  CA  . GLY A  1 345 ? 26.717  30.896  -3.441  1.00 42.21  ?  345  GLY A CA  1 
ATOM   2622 C  C   . GLY A  1 345 ? 25.843  30.722  -2.214  1.00 48.28  ?  345  GLY A C   1 
ATOM   2623 O  O   . GLY A  1 345 ? 24.767  31.303  -2.135  1.00 59.41  ?  345  GLY A O   1 
ATOM   2624 N  N   . PHE A  1 346 ? 26.307  29.943  -1.240  1.00 44.28  ?  346  PHE A N   1 
ATOM   2625 C  CA  . PHE A  1 346 ? 25.492  29.649  -0.057  1.00 44.01  ?  346  PHE A CA  1 
ATOM   2626 C  C   . PHE A  1 346 ? 25.848  30.495  1.175   1.00 48.13  ?  346  PHE A C   1 
ATOM   2627 O  O   . PHE A  1 346 ? 27.020  30.692  1.510   1.00 52.24  ?  346  PHE A O   1 
ATOM   2628 C  CB  . PHE A  1 346 ? 25.508  28.143  0.261   1.00 32.64  ?  346  PHE A CB  1 
ATOM   2629 C  CG  . PHE A  1 346 ? 24.946  27.300  -0.842  1.00 35.89  ?  346  PHE A CG  1 
ATOM   2630 C  CD1 . PHE A  1 346 ? 25.719  26.998  -1.968  1.00 40.80  ?  346  PHE A CD1 1 
ATOM   2631 C  CD2 . PHE A  1 346 ? 23.638  26.842  -0.787  1.00 35.98  ?  346  PHE A CD2 1 
ATOM   2632 C  CE1 . PHE A  1 346 ? 25.202  26.233  -3.021  1.00 36.21  ?  346  PHE A CE1 1 
ATOM   2633 C  CE2 . PHE A  1 346 ? 23.111  26.078  -1.831  1.00 42.21  ?  346  PHE A CE2 1 
ATOM   2634 C  CZ  . PHE A  1 346 ? 23.902  25.772  -2.957  1.00 36.43  ?  346  PHE A CZ  1 
ATOM   2635 N  N   . SER A  1 347 ? 24.810  31.001  1.830   1.00 46.03  ?  347  SER A N   1 
ATOM   2636 C  CA  . SER A  1 347 ? 24.950  31.787  3.047   1.00 46.35  ?  347  SER A CA  1 
ATOM   2637 C  C   . SER A  1 347 ? 23.653  31.686  3.834   1.00 52.87  ?  347  SER A C   1 
ATOM   2638 O  O   . SER A  1 347 ? 22.582  31.458  3.265   1.00 61.14  ?  347  SER A O   1 
ATOM   2639 C  CB  . SER A  1 347 ? 25.244  33.255  2.721   1.00 48.58  ?  347  SER A CB  1 
ATOM   2640 O  OG  . SER A  1 347 ? 25.530  34.004  3.895   1.00 50.62  ?  347  SER A OG  1 
ATOM   2641 N  N   . LYS A  1 348 ? 23.742  31.858  5.145   1.00 46.87  ?  348  LYS A N   1 
ATOM   2642 C  CA  . LYS A  1 348 ? 22.550  31.831  5.966   1.00 43.46  ?  348  LYS A CA  1 
ATOM   2643 C  C   . LYS A  1 348 ? 21.823  33.162  5.864   1.00 46.48  ?  348  LYS A C   1 
ATOM   2644 O  O   . LYS A  1 348 ? 20.674  33.281  6.288   1.00 57.41  ?  348  LYS A O   1 
ATOM   2645 C  CB  . LYS A  1 348 ? 22.910  31.557  7.426   1.00 41.83  ?  348  LYS A CB  1 
ATOM   2646 C  CG  . LYS A  1 348 ? 23.340  32.788  8.212   1.00 41.26  ?  348  LYS A CG  1 
ATOM   2647 C  CD  . LYS A  1 348 ? 23.465  32.443  9.692   1.00 53.13  ?  348  LYS A CD  1 
ATOM   2648 C  CE  . LYS A  1 348 ? 23.873  33.653  10.518  1.00 59.03  ?  348  LYS A CE  1 
ATOM   2649 N  NZ  . LYS A  1 348 ? 22.893  34.768  10.394  1.00 64.57  ?  348  LYS A NZ  1 
ATOM   2650 N  N   . ASP A  1 349 ? 22.502  34.163  5.307   1.00 41.25  ?  349  ASP A N   1 
ATOM   2651 C  CA  . ASP A  1 349 ? 21.990  35.534  5.312   1.00 49.89  ?  349  ASP A CA  1 
ATOM   2652 C  C   . ASP A  1 349 ? 21.252  35.921  4.038   1.00 52.03  ?  349  ASP A C   1 
ATOM   2653 O  O   . ASP A  1 349 ? 20.765  37.045  3.921   1.00 56.83  ?  349  ASP A O   1 
ATOM   2654 C  CB  . ASP A  1 349 ? 23.116  36.534  5.588   1.00 53.62  ?  349  ASP A CB  1 
ATOM   2655 C  CG  . ASP A  1 349 ? 23.699  36.387  6.990   1.00 61.45  ?  349  ASP A CG  1 
ATOM   2656 O  OD1 . ASP A  1 349 ? 22.916  36.206  7.961   1.00 49.99  ?  349  ASP A OD1 1 
ATOM   2657 O  OD2 . ASP A  1 349 ? 24.945  36.442  7.109   1.00 63.53  ?  349  ASP A OD2 1 
ATOM   2658 N  N   . ASN A  1 350 ? 21.191  35.001  3.080   1.00 50.98  ?  350  ASN A N   1 
ATOM   2659 C  CA  . ASN A  1 350 ? 20.353  35.181  1.899   1.00 53.03  ?  350  ASN A CA  1 
ATOM   2660 C  C   . ASN A  1 350 ? 19.715  33.853  1.526   1.00 53.66  ?  350  ASN A C   1 
ATOM   2661 O  O   . ASN A  1 350 ? 19.928  32.839  2.213   1.00 47.19  ?  350  ASN A O   1 
ATOM   2662 C  CB  . ASN A  1 350 ? 21.129  35.795  0.716   1.00 60.38  ?  350  ASN A CB  1 
ATOM   2663 C  CG  . ASN A  1 350 ? 22.266  34.908  0.219   1.00 75.88  ?  350  ASN A CG  1 
ATOM   2664 O  OD1 . ASN A  1 350 ? 22.041  33.786  -0.244  1.00 72.95  ?  350  ASN A OD1 1 
ATOM   2665 N  ND2 . ASN A  1 350 ? 23.496  35.421  0.291   1.00 99.03  ?  350  ASN A ND2 1 
ATOM   2666 N  N   . GLU A  1 351 ? 18.950  33.862  0.435   1.00 57.55  ?  351  GLU A N   1 
ATOM   2667 C  CA  . GLU A  1 351 ? 18.169  32.702  0.001   1.00 57.13  ?  351  GLU A CA  1 
ATOM   2668 C  C   . GLU A  1 351 ? 18.997  31.630  -0.711  1.00 44.52  ?  351  GLU A C   1 
ATOM   2669 O  O   . GLU A  1 351 ? 18.481  30.556  -1.042  1.00 44.08  ?  351  GLU A O   1 
ATOM   2670 C  CB  . GLU A  1 351 ? 17.019  33.149  -0.899  1.00 65.66  ?  351  GLU A CB  1 
ATOM   2671 C  CG  . GLU A  1 351 ? 16.104  34.173  -0.267  1.00 80.83  ?  351  GLU A CG  1 
ATOM   2672 C  CD  . GLU A  1 351 ? 15.225  33.581  0.817   1.00 98.74  ?  351  GLU A CD  1 
ATOM   2673 O  OE1 . GLU A  1 351 ? 15.140  32.335  0.912   1.00 101.41 ?  351  GLU A OE1 1 
ATOM   2674 O  OE2 . GLU A  1 351 ? 14.611  34.366  1.571   1.00 110.27 ?  351  GLU A OE2 1 
ATOM   2675 N  N   . SER A  1 352 ? 20.273  31.930  -0.941  1.00 37.26  ?  352  SER A N   1 
ATOM   2676 C  CA  . SER A  1 352 ? 21.198  30.990  -1.574  1.00 45.80  ?  352  SER A CA  1 
ATOM   2677 C  C   . SER A  1 352 ? 20.742  30.439  -2.933  1.00 49.71  ?  352  SER A C   1 
ATOM   2678 O  O   . SER A  1 352 ? 21.017  29.289  -3.268  1.00 50.46  ?  352  SER A O   1 
ATOM   2679 C  CB  . SER A  1 352 ? 21.507  29.851  -0.612  1.00 48.02  ?  352  SER A CB  1 
ATOM   2680 O  OG  . SER A  1 352 ? 22.117  30.380  0.543   1.00 47.49  ?  352  SER A OG  1 
ATOM   2681 N  N   . LEU A  1 353 ? 20.041  31.263  -3.707  1.00 46.72  ?  353  LEU A N   1 
ATOM   2682 C  CA  . LEU A  1 353 ? 19.643  30.882  -5.053  1.00 50.16  ?  353  LEU A CA  1 
ATOM   2683 C  C   . LEU A  1 353 ? 20.876  30.865  -5.957  1.00 52.57  ?  353  LEU A C   1 
ATOM   2684 O  O   . LEU A  1 353 ? 21.445  31.909  -6.256  1.00 57.38  ?  353  LEU A O   1 
ATOM   2685 C  CB  . LEU A  1 353 ? 18.585  31.848  -5.585  1.00 48.81  ?  353  LEU A CB  1 
ATOM   2686 C  CG  . LEU A  1 353 ? 17.275  31.831  -4.787  1.00 54.07  ?  353  LEU A CG  1 
ATOM   2687 C  CD1 . LEU A  1 353 ? 16.314  32.915  -5.256  1.00 57.98  ?  353  LEU A CD1 1 
ATOM   2688 C  CD2 . LEU A  1 353 ? 16.609  30.460  -4.850  1.00 48.91  ?  353  LEU A CD2 1 
ATOM   2689 N  N   . ILE A  1 354 ? 21.298  29.675  -6.372  1.00 47.41  ?  354  ILE A N   1 
ATOM   2690 C  CA  . ILE A  1 354 ? 22.514  29.533  -7.169  1.00 47.28  ?  354  ILE A CA  1 
ATOM   2691 C  C   . ILE A  1 354 ? 22.259  29.317  -8.675  1.00 47.61  ?  354  ILE A C   1 
ATOM   2692 O  O   . ILE A  1 354 ? 21.161  28.955  -9.094  1.00 47.98  ?  354  ILE A O   1 
ATOM   2693 C  CB  . ILE A  1 354 ? 23.397  28.387  -6.638  1.00 44.05  ?  354  ILE A CB  1 
ATOM   2694 C  CG1 . ILE A  1 354 ? 22.610  27.076  -6.603  1.00 35.05  ?  354  ILE A CG1 1 
ATOM   2695 C  CG2 . ILE A  1 354 ? 23.940  28.730  -5.255  1.00 46.52  ?  354  ILE A CG2 1 
ATOM   2696 C  CD1 . ILE A  1 354 ? 23.489  25.852  -6.612  1.00 33.68  ?  354  ILE A CD1 1 
ATOM   2697 N  N   . SER A  1 355 ? 23.287  29.550  -9.482  1.00 45.93  ?  355  SER A N   1 
ATOM   2698 C  CA  . SER A  1 355 ? 23.214  29.282  -10.914 1.00 46.32  ?  355  SER A CA  1 
ATOM   2699 C  C   . SER A  1 355 ? 23.588  27.834  -11.224 1.00 48.29  ?  355  SER A C   1 
ATOM   2700 O  O   . SER A  1 355 ? 24.087  27.105  -10.372 1.00 50.45  ?  355  SER A O   1 
ATOM   2701 C  CB  . SER A  1 355 ? 24.153  30.214  -11.668 1.00 48.36  ?  355  SER A CB  1 
ATOM   2702 O  OG  . SER A  1 355 ? 25.509  29.945  -11.328 1.00 53.75  ?  355  SER A OG  1 
ATOM   2703 N  N   . ARG A  1 356 ? 23.354  27.423  -12.460 1.00 57.19  ?  356  ARG A N   1 
ATOM   2704 C  CA  . ARG A  1 356 ? 23.737  26.092  -12.893 1.00 53.25  ?  356  ARG A CA  1 
ATOM   2705 C  C   . ARG A  1 356 ? 25.240  25.917  -12.723 1.00 50.49  ?  356  ARG A C   1 
ATOM   2706 O  O   . ARG A  1 356 ? 25.716  24.877  -12.261 1.00 50.92  ?  356  ARG A O   1 
ATOM   2707 C  CB  . ARG A  1 356 ? 23.345  25.886  -14.351 1.00 57.41  ?  356  ARG A CB  1 
ATOM   2708 C  CG  . ARG A  1 356 ? 23.696  24.527  -14.861 1.00 60.18  ?  356  ARG A CG  1 
ATOM   2709 C  CD  . ARG A  1 356 ? 22.550  23.922  -15.633 1.00 59.67  ?  356  ARG A CD  1 
ATOM   2710 N  NE  . ARG A  1 356 ? 22.811  22.512  -15.884 1.00 55.11  ?  356  ARG A NE  1 
ATOM   2711 C  CZ  . ARG A  1 356 ? 22.321  21.519  -15.154 1.00 50.26  ?  356  ARG A CZ  1 
ATOM   2712 N  NH1 . ARG A  1 356 ? 21.509  21.776  -14.132 1.00 50.86  ?  356  ARG A NH1 1 
ATOM   2713 N  NH2 . ARG A  1 356 ? 22.628  20.269  -15.463 1.00 44.13  ?  356  ARG A NH2 1 
ATOM   2714 N  N   . ALA A  1 357 ? 25.979  26.956  -13.088 1.00 45.84  ?  357  ALA A N   1 
ATOM   2715 C  CA  . ALA A  1 357 ? 27.425  26.952  -12.955 1.00 47.81  ?  357  ALA A CA  1 
ATOM   2716 C  C   . ALA A  1 357 ? 27.818  26.657  -11.518 1.00 46.36  ?  357  ALA A C   1 
ATOM   2717 O  O   . ALA A  1 357 ? 28.695  25.835  -11.262 1.00 51.98  ?  357  ALA A O   1 
ATOM   2718 C  CB  . ALA A  1 357 ? 28.005  28.289  -13.405 1.00 39.84  ?  357  ALA A CB  1 
ATOM   2719 N  N   . GLN A  1 358 ? 27.145  27.314  -10.581 1.00 45.40  ?  358  GLN A N   1 
ATOM   2720 C  CA  . GLN A  1 358 ? 27.480  27.165  -9.173  1.00 39.52  ?  358  GLN A CA  1 
ATOM   2721 C  C   . GLN A  1 358 ? 27.127  25.777  -8.685  1.00 37.00  ?  358  GLN A C   1 
ATOM   2722 O  O   . GLN A  1 358 ? 27.779  25.234  -7.794  1.00 41.95  ?  358  GLN A O   1 
ATOM   2723 C  CB  . GLN A  1 358 ? 26.802  28.247  -8.335  1.00 39.13  ?  358  GLN A CB  1 
ATOM   2724 C  CG  . GLN A  1 358 ? 27.355  29.640  -8.621  1.00 41.99  ?  358  GLN A CG  1 
ATOM   2725 C  CD  . GLN A  1 358 ? 26.642  30.725  -7.850  1.00 50.67  ?  358  GLN A CD  1 
ATOM   2726 O  OE1 . GLN A  1 358 ? 25.419  30.851  -7.914  1.00 55.55  ?  358  GLN A OE1 1 
ATOM   2727 N  NE2 . GLN A  1 358 ? 27.404  31.509  -7.104  1.00 54.47  ?  358  GLN A NE2 1 
ATOM   2728 N  N   . PHE A  1 359 ? 26.104  25.194  -9.289  1.00 36.35  ?  359  PHE A N   1 
ATOM   2729 C  CA  . PHE A  1 359 ? 25.732  23.824  -8.971  1.00 36.15  ?  359  PHE A CA  1 
ATOM   2730 C  C   . PHE A  1 359 ? 26.817  22.845  -9.426  1.00 40.24  ?  359  PHE A C   1 
ATOM   2731 O  O   . PHE A  1 359 ? 27.232  21.983  -8.654  1.00 41.24  ?  359  PHE A O   1 
ATOM   2732 C  CB  . PHE A  1 359 ? 24.376  23.491  -9.589  1.00 36.12  ?  359  PHE A CB  1 
ATOM   2733 C  CG  . PHE A  1 359 ? 23.936  22.076  -9.365  1.00 43.55  ?  359  PHE A CG  1 
ATOM   2734 C  CD1 . PHE A  1 359 ? 23.620  21.627  -8.101  1.00 41.43  ?  359  PHE A CD1 1 
ATOM   2735 C  CD2 . PHE A  1 359 ? 23.833  21.191  -10.426 1.00 49.07  ?  359  PHE A CD2 1 
ATOM   2736 C  CE1 . PHE A  1 359 ? 23.202  20.321  -7.902  1.00 36.82  ?  359  PHE A CE1 1 
ATOM   2737 C  CE2 . PHE A  1 359 ? 23.424  19.881  -10.229 1.00 37.70  ?  359  PHE A CE2 1 
ATOM   2738 C  CZ  . PHE A  1 359 ? 23.104  19.452  -8.973  1.00 41.90  ?  359  PHE A CZ  1 
ATOM   2739 N  N   . LEU A  1 360 ? 27.289  22.987  -10.669 1.00 37.40  ?  360  LEU A N   1 
ATOM   2740 C  CA  . LEU A  1 360 ? 28.364  22.130  -11.171 1.00 40.80  ?  360  LEU A CA  1 
ATOM   2741 C  C   . LEU A  1 360 ? 29.625  22.245  -10.294 1.00 43.93  ?  360  LEU A C   1 
ATOM   2742 O  O   . LEU A  1 360 ? 30.196  21.231  -9.899  1.00 48.42  ?  360  LEU A O   1 
ATOM   2743 C  CB  . LEU A  1 360 ? 28.690  22.417  -12.654 1.00 37.46  ?  360  LEU A CB  1 
ATOM   2744 C  CG  . LEU A  1 360 ? 27.486  22.442  -13.612 1.00 53.88  ?  360  LEU A CG  1 
ATOM   2745 C  CD1 . LEU A  1 360 ? 27.888  22.533  -15.096 1.00 49.40  ?  360  LEU A CD1 1 
ATOM   2746 C  CD2 . LEU A  1 360 ? 26.596  21.249  -13.384 1.00 49.44  ?  360  LEU A CD2 1 
ATOM   2747 N  N   . ALA A  1 361 ? 30.051  23.472  -9.998  1.00 38.28  ?  361  ALA A N   1 
ATOM   2748 C  CA  . ALA A  1 361 ? 31.179  23.702  -9.088  1.00 43.45  ?  361  ALA A CA  1 
ATOM   2749 C  C   . ALA A  1 361 ? 30.939  23.039  -7.729  1.00 48.85  ?  361  ALA A C   1 
ATOM   2750 O  O   . ALA A  1 361 ? 31.823  22.371  -7.189  1.00 50.69  ?  361  ALA A O   1 
ATOM   2751 C  CB  . ALA A  1 361 ? 31.440  25.201  -8.917  1.00 30.38  ?  361  ALA A CB  1 
ATOM   2752 N  N   . GLY A  1 362 ? 29.725  23.206  -7.202  1.00 43.59  ?  362  GLY A N   1 
ATOM   2753 C  CA  . GLY A  1 362 ? 29.375  22.691  -5.897  1.00 37.27  ?  362  GLY A CA  1 
ATOM   2754 C  C   . GLY A  1 362 ? 29.377  21.174  -5.821  1.00 49.88  ?  362  GLY A C   1 
ATOM   2755 O  O   . GLY A  1 362 ? 29.729  20.603  -4.790  1.00 53.56  ?  362  GLY A O   1 
ATOM   2756 N  N   . VAL A  1 363 ? 28.975  20.513  -6.903  1.00 45.00  ?  363  VAL A N   1 
ATOM   2757 C  CA  . VAL A  1 363 ? 28.989  19.054  -6.922  1.00 43.10  ?  363  VAL A CA  1 
ATOM   2758 C  C   . VAL A  1 363 ? 30.412  18.506  -6.724  1.00 46.57  ?  363  VAL A C   1 
ATOM   2759 O  O   . VAL A  1 363 ? 30.598  17.542  -5.980  1.00 40.79  ?  363  VAL A O   1 
ATOM   2760 C  CB  . VAL A  1 363 ? 28.318  18.476  -8.207  1.00 40.23  ?  363  VAL A CB  1 
ATOM   2761 C  CG1 . VAL A  1 363 ? 28.619  16.995  -8.377  1.00 31.81  ?  363  VAL A CG1 1 
ATOM   2762 C  CG2 . VAL A  1 363 ? 26.813  18.685  -8.145  1.00 43.12  ?  363  VAL A CG2 1 
ATOM   2763 N  N   . ARG A  1 364 ? 31.406  19.129  -7.367  1.00 35.53  ?  364  ARG A N   1 
ATOM   2764 C  CA  . ARG A  1 364 ? 32.782  18.676  -7.242  1.00 49.43  ?  364  ARG A CA  1 
ATOM   2765 C  C   . ARG A  1 364 ? 33.279  18.794  -5.799  1.00 55.83  ?  364  ARG A C   1 
ATOM   2766 O  O   . ARG A  1 364 ? 34.129  18.021  -5.356  1.00 53.93  ?  364  ARG A O   1 
ATOM   2767 C  CB  . ARG A  1 364 ? 33.718  19.483  -8.145  1.00 56.78  ?  364  ARG A CB  1 
ATOM   2768 C  CG  . ARG A  1 364 ? 33.329  19.555  -9.610  1.00 57.27  ?  364  ARG A CG  1 
ATOM   2769 C  CD  . ARG A  1 364 ? 33.008  18.191  -10.197 1.00 63.33  ?  364  ARG A CD  1 
ATOM   2770 N  NE  . ARG A  1 364 ? 34.063  17.199  -9.988  1.00 65.09  ?  364  ARG A NE  1 
ATOM   2771 C  CZ  . ARG A  1 364 ? 34.991  16.886  -10.887 1.00 65.52  ?  364  ARG A CZ  1 
ATOM   2772 N  NH1 . ARG A  1 364 ? 35.015  17.499  -12.073 1.00 51.01  ?  364  ARG A NH1 1 
ATOM   2773 N  NH2 . ARG A  1 364 ? 35.898  15.960  -10.597 1.00 65.62  ?  364  ARG A NH2 1 
ATOM   2774 N  N   . ILE A  1 365 ? 32.759  19.779  -5.079  1.00 53.68  ?  365  ILE A N   1 
ATOM   2775 C  CA  . ILE A  1 365 ? 33.207  20.050  -3.721  1.00 48.79  ?  365  ILE A CA  1 
ATOM   2776 C  C   . ILE A  1 365 ? 32.534  19.093  -2.739  1.00 44.79  ?  365  ILE A C   1 
ATOM   2777 O  O   . ILE A  1 365 ? 33.201  18.505  -1.885  1.00 36.30  ?  365  ILE A O   1 
ATOM   2778 C  CB  . ILE A  1 365 ? 32.929  21.506  -3.339  1.00 40.50  ?  365  ILE A CB  1 
ATOM   2779 C  CG1 . ILE A  1 365 ? 33.757  22.436  -4.223  1.00 40.14  ?  365  ILE A CG1 1 
ATOM   2780 C  CG2 . ILE A  1 365 ? 33.263  21.757  -1.900  1.00 32.14  ?  365  ILE A CG2 1 
ATOM   2781 C  CD1 . ILE A  1 365 ? 33.405  23.891  -4.046  1.00 42.38  ?  365  ILE A CD1 1 
ATOM   2782 N  N   . GLY A  1 366 ? 31.221  18.929  -2.901  1.00 35.79  ?  366  GLY A N   1 
ATOM   2783 C  CA  . GLY A  1 366 ? 30.426  17.989  -2.130  1.00 37.18  ?  366  GLY A CA  1 
ATOM   2784 C  C   . GLY A  1 366 ? 30.567  16.514  -2.492  1.00 47.77  ?  366  GLY A C   1 
ATOM   2785 O  O   . GLY A  1 366 ? 30.079  15.639  -1.766  1.00 52.24  ?  366  GLY A O   1 
ATOM   2786 N  N   . VAL A  1 367 ? 31.199  16.227  -3.627  1.00 47.97  ?  367  VAL A N   1 
ATOM   2787 C  CA  . VAL A  1 367 ? 31.568  14.858  -3.968  1.00 38.99  ?  367  VAL A CA  1 
ATOM   2788 C  C   . VAL A  1 367 ? 33.041  14.846  -4.347  1.00 43.89  ?  367  VAL A C   1 
ATOM   2789 O  O   . VAL A  1 367 ? 33.403  14.498  -5.473  1.00 50.71  ?  367  VAL A O   1 
ATOM   2790 C  CB  . VAL A  1 367 ? 30.749  14.299  -5.143  1.00 35.53  ?  367  VAL A CB  1 
ATOM   2791 C  CG1 . VAL A  1 367 ? 30.831  12.777  -5.157  1.00 41.60  ?  367  VAL A CG1 1 
ATOM   2792 C  CG2 . VAL A  1 367 ? 29.306  14.737  -5.044  1.00 31.46  ?  367  VAL A CG2 1 
ATOM   2793 N  N   . PRO A  1 368 ? 33.906  15.212  -3.393  1.00 41.87  ?  368  PRO A N   1 
ATOM   2794 C  CA  . PRO A  1 368 ? 35.301  15.489  -3.745  1.00 37.46  ?  368  PRO A CA  1 
ATOM   2795 C  C   . PRO A  1 368 ? 36.061  14.308  -4.335  1.00 44.96  ?  368  PRO A C   1 
ATOM   2796 O  O   . PRO A  1 368 ? 37.020  14.533  -5.059  1.00 52.31  ?  368  PRO A O   1 
ATOM   2797 C  CB  . PRO A  1 368 ? 35.914  15.933  -2.409  1.00 46.37  ?  368  PRO A CB  1 
ATOM   2798 C  CG  . PRO A  1 368 ? 35.033  15.353  -1.377  1.00 43.75  ?  368  PRO A CG  1 
ATOM   2799 C  CD  . PRO A  1 368 ? 33.658  15.366  -1.948  1.00 29.35  ?  368  PRO A CD  1 
ATOM   2800 N  N   A GLN A  1 369 ? 35.625  13.086  -4.031  0.54 52.01  ?  369  GLN A N   1 
ATOM   2801 N  N   B GLN A  1 369 ? 35.654  13.075  -4.047  0.46 51.79  ?  369  GLN A N   1 
ATOM   2802 C  CA  A GLN A  1 369 ? 36.294  11.874  -4.504  0.54 51.80  ?  369  GLN A CA  1 
ATOM   2803 C  CA  B GLN A  1 369 ? 36.371  11.916  -4.581  0.46 52.61  ?  369  GLN A CA  1 
ATOM   2804 C  C   A GLN A  1 369 ? 35.767  11.380  -5.852  0.54 54.45  ?  369  GLN A C   1 
ATOM   2805 C  C   B GLN A  1 369 ? 36.071  11.692  -6.053  0.46 55.41  ?  369  GLN A C   1 
ATOM   2806 O  O   A GLN A  1 369 ? 36.129  10.294  -6.298  0.54 59.04  ?  369  GLN A O   1 
ATOM   2807 O  O   B GLN A  1 369 ? 36.874  11.097  -6.771  0.46 58.88  ?  369  GLN A O   1 
ATOM   2808 C  CB  A GLN A  1 369 ? 36.185  10.748  -3.469  0.54 49.40  ?  369  GLN A CB  1 
ATOM   2809 C  CB  B GLN A  1 369 ? 36.030  10.635  -3.819  0.46 48.98  ?  369  GLN A CB  1 
ATOM   2810 C  CG  A GLN A  1 369 ? 37.231  10.796  -2.339  0.54 50.15  ?  369  GLN A CG  1 
ATOM   2811 C  CG  B GLN A  1 369 ? 35.260  10.845  -2.549  0.46 48.63  ?  369  GLN A CG  1 
ATOM   2812 C  CD  A GLN A  1 369 ? 36.927  11.853  -1.290  0.54 49.43  ?  369  GLN A CD  1 
ATOM   2813 C  CD  B GLN A  1 369 ? 33.785  10.996  -2.785  0.46 42.62  ?  369  GLN A CD  1 
ATOM   2814 O  OE1 A GLN A  1 369 ? 35.975  11.729  -0.514  0.54 31.66  ?  369  GLN A OE1 1 
ATOM   2815 O  OE1 B GLN A  1 369 ? 33.234  12.078  -2.617  0.46 29.06  ?  369  GLN A OE1 1 
ATOM   2816 N  NE2 A GLN A  1 369 ? 37.730  12.906  -1.273  0.54 33.94  ?  369  GLN A NE2 1 
ATOM   2817 N  NE2 B GLN A  1 369 ? 33.131  9.906   -3.163  0.46 37.97  ?  369  GLN A NE2 1 
ATOM   2818 N  N   . ALA A  1 370 ? 34.913  12.173  -6.492  1.00 50.92  ?  370  ALA A N   1 
ATOM   2819 C  CA  . ALA A  1 370 ? 34.385  11.835  -7.818  1.00 46.69  ?  370  ALA A CA  1 
ATOM   2820 C  C   . ALA A  1 370 ? 35.246  12.274  -8.997  1.00 49.59  ?  370  ALA A C   1 
ATOM   2821 O  O   . ALA A  1 370 ? 35.630  13.438  -9.100  1.00 52.06  ?  370  ALA A O   1 
ATOM   2822 C  CB  . ALA A  1 370 ? 32.970  12.393  -7.990  1.00 46.83  ?  370  ALA A CB  1 
ATOM   2823 N  N   . SER A  1 371 ? 35.517  11.331  -9.900  1.00 50.22  ?  371  SER A N   1 
ATOM   2824 C  CA  . SER A  1 371 ? 36.065  11.651  -11.218 1.00 54.86  ?  371  SER A CA  1 
ATOM   2825 C  C   . SER A  1 371 ? 35.139  12.608  -11.982 1.00 54.42  ?  371  SER A C   1 
ATOM   2826 O  O   . SER A  1 371 ? 34.039  12.908  -11.538 1.00 59.17  ?  371  SER A O   1 
ATOM   2827 C  CB  . SER A  1 371 ? 36.247  10.370  -12.033 1.00 57.31  ?  371  SER A CB  1 
ATOM   2828 O  OG  . SER A  1 371 ? 34.994  9.762   -12.328 1.00 56.56  ?  371  SER A OG  1 
ATOM   2829 N  N   . ASP A  1 372 ? 35.579  13.080  -13.138 1.00 61.92  ?  372  ASP A N   1 
ATOM   2830 C  CA  . ASP A  1 372 ? 34.743  13.966  -13.943 1.00 67.88  ?  372  ASP A CA  1 
ATOM   2831 C  C   . ASP A  1 372 ? 33.438  13.290  -14.371 1.00 62.29  ?  372  ASP A C   1 
ATOM   2832 O  O   . ASP A  1 372 ? 32.381  13.924  -14.384 1.00 53.87  ?  372  ASP A O   1 
ATOM   2833 C  CB  . ASP A  1 372 ? 35.509  14.477  -15.169 1.00 69.96  ?  372  ASP A CB  1 
ATOM   2834 C  CG  . ASP A  1 372 ? 36.445  15.627  -14.837 1.00 80.35  ?  372  ASP A CG  1 
ATOM   2835 O  OD1 . ASP A  1 372 ? 36.726  15.845  -13.639 1.00 78.42  ?  372  ASP A OD1 1 
ATOM   2836 O  OD2 . ASP A  1 372 ? 36.909  16.312  -15.777 1.00 90.64  ?  372  ASP A OD2 1 
ATOM   2837 N  N   . LEU A  1 373 ? 33.521  12.004  -14.709 1.00 60.64  ?  373  LEU A N   1 
ATOM   2838 C  CA  . LEU A  1 373 ? 32.364  11.242  -15.176 1.00 59.51  ?  373  LEU A CA  1 
ATOM   2839 C  C   . LEU A  1 373 ? 31.363  10.970  -14.047 1.00 62.86  ?  373  LEU A C   1 
ATOM   2840 O  O   . LEU A  1 373 ? 30.151  11.157  -14.203 1.00 55.98  ?  373  LEU A O   1 
ATOM   2841 C  CB  . LEU A  1 373 ? 32.821  9.926   -15.816 1.00 60.83  ?  373  LEU A CB  1 
ATOM   2842 C  CG  . LEU A  1 373 ? 31.755  9.077   -16.518 1.00 61.14  ?  373  LEU A CG  1 
ATOM   2843 C  CD1 . LEU A  1 373 ? 30.975  9.911   -17.522 1.00 56.28  ?  373  LEU A CD1 1 
ATOM   2844 C  CD2 . LEU A  1 373 ? 32.376  7.868   -17.206 1.00 60.42  ?  373  LEU A CD2 1 
ATOM   2845 N  N   . ALA A  1 374 ? 31.871  10.528  -12.905 1.00 65.41  ?  374  ALA A N   1 
ATOM   2846 C  CA  . ALA A  1 374 ? 31.016  10.312  -11.748 1.00 53.35  ?  374  ALA A CA  1 
ATOM   2847 C  C   . ALA A  1 374 ? 30.302  11.600  -11.366 1.00 46.69  ?  374  ALA A C   1 
ATOM   2848 O  O   . ALA A  1 374 ? 29.124  11.571  -11.015 1.00 42.49  ?  374  ALA A O   1 
ATOM   2849 C  CB  . ALA A  1 374 ? 31.818  9.771   -10.585 1.00 55.21  ?  374  ALA A CB  1 
ATOM   2850 N  N   . ALA A  1 375 ? 31.006  12.728  -11.463 1.00 48.18  ?  375  ALA A N   1 
ATOM   2851 C  CA  . ALA A  1 375 ? 30.420  14.028  -11.134 1.00 48.20  ?  375  ALA A CA  1 
ATOM   2852 C  C   . ALA A  1 375 ? 29.349  14.374  -12.146 1.00 54.48  ?  375  ALA A C   1 
ATOM   2853 O  O   . ALA A  1 375 ? 28.301  14.914  -11.795 1.00 61.11  ?  375  ALA A O   1 
ATOM   2854 C  CB  . ALA A  1 375 ? 31.474  15.105  -11.109 1.00 41.69  ?  375  ALA A CB  1 
ATOM   2855 N  N   . GLU A  1 376 ? 29.617  14.050  -13.405 1.00 52.85  ?  376  GLU A N   1 
ATOM   2856 C  CA  . GLU A  1 376 ? 28.645  14.255  -14.466 1.00 57.09  ?  376  GLU A CA  1 
ATOM   2857 C  C   . GLU A  1 376 ? 27.369  13.474  -14.174 1.00 48.09  ?  376  GLU A C   1 
ATOM   2858 O  O   . GLU A  1 376 ? 26.275  13.996  -14.320 1.00 48.84  ?  376  GLU A O   1 
ATOM   2859 C  CB  . GLU A  1 376 ? 29.223  13.829  -15.817 1.00 72.37  ?  376  GLU A CB  1 
ATOM   2860 C  CG  . GLU A  1 376 ? 28.518  14.452  -17.000 1.00 89.52  ?  376  GLU A CG  1 
ATOM   2861 C  CD  . GLU A  1 376 ? 28.631  15.965  -16.999 1.00 104.37 ?  376  GLU A CD  1 
ATOM   2862 O  OE1 . GLU A  1 376 ? 29.657  16.478  -17.499 1.00 114.76 ?  376  GLU A OE1 1 
ATOM   2863 O  OE2 . GLU A  1 376 ? 27.703  16.640  -16.494 1.00 101.94 ?  376  GLU A OE2 1 
ATOM   2864 N  N   . ALA A  1 377 ? 27.519  12.222  -13.756 1.00 41.85  ?  377  ALA A N   1 
ATOM   2865 C  CA  . ALA A  1 377 ? 26.372  11.388  -13.420 1.00 42.31  ?  377  ALA A CA  1 
ATOM   2866 C  C   . ALA A  1 377 ? 25.512  11.984  -12.294 1.00 45.48  ?  377  ALA A C   1 
ATOM   2867 O  O   . ALA A  1 377 ? 24.276  11.971  -12.373 1.00 43.65  ?  377  ALA A O   1 
ATOM   2868 C  CB  . ALA A  1 377 ? 26.826  9.986   -13.074 1.00 41.20  ?  377  ALA A CB  1 
ATOM   2869 N  N   . VAL A  1 378 ? 26.167  12.515  -11.263 1.00 46.66  ?  378  VAL A N   1 
ATOM   2870 C  CA  . VAL A  1 378 ? 25.469  13.161  -10.149 1.00 46.95  ?  378  VAL A CA  1 
ATOM   2871 C  C   . VAL A  1 378 ? 24.666  14.354  -10.655 1.00 46.84  ?  378  VAL A C   1 
ATOM   2872 O  O   . VAL A  1 378 ? 23.502  14.545  -10.286 1.00 46.27  ?  378  VAL A O   1 
ATOM   2873 C  CB  . VAL A  1 378 ? 26.450  13.661  -9.055  1.00 39.97  ?  378  VAL A CB  1 
ATOM   2874 C  CG1 . VAL A  1 378 ? 25.692  14.359  -7.937  1.00 40.22  ?  378  VAL A CG1 1 
ATOM   2875 C  CG2 . VAL A  1 378 ? 27.281  12.509  -8.493  1.00 37.50  ?  378  VAL A CG2 1 
ATOM   2876 N  N   . VAL A  1 379 ? 25.290  15.154  -11.514 1.00 39.94  ?  379  VAL A N   1 
ATOM   2877 C  CA  . VAL A  1 379 ? 24.640  16.348  -12.020 1.00 40.45  ?  379  VAL A CA  1 
ATOM   2878 C  C   . VAL A  1 379 ? 23.458  15.979  -12.905 1.00 46.66  ?  379  VAL A C   1 
ATOM   2879 O  O   . VAL A  1 379 ? 22.412  16.628  -12.868 1.00 45.49  ?  379  VAL A O   1 
ATOM   2880 C  CB  . VAL A  1 379 ? 25.607  17.228  -12.811 1.00 46.90  ?  379  VAL A CB  1 
ATOM   2881 C  CG1 . VAL A  1 379 ? 24.841  18.316  -13.539 1.00 41.80  ?  379  VAL A CG1 1 
ATOM   2882 C  CG2 . VAL A  1 379 ? 26.659  17.824  -11.883 1.00 46.83  ?  379  VAL A CG2 1 
ATOM   2883 N  N   . LEU A  1 380 ? 23.612  14.917  -13.685 1.00 52.52  ?  380  LEU A N   1 
ATOM   2884 C  CA  . LEU A  1 380 ? 22.535  14.492  -14.565 1.00 58.29  ?  380  LEU A CA  1 
ATOM   2885 C  C   . LEU A  1 380 ? 21.390  13.904  -13.748 1.00 51.13  ?  380  LEU A C   1 
ATOM   2886 O  O   . LEU A  1 380 ? 20.221  14.173  -14.027 1.00 53.72  ?  380  LEU A O   1 
ATOM   2887 C  CB  . LEU A  1 380 ? 23.048  13.535  -15.650 1.00 67.87  ?  380  LEU A CB  1 
ATOM   2888 C  CG  . LEU A  1 380 ? 24.138  14.211  -16.496 1.00 82.64  ?  380  LEU A CG  1 
ATOM   2889 C  CD1 . LEU A  1 380 ? 24.646  13.347  -17.631 1.00 89.16  ?  380  LEU A CD1 1 
ATOM   2890 C  CD2 . LEU A  1 380 ? 23.668  15.553  -17.037 1.00 87.16  ?  380  LEU A CD2 1 
ATOM   2891 N  N   . HIS A  1 381 ? 21.725  13.136  -12.716 1.00 45.15  ?  381  HIS A N   1 
ATOM   2892 C  CA  . HIS A  1 381 ? 20.698  12.583  -11.831 1.00 45.39  ?  381  HIS A CA  1 
ATOM   2893 C  C   . HIS A  1 381 ? 19.941  13.655  -11.052 1.00 40.99  ?  381  HIS A C   1 
ATOM   2894 O  O   . HIS A  1 381 ? 18.723  13.583  -10.920 1.00 41.99  ?  381  HIS A O   1 
ATOM   2895 C  CB  . HIS A  1 381 ? 21.292  11.581  -10.839 1.00 49.30  ?  381  HIS A CB  1 
ATOM   2896 C  CG  . HIS A  1 381 ? 20.262  10.891  -10.001 1.00 53.98  ?  381  HIS A CG  1 
ATOM   2897 N  ND1 . HIS A  1 381 ? 19.673  9.704   -10.378 1.00 60.76  ?  381  HIS A ND1 1 
ATOM   2898 C  CD2 . HIS A  1 381 ? 19.692  11.235  -8.822  1.00 55.53  ?  381  HIS A CD2 1 
ATOM   2899 C  CE1 . HIS A  1 381 ? 18.794  9.340   -9.461  1.00 57.37  ?  381  HIS A CE1 1 
ATOM   2900 N  NE2 . HIS A  1 381 ? 18.783  10.254  -8.509  1.00 57.14  ?  381  HIS A NE2 1 
ATOM   2901 N  N   . TYR A  1 382 ? 20.656  14.643  -10.526 1.00 38.96  ?  382  TYR A N   1 
ATOM   2902 C  CA  . TYR A  1 382 ? 20.012  15.632  -9.660  1.00 43.84  ?  382  TYR A CA  1 
ATOM   2903 C  C   . TYR A  1 382 ? 19.412  16.828  -10.388 1.00 43.38  ?  382  TYR A C   1 
ATOM   2904 O  O   . TYR A  1 382 ? 18.627  17.565  -9.801  1.00 48.91  ?  382  TYR A O   1 
ATOM   2905 C  CB  . TYR A  1 382 ? 20.949  16.087  -8.532  1.00 47.84  ?  382  TYR A CB  1 
ATOM   2906 C  CG  . TYR A  1 382 ? 21.019  15.083  -7.404  1.00 46.07  ?  382  TYR A CG  1 
ATOM   2907 C  CD1 . TYR A  1 382 ? 21.858  13.976  -7.486  1.00 36.26  ?  382  TYR A CD1 1 
ATOM   2908 C  CD2 . TYR A  1 382 ? 20.229  15.231  -6.264  1.00 49.76  ?  382  TYR A CD2 1 
ATOM   2909 C  CE1 . TYR A  1 382 ? 21.912  13.048  -6.477  1.00 45.51  ?  382  TYR A CE1 1 
ATOM   2910 C  CE2 . TYR A  1 382 ? 20.278  14.309  -5.237  1.00 46.39  ?  382  TYR A CE2 1 
ATOM   2911 C  CZ  . TYR A  1 382 ? 21.123  13.220  -5.349  1.00 51.51  ?  382  TYR A CZ  1 
ATOM   2912 O  OH  . TYR A  1 382 ? 21.176  12.292  -4.344  1.00 51.07  ?  382  TYR A OH  1 
ATOM   2913 N  N   . THR A  1 383 ? 19.767  17.019  -11.658 1.00 38.20  ?  383  THR A N   1 
ATOM   2914 C  CA  . THR A  1 383 ? 19.170  18.096  -12.447 1.00 37.23  ?  383  THR A CA  1 
ATOM   2915 C  C   . THR A  1 383 ? 17.685  17.838  -12.660 1.00 43.19  ?  383  THR A C   1 
ATOM   2916 O  O   . THR A  1 383 ? 17.283  16.709  -12.952 1.00 50.08  ?  383  THR A O   1 
ATOM   2917 C  CB  . THR A  1 383 ? 19.872  18.264  -13.825 1.00 41.71  ?  383  THR A CB  1 
ATOM   2918 O  OG1 . THR A  1 383 ? 21.212  18.724  -13.626 1.00 51.26  ?  383  THR A OG1 1 
ATOM   2919 C  CG2 . THR A  1 383 ? 19.146  19.271  -14.701 1.00 40.76  ?  383  THR A CG2 1 
ATOM   2920 N  N   . ASP A  1 384 ? 16.869  18.876  -12.491 1.00 42.81  ?  384  ASP A N   1 
ATOM   2921 C  CA  . ASP A  1 384 ? 15.475  18.833  -12.941 1.00 52.26  ?  384  ASP A CA  1 
ATOM   2922 C  C   . ASP A  1 384 ? 15.375  19.267  -14.422 1.00 54.79  ?  384  ASP A C   1 
ATOM   2923 O  O   . ASP A  1 384 ? 15.427  20.455  -14.731 1.00 51.04  ?  384  ASP A O   1 
ATOM   2924 C  CB  . ASP A  1 384 ? 14.607  19.731  -12.052 1.00 57.12  ?  384  ASP A CB  1 
ATOM   2925 C  CG  . ASP A  1 384 ? 13.133  19.710  -12.446 1.00 66.72  ?  384  ASP A CG  1 
ATOM   2926 O  OD1 . ASP A  1 384 ? 12.741  18.881  -13.292 1.00 71.75  ?  384  ASP A OD1 1 
ATOM   2927 O  OD2 . ASP A  1 384 ? 12.360  20.524  -11.900 1.00 71.40  ?  384  ASP A OD2 1 
ATOM   2928 N  N   . TRP A  1 385 ? 15.224  18.314  -15.337 1.00 52.19  ?  385  TRP A N   1 
ATOM   2929 C  CA  . TRP A  1 385 ? 15.327  18.645  -16.766 1.00 56.20  ?  385  TRP A CA  1 
ATOM   2930 C  C   . TRP A  1 385 ? 14.181  19.463  -17.339 1.00 59.62  ?  385  TRP A C   1 
ATOM   2931 O  O   . TRP A  1 385 ? 14.308  20.018  -18.420 1.00 61.91  ?  385  TRP A O   1 
ATOM   2932 C  CB  . TRP A  1 385 ? 15.621  17.405  -17.603 1.00 50.85  ?  385  TRP A CB  1 
ATOM   2933 C  CG  . TRP A  1 385 ? 16.932  16.872  -17.205 1.00 51.61  ?  385  TRP A CG  1 
ATOM   2934 C  CD1 . TRP A  1 385 ? 17.172  15.823  -16.376 1.00 46.97  ?  385  TRP A CD1 1 
ATOM   2935 C  CD2 . TRP A  1 385 ? 18.208  17.418  -17.548 1.00 48.77  ?  385  TRP A CD2 1 
ATOM   2936 N  NE1 . TRP A  1 385 ? 18.527  15.658  -16.203 1.00 47.46  ?  385  TRP A NE1 1 
ATOM   2937 C  CE2 . TRP A  1 385 ? 19.184  16.625  -16.914 1.00 45.01  ?  385  TRP A CE2 1 
ATOM   2938 C  CE3 . TRP A  1 385 ? 18.619  18.494  -18.339 1.00 45.76  ?  385  TRP A CE3 1 
ATOM   2939 C  CZ2 . TRP A  1 385 ? 20.544  16.872  -17.047 1.00 44.12  ?  385  TRP A CZ2 1 
ATOM   2940 C  CZ3 . TRP A  1 385 ? 19.972  18.741  -18.470 1.00 44.91  ?  385  TRP A CZ3 1 
ATOM   2941 C  CH2 . TRP A  1 385 ? 20.919  17.931  -17.833 1.00 44.78  ?  385  TRP A CH2 1 
ATOM   2942 N  N   . LEU A  1 386 ? 13.083  19.561  -16.595 1.00 56.74  ?  386  LEU A N   1 
ATOM   2943 C  CA  . LEU A  1 386 ? 12.003  20.481  -16.931 1.00 52.63  ?  386  LEU A CA  1 
ATOM   2944 C  C   . LEU A  1 386 ? 12.373  21.908  -16.529 1.00 59.13  ?  386  LEU A C   1 
ATOM   2945 O  O   . LEU A  1 386 ? 11.870  22.874  -17.100 1.00 64.32  ?  386  LEU A O   1 
ATOM   2946 C  CB  . LEU A  1 386 ? 10.715  20.080  -16.214 1.00 50.03  ?  386  LEU A CB  1 
ATOM   2947 C  CG  . LEU A  1 386 ? 9.491   19.775  -17.069 1.00 65.59  ?  386  LEU A CG  1 
ATOM   2948 C  CD1 . LEU A  1 386 ? 8.268   19.663  -16.178 1.00 60.15  ?  386  LEU A CD1 1 
ATOM   2949 C  CD2 . LEU A  1 386 ? 9.296   20.831  -18.170 1.00 74.24  ?  386  LEU A CD2 1 
ATOM   2950 N  N   . HIS A  1 387 ? 13.231  22.037  -15.519 1.00 60.03  ?  387  HIS A N   1 
ATOM   2951 C  CA  . HIS A  1 387 ? 13.693  23.354  -15.081 1.00 57.96  ?  387  HIS A CA  1 
ATOM   2952 C  C   . HIS A  1 387 ? 15.180  23.337  -14.728 1.00 50.21  ?  387  HIS A C   1 
ATOM   2953 O  O   . HIS A  1 387 ? 15.557  23.678  -13.611 1.00 48.25  ?  387  HIS A O   1 
ATOM   2954 C  CB  . HIS A  1 387 ? 12.881  23.840  -13.875 1.00 58.73  ?  387  HIS A CB  1 
ATOM   2955 C  CG  . HIS A  1 387 ? 11.407  23.933  -14.127 1.00 69.86  ?  387  HIS A CG  1 
ATOM   2956 N  ND1 . HIS A  1 387 ? 10.506  23.022  -13.618 1.00 68.93  ?  387  HIS A ND1 1 
ATOM   2957 C  CD2 . HIS A  1 387 ? 10.677  24.829  -14.834 1.00 77.75  ?  387  HIS A CD2 1 
ATOM   2958 C  CE1 . HIS A  1 387 ? 9.284   23.354  -13.997 1.00 69.78  ?  387  HIS A CE1 1 
ATOM   2959 N  NE2 . HIS A  1 387 ? 9.360   24.448  -14.734 1.00 76.93  ?  387  HIS A NE2 1 
ATOM   2960 N  N   . PRO A  1 388 ? 16.035  22.973  -15.695 1.00 51.39  ?  388  PRO A N   1 
ATOM   2961 C  CA  . PRO A  1 388 ? 17.458  22.738  -15.410 1.00 42.02  ?  388  PRO A CA  1 
ATOM   2962 C  C   . PRO A  1 388 ? 18.216  23.971  -14.913 1.00 46.38  ?  388  PRO A C   1 
ATOM   2963 O  O   . PRO A  1 388 ? 19.306  23.815  -14.363 1.00 52.97  ?  388  PRO A O   1 
ATOM   2964 C  CB  . PRO A  1 388 ? 18.017  22.283  -16.763 1.00 40.00  ?  388  PRO A CB  1 
ATOM   2965 C  CG  . PRO A  1 388 ? 17.082  22.876  -17.770 1.00 49.23  ?  388  PRO A CG  1 
ATOM   2966 C  CD  . PRO A  1 388 ? 15.733  22.913  -17.140 1.00 51.23  ?  388  PRO A CD  1 
ATOM   2967 N  N   . GLU A  1 389 ? 17.651  25.161  -15.101 1.00 50.81  ?  389  GLU A N   1 
ATOM   2968 C  CA  . GLU A  1 389 ? 18.326  26.410  -14.745 1.00 53.81  ?  389  GLU A CA  1 
ATOM   2969 C  C   . GLU A  1 389 ? 17.671  27.130  -13.565 1.00 48.13  ?  389  GLU A C   1 
ATOM   2970 O  O   . GLU A  1 389 ? 18.101  28.222  -13.195 1.00 49.94  ?  389  GLU A O   1 
ATOM   2971 C  CB  . GLU A  1 389 ? 18.349  27.367  -15.944 1.00 62.39  ?  389  GLU A CB  1 
ATOM   2972 C  CG  . GLU A  1 389 ? 18.917  26.783  -17.238 1.00 75.99  ?  389  GLU A CG  1 
ATOM   2973 C  CD  . GLU A  1 389 ? 20.432  26.884  -17.337 1.00 81.26  ?  389  GLU A CD  1 
ATOM   2974 O  OE1 . GLU A  1 389 ? 21.055  27.534  -16.470 1.00 86.08  ?  389  GLU A OE1 1 
ATOM   2975 O  OE2 . GLU A  1 389 ? 21.000  26.307  -18.289 1.00 81.27  ?  389  GLU A OE2 1 
ATOM   2976 N  N   . ASP A  1 390 ? 16.624  26.537  -12.996 1.00 39.11  ?  390  ASP A N   1 
ATOM   2977 C  CA  . ASP A  1 390 ? 15.907  27.148  -11.870 1.00 41.08  ?  390  ASP A CA  1 
ATOM   2978 C  C   . ASP A  1 390 ? 16.768  27.225  -10.603 1.00 37.04  ?  390  ASP A C   1 
ATOM   2979 O  O   . ASP A  1 390 ? 17.117  26.198  -10.045 1.00 40.31  ?  390  ASP A O   1 
ATOM   2980 C  CB  . ASP A  1 390 ? 14.639  26.355  -11.567 1.00 48.39  ?  390  ASP A CB  1 
ATOM   2981 C  CG  . ASP A  1 390 ? 13.806  26.986  -10.473 1.00 63.12  ?  390  ASP A CG  1 
ATOM   2982 O  OD1 . ASP A  1 390 ? 13.637  28.219  -10.496 1.00 70.83  ?  390  ASP A OD1 1 
ATOM   2983 O  OD2 . ASP A  1 390 ? 13.324  26.258  -9.584  1.00 71.93  ?  390  ASP A OD2 1 
ATOM   2984 N  N   . PRO A  1 391 ? 17.093  28.447  -10.139 1.00 41.58  ?  391  PRO A N   1 
ATOM   2985 C  CA  . PRO A  1 391 ? 17.942  28.655  -8.955  1.00 40.42  ?  391  PRO A CA  1 
ATOM   2986 C  C   . PRO A  1 391 ? 17.446  27.940  -7.699  1.00 46.15  ?  391  PRO A C   1 
ATOM   2987 O  O   . PRO A  1 391 ? 18.258  27.396  -6.959  1.00 48.54  ?  391  PRO A O   1 
ATOM   2988 C  CB  . PRO A  1 391 ? 17.878  30.171  -8.745  1.00 37.52  ?  391  PRO A CB  1 
ATOM   2989 C  CG  . PRO A  1 391 ? 17.666  30.721  -10.103 1.00 41.65  ?  391  PRO A CG  1 
ATOM   2990 C  CD  . PRO A  1 391 ? 16.724  29.730  -10.767 1.00 43.65  ?  391  PRO A CD  1 
ATOM   2991 N  N   . THR A  1 392 ? 16.138  27.951  -7.468  1.00 49.74  ?  392  THR A N   1 
ATOM   2992 C  CA  . THR A  1 392 ? 15.550  27.318  -6.293  1.00 49.36  ?  392  THR A CA  1 
ATOM   2993 C  C   . THR A  1 392 ? 15.698  25.798  -6.356  1.00 49.81  ?  392  THR A C   1 
ATOM   2994 O  O   . THR A  1 392 ? 16.015  25.163  -5.347  1.00 46.90  ?  392  THR A O   1 
ATOM   2995 C  CB  . THR A  1 392 ? 14.050  27.698  -6.112  1.00 44.96  ?  392  THR A CB  1 
ATOM   2996 O  OG1 . THR A  1 392 ? 13.929  29.101  -5.841  1.00 42.11  ?  392  THR A OG1 1 
ATOM   2997 C  CG2 . THR A  1 392 ? 13.441  26.931  -4.961  1.00 38.96  ?  392  THR A CG2 1 
ATOM   2998 N  N   A HIS A  1 393 ? 15.468  25.192  -7.516  0.54 46.38  ?  393  HIS A N   1 
ATOM   2999 N  N   B HIS A  1 393 ? 15.461  25.240  -7.546  0.46 46.37  ?  393  HIS A N   1 
ATOM   3000 C  CA  A HIS A  1 393 ? 15.688  23.756  -7.580  0.54 44.73  ?  393  HIS A CA  1 
ATOM   3001 C  CA  B HIS A  1 393 ? 15.625  23.811  -7.817  0.46 43.75  ?  393  HIS A CA  1 
ATOM   3002 C  C   A HIS A  1 393 ? 17.162  23.451  -7.441  0.54 46.00  ?  393  HIS A C   1 
ATOM   3003 C  C   B HIS A  1 393 ? 17.084  23.391  -7.660  0.46 45.46  ?  393  HIS A C   1 
ATOM   3004 O  O   A HIS A  1 393 ? 17.542  22.480  -6.786  0.54 49.28  ?  393  HIS A O   1 
ATOM   3005 O  O   B HIS A  1 393 ? 17.377  22.295  -7.184  0.46 49.55  ?  393  HIS A O   1 
ATOM   3006 C  CB  A HIS A  1 393 ? 15.198  23.110  -8.865  0.54 40.98  ?  393  HIS A CB  1 
ATOM   3007 C  CB  B HIS A  1 393 ? 15.167  23.470  -9.244  0.46 41.33  ?  393  HIS A CB  1 
ATOM   3008 C  CG  A HIS A  1 393 ? 15.576  21.665  -8.962  0.54 38.71  ?  393  HIS A CG  1 
ATOM   3009 C  CG  B HIS A  1 393 ? 13.729  23.049  -9.353  0.46 41.81  ?  393  HIS A CG  1 
ATOM   3010 N  ND1 A HIS A  1 393 ? 14.809  20.658  -8.416  0.54 46.90  ?  393  HIS A ND1 1 
ATOM   3011 N  ND1 B HIS A  1 393 ? 12.758  23.851  -9.914  0.46 48.77  ?  393  HIS A ND1 1 
ATOM   3012 C  CD2 A HIS A  1 393 ? 16.672  21.063  -9.479  0.54 31.87  ?  393  HIS A CD2 1 
ATOM   3013 C  CD2 B HIS A  1 393 ? 13.106  21.898  -9.003  0.46 36.84  ?  393  HIS A CD2 1 
ATOM   3014 C  CE1 A HIS A  1 393 ? 15.398  19.495  -8.628  0.54 47.91  ?  393  HIS A CE1 1 
ATOM   3015 C  CE1 B HIS A  1 393 ? 11.596  23.220  -9.891  0.46 43.92  ?  393  HIS A CE1 1 
ATOM   3016 N  NE2 A HIS A  1 393 ? 16.531  19.713  -9.271  0.54 42.55  ?  393  HIS A NE2 1 
ATOM   3017 N  NE2 B HIS A  1 393 ? 11.781  22.032  -9.345  0.46 41.25  ?  393  HIS A NE2 1 
ATOM   3018 N  N   . LEU A  1 394 ? 17.994  24.268  -8.072  1.00 34.30  ?  394  LEU A N   1 
ATOM   3019 C  CA  . LEU A  1 394 ? 19.413  23.985  -8.046  1.00 34.00  ?  394  LEU A CA  1 
ATOM   3020 C  C   . LEU A  1 394 ? 19.947  24.052  -6.603  1.00 44.02  ?  394  LEU A C   1 
ATOM   3021 O  O   . LEU A  1 394 ? 20.742  23.211  -6.193  1.00 42.92  ?  394  LEU A O   1 
ATOM   3022 C  CB  . LEU A  1 394 ? 20.179  24.920  -8.995  1.00 30.64  ?  394  LEU A CB  1 
ATOM   3023 C  CG  . LEU A  1 394 ? 19.933  24.717  -10.511 1.00 40.81  ?  394  LEU A CG  1 
ATOM   3024 C  CD1 . LEU A  1 394 ? 20.432  25.894  -11.327 1.00 36.04  ?  394  LEU A CD1 1 
ATOM   3025 C  CD2 . LEU A  1 394 ? 20.529  23.421  -11.044 1.00 31.59  ?  394  LEU A CD2 1 
ATOM   3026 N  N   . ARG A  1 395 ? 19.489  25.045  -5.843  1.00 46.04  ?  395  ARG A N   1 
ATOM   3027 C  CA  . ARG A  1 395 ? 19.897  25.213  -4.455  1.00 43.46  ?  395  ARG A CA  1 
ATOM   3028 C  C   . ARG A  1 395 ? 19.494  23.971  -3.643  1.00 38.81  ?  395  ARG A C   1 
ATOM   3029 O  O   . ARG A  1 395 ? 20.334  23.333  -3.034  1.00 43.07  ?  395  ARG A O   1 
ATOM   3030 C  CB  . ARG A  1 395 ? 19.303  26.512  -3.886  1.00 44.35  ?  395  ARG A CB  1 
ATOM   3031 C  CG  . ARG A  1 395 ? 19.459  26.713  -2.387  1.00 43.11  ?  395  ARG A CG  1 
ATOM   3032 C  CD  . ARG A  1 395 ? 18.098  26.607  -1.692  1.00 39.31  ?  395  ARG A CD  1 
ATOM   3033 N  NE  . ARG A  1 395 ? 17.422  27.890  -1.583  1.00 37.83  ?  395  ARG A NE  1 
ATOM   3034 C  CZ  . ARG A  1 395 ? 16.119  28.045  -1.374  1.00 41.71  ?  395  ARG A CZ  1 
ATOM   3035 N  NH1 . ARG A  1 395 ? 15.314  26.994  -1.255  1.00 31.76  ?  395  ARG A NH1 1 
ATOM   3036 N  NH2 . ARG A  1 395 ? 15.617  29.267  -1.291  1.00 53.31  ?  395  ARG A NH2 1 
ATOM   3037 N  N   . ASP A  1 396 ? 18.222  23.597  -3.695  1.00 42.42  ?  396  ASP A N   1 
ATOM   3038 C  CA  . ASP A  1 396 ? 17.743  22.393  -3.016  1.00 46.84  ?  396  ASP A CA  1 
ATOM   3039 C  C   . ASP A  1 396 ? 18.370  21.087  -3.537  1.00 48.57  ?  396  ASP A C   1 
ATOM   3040 O  O   . ASP A  1 396 ? 18.402  20.084  -2.831  1.00 52.77  ?  396  ASP A O   1 
ATOM   3041 C  CB  . ASP A  1 396 ? 16.212  22.295  -3.091  1.00 43.83  ?  396  ASP A CB  1 
ATOM   3042 C  CG  . ASP A  1 396 ? 15.510  23.514  -2.508  1.00 50.34  ?  396  ASP A CG  1 
ATOM   3043 O  OD1 . ASP A  1 396 ? 16.206  24.390  -1.957  1.00 52.26  ?  396  ASP A OD1 1 
ATOM   3044 O  OD2 . ASP A  1 396 ? 14.258  23.593  -2.586  1.00 52.23  ?  396  ASP A OD2 1 
ATOM   3045 N  N   . ALA A  1 397 ? 18.858  21.088  -4.768  1.00 46.90  ?  397  ALA A N   1 
ATOM   3046 C  CA  . ALA A  1 397 ? 19.483  19.884  -5.308  1.00 47.16  ?  397  ALA A CA  1 
ATOM   3047 C  C   . ALA A  1 397 ? 20.866  19.721  -4.707  1.00 44.81  ?  397  ALA A C   1 
ATOM   3048 O  O   . ALA A  1 397 ? 21.302  18.611  -4.416  1.00 52.30  ?  397  ALA A O   1 
ATOM   3049 C  CB  . ALA A  1 397 ? 19.567  19.941  -6.833  1.00 39.17  ?  397  ALA A CB  1 
ATOM   3050 N  N   . MET A  1 398 ? 21.548  20.844  -4.535  1.00 35.50  ?  398  MET A N   1 
ATOM   3051 C  CA  . MET A  1 398 ? 22.876  20.861  -3.954  1.00 42.69  ?  398  MET A CA  1 
ATOM   3052 C  C   . MET A  1 398 ? 22.802  20.264  -2.542  1.00 46.90  ?  398  MET A C   1 
ATOM   3053 O  O   . MET A  1 398 ? 23.602  19.398  -2.175  1.00 38.08  ?  398  MET A O   1 
ATOM   3054 C  CB  . MET A  1 398 ? 23.386  22.300  -3.885  1.00 38.81  ?  398  MET A CB  1 
ATOM   3055 C  CG  . MET A  1 398 ? 24.846  22.430  -3.544  1.00 40.98  ?  398  MET A CG  1 
ATOM   3056 S  SD  . MET A  1 398 ? 25.917  21.739  -4.816  1.00 47.93  ?  398  MET A SD  1 
ATOM   3057 C  CE  . MET A  1 398 ? 26.306  20.120  -4.144  1.00 37.91  ?  398  MET A CE  1 
ATOM   3058 N  N   . SER A  1 399 ? 21.821  20.730  -1.774  1.00 38.98  ?  399  SER A N   1 
ATOM   3059 C  CA  . SER A  1 399 ? 21.628  20.280  -0.410  1.00 46.27  ?  399  SER A CA  1 
ATOM   3060 C  C   . SER A  1 399 ? 21.390  18.776  -0.420  1.00 41.93  ?  399  SER A C   1 
ATOM   3061 O  O   . SER A  1 399 ? 21.922  18.048  0.413   1.00 41.95  ?  399  SER A O   1 
ATOM   3062 C  CB  . SER A  1 399 ? 20.454  21.045  0.223   1.00 46.83  ?  399  SER A CB  1 
ATOM   3063 O  OG  . SER A  1 399 ? 19.910  20.395  1.360   1.00 44.39  ?  399  SER A OG  1 
ATOM   3064 N  N   . ALA A  1 400 ? 20.632  18.312  -1.403  1.00 35.31  ?  400  ALA A N   1 
ATOM   3065 C  CA  . ALA A  1 400 ? 20.230  16.911  -1.450  1.00 39.71  ?  400  ALA A CA  1 
ATOM   3066 C  C   . ALA A  1 400 ? 21.370  16.015  -1.891  1.00 38.94  ?  400  ALA A C   1 
ATOM   3067 O  O   . ALA A  1 400 ? 21.457  14.870  -1.454  1.00 41.32  ?  400  ALA A O   1 
ATOM   3068 C  CB  . ALA A  1 400 ? 19.016  16.718  -2.365  1.00 36.88  ?  400  ALA A CB  1 
ATOM   3069 N  N   . VAL A  1 401 ? 22.239  16.536  -2.755  1.00 34.04  ?  401  VAL A N   1 
ATOM   3070 C  CA  . VAL A  1 401 ? 23.425  15.802  -3.199  1.00 41.43  ?  401  VAL A CA  1 
ATOM   3071 C  C   . VAL A  1 401 ? 24.324  15.508  -2.004  1.00 41.22  ?  401  VAL A C   1 
ATOM   3072 O  O   . VAL A  1 401 ? 24.736  14.370  -1.780  1.00 43.21  ?  401  VAL A O   1 
ATOM   3073 C  CB  . VAL A  1 401 ? 24.230  16.610  -4.262  1.00 42.57  ?  401  VAL A CB  1 
ATOM   3074 C  CG1 . VAL A  1 401 ? 25.680  16.113  -4.383  1.00 25.10  ?  401  VAL A CG1 1 
ATOM   3075 C  CG2 . VAL A  1 401 ? 23.517  16.585  -5.585  1.00 32.04  ?  401  VAL A CG2 1 
ATOM   3076 N  N   . VAL A  1 402 ? 24.617  16.556  -1.244  1.00 39.21  ?  402  VAL A N   1 
ATOM   3077 C  CA  . VAL A  1 402 ? 25.450  16.456  -0.058  1.00 37.59  ?  402  VAL A CA  1 
ATOM   3078 C  C   . VAL A  1 402 ? 24.833  15.567  1.008   1.00 47.84  ?  402  VAL A C   1 
ATOM   3079 O  O   . VAL A  1 402 ? 25.530  14.754  1.624   1.00 50.65  ?  402  VAL A O   1 
ATOM   3080 C  CB  . VAL A  1 402 ? 25.694  17.833  0.547   1.00 33.03  ?  402  VAL A CB  1 
ATOM   3081 C  CG1 . VAL A  1 402 ? 26.542  17.716  1.822   1.00 30.39  ?  402  VAL A CG1 1 
ATOM   3082 C  CG2 . VAL A  1 402 ? 26.375  18.710  -0.469  1.00 27.72  ?  402  VAL A CG2 1 
ATOM   3083 N  N   . GLY A  1 403 ? 23.528  15.725  1.216   1.00 43.00  ?  403  GLY A N   1 
ATOM   3084 C  CA  . GLY A  1 403 ? 22.828  14.999  2.257   1.00 33.19  ?  403  GLY A CA  1 
ATOM   3085 C  C   . GLY A  1 403 ? 22.690  13.524  1.935   1.00 42.84  ?  403  GLY A C   1 
ATOM   3086 O  O   . GLY A  1 403 ? 22.813  12.674  2.817   1.00 54.32  ?  403  GLY A O   1 
ATOM   3087 N  N   . ASP A  1 404 ? 22.430  13.219  0.668   1.00 38.67  ?  404  ASP A N   1 
ATOM   3088 C  CA  . ASP A  1 404 ? 22.208  11.842  0.243   1.00 36.24  ?  404  ASP A CA  1 
ATOM   3089 C  C   . ASP A  1 404 ? 23.496  11.061  0.244   1.00 38.49  ?  404  ASP A C   1 
ATOM   3090 O  O   . ASP A  1 404 ? 23.513  9.899   0.635   1.00 44.04  ?  404  ASP A O   1 
ATOM   3091 C  CB  . ASP A  1 404 ? 21.616  11.782  -1.177  1.00 33.35  ?  404  ASP A CB  1 
ATOM   3092 C  CG  . ASP A  1 404 ? 20.192  12.261  -1.231  1.00 46.15  ?  404  ASP A CG  1 
ATOM   3093 O  OD1 . ASP A  1 404 ? 19.626  12.571  -0.159  1.00 55.12  ?  404  ASP A OD1 1 
ATOM   3094 O  OD2 . ASP A  1 404 ? 19.635  12.325  -2.341  1.00 57.97  ?  404  ASP A OD2 1 
ATOM   3095 N  N   . HIS A  1 405 ? 24.562  11.697  -0.238  1.00 34.88  ?  405  HIS A N   1 
ATOM   3096 C  CA  . HIS A  1 405 ? 25.851  11.038  -0.418  1.00 39.58  ?  405  HIS A CA  1 
ATOM   3097 C  C   . HIS A  1 405 ? 26.454  10.742  0.958   1.00 45.78  ?  405  HIS A C   1 
ATOM   3098 O  O   . HIS A  1 405 ? 27.014  9.673   1.211   1.00 47.79  ?  405  HIS A O   1 
ATOM   3099 C  CB  . HIS A  1 405 ? 26.765  11.965  -1.230  1.00 37.70  ?  405  HIS A CB  1 
ATOM   3100 C  CG  . HIS A  1 405 ? 28.197  11.523  -1.318  1.00 36.69  ?  405  HIS A CG  1 
ATOM   3101 N  ND1 . HIS A  1 405 ? 28.571  10.272  -1.768  1.00 34.69  ?  405  HIS A ND1 1 
ATOM   3102 C  CD2 . HIS A  1 405 ? 29.350  12.185  -1.043  1.00 32.77  ?  405  HIS A CD2 1 
ATOM   3103 C  CE1 . HIS A  1 405 ? 29.892  10.181  -1.759  1.00 37.16  ?  405  HIS A CE1 1 
ATOM   3104 N  NE2 . HIS A  1 405 ? 30.388  11.327  -1.321  1.00 35.89  ?  405  HIS A NE2 1 
ATOM   3105 N  N   . ASN A  1 406 ? 26.303  11.700  1.854   1.00 40.52  ?  406  ASN A N   1 
ATOM   3106 C  CA  . ASN A  1 406 ? 26.944  11.616  3.151   1.00 51.70  ?  406  ASN A CA  1 
ATOM   3107 C  C   . ASN A  1 406 ? 26.143  10.911  4.246   1.00 49.41  ?  406  ASN A C   1 
ATOM   3108 O  O   . ASN A  1 406 ? 26.737  10.289  5.116   1.00 44.07  ?  406  ASN A O   1 
ATOM   3109 C  CB  . ASN A  1 406 ? 27.401  12.999  3.610   1.00 45.33  ?  406  ASN A CB  1 
ATOM   3110 C  CG  . ASN A  1 406 ? 28.574  13.516  2.799   1.00 43.95  ?  406  ASN A CG  1 
ATOM   3111 O  OD1 . ASN A  1 406 ? 29.618  12.851  2.690   1.00 34.86  ?  406  ASN A OD1 1 
ATOM   3112 N  ND2 . ASN A  1 406 ? 28.408  14.705  2.210   1.00 40.00  ?  406  ASN A ND2 1 
ATOM   3113 N  N   . VAL A  1 407 ? 24.813  10.981  4.197   1.00 47.72  ?  407  VAL A N   1 
ATOM   3114 C  CA  . VAL A  1 407 ? 24.010  10.472  5.309   1.00 43.17  ?  407  VAL A CA  1 
ATOM   3115 C  C   . VAL A  1 407 ? 22.885  9.519   4.912   1.00 47.93  ?  407  VAL A C   1 
ATOM   3116 O  O   . VAL A  1 407 ? 22.915  8.338   5.265   1.00 46.79  ?  407  VAL A O   1 
ATOM   3117 C  CB  . VAL A  1 407 ? 23.409  11.635  6.138   1.00 43.41  ?  407  VAL A CB  1 
ATOM   3118 C  CG1 . VAL A  1 407 ? 22.536  11.100  7.283   1.00 41.56  ?  407  VAL A CG1 1 
ATOM   3119 C  CG2 . VAL A  1 407 ? 24.511  12.536  6.660   1.00 36.60  ?  407  VAL A CG2 1 
ATOM   3120 N  N   . VAL A  1 408 ? 21.896  10.046  4.188   1.00 47.38  ?  408  VAL A N   1 
ATOM   3121 C  CA  . VAL A  1 408 ? 20.687  9.301   3.828   1.00 41.34  ?  408  VAL A CA  1 
ATOM   3122 C  C   . VAL A  1 408 ? 20.960  7.972   3.103   1.00 47.39  ?  408  VAL A C   1 
ATOM   3123 O  O   . VAL A  1 408 ? 20.316  6.957   3.383   1.00 40.93  ?  408  VAL A O   1 
ATOM   3124 C  CB  . VAL A  1 408 ? 19.759  10.155  2.951   1.00 40.33  ?  408  VAL A CB  1 
ATOM   3125 C  CG1 . VAL A  1 408 ? 18.486  9.388   2.639   1.00 36.32  ?  408  VAL A CG1 1 
ATOM   3126 C  CG2 . VAL A  1 408 ? 19.442  11.477  3.633   1.00 31.86  ?  408  VAL A CG2 1 
ATOM   3127 N  N   . CYS A  1 409 ? 21.914  7.971   2.176   1.00 39.36  ?  409  CYS A N   1 
ATOM   3128 C  CA  . CYS A  1 409 ? 22.230  6.735   1.454   1.00 46.68  ?  409  CYS A CA  1 
ATOM   3129 C  C   . CYS A  1 409 ? 23.172  5.767   2.187   1.00 49.52  ?  409  CYS A C   1 
ATOM   3130 O  O   . CYS A  1 409 ? 23.049  4.550   2.035   1.00 48.46  ?  409  CYS A O   1 
ATOM   3131 C  CB  . CYS A  1 409 ? 22.689  7.032   0.025   1.00 45.98  ?  409  CYS A CB  1 
ATOM   3132 S  SG  . CYS A  1 409 ? 21.329  7.785   -0.947  1.00 50.88  ?  409  CYS A SG  1 
ATOM   3133 N  N   . PRO A  1 410 ? 24.116  6.297   2.980   1.00 46.87  ?  410  PRO A N   1 
ATOM   3134 C  CA  . PRO A  1 410 ? 24.793  5.384   3.908   1.00 47.67  ?  410  PRO A CA  1 
ATOM   3135 C  C   . PRO A  1 410 ? 23.849  4.774   4.952   1.00 42.21  ?  410  PRO A C   1 
ATOM   3136 O  O   . PRO A  1 410 ? 23.983  3.598   5.283   1.00 44.09  ?  410  PRO A O   1 
ATOM   3137 C  CB  . PRO A  1 410 ? 25.832  6.286   4.564   1.00 42.14  ?  410  PRO A CB  1 
ATOM   3138 C  CG  . PRO A  1 410 ? 26.185  7.253   3.457   1.00 39.63  ?  410  PRO A CG  1 
ATOM   3139 C  CD  . PRO A  1 410 ? 24.858  7.565   2.834   1.00 39.62  ?  410  PRO A CD  1 
ATOM   3140 N  N   . VAL A  1 411 ? 22.893  5.551   5.445   1.00 40.11  ?  411  VAL A N   1 
ATOM   3141 C  CA  . VAL A  1 411 ? 21.918  5.032   6.402   1.00 39.99  ?  411  VAL A CA  1 
ATOM   3142 C  C   . VAL A  1 411 ? 21.023  3.960   5.766   1.00 51.01  ?  411  VAL A C   1 
ATOM   3143 O  O   . VAL A  1 411 ? 20.713  2.931   6.387   1.00 51.93  ?  411  VAL A O   1 
ATOM   3144 C  CB  . VAL A  1 411 ? 21.062  6.166   6.975   1.00 36.48  ?  411  VAL A CB  1 
ATOM   3145 C  CG1 . VAL A  1 411 ? 19.863  5.612   7.722   1.00 35.58  ?  411  VAL A CG1 1 
ATOM   3146 C  CG2 . VAL A  1 411 ? 21.908  7.054   7.875   1.00 28.15  ?  411  VAL A CG2 1 
ATOM   3147 N  N   . ALA A  1 412 ? 20.626  4.210   4.520   1.00 41.79  ?  412  ALA A N   1 
ATOM   3148 C  CA  . ALA A  1 412 ? 19.816  3.276   3.758   1.00 42.21  ?  412  ALA A CA  1 
ATOM   3149 C  C   . ALA A  1 412 ? 20.572  1.975   3.545   1.00 45.19  ?  412  ALA A C   1 
ATOM   3150 O  O   . ALA A  1 412 ? 20.015  0.896   3.723   1.00 45.49  ?  412  ALA A O   1 
ATOM   3151 C  CB  . ALA A  1 412 ? 19.442  3.884   2.422   1.00 48.22  ?  412  ALA A CB  1 
ATOM   3152 N  N   . GLN A  1 413 ? 21.845  2.087   3.170   1.00 45.20  ?  413  GLN A N   1 
ATOM   3153 C  CA  . GLN A  1 413 ? 22.688  0.911   2.975   1.00 47.63  ?  413  GLN A CA  1 
ATOM   3154 C  C   . GLN A  1 413 ? 22.834  0.137   4.292   1.00 48.05  ?  413  GLN A C   1 
ATOM   3155 O  O   . GLN A  1 413 ? 22.661  -1.081  4.334   1.00 41.41  ?  413  GLN A O   1 
ATOM   3156 C  CB  . GLN A  1 413 ? 24.062  1.303   2.410   1.00 44.34  ?  413  GLN A CB  1 
ATOM   3157 C  CG  . GLN A  1 413 ? 24.935  0.125   1.966   1.00 51.57  ?  413  GLN A CG  1 
ATOM   3158 C  CD  . GLN A  1 413 ? 24.353  -0.653  0.774   1.00 72.13  ?  413  GLN A CD  1 
ATOM   3159 O  OE1 . GLN A  1 413 ? 23.511  -0.148  0.018   1.00 72.39  ?  413  GLN A OE1 1 
ATOM   3160 N  NE2 . GLN A  1 413 ? 24.808  -1.893  0.606   1.00 79.74  ?  413  GLN A NE2 1 
ATOM   3161 N  N   . LEU A  1 414 ? 23.147  0.857   5.363   1.00 46.20  ?  414  LEU A N   1 
ATOM   3162 C  CA  . LEU A  1 414 ? 23.216  0.263   6.687   1.00 47.29  ?  414  LEU A CA  1 
ATOM   3163 C  C   . LEU A  1 414 ? 21.932  -0.503  7.037   1.00 51.31  ?  414  LEU A C   1 
ATOM   3164 O  O   . LEU A  1 414 ? 21.976  -1.707  7.314   1.00 49.55  ?  414  LEU A O   1 
ATOM   3165 C  CB  . LEU A  1 414 ? 23.482  1.347   7.732   1.00 47.08  ?  414  LEU A CB  1 
ATOM   3166 C  CG  . LEU A  1 414 ? 23.672  0.898   9.187   1.00 44.32  ?  414  LEU A CG  1 
ATOM   3167 C  CD1 . LEU A  1 414 ? 24.825  -0.077  9.301   1.00 47.04  ?  414  LEU A CD1 1 
ATOM   3168 C  CD2 . LEU A  1 414 ? 23.929  2.108   10.045  1.00 42.53  ?  414  LEU A CD2 1 
ATOM   3169 N  N   . ALA A  1 415 ? 20.796  0.193   7.008   1.00 43.95  ?  415  ALA A N   1 
ATOM   3170 C  CA  . ALA A  1 415 ? 19.520  -0.414  7.381   1.00 41.98  ?  415  ALA A CA  1 
ATOM   3171 C  C   . ALA A  1 415 ? 19.209  -1.617  6.502   1.00 49.43  ?  415  ALA A C   1 
ATOM   3172 O  O   . ALA A  1 415 ? 18.656  -2.618  6.966   1.00 44.79  ?  415  ALA A O   1 
ATOM   3173 C  CB  . ALA A  1 415 ? 18.402  0.608   7.291   1.00 40.38  ?  415  ALA A CB  1 
ATOM   3174 N  N   . GLY A  1 416 ? 19.576  -1.506  5.227   1.00 49.70  ?  416  GLY A N   1 
ATOM   3175 C  CA  . GLY A  1 416 ? 19.336  -2.559  4.260   1.00 50.57  ?  416  GLY A CA  1 
ATOM   3176 C  C   . GLY A  1 416 ? 20.170  -3.796  4.523   1.00 52.58  ?  416  GLY A C   1 
ATOM   3177 O  O   . GLY A  1 416 ? 19.670  -4.915  4.423   1.00 53.42  ?  416  GLY A O   1 
ATOM   3178 N  N   . ARG A  1 417 ? 21.444  -3.597  4.857   1.00 50.98  ?  417  ARG A N   1 
ATOM   3179 C  CA  . ARG A  1 417 ? 22.328  -4.718  5.146   1.00 53.97  ?  417  ARG A CA  1 
ATOM   3180 C  C   . ARG A  1 417 ? 21.981  -5.368  6.483   1.00 56.70  ?  417  ARG A C   1 
ATOM   3181 O  O   . ARG A  1 417 ? 21.830  -6.585  6.558   1.00 62.56  ?  417  ARG A O   1 
ATOM   3182 C  CB  . ARG A  1 417 ? 23.801  -4.298  5.124   1.00 53.48  ?  417  ARG A CB  1 
ATOM   3183 C  CG  . ARG A  1 417 ? 24.332  -3.835  3.765   1.00 59.67  ?  417  ARG A CG  1 
ATOM   3184 C  CD  . ARG A  1 417 ? 23.929  -4.754  2.614   1.00 69.01  ?  417  ARG A CD  1 
ATOM   3185 N  NE  . ARG A  1 417 ? 24.630  -6.037  2.599   1.00 80.74  ?  417  ARG A NE  1 
ATOM   3186 C  CZ  . ARG A  1 417 ? 25.066  -6.636  1.490   1.00 90.13  ?  417  ARG A CZ  1 
ATOM   3187 N  NH1 . ARG A  1 417 ? 24.890  -6.060  0.303   1.00 87.64  ?  417  ARG A NH1 1 
ATOM   3188 N  NH2 . ARG A  1 417 ? 25.690  -7.807  1.564   1.00 91.61  ?  417  ARG A NH2 1 
ATOM   3189 N  N   . LEU A  1 418 ? 21.848  -4.558  7.531   1.00 50.01  ?  418  LEU A N   1 
ATOM   3190 C  CA  . LEU A  1 418 ? 21.530  -5.084  8.856   1.00 49.78  ?  418  LEU A CA  1 
ATOM   3191 C  C   . LEU A  1 418 ? 20.232  -5.886  8.846   1.00 53.01  ?  418  LEU A C   1 
ATOM   3192 O  O   . LEU A  1 418 ? 20.180  -6.995  9.377   1.00 54.70  ?  418  LEU A O   1 
ATOM   3193 C  CB  . LEU A  1 418 ? 21.457  -3.966  9.902   1.00 47.82  ?  418  LEU A CB  1 
ATOM   3194 C  CG  . LEU A  1 418 ? 22.739  -3.172  10.186  1.00 49.30  ?  418  LEU A CG  1 
ATOM   3195 C  CD1 . LEU A  1 418 ? 22.501  -2.142  11.265  1.00 41.56  ?  418  LEU A CD1 1 
ATOM   3196 C  CD2 . LEU A  1 418 ? 23.880  -4.080  10.572  1.00 52.37  ?  418  LEU A CD2 1 
ATOM   3197 N  N   . ALA A  1 419 ? 19.191  -5.337  8.228   1.00 54.12  ?  419  ALA A N   1 
ATOM   3198 C  CA  . ALA A  1 419 ? 17.902  -6.021  8.185   1.00 56.57  ?  419  ALA A CA  1 
ATOM   3199 C  C   . ALA A  1 419 ? 18.017  -7.373  7.490   1.00 68.03  ?  419  ALA A C   1 
ATOM   3200 O  O   . ALA A  1 419 ? 17.489  -8.380  7.964   1.00 72.39  ?  419  ALA A O   1 
ATOM   3201 C  CB  . ALA A  1 419 ? 16.866  -5.162  7.494   1.00 55.59  ?  419  ALA A CB  1 
ATOM   3202 N  N   . ALA A  1 420 ? 18.723  -7.393  6.367   1.00 69.97  ?  420  ALA A N   1 
ATOM   3203 C  CA  . ALA A  1 420 ? 18.861  -8.615  5.586   1.00 69.61  ?  420  ALA A CA  1 
ATOM   3204 C  C   . ALA A  1 420 ? 19.675  -9.649  6.353   1.00 72.03  ?  420  ALA A C   1 
ATOM   3205 O  O   . ALA A  1 420 ? 19.556  -10.853 6.117   1.00 74.64  ?  420  ALA A O   1 
ATOM   3206 C  CB  . ALA A  1 420 ? 19.505  -8.317  4.230   1.00 55.88  ?  420  ALA A CB  1 
ATOM   3207 N  N   . GLN A  1 421 ? 20.493  -9.175  7.284   1.00 66.32  ?  421  GLN A N   1 
ATOM   3208 C  CA  . GLN A  1 421 ? 21.406  -10.063 7.982   1.00 69.55  ?  421  GLN A CA  1 
ATOM   3209 C  C   . GLN A  1 421 ? 21.034  -10.313 9.438   1.00 63.69  ?  421  GLN A C   1 
ATOM   3210 O  O   . GLN A  1 421 ? 21.906  -10.519 10.279  1.00 64.34  ?  421  GLN A O   1 
ATOM   3211 C  CB  . GLN A  1 421 ? 22.853  -9.586  7.820   1.00 73.74  ?  421  GLN A CB  1 
ATOM   3212 C  CG  . GLN A  1 421 ? 23.455  -10.048 6.482   1.00 85.26  ?  421  GLN A CG  1 
ATOM   3213 C  CD  . GLN A  1 421 ? 24.256  -8.972  5.768   1.00 88.34  ?  421  GLN A CD  1 
ATOM   3214 O  OE1 . GLN A  1 421 ? 23.918  -8.567  4.654   1.00 87.43  ?  421  GLN A OE1 1 
ATOM   3215 N  NE2 . GLN A  1 421 ? 25.330  -8.516  6.399   1.00 89.77  ?  421  GLN A NE2 1 
ATOM   3216 N  N   . GLY A  1 422 ? 19.733  -10.301 9.722   1.00 61.18  ?  422  GLY A N   1 
ATOM   3217 C  CA  . GLY A  1 422 ? 19.221  -10.771 11.000  1.00 65.39  ?  422  GLY A CA  1 
ATOM   3218 C  C   . GLY A  1 422 ? 18.777  -9.733  12.015  1.00 63.90  ?  422  GLY A C   1 
ATOM   3219 O  O   . GLY A  1 422 ? 17.997  -10.040 12.919  1.00 70.32  ?  422  GLY A O   1 
ATOM   3220 N  N   . ALA A  1 423 ? 19.270  -8.507  11.873  1.00 57.99  ?  423  ALA A N   1 
ATOM   3221 C  CA  . ALA A  1 423 ? 19.005  -7.455  12.852  1.00 51.76  ?  423  ALA A CA  1 
ATOM   3222 C  C   . ALA A  1 423 ? 17.554  -6.996  12.845  1.00 54.93  ?  423  ALA A C   1 
ATOM   3223 O  O   . ALA A  1 423 ? 16.872  -7.065  11.819  1.00 57.55  ?  423  ALA A O   1 
ATOM   3224 C  CB  . ALA A  1 423 ? 19.924  -6.278  12.620  1.00 41.58  ?  423  ALA A CB  1 
ATOM   3225 N  N   . ARG A  1 424 ? 17.081  -6.540  13.999  1.00 54.24  ?  424  ARG A N   1 
ATOM   3226 C  CA  . ARG A  1 424 ? 15.797  -5.861  14.058  1.00 57.10  ?  424  ARG A CA  1 
ATOM   3227 C  C   . ARG A  1 424 ? 16.075  -4.370  13.889  1.00 56.46  ?  424  ARG A C   1 
ATOM   3228 O  O   . ARG A  1 424 ? 16.768  -3.758  14.709  1.00 49.16  ?  424  ARG A O   1 
ATOM   3229 C  CB  . ARG A  1 424 ? 15.061  -6.153  15.370  1.00 60.06  ?  424  ARG A CB  1 
ATOM   3230 C  CG  . ARG A  1 424 ? 13.556  -5.903  15.302  1.00 64.37  ?  424  ARG A CG  1 
ATOM   3231 C  CD  . ARG A  1 424 ? 12.806  -6.745  16.327  1.00 79.76  ?  424  ARG A CD  1 
ATOM   3232 N  NE  . ARG A  1 424 ? 13.030  -6.277  17.695  1.00 89.83  ?  424  ARG A NE  1 
ATOM   3233 C  CZ  . ARG A  1 424 ? 12.770  -6.990  18.789  1.00 93.96  ?  424  ARG A CZ  1 
ATOM   3234 N  NH1 . ARG A  1 424 ? 12.278  -8.220  18.686  1.00 96.79  ?  424  ARG A NH1 1 
ATOM   3235 N  NH2 . ARG A  1 424 ? 13.008  -6.474  19.988  1.00 91.03  ?  424  ARG A NH2 1 
ATOM   3236 N  N   . VAL A  1 425 ? 15.556  -3.801  12.804  1.00 55.34  ?  425  VAL A N   1 
ATOM   3237 C  CA  . VAL A  1 425 ? 15.860  -2.426  12.447  1.00 50.14  ?  425  VAL A CA  1 
ATOM   3238 C  C   . VAL A  1 425 ? 14.597  -1.577  12.440  1.00 46.18  ?  425  VAL A C   1 
ATOM   3239 O  O   . VAL A  1 425 ? 13.566  -1.997  11.929  1.00 52.05  ?  425  VAL A O   1 
ATOM   3240 C  CB  . VAL A  1 425 ? 16.542  -2.356  11.062  1.00 50.61  ?  425  VAL A CB  1 
ATOM   3241 C  CG1 . VAL A  1 425 ? 16.956  -0.924  10.740  1.00 49.12  ?  425  VAL A CG1 1 
ATOM   3242 C  CG2 . VAL A  1 425 ? 17.750  -3.297  11.017  1.00 42.57  ?  425  VAL A CG2 1 
ATOM   3243 N  N   . TYR A  1 426 ? 14.675  -0.392  13.029  1.00 44.30  ?  426  TYR A N   1 
ATOM   3244 C  CA  . TYR A  1 426 ? 13.568  0.557   12.994  1.00 44.72  ?  426  TYR A CA  1 
ATOM   3245 C  C   . TYR A  1 426 ? 14.082  1.833   12.376  1.00 43.76  ?  426  TYR A C   1 
ATOM   3246 O  O   . TYR A  1 426 ? 15.142  2.322   12.758  1.00 44.26  ?  426  TYR A O   1 
ATOM   3247 C  CB  . TYR A  1 426 ? 13.034  0.837   14.397  1.00 48.65  ?  426  TYR A CB  1 
ATOM   3248 C  CG  . TYR A  1 426 ? 12.253  -0.309  14.985  1.00 52.02  ?  426  TYR A CG  1 
ATOM   3249 C  CD1 . TYR A  1 426 ? 10.886  -0.443  14.738  1.00 49.55  ?  426  TYR A CD1 1 
ATOM   3250 C  CD2 . TYR A  1 426 ? 12.877  -1.264  15.786  1.00 51.17  ?  426  TYR A CD2 1 
ATOM   3251 C  CE1 . TYR A  1 426 ? 10.160  -1.499  15.273  1.00 51.95  ?  426  TYR A CE1 1 
ATOM   3252 C  CE2 . TYR A  1 426 ? 12.161  -2.323  16.327  1.00 55.29  ?  426  TYR A CE2 1 
ATOM   3253 C  CZ  . TYR A  1 426 ? 10.803  -2.435  16.067  1.00 59.89  ?  426  TYR A CZ  1 
ATOM   3254 O  OH  . TYR A  1 426 ? 10.090  -3.482  16.604  1.00 67.22  ?  426  TYR A OH  1 
ATOM   3255 N  N   . ALA A  1 427 ? 13.339  2.377   11.418  1.00 41.56  ?  427  ALA A N   1 
ATOM   3256 C  CA  . ALA A  1 427 ? 13.845  3.507   10.653  1.00 40.89  ?  427  ALA A CA  1 
ATOM   3257 C  C   . ALA A  1 427 ? 12.871  4.668   10.704  1.00 41.56  ?  427  ALA A C   1 
ATOM   3258 O  O   . ALA A  1 427 ? 11.659  4.456   10.750  1.00 42.46  ?  427  ALA A O   1 
ATOM   3259 C  CB  . ALA A  1 427 ? 14.095  3.081   9.214   1.00 49.60  ?  427  ALA A CB  1 
ATOM   3260 N  N   . TYR A  1 428 ? 13.398  5.892   10.692  1.00 39.73  ?  428  TYR A N   1 
ATOM   3261 C  CA  . TYR A  1 428 ? 12.560  7.092   10.727  1.00 42.49  ?  428  TYR A CA  1 
ATOM   3262 C  C   . TYR A  1 428 ? 13.137  8.195   9.858   1.00 46.66  ?  428  TYR A C   1 
ATOM   3263 O  O   . TYR A  1 428 ? 14.334  8.215   9.577   1.00 40.14  ?  428  TYR A O   1 
ATOM   3264 C  CB  . TYR A  1 428 ? 12.453  7.643   12.157  1.00 44.55  ?  428  TYR A CB  1 
ATOM   3265 C  CG  . TYR A  1 428 ? 13.764  8.208   12.691  1.00 48.16  ?  428  TYR A CG  1 
ATOM   3266 C  CD1 . TYR A  1 428 ? 14.124  9.538   12.471  1.00 44.29  ?  428  TYR A CD1 1 
ATOM   3267 C  CD2 . TYR A  1 428 ? 14.639  7.408   13.418  1.00 47.52  ?  428  TYR A CD2 1 
ATOM   3268 C  CE1 . TYR A  1 428 ? 15.329  10.045  12.953  1.00 38.35  ?  428  TYR A CE1 1 
ATOM   3269 C  CE2 . TYR A  1 428 ? 15.834  7.905   13.905  1.00 47.11  ?  428  TYR A CE2 1 
ATOM   3270 C  CZ  . TYR A  1 428 ? 16.178  9.219   13.662  1.00 47.48  ?  428  TYR A CZ  1 
ATOM   3271 O  OH  . TYR A  1 428 ? 17.369  9.707   14.142  1.00 57.14  ?  428  TYR A OH  1 
ATOM   3272 N  N   . ILE A  1 429 ? 12.287  9.140   9.474   1.00 47.42  ?  429  ILE A N   1 
ATOM   3273 C  CA  . ILE A  1 429 ? 12.765  10.423  8.982   1.00 42.94  ?  429  ILE A CA  1 
ATOM   3274 C  C   . ILE A  1 429 ? 12.180  11.531  9.836   1.00 44.61  ?  429  ILE A C   1 
ATOM   3275 O  O   . ILE A  1 429 ? 10.963  11.569  10.068  1.00 48.88  ?  429  ILE A O   1 
ATOM   3276 C  CB  . ILE A  1 429 ? 12.425  10.655  7.508   1.00 45.21  ?  429  ILE A CB  1 
ATOM   3277 C  CG1 . ILE A  1 429 ? 12.852  12.063  7.093   1.00 44.02  ?  429  ILE A CG1 1 
ATOM   3278 C  CG2 . ILE A  1 429 ? 10.941  10.438  7.240   1.00 45.73  ?  429  ILE A CG2 1 
ATOM   3279 C  CD1 . ILE A  1 429 ? 12.666  12.317  5.632   1.00 45.47  ?  429  ILE A CD1 1 
ATOM   3280 N  N   . PHE A  1 430 ? 13.042  12.418  10.330  1.00 32.88  ?  430  PHE A N   1 
ATOM   3281 C  CA  . PHE A  1 430 ? 12.584  13.483  11.227  1.00 36.81  ?  430  PHE A CA  1 
ATOM   3282 C  C   . PHE A  1 430 ? 12.243  14.749  10.447  1.00 37.90  ?  430  PHE A C   1 
ATOM   3283 O  O   . PHE A  1 430 ? 13.126  15.389  9.885   1.00 40.78  ?  430  PHE A O   1 
ATOM   3284 C  CB  . PHE A  1 430 ? 13.650  13.762  12.293  1.00 37.99  ?  430  PHE A CB  1 
ATOM   3285 C  CG  . PHE A  1 430 ? 13.263  14.818  13.289  1.00 40.54  ?  430  PHE A CG  1 
ATOM   3286 C  CD1 . PHE A  1 430 ? 13.547  16.155  13.050  1.00 41.84  ?  430  PHE A CD1 1 
ATOM   3287 C  CD2 . PHE A  1 430 ? 12.651  14.469  14.481  1.00 40.49  ?  430  PHE A CD2 1 
ATOM   3288 C  CE1 . PHE A  1 430 ? 13.208  17.128  13.967  1.00 43.95  ?  430  PHE A CE1 1 
ATOM   3289 C  CE2 . PHE A  1 430 ? 12.312  15.437  15.406  1.00 44.76  ?  430  PHE A CE2 1 
ATOM   3290 C  CZ  . PHE A  1 430 ? 12.587  16.769  15.147  1.00 43.61  ?  430  PHE A CZ  1 
ATOM   3291 N  N   . GLU A  1 431 ? 10.966  15.123  10.424  1.00 39.01  ?  431  GLU A N   1 
ATOM   3292 C  CA  . GLU A  1 431 ? 10.526  16.173  9.510   1.00 49.66  ?  431  GLU A CA  1 
ATOM   3293 C  C   . GLU A  1 431 ? 10.056  17.486  10.143  1.00 55.08  ?  431  GLU A C   1 
ATOM   3294 O  O   . GLU A  1 431 ? 9.556   18.368  9.438   1.00 58.60  ?  431  GLU A O   1 
ATOM   3295 C  CB  . GLU A  1 431 ? 9.417   15.646  8.601   1.00 51.69  ?  431  GLU A CB  1 
ATOM   3296 C  CG  . GLU A  1 431 ? 9.833   14.533  7.666   1.00 55.79  ?  431  GLU A CG  1 
ATOM   3297 C  CD  . GLU A  1 431 ? 8.728   14.199  6.676   1.00 61.80  ?  431  GLU A CD  1 
ATOM   3298 O  OE1 . GLU A  1 431 ? 7.547   14.185  7.094   1.00 58.93  ?  431  GLU A OE1 1 
ATOM   3299 O  OE2 . GLU A  1 431 ? 9.034   13.975  5.483   1.00 63.97  ?  431  GLU A OE2 1 
ATOM   3300 N  N   . HIS A  1 432 ? 10.203  17.637  11.451  1.00 47.02  ?  432  HIS A N   1 
ATOM   3301 C  CA  . HIS A  1 432 ? 9.697   18.851  12.070  1.00 44.02  ?  432  HIS A CA  1 
ATOM   3302 C  C   . HIS A  1 432 ? 10.761  19.920  12.276  1.00 42.90  ?  432  HIS A C   1 
ATOM   3303 O  O   . HIS A  1 432 ? 11.790  19.672  12.901  1.00 39.65  ?  432  HIS A O   1 
ATOM   3304 C  CB  . HIS A  1 432 ? 8.975   18.554  13.377  1.00 40.41  ?  432  HIS A CB  1 
ATOM   3305 C  CG  . HIS A  1 432 ? 8.653   19.782  14.164  1.00 50.78  ?  432  HIS A CG  1 
ATOM   3306 N  ND1 . HIS A  1 432 ? 7.630   20.637  13.820  1.00 53.30  ?  432  HIS A ND1 1 
ATOM   3307 C  CD2 . HIS A  1 432 ? 9.234   20.314  15.266  1.00 53.59  ?  432  HIS A CD2 1 
ATOM   3308 C  CE1 . HIS A  1 432 ? 7.584   21.635  14.684  1.00 54.60  ?  432  HIS A CE1 1 
ATOM   3309 N  NE2 . HIS A  1 432 ? 8.548   21.465  15.569  1.00 55.26  ?  432  HIS A NE2 1 
ATOM   3310 N  N   . ARG A  1 433 ? 10.501  21.111  11.739  1.00 46.10  ?  433  ARG A N   1 
ATOM   3311 C  CA  . ARG A  1 433 ? 11.395  22.255  11.912  1.00 47.92  ?  433  ARG A CA  1 
ATOM   3312 C  C   . ARG A  1 433 ? 11.056  23.034  13.183  1.00 48.65  ?  433  ARG A C   1 
ATOM   3313 O  O   . ARG A  1 433 ? 9.943   23.573  13.308  1.00 43.49  ?  433  ARG A O   1 
ATOM   3314 C  CB  . ARG A  1 433 ? 11.289  23.196  10.717  1.00 49.61  ?  433  ARG A CB  1 
ATOM   3315 C  CG  . ARG A  1 433 ? 12.264  24.362  10.774  1.00 53.57  ?  433  ARG A CG  1 
ATOM   3316 C  CD  . ARG A  1 433 ? 12.062  25.299  9.597   1.00 52.44  ?  433  ARG A CD  1 
ATOM   3317 N  NE  . ARG A  1 433 ? 12.620  26.627  9.833   1.00 51.94  ?  433  ARG A NE  1 
ATOM   3318 C  CZ  . ARG A  1 433 ? 13.852  26.990  9.496   1.00 55.62  ?  433  ARG A CZ  1 
ATOM   3319 N  NH1 . ARG A  1 433 ? 14.664  26.120  8.902   1.00 52.45  ?  433  ARG A NH1 1 
ATOM   3320 N  NH2 . ARG A  1 433 ? 14.270  28.224  9.751   1.00 56.79  ?  433  ARG A NH2 1 
ATOM   3321 N  N   . ALA A  1 434 ? 12.014  23.105  14.110  1.00 42.34  ?  434  ALA A N   1 
ATOM   3322 C  CA  . ALA A  1 434 ? 11.784  23.774  15.395  1.00 45.58  ?  434  ALA A CA  1 
ATOM   3323 C  C   . ALA A  1 434 ? 11.317  25.216  15.220  1.00 49.49  ?  434  ALA A C   1 
ATOM   3324 O  O   . ALA A  1 434 ? 11.870  25.965  14.413  1.00 47.69  ?  434  ALA A O   1 
ATOM   3325 C  CB  . ALA A  1 434 ? 13.030  23.725  16.250  1.00 44.46  ?  434  ALA A CB  1 
ATOM   3326 N  N   . SER A  1 435 ? 10.290  25.598  15.973  1.00 50.86  ?  435  SER A N   1 
ATOM   3327 C  CA  . SER A  1 435 ? 9.776   26.960  15.918  1.00 54.11  ?  435  SER A CA  1 
ATOM   3328 C  C   . SER A  1 435 ? 10.854  27.956  16.339  1.00 54.90  ?  435  SER A C   1 
ATOM   3329 O  O   . SER A  1 435 ? 10.837  29.117  15.934  1.00 54.90  ?  435  SER A O   1 
ATOM   3330 C  CB  . SER A  1 435 ? 8.518   27.111  16.788  1.00 56.04  ?  435  SER A CB  1 
ATOM   3331 O  OG  . SER A  1 435 ? 8.820   27.210  18.168  1.00 55.04  ?  435  SER A OG  1 
ATOM   3332 N  N   . THR A  1 436 ? 11.807  27.475  17.131  1.00 54.34  ?  436  THR A N   1 
ATOM   3333 C  CA  . THR A  1 436 ? 12.881  28.303  17.671  1.00 56.93  ?  436  THR A CA  1 
ATOM   3334 C  C   . THR A  1 436 ? 14.166  28.295  16.846  1.00 56.36  ?  436  THR A C   1 
ATOM   3335 O  O   . THR A  1 436 ? 15.185  28.822  17.290  1.00 60.58  ?  436  THR A O   1 
ATOM   3336 C  CB  . THR A  1 436 ? 13.263  27.831  19.085  1.00 52.50  ?  436  THR A CB  1 
ATOM   3337 O  OG1 . THR A  1 436 ? 13.673  26.460  19.023  1.00 53.40  ?  436  THR A OG1 1 
ATOM   3338 C  CG2 . THR A  1 436 ? 12.077  27.950  20.020  1.00 46.52  ?  436  THR A CG2 1 
ATOM   3339 N  N   . LEU A  1 437 ? 14.133  27.692  15.663  1.00 52.99  ?  437  LEU A N   1 
ATOM   3340 C  CA  . LEU A  1 437 ? 15.346  27.527  14.855  1.00 44.59  ?  437  LEU A CA  1 
ATOM   3341 C  C   . LEU A  1 437 ? 15.848  28.882  14.333  1.00 43.53  ?  437  LEU A C   1 
ATOM   3342 O  O   . LEU A  1 437 ? 15.060  29.695  13.842  1.00 41.45  ?  437  LEU A O   1 
ATOM   3343 C  CB  . LEU A  1 437 ? 15.058  26.566  13.699  1.00 50.49  ?  437  LEU A CB  1 
ATOM   3344 C  CG  . LEU A  1 437 ? 16.209  25.944  12.909  1.00 55.49  ?  437  LEU A CG  1 
ATOM   3345 C  CD1 . LEU A  1 437 ? 17.186  25.319  13.848  1.00 52.80  ?  437  LEU A CD1 1 
ATOM   3346 C  CD2 . LEU A  1 437 ? 15.689  24.896  11.952  1.00 52.68  ?  437  LEU A CD2 1 
ATOM   3347 N  N   . THR A  1 438 ? 17.153  29.130  14.437  1.00 39.16  ?  438  THR A N   1 
ATOM   3348 C  CA  . THR A  1 438 ? 17.708  30.420  14.001  1.00 44.63  ?  438  THR A CA  1 
ATOM   3349 C  C   . THR A  1 438 ? 18.270  30.422  12.572  1.00 45.17  ?  438  THR A C   1 
ATOM   3350 O  O   . THR A  1 438 ? 18.531  31.485  12.003  1.00 55.56  ?  438  THR A O   1 
ATOM   3351 C  CB  . THR A  1 438 ? 18.809  30.913  14.951  1.00 52.61  ?  438  THR A CB  1 
ATOM   3352 O  OG1 . THR A  1 438 ? 19.816  29.898  15.082  1.00 54.34  ?  438  THR A OG1 1 
ATOM   3353 C  CG2 . THR A  1 438 ? 18.223  31.228  16.317  1.00 49.06  ?  438  THR A CG2 1 
ATOM   3354 N  N   . TRP A  1 439 ? 18.470  29.239  12.002  1.00 37.26  ?  439  TRP A N   1 
ATOM   3355 C  CA  . TRP A  1 439 ? 18.900  29.129  10.611  1.00 46.13  ?  439  TRP A CA  1 
ATOM   3356 C  C   . TRP A  1 439 ? 17.773  29.550  9.663   1.00 44.16  ?  439  TRP A C   1 
ATOM   3357 O  O   . TRP A  1 439 ? 16.595  29.502  10.036  1.00 45.18  ?  439  TRP A O   1 
ATOM   3358 C  CB  . TRP A  1 439 ? 19.358  27.704  10.309  1.00 45.80  ?  439  TRP A CB  1 
ATOM   3359 C  CG  . TRP A  1 439 ? 20.590  27.320  11.043  1.00 35.53  ?  439  TRP A CG  1 
ATOM   3360 C  CD1 . TRP A  1 439 ? 20.660  26.567  12.177  1.00 36.29  ?  439  TRP A CD1 1 
ATOM   3361 C  CD2 . TRP A  1 439 ? 21.941  27.666  10.703  1.00 32.26  ?  439  TRP A CD2 1 
ATOM   3362 N  NE1 . TRP A  1 439 ? 21.969  26.425  12.571  1.00 35.62  ?  439  TRP A NE1 1 
ATOM   3363 C  CE2 . TRP A  1 439 ? 22.777  27.090  11.686  1.00 33.59  ?  439  TRP A CE2 1 
ATOM   3364 C  CE3 . TRP A  1 439 ? 22.525  28.403  9.665   1.00 33.18  ?  439  TRP A CE3 1 
ATOM   3365 C  CZ2 . TRP A  1 439 ? 24.166  27.224  11.659  1.00 33.06  ?  439  TRP A CZ2 1 
ATOM   3366 C  CZ3 . TRP A  1 439 ? 23.891  28.540  9.635   1.00 43.85  ?  439  TRP A CZ3 1 
ATOM   3367 C  CH2 . TRP A  1 439 ? 24.705  27.952  10.631  1.00 48.91  ?  439  TRP A CH2 1 
ATOM   3368 N  N   . PRO A  1 440 ? 18.126  29.978  8.440   1.00 41.27  ?  440  PRO A N   1 
ATOM   3369 C  CA  . PRO A  1 440 ? 17.087  30.451  7.510   1.00 45.14  ?  440  PRO A CA  1 
ATOM   3370 C  C   . PRO A  1 440 ? 16.141  29.330  7.078   1.00 44.99  ?  440  PRO A C   1 
ATOM   3371 O  O   . PRO A  1 440 ? 16.453  28.153  7.268   1.00 46.24  ?  440  PRO A O   1 
ATOM   3372 C  CB  . PRO A  1 440 ? 17.893  30.985  6.314   1.00 41.37  ?  440  PRO A CB  1 
ATOM   3373 C  CG  . PRO A  1 440 ? 19.184  30.257  6.366   1.00 43.11  ?  440  PRO A CG  1 
ATOM   3374 C  CD  . PRO A  1 440 ? 19.471  30.042  7.840   1.00 46.82  ?  440  PRO A CD  1 
ATOM   3375 N  N   . LEU A  1 441 ? 14.998  29.699  6.510   1.00 47.69  ?  441  LEU A N   1 
ATOM   3376 C  CA  . LEU A  1 441 ? 13.977  28.722  6.160   1.00 51.46  ?  441  LEU A CA  1 
ATOM   3377 C  C   . LEU A  1 441 ? 14.476  27.768  5.101   1.00 51.48  ?  441  LEU A C   1 
ATOM   3378 O  O   . LEU A  1 441 ? 14.171  26.579  5.152   1.00 53.30  ?  441  LEU A O   1 
ATOM   3379 C  CB  . LEU A  1 441 ? 12.695  29.409  5.679   1.00 55.45  ?  441  LEU A CB  1 
ATOM   3380 C  CG  . LEU A  1 441 ? 12.051  30.324  6.721   1.00 65.23  ?  441  LEU A CG  1 
ATOM   3381 C  CD1 . LEU A  1 441 ? 10.758  30.917  6.210   1.00 66.63  ?  441  LEU A CD1 1 
ATOM   3382 C  CD2 . LEU A  1 441 ? 11.825  29.586  8.036   1.00 65.02  ?  441  LEU A CD2 1 
ATOM   3383 N  N   . TRP A  1 442 ? 15.253  28.284  4.151   1.00 46.78  ?  442  TRP A N   1 
ATOM   3384 C  CA  . TRP A  1 442 ? 15.677  27.466  3.017   1.00 48.89  ?  442  TRP A CA  1 
ATOM   3385 C  C   . TRP A  1 442 ? 16.405  26.198  3.481   1.00 48.35  ?  442  TRP A C   1 
ATOM   3386 O  O   . TRP A  1 442 ? 16.355  25.175  2.806   1.00 52.57  ?  442  TRP A O   1 
ATOM   3387 C  CB  . TRP A  1 442 ? 16.471  28.270  1.958   1.00 44.71  ?  442  TRP A CB  1 
ATOM   3388 C  CG  . TRP A  1 442 ? 17.905  28.690  2.319   1.00 58.92  ?  442  TRP A CG  1 
ATOM   3389 C  CD1 . TRP A  1 442 ? 18.327  29.944  2.686   1.00 54.68  ?  442  TRP A CD1 1 
ATOM   3390 C  CD2 . TRP A  1 442 ? 19.089  27.866  2.295   1.00 49.86  ?  442  TRP A CD2 1 
ATOM   3391 N  NE1 . TRP A  1 442 ? 19.686  29.944  2.910   1.00 47.04  ?  442  TRP A NE1 1 
ATOM   3392 C  CE2 . TRP A  1 442 ? 20.176  28.683  2.687   1.00 46.49  ?  442  TRP A CE2 1 
ATOM   3393 C  CE3 . TRP A  1 442 ? 19.332  26.518  1.990   1.00 41.04  ?  442  TRP A CE3 1 
ATOM   3394 C  CZ2 . TRP A  1 442 ? 21.483  28.195  2.792   1.00 41.17  ?  442  TRP A CZ2 1 
ATOM   3395 C  CZ3 . TRP A  1 442 ? 20.629  26.034  2.089   1.00 43.10  ?  442  TRP A CZ3 1 
ATOM   3396 C  CH2 . TRP A  1 442 ? 21.690  26.874  2.490   1.00 45.70  ?  442  TRP A CH2 1 
ATOM   3397 N  N   . MET A  1 443 ? 17.031  26.252  4.655   1.00 44.96  ?  443  MET A N   1 
ATOM   3398 C  CA  . MET A  1 443 ? 17.786  25.108  5.162   1.00 40.28  ?  443  MET A CA  1 
ATOM   3399 C  C   . MET A  1 443 ? 16.912  23.970  5.684   1.00 44.54  ?  443  MET A C   1 
ATOM   3400 O  O   . MET A  1 443 ? 17.421  22.901  6.040   1.00 39.90  ?  443  MET A O   1 
ATOM   3401 C  CB  . MET A  1 443 ? 18.778  25.540  6.234   1.00 39.65  ?  443  MET A CB  1 
ATOM   3402 C  CG  . MET A  1 443 ? 19.920  26.380  5.709   1.00 46.55  ?  443  MET A CG  1 
ATOM   3403 S  SD  . MET A  1 443 ? 21.216  26.555  6.947   1.00 46.66  ?  443  MET A SD  1 
ATOM   3404 C  CE  . MET A  1 443 ? 22.136  27.915  6.246   1.00 102.49 ?  443  MET A CE  1 
ATOM   3405 N  N   . GLY A  1 444 ? 15.602  24.198  5.717   1.00 43.65  ?  444  GLY A N   1 
ATOM   3406 C  CA  . GLY A  1 444 ? 14.657  23.176  6.131   1.00 43.45  ?  444  GLY A CA  1 
ATOM   3407 C  C   . GLY A  1 444 ? 14.901  22.664  7.540   1.00 44.55  ?  444  GLY A C   1 
ATOM   3408 O  O   . GLY A  1 444 ? 15.002  23.454  8.482   1.00 42.71  ?  444  GLY A O   1 
ATOM   3409 N  N   . VAL A  1 445 ? 14.984  21.341  7.677   1.00 42.95  ?  445  VAL A N   1 
ATOM   3410 C  CA  . VAL A  1 445 ? 15.281  20.706  8.953   1.00 48.92  ?  445  VAL A CA  1 
ATOM   3411 C  C   . VAL A  1 445 ? 16.713  20.194  8.906   1.00 51.79  ?  445  VAL A C   1 
ATOM   3412 O  O   . VAL A  1 445 ? 16.962  19.076  8.447   1.00 51.95  ?  445  VAL A O   1 
ATOM   3413 C  CB  . VAL A  1 445 ? 14.329  19.519  9.250   1.00 48.21  ?  445  VAL A CB  1 
ATOM   3414 C  CG1 . VAL A  1 445 ? 14.622  18.942  10.629  1.00 38.30  ?  445  VAL A CG1 1 
ATOM   3415 C  CG2 . VAL A  1 445 ? 12.872  19.947  9.153   1.00 47.93  ?  445  VAL A CG2 1 
ATOM   3416 N  N   . PRO A  1 446 ? 17.665  21.014  9.379   1.00 45.61  ?  446  PRO A N   1 
ATOM   3417 C  CA  . PRO A  1 446 ? 19.073  20.697  9.154   1.00 38.02  ?  446  PRO A CA  1 
ATOM   3418 C  C   . PRO A  1 446 ? 19.589  19.572  10.037  1.00 42.24  ?  446  PRO A C   1 
ATOM   3419 O  O   . PRO A  1 446 ? 18.961  19.155  11.019  1.00 41.16  ?  446  PRO A O   1 
ATOM   3420 C  CB  . PRO A  1 446 ? 19.792  22.009  9.500   1.00 35.29  ?  446  PRO A CB  1 
ATOM   3421 C  CG  . PRO A  1 446 ? 18.716  23.051  9.583   1.00 41.87  ?  446  PRO A CG  1 
ATOM   3422 C  CD  . PRO A  1 446 ? 17.509  22.312  10.049  1.00 44.41  ?  446  PRO A CD  1 
ATOM   3423 N  N   . HIS A  1 447 ? 20.745  19.074  9.627   1.00 44.57  ?  447  HIS A N   1 
ATOM   3424 C  CA  . HIS A  1 447 ? 21.541  18.108  10.359  1.00 45.28  ?  447  HIS A CA  1 
ATOM   3425 C  C   . HIS A  1 447 ? 21.679  18.508  11.841  1.00 51.35  ?  447  HIS A C   1 
ATOM   3426 O  O   . HIS A  1 447 ? 22.204  19.577  12.165  1.00 41.06  ?  447  HIS A O   1 
ATOM   3427 C  CB  . HIS A  1 447 ? 22.920  18.059  9.686   1.00 33.80  ?  447  HIS A CB  1 
ATOM   3428 C  CG  . HIS A  1 447 ? 23.753  16.874  10.057  1.00 37.55  ?  447  HIS A CG  1 
ATOM   3429 N  ND1 . HIS A  1 447 ? 23.281  15.580  9.999   1.00 40.31  ?  447  HIS A ND1 1 
ATOM   3430 C  CD2 . HIS A  1 447 ? 25.049  16.785  10.447  1.00 33.12  ?  447  HIS A CD2 1 
ATOM   3431 C  CE1 . HIS A  1 447 ? 24.246  14.745  10.347  1.00 35.83  ?  447  HIS A CE1 1 
ATOM   3432 N  NE2 . HIS A  1 447 ? 25.330  15.450  10.618  1.00 32.49  ?  447  HIS A NE2 1 
ATOM   3433 N  N   . GLY A  1 448 ? 21.188  17.653  12.734  1.00 50.57  ?  448  GLY A N   1 
ATOM   3434 C  CA  . GLY A  1 448 ? 21.419  17.829  14.152  1.00 46.18  ?  448  GLY A CA  1 
ATOM   3435 C  C   . GLY A  1 448 ? 20.297  18.495  14.919  1.00 46.02  ?  448  GLY A C   1 
ATOM   3436 O  O   . GLY A  1 448 ? 20.406  18.700  16.136  1.00 47.25  ?  448  GLY A O   1 
ATOM   3437 N  N   . TYR A  1 449 ? 19.207  18.822  14.233  1.00 35.42  ?  449  TYR A N   1 
ATOM   3438 C  CA  . TYR A  1 449 ? 18.119  19.519  14.907  1.00 33.17  ?  449  TYR A CA  1 
ATOM   3439 C  C   . TYR A  1 449 ? 16.961  18.641  15.362  1.00 38.64  ?  449  TYR A C   1 
ATOM   3440 O  O   . TYR A  1 449 ? 15.897  19.142  15.738  1.00 41.55  ?  449  TYR A O   1 
ATOM   3441 C  CB  . TYR A  1 449 ? 17.690  20.777  14.145  1.00 31.03  ?  449  TYR A CB  1 
ATOM   3442 C  CG  . TYR A  1 449 ? 18.764  21.836  14.257  1.00 40.23  ?  449  TYR A CG  1 
ATOM   3443 C  CD1 . TYR A  1 449 ? 19.818  21.884  13.347  1.00 41.13  ?  449  TYR A CD1 1 
ATOM   3444 C  CD2 . TYR A  1 449 ? 18.778  22.731  15.320  1.00 43.38  ?  449  TYR A CD2 1 
ATOM   3445 C  CE1 . TYR A  1 449 ? 20.832  22.830  13.470  1.00 39.72  ?  449  TYR A CE1 1 
ATOM   3446 C  CE2 . TYR A  1 449 ? 19.786  23.684  15.450  1.00 43.40  ?  449  TYR A CE2 1 
ATOM   3447 C  CZ  . TYR A  1 449 ? 20.806  23.728  14.521  1.00 43.68  ?  449  TYR A CZ  1 
ATOM   3448 O  OH  . TYR A  1 449 ? 21.808  24.663  14.640  1.00 44.40  ?  449  TYR A OH  1 
ATOM   3449 N  N   . GLU A  1 450 ? 17.191  17.332  15.383  1.00 36.06  ?  450  GLU A N   1 
ATOM   3450 C  CA  . GLU A  1 450 ? 16.266  16.430  16.057  1.00 34.26  ?  450  GLU A CA  1 
ATOM   3451 C  C   . GLU A  1 450 ? 16.700  16.251  17.503  1.00 36.67  ?  450  GLU A C   1 
ATOM   3452 O  O   . GLU A  1 450 ? 15.890  15.933  18.373  1.00 47.81  ?  450  GLU A O   1 
ATOM   3453 C  CB  . GLU A  1 450 ? 16.193  15.077  15.348  1.00 31.10  ?  450  GLU A CB  1 
ATOM   3454 C  CG  . GLU A  1 450 ? 17.307  14.109  15.681  1.00 24.12  ?  450  GLU A CG  1 
ATOM   3455 C  CD  . GLU A  1 450 ? 18.644  14.436  15.016  1.00 49.91  ?  450  GLU A CD  1 
ATOM   3456 O  OE1 . GLU A  1 450 ? 18.866  15.604  14.617  1.00 46.89  ?  450  GLU A OE1 1 
ATOM   3457 O  OE2 . GLU A  1 450 ? 19.481  13.508  14.896  1.00 47.72  ?  450  GLU A OE2 1 
ATOM   3458 N  N   . ILE A  1 451 ? 17.979  16.488  17.756  1.00 40.28  ?  451  ILE A N   1 
ATOM   3459 C  CA  . ILE A  1 451 ? 18.580  16.225  19.062  1.00 43.14  ?  451  ILE A CA  1 
ATOM   3460 C  C   . ILE A  1 451 ? 17.852  16.894  20.228  1.00 48.83  ?  451  ILE A C   1 
ATOM   3461 O  O   . ILE A  1 451 ? 17.518  16.221  21.203  1.00 52.58  ?  451  ILE A O   1 
ATOM   3462 C  CB  . ILE A  1 451 ? 20.059  16.638  19.082  1.00 36.92  ?  451  ILE A CB  1 
ATOM   3463 C  CG1 . ILE A  1 451 ? 20.839  15.862  18.021  1.00 33.61  ?  451  ILE A CG1 1 
ATOM   3464 C  CG2 . ILE A  1 451 ? 20.657  16.400  20.445  1.00 39.74  ?  451  ILE A CG2 1 
ATOM   3465 C  CD1 . ILE A  1 451 ? 22.329  16.160  18.043  1.00 41.37  ?  451  ILE A CD1 1 
ATOM   3466 N  N   . GLU A  1 452 ? 17.595  18.202  20.119  1.00 47.33  ?  452  GLU A N   1 
ATOM   3467 C  CA  . GLU A  1 452 ? 16.948  18.962  21.197  1.00 43.61  ?  452  GLU A CA  1 
ATOM   3468 C  C   . GLU A  1 452 ? 15.580  18.379  21.567  1.00 47.49  ?  452  GLU A C   1 
ATOM   3469 O  O   . GLU A  1 452 ? 15.129  18.518  22.703  1.00 55.36  ?  452  GLU A O   1 
ATOM   3470 C  CB  . GLU A  1 452 ? 16.844  20.466  20.857  1.00 39.37  ?  452  GLU A CB  1 
ATOM   3471 C  CG  . GLU A  1 452 ? 16.091  20.791  19.542  1.00 39.49  ?  452  GLU A CG  1 
ATOM   3472 C  CD  . GLU A  1 452 ? 16.577  22.083  18.867  1.00 42.90  ?  452  GLU A CD  1 
ATOM   3473 O  OE1 . GLU A  1 452 ? 17.798  22.229  18.647  1.00 45.67  ?  452  GLU A OE1 1 
ATOM   3474 O  OE2 . GLU A  1 452 ? 15.744  22.963  18.556  1.00 44.07  ?  452  GLU A OE2 1 
ATOM   3475 N  N   . PHE A  1 453 ? 14.938  17.710  20.613  1.00 41.76  ?  453  PHE A N   1 
ATOM   3476 C  CA  . PHE A  1 453 ? 13.631  17.105  20.846  1.00 39.73  ?  453  PHE A CA  1 
ATOM   3477 C  C   . PHE A  1 453 ? 13.738  15.749  21.539  1.00 43.54  ?  453  PHE A C   1 
ATOM   3478 O  O   . PHE A  1 453 ? 12.922  15.424  22.397  1.00 53.20  ?  453  PHE A O   1 
ATOM   3479 C  CB  . PHE A  1 453 ? 12.841  16.981  19.536  1.00 43.40  ?  453  PHE A CB  1 
ATOM   3480 C  CG  . PHE A  1 453 ? 12.323  18.293  19.024  1.00 41.65  ?  453  PHE A CG  1 
ATOM   3481 C  CD1 . PHE A  1 453 ? 11.121  18.792  19.470  1.00 38.49  ?  453  PHE A CD1 1 
ATOM   3482 C  CD2 . PHE A  1 453 ? 13.057  19.041  18.126  1.00 45.50  ?  453  PHE A CD2 1 
ATOM   3483 C  CE1 . PHE A  1 453 ? 10.653  20.003  19.020  1.00 45.75  ?  453  PHE A CE1 1 
ATOM   3484 C  CE2 . PHE A  1 453 ? 12.590  20.259  17.666  1.00 44.10  ?  453  PHE A CE2 1 
ATOM   3485 C  CZ  . PHE A  1 453 ? 11.387  20.739  18.118  1.00 45.12  ?  453  PHE A CZ  1 
ATOM   3486 N  N   . ILE A  1 454 ? 14.746  14.969  21.166  1.00 39.53  ?  454  ILE A N   1 
ATOM   3487 C  CA  . ILE A  1 454 ? 14.991  13.672  21.773  1.00 34.41  ?  454  ILE A CA  1 
ATOM   3488 C  C   . ILE A  1 454 ? 15.338  13.837  23.248  1.00 42.39  ?  454  ILE A C   1 
ATOM   3489 O  O   . ILE A  1 454 ? 14.941  13.018  24.072  1.00 48.33  ?  454  ILE A O   1 
ATOM   3490 C  CB  . ILE A  1 454 ? 16.162  12.928  21.078  1.00 54.21  ?  454  ILE A CB  1 
ATOM   3491 C  CG1 . ILE A  1 454 ? 15.916  12.780  19.567  1.00 46.32  ?  454  ILE A CG1 1 
ATOM   3492 C  CG2 . ILE A  1 454 ? 16.406  11.567  21.736  1.00 47.57  ?  454  ILE A CG2 1 
ATOM   3493 C  CD1 . ILE A  1 454 ? 14.726  11.944  19.241  1.00 45.65  ?  454  ILE A CD1 1 
ATOM   3494 N  N   . PHE A  1 455 ? 16.080  14.898  23.572  1.00 41.82  ?  455  PHE A N   1 
ATOM   3495 C  CA  . PHE A  1 455 ? 16.499  15.156  24.949  1.00 42.83  ?  455  PHE A CA  1 
ATOM   3496 C  C   . PHE A  1 455 ? 15.436  15.896  25.752  1.00 46.20  ?  455  PHE A C   1 
ATOM   3497 O  O   . PHE A  1 455 ? 15.551  16.031  26.971  1.00 44.66  ?  455  PHE A O   1 
ATOM   3498 C  CB  . PHE A  1 455 ? 17.831  15.916  25.008  1.00 33.86  ?  455  PHE A CB  1 
ATOM   3499 C  CG  . PHE A  1 455 ? 19.037  15.034  24.841  1.00 36.52  ?  455  PHE A CG  1 
ATOM   3500 C  CD1 . PHE A  1 455 ? 19.453  14.632  23.577  1.00 29.69  ?  455  PHE A CD1 1 
ATOM   3501 C  CD2 . PHE A  1 455 ? 19.755  14.601  25.949  1.00 36.41  ?  455  PHE A CD2 1 
ATOM   3502 C  CE1 . PHE A  1 455 ? 20.559  13.809  23.424  1.00 28.26  ?  455  PHE A CE1 1 
ATOM   3503 C  CE2 . PHE A  1 455 ? 20.868  13.786  25.802  1.00 39.80  ?  455  PHE A CE2 1 
ATOM   3504 C  CZ  . PHE A  1 455 ? 21.266  13.385  24.524  1.00 36.86  ?  455  PHE A CZ  1 
ATOM   3505 N  N   . GLY A  1 456 ? 14.408  16.382  25.072  1.00 38.39  ?  456  GLY A N   1 
ATOM   3506 C  CA  . GLY A  1 456 ? 13.271  16.947  25.773  1.00 37.55  ?  456  GLY A CA  1 
ATOM   3507 C  C   . GLY A  1 456 ? 13.425  18.399  26.172  1.00 41.89  ?  456  GLY A C   1 
ATOM   3508 O  O   . GLY A  1 456 ? 12.713  18.881  27.043  1.00 49.54  ?  456  GLY A O   1 
ATOM   3509 N  N   . LEU A  1 457 ? 14.339  19.111  25.522  1.00 43.52  ?  457  LEU A N   1 
ATOM   3510 C  CA  . LEU A  1 457 ? 14.474  20.548  25.765  1.00 42.46  ?  457  LEU A CA  1 
ATOM   3511 C  C   . LEU A  1 457 ? 13.179  21.366  25.681  1.00 51.02  ?  457  LEU A C   1 
ATOM   3512 O  O   . LEU A  1 457 ? 13.023  22.313  26.450  1.00 57.44  ?  457  LEU A O   1 
ATOM   3513 C  CB  . LEU A  1 457 ? 15.567  21.174  24.900  1.00 41.03  ?  457  LEU A CB  1 
ATOM   3514 C  CG  . LEU A  1 457 ? 16.985  21.069  25.484  1.00 49.23  ?  457  LEU A CG  1 
ATOM   3515 C  CD1 . LEU A  1 457 ? 17.503  19.623  25.513  1.00 45.47  ?  457  LEU A CD1 1 
ATOM   3516 C  CD2 . LEU A  1 457 ? 17.950  21.975  24.726  1.00 39.42  ?  457  LEU A CD2 1 
ATOM   3517 N  N   . PRO A  1 458 ? 12.246  21.013  24.765  1.00 50.69  ?  458  PRO A N   1 
ATOM   3518 C  CA  . PRO A  1 458 ? 11.015  21.810  24.745  1.00 50.15  ?  458  PRO A CA  1 
ATOM   3519 C  C   . PRO A  1 458 ? 10.250  21.821  26.065  1.00 52.07  ?  458  PRO A C   1 
ATOM   3520 O  O   . PRO A  1 458 ? 9.500   22.769  26.280  1.00 52.62  ?  458  PRO A O   1 
ATOM   3521 C  CB  . PRO A  1 458 ? 10.179  21.131  23.658  1.00 45.34  ?  458  PRO A CB  1 
ATOM   3522 C  CG  . PRO A  1 458 ? 11.167  20.560  22.762  1.00 48.73  ?  458  PRO A CG  1 
ATOM   3523 C  CD  . PRO A  1 458 ? 12.288  20.086  23.618  1.00 45.35  ?  458  PRO A CD  1 
ATOM   3524 N  N   . LEU A  1 459 ? 10.440  20.810  26.918  1.00 55.10  ?  459  LEU A N   1 
ATOM   3525 C  CA  . LEU A  1 459 ? 9.812   20.778  28.249  1.00 50.03  ?  459  LEU A CA  1 
ATOM   3526 C  C   . LEU A  1 459 ? 10.270  21.932  29.139  1.00 48.21  ?  459  LEU A C   1 
ATOM   3527 O  O   . LEU A  1 459 ? 9.605   22.286  30.110  1.00 56.43  ?  459  LEU A O   1 
ATOM   3528 C  CB  . LEU A  1 459 ? 10.085  19.448  28.950  1.00 48.09  ?  459  LEU A CB  1 
ATOM   3529 C  CG  . LEU A  1 459 ? 9.580   18.216  28.206  1.00 59.86  ?  459  LEU A CG  1 
ATOM   3530 C  CD1 . LEU A  1 459 ? 9.928   16.951  28.963  1.00 57.78  ?  459  LEU A CD1 1 
ATOM   3531 C  CD2 . LEU A  1 459 ? 8.084   18.323  28.014  1.00 69.70  ?  459  LEU A CD2 1 
ATOM   3532 N  N   . ASP A  1 460 ? 11.415  22.513  28.804  1.00 54.16  ?  460  ASP A N   1 
ATOM   3533 C  CA  . ASP A  1 460 ? 11.910  23.681  29.517  1.00 60.23  ?  460  ASP A CA  1 
ATOM   3534 C  C   . ASP A  1 460 ? 11.089  24.901  29.122  1.00 59.72  ?  460  ASP A C   1 
ATOM   3535 O  O   . ASP A  1 460 ? 11.154  25.364  27.993  1.00 66.07  ?  460  ASP A O   1 
ATOM   3536 C  CB  . ASP A  1 460 ? 13.388  23.908  29.196  1.00 57.29  ?  460  ASP A CB  1 
ATOM   3537 C  CG  . ASP A  1 460 ? 14.027  24.944  30.092  1.00 56.74  ?  460  ASP A CG  1 
ATOM   3538 O  OD1 . ASP A  1 460 ? 13.307  25.838  30.583  1.00 56.11  ?  460  ASP A OD1 1 
ATOM   3539 O  OD2 . ASP A  1 460 ? 15.255  24.866  30.301  1.00 61.42  ?  460  ASP A OD2 1 
ATOM   3540 N  N   . PRO A  1 461 ? 10.333  25.441  30.071  1.00 60.19  ?  461  PRO A N   1 
ATOM   3541 C  CA  . PRO A  1 461 ? 9.417   26.563  29.848  1.00 64.39  ?  461  PRO A CA  1 
ATOM   3542 C  C   . PRO A  1 461 ? 10.121  27.795  29.307  1.00 65.51  ?  461  PRO A C   1 
ATOM   3543 O  O   . PRO A  1 461 ? 9.622   28.448  28.393  1.00 66.48  ?  461  PRO A O   1 
ATOM   3544 C  CB  . PRO A  1 461 ? 8.899   26.862  31.254  1.00 65.64  ?  461  PRO A CB  1 
ATOM   3545 C  CG  . PRO A  1 461 ? 9.071   25.581  31.992  1.00 65.61  ?  461  PRO A CG  1 
ATOM   3546 C  CD  . PRO A  1 461 ? 10.340  25.007  31.474  1.00 62.85  ?  461  PRO A CD  1 
ATOM   3547 N  N   . SER A  1 462 ? 11.280  28.107  29.871  1.00 68.24  ?  462  SER A N   1 
ATOM   3548 C  CA  . SER A  1 462 ? 12.009  29.308  29.483  1.00 71.80  ?  462  SER A CA  1 
ATOM   3549 C  C   . SER A  1 462 ? 12.506  29.298  28.030  1.00 71.41  ?  462  SER A C   1 
ATOM   3550 O  O   . SER A  1 462 ? 12.970  30.324  27.532  1.00 70.31  ?  462  SER A O   1 
ATOM   3551 C  CB  . SER A  1 462 ? 13.183  29.546  30.435  1.00 65.86  ?  462  SER A CB  1 
ATOM   3552 O  OG  . SER A  1 462 ? 14.210  28.596  30.222  1.00 63.74  ?  462  SER A OG  1 
ATOM   3553 N  N   . LEU A  1 463 ? 12.404  28.154  27.353  1.00 68.30  ?  463  LEU A N   1 
ATOM   3554 C  CA  . LEU A  1 463 ? 12.933  28.020  25.993  1.00 54.48  ?  463  LEU A CA  1 
ATOM   3555 C  C   . LEU A  1 463 ? 11.962  28.431  24.879  1.00 63.68  ?  463  LEU A C   1 
ATOM   3556 O  O   . LEU A  1 463 ? 12.343  28.464  23.706  1.00 67.97  ?  463  LEU A O   1 
ATOM   3557 C  CB  . LEU A  1 463 ? 13.475  26.606  25.747  1.00 46.15  ?  463  LEU A CB  1 
ATOM   3558 C  CG  . LEU A  1 463 ? 14.783  26.267  26.480  1.00 53.31  ?  463  LEU A CG  1 
ATOM   3559 C  CD1 . LEU A  1 463 ? 15.311  24.871  26.114  1.00 47.45  ?  463  LEU A CD1 1 
ATOM   3560 C  CD2 . LEU A  1 463 ? 15.854  27.335  26.235  1.00 48.89  ?  463  LEU A CD2 1 
ATOM   3561 N  N   . ASN A  1 464 ? 10.721  28.748  25.237  1.00 66.50  ?  464  ASN A N   1 
ATOM   3562 C  CA  . ASN A  1 464 ? 9.776   29.342  24.279  1.00 75.19  ?  464  ASN A CA  1 
ATOM   3563 C  C   . ASN A  1 464 ? 9.333   28.439  23.104  1.00 66.32  ?  464  ASN A C   1 
ATOM   3564 O  O   . ASN A  1 464 ? 8.873   28.943  22.080  1.00 66.11  ?  464  ASN A O   1 
ATOM   3565 C  CB  . ASN A  1 464 ? 10.299  30.690  23.723  1.00 83.78  ?  464  ASN A CB  1 
ATOM   3566 C  CG  . ASN A  1 464 ? 10.518  31.754  24.806  1.00 95.40  ?  464  ASN A CG  1 
ATOM   3567 O  OD1 . ASN A  1 464 ? 10.012  31.640  25.922  1.00 87.97  ?  464  ASN A OD1 1 
ATOM   3568 N  ND2 . ASN A  1 464 ? 11.272  32.809  24.455  1.00 116.23 ?  464  ASN A ND2 1 
ATOM   3569 N  N   . TYR A  1 465 ? 9.467   27.121  23.241  1.00 58.05  ?  465  TYR A N   1 
ATOM   3570 C  CA  . TYR A  1 465 ? 8.857   26.195  22.286  1.00 39.13  ?  465  TYR A CA  1 
ATOM   3571 C  C   . TYR A  1 465 ? 7.328   26.250  22.393  1.00 56.26  ?  465  TYR A C   1 
ATOM   3572 O  O   . TYR A  1 465 ? 6.786   26.866  23.311  1.00 58.52  ?  465  TYR A O   1 
ATOM   3573 C  CB  . TYR A  1 465 ? 9.301   24.761  22.550  1.00 37.43  ?  465  TYR A CB  1 
ATOM   3574 C  CG  . TYR A  1 465 ? 10.732  24.458  22.204  1.00 41.18  ?  465  TYR A CG  1 
ATOM   3575 C  CD1 . TYR A  1 465 ? 11.749  24.654  23.132  1.00 49.21  ?  465  TYR A CD1 1 
ATOM   3576 C  CD2 . TYR A  1 465 ? 11.073  23.965  20.951  1.00 47.09  ?  465  TYR A CD2 1 
ATOM   3577 C  CE1 . TYR A  1 465 ? 13.069  24.372  22.821  1.00 52.16  ?  465  TYR A CE1 1 
ATOM   3578 C  CE2 . TYR A  1 465 ? 12.393  23.682  20.626  1.00 49.01  ?  465  TYR A CE2 1 
ATOM   3579 C  CZ  . TYR A  1 465 ? 13.384  23.889  21.568  1.00 52.59  ?  465  TYR A CZ  1 
ATOM   3580 O  OH  . TYR A  1 465 ? 14.693  23.610  21.255  1.00 57.45  ?  465  TYR A OH  1 
ATOM   3581 N  N   . THR A  1 466 ? 6.633   25.585  21.472  1.00 48.97  ?  466  THR A N   1 
ATOM   3582 C  CA  . THR A  1 466 ? 5.169   25.529  21.509  1.00 53.33  ?  466  THR A CA  1 
ATOM   3583 C  C   . THR A  1 466 ? 4.645   24.363  22.346  1.00 51.67  ?  466  THR A C   1 
ATOM   3584 O  O   . THR A  1 466 ? 5.384   23.435  22.673  1.00 52.18  ?  466  THR A O   1 
ATOM   3585 C  CB  . THR A  1 466 ? 4.576   25.350  20.104  1.00 54.20  ?  466  THR A CB  1 
ATOM   3586 O  OG1 . THR A  1 466 ? 5.041   24.108  19.554  1.00 52.23  ?  466  THR A OG1 1 
ATOM   3587 C  CG2 . THR A  1 466 ? 4.969   26.513  19.193  1.00 53.35  ?  466  THR A CG2 1 
ATOM   3588 N  N   . THR A  1 467 ? 3.354   24.401  22.664  1.00 57.15  ?  467  THR A N   1 
ATOM   3589 C  CA  . THR A  1 467 ? 2.706   23.294  23.360  1.00 65.80  ?  467  THR A CA  1 
ATOM   3590 C  C   . THR A  1 467 ? 2.763   21.995  22.536  1.00 67.66  ?  467  THR A C   1 
ATOM   3591 O  O   . THR A  1 467 ? 2.992   20.911  23.076  1.00 68.11  ?  467  THR A O   1 
ATOM   3592 C  CB  . THR A  1 467 ? 1.254   23.655  23.746  1.00 74.43  ?  467  THR A CB  1 
ATOM   3593 O  OG1 . THR A  1 467 ? 1.265   24.727  24.702  1.00 71.02  ?  467  THR A OG1 1 
ATOM   3594 C  CG2 . THR A  1 467 ? 0.535   22.454  24.346  1.00 77.75  ?  467  THR A CG2 1 
ATOM   3595 N  N   . GLU A  1 468 ? 2.584   22.116  21.225  1.00 68.99  ?  468  GLU A N   1 
ATOM   3596 C  CA  . GLU A  1 468 ? 2.684   20.968  20.328  1.00 65.68  ?  468  GLU A CA  1 
ATOM   3597 C  C   . GLU A  1 468 ? 4.113   20.438  20.279  1.00 59.39  ?  468  GLU A C   1 
ATOM   3598 O  O   . GLU A  1 468 ? 4.336   19.233  20.176  1.00 56.20  ?  468  GLU A O   1 
ATOM   3599 C  CB  . GLU A  1 468 ? 2.215   21.335  18.917  1.00 70.48  ?  468  GLU A CB  1 
ATOM   3600 C  CG  . GLU A  1 468 ? 0.828   21.966  18.859  1.00 91.99  ?  468  GLU A CG  1 
ATOM   3601 C  CD  . GLU A  1 468 ? 0.853   23.475  19.074  1.00 105.63 ?  468  GLU A CD  1 
ATOM   3602 O  OE1 . GLU A  1 468 ? 0.816   23.919  20.244  1.00 105.27 ?  468  GLU A OE1 1 
ATOM   3603 O  OE2 . GLU A  1 468 ? 0.913   24.218  18.068  1.00 111.11 ?  468  GLU A OE2 1 
ATOM   3604 N  N   . GLU A  1 469 ? 5.084   21.341  20.343  1.00 51.46  ?  469  GLU A N   1 
ATOM   3605 C  CA  . GLU A  1 469 ? 6.473   20.915  20.382  1.00 59.08  ?  469  GLU A CA  1 
ATOM   3606 C  C   . GLU A  1 469 ? 6.809   20.203  21.692  1.00 60.46  ?  469  GLU A C   1 
ATOM   3607 O  O   . GLU A  1 469 ? 7.620   19.278  21.703  1.00 58.00  ?  469  GLU A O   1 
ATOM   3608 C  CB  . GLU A  1 469 ? 7.422   22.086  20.098  1.00 62.99  ?  469  GLU A CB  1 
ATOM   3609 C  CG  . GLU A  1 469 ? 7.617   22.321  18.594  1.00 61.96  ?  469  GLU A CG  1 
ATOM   3610 C  CD  . GLU A  1 469 ? 8.316   23.625  18.259  1.00 60.05  ?  469  GLU A CD  1 
ATOM   3611 O  OE1 . GLU A  1 469 ? 8.121   24.629  18.973  1.00 66.30  ?  469  GLU A OE1 1 
ATOM   3612 O  OE2 . GLU A  1 469 ? 9.061   23.646  17.262  1.00 58.62  ?  469  GLU A OE2 1 
ATOM   3613 N  N   . ARG A  1 470 ? 6.164   20.620  22.783  1.00 62.81  ?  470  ARG A N   1 
ATOM   3614 C  CA  . ARG A  1 470 ? 6.340   19.971  24.077  1.00 60.09  ?  470  ARG A CA  1 
ATOM   3615 C  C   . ARG A  1 470 ? 5.811   18.544  24.031  1.00 54.09  ?  470  ARG A C   1 
ATOM   3616 O  O   . ARG A  1 470 ? 6.479   17.610  24.469  1.00 53.07  ?  470  ARG A O   1 
ATOM   3617 C  CB  . ARG A  1 470 ? 5.621   20.743  25.183  1.00 72.88  ?  470  ARG A CB  1 
ATOM   3618 C  CG  . ARG A  1 470 ? 6.281   22.051  25.587  1.00 85.71  ?  470  ARG A CG  1 
ATOM   3619 C  CD  . ARG A  1 470 ? 5.645   22.629  26.857  1.00 96.86  ?  470  ARG A CD  1 
ATOM   3620 N  NE  . ARG A  1 470 ? 6.315   23.848  27.315  1.00 103.54 ?  470  ARG A NE  1 
ATOM   3621 C  CZ  . ARG A  1 470 ? 6.010   25.077  26.901  1.00 111.19 ?  470  ARG A CZ  1 
ATOM   3622 N  NH1 . ARG A  1 470 ? 5.042   25.261  26.013  1.00 117.37 ?  470  ARG A NH1 1 
ATOM   3623 N  NH2 . ARG A  1 470 ? 6.673   26.125  27.372  1.00 110.30 ?  470  ARG A NH2 1 
ATOM   3624 N  N   . ILE A  1 471 ? 4.605   18.386  23.495  1.00 46.38  ?  471  ILE A N   1 
ATOM   3625 C  CA  . ILE A  1 471 ? 3.957   17.081  23.406  1.00 48.67  ?  471  ILE A CA  1 
ATOM   3626 C  C   . ILE A  1 471 ? 4.695   16.152  22.442  1.00 56.05  ?  471  ILE A C   1 
ATOM   3627 O  O   . ILE A  1 471 ? 4.904   14.966  22.723  1.00 63.93  ?  471  ILE A O   1 
ATOM   3628 C  CB  . ILE A  1 471 ? 2.487   17.243  22.992  1.00 50.28  ?  471  ILE A CB  1 
ATOM   3629 C  CG1 . ILE A  1 471 ? 1.729   17.982  24.105  1.00 54.65  ?  471  ILE A CG1 1 
ATOM   3630 C  CG2 . ILE A  1 471 ? 1.856   15.886  22.681  1.00 48.65  ?  471  ILE A CG2 1 
ATOM   3631 C  CD1 . ILE A  1 471 ? 0.282   18.258  23.803  1.00 60.96  ?  471  ILE A CD1 1 
ATOM   3632 N  N   . PHE A  1 472 ? 5.098   16.711  21.310  1.00 48.48  ?  472  PHE A N   1 
ATOM   3633 C  CA  . PHE A  1 472 ? 5.909   16.003  20.336  1.00 52.55  ?  472  PHE A CA  1 
ATOM   3634 C  C   . PHE A  1 472 ? 7.216   15.515  20.969  1.00 49.19  ?  472  PHE A C   1 
ATOM   3635 O  O   . PHE A  1 472 ? 7.588   14.345  20.830  1.00 51.56  ?  472  PHE A O   1 
ATOM   3636 C  CB  . PHE A  1 472 ? 6.181   16.928  19.144  1.00 51.00  ?  472  PHE A CB  1 
ATOM   3637 C  CG  . PHE A  1 472 ? 7.071   16.336  18.094  1.00 47.79  ?  472  PHE A CG  1 
ATOM   3638 C  CD1 . PHE A  1 472 ? 6.781   15.102  17.528  1.00 52.15  ?  472  PHE A CD1 1 
ATOM   3639 C  CD2 . PHE A  1 472 ? 8.184   17.031  17.646  1.00 41.99  ?  472  PHE A CD2 1 
ATOM   3640 C  CE1 . PHE A  1 472 ? 7.602   14.560  16.547  1.00 51.09  ?  472  PHE A CE1 1 
ATOM   3641 C  CE2 . PHE A  1 472 ? 9.006   16.500  16.662  1.00 43.32  ?  472  PHE A CE2 1 
ATOM   3642 C  CZ  . PHE A  1 472 ? 8.717   15.260  16.114  1.00 45.67  ?  472  PHE A CZ  1 
ATOM   3643 N  N   . ALA A  1 473 ? 7.900   16.409  21.676  1.00 39.09  ?  473  ALA A N   1 
ATOM   3644 C  CA  . ALA A  1 473 ? 9.142   16.045  22.359  1.00 41.91  ?  473  ALA A CA  1 
ATOM   3645 C  C   . ALA A  1 473 ? 8.941   14.838  23.276  1.00 52.65  ?  473  ALA A C   1 
ATOM   3646 O  O   . ALA A  1 473 ? 9.773   13.926  23.304  1.00 50.16  ?  473  ALA A O   1 
ATOM   3647 C  CB  . ALA A  1 473 ? 9.695   17.230  23.142  1.00 33.92  ?  473  ALA A CB  1 
ATOM   3648 N  N   . GLN A  1 474 ? 7.823   14.836  24.004  1.00 44.75  ?  474  GLN A N   1 
ATOM   3649 C  CA  . GLN A  1 474 ? 7.484   13.743  24.907  1.00 45.90  ?  474  GLN A CA  1 
ATOM   3650 C  C   . GLN A  1 474 ? 7.257   12.421  24.184  1.00 54.55  ?  474  GLN A C   1 
ATOM   3651 O  O   . GLN A  1 474 ? 7.656   11.361  24.675  1.00 58.44  ?  474  GLN A O   1 
ATOM   3652 C  CB  . GLN A  1 474 ? 6.258   14.094  25.748  1.00 41.45  ?  474  GLN A CB  1 
ATOM   3653 C  CG  . GLN A  1 474 ? 6.456   15.312  26.617  1.00 69.72  ?  474  GLN A CG  1 
ATOM   3654 C  CD  . GLN A  1 474 ? 5.314   15.526  27.576  1.00 77.26  ?  474  GLN A CD  1 
ATOM   3655 O  OE1 . GLN A  1 474 ? 4.259   16.049  27.200  1.00 77.47  ?  474  GLN A OE1 1 
ATOM   3656 N  NE2 . GLN A  1 474 ? 5.510   15.112  28.826  1.00 83.02  ?  474  GLN A NE2 1 
ATOM   3657 N  N   . ARG A  1 475 ? 6.600   12.482  23.029  1.00 56.07  ?  475  ARG A N   1 
ATOM   3658 C  CA  . ARG A  1 475 ? 6.412   11.297  22.206  1.00 54.28  ?  475  ARG A CA  1 
ATOM   3659 C  C   . ARG A  1 475 ? 7.762   10.705  21.811  1.00 48.73  ?  475  ARG A C   1 
ATOM   3660 O  O   . ARG A  1 475 ? 7.964   9.489   21.875  1.00 49.79  ?  475  ARG A O   1 
ATOM   3661 C  CB  . ARG A  1 475 ? 5.647   11.656  20.943  1.00 60.30  ?  475  ARG A CB  1 
ATOM   3662 C  CG  . ARG A  1 475 ? 4.171   11.516  21.051  1.00 63.21  ?  475  ARG A CG  1 
ATOM   3663 C  CD  . ARG A  1 475 ? 3.541   11.864  19.718  1.00 70.81  ?  475  ARG A CD  1 
ATOM   3664 N  NE  . ARG A  1 475 ? 4.027   10.997  18.650  1.00 70.46  ?  475  ARG A NE  1 
ATOM   3665 C  CZ  . ARG A  1 475 ? 4.248   11.401  17.403  1.00 61.69  ?  475  ARG A CZ  1 
ATOM   3666 N  NH1 . ARG A  1 475 ? 4.038   12.664  17.061  1.00 42.09  ?  475  ARG A NH1 1 
ATOM   3667 N  NH2 . ARG A  1 475 ? 4.689   10.539  16.504  1.00 46.88  ?  475  ARG A NH2 1 
ATOM   3668 N  N   . LEU A  1 476 ? 8.680   11.569  21.390  1.00 39.35  ?  476  LEU A N   1 
ATOM   3669 C  CA  . LEU A  1 476 ? 10.010  11.113  20.984  1.00 41.29  ?  476  LEU A CA  1 
ATOM   3670 C  C   . LEU A  1 476 ? 10.781  10.462  22.126  1.00 50.37  ?  476  LEU A C   1 
ATOM   3671 O  O   . LEU A  1 476 ? 11.410  9.421   21.932  1.00 52.29  ?  476  LEU A O   1 
ATOM   3672 C  CB  . LEU A  1 476 ? 10.834  12.260  20.408  1.00 37.58  ?  476  LEU A CB  1 
ATOM   3673 C  CG  . LEU A  1 476 ? 10.358  12.820  19.069  1.00 51.12  ?  476  LEU A CG  1 
ATOM   3674 C  CD1 . LEU A  1 476 ? 11.403  13.766  18.516  1.00 55.52  ?  476  LEU A CD1 1 
ATOM   3675 C  CD2 . LEU A  1 476 ? 10.090  11.692  18.092  1.00 51.88  ?  476  LEU A CD2 1 
ATOM   3676 N  N   . MET A  1 477 ? 10.740  11.079  23.308  1.00 50.51  ?  477  MET A N   1 
ATOM   3677 C  CA  . MET A  1 477 ? 11.426  10.523  24.469  1.00 48.04  ?  477  MET A CA  1 
ATOM   3678 C  C   . MET A  1 477 ? 10.873  9.146   24.798  1.00 45.11  ?  477  MET A C   1 
ATOM   3679 O  O   . MET A  1 477 ? 11.616  8.265   25.224  1.00 46.89  ?  477  MET A O   1 
ATOM   3680 C  CB  . MET A  1 477 ? 11.317  11.444  25.684  1.00 50.99  ?  477  MET A CB  1 
ATOM   3681 C  CG  . MET A  1 477 ? 12.019  12.773  25.503  1.00 50.66  ?  477  MET A CG  1 
ATOM   3682 S  SD  . MET A  1 477 ? 11.491  13.983  26.729  1.00 57.87  ?  477  MET A SD  1 
ATOM   3683 C  CE  . MET A  1 477 ? 12.447  13.477  28.144  1.00 46.44  ?  477  MET A CE  1 
ATOM   3684 N  N   . LYS A  1 478 ? 9.577   8.952   24.580  1.00 40.23  ?  478  LYS A N   1 
ATOM   3685 C  CA  . LYS A  1 478 ? 8.987   7.641   24.812  1.00 48.18  ?  478  LYS A CA  1 
ATOM   3686 C  C   . LYS A  1 478 ? 9.467   6.611   23.801  1.00 50.69  ?  478  LYS A C   1 
ATOM   3687 O  O   . LYS A  1 478 ? 9.746   5.480   24.177  1.00 48.43  ?  478  LYS A O   1 
ATOM   3688 C  CB  . LYS A  1 478 ? 7.457   7.682   24.844  1.00 44.10  ?  478  LYS A CB  1 
ATOM   3689 C  CG  . LYS A  1 478 ? 6.899   8.278   26.085  1.00 54.97  ?  478  LYS A CG  1 
ATOM   3690 C  CD  . LYS A  1 478 ? 5.684   7.511   26.554  1.00 66.68  ?  478  LYS A CD  1 
ATOM   3691 C  CE  . LYS A  1 478 ? 5.400   7.820   28.019  1.00 67.93  ?  478  LYS A CE  1 
ATOM   3692 N  NZ  . LYS A  1 478 ? 6.533   7.400   28.890  1.00 64.39  ?  478  LYS A NZ  1 
ATOM   3693 N  N   . TYR A  1 479 ? 9.556   6.997   22.528  1.00 53.64  ?  479  TYR A N   1 
ATOM   3694 C  CA  . TYR A  1 479 ? 10.030  6.081   21.491  1.00 47.76  ?  479  TYR A CA  1 
ATOM   3695 C  C   . TYR A  1 479 ? 11.437  5.601   21.825  1.00 43.81  ?  479  TYR A C   1 
ATOM   3696 O  O   . TYR A  1 479 ? 11.720  4.403   21.826  1.00 43.28  ?  479  TYR A O   1 
ATOM   3697 C  CB  . TYR A  1 479 ? 10.037  6.763   20.124  1.00 48.72  ?  479  TYR A CB  1 
ATOM   3698 C  CG  . TYR A  1 479 ? 8.668   6.961   19.513  1.00 48.55  ?  479  TYR A CG  1 
ATOM   3699 C  CD1 . TYR A  1 479 ? 7.681   5.994   19.642  1.00 44.85  ?  479  TYR A CD1 1 
ATOM   3700 C  CD2 . TYR A  1 479 ? 8.368   8.114   18.794  1.00 43.05  ?  479  TYR A CD2 1 
ATOM   3701 C  CE1 . TYR A  1 479 ? 6.422   6.177   19.074  1.00 48.89  ?  479  TYR A CE1 1 
ATOM   3702 C  CE2 . TYR A  1 479 ? 7.116   8.309   18.231  1.00 42.53  ?  479  TYR A CE2 1 
ATOM   3703 C  CZ  . TYR A  1 479 ? 6.146   7.340   18.366  1.00 50.62  ?  479  TYR A CZ  1 
ATOM   3704 O  OH  . TYR A  1 479 ? 4.895   7.534   17.803  1.00 58.45  ?  479  TYR A OH  1 
ATOM   3705 N  N   . TRP A  1 480 ? 12.314  6.548   22.119  1.00 32.54  ?  480  TRP A N   1 
ATOM   3706 C  CA  . TRP A  1 480 ? 13.705  6.234   22.397  1.00 45.29  ?  480  TRP A CA  1 
ATOM   3707 C  C   . TRP A  1 480 ? 13.844  5.398   23.674  1.00 50.30  ?  480  TRP A C   1 
ATOM   3708 O  O   . TRP A  1 480 ? 14.562  4.391   23.696  1.00 46.99  ?  480  TRP A O   1 
ATOM   3709 C  CB  . TRP A  1 480 ? 14.509  7.529   22.520  1.00 46.15  ?  480  TRP A CB  1 
ATOM   3710 C  CG  . TRP A  1 480 ? 15.258  7.927   21.267  1.00 48.72  ?  480  TRP A CG  1 
ATOM   3711 C  CD1 . TRP A  1 480 ? 16.604  8.132   21.149  1.00 48.37  ?  480  TRP A CD1 1 
ATOM   3712 C  CD2 . TRP A  1 480 ? 14.704  8.167   19.966  1.00 45.67  ?  480  TRP A CD2 1 
ATOM   3713 N  NE1 . TRP A  1 480 ? 16.921  8.489   19.860  1.00 42.20  ?  480  TRP A NE1 1 
ATOM   3714 C  CE2 . TRP A  1 480 ? 15.772  8.517   19.115  1.00 44.09  ?  480  TRP A CE2 1 
ATOM   3715 C  CE3 . TRP A  1 480 ? 13.410  8.115   19.438  1.00 45.39  ?  480  TRP A CE3 1 
ATOM   3716 C  CZ2 . TRP A  1 480 ? 15.584  8.811   17.769  1.00 42.42  ?  480  TRP A CZ2 1 
ATOM   3717 C  CZ3 . TRP A  1 480 ? 13.225  8.413   18.117  1.00 40.93  ?  480  TRP A CZ3 1 
ATOM   3718 C  CH2 . TRP A  1 480 ? 14.306  8.756   17.290  1.00 44.42  ?  480  TRP A CH2 1 
ATOM   3719 N  N   . THR A  1 481 ? 13.148  5.808   24.733  1.00 48.22  ?  481  THR A N   1 
ATOM   3720 C  CA  . THR A  1 481 ? 13.224  5.088   25.994  1.00 43.59  ?  481  THR A CA  1 
ATOM   3721 C  C   . THR A  1 481 ? 12.552  3.722   25.908  1.00 49.66  ?  481  THR A C   1 
ATOM   3722 O  O   . THR A  1 481 ? 13.066  2.747   26.457  1.00 52.29  ?  481  THR A O   1 
ATOM   3723 C  CB  . THR A  1 481 ? 12.654  5.902   27.158  1.00 49.90  ?  481  THR A CB  1 
ATOM   3724 O  OG1 . THR A  1 481 ? 11.310  6.299   26.856  1.00 58.06  ?  481  THR A OG1 1 
ATOM   3725 C  CG2 . THR A  1 481 ? 13.512  7.135   27.398  1.00 41.38  ?  481  THR A CG2 1 
ATOM   3726 N  N   . ASN A  1 482 ? 11.425  3.638   25.205  1.00 51.10  ?  482  ASN A N   1 
ATOM   3727 C  CA  . ASN A  1 482 ? 10.775  2.341   25.009  1.00 51.13  ?  482  ASN A CA  1 
ATOM   3728 C  C   . ASN A  1 482 ? 11.688  1.409   24.241  1.00 50.66  ?  482  ASN A C   1 
ATOM   3729 O  O   . ASN A  1 482 ? 11.734  0.204   24.514  1.00 51.83  ?  482  ASN A O   1 
ATOM   3730 C  CB  . ASN A  1 482 ? 9.439   2.466   24.273  1.00 50.90  ?  482  ASN A CB  1 
ATOM   3731 C  CG  . ASN A  1 482 ? 8.334   2.992   25.159  1.00 56.16  ?  482  ASN A CG  1 
ATOM   3732 O  OD1 . ASN A  1 482 ? 8.309   2.732   26.357  1.00 63.33  ?  482  ASN A OD1 1 
ATOM   3733 N  ND2 . ASN A  1 482 ? 7.415   3.741   24.574  1.00 62.14  ?  482  ASN A ND2 1 
ATOM   3734 N  N   . PHE A  1 483 ? 12.418  1.973   23.281  1.00 46.70  ?  483  PHE A N   1 
ATOM   3735 C  CA  . PHE A  1 483 ? 13.347  1.179   22.500  1.00 47.13  ?  483  PHE A CA  1 
ATOM   3736 C  C   . PHE A  1 483 ? 14.509  0.713   23.367  1.00 51.88  ?  483  PHE A C   1 
ATOM   3737 O  O   . PHE A  1 483 ? 14.924  -0.442  23.279  1.00 57.93  ?  483  PHE A O   1 
ATOM   3738 C  CB  . PHE A  1 483 ? 13.882  1.941   21.288  1.00 45.06  ?  483  PHE A CB  1 
ATOM   3739 C  CG  . PHE A  1 483 ? 14.959  1.191   20.555  1.00 42.23  ?  483  PHE A CG  1 
ATOM   3740 C  CD1 . PHE A  1 483 ? 14.643  0.077   19.794  1.00 38.22  ?  483  PHE A CD1 1 
ATOM   3741 C  CD2 . PHE A  1 483 ? 16.286  1.560   20.674  1.00 32.12  ?  483  PHE A CD2 1 
ATOM   3742 C  CE1 . PHE A  1 483 ? 15.634  -0.640  19.138  1.00 43.43  ?  483  PHE A CE1 1 
ATOM   3743 C  CE2 . PHE A  1 483 ? 17.279  0.854   20.021  1.00 47.57  ?  483  PHE A CE2 1 
ATOM   3744 C  CZ  . PHE A  1 483 ? 16.954  -0.250  19.247  1.00 42.80  ?  483  PHE A CZ  1 
ATOM   3745 N  N   . ALA A  1 484 ? 15.034  1.619   24.192  1.00 50.04  ?  484  ALA A N   1 
ATOM   3746 C  CA  . ALA A  1 484 ? 16.071  1.275   25.172  1.00 46.50  ?  484  ALA A CA  1 
ATOM   3747 C  C   . ALA A  1 484 ? 15.626  0.122   26.062  1.00 51.60  ?  484  ALA A C   1 
ATOM   3748 O  O   . ALA A  1 484 ? 16.379  -0.826  26.265  1.00 55.63  ?  484  ALA A O   1 
ATOM   3749 C  CB  . ALA A  1 484 ? 16.427  2.486   26.036  1.00 36.53  ?  484  ALA A CB  1 
ATOM   3750 N  N   . ARG A  1 485 ? 14.400  0.202   26.579  1.00 50.52  ?  485  ARG A N   1 
ATOM   3751 C  CA  . ARG A  1 485 ? 13.907  -0.796  27.534  1.00 55.64  ?  485  ARG A CA  1 
ATOM   3752 C  C   . ARG A  1 485 ? 13.671  -2.163  26.909  1.00 57.01  ?  485  ARG A C   1 
ATOM   3753 O  O   . ARG A  1 485 ? 13.929  -3.187  27.540  1.00 52.83  ?  485  ARG A O   1 
ATOM   3754 C  CB  . ARG A  1 485 ? 12.594  -0.356  28.191  1.00 60.42  ?  485  ARG A CB  1 
ATOM   3755 C  CG  . ARG A  1 485 ? 12.649  0.913   29.004  1.00 67.21  ?  485  ARG A CG  1 
ATOM   3756 C  CD  . ARG A  1 485 ? 11.241  1.316   29.455  1.00 71.44  ?  485  ARG A CD  1 
ATOM   3757 N  NE  . ARG A  1 485 ? 11.209  2.677   29.992  1.00 75.56  ?  485  ARG A NE  1 
ATOM   3758 C  CZ  . ARG A  1 485 ? 10.762  3.742   29.327  1.00 77.60  ?  485  ARG A CZ  1 
ATOM   3759 N  NH1 . ARG A  1 485 ? 10.286  3.623   28.090  1.00 68.78  ?  485  ARG A NH1 1 
ATOM   3760 N  NH2 . ARG A  1 485 ? 10.781  4.936   29.907  1.00 81.75  ?  485  ARG A NH2 1 
ATOM   3761 N  N   . THR A  1 486 ? 13.161  -2.180  25.679  1.00 58.42  ?  486  THR A N   1 
ATOM   3762 C  CA  . THR A  1 486 ? 12.601  -3.411  25.119  1.00 60.39  ?  486  THR A CA  1 
ATOM   3763 C  C   . THR A  1 486 ? 13.208  -3.843  23.793  1.00 60.70  ?  486  THR A C   1 
ATOM   3764 O  O   . THR A  1 486 ? 13.144  -5.022  23.431  1.00 64.59  ?  486  THR A O   1 
ATOM   3765 C  CB  . THR A  1 486 ? 11.087  -3.273  24.902  1.00 58.59  ?  486  THR A CB  1 
ATOM   3766 O  OG1 . THR A  1 486 ? 10.844  -2.307  23.872  1.00 52.35  ?  486  THR A OG1 1 
ATOM   3767 C  CG2 . THR A  1 486 ? 10.388  -2.837  26.197  1.00 47.88  ?  486  THR A CG2 1 
ATOM   3768 N  N   . GLY A  1 487 ? 13.788  -2.892  23.070  1.00 56.22  ?  487  GLY A N   1 
ATOM   3769 C  CA  . GLY A  1 487 ? 14.255  -3.152  21.724  1.00 55.66  ?  487  GLY A CA  1 
ATOM   3770 C  C   . GLY A  1 487 ? 13.169  -2.826  20.722  1.00 59.39  ?  487  GLY A C   1 
ATOM   3771 O  O   . GLY A  1 487 ? 13.271  -3.171  19.548  1.00 57.48  ?  487  GLY A O   1 
ATOM   3772 N  N   . ASP A  1 488 ? 12.136  -2.139  21.205  1.00 62.47  ?  488  ASP A N   1 
ATOM   3773 C  CA  . ASP A  1 488 ? 10.930  -1.846  20.441  1.00 56.29  ?  488  ASP A CA  1 
ATOM   3774 C  C   . ASP A  1 488 ? 10.410  -0.451  20.811  1.00 56.63  ?  488  ASP A C   1 
ATOM   3775 O  O   . ASP A  1 488 ? 10.082  -0.200  21.967  1.00 64.52  ?  488  ASP A O   1 
ATOM   3776 C  CB  . ASP A  1 488 ? 9.875   -2.907  20.757  1.00 55.07  ?  488  ASP A CB  1 
ATOM   3777 C  CG  . ASP A  1 488 ? 8.642   -2.793  19.887  1.00 58.96  ?  488  ASP A CG  1 
ATOM   3778 O  OD1 . ASP A  1 488 ? 8.471   -1.775  19.185  1.00 63.15  ?  488  ASP A OD1 1 
ATOM   3779 O  OD2 . ASP A  1 488 ? 7.828   -3.733  19.916  1.00 66.22  ?  488  ASP A OD2 1 
ATOM   3780 N  N   . PRO A  1 489 ? 10.322  0.459   19.826  1.00 61.42  ?  489  PRO A N   1 
ATOM   3781 C  CA  . PRO A  1 489 ? 9.955   1.848   20.134  1.00 57.91  ?  489  PRO A CA  1 
ATOM   3782 C  C   . PRO A  1 489 ? 8.485   2.027   20.468  1.00 60.02  ?  489  PRO A C   1 
ATOM   3783 O  O   . PRO A  1 489 ? 8.113   3.084   20.983  1.00 68.44  ?  489  PRO A O   1 
ATOM   3784 C  CB  . PRO A  1 489 ? 10.303  2.603   18.841  1.00 52.54  ?  489  PRO A CB  1 
ATOM   3785 C  CG  . PRO A  1 489 ? 10.243  1.561   17.768  1.00 56.29  ?  489  PRO A CG  1 
ATOM   3786 C  CD  . PRO A  1 489 ? 10.693  0.279   18.408  1.00 58.09  ?  489  PRO A CD  1 
ATOM   3787 N  N   . ASN A  1 490 ? 7.665   1.017   20.193  1.00 54.34  ?  490  ASN A N   1 
ATOM   3788 C  CA  . ASN A  1 490 ? 6.227   1.123   20.457  1.00 62.33  ?  490  ASN A CA  1 
ATOM   3789 C  C   . ASN A  1 490 ? 5.855   0.970   21.920  1.00 70.16  ?  490  ASN A C   1 
ATOM   3790 O  O   . ASN A  1 490 ? 6.460   0.178   22.649  1.00 65.69  ?  490  ASN A O   1 
ATOM   3791 C  CB  . ASN A  1 490 ? 5.426   0.120   19.611  1.00 64.52  ?  490  ASN A CB  1 
ATOM   3792 C  CG  . ASN A  1 490 ? 5.556   0.381   18.116  1.00 61.85  ?  490  ASN A CG  1 
ATOM   3793 O  OD1 . ASN A  1 490 ? 5.013   1.359   17.594  1.00 57.62  ?  490  ASN A OD1 1 
ATOM   3794 N  ND2 . ASN A  1 490 ? 6.282   -0.492  17.423  1.00 53.30  ?  490  ASN A ND2 1 
ATOM   3795 N  N   . ASP A  1 491 ? 4.851   1.726   22.347  1.00 84.02  ?  491  ASP A N   1 
ATOM   3796 C  CA  . ASP A  1 491 ? 4.336   1.580   23.704  1.00 92.75  ?  491  ASP A CA  1 
ATOM   3797 C  C   . ASP A  1 491 ? 3.520   0.295   23.765  1.00 100.90 ?  491  ASP A C   1 
ATOM   3798 O  O   . ASP A  1 491 ? 2.644   0.077   22.928  1.00 106.58 ?  491  ASP A O   1 
ATOM   3799 C  CB  . ASP A  1 491 ? 3.488   2.792   24.106  1.00 95.82  ?  491  ASP A CB  1 
ATOM   3800 C  CG  . ASP A  1 491 ? 3.424   2.992   25.619  1.00 105.78 ?  491  ASP A CG  1 
ATOM   3801 O  OD1 . ASP A  1 491 ? 2.979   2.065   26.337  1.00 106.18 ?  491  ASP A OD1 1 
ATOM   3802 O  OD2 . ASP A  1 491 ? 3.814   4.086   26.089  1.00 106.48 ?  491  ASP A OD2 1 
ATOM   3803 N  N   . PRO A  1 492 ? 3.829   -0.574  24.741  1.00 104.31 ?  492  PRO A N   1 
ATOM   3804 C  CA  . PRO A  1 492 ? 3.151   -1.866  24.892  1.00 107.14 ?  492  PRO A CA  1 
ATOM   3805 C  C   . PRO A  1 492 ? 1.646   -1.702  25.058  1.00 114.41 ?  492  PRO A C   1 
ATOM   3806 O  O   . PRO A  1 492 ? 0.877   -2.355  24.352  1.00 117.88 ?  492  PRO A O   1 
ATOM   3807 C  CB  . PRO A  1 492 ? 3.765   -2.432  26.174  1.00 110.48 ?  492  PRO A CB  1 
ATOM   3808 C  CG  . PRO A  1 492 ? 5.101   -1.788  26.264  1.00 109.18 ?  492  PRO A CG  1 
ATOM   3809 C  CD  . PRO A  1 492 ? 4.912   -0.402  25.725  1.00 106.12 ?  492  PRO A CD  1 
ATOM   3810 N  N   . ARG A  1 493 ? 1.236   -0.835  25.979  1.00 118.49 ?  493  ARG A N   1 
ATOM   3811 C  CA  . ARG A  1 493 ? -0.182  -0.581  26.216  1.00 122.49 ?  493  ARG A CA  1 
ATOM   3812 C  C   . ARG A  1 493 ? -0.815  0.081   25.000  1.00 127.97 ?  493  ARG A C   1 
ATOM   3813 O  O   . ARG A  1 493 ? -1.816  -0.399  24.465  1.00 134.14 ?  493  ARG A O   1 
ATOM   3814 C  CB  . ARG A  1 493 ? -0.374  0.307   27.449  1.00 116.88 ?  493  ARG A CB  1 
ATOM   3815 N  N   . ASP A  1 494 ? -0.209  1.178   24.562  1.00 123.68 ?  494  ASP A N   1 
ATOM   3816 C  CA  . ASP A  1 494 ? -0.762  2.005   23.499  1.00 126.80 ?  494  ASP A CA  1 
ATOM   3817 C  C   . ASP A  1 494 ? -0.704  1.323   22.130  1.00 133.84 ?  494  ASP A C   1 
ATOM   3818 O  O   . ASP A  1 494 ? 0.236   1.532   21.354  1.00 132.74 ?  494  ASP A O   1 
ATOM   3819 C  CB  . ASP A  1 494 ? -0.025  3.344   23.461  1.00 123.25 ?  494  ASP A CB  1 
ATOM   3820 C  CG  . ASP A  1 494 ? -0.828  4.432   22.790  1.00 124.23 ?  494  ASP A CG  1 
ATOM   3821 O  OD1 . ASP A  1 494 ? -2.053  4.248   22.618  1.00 129.42 ?  494  ASP A OD1 1 
ATOM   3822 O  OD2 . ASP A  1 494 ? -0.233  5.475   22.447  1.00 118.54 ?  494  ASP A OD2 1 
ATOM   3823 N  N   . SER A  1 495 ? -1.717  0.509   21.841  1.00 138.12 ?  495  SER A N   1 
ATOM   3824 C  CA  . SER A  1 495 ? -1.821  -0.171  20.553  1.00 134.76 ?  495  SER A CA  1 
ATOM   3825 C  C   . SER A  1 495 ? -2.803  0.551   19.635  1.00 136.59 ?  495  SER A C   1 
ATOM   3826 O  O   . SER A  1 495 ? -2.750  0.397   18.413  1.00 135.74 ?  495  SER A O   1 
ATOM   3827 C  CB  . SER A  1 495 ? -2.253  -1.626  20.744  1.00 133.41 ?  495  SER A CB  1 
ATOM   3828 O  OG  . SER A  1 495 ? -3.513  -1.698  21.388  1.00 135.60 ?  495  SER A OG  1 
ATOM   3829 N  N   . LYS A  1 496 ? -3.699  1.335   20.236  1.00 136.50 ?  496  LYS A N   1 
ATOM   3830 C  CA  . LYS A  1 496 ? -4.658  2.147   19.488  1.00 133.49 ?  496  LYS A CA  1 
ATOM   3831 C  C   . LYS A  1 496 ? -3.941  3.200   18.637  1.00 128.72 ?  496  LYS A C   1 
ATOM   3832 O  O   . LYS A  1 496 ? -4.330  3.471   17.496  1.00 126.62 ?  496  LYS A O   1 
ATOM   3833 C  CB  . LYS A  1 496 ? -5.646  2.823   20.442  1.00 130.00 ?  496  LYS A CB  1 
ATOM   3834 N  N   . SER A  1 497 ? -2.896  3.790   19.212  1.00 121.57 ?  497  SER A N   1 
ATOM   3835 C  CA  . SER A  1 497 ? -2.034  4.721   18.499  1.00 109.46 ?  497  SER A CA  1 
ATOM   3836 C  C   . SER A  1 497 ? -1.330  3.958   17.384  1.00 103.70 ?  497  SER A C   1 
ATOM   3837 O  O   . SER A  1 497 ? -1.028  2.771   17.543  1.00 104.32 ?  497  SER A O   1 
ATOM   3838 C  CB  . SER A  1 497 ? -1.006  5.318   19.462  1.00 103.76 ?  497  SER A CB  1 
ATOM   3839 O  OG  . SER A  1 497 ? -0.453  6.524   18.967  1.00 100.35 ?  497  SER A OG  1 
ATOM   3840 N  N   . PRO A  1 498 ? -1.075  4.631   16.250  1.00 95.12  ?  498  PRO A N   1 
ATOM   3841 C  CA  . PRO A  1 498 ? -0.438  3.989   15.093  1.00 84.54  ?  498  PRO A CA  1 
ATOM   3842 C  C   . PRO A  1 498 ? 0.898   3.336   15.453  1.00 74.10  ?  498  PRO A C   1 
ATOM   3843 O  O   . PRO A  1 498 ? 1.680   3.916   16.206  1.00 71.21  ?  498  PRO A O   1 
ATOM   3844 C  CB  . PRO A  1 498 ? -0.236  5.155   14.113  1.00 81.51  ?  498  PRO A CB  1 
ATOM   3845 C  CG  . PRO A  1 498 ? -0.355  6.401   14.946  1.00 82.21  ?  498  PRO A CG  1 
ATOM   3846 C  CD  . PRO A  1 498 ? -1.349  6.057   16.002  1.00 90.76  ?  498  PRO A CD  1 
ATOM   3847 N  N   . GLN A  1 499 ? 1.130   2.138   14.919  1.00 70.69  ?  499  GLN A N   1 
ATOM   3848 C  CA  . GLN A  1 499 ? 2.324   1.343   15.207  1.00 67.64  ?  499  GLN A CA  1 
ATOM   3849 C  C   . GLN A  1 499 ? 3.506   1.680   14.302  1.00 68.83  ?  499  GLN A C   1 
ATOM   3850 O  O   . GLN A  1 499 ? 3.331   2.066   13.141  1.00 67.60  ?  499  GLN A O   1 
ATOM   3851 C  CB  . GLN A  1 499 ? 2.009   -0.151  15.078  1.00 73.44  ?  499  GLN A CB  1 
ATOM   3852 C  CG  . GLN A  1 499 ? 1.002   -0.667  16.095  1.00 84.63  ?  499  GLN A CG  1 
ATOM   3853 C  CD  . GLN A  1 499 ? 1.530   -0.597  17.521  1.00 90.01  ?  499  GLN A CD  1 
ATOM   3854 O  OE1 . GLN A  1 499 ? 0.900   -0.005  18.402  1.00 97.34  ?  499  GLN A OE1 1 
ATOM   3855 N  NE2 . GLN A  1 499 ? 2.692   -1.208  17.754  1.00 82.85  ?  499  GLN A NE2 1 
ATOM   3856 N  N   . TRP A  1 500 ? 4.708   1.512   14.850  1.00 59.96  ?  500  TRP A N   1 
ATOM   3857 C  CA  . TRP A  1 500 ? 5.957   1.698   14.123  1.00 57.37  ?  500  TRP A CA  1 
ATOM   3858 C  C   . TRP A  1 500 ? 6.511   0.328   13.747  1.00 64.61  ?  500  TRP A C   1 
ATOM   3859 O  O   . TRP A  1 500 ? 7.035   -0.387  14.601  1.00 64.13  ?  500  TRP A O   1 
ATOM   3860 C  CB  . TRP A  1 500 ? 6.960   2.454   15.005  1.00 52.60  ?  500  TRP A CB  1 
ATOM   3861 C  CG  . TRP A  1 500 ? 8.279   2.832   14.365  1.00 54.27  ?  500  TRP A CG  1 
ATOM   3862 C  CD1 . TRP A  1 500 ? 8.818   2.341   13.200  1.00 53.06  ?  500  TRP A CD1 1 
ATOM   3863 C  CD2 . TRP A  1 500 ? 9.220   3.791   14.865  1.00 52.65  ?  500  TRP A CD2 1 
ATOM   3864 N  NE1 . TRP A  1 500 ? 10.038  2.936   12.955  1.00 48.99  ?  500  TRP A NE1 1 
ATOM   3865 C  CE2 . TRP A  1 500 ? 10.305  3.830   13.960  1.00 49.80  ?  500  TRP A CE2 1 
ATOM   3866 C  CE3 . TRP A  1 500 ? 9.246   4.629   15.986  1.00 44.30  ?  500  TRP A CE3 1 
ATOM   3867 C  CZ2 . TRP A  1 500 ? 11.401  4.672   14.147  1.00 45.80  ?  500  TRP A CZ2 1 
ATOM   3868 C  CZ3 . TRP A  1 500 ? 10.335  5.464   16.167  1.00 38.24  ?  500  TRP A CZ3 1 
ATOM   3869 C  CH2 . TRP A  1 500 ? 11.397  5.477   15.256  1.00 43.30  ?  500  TRP A CH2 1 
ATOM   3870 N  N   . PRO A  1 501 ? 6.409   -0.040  12.460  1.00 66.21  ?  501  PRO A N   1 
ATOM   3871 C  CA  . PRO A  1 501 ? 6.830   -1.365  11.998  1.00 59.41  ?  501  PRO A CA  1 
ATOM   3872 C  C   . PRO A  1 501 ? 8.336   -1.430  11.821  1.00 47.82  ?  501  PRO A C   1 
ATOM   3873 O  O   . PRO A  1 501 ? 8.947   -0.397  11.576  1.00 49.26  ?  501  PRO A O   1 
ATOM   3874 C  CB  . PRO A  1 501 ? 6.137   -1.488  10.642  1.00 60.09  ?  501  PRO A CB  1 
ATOM   3875 C  CG  . PRO A  1 501 ? 6.075   -0.090  10.141  1.00 65.22  ?  501  PRO A CG  1 
ATOM   3876 C  CD  . PRO A  1 501 ? 5.938   0.808   11.351  1.00 65.86  ?  501  PRO A CD  1 
ATOM   3877 N  N   . PRO A  1 502 ? 8.931   -2.625  11.967  1.00 51.61  ?  502  PRO A N   1 
ATOM   3878 C  CA  . PRO A  1 502 ? 10.362  -2.813  11.695  1.00 54.08  ?  502  PRO A CA  1 
ATOM   3879 C  C   . PRO A  1 502 ? 10.661  -2.535  10.227  1.00 52.38  ?  502  PRO A C   1 
ATOM   3880 O  O   . PRO A  1 502 ? 9.782   -2.730  9.387   1.00 59.77  ?  502  PRO A O   1 
ATOM   3881 C  CB  . PRO A  1 502 ? 10.584  -4.306  11.970  1.00 43.87  ?  502  PRO A CB  1 
ATOM   3882 C  CG  . PRO A  1 502 ? 9.463   -4.712  12.837  1.00 58.16  ?  502  PRO A CG  1 
ATOM   3883 C  CD  . PRO A  1 502 ? 8.294   -3.858  12.454  1.00 47.76  ?  502  PRO A CD  1 
ATOM   3884 N  N   . TYR A  1 503 ? 11.873  -2.088  9.926   1.00 42.33  ?  503  TYR A N   1 
ATOM   3885 C  CA  . TYR A  1 503 ? 12.309  -1.945  8.544   1.00 47.85  ?  503  TYR A CA  1 
ATOM   3886 C  C   . TYR A  1 503 ? 12.751  -3.297  8.005   1.00 53.35  ?  503  TYR A C   1 
ATOM   3887 O  O   . TYR A  1 503 ? 13.587  -3.964  8.605   1.00 50.32  ?  503  TYR A O   1 
ATOM   3888 C  CB  . TYR A  1 503 ? 13.467  -0.950  8.454   1.00 43.40  ?  503  TYR A CB  1 
ATOM   3889 C  CG  . TYR A  1 503 ? 13.992  -0.730  7.052   1.00 47.80  ?  503  TYR A CG  1 
ATOM   3890 C  CD1 . TYR A  1 503 ? 13.454  0.250   6.235   1.00 56.94  ?  503  TYR A CD1 1 
ATOM   3891 C  CD2 . TYR A  1 503 ? 15.041  -1.495  6.547   1.00 53.34  ?  503  TYR A CD2 1 
ATOM   3892 C  CE1 . TYR A  1 503 ? 13.942  0.462   4.947   1.00 59.60  ?  503  TYR A CE1 1 
ATOM   3893 C  CE2 . TYR A  1 503 ? 15.534  -1.291  5.269   1.00 52.25  ?  503  TYR A CE2 1 
ATOM   3894 C  CZ  . TYR A  1 503 ? 14.979  -0.312  4.474   1.00 57.55  ?  503  TYR A CZ  1 
ATOM   3895 O  OH  . TYR A  1 503 ? 15.453  -0.112  3.198   1.00 67.16  ?  503  TYR A OH  1 
ATOM   3896 N  N   . THR A  1 504 ? 12.192  -3.710  6.873   1.00 59.41  ?  504  THR A N   1 
ATOM   3897 C  CA  . THR A  1 504 ? 12.633  -4.950  6.241   1.00 64.04  ?  504  THR A CA  1 
ATOM   3898 C  C   . THR A  1 504 ? 13.067  -4.753  4.802   1.00 67.67  ?  504  THR A C   1 
ATOM   3899 O  O   . THR A  1 504 ? 12.759  -3.741  4.184   1.00 71.08  ?  504  THR A O   1 
ATOM   3900 C  CB  . THR A  1 504 ? 11.546  -6.019  6.275   1.00 62.71  ?  504  THR A CB  1 
ATOM   3901 O  OG1 . THR A  1 504 ? 10.385  -5.552  5.571   1.00 67.64  ?  504  THR A OG1 1 
ATOM   3902 C  CG2 . THR A  1 504 ? 11.187  -6.340  7.715   1.00 55.35  ?  504  THR A CG2 1 
ATOM   3903 N  N   . THR A  1 505 ? 13.785  -5.729  4.268   1.00 64.50  ?  505  THR A N   1 
ATOM   3904 C  CA  . THR A  1 505 ? 14.205  -5.649  2.884   1.00 69.02  ?  505  THR A CA  1 
ATOM   3905 C  C   . THR A  1 505 ? 12.992  -5.755  1.966   1.00 69.29  ?  505  THR A C   1 
ATOM   3906 O  O   . THR A  1 505 ? 12.915  -5.078  0.946   1.00 71.03  ?  505  THR A O   1 
ATOM   3907 C  CB  . THR A  1 505 ? 15.243  -6.733  2.539   1.00 69.23  ?  505  THR A CB  1 
ATOM   3908 O  OG1 . THR A  1 505 ? 14.725  -8.022  2.880   1.00 70.72  ?  505  THR A OG1 1 
ATOM   3909 C  CG2 . THR A  1 505 ? 16.526  -6.489  3.317   1.00 61.44  ?  505  THR A CG2 1 
ATOM   3910 N  N   . ALA A  1 506 ? 12.031  -6.584  2.353   1.00 66.73  ?  506  ALA A N   1 
ATOM   3911 C  CA  . ALA A  1 506 ? 10.862  -6.825  1.519   1.00 71.66  ?  506  ALA A CA  1 
ATOM   3912 C  C   . ALA A  1 506 ? 9.928   -5.623  1.440   1.00 74.93  ?  506  ALA A C   1 
ATOM   3913 O  O   . ALA A  1 506 ? 9.393   -5.317  0.372   1.00 81.92  ?  506  ALA A O   1 
ATOM   3914 C  CB  . ALA A  1 506 ? 10.102  -8.056  2.006   1.00 77.51  ?  506  ALA A CB  1 
ATOM   3915 N  N   . ALA A  1 507 ? 9.722   -4.940  2.561   1.00 69.82  ?  507  ALA A N   1 
ATOM   3916 C  CA  . ALA A  1 507 ? 8.739   -3.859  2.587   1.00 65.96  ?  507  ALA A CA  1 
ATOM   3917 C  C   . ALA A  1 507 ? 9.349   -2.466  2.767   1.00 60.49  ?  507  ALA A C   1 
ATOM   3918 O  O   . ALA A  1 507 ? 8.704   -1.461  2.464   1.00 59.35  ?  507  ALA A O   1 
ATOM   3919 C  CB  . ALA A  1 507 ? 7.657   -4.132  3.628   1.00 61.27  ?  507  ALA A CB  1 
ATOM   3920 N  N   . GLN A  1 508 ? 10.581  -2.413  3.260   1.00 50.23  ?  508  GLN A N   1 
ATOM   3921 C  CA  . GLN A  1 508 ? 11.335  -1.155  3.314   1.00 58.57  ?  508  GLN A CA  1 
ATOM   3922 C  C   . GLN A  1 508 ? 10.593  -0.033  4.051   1.00 52.28  ?  508  GLN A C   1 
ATOM   3923 O  O   . GLN A  1 508 ? 10.734  1.151   3.728   1.00 50.53  ?  508  GLN A O   1 
ATOM   3924 C  CB  . GLN A  1 508 ? 11.749  -0.707  1.904   1.00 48.07  ?  508  GLN A CB  1 
ATOM   3925 C  CG  . GLN A  1 508 ? 12.518  -1.763  1.104   1.00 58.67  ?  508  GLN A CG  1 
ATOM   3926 C  CD  . GLN A  1 508 ? 12.946  -1.271  -0.292  1.00 64.20  ?  508  GLN A CD  1 
ATOM   3927 O  OE1 . GLN A  1 508 ? 13.747  -0.346  -0.419  1.00 66.14  ?  508  GLN A OE1 1 
ATOM   3928 N  NE2 . GLN A  1 508 ? 12.404  -1.890  -1.332  1.00 61.25  ?  508  GLN A NE2 1 
ATOM   3929 N  N   . GLN A  1 509 ? 9.808   -0.423  5.051   1.00 49.29  ?  509  GLN A N   1 
ATOM   3930 C  CA  . GLN A  1 509 ? 9.008   0.522   5.820   1.00 48.68  ?  509  GLN A CA  1 
ATOM   3931 C  C   . GLN A  1 509 ? 9.809   1.377   6.788   1.00 51.29  ?  509  GLN A C   1 
ATOM   3932 O  O   . GLN A  1 509 ? 10.722  0.890   7.454   1.00 48.52  ?  509  GLN A O   1 
ATOM   3933 C  CB  . GLN A  1 509 ? 7.900   -0.212  6.575   1.00 47.36  ?  509  GLN A CB  1 
ATOM   3934 C  CG  . GLN A  1 509 ? 6.670   -0.427  5.741   1.00 60.04  ?  509  GLN A CG  1 
ATOM   3935 C  CD  . GLN A  1 509 ? 5.708   -1.394  6.373   1.00 62.10  ?  509  GLN A CD  1 
ATOM   3936 O  OE1 . GLN A  1 509 ? 6.124   -2.371  6.988   1.00 60.69  ?  509  GLN A OE1 1 
ATOM   3937 N  NE2 . GLN A  1 509 ? 4.409   -1.134  6.221   1.00 60.10  ?  509  GLN A NE2 1 
ATOM   3938 N  N   . TYR A  1 510 ? 9.455   2.659   6.846   1.00 50.97  ?  510  TYR A N   1 
ATOM   3939 C  CA  . TYR A  1 510 ? 9.945   3.562   7.879   1.00 46.44  ?  510  TYR A CA  1 
ATOM   3940 C  C   . TYR A  1 510 ? 8.817   4.513   8.298   1.00 53.43  ?  510  TYR A C   1 
ATOM   3941 O  O   . TYR A  1 510 ? 7.781   4.560   7.637   1.00 71.75  ?  510  TYR A O   1 
ATOM   3942 C  CB  . TYR A  1 510 ? 11.159  4.332   7.376   1.00 37.20  ?  510  TYR A CB  1 
ATOM   3943 C  CG  . TYR A  1 510 ? 10.883  5.308   6.249   1.00 40.48  ?  510  TYR A CG  1 
ATOM   3944 C  CD1 . TYR A  1 510 ? 10.779  4.875   4.922   1.00 46.94  ?  510  TYR A CD1 1 
ATOM   3945 C  CD2 . TYR A  1 510 ? 10.768  6.670   6.504   1.00 37.57  ?  510  TYR A CD2 1 
ATOM   3946 C  CE1 . TYR A  1 510 ? 10.544  5.781   3.884   1.00 48.21  ?  510  TYR A CE1 1 
ATOM   3947 C  CE2 . TYR A  1 510 ? 10.532  7.575   5.482   1.00 51.13  ?  510  TYR A CE2 1 
ATOM   3948 C  CZ  . TYR A  1 510 ? 10.422  7.135   4.172   1.00 56.15  ?  510  TYR A CZ  1 
ATOM   3949 O  OH  . TYR A  1 510 ? 10.187  8.066   3.171   1.00 57.85  ?  510  TYR A OH  1 
ATOM   3950 N  N   . VAL A  1 511 ? 8.993   5.257   9.389   1.00 41.02  ?  511  VAL A N   1 
ATOM   3951 C  CA  . VAL A  1 511 ? 7.974   6.231   9.797   1.00 41.46  ?  511  VAL A CA  1 
ATOM   3952 C  C   . VAL A  1 511 ? 8.440   7.677   9.667   1.00 40.04  ?  511  VAL A C   1 
ATOM   3953 O  O   . VAL A  1 511 ? 9.625   7.976   9.774   1.00 37.13  ?  511  VAL A O   1 
ATOM   3954 C  CB  . VAL A  1 511 ? 7.518   6.045   11.263  1.00 46.72  ?  511  VAL A CB  1 
ATOM   3955 C  CG1 . VAL A  1 511 ? 6.729   4.753   11.445  1.00 48.53  ?  511  VAL A CG1 1 
ATOM   3956 C  CG2 . VAL A  1 511 ? 8.718   6.117   12.213  1.00 46.04  ?  511  VAL A CG2 1 
ATOM   3957 N  N   . SER A  1 512 ? 7.493   8.580   9.464   1.00 39.53  ?  512  SER A N   1 
ATOM   3958 C  CA  . SER A  1 512 ? 7.784   9.999   9.561   1.00 46.39  ?  512  SER A CA  1 
ATOM   3959 C  C   . SER A  1 512 ? 7.590   10.448  10.999  1.00 58.29  ?  512  SER A C   1 
ATOM   3960 O  O   . SER A  1 512 ? 6.584   10.118  11.628  1.00 62.69  ?  512  SER A O   1 
ATOM   3961 C  CB  . SER A  1 512 ? 6.857   10.800  8.656   1.00 47.27  ?  512  SER A CB  1 
ATOM   3962 O  OG  . SER A  1 512 ? 5.501   10.602  9.016   1.00 52.45  ?  512  SER A OG  1 
ATOM   3963 N  N   . LEU A  1 513 ? 8.561   11.191  11.521  1.00 55.51  ?  513  LEU A N   1 
ATOM   3964 C  CA  . LEU A  1 513 ? 8.428   11.811  12.834  1.00 46.78  ?  513  LEU A CA  1 
ATOM   3965 C  C   . LEU A  1 513 ? 8.159   13.326  12.717  1.00 45.09  ?  513  LEU A C   1 
ATOM   3966 O  O   . LEU A  1 513 ? 9.079   14.110  12.471  1.00 40.62  ?  513  LEU A O   1 
ATOM   3967 C  CB  . LEU A  1 513 ? 9.678   11.545  13.686  1.00 42.88  ?  513  LEU A CB  1 
ATOM   3968 C  CG  . LEU A  1 513 ? 10.033  10.093  14.041  1.00 40.47  ?  513  LEU A CG  1 
ATOM   3969 C  CD1 . LEU A  1 513 ? 11.400  10.011  14.709  1.00 32.79  ?  513  LEU A CD1 1 
ATOM   3970 C  CD2 . LEU A  1 513 ? 8.980   9.491   14.953  1.00 43.84  ?  513  LEU A CD2 1 
ATOM   3971 N  N   . ASN A  1 514 ? 6.898   13.725  12.885  1.00 50.17  ?  514  ASN A N   1 
ATOM   3972 C  CA  . ASN A  1 514 ? 6.523   15.142  12.951  1.00 56.44  ?  514  ASN A CA  1 
ATOM   3973 C  C   . ASN A  1 514 ? 5.374   15.390  13.931  1.00 60.07  ?  514  ASN A C   1 
ATOM   3974 O  O   . ASN A  1 514 ? 4.940   14.477  14.629  1.00 59.61  ?  514  ASN A O   1 
ATOM   3975 C  CB  . ASN A  1 514 ? 6.134   15.664  11.566  1.00 57.43  ?  514  ASN A CB  1 
ATOM   3976 C  CG  . ASN A  1 514 ? 5.218   14.715  10.831  1.00 60.73  ?  514  ASN A CG  1 
ATOM   3977 O  OD1 . ASN A  1 514 ? 4.109   14.439  11.281  1.00 58.46  ?  514  ASN A OD1 1 
ATOM   3978 N  ND2 . ASN A  1 514 ? 5.677   14.203  9.692   1.00 65.36  ?  514  ASN A ND2 1 
ATOM   3979 N  N   . LEU A  1 515 ? 4.864   16.620  13.954  1.00 59.00  ?  515  LEU A N   1 
ATOM   3980 C  CA  . LEU A  1 515 ? 3.767   16.997  14.847  1.00 56.19  ?  515  LEU A CA  1 
ATOM   3981 C  C   . LEU A  1 515 ? 2.511   16.138  14.674  1.00 64.82  ?  515  LEU A C   1 
ATOM   3982 O  O   . LEU A  1 515 ? 1.637   16.127  15.542  1.00 73.66  ?  515  LEU A O   1 
ATOM   3983 C  CB  . LEU A  1 515 ? 3.396   18.468  14.647  1.00 52.39  ?  515  LEU A CB  1 
ATOM   3984 C  CG  . LEU A  1 515 ? 4.493   19.499  14.880  1.00 52.77  ?  515  LEU A CG  1 
ATOM   3985 C  CD1 . LEU A  1 515 ? 3.932   20.898  14.752  1.00 49.15  ?  515  LEU A CD1 1 
ATOM   3986 C  CD2 . LEU A  1 515 ? 5.110   19.291  16.249  1.00 56.90  ?  515  LEU A CD2 1 
ATOM   3987 N  N   . LYS A  1 516 ? 2.418   15.435  13.550  1.00 61.74  ?  516  LYS A N   1 
ATOM   3988 C  CA  . LYS A  1 516 ? 1.286   14.553  13.272  1.00 59.27  ?  516  LYS A CA  1 
ATOM   3989 C  C   . LYS A  1 516 ? 1.563   13.116  13.730  1.00 56.88  ?  516  LYS A C   1 
ATOM   3990 O  O   . LYS A  1 516 ? 2.713   12.730  13.935  1.00 45.48  ?  516  LYS A O   1 
ATOM   3991 C  CB  . LYS A  1 516 ? 0.957   14.593  11.780  1.00 56.78  ?  516  LYS A CB  1 
ATOM   3992 C  CG  . LYS A  1 516 ? 0.433   15.942  11.313  1.00 67.39  ?  516  LYS A CG  1 
ATOM   3993 C  CD  . LYS A  1 516 ? 0.754   16.218  9.837   1.00 78.02  ?  516  LYS A CD  1 
ATOM   3994 C  CE  . LYS A  1 516 ? -0.073  15.369  8.877   1.00 84.08  ?  516  LYS A CE  1 
ATOM   3995 N  NZ  . LYS A  1 516 ? 0.113   15.800  7.447   1.00 89.31  ?  516  LYS A NZ  1 
ATOM   3996 N  N   . PRO A  1 517 ? 0.503   12.319  13.916  1.00 62.28  ?  517  PRO A N   1 
ATOM   3997 C  CA  . PRO A  1 517 ? 0.735   10.925  14.310  1.00 65.83  ?  517  PRO A CA  1 
ATOM   3998 C  C   . PRO A  1 517 ? 1.591   10.176  13.295  1.00 61.39  ?  517  PRO A C   1 
ATOM   3999 O  O   . PRO A  1 517 ? 1.559   10.511  12.106  1.00 56.70  ?  517  PRO A O   1 
ATOM   4000 C  CB  . PRO A  1 517 ? -0.677  10.334  14.344  1.00 66.98  ?  517  PRO A CB  1 
ATOM   4001 C  CG  . PRO A  1 517 ? -1.552  11.494  14.626  1.00 66.88  ?  517  PRO A CG  1 
ATOM   4002 C  CD  . PRO A  1 517 ? -0.930  12.657  13.906  1.00 63.67  ?  517  PRO A CD  1 
ATOM   4003 N  N   . LEU A  1 518 ? 2.342   9.188   13.781  1.00 58.38  ?  518  LEU A N   1 
ATOM   4004 C  CA  . LEU A  1 518 ? 3.187   8.319   12.963  1.00 58.10  ?  518  LEU A CA  1 
ATOM   4005 C  C   . LEU A  1 518 ? 2.573   7.909   11.632  1.00 58.87  ?  518  LEU A C   1 
ATOM   4006 O  O   . LEU A  1 518 ? 1.536   7.241   11.590  1.00 56.34  ?  518  LEU A O   1 
ATOM   4007 C  CB  . LEU A  1 518 ? 3.523   7.041   13.727  1.00 55.92  ?  518  LEU A CB  1 
ATOM   4008 C  CG  . LEU A  1 518 ? 4.709   7.038   14.676  1.00 54.34  ?  518  LEU A CG  1 
ATOM   4009 C  CD1 . LEU A  1 518 ? 5.080   5.596   14.960  1.00 57.88  ?  518  LEU A CD1 1 
ATOM   4010 C  CD2 . LEU A  1 518 ? 5.879   7.804   14.094  1.00 50.24  ?  518  LEU A CD2 1 
ATOM   4011 N  N   . GLU A  1 519 ? 3.231   8.298   10.548  1.00 58.74  ?  519  GLU A N   1 
ATOM   4012 C  CA  . GLU A  1 519 ? 2.828   7.872   9.214   1.00 59.13  ?  519  GLU A CA  1 
ATOM   4013 C  C   . GLU A  1 519 ? 3.870   6.901   8.675   1.00 50.46  ?  519  GLU A C   1 
ATOM   4014 O  O   . GLU A  1 519 ? 5.055   7.191   8.689   1.00 52.03  ?  519  GLU A O   1 
ATOM   4015 C  CB  . GLU A  1 519 ? 2.668   9.086   8.298   1.00 66.03  ?  519  GLU A CB  1 
ATOM   4016 C  CG  . GLU A  1 519 ? 2.754   8.767   6.821   1.00 83.30  ?  519  GLU A CG  1 
ATOM   4017 C  CD  . GLU A  1 519 ? 2.401   9.956   5.941   1.00 90.65  ?  519  GLU A CD  1 
ATOM   4018 O  OE1 . GLU A  1 519 ? 1.308   10.535  6.132   1.00 98.06  ?  519  GLU A OE1 1 
ATOM   4019 O  OE2 . GLU A  1 519 ? 3.214   10.304  5.057   1.00 83.68  ?  519  GLU A OE2 1 
ATOM   4020 N  N   . VAL A  1 520 ? 3.429   5.733   8.231   1.00 54.35  ?  520  VAL A N   1 
ATOM   4021 C  CA  . VAL A  1 520 ? 4.338   4.731   7.681   1.00 58.05  ?  520  VAL A CA  1 
ATOM   4022 C  C   . VAL A  1 520 ? 4.547   4.926   6.177   1.00 60.62  ?  520  VAL A C   1 
ATOM   4023 O  O   . VAL A  1 520 ? 3.586   5.058   5.414   1.00 59.54  ?  520  VAL A O   1 
ATOM   4024 C  CB  . VAL A  1 520 ? 3.805   3.310   7.948   1.00 59.66  ?  520  VAL A CB  1 
ATOM   4025 C  CG1 . VAL A  1 520 ? 4.585   2.264   7.154   1.00 50.99  ?  520  VAL A CG1 1 
ATOM   4026 C  CG2 . VAL A  1 520 ? 3.843   3.015   9.435   1.00 55.65  ?  520  VAL A CG2 1 
ATOM   4027 N  N   . ARG A  1 521 ? 5.809   4.947   5.762   1.00 57.35  ?  521  ARG A N   1 
ATOM   4028 C  CA  . ARG A  1 521 ? 6.167   5.121   4.362   1.00 53.09  ?  521  ARG A CA  1 
ATOM   4029 C  C   . ARG A  1 521 ? 7.019   3.953   3.894   1.00 57.38  ?  521  ARG A C   1 
ATOM   4030 O  O   . ARG A  1 521 ? 7.560   3.218   4.714   1.00 63.18  ?  521  ARG A O   1 
ATOM   4031 C  CB  . ARG A  1 521 ? 6.925   6.434   4.175   1.00 48.47  ?  521  ARG A CB  1 
ATOM   4032 C  CG  . ARG A  1 521 ? 6.076   7.642   4.470   1.00 46.54  ?  521  ARG A CG  1 
ATOM   4033 C  CD  . ARG A  1 521 ? 6.874   8.909   4.400   1.00 43.78  ?  521  ARG A CD  1 
ATOM   4034 N  NE  . ARG A  1 521 ? 6.089   10.052  4.850   1.00 44.23  ?  521  ARG A NE  1 
ATOM   4035 C  CZ  . ARG A  1 521 ? 6.616   11.235  5.153   1.00 47.02  ?  521  ARG A CZ  1 
ATOM   4036 N  NH1 . ARG A  1 521 ? 7.923   11.424  5.043   1.00 42.12  ?  521  ARG A NH1 1 
ATOM   4037 N  NH2 . ARG A  1 521 ? 5.843   12.228  5.569   1.00 53.44  ?  521  ARG A NH2 1 
ATOM   4038 N  N   . ARG A  1 522 ? 7.136   3.777   2.582   1.00 52.20  ?  522  ARG A N   1 
ATOM   4039 C  CA  . ARG A  1 522 ? 7.952   2.697   2.040   1.00 58.28  ?  522  ARG A CA  1 
ATOM   4040 C  C   . ARG A  1 522 ? 9.105   3.225   1.181   1.00 63.09  ?  522  ARG A C   1 
ATOM   4041 O  O   . ARG A  1 522 ? 8.937   4.136   0.370   1.00 63.39  ?  522  ARG A O   1 
ATOM   4042 C  CB  . ARG A  1 522 ? 7.094   1.713   1.232   1.00 61.73  ?  522  ARG A CB  1 
ATOM   4043 C  CG  . ARG A  1 522 ? 6.043   0.954   2.049   1.00 69.33  ?  522  ARG A CG  1 
ATOM   4044 C  CD  . ARG A  1 522 ? 5.495   -0.263  1.295   1.00 74.84  ?  522  ARG A CD  1 
ATOM   4045 N  NE  . ARG A  1 522 ? 6.569   -1.053  0.682   1.00 89.73  ?  522  ARG A NE  1 
ATOM   4046 C  CZ  . ARG A  1 522 ? 6.569   -1.493  -0.579  1.00 93.69  ?  522  ARG A CZ  1 
ATOM   4047 N  NH1 . ARG A  1 522 ? 5.541   -1.233  -1.381  1.00 86.74  ?  522  ARG A NH1 1 
ATOM   4048 N  NH2 . ARG A  1 522 ? 7.599   -2.198  -1.041  1.00 93.64  ?  522  ARG A NH2 1 
ATOM   4049 N  N   . GLY A  1 523 ? 10.282  2.646   1.368   1.00 58.87  ?  523  GLY A N   1 
ATOM   4050 C  CA  . GLY A  1 523 ? 11.429  2.999   0.559   1.00 50.84  ?  523  GLY A CA  1 
ATOM   4051 C  C   . GLY A  1 523 ? 12.149  4.243   1.021   1.00 56.48  ?  523  GLY A C   1 
ATOM   4052 O  O   . GLY A  1 523 ? 11.600  5.342   1.016   1.00 67.12  ?  523  GLY A O   1 
ATOM   4053 N  N   . LEU A  1 524 ? 13.402  4.054   1.408   1.00 49.58  ?  524  LEU A N   1 
ATOM   4054 C  CA  . LEU A  1 524 ? 14.230  5.125   1.917   1.00 48.81  ?  524  LEU A CA  1 
ATOM   4055 C  C   . LEU A  1 524 ? 15.050  5.727   0.790   1.00 45.52  ?  524  LEU A C   1 
ATOM   4056 O  O   . LEU A  1 524 ? 16.137  5.228   0.503   1.00 51.42  ?  524  LEU A O   1 
ATOM   4057 C  CB  . LEU A  1 524 ? 15.165  4.551   2.976   1.00 48.87  ?  524  LEU A CB  1 
ATOM   4058 C  CG  . LEU A  1 524 ? 14.962  5.157   4.353   1.00 65.83  ?  524  LEU A CG  1 
ATOM   4059 C  CD1 . LEU A  1 524 ? 15.506  4.237   5.440   1.00 67.95  ?  524  LEU A CD1 1 
ATOM   4060 C  CD2 . LEU A  1 524 ? 15.632  6.522   4.381   1.00 69.38  ?  524  LEU A CD2 1 
ATOM   4061 N  N   . ARG A  1 525 ? 14.546  6.801   0.179   1.00 43.97  ?  525  ARG A N   1 
ATOM   4062 C  CA  . ARG A  1 525 ? 15.113  7.338   -1.071  1.00 56.69  ?  525  ARG A CA  1 
ATOM   4063 C  C   . ARG A  1 525 ? 15.539  6.210   -1.995  1.00 53.78  ?  525  ARG A C   1 
ATOM   4064 O  O   . ARG A  1 525 ? 16.685  6.173   -2.438  1.00 56.67  ?  525  ARG A O   1 
ATOM   4065 C  CB  . ARG A  1 525 ? 16.338  8.212   -0.795  1.00 55.31  ?  525  ARG A CB  1 
ATOM   4066 C  CG  . ARG A  1 525 ? 16.023  9.489   -0.090  1.00 57.56  ?  525  ARG A CG  1 
ATOM   4067 C  CD  . ARG A  1 525 ? 15.717  10.617  -1.038  1.00 57.66  ?  525  ARG A CD  1 
ATOM   4068 N  NE  . ARG A  1 525 ? 15.152  11.725  -0.277  1.00 65.68  ?  525  ARG A NE  1 
ATOM   4069 C  CZ  . ARG A  1 525 ? 15.878  12.656  0.336   1.00 71.68  ?  525  ARG A CZ  1 
ATOM   4070 N  NH1 . ARG A  1 525 ? 17.201  12.630  0.248   1.00 71.61  ?  525  ARG A NH1 1 
ATOM   4071 N  NH2 . ARG A  1 525 ? 15.282  13.625  1.025   1.00 77.23  ?  525  ARG A NH2 1 
ATOM   4072 N  N   . ALA A  1 526 ? 14.630  5.275   -2.243  1.00 48.42  ?  526  ALA A N   1 
ATOM   4073 C  CA  . ALA A  1 526 ? 15.003  3.992   -2.823  1.00 46.55  ?  526  ALA A CA  1 
ATOM   4074 C  C   . ALA A  1 526 ? 15.719  4.150   -4.169  1.00 52.25  ?  526  ALA A C   1 
ATOM   4075 O  O   . ALA A  1 526 ? 16.798  3.602   -4.364  1.00 58.72  ?  526  ALA A O   1 
ATOM   4076 C  CB  . ALA A  1 526 ? 13.776  3.092   -2.947  1.00 46.19  ?  526  ALA A CB  1 
ATOM   4077 N  N   . GLN A  1 527 ? 15.142  4.930   -5.077  1.00 50.33  ?  527  GLN A N   1 
ATOM   4078 C  CA  . GLN A  1 527 ? 15.726  5.089   -6.408  1.00 54.26  ?  527  GLN A CA  1 
ATOM   4079 C  C   . GLN A  1 527 ? 17.073  5.833   -6.404  1.00 54.39  ?  527  GLN A C   1 
ATOM   4080 O  O   . GLN A  1 527 ? 18.067  5.335   -6.940  1.00 58.38  ?  527  GLN A O   1 
ATOM   4081 C  CB  . GLN A  1 527 ? 14.724  5.741   -7.368  1.00 52.60  ?  527  GLN A CB  1 
ATOM   4082 C  CG  . GLN A  1 527 ? 14.651  5.071   -8.715  1.00 60.29  ?  527  GLN A CG  1 
ATOM   4083 C  CD  . GLN A  1 527 ? 14.054  3.672   -8.675  1.00 64.50  ?  527  GLN A CD  1 
ATOM   4084 O  OE1 . GLN A  1 527 ? 13.359  3.298   -7.728  1.00 65.46  ?  527  GLN A OE1 1 
ATOM   4085 N  NE2 . GLN A  1 527 ? 14.312  2.895   -9.723  1.00 66.74  ?  527  GLN A NE2 1 
ATOM   4086 N  N   . THR A  1 528 ? 17.110  7.012   -5.794  1.00 43.76  ?  528  THR A N   1 
ATOM   4087 C  CA  . THR A  1 528 ? 18.348  7.779   -5.710  1.00 42.04  ?  528  THR A CA  1 
ATOM   4088 C  C   . THR A  1 528 ? 19.469  6.993   -5.015  1.00 55.04  ?  528  THR A C   1 
ATOM   4089 O  O   . THR A  1 528 ? 20.628  7.060   -5.427  1.00 67.97  ?  528  THR A O   1 
ATOM   4090 C  CB  . THR A  1 528 ? 18.107  9.115   -4.980  1.00 44.69  ?  528  THR A CB  1 
ATOM   4091 O  OG1 . THR A  1 528 ? 17.473  10.035  -5.869  1.00 39.88  ?  528  THR A OG1 1 
ATOM   4092 C  CG2 . THR A  1 528 ? 19.411  9.727   -4.469  1.00 40.50  ?  528  THR A CG2 1 
ATOM   4093 N  N   . CYS A  1 529 ? 19.134  6.238   -3.970  1.00 43.82  ?  529  CYS A N   1 
ATOM   4094 C  CA  . CYS A  1 529 ? 20.168  5.492   -3.234  1.00 43.96  ?  529  CYS A CA  1 
ATOM   4095 C  C   . CYS A  1 529 ? 20.687  4.281   -4.010  1.00 48.15  ?  529  CYS A C   1 
ATOM   4096 O  O   . CYS A  1 529 ? 21.805  3.827   -3.794  1.00 50.36  ?  529  CYS A O   1 
ATOM   4097 C  CB  . CYS A  1 529 ? 19.705  5.119   -1.818  1.00 38.33  ?  529  CYS A CB  1 
ATOM   4098 S  SG  . CYS A  1 529 ? 19.703  6.577   -0.705  1.00 61.87  ?  529  CYS A SG  1 
ATOM   4099 N  N   . ALA A  1 530 ? 19.883  3.780   -4.937  1.00 51.38  ?  530  ALA A N   1 
ATOM   4100 C  CA  . ALA A  1 530 ? 20.369  2.786   -5.883  1.00 48.27  ?  530  ALA A CA  1 
ATOM   4101 C  C   . ALA A  1 530 ? 21.513  3.372   -6.706  1.00 52.81  ?  530  ALA A C   1 
ATOM   4102 O  O   . ALA A  1 530 ? 22.488  2.683   -7.003  1.00 57.98  ?  530  ALA A O   1 
ATOM   4103 C  CB  . ALA A  1 530 ? 19.259  2.331   -6.774  1.00 46.47  ?  530  ALA A CB  1 
ATOM   4104 N  N   . PHE A  1 531 ? 21.398  4.652   -7.055  1.00 46.92  ?  531  PHE A N   1 
ATOM   4105 C  CA  . PHE A  1 531 ? 22.468  5.360   -7.765  1.00 48.01  ?  531  PHE A CA  1 
ATOM   4106 C  C   . PHE A  1 531 ? 23.786  5.413   -6.981  1.00 50.52  ?  531  PHE A C   1 
ATOM   4107 O  O   . PHE A  1 531 ? 24.844  5.023   -7.505  1.00 45.97  ?  531  PHE A O   1 
ATOM   4108 C  CB  . PHE A  1 531 ? 22.010  6.778   -8.139  1.00 54.69  ?  531  PHE A CB  1 
ATOM   4109 C  CG  . PHE A  1 531 ? 23.111  7.672   -8.637  1.00 51.08  ?  531  PHE A CG  1 
ATOM   4110 C  CD1 . PHE A  1 531 ? 23.524  7.614   -9.954  1.00 47.07  ?  531  PHE A CD1 1 
ATOM   4111 C  CD2 . PHE A  1 531 ? 23.722  8.580   -7.786  1.00 54.13  ?  531  PHE A CD2 1 
ATOM   4112 C  CE1 . PHE A  1 531 ? 24.529  8.436   -10.421 1.00 52.41  ?  531  PHE A CE1 1 
ATOM   4113 C  CE2 . PHE A  1 531 ? 24.733  9.404   -8.244  1.00 60.60  ?  531  PHE A CE2 1 
ATOM   4114 C  CZ  . PHE A  1 531 ? 25.131  9.337   -9.567  1.00 62.86  ?  531  PHE A CZ  1 
ATOM   4115 N  N   . TRP A  1 532 ? 23.717  5.900   -5.740  1.00 40.54  ?  532  TRP A N   1 
ATOM   4116 C  CA  . TRP A  1 532 ? 24.908  6.047   -4.908  1.00 44.47  ?  532  TRP A CA  1 
ATOM   4117 C  C   . TRP A  1 532 ? 25.431  4.710   -4.434  1.00 50.34  ?  532  TRP A C   1 
ATOM   4118 O  O   . TRP A  1 532 ? 26.636  4.480   -4.412  1.00 54.69  ?  532  TRP A O   1 
ATOM   4119 C  CB  . TRP A  1 532 ? 24.625  6.897   -3.660  1.00 40.96  ?  532  TRP A CB  1 
ATOM   4120 C  CG  . TRP A  1 532 ? 24.251  8.304   -3.953  1.00 44.74  ?  532  TRP A CG  1 
ATOM   4121 C  CD1 . TRP A  1 532 ? 22.988  8.816   -4.039  1.00 46.07  ?  532  TRP A CD1 1 
ATOM   4122 C  CD2 . TRP A  1 532 ? 25.143  9.388   -4.204  1.00 39.60  ?  532  TRP A CD2 1 
ATOM   4123 N  NE1 . TRP A  1 532 ? 23.042  10.155  -4.327  1.00 44.31  ?  532  TRP A NE1 1 
ATOM   4124 C  CE2 . TRP A  1 532 ? 24.355  10.532  -4.429  1.00 42.90  ?  532  TRP A CE2 1 
ATOM   4125 C  CE3 . TRP A  1 532 ? 26.533  9.503   -4.264  1.00 59.80  ?  532  TRP A CE3 1 
ATOM   4126 C  CZ2 . TRP A  1 532 ? 24.911  11.776  -4.706  1.00 40.22  ?  532  TRP A CZ2 1 
ATOM   4127 C  CZ3 . TRP A  1 532 ? 27.082  10.738  -4.540  1.00 41.28  ?  532  TRP A CZ3 1 
ATOM   4128 C  CH2 . TRP A  1 532 ? 26.272  11.860  -4.751  1.00 42.44  ?  532  TRP A CH2 1 
ATOM   4129 N  N   . ASN A  1 533 ? 24.524  3.835   -4.024  1.00 47.30  ?  533  ASN A N   1 
ATOM   4130 C  CA  . ASN A  1 533 ? 24.940  2.602   -3.377  1.00 47.48  ?  533  ASN A CA  1 
ATOM   4131 C  C   . ASN A  1 533 ? 25.261  1.459   -4.339  1.00 48.51  ?  533  ASN A C   1 
ATOM   4132 O  O   . ASN A  1 533 ? 26.105  0.622   -4.050  1.00 51.76  ?  533  ASN A O   1 
ATOM   4133 C  CB  . ASN A  1 533 ? 23.921  2.173   -2.318  1.00 45.36  ?  533  ASN A CB  1 
ATOM   4134 C  CG  . ASN A  1 533 ? 23.808  3.177   -1.169  1.00 47.67  ?  533  ASN A CG  1 
ATOM   4135 O  OD1 . ASN A  1 533 ? 24.700  3.988   -0.951  1.00 58.02  ?  533  ASN A OD1 1 
ATOM   4136 N  ND2 . ASN A  1 533 ? 22.714  3.109   -0.425  1.00 49.53  ?  533  ASN A ND2 1 
ATOM   4137 N  N   . ARG A  1 534 ? 24.608  1.427   -5.492  1.00 51.49  ?  534  ARG A N   1 
ATOM   4138 C  CA  . ARG A  1 534 ? 24.833  0.327   -6.423  1.00 57.71  ?  534  ARG A CA  1 
ATOM   4139 C  C   . ARG A  1 534 ? 25.636  0.731   -7.655  1.00 62.36  ?  534  ARG A C   1 
ATOM   4140 O  O   . ARG A  1 534 ? 26.555  0.022   -8.061  1.00 66.61  ?  534  ARG A O   1 
ATOM   4141 C  CB  . ARG A  1 534 ? 23.507  -0.307  -6.839  1.00 52.56  ?  534  ARG A CB  1 
ATOM   4142 C  CG  . ARG A  1 534 ? 22.828  -1.089  -5.743  1.00 53.54  ?  534  ARG A CG  1 
ATOM   4143 C  CD  . ARG A  1 534 ? 21.325  -1.108  -5.938  1.00 60.19  ?  534  ARG A CD  1 
ATOM   4144 N  NE  . ARG A  1 534 ? 20.623  -1.466  -4.706  1.00 70.01  ?  534  ARG A NE  1 
ATOM   4145 C  CZ  . ARG A  1 534 ? 20.425  -2.715  -4.293  1.00 64.78  ?  534  ARG A CZ  1 
ATOM   4146 N  NH1 . ARG A  1 534 ? 20.884  -3.736  -5.010  1.00 64.29  ?  534  ARG A NH1 1 
ATOM   4147 N  NH2 . ARG A  1 534 ? 19.763  -2.943  -3.166  1.00 54.49  ?  534  ARG A NH2 1 
ATOM   4148 N  N   . PHE A  1 535 ? 25.295  1.874   -8.240  1.00 56.62  ?  535  PHE A N   1 
ATOM   4149 C  CA  . PHE A  1 535 ? 25.917  2.284   -9.495  1.00 48.81  ?  535  PHE A CA  1 
ATOM   4150 C  C   . PHE A  1 535 ? 27.261  3.007   -9.357  1.00 55.06  ?  535  PHE A C   1 
ATOM   4151 O  O   . PHE A  1 535 ? 28.212  2.640   -10.039 1.00 54.80  ?  535  PHE A O   1 
ATOM   4152 C  CB  . PHE A  1 535 ? 24.973  3.131   -10.339 1.00 45.55  ?  535  PHE A CB  1 
ATOM   4153 C  CG  . PHE A  1 535 ? 25.602  3.638   -11.591 1.00 46.41  ?  535  PHE A CG  1 
ATOM   4154 C  CD1 . PHE A  1 535 ? 25.860  2.770   -12.657 1.00 47.97  ?  535  PHE A CD1 1 
ATOM   4155 C  CD2 . PHE A  1 535 ? 25.947  4.976   -11.722 1.00 61.05  ?  535  PHE A CD2 1 
ATOM   4156 C  CE1 . PHE A  1 535 ? 26.449  3.229   -13.822 1.00 48.92  ?  535  PHE A CE1 1 
ATOM   4157 C  CE2 . PHE A  1 535 ? 26.532  5.447   -12.907 1.00 62.44  ?  535  PHE A CE2 1 
ATOM   4158 C  CZ  . PHE A  1 535 ? 26.782  4.569   -13.950 1.00 56.33  ?  535  PHE A CZ  1 
ATOM   4159 N  N   . LEU A  1 536 ? 27.346  4.040   -8.515  1.00 55.73  ?  536  LEU A N   1 
ATOM   4160 C  CA  . LEU A  1 536 ? 28.612  4.782   -8.397  1.00 53.35  ?  536  LEU A CA  1 
ATOM   4161 C  C   . LEU A  1 536 ? 29.868  3.945   -8.146  1.00 61.37  ?  536  LEU A C   1 
ATOM   4162 O  O   . LEU A  1 536 ? 30.878  4.142   -8.832  1.00 68.84  ?  536  LEU A O   1 
ATOM   4163 C  CB  . LEU A  1 536 ? 28.534  5.941   -7.407  1.00 50.51  ?  536  LEU A CB  1 
ATOM   4164 C  CG  . LEU A  1 536 ? 28.136  7.253   -8.082  1.00 60.39  ?  536  LEU A CG  1 
ATOM   4165 C  CD1 . LEU A  1 536 ? 28.585  8.443   -7.269  1.00 63.14  ?  536  LEU A CD1 1 
ATOM   4166 C  CD2 . LEU A  1 536 ? 28.710  7.330   -9.485  1.00 66.70  ?  536  LEU A CD2 1 
ATOM   4167 N  N   . PRO A  1 537 ? 29.815  3.004   -7.184  1.00 56.89  ?  537  PRO A N   1 
ATOM   4168 C  CA  . PRO A  1 537 ? 31.011  2.180   -6.952  1.00 62.20  ?  537  PRO A CA  1 
ATOM   4169 C  C   . PRO A  1 537 ? 31.448  1.368   -8.180  1.00 68.25  ?  537  PRO A C   1 
ATOM   4170 O  O   . PRO A  1 537 ? 32.632  1.063   -8.298  1.00 76.97  ?  537  PRO A O   1 
ATOM   4171 C  CB  . PRO A  1 537 ? 30.574  1.242   -5.822  1.00 59.71  ?  537  PRO A CB  1 
ATOM   4172 C  CG  . PRO A  1 537 ? 29.472  1.952   -5.144  1.00 49.56  ?  537  PRO A CG  1 
ATOM   4173 C  CD  . PRO A  1 537 ? 28.737  2.660   -6.244  1.00 48.47  ?  537  PRO A CD  1 
ATOM   4174 N  N   . LYS A  1 538 ? 30.513  1.020   -9.062  1.00 61.14  ?  538  LYS A N   1 
ATOM   4175 C  CA  . LYS A  1 538 ? 30.851  0.370   -10.327 1.00 72.12  ?  538  LYS A CA  1 
ATOM   4176 C  C   . LYS A  1 538 ? 31.571  1.357   -11.247 1.00 68.33  ?  538  LYS A C   1 
ATOM   4177 O  O   . LYS A  1 538 ? 32.554  1.018   -11.902 1.00 70.11  ?  538  LYS A O   1 
ATOM   4178 C  CB  . LYS A  1 538 ? 29.588  -0.143  -11.034 1.00 79.39  ?  538  LYS A CB  1 
ATOM   4179 C  CG  . LYS A  1 538 ? 28.844  -1.256  -10.313 1.00 87.15  ?  538  LYS A CG  1 
ATOM   4180 C  CD  . LYS A  1 538 ? 29.458  -2.614  -10.603 1.00 97.12  ?  538  LYS A CD  1 
ATOM   4181 C  CE  . LYS A  1 538 ? 28.775  -3.714  -9.803  1.00 99.67  ?  538  LYS A CE  1 
ATOM   4182 N  NZ  . LYS A  1 538 ? 29.303  -5.061  -10.163 1.00 103.32 ?  538  LYS A NZ  1 
ATOM   4183 N  N   . LEU A  1 539 ? 31.061  2.583   -11.280 1.00 67.67  ?  539  LEU A N   1 
ATOM   4184 C  CA  . LEU A  1 539 ? 31.569  3.630   -12.154 1.00 65.77  ?  539  LEU A CA  1 
ATOM   4185 C  C   . LEU A  1 539 ? 32.930  4.125   -11.710 1.00 78.22  ?  539  LEU A C   1 
ATOM   4186 O  O   . LEU A  1 539 ? 33.852  4.255   -12.525 1.00 75.21  ?  539  LEU A O   1 
ATOM   4187 C  CB  . LEU A  1 539 ? 30.606  4.813   -12.161 1.00 57.75  ?  539  LEU A CB  1 
ATOM   4188 C  CG  . LEU A  1 539 ? 31.099  6.033   -12.930 1.00 54.35  ?  539  LEU A CG  1 
ATOM   4189 C  CD1 . LEU A  1 539 ? 31.294  5.659   -14.380 1.00 55.72  ?  539  LEU A CD1 1 
ATOM   4190 C  CD2 . LEU A  1 539 ? 30.105  7.155   -12.805 1.00 49.34  ?  539  LEU A CD2 1 
ATOM   4191 N  N   . LEU A  1 540 ? 33.038  4.432   -10.418 1.00 85.05  ?  540  LEU A N   1 
ATOM   4192 C  CA  . LEU A  1 540 ? 34.287  4.923   -9.855  1.00 93.98  ?  540  LEU A CA  1 
ATOM   4193 C  C   . LEU A  1 540 ? 35.441  3.942   -10.097 1.00 97.90  ?  540  LEU A C   1 
ATOM   4194 O  O   . LEU A  1 540 ? 36.551  4.359   -10.436 1.00 104.70 ?  540  LEU A O   1 
ATOM   4195 C  CB  . LEU A  1 540 ? 34.119  5.251   -8.370  1.00 103.59 ?  540  LEU A CB  1 
ATOM   4196 C  CG  . LEU A  1 540 ? 33.352  6.555   -8.113  1.00 102.27 ?  540  LEU A CG  1 
ATOM   4197 C  CD1 . LEU A  1 540 ? 32.988  6.729   -6.631  1.00 86.64  ?  540  LEU A CD1 1 
ATOM   4198 C  CD2 . LEU A  1 540 ? 34.158  7.749   -8.630  1.00 102.74 ?  540  LEU A CD2 1 
ATOM   4199 N  N   . SER A  1 541 ? 35.173  2.644   -9.960  1.00 91.36  ?  541  SER A N   1 
ATOM   4200 C  CA  . SER A  1 541 ? 36.182  1.627   -10.263 1.00 92.86  ?  541  SER A CA  1 
ATOM   4201 C  C   . SER A  1 541 ? 36.281  1.325   -11.765 1.00 100.08 ?  541  SER A C   1 
ATOM   4202 O  O   . SER A  1 541 ? 36.232  0.164   -12.180 1.00 101.87 ?  541  SER A O   1 
ATOM   4203 C  CB  . SER A  1 541 ? 35.938  0.340   -9.463  1.00 93.51  ?  541  SER A CB  1 
ATOM   4204 O  OG  . SER A  1 541 ? 34.658  -0.214  -9.716  1.00 92.54  ?  541  SER A OG  1 
ATOM   4205 N  N   . ALA A  1 542 ? 36.418  2.388   -12.560 1.00 97.85  ?  542  ALA A N   1 
ATOM   4206 C  CA  . ALA A  1 542 ? 36.618  2.298   -14.004 1.00 92.11  ?  542  ALA A CA  1 
ATOM   4207 C  C   . ALA A  1 542 ? 37.029  3.667   -14.550 1.00 86.42  ?  542  ALA A C   1 
ATOM   4208 O  O   . ALA A  1 542 ? 37.302  4.603   -13.788 1.00 75.53  ?  542  ALA A O   1 
ATOM   4209 C  CB  . ALA A  1 542 ? 35.355  1.795   -14.702 1.00 87.06  ?  542  ALA A CB  1 
ATOM   4210 N  N   . GLU B  1 4   ? -17.189 5.570   -69.849 1.00 113.91 ?  4    GLU B N   1 
ATOM   4211 C  CA  . GLU B  1 4   ? -15.899 6.178   -69.551 1.00 111.19 ?  4    GLU B CA  1 
ATOM   4212 C  C   . GLU B  1 4   ? -16.053 7.440   -68.699 1.00 108.84 ?  4    GLU B C   1 
ATOM   4213 O  O   . GLU B  1 4   ? -16.375 8.509   -69.216 1.00 108.63 ?  4    GLU B O   1 
ATOM   4214 C  CB  . GLU B  1 4   ? -15.157 6.504   -70.849 1.00 115.63 ?  4    GLU B CB  1 
ATOM   4215 C  CG  . GLU B  1 4   ? -13.716 6.968   -70.652 1.00 118.29 ?  4    GLU B CG  1 
ATOM   4216 C  CD  . GLU B  1 4   ? -12.780 5.840   -70.247 1.00 120.21 ?  4    GLU B CD  1 
ATOM   4217 O  OE1 . GLU B  1 4   ? -13.205 4.666   -70.287 1.00 126.34 ?  4    GLU B OE1 1 
ATOM   4218 O  OE2 . GLU B  1 4   ? -11.617 6.127   -69.890 1.00 114.58 ?  4    GLU B OE2 1 
ATOM   4219 N  N   . ASP B  1 5   ? -15.815 7.305   -67.395 1.00 104.22 ?  5    ASP B N   1 
ATOM   4220 C  CA  . ASP B  1 5   ? -15.949 8.411   -66.440 1.00 95.33  ?  5    ASP B CA  1 
ATOM   4221 C  C   . ASP B  1 5   ? -14.771 9.376   -66.553 1.00 87.03  ?  5    ASP B C   1 
ATOM   4222 O  O   . ASP B  1 5   ? -13.642 9.005   -66.246 1.00 84.70  ?  5    ASP B O   1 
ATOM   4223 C  CB  . ASP B  1 5   ? -16.020 7.851   -65.014 1.00 88.50  ?  5    ASP B CB  1 
ATOM   4224 C  CG  . ASP B  1 5   ? -16.485 8.881   -63.989 1.00 86.61  ?  5    ASP B CG  1 
ATOM   4225 O  OD1 . ASP B  1 5   ? -16.394 10.099  -64.259 1.00 90.04  ?  5    ASP B OD1 1 
ATOM   4226 O  OD2 . ASP B  1 5   ? -16.948 8.461   -62.905 1.00 79.81  ?  5    ASP B OD2 1 
ATOM   4227 N  N   . PRO B  1 6   ? -15.034 10.623  -66.986 1.00 86.48  ?  6    PRO B N   1 
ATOM   4228 C  CA  . PRO B  1 6   ? -13.977 11.630  -67.167 1.00 81.56  ?  6    PRO B CA  1 
ATOM   4229 C  C   . PRO B  1 6   ? -13.285 12.050  -65.868 1.00 83.15  ?  6    PRO B C   1 
ATOM   4230 O  O   . PRO B  1 6   ? -12.177 12.586  -65.915 1.00 82.44  ?  6    PRO B O   1 
ATOM   4231 C  CB  . PRO B  1 6   ? -14.713 12.815  -67.805 1.00 84.50  ?  6    PRO B CB  1 
ATOM   4232 C  CG  . PRO B  1 6   ? -16.166 12.578  -67.533 1.00 87.84  ?  6    PRO B CG  1 
ATOM   4233 C  CD  . PRO B  1 6   ? -16.345 11.098  -67.466 1.00 88.21  ?  6    PRO B CD  1 
ATOM   4234 N  N   . GLN B  1 7   ? -13.919 11.806  -64.727 1.00 81.23  ?  7    GLN B N   1 
ATOM   4235 C  CA  . GLN B  1 7   ? -13.264 12.040  -63.445 1.00 78.88  ?  7    GLN B CA  1 
ATOM   4236 C  C   . GLN B  1 7   ? -12.157 11.024  -63.214 1.00 72.32  ?  7    GLN B C   1 
ATOM   4237 O  O   . GLN B  1 7   ? -11.251 11.256  -62.422 1.00 69.37  ?  7    GLN B O   1 
ATOM   4238 C  CB  . GLN B  1 7   ? -14.265 11.960  -62.292 1.00 82.75  ?  7    GLN B CB  1 
ATOM   4239 C  CG  . GLN B  1 7   ? -15.241 13.114  -62.228 1.00 88.39  ?  7    GLN B CG  1 
ATOM   4240 C  CD  . GLN B  1 7   ? -14.558 14.422  -61.914 1.00 91.36  ?  7    GLN B CD  1 
ATOM   4241 O  OE1 . GLN B  1 7   ? -13.607 14.464  -61.133 1.00 93.44  ?  7    GLN B OE1 1 
ATOM   4242 N  NE2 . GLN B  1 7   ? -15.034 15.501  -62.526 1.00 93.13  ?  7    GLN B NE2 1 
ATOM   4243 N  N   . LEU B  1 8   ? -12.234 9.890   -63.899 1.00 66.95  ?  8    LEU B N   1 
ATOM   4244 C  CA  . LEU B  1 8   ? -11.251 8.836   -63.700 1.00 63.34  ?  8    LEU B CA  1 
ATOM   4245 C  C   . LEU B  1 8   ? -10.138 8.915   -64.734 1.00 66.04  ?  8    LEU B C   1 
ATOM   4246 O  O   . LEU B  1 8   ? -9.218  8.099   -64.737 1.00 71.35  ?  8    LEU B O   1 
ATOM   4247 C  CB  . LEU B  1 8   ? -11.919 7.466   -63.746 1.00 57.08  ?  8    LEU B CB  1 
ATOM   4248 C  CG  . LEU B  1 8   ? -13.032 7.283   -62.722 1.00 58.05  ?  8    LEU B CG  1 
ATOM   4249 C  CD1 . LEU B  1 8   ? -13.525 5.841   -62.739 1.00 58.61  ?  8    LEU B CD1 1 
ATOM   4250 C  CD2 . LEU B  1 8   ? -12.545 7.692   -61.330 1.00 59.24  ?  8    LEU B CD2 1 
ATOM   4251 N  N   . LEU B  1 9   ? -10.217 9.912   -65.606 1.00 69.07  ?  9    LEU B N   1 
ATOM   4252 C  CA  . LEU B  1 9   ? -9.248  10.043  -66.687 1.00 70.53  ?  9    LEU B CA  1 
ATOM   4253 C  C   . LEU B  1 9   ? -8.284  11.198  -66.450 1.00 69.52  ?  9    LEU B C   1 
ATOM   4254 O  O   . LEU B  1 9   ? -8.686  12.364  -66.456 1.00 80.85  ?  9    LEU B O   1 
ATOM   4255 C  CB  . LEU B  1 9   ? -9.959  10.203  -68.033 1.00 66.71  ?  9    LEU B CB  1 
ATOM   4256 C  CG  . LEU B  1 9   ? -9.883  8.954   -68.907 1.00 75.28  ?  9    LEU B CG  1 
ATOM   4257 C  CD1 . LEU B  1 9   ? -10.530 9.190   -70.279 1.00 75.44  ?  9    LEU B CD1 1 
ATOM   4258 C  CD2 . LEU B  1 9   ? -8.425  8.518   -69.053 1.00 73.55  ?  9    LEU B CD2 1 
ATOM   4259 N  N   . VAL B  1 10  ? -7.012  10.871  -66.245 1.00 49.97  ?  10   VAL B N   1 
ATOM   4260 C  CA  . VAL B  1 10  ? -6.019  11.895  -65.953 1.00 59.61  ?  10   VAL B CA  1 
ATOM   4261 C  C   . VAL B  1 10  ? -4.783  11.802  -66.838 1.00 67.55  ?  10   VAL B C   1 
ATOM   4262 O  O   . VAL B  1 10  ? -4.272  10.710  -67.099 1.00 65.57  ?  10   VAL B O   1 
ATOM   4263 C  CB  . VAL B  1 10  ? -5.569  11.847  -64.485 1.00 54.92  ?  10   VAL B CB  1 
ATOM   4264 C  CG1 . VAL B  1 10  ? -4.553  12.924  -64.220 1.00 54.09  ?  10   VAL B CG1 1 
ATOM   4265 C  CG2 . VAL B  1 10  ? -6.754  12.027  -63.574 1.00 67.68  ?  10   VAL B CG2 1 
ATOM   4266 N  N   . ARG B  1 11  ? -4.316  12.965  -67.291 1.00 68.36  ?  11   ARG B N   1 
ATOM   4267 C  CA  . ARG B  1 11  ? -3.086  13.076  -68.056 1.00 63.00  ?  11   ARG B CA  1 
ATOM   4268 C  C   . ARG B  1 11  ? -1.931  13.661  -67.233 1.00 61.13  ?  11   ARG B C   1 
ATOM   4269 O  O   . ARG B  1 11  ? -1.910  14.851  -66.913 1.00 61.65  ?  11   ARG B O   1 
ATOM   4270 C  CB  . ARG B  1 11  ? -3.317  13.908  -69.318 1.00 62.31  ?  11   ARG B CB  1 
ATOM   4271 C  CG  . ARG B  1 11  ? -2.045  14.251  -70.084 1.00 67.57  ?  11   ARG B CG  1 
ATOM   4272 C  CD  . ARG B  1 11  ? -2.325  14.443  -71.564 1.00 70.16  ?  11   ARG B CD  1 
ATOM   4273 N  NE  . ARG B  1 11  ? -2.314  13.157  -72.250 1.00 82.97  ?  11   ARG B NE  1 
ATOM   4274 C  CZ  . ARG B  1 11  ? -2.715  12.961  -73.501 1.00 88.29  ?  11   ARG B CZ  1 
ATOM   4275 N  NH1 . ARG B  1 11  ? -3.185  13.974  -74.224 1.00 91.20  ?  11   ARG B NH1 1 
ATOM   4276 N  NH2 . ARG B  1 11  ? -2.654  11.742  -74.024 1.00 86.94  ?  11   ARG B NH2 1 
ATOM   4277 N  N   . VAL B  1 12  ? -0.971  12.803  -66.904 1.00 54.98  ?  12   VAL B N   1 
ATOM   4278 C  CA  . VAL B  1 12  ? 0.287   13.219  -66.304 1.00 50.24  ?  12   VAL B CA  1 
ATOM   4279 C  C   . VAL B  1 12  ? 1.365   13.228  -67.394 1.00 60.55  ?  12   VAL B C   1 
ATOM   4280 O  O   . VAL B  1 12  ? 1.116   12.782  -68.514 1.00 56.05  ?  12   VAL B O   1 
ATOM   4281 C  CB  . VAL B  1 12  ? 0.691   12.273  -65.163 1.00 43.72  ?  12   VAL B CB  1 
ATOM   4282 C  CG1 . VAL B  1 12  ? -0.434  12.180  -64.133 1.00 40.63  ?  12   VAL B CG1 1 
ATOM   4283 C  CG2 . VAL B  1 12  ? 1.027   10.895  -65.688 1.00 37.20  ?  12   VAL B CG2 1 
ATOM   4284 N  N   . ARG B  1 13  ? 2.557   13.719  -67.061 1.00 62.73  ?  13   ARG B N   1 
ATOM   4285 C  CA  . ARG B  1 13  ? 3.637   13.900  -68.036 1.00 56.59  ?  13   ARG B CA  1 
ATOM   4286 C  C   . ARG B  1 13  ? 4.094   12.637  -68.763 1.00 56.62  ?  13   ARG B C   1 
ATOM   4287 O  O   . ARG B  1 13  ? 4.825   12.716  -69.739 1.00 69.33  ?  13   ARG B O   1 
ATOM   4288 C  CB  . ARG B  1 13  ? 4.854   14.545  -67.372 1.00 55.75  ?  13   ARG B CB  1 
ATOM   4289 C  CG  . ARG B  1 13  ? 4.668   16.002  -67.017 1.00 71.40  ?  13   ARG B CG  1 
ATOM   4290 C  CD  . ARG B  1 13  ? 5.992   16.638  -66.645 1.00 85.60  ?  13   ARG B CD  1 
ATOM   4291 N  NE  . ARG B  1 13  ? 5.803   17.935  -66.002 1.00 100.22 ?  13   ARG B NE  1 
ATOM   4292 C  CZ  . ARG B  1 13  ? 6.781   18.640  -65.440 1.00 108.30 ?  13   ARG B CZ  1 
ATOM   4293 N  NH1 . ARG B  1 13  ? 8.025   18.174  -65.441 1.00 110.33 ?  13   ARG B NH1 1 
ATOM   4294 N  NH2 . ARG B  1 13  ? 6.515   19.810  -64.872 1.00 109.98 ?  13   ARG B NH2 1 
ATOM   4295 N  N   . GLY B  1 14  ? 3.676   11.477  -68.287 1.00 51.93  ?  14   GLY B N   1 
ATOM   4296 C  CA  . GLY B  1 14  ? 4.158   10.230  -68.835 1.00 42.07  ?  14   GLY B CA  1 
ATOM   4297 C  C   . GLY B  1 14  ? 3.154   9.620   -69.789 1.00 46.70  ?  14   GLY B C   1 
ATOM   4298 O  O   . GLY B  1 14  ? 3.466   8.693   -70.532 1.00 48.00  ?  14   GLY B O   1 
ATOM   4299 N  N   . GLY B  1 15  ? 1.938   10.148  -69.772 1.00 47.74  ?  15   GLY B N   1 
ATOM   4300 C  CA  . GLY B  1 15  ? 0.872   9.604   -70.586 1.00 48.42  ?  15   GLY B CA  1 
ATOM   4301 C  C   . GLY B  1 15  ? -0.456  9.673   -69.861 1.00 53.80  ?  15   GLY B C   1 
ATOM   4302 O  O   . GLY B  1 15  ? -0.587  10.358  -68.838 1.00 48.28  ?  15   GLY B O   1 
ATOM   4303 N  N   . GLN B  1 16  ? -1.448  8.968   -70.396 1.00 55.06  ?  16   GLN B N   1 
ATOM   4304 C  CA  . GLN B  1 16  ? -2.773  8.959   -69.800 1.00 55.20  ?  16   GLN B CA  1 
ATOM   4305 C  C   . GLN B  1 16  ? -2.966  7.822   -68.801 1.00 53.17  ?  16   GLN B C   1 
ATOM   4306 O  O   . GLN B  1 16  ? -2.384  6.743   -68.941 1.00 58.24  ?  16   GLN B O   1 
ATOM   4307 C  CB  . GLN B  1 16  ? -3.841  8.890   -70.884 1.00 58.11  ?  16   GLN B CB  1 
ATOM   4308 C  CG  . GLN B  1 16  ? -4.234  10.236  -71.429 1.00 66.71  ?  16   GLN B CG  1 
ATOM   4309 C  CD  . GLN B  1 16  ? -5.508  10.155  -72.243 1.00 84.36  ?  16   GLN B CD  1 
ATOM   4310 O  OE1 . GLN B  1 16  ? -5.594  9.392   -73.208 1.00 80.08  ?  16   GLN B OE1 1 
ATOM   4311 N  NE2 . GLN B  1 16  ? -6.519  10.925  -71.842 1.00 93.94  ?  16   GLN B NE2 1 
ATOM   4312 N  N   . LEU B  1 17  ? -3.808  8.078   -67.806 1.00 45.56  ?  17   LEU B N   1 
ATOM   4313 C  CA  . LEU B  1 17  ? -4.067  7.132   -66.735 1.00 46.67  ?  17   LEU B CA  1 
ATOM   4314 C  C   . LEU B  1 17  ? -5.555  6.997   -66.559 1.00 47.49  ?  17   LEU B C   1 
ATOM   4315 O  O   . LEU B  1 17  ? -6.281  7.984   -66.683 1.00 50.44  ?  17   LEU B O   1 
ATOM   4316 C  CB  . LEU B  1 17  ? -3.519  7.676   -65.413 1.00 51.29  ?  17   LEU B CB  1 
ATOM   4317 C  CG  . LEU B  1 17  ? -2.023  7.842   -65.223 1.00 48.93  ?  17   LEU B CG  1 
ATOM   4318 C  CD1 . LEU B  1 17  ? -1.760  8.506   -63.883 1.00 48.01  ?  17   LEU B CD1 1 
ATOM   4319 C  CD2 . LEU B  1 17  ? -1.352  6.477   -65.290 1.00 48.49  ?  17   LEU B CD2 1 
ATOM   4320 N  N   . ARG B  1 18  ? -6.008  5.791   -66.229 1.00 52.63  ?  18   ARG B N   1 
ATOM   4321 C  CA  . ARG B  1 18  ? -7.399  5.585   -65.825 1.00 56.67  ?  18   ARG B CA  1 
ATOM   4322 C  C   . ARG B  1 18  ? -7.465  5.117   -64.380 1.00 53.75  ?  18   ARG B C   1 
ATOM   4323 O  O   . ARG B  1 18  ? -6.891  4.087   -64.022 1.00 56.31  ?  18   ARG B O   1 
ATOM   4324 C  CB  . ARG B  1 18  ? -8.103  4.577   -66.737 1.00 63.95  ?  18   ARG B CB  1 
ATOM   4325 C  CG  . ARG B  1 18  ? -9.591  4.398   -66.439 1.00 72.60  ?  18   ARG B CG  1 
ATOM   4326 C  CD  . ARG B  1 18  ? -10.310 3.711   -67.589 1.00 88.40  ?  18   ARG B CD  1 
ATOM   4327 N  NE  . ARG B  1 18  ? -9.461  2.700   -68.214 1.00 98.35  ?  18   ARG B NE  1 
ATOM   4328 C  CZ  . ARG B  1 18  ? -9.102  2.708   -69.494 1.00 106.33 ?  18   ARG B CZ  1 
ATOM   4329 N  NH1 . ARG B  1 18  ? -9.535  3.669   -70.303 1.00 107.30 ?  18   ARG B NH1 1 
ATOM   4330 N  NH2 . ARG B  1 18  ? -8.315  1.749   -69.967 1.00 109.63 ?  18   ARG B NH2 1 
ATOM   4331 N  N   . GLY B  1 19  ? -8.160  5.879   -63.545 1.00 55.03  ?  19   GLY B N   1 
ATOM   4332 C  CA  . GLY B  1 19  ? -8.330  5.504   -62.154 1.00 48.15  ?  19   GLY B CA  1 
ATOM   4333 C  C   . GLY B  1 19  ? -9.636  4.780   -61.921 1.00 56.13  ?  19   GLY B C   1 
ATOM   4334 O  O   . GLY B  1 19  ? -10.388 4.503   -62.861 1.00 62.23  ?  19   GLY B O   1 
ATOM   4335 N  N   . ILE B  1 20  ? -9.915  4.484   -60.658 1.00 55.50  ?  20   ILE B N   1 
ATOM   4336 C  CA  . ILE B  1 20  ? -11.132 3.776   -60.288 1.00 53.78  ?  20   ILE B CA  1 
ATOM   4337 C  C   . ILE B  1 20  ? -11.895 4.568   -59.231 1.00 55.54  ?  20   ILE B C   1 
ATOM   4338 O  O   . ILE B  1 20  ? -11.291 5.222   -58.387 1.00 64.40  ?  20   ILE B O   1 
ATOM   4339 C  CB  . ILE B  1 20  ? -10.815 2.351   -59.772 1.00 56.80  ?  20   ILE B CB  1 
ATOM   4340 C  CG1 . ILE B  1 20  ? -12.101 1.593   -59.435 1.00 61.75  ?  20   ILE B CG1 1 
ATOM   4341 C  CG2 . ILE B  1 20  ? -9.894  2.404   -58.553 1.00 55.49  ?  20   ILE B CG2 1 
ATOM   4342 C  CD1 . ILE B  1 20  ? -11.896 0.120   -59.150 1.00 58.35  ?  20   ILE B CD1 1 
ATOM   4343 N  N   . ARG B  1 21  ? -13.221 4.526   -59.298 1.00 56.24  ?  21   ARG B N   1 
ATOM   4344 C  CA  . ARG B  1 21  ? -14.073 5.211   -58.334 1.00 58.65  ?  21   ARG B CA  1 
ATOM   4345 C  C   . ARG B  1 21  ? -14.378 4.258   -57.195 1.00 64.15  ?  21   ARG B C   1 
ATOM   4346 O  O   . ARG B  1 21  ? -15.014 3.218   -57.393 1.00 67.03  ?  21   ARG B O   1 
ATOM   4347 C  CB  . ARG B  1 21  ? -15.376 5.656   -58.991 1.00 67.85  ?  21   ARG B CB  1 
ATOM   4348 C  CG  . ARG B  1 21  ? -16.083 6.781   -58.264 1.00 74.69  ?  21   ARG B CG  1 
ATOM   4349 C  CD  . ARG B  1 21  ? -17.519 6.913   -58.735 1.00 80.73  ?  21   ARG B CD  1 
ATOM   4350 N  NE  . ARG B  1 21  ? -18.387 5.978   -58.033 1.00 90.46  ?  21   ARG B NE  1 
ATOM   4351 C  CZ  . ARG B  1 21  ? -19.706 5.934   -58.176 1.00 107.32 ?  21   ARG B CZ  1 
ATOM   4352 N  NH1 . ARG B  1 21  ? -20.312 6.772   -59.007 1.00 111.91 ?  21   ARG B NH1 1 
ATOM   4353 N  NH2 . ARG B  1 21  ? -20.417 5.051   -57.489 1.00 114.76 ?  21   ARG B NH2 1 
ATOM   4354 N  N   . LEU B  1 22  ? -13.905 4.612   -56.005 1.00 61.86  ?  22   LEU B N   1 
ATOM   4355 C  CA  . LEU B  1 22  ? -14.048 3.767   -54.837 1.00 62.31  ?  22   LEU B CA  1 
ATOM   4356 C  C   . LEU B  1 22  ? -15.103 4.329   -53.923 1.00 65.57  ?  22   LEU B C   1 
ATOM   4357 O  O   . LEU B  1 22  ? -15.332 5.535   -53.894 1.00 63.85  ?  22   LEU B O   1 
ATOM   4358 C  CB  . LEU B  1 22  ? -12.723 3.661   -54.085 1.00 67.55  ?  22   LEU B CB  1 
ATOM   4359 C  CG  . LEU B  1 22  ? -11.706 2.761   -54.783 1.00 69.57  ?  22   LEU B CG  1 
ATOM   4360 C  CD1 . LEU B  1 22  ? -10.471 2.573   -53.930 1.00 67.11  ?  22   LEU B CD1 1 
ATOM   4361 C  CD2 . LEU B  1 22  ? -12.346 1.421   -55.127 1.00 73.78  ?  22   LEU B CD2 1 
ATOM   4362 N  N   . LYS B  1 23  ? -15.740 3.443   -53.171 1.00 72.78  ?  23   LYS B N   1 
ATOM   4363 C  CA  . LYS B  1 23  ? -16.787 3.840   -52.245 1.00 73.58  ?  23   LYS B CA  1 
ATOM   4364 C  C   . LYS B  1 23  ? -16.215 4.014   -50.841 1.00 69.30  ?  23   LYS B C   1 
ATOM   4365 O  O   . LYS B  1 23  ? -15.655 3.079   -50.267 1.00 69.59  ?  23   LYS B O   1 
ATOM   4366 C  CB  . LYS B  1 23  ? -17.909 2.799   -52.250 1.00 81.23  ?  23   LYS B CB  1 
ATOM   4367 C  CG  . LYS B  1 23  ? -19.144 3.201   -51.469 1.00 98.32  ?  23   LYS B CG  1 
ATOM   4368 C  CD  . LYS B  1 23  ? -19.748 4.493   -51.999 1.00 107.44 ?  23   LYS B CD  1 
ATOM   4369 C  CE  . LYS B  1 23  ? -20.841 5.003   -51.068 1.00 111.10 ?  23   LYS B CE  1 
ATOM   4370 N  NZ  . LYS B  1 23  ? -21.341 6.347   -51.470 1.00 113.03 ?  23   LYS B NZ  1 
ATOM   4371 N  N   . ALA B  1 24  ? -16.329 5.227   -50.310 1.00 68.83  ?  24   ALA B N   1 
ATOM   4372 C  CA  . ALA B  1 24  ? -16.039 5.496   -48.902 1.00 60.85  ?  24   ALA B CA  1 
ATOM   4373 C  C   . ALA B  1 24  ? -17.377 5.694   -48.193 1.00 65.74  ?  24   ALA B C   1 
ATOM   4374 O  O   . ALA B  1 24  ? -18.366 6.035   -48.839 1.00 73.06  ?  24   ALA B O   1 
ATOM   4375 C  CB  . ALA B  1 24  ? -15.164 6.732   -48.773 1.00 51.55  ?  24   ALA B CB  1 
ATOM   4376 N  N   . PRO B  1 25  ? -17.425 5.475   -46.868 1.00 71.66  ?  25   PRO B N   1 
ATOM   4377 C  CA  . PRO B  1 25  ? -18.712 5.537   -46.154 1.00 71.29  ?  25   PRO B CA  1 
ATOM   4378 C  C   . PRO B  1 25  ? -19.542 6.784   -46.468 1.00 73.95  ?  25   PRO B C   1 
ATOM   4379 O  O   . PRO B  1 25  ? -20.762 6.695   -46.591 1.00 79.29  ?  25   PRO B O   1 
ATOM   4380 C  CB  . PRO B  1 25  ? -18.291 5.547   -44.681 1.00 63.53  ?  25   PRO B CB  1 
ATOM   4381 C  CG  . PRO B  1 25  ? -17.001 4.821   -44.663 1.00 65.58  ?  25   PRO B CG  1 
ATOM   4382 C  CD  . PRO B  1 25  ? -16.310 5.140   -45.962 1.00 64.14  ?  25   PRO B CD  1 
ATOM   4383 N  N   . GLY B  1 26  ? -18.883 7.928   -46.616 1.00 73.47  ?  26   GLY B N   1 
ATOM   4384 C  CA  . GLY B  1 26  ? -19.585 9.180   -46.828 1.00 75.31  ?  26   GLY B CA  1 
ATOM   4385 C  C   . GLY B  1 26  ? -19.763 9.569   -48.282 1.00 79.74  ?  26   GLY B C   1 
ATOM   4386 O  O   . GLY B  1 26  ? -20.428 10.560  -48.576 1.00 82.63  ?  26   GLY B O   1 
ATOM   4387 N  N   . GLY B  1 27  ? -19.168 8.797   -49.190 1.00 76.83  ?  27   GLY B N   1 
ATOM   4388 C  CA  . GLY B  1 27  ? -19.260 9.086   -50.611 1.00 74.36  ?  27   GLY B CA  1 
ATOM   4389 C  C   . GLY B  1 27  ? -18.163 8.454   -51.447 1.00 74.50  ?  27   GLY B C   1 
ATOM   4390 O  O   . GLY B  1 27  ? -17.303 7.744   -50.933 1.00 79.17  ?  27   GLY B O   1 
ATOM   4391 N  N   . PRO B  1 28  ? -18.188 8.702   -52.759 1.00 70.86  ?  28   PRO B N   1 
ATOM   4392 C  CA  . PRO B  1 28  ? -17.171 8.131   -53.641 1.00 65.47  ?  28   PRO B CA  1 
ATOM   4393 C  C   . PRO B  1 28  ? -15.856 8.891   -53.537 1.00 61.86  ?  28   PRO B C   1 
ATOM   4394 O  O   . PRO B  1 28  ? -15.842 10.033  -53.079 1.00 66.83  ?  28   PRO B O   1 
ATOM   4395 C  CB  . PRO B  1 28  ? -17.780 8.330   -55.027 1.00 71.04  ?  28   PRO B CB  1 
ATOM   4396 C  CG  . PRO B  1 28  ? -18.621 9.545   -54.873 1.00 58.94  ?  28   PRO B CG  1 
ATOM   4397 C  CD  . PRO B  1 28  ? -19.215 9.444   -53.512 1.00 68.94  ?  28   PRO B CD  1 
ATOM   4398 N  N   . VAL B  1 29  ? -14.760 8.252   -53.935 1.00 50.95  ?  29   VAL B N   1 
ATOM   4399 C  CA  . VAL B  1 29  ? -13.482 8.934   -54.063 1.00 51.69  ?  29   VAL B CA  1 
ATOM   4400 C  C   . VAL B  1 29  ? -12.821 8.423   -55.322 1.00 56.74  ?  29   VAL B C   1 
ATOM   4401 O  O   . VAL B  1 29  ? -13.067 7.288   -55.725 1.00 61.06  ?  29   VAL B O   1 
ATOM   4402 C  CB  . VAL B  1 29  ? -12.531 8.674   -52.862 1.00 56.12  ?  29   VAL B CB  1 
ATOM   4403 C  CG1 . VAL B  1 29  ? -13.229 8.977   -51.553 1.00 60.89  ?  29   VAL B CG1 1 
ATOM   4404 C  CG2 . VAL B  1 29  ? -12.003 7.243   -52.873 1.00 52.41  ?  29   VAL B CG2 1 
ATOM   4405 N  N   . SER B  1 30  ? -11.999 9.264   -55.947 1.00 57.46  ?  30   SER B N   1 
ATOM   4406 C  CA  . SER B  1 30  ? -11.218 8.867   -57.118 1.00 55.18  ?  30   SER B CA  1 
ATOM   4407 C  C   . SER B  1 30  ? -9.897  8.252   -56.681 1.00 53.09  ?  30   SER B C   1 
ATOM   4408 O  O   . SER B  1 30  ? -9.109  8.892   -55.986 1.00 59.57  ?  30   SER B O   1 
ATOM   4409 C  CB  . SER B  1 30  ? -10.943 10.075  -58.024 1.00 61.97  ?  30   SER B CB  1 
ATOM   4410 O  OG  . SER B  1 30  ? -12.141 10.633  -58.548 1.00 69.84  ?  30   SER B OG  1 
ATOM   4411 N  N   . ALA B  1 31  ? -9.650  7.010   -57.078 1.00 47.53  ?  31   ALA B N   1 
ATOM   4412 C  CA  . ALA B  1 31  ? -8.386  6.356   -56.744 1.00 43.30  ?  31   ALA B CA  1 
ATOM   4413 C  C   . ALA B  1 31  ? -7.567  5.998   -57.984 1.00 48.54  ?  31   ALA B C   1 
ATOM   4414 O  O   . ALA B  1 31  ? -8.102  5.511   -58.981 1.00 51.17  ?  31   ALA B O   1 
ATOM   4415 C  CB  . ALA B  1 31  ? -8.625  5.118   -55.898 1.00 43.78  ?  31   ALA B CB  1 
ATOM   4416 N  N   . PHE B  1 32  ? -6.263  6.235   -57.896 1.00 46.28  ?  32   PHE B N   1 
ATOM   4417 C  CA  . PHE B  1 32  ? -5.333  5.963   -58.978 1.00 50.21  ?  32   PHE B CA  1 
ATOM   4418 C  C   . PHE B  1 32  ? -4.189  5.131   -58.415 1.00 47.25  ?  32   PHE B C   1 
ATOM   4419 O  O   . PHE B  1 32  ? -3.293  5.650   -57.752 1.00 45.54  ?  32   PHE B O   1 
ATOM   4420 C  CB  . PHE B  1 32  ? -4.832  7.277   -59.573 1.00 50.87  ?  32   PHE B CB  1 
ATOM   4421 C  CG  . PHE B  1 32  ? -5.941  8.192   -60.011 1.00 53.57  ?  32   PHE B CG  1 
ATOM   4422 C  CD1 . PHE B  1 32  ? -6.524  9.077   -59.116 1.00 48.71  ?  32   PHE B CD1 1 
ATOM   4423 C  CD2 . PHE B  1 32  ? -6.414  8.153   -61.313 1.00 53.10  ?  32   PHE B CD2 1 
ATOM   4424 C  CE1 . PHE B  1 32  ? -7.554  9.908   -59.514 1.00 49.13  ?  32   PHE B CE1 1 
ATOM   4425 C  CE2 . PHE B  1 32  ? -7.439  8.980   -61.721 1.00 52.66  ?  32   PHE B CE2 1 
ATOM   4426 C  CZ  . PHE B  1 32  ? -8.009  9.863   -60.820 1.00 53.02  ?  32   PHE B CZ  1 
ATOM   4427 N  N   . LEU B  1 33  ? -4.245  3.832   -58.675 1.00 43.80  ?  33   LEU B N   1 
ATOM   4428 C  CA  . LEU B  1 33  ? -3.394  2.870   -58.005 1.00 37.18  ?  33   LEU B CA  1 
ATOM   4429 C  C   . LEU B  1 33  ? -2.446  2.193   -58.987 1.00 50.48  ?  33   LEU B C   1 
ATOM   4430 O  O   . LEU B  1 33  ? -2.867  1.723   -60.035 1.00 62.72  ?  33   LEU B O   1 
ATOM   4431 C  CB  . LEU B  1 33  ? -4.280  1.825   -57.331 1.00 33.10  ?  33   LEU B CB  1 
ATOM   4432 C  CG  . LEU B  1 33  ? -5.392  2.400   -56.438 1.00 44.35  ?  33   LEU B CG  1 
ATOM   4433 C  CD1 . LEU B  1 33  ? -6.265  1.303   -55.825 1.00 41.13  ?  33   LEU B CD1 1 
ATOM   4434 C  CD2 . LEU B  1 33  ? -4.818  3.287   -55.344 1.00 38.81  ?  33   LEU B CD2 1 
ATOM   4435 N  N   . GLY B  1 34  ? -1.165  2.135   -58.646 1.00 53.65  ?  34   GLY B N   1 
ATOM   4436 C  CA  . GLY B  1 34  ? -0.204  1.425   -59.470 1.00 44.17  ?  34   GLY B CA  1 
ATOM   4437 C  C   . GLY B  1 34  ? 0.516   2.285   -60.493 1.00 48.66  ?  34   GLY B C   1 
ATOM   4438 O  O   . GLY B  1 34  ? 1.022   1.775   -61.488 1.00 53.11  ?  34   GLY B O   1 
ATOM   4439 N  N   . ILE B  1 35  ? 0.573   3.589   -60.251 1.00 43.54  ?  35   ILE B N   1 
ATOM   4440 C  CA  . ILE B  1 35  ? 1.195   4.510   -61.196 1.00 42.27  ?  35   ILE B CA  1 
ATOM   4441 C  C   . ILE B  1 35  ? 2.714   4.387   -61.125 1.00 50.30  ?  35   ILE B C   1 
ATOM   4442 O  O   . ILE B  1 35  ? 3.302   4.624   -60.073 1.00 60.18  ?  35   ILE B O   1 
ATOM   4443 C  CB  . ILE B  1 35  ? 0.820   5.970   -60.871 1.00 39.52  ?  35   ILE B CB  1 
ATOM   4444 C  CG1 . ILE B  1 35  ? -0.693  6.132   -60.712 1.00 39.18  ?  35   ILE B CG1 1 
ATOM   4445 C  CG2 . ILE B  1 35  ? 1.382   6.915   -61.908 1.00 30.33  ?  35   ILE B CG2 1 
ATOM   4446 C  CD1 . ILE B  1 35  ? -1.119  7.533   -60.248 1.00 34.06  ?  35   ILE B CD1 1 
ATOM   4447 N  N   . PRO B  1 36  ? 3.361   4.023   -62.244 1.00 45.45  ?  36   PRO B N   1 
ATOM   4448 C  CA  . PRO B  1 36  ? 4.820   3.891   -62.246 1.00 34.14  ?  36   PRO B CA  1 
ATOM   4449 C  C   . PRO B  1 36  ? 5.495   5.249   -62.224 1.00 43.66  ?  36   PRO B C   1 
ATOM   4450 O  O   . PRO B  1 36  ? 5.084   6.146   -62.968 1.00 45.21  ?  36   PRO B O   1 
ATOM   4451 C  CB  . PRO B  1 36  ? 5.107   3.202   -63.583 1.00 33.23  ?  36   PRO B CB  1 
ATOM   4452 C  CG  . PRO B  1 36  ? 3.961   3.570   -64.455 1.00 37.16  ?  36   PRO B CG  1 
ATOM   4453 C  CD  . PRO B  1 36  ? 2.767   3.694   -63.553 1.00 39.20  ?  36   PRO B CD  1 
ATOM   4454 N  N   . PHE B  1 37  ? 6.514   5.398   -61.379 1.00 43.05  ?  37   PHE B N   1 
ATOM   4455 C  CA  . PHE B  1 37  ? 7.270   6.643   -61.306 1.00 38.71  ?  37   PHE B CA  1 
ATOM   4456 C  C   . PHE B  1 37  ? 8.742   6.412   -61.623 1.00 40.93  ?  37   PHE B C   1 
ATOM   4457 O  O   . PHE B  1 37  ? 9.531   7.355   -61.718 1.00 41.44  ?  37   PHE B O   1 
ATOM   4458 C  CB  . PHE B  1 37  ? 7.072   7.348   -59.959 1.00 39.49  ?  37   PHE B CB  1 
ATOM   4459 C  CG  . PHE B  1 37  ? 7.621   6.591   -58.757 1.00 43.64  ?  37   PHE B CG  1 
ATOM   4460 C  CD1 . PHE B  1 37  ? 8.926   6.789   -58.326 1.00 45.06  ?  37   PHE B CD1 1 
ATOM   4461 C  CD2 . PHE B  1 37  ? 6.811   5.725   -58.029 1.00 45.13  ?  37   PHE B CD2 1 
ATOM   4462 C  CE1 . PHE B  1 37  ? 9.421   6.121   -57.206 1.00 48.50  ?  37   PHE B CE1 1 
ATOM   4463 C  CE2 . PHE B  1 37  ? 7.301   5.045   -56.906 1.00 37.87  ?  37   PHE B CE2 1 
ATOM   4464 C  CZ  . PHE B  1 37  ? 8.605   5.247   -56.493 1.00 37.27  ?  37   PHE B CZ  1 
ATOM   4465 N  N   . ALA B  1 38  ? 9.100   5.149   -61.829 1.00 44.35  ?  38   ALA B N   1 
ATOM   4466 C  CA  . ALA B  1 38  ? 10.472  4.813   -62.169 1.00 40.56  ?  38   ALA B CA  1 
ATOM   4467 C  C   . ALA B  1 38  ? 10.532  3.634   -63.120 1.00 45.91  ?  38   ALA B C   1 
ATOM   4468 O  O   . ALA B  1 38  ? 9.608   2.824   -63.177 1.00 50.44  ?  38   ALA B O   1 
ATOM   4469 C  CB  . ALA B  1 38  ? 11.274  4.503   -60.915 1.00 30.99  ?  38   ALA B CB  1 
ATOM   4470 N  N   . GLU B  1 39  ? 11.632  3.553   -63.860 1.00 37.15  ?  39   GLU B N   1 
ATOM   4471 C  CA  . GLU B  1 39  ? 11.986  2.340   -64.574 1.00 44.26  ?  39   GLU B CA  1 
ATOM   4472 C  C   . GLU B  1 39  ? 12.227  1.225   -63.566 1.00 54.51  ?  39   GLU B C   1 
ATOM   4473 O  O   . GLU B  1 39  ? 13.002  1.406   -62.619 1.00 56.36  ?  39   GLU B O   1 
ATOM   4474 C  CB  . GLU B  1 39  ? 13.271  2.560   -65.375 1.00 38.63  ?  39   GLU B CB  1 
ATOM   4475 C  CG  . GLU B  1 39  ? 13.126  3.557   -66.494 1.00 47.82  ?  39   GLU B CG  1 
ATOM   4476 C  CD  . GLU B  1 39  ? 12.252  3.030   -67.612 1.00 53.88  ?  39   GLU B CD  1 
ATOM   4477 O  OE1 . GLU B  1 39  ? 11.018  3.211   -67.521 1.00 56.75  ?  39   GLU B OE1 1 
ATOM   4478 O  OE2 . GLU B  1 39  ? 12.806  2.429   -68.567 1.00 54.55  ?  39   GLU B OE2 1 
ATOM   4479 N  N   . PRO B  1 40  ? 11.574  0.070   -63.770 1.00 54.99  ?  40   PRO B N   1 
ATOM   4480 C  CA  . PRO B  1 40  ? 11.765  -1.149  -62.976 1.00 56.35  ?  40   PRO B CA  1 
ATOM   4481 C  C   . PRO B  1 40  ? 13.228  -1.414  -62.660 1.00 54.99  ?  40   PRO B C   1 
ATOM   4482 O  O   . PRO B  1 40  ? 13.987  -1.713  -63.571 1.00 62.51  ?  40   PRO B O   1 
ATOM   4483 C  CB  . PRO B  1 40  ? 11.230  -2.235  -63.906 1.00 51.77  ?  40   PRO B CB  1 
ATOM   4484 C  CG  . PRO B  1 40  ? 10.108  -1.562  -64.603 1.00 38.27  ?  40   PRO B CG  1 
ATOM   4485 C  CD  . PRO B  1 40  ? 10.571  -0.134  -64.829 1.00 48.42  ?  40   PRO B CD  1 
ATOM   4486 N  N   . PRO B  1 41  ? 13.609  -1.309  -61.375 1.00 58.42  ?  41   PRO B N   1 
ATOM   4487 C  CA  . PRO B  1 41  ? 14.991  -1.403  -60.894 1.00 58.52  ?  41   PRO B CA  1 
ATOM   4488 C  C   . PRO B  1 41  ? 15.503  -2.842  -60.875 1.00 60.77  ?  41   PRO B C   1 
ATOM   4489 O  O   . PRO B  1 41  ? 16.092  -3.289  -59.891 1.00 69.82  ?  41   PRO B O   1 
ATOM   4490 C  CB  . PRO B  1 41  ? 14.883  -0.872  -59.462 1.00 50.38  ?  41   PRO B CB  1 
ATOM   4491 C  CG  . PRO B  1 41  ? 13.507  -1.273  -59.038 1.00 40.66  ?  41   PRO B CG  1 
ATOM   4492 C  CD  . PRO B  1 41  ? 12.656  -1.100  -60.264 1.00 47.04  ?  41   PRO B CD  1 
ATOM   4493 N  N   . VAL B  1 42  ? 15.284  -3.548  -61.971 1.00 56.67  ?  42   VAL B N   1 
ATOM   4494 C  CA  . VAL B  1 42  ? 15.642  -4.953  -62.096 1.00 53.92  ?  42   VAL B CA  1 
ATOM   4495 C  C   . VAL B  1 42  ? 16.897  -5.172  -62.952 1.00 55.69  ?  42   VAL B C   1 
ATOM   4496 O  O   . VAL B  1 42  ? 17.397  -4.261  -63.620 1.00 46.80  ?  42   VAL B O   1 
ATOM   4497 C  CB  . VAL B  1 42  ? 14.462  -5.738  -62.691 1.00 45.79  ?  42   VAL B CB  1 
ATOM   4498 C  CG1 . VAL B  1 42  ? 13.225  -5.594  -61.766 1.00 39.59  ?  42   VAL B CG1 1 
ATOM   4499 C  CG2 . VAL B  1 42  ? 14.134  -5.197  -64.054 1.00 38.00  ?  42   VAL B CG2 1 
ATOM   4500 N  N   . GLY B  1 43  ? 17.408  -6.396  -62.916 1.00 59.23  ?  43   GLY B N   1 
ATOM   4501 C  CA  . GLY B  1 43  ? 18.628  -6.732  -63.621 1.00 48.80  ?  43   GLY B CA  1 
ATOM   4502 C  C   . GLY B  1 43  ? 19.842  -5.935  -63.168 1.00 57.49  ?  43   GLY B C   1 
ATOM   4503 O  O   . GLY B  1 43  ? 20.273  -6.014  -62.008 1.00 60.57  ?  43   GLY B O   1 
ATOM   4504 N  N   . SER B  1 44  ? 20.402  -5.169  -64.100 1.00 63.08  ?  44   SER B N   1 
ATOM   4505 C  CA  . SER B  1 44  ? 21.613  -4.404  -63.848 1.00 62.53  ?  44   SER B CA  1 
ATOM   4506 C  C   . SER B  1 44  ? 21.279  -3.139  -63.064 1.00 58.98  ?  44   SER B C   1 
ATOM   4507 O  O   . SER B  1 44  ? 22.170  -2.434  -62.575 1.00 57.19  ?  44   SER B O   1 
ATOM   4508 C  CB  . SER B  1 44  ? 22.304  -4.045  -65.163 1.00 57.91  ?  44   SER B CB  1 
ATOM   4509 O  OG  . SER B  1 44  ? 21.641  -2.955  -65.785 1.00 64.92  ?  44   SER B OG  1 
ATOM   4510 N  N   . ARG B  1 45  ? 19.987  -2.859  -62.949 1.00 50.43  ?  45   ARG B N   1 
ATOM   4511 C  CA  . ARG B  1 45  ? 19.525  -1.701  -62.200 1.00 58.97  ?  45   ARG B CA  1 
ATOM   4512 C  C   . ARG B  1 45  ? 19.427  -1.982  -60.690 1.00 59.71  ?  45   ARG B C   1 
ATOM   4513 O  O   . ARG B  1 45  ? 19.197  -1.071  -59.891 1.00 58.21  ?  45   ARG B O   1 
ATOM   4514 C  CB  . ARG B  1 45  ? 18.169  -1.252  -62.740 1.00 60.89  ?  45   ARG B CB  1 
ATOM   4515 C  CG  . ARG B  1 45  ? 18.216  -0.598  -64.108 1.00 59.28  ?  45   ARG B CG  1 
ATOM   4516 C  CD  . ARG B  1 45  ? 18.592  0.868   -63.980 1.00 73.03  ?  45   ARG B CD  1 
ATOM   4517 N  NE  . ARG B  1 45  ? 20.035  1.090   -64.030 1.00 83.25  ?  45   ARG B NE  1 
ATOM   4518 C  CZ  . ARG B  1 45  ? 20.662  2.112   -63.451 1.00 86.86  ?  45   ARG B CZ  1 
ATOM   4519 N  NH1 . ARG B  1 45  ? 19.983  3.011   -62.745 1.00 78.85  ?  45   ARG B NH1 1 
ATOM   4520 N  NH2 . ARG B  1 45  ? 21.978  2.226   -63.570 1.00 92.88  ?  45   ARG B NH2 1 
ATOM   4521 N  N   . ARG B  1 46  ? 19.593  -3.244  -60.307 1.00 59.57  ?  46   ARG B N   1 
ATOM   4522 C  CA  . ARG B  1 46  ? 19.535  -3.625  -58.904 1.00 55.98  ?  46   ARG B CA  1 
ATOM   4523 C  C   . ARG B  1 46  ? 20.643  -2.928  -58.121 1.00 55.40  ?  46   ARG B C   1 
ATOM   4524 O  O   . ARG B  1 46  ? 21.789  -2.856  -58.593 1.00 53.36  ?  46   ARG B O   1 
ATOM   4525 C  CB  . ARG B  1 46  ? 19.662  -5.143  -58.757 1.00 56.00  ?  46   ARG B CB  1 
ATOM   4526 C  CG  . ARG B  1 46  ? 19.463  -5.639  -57.341 1.00 54.70  ?  46   ARG B CG  1 
ATOM   4527 C  CD  . ARG B  1 46  ? 19.859  -7.099  -57.212 1.00 54.60  ?  46   ARG B CD  1 
ATOM   4528 N  NE  . ARG B  1 46  ? 18.725  -8.012  -57.302 1.00 52.13  ?  46   ARG B NE  1 
ATOM   4529 C  CZ  . ARG B  1 46  ? 18.820  -9.328  -57.128 1.00 53.68  ?  46   ARG B CZ  1 
ATOM   4530 N  NH1 . ARG B  1 46  ? 19.991  -9.877  -56.860 1.00 50.75  ?  46   ARG B NH1 1 
ATOM   4531 N  NH2 . ARG B  1 46  ? 17.747  -10.098 -57.217 1.00 57.14  ?  46   ARG B NH2 1 
ATOM   4532 N  N   . PHE B  1 47  ? 20.281  -2.420  -56.938 1.00 49.07  ?  47   PHE B N   1 
ATOM   4533 C  CA  . PHE B  1 47  ? 21.163  -1.630  -56.054 1.00 46.48  ?  47   PHE B CA  1 
ATOM   4534 C  C   . PHE B  1 47  ? 21.511  -0.241  -56.586 1.00 53.09  ?  47   PHE B C   1 
ATOM   4535 O  O   . PHE B  1 47  ? 22.356  0.440   -56.022 1.00 51.94  ?  47   PHE B O   1 
ATOM   4536 C  CB  . PHE B  1 47  ? 22.472  -2.350  -55.728 1.00 44.96  ?  47   PHE B CB  1 
ATOM   4537 C  CG  . PHE B  1 47  ? 22.308  -3.781  -55.348 1.00 52.42  ?  47   PHE B CG  1 
ATOM   4538 C  CD1 . PHE B  1 47  ? 21.562  -4.138  -54.244 1.00 44.59  ?  47   PHE B CD1 1 
ATOM   4539 C  CD2 . PHE B  1 47  ? 22.936  -4.778  -56.081 1.00 56.06  ?  47   PHE B CD2 1 
ATOM   4540 C  CE1 . PHE B  1 47  ? 21.422  -5.465  -53.882 1.00 51.14  ?  47   PHE B CE1 1 
ATOM   4541 C  CE2 . PHE B  1 47  ? 22.799  -6.110  -55.728 1.00 53.18  ?  47   PHE B CE2 1 
ATOM   4542 C  CZ  . PHE B  1 47  ? 22.039  -6.451  -54.623 1.00 54.93  ?  47   PHE B CZ  1 
ATOM   4543 N  N   . MET B  1 48  ? 20.884  0.182   -57.676 1.00 58.71  ?  48   MET B N   1 
ATOM   4544 C  CA  . MET B  1 48  ? 21.267  1.452   -58.273 1.00 52.31  ?  48   MET B CA  1 
ATOM   4545 C  C   . MET B  1 48  ? 20.182  2.510   -58.137 1.00 50.33  ?  48   MET B C   1 
ATOM   4546 O  O   . MET B  1 48  ? 19.026  2.171   -57.888 1.00 46.90  ?  48   MET B O   1 
ATOM   4547 C  CB  . MET B  1 48  ? 21.710  1.234   -59.718 1.00 54.38  ?  48   MET B CB  1 
ATOM   4548 C  CG  . MET B  1 48  ? 23.073  0.543   -59.786 1.00 51.89  ?  48   MET B CG  1 
ATOM   4549 S  SD  . MET B  1 48  ? 24.123  1.132   -61.110 1.00 105.79 ?  48   MET B SD  1 
ATOM   4550 C  CE  . MET B  1 48  ? 24.260  2.862   -60.679 1.00 102.36 ?  48   MET B CE  1 
ATOM   4551 N  N   . PRO B  1 49  ? 20.561  3.797   -58.249 1.00 53.08  ?  49   PRO B N   1 
ATOM   4552 C  CA  . PRO B  1 49  ? 19.569  4.871   -58.155 1.00 49.03  ?  49   PRO B CA  1 
ATOM   4553 C  C   . PRO B  1 49  ? 18.462  4.651   -59.164 1.00 49.23  ?  49   PRO B C   1 
ATOM   4554 O  O   . PRO B  1 49  ? 18.715  4.135   -60.244 1.00 49.38  ?  49   PRO B O   1 
ATOM   4555 C  CB  . PRO B  1 49  ? 20.364  6.118   -58.541 1.00 47.67  ?  49   PRO B CB  1 
ATOM   4556 C  CG  . PRO B  1 49  ? 21.758  5.792   -58.234 1.00 50.14  ?  49   PRO B CG  1 
ATOM   4557 C  CD  . PRO B  1 49  ? 21.925  4.324   -58.431 1.00 49.41  ?  49   PRO B CD  1 
ATOM   4558 N  N   . PRO B  1 50  ? 17.234  5.022   -58.807 1.00 52.19  ?  50   PRO B N   1 
ATOM   4559 C  CA  . PRO B  1 50  ? 16.109  4.870   -59.735 1.00 42.71  ?  50   PRO B CA  1 
ATOM   4560 C  C   . PRO B  1 50  ? 16.220  5.843   -60.903 1.00 55.70  ?  50   PRO B C   1 
ATOM   4561 O  O   . PRO B  1 50  ? 16.853  6.889   -60.747 1.00 62.76  ?  50   PRO B O   1 
ATOM   4562 C  CB  . PRO B  1 50  ? 14.895  5.217   -58.874 1.00 43.51  ?  50   PRO B CB  1 
ATOM   4563 C  CG  . PRO B  1 50  ? 15.450  6.079   -57.761 1.00 49.56  ?  50   PRO B CG  1 
ATOM   4564 C  CD  . PRO B  1 50  ? 16.823  5.542   -57.490 1.00 47.37  ?  50   PRO B CD  1 
ATOM   4565 N  N   . GLU B  1 51  ? 15.637  5.491   -62.049 1.00 50.80  ?  51   GLU B N   1 
ATOM   4566 C  CA  . GLU B  1 51  ? 15.566  6.396   -63.190 1.00 56.31  ?  51   GLU B CA  1 
ATOM   4567 C  C   . GLU B  1 51  ? 14.101  6.662   -63.473 1.00 51.52  ?  51   GLU B C   1 
ATOM   4568 O  O   . GLU B  1 51  ? 13.273  5.766   -63.325 1.00 54.52  ?  51   GLU B O   1 
ATOM   4569 C  CB  . GLU B  1 51  ? 16.211  5.774   -64.435 1.00 66.32  ?  51   GLU B CB  1 
ATOM   4570 C  CG  . GLU B  1 51  ? 17.664  5.357   -64.286 1.00 76.23  ?  51   GLU B CG  1 
ATOM   4571 C  CD  . GLU B  1 51  ? 18.091  4.364   -65.360 1.00 93.37  ?  51   GLU B CD  1 
ATOM   4572 O  OE1 . GLU B  1 51  ? 17.318  3.419   -65.649 1.00 94.52  ?  51   GLU B OE1 1 
ATOM   4573 O  OE2 . GLU B  1 51  ? 19.199  4.530   -65.922 1.00 101.61 ?  51   GLU B OE2 1 
ATOM   4574 N  N   . PRO B  1 52  ? 13.774  7.893   -63.886 1.00 46.84  ?  52   PRO B N   1 
ATOM   4575 C  CA  . PRO B  1 52  ? 12.390  8.272   -64.198 1.00 48.20  ?  52   PRO B CA  1 
ATOM   4576 C  C   . PRO B  1 52  ? 11.729  7.358   -65.245 1.00 54.11  ?  52   PRO B C   1 
ATOM   4577 O  O   . PRO B  1 52  ? 12.388  6.878   -66.166 1.00 44.34  ?  52   PRO B O   1 
ATOM   4578 C  CB  . PRO B  1 52  ? 12.520  9.713   -64.723 1.00 42.75  ?  52   PRO B CB  1 
ATOM   4579 C  CG  . PRO B  1 52  ? 13.966  9.920   -64.983 1.00 47.21  ?  52   PRO B CG  1 
ATOM   4580 C  CD  . PRO B  1 52  ? 14.700  9.024   -64.037 1.00 49.09  ?  52   PRO B CD  1 
ATOM   4581 N  N   . LYS B  1 53  ? 10.431  7.120   -65.071 1.00 54.48  ?  53   LYS B N   1 
ATOM   4582 C  CA  . LYS B  1 53  ? 9.645   6.263   -65.952 1.00 54.49  ?  53   LYS B CA  1 
ATOM   4583 C  C   . LYS B  1 53  ? 9.512   6.829   -67.364 1.00 58.14  ?  53   LYS B C   1 
ATOM   4584 O  O   . LYS B  1 53  ? 9.137   7.994   -67.546 1.00 53.07  ?  53   LYS B O   1 
ATOM   4585 C  CB  . LYS B  1 53  ? 8.248   6.060   -65.357 1.00 48.04  ?  53   LYS B CB  1 
ATOM   4586 C  CG  . LYS B  1 53  ? 7.288   5.261   -66.233 1.00 46.27  ?  53   LYS B CG  1 
ATOM   4587 C  CD  . LYS B  1 53  ? 7.628   3.772   -66.229 1.00 49.23  ?  53   LYS B CD  1 
ATOM   4588 C  CE  . LYS B  1 53  ? 6.623   2.965   -67.058 1.00 47.57  ?  53   LYS B CE  1 
ATOM   4589 N  NZ  . LYS B  1 53  ? 6.836   3.162   -68.524 1.00 49.29  ?  53   LYS B NZ  1 
ATOM   4590 N  N   . ARG B  1 54  ? 9.815   5.999   -68.360 1.00 56.58  ?  54   ARG B N   1 
ATOM   4591 C  CA  . ARG B  1 54  ? 9.615   6.382   -69.750 1.00 52.06  ?  54   ARG B CA  1 
ATOM   4592 C  C   . ARG B  1 54  ? 8.128   6.612   -70.010 1.00 51.66  ?  54   ARG B C   1 
ATOM   4593 O  O   . ARG B  1 54  ? 7.285   5.893   -69.479 1.00 48.28  ?  54   ARG B O   1 
ATOM   4594 C  CB  . ARG B  1 54  ? 10.153  5.298   -70.688 1.00 57.63  ?  54   ARG B CB  1 
ATOM   4595 C  CG  . ARG B  1 54  ? 11.666  5.171   -70.668 1.00 62.63  ?  54   ARG B CG  1 
ATOM   4596 C  CD  . ARG B  1 54  ? 12.157  3.991   -71.482 1.00 52.07  ?  54   ARG B CD  1 
ATOM   4597 N  NE  . ARG B  1 54  ? 11.555  2.739   -71.033 1.00 57.83  ?  54   ARG B NE  1 
ATOM   4598 C  CZ  . ARG B  1 54  ? 10.794  1.951   -71.792 1.00 63.15  ?  54   ARG B CZ  1 
ATOM   4599 N  NH1 . ARG B  1 54  ? 10.545  2.270   -73.068 1.00 55.67  ?  54   ARG B NH1 1 
ATOM   4600 N  NH2 . ARG B  1 54  ? 10.292  0.832   -71.279 1.00 56.23  ?  54   ARG B NH2 1 
ATOM   4601 N  N   . PRO B  1 55  ? 7.801   7.630   -70.817 1.00 58.86  ?  55   PRO B N   1 
ATOM   4602 C  CA  . PRO B  1 55  ? 6.438   7.823   -71.331 1.00 63.71  ?  55   PRO B CA  1 
ATOM   4603 C  C   . PRO B  1 55  ? 5.837   6.517   -71.873 1.00 60.79  ?  55   PRO B C   1 
ATOM   4604 O  O   . PRO B  1 55  ? 6.570   5.620   -72.305 1.00 52.01  ?  55   PRO B O   1 
ATOM   4605 C  CB  . PRO B  1 55  ? 6.644   8.801   -72.491 1.00 69.71  ?  55   PRO B CB  1 
ATOM   4606 C  CG  . PRO B  1 55  ? 7.853   9.584   -72.108 1.00 69.47  ?  55   PRO B CG  1 
ATOM   4607 C  CD  . PRO B  1 55  ? 8.739   8.653   -71.317 1.00 64.14  ?  55   PRO B CD  1 
ATOM   4608 N  N   . TRP B  1 56  ? 4.513   6.418   -71.842 1.00 56.04  ?  56   TRP B N   1 
ATOM   4609 C  CA  . TRP B  1 56  ? 3.822   5.232   -72.326 1.00 55.34  ?  56   TRP B CA  1 
ATOM   4610 C  C   . TRP B  1 56  ? 2.731   5.614   -73.309 1.00 59.22  ?  56   TRP B C   1 
ATOM   4611 O  O   . TRP B  1 56  ? 2.308   6.772   -73.357 1.00 57.44  ?  56   TRP B O   1 
ATOM   4612 C  CB  . TRP B  1 56  ? 3.209   4.448   -71.172 1.00 47.91  ?  56   TRP B CB  1 
ATOM   4613 C  CG  . TRP B  1 56  ? 2.230   5.246   -70.377 1.00 53.61  ?  56   TRP B CG  1 
ATOM   4614 C  CD1 . TRP B  1 56  ? 0.899   5.399   -70.624 1.00 49.30  ?  56   TRP B CD1 1 
ATOM   4615 C  CD2 . TRP B  1 56  ? 2.510   6.003   -69.190 1.00 50.68  ?  56   TRP B CD2 1 
ATOM   4616 N  NE1 . TRP B  1 56  ? 0.330   6.212   -69.666 1.00 51.45  ?  56   TRP B NE1 1 
ATOM   4617 C  CE2 . TRP B  1 56  ? 1.299   6.588   -68.772 1.00 50.22  ?  56   TRP B CE2 1 
ATOM   4618 C  CE3 . TRP B  1 56  ? 3.670   6.239   -68.440 1.00 47.22  ?  56   TRP B CE3 1 
ATOM   4619 C  CZ2 . TRP B  1 56  ? 1.213   7.396   -67.641 1.00 54.58  ?  56   TRP B CZ2 1 
ATOM   4620 C  CZ3 . TRP B  1 56  ? 3.586   7.040   -67.321 1.00 49.29  ?  56   TRP B CZ3 1 
ATOM   4621 C  CH2 . TRP B  1 56  ? 2.364   7.609   -66.928 1.00 53.07  ?  56   TRP B CH2 1 
ATOM   4622 N  N   . SER B  1 57  ? 2.268   4.631   -74.078 1.00 58.23  ?  57   SER B N   1 
ATOM   4623 C  CA  . SER B  1 57  ? 1.218   4.863   -75.058 1.00 57.82  ?  57   SER B CA  1 
ATOM   4624 C  C   . SER B  1 57  ? -0.150  4.551   -74.473 1.00 52.25  ?  57   SER B C   1 
ATOM   4625 O  O   . SER B  1 57  ? -0.250  3.863   -73.466 1.00 62.11  ?  57   SER B O   1 
ATOM   4626 C  CB  . SER B  1 57  ? 1.463   4.020   -76.317 1.00 61.10  ?  57   SER B CB  1 
ATOM   4627 O  OG  . SER B  1 57  ? 1.265   2.637   -76.062 1.00 59.28  ?  57   SER B OG  1 
ATOM   4628 N  N   . GLY B  1 58  ? -1.199  5.063   -75.109 1.00 53.05  ?  58   GLY B N   1 
ATOM   4629 C  CA  . GLY B  1 58  ? -2.564  4.786   -74.697 1.00 53.20  ?  58   GLY B CA  1 
ATOM   4630 C  C   . GLY B  1 58  ? -2.895  5.152   -73.256 1.00 63.53  ?  58   GLY B C   1 
ATOM   4631 O  O   . GLY B  1 58  ? -2.289  6.048   -72.663 1.00 60.00  ?  58   GLY B O   1 
ATOM   4632 N  N   . VAL B  1 59  ? -3.875  4.449   -72.697 1.00 61.13  ?  59   VAL B N   1 
ATOM   4633 C  CA  . VAL B  1 59  ? -4.353  4.719   -71.350 1.00 57.40  ?  59   VAL B CA  1 
ATOM   4634 C  C   . VAL B  1 59  ? -3.894  3.628   -70.383 1.00 59.46  ?  59   VAL B C   1 
ATOM   4635 O  O   . VAL B  1 59  ? -4.297  2.461   -70.493 1.00 50.83  ?  59   VAL B O   1 
ATOM   4636 C  CB  . VAL B  1 59  ? -5.890  4.807   -71.304 1.00 62.00  ?  59   VAL B CB  1 
ATOM   4637 C  CG1 . VAL B  1 59  ? -6.360  5.293   -69.919 1.00 58.51  ?  59   VAL B CG1 1 
ATOM   4638 C  CG2 . VAL B  1 59  ? -6.412  5.724   -72.413 1.00 52.18  ?  59   VAL B CG2 1 
ATOM   4639 N  N   . LEU B  1 60  ? -3.052  4.017   -69.432 1.00 48.17  ?  60   LEU B N   1 
ATOM   4640 C  CA  . LEU B  1 60  ? -2.543  3.072   -68.453 1.00 54.95  ?  60   LEU B CA  1 
ATOM   4641 C  C   . LEU B  1 60  ? -3.592  2.792   -67.377 1.00 57.43  ?  60   LEU B C   1 
ATOM   4642 O  O   . LEU B  1 60  ? -4.167  3.709   -66.783 1.00 60.47  ?  60   LEU B O   1 
ATOM   4643 C  CB  . LEU B  1 60  ? -1.245  3.593   -67.834 1.00 53.68  ?  60   LEU B CB  1 
ATOM   4644 C  CG  . LEU B  1 60  ? -0.389  2.617   -67.026 1.00 63.63  ?  60   LEU B CG  1 
ATOM   4645 C  CD1 . LEU B  1 60  ? -0.028  1.381   -67.851 1.00 68.91  ?  60   LEU B CD1 1 
ATOM   4646 C  CD2 . LEU B  1 60  ? 0.861   3.324   -66.576 1.00 60.37  ?  60   LEU B CD2 1 
ATOM   4647 N  N   . ASP B  1 61  ? -3.843  1.512   -67.144 1.00 57.99  ?  61   ASP B N   1 
ATOM   4648 C  CA  . ASP B  1 61  ? -4.816  1.088   -66.155 1.00 64.89  ?  61   ASP B CA  1 
ATOM   4649 C  C   . ASP B  1 61  ? -4.261  1.242   -64.739 1.00 67.74  ?  61   ASP B C   1 
ATOM   4650 O  O   . ASP B  1 61  ? -3.387  0.474   -64.323 1.00 71.53  ?  61   ASP B O   1 
ATOM   4651 C  CB  . ASP B  1 61  ? -5.202  -0.365  -66.414 1.00 71.40  ?  61   ASP B CB  1 
ATOM   4652 C  CG  . ASP B  1 61  ? -6.273  -0.856  -65.473 1.00 79.53  ?  61   ASP B CG  1 
ATOM   4653 O  OD1 . ASP B  1 61  ? -7.444  -0.454  -65.645 1.00 85.38  ?  61   ASP B OD1 1 
ATOM   4654 O  OD2 . ASP B  1 61  ? -5.942  -1.644  -64.567 1.00 81.38  ?  61   ASP B OD2 1 
ATOM   4655 N  N   . ALA B  1 62  ? -4.765  2.241   -64.012 1.00 61.06  ?  62   ALA B N   1 
ATOM   4656 C  CA  . ALA B  1 62  ? -4.324  2.519   -62.642 1.00 54.22  ?  62   ALA B CA  1 
ATOM   4657 C  C   . ALA B  1 62  ? -5.467  2.319   -61.649 1.00 57.22  ?  62   ALA B C   1 
ATOM   4658 O  O   . ALA B  1 62  ? -5.795  3.222   -60.873 1.00 51.56  ?  62   ALA B O   1 
ATOM   4659 C  CB  . ALA B  1 62  ? -3.774  3.937   -62.527 1.00 43.28  ?  62   ALA B CB  1 
ATOM   4660 N  N   . THR B  1 63  ? -6.064  1.132   -61.683 1.00 50.43  ?  63   THR B N   1 
ATOM   4661 C  CA  . THR B  1 63  ? -7.244  0.833   -60.891 1.00 53.37  ?  63   THR B CA  1 
ATOM   4662 C  C   . THR B  1 63  ? -6.932  -0.243  -59.850 1.00 66.18  ?  63   THR B C   1 
ATOM   4663 O  O   . THR B  1 63  ? -7.813  -0.687  -59.115 1.00 70.54  ?  63   THR B O   1 
ATOM   4664 C  CB  . THR B  1 63  ? -8.422  0.362   -61.797 1.00 63.74  ?  63   THR B CB  1 
ATOM   4665 O  OG1 . THR B  1 63  ? -8.113  -0.903  -62.403 1.00 54.54  ?  63   THR B OG1 1 
ATOM   4666 C  CG2 . THR B  1 63  ? -8.712  1.389   -62.887 1.00 48.26  ?  63   THR B CG2 1 
ATOM   4667 N  N   . THR B  1 64  ? -5.661  -0.624  -59.773 1.00 63.79  ?  64   THR B N   1 
ATOM   4668 C  CA  . THR B  1 64  ? -5.245  -1.832  -59.075 1.00 51.20  ?  64   THR B CA  1 
ATOM   4669 C  C   . THR B  1 64  ? -3.958  -1.546  -58.296 1.00 54.57  ?  64   THR B C   1 
ATOM   4670 O  O   . THR B  1 64  ? -3.142  -0.734  -58.720 1.00 55.53  ?  64   THR B O   1 
ATOM   4671 C  CB  . THR B  1 64  ? -5.039  -2.976  -60.122 1.00 74.33  ?  64   THR B CB  1 
ATOM   4672 O  OG1 . THR B  1 64  ? -5.880  -4.092  -59.810 1.00 70.60  ?  64   THR B OG1 1 
ATOM   4673 C  CG2 . THR B  1 64  ? -3.577  -3.426  -60.221 1.00 73.13  ?  64   THR B CG2 1 
ATOM   4674 N  N   . PHE B  1 65  ? -3.777  -2.176  -57.142 1.00 59.97  ?  65   PHE B N   1 
ATOM   4675 C  CA  . PHE B  1 65  ? -2.509  -2.028  -56.431 1.00 57.48  ?  65   PHE B CA  1 
ATOM   4676 C  C   . PHE B  1 65  ? -1.427  -2.834  -57.129 1.00 56.54  ?  65   PHE B C   1 
ATOM   4677 O  O   . PHE B  1 65  ? -1.654  -3.970  -57.552 1.00 55.74  ?  65   PHE B O   1 
ATOM   4678 C  CB  . PHE B  1 65  ? -2.618  -2.459  -54.961 1.00 52.36  ?  65   PHE B CB  1 
ATOM   4679 C  CG  . PHE B  1 65  ? -3.085  -1.367  -54.045 1.00 47.24  ?  65   PHE B CG  1 
ATOM   4680 C  CD1 . PHE B  1 65  ? -2.342  -0.203  -53.903 1.00 44.82  ?  65   PHE B CD1 1 
ATOM   4681 C  CD2 . PHE B  1 65  ? -4.267  -1.502  -53.324 1.00 45.64  ?  65   PHE B CD2 1 
ATOM   4682 C  CE1 . PHE B  1 65  ? -2.765  0.810   -53.064 1.00 50.16  ?  65   PHE B CE1 1 
ATOM   4683 C  CE2 . PHE B  1 65  ? -4.705  -0.490  -52.484 1.00 49.26  ?  65   PHE B CE2 1 
ATOM   4684 C  CZ  . PHE B  1 65  ? -3.953  0.664   -52.347 1.00 51.03  ?  65   PHE B CZ  1 
ATOM   4685 N  N   . GLN B  1 66  ? -0.247  -2.245  -57.240 1.00 59.26  ?  66   GLN B N   1 
ATOM   4686 C  CA  . GLN B  1 66  ? 0.869   -2.920  -57.881 1.00 64.74  ?  66   GLN B CA  1 
ATOM   4687 C  C   . GLN B  1 66  ? 1.616   -3.807  -56.896 1.00 67.82  ?  66   GLN B C   1 
ATOM   4688 O  O   . GLN B  1 66  ? 1.265   -3.865  -55.714 1.00 63.11  ?  66   GLN B O   1 
ATOM   4689 C  CB  . GLN B  1 66  ? 1.819   -1.897  -58.490 1.00 63.65  ?  66   GLN B CB  1 
ATOM   4690 C  CG  . GLN B  1 66  ? 1.469   -1.533  -59.902 1.00 59.08  ?  66   GLN B CG  1 
ATOM   4691 C  CD  . GLN B  1 66  ? 1.803   -2.631  -60.875 1.00 58.87  ?  66   GLN B CD  1 
ATOM   4692 O  OE1 . GLN B  1 66  ? 2.606   -3.520  -60.586 1.00 67.30  ?  66   GLN B OE1 1 
ATOM   4693 N  NE2 . GLN B  1 66  ? 1.195   -2.576  -62.039 1.00 52.83  ?  66   GLN B NE2 1 
ATOM   4694 N  N   . ASN B  1 67  ? 2.647   -4.490  -57.389 1.00 63.01  ?  67   ASN B N   1 
ATOM   4695 C  CA  . ASN B  1 67  ? 3.431   -5.413  -56.573 1.00 49.29  ?  67   ASN B CA  1 
ATOM   4696 C  C   . ASN B  1 67  ? 4.164   -4.757  -55.418 1.00 51.04  ?  67   ASN B C   1 
ATOM   4697 O  O   . ASN B  1 67  ? 4.526   -3.582  -55.475 1.00 58.95  ?  67   ASN B O   1 
ATOM   4698 C  CB  . ASN B  1 67  ? 4.420   -6.193  -57.438 1.00 46.23  ?  67   ASN B CB  1 
ATOM   4699 C  CG  . ASN B  1 67  ? 3.725   -7.166  -58.378 1.00 53.05  ?  67   ASN B CG  1 
ATOM   4700 O  OD1 . ASN B  1 67  ? 2.702   -7.757  -58.021 1.00 52.54  ?  67   ASN B OD1 1 
ATOM   4701 N  ND2 . ASN B  1 67  ? 4.268   -7.328  -59.589 1.00 52.30  ?  67   ASN B ND2 1 
ATOM   4702 N  N   . VAL B  1 68  ? 4.375   -5.542  -54.369 1.00 49.31  ?  68   VAL B N   1 
ATOM   4703 C  CA  . VAL B  1 68  ? 5.141   -5.130  -53.204 1.00 47.09  ?  68   VAL B CA  1 
ATOM   4704 C  C   . VAL B  1 68  ? 6.625   -5.355  -53.483 1.00 51.17  ?  68   VAL B C   1 
ATOM   4705 O  O   . VAL B  1 68  ? 6.997   -6.368  -54.082 1.00 58.72  ?  68   VAL B O   1 
ATOM   4706 C  CB  . VAL B  1 68  ? 4.706   -5.954  -51.972 1.00 49.94  ?  68   VAL B CB  1 
ATOM   4707 C  CG1 . VAL B  1 68  ? 5.575   -5.647  -50.770 1.00 47.17  ?  68   VAL B CG1 1 
ATOM   4708 C  CG2 . VAL B  1 68  ? 3.245   -5.684  -51.659 1.00 51.42  ?  68   VAL B CG2 1 
ATOM   4709 N  N   . CYS B  1 69  ? 7.463   -4.404  -53.077 1.00 47.31  ?  69   CYS B N   1 
ATOM   4710 C  CA  . CYS B  1 69  ? 8.910   -4.532  -53.226 1.00 43.05  ?  69   CYS B CA  1 
ATOM   4711 C  C   . CYS B  1 69  ? 9.381   -5.807  -52.563 1.00 52.87  ?  69   CYS B C   1 
ATOM   4712 O  O   . CYS B  1 69  ? 8.885   -6.165  -51.497 1.00 55.95  ?  69   CYS B O   1 
ATOM   4713 C  CB  . CYS B  1 69  ? 9.619   -3.328  -52.617 1.00 39.17  ?  69   CYS B CB  1 
ATOM   4714 S  SG  . CYS B  1 69  ? 9.388   -1.792  -53.539 1.00 57.88  ?  69   CYS B SG  1 
ATOM   4715 N  N   . TYR B  1 70  ? 10.314  -6.511  -53.197 1.00 61.11  ?  70   TYR B N   1 
ATOM   4716 C  CA  . TYR B  1 70  ? 10.744  -7.790  -52.644 1.00 60.84  ?  70   TYR B CA  1 
ATOM   4717 C  C   . TYR B  1 70  ? 11.294  -7.598  -51.237 1.00 56.45  ?  70   TYR B C   1 
ATOM   4718 O  O   . TYR B  1 70  ? 12.087  -6.690  -50.985 1.00 53.83  ?  70   TYR B O   1 
ATOM   4719 C  CB  . TYR B  1 70  ? 11.739  -8.533  -53.545 1.00 59.51  ?  70   TYR B CB  1 
ATOM   4720 C  CG  . TYR B  1 70  ? 11.623  -10.029 -53.374 1.00 54.09  ?  70   TYR B CG  1 
ATOM   4721 C  CD1 . TYR B  1 70  ? 12.256  -10.673 -52.328 1.00 48.28  ?  70   TYR B CD1 1 
ATOM   4722 C  CD2 . TYR B  1 70  ? 10.842  -10.793 -54.236 1.00 53.44  ?  70   TYR B CD2 1 
ATOM   4723 C  CE1 . TYR B  1 70  ? 12.139  -12.038 -52.148 1.00 50.41  ?  70   TYR B CE1 1 
ATOM   4724 C  CE2 . TYR B  1 70  ? 10.717  -12.166 -54.064 1.00 50.59  ?  70   TYR B CE2 1 
ATOM   4725 C  CZ  . TYR B  1 70  ? 11.364  -12.780 -53.008 1.00 51.70  ?  70   TYR B CZ  1 
ATOM   4726 O  OH  . TYR B  1 70  ? 11.251  -14.141 -52.805 1.00 51.35  ?  70   TYR B OH  1 
ATOM   4727 N  N   . GLN B  1 71  ? 10.829  -8.449  -50.326 1.00 55.16  ?  71   GLN B N   1 
ATOM   4728 C  CA  . GLN B  1 71  ? 11.112  -8.309  -48.905 1.00 51.62  ?  71   GLN B CA  1 
ATOM   4729 C  C   . GLN B  1 71  ? 10.853  -9.600  -48.131 1.00 50.65  ?  71   GLN B C   1 
ATOM   4730 O  O   . GLN B  1 71  ? 10.134  -10.498 -48.590 1.00 48.29  ?  71   GLN B O   1 
ATOM   4731 C  CB  . GLN B  1 71  ? 10.260  -7.188  -48.301 1.00 48.63  ?  71   GLN B CB  1 
ATOM   4732 C  CG  . GLN B  1 71  ? 8.763   -7.492  -48.224 1.00 44.33  ?  71   GLN B CG  1 
ATOM   4733 C  CD  . GLN B  1 71  ? 7.956   -6.250  -47.872 1.00 59.02  ?  71   GLN B CD  1 
ATOM   4734 O  OE1 . GLN B  1 71  ? 7.229   -6.215  -46.869 1.00 55.00  ?  71   GLN B OE1 1 
ATOM   4735 N  NE2 . GLN B  1 71  ? 8.094   -5.212  -48.693 1.00 62.58  ?  71   GLN B NE2 1 
ATOM   4736 N  N   . TYR B  1 72  ? 11.466  -9.667  -46.954 1.00 44.12  ?  72   TYR B N   1 
ATOM   4737 C  CA  . TYR B  1 72  ? 11.231  -10.707 -45.966 1.00 46.90  ?  72   TYR B CA  1 
ATOM   4738 C  C   . TYR B  1 72  ? 9.772   -10.710 -45.505 1.00 58.27  ?  72   TYR B C   1 
ATOM   4739 O  O   . TYR B  1 72  ? 9.207   -9.656  -45.202 1.00 69.30  ?  72   TYR B O   1 
ATOM   4740 C  CB  . TYR B  1 72  ? 12.166  -10.459 -44.773 1.00 45.61  ?  72   TYR B CB  1 
ATOM   4741 C  CG  . TYR B  1 72  ? 11.938  -11.356 -43.588 1.00 49.06  ?  72   TYR B CG  1 
ATOM   4742 C  CD1 . TYR B  1 72  ? 12.212  -12.719 -43.663 1.00 55.75  ?  72   TYR B CD1 1 
ATOM   4743 C  CD2 . TYR B  1 72  ? 11.465  -10.843 -42.386 1.00 51.90  ?  72   TYR B CD2 1 
ATOM   4744 C  CE1 . TYR B  1 72  ? 12.012  -13.552 -42.577 1.00 59.99  ?  72   TYR B CE1 1 
ATOM   4745 C  CE2 . TYR B  1 72  ? 11.264  -11.667 -41.284 1.00 55.13  ?  72   TYR B CE2 1 
ATOM   4746 C  CZ  . TYR B  1 72  ? 11.539  -13.022 -41.386 1.00 62.72  ?  72   TYR B CZ  1 
ATOM   4747 O  OH  . TYR B  1 72  ? 11.340  -13.851 -40.304 1.00 68.46  ?  72   TYR B OH  1 
ATOM   4748 N  N   . VAL B  1 73  ? 9.168   -11.895 -45.454 1.00 59.77  ?  73   VAL B N   1 
ATOM   4749 C  CA  . VAL B  1 73  ? 7.796   -12.058 -44.967 1.00 61.25  ?  73   VAL B CA  1 
ATOM   4750 C  C   . VAL B  1 73  ? 7.782   -12.711 -43.581 1.00 63.33  ?  73   VAL B C   1 
ATOM   4751 O  O   . VAL B  1 73  ? 8.263   -13.831 -43.419 1.00 64.13  ?  73   VAL B O   1 
ATOM   4752 C  CB  . VAL B  1 73  ? 6.972   -12.937 -45.925 1.00 65.63  ?  73   VAL B CB  1 
ATOM   4753 C  CG1 . VAL B  1 73  ? 5.587   -13.203 -45.351 1.00 66.18  ?  73   VAL B CG1 1 
ATOM   4754 C  CG2 . VAL B  1 73  ? 6.882   -12.291 -47.296 1.00 58.09  ?  73   VAL B CG2 1 
ATOM   4755 N  N   . ASP B  1 74  ? 7.220   -12.020 -42.588 1.00 63.16  ?  74   ASP B N   1 
ATOM   4756 C  CA  . ASP B  1 74  ? 7.257   -12.498 -41.203 1.00 49.58  ?  74   ASP B CA  1 
ATOM   4757 C  C   . ASP B  1 74  ? 6.568   -13.843 -40.937 1.00 57.70  ?  74   ASP B C   1 
ATOM   4758 O  O   . ASP B  1 74  ? 5.547   -14.158 -41.551 1.00 58.06  ?  74   ASP B O   1 
ATOM   4759 C  CB  . ASP B  1 74  ? 6.702   -11.448 -40.251 1.00 57.82  ?  74   ASP B CB  1 
ATOM   4760 C  CG  . ASP B  1 74  ? 6.942   -11.813 -38.818 1.00 60.45  ?  74   ASP B CG  1 
ATOM   4761 O  OD1 . ASP B  1 74  ? 8.102   -11.679 -38.387 1.00 64.07  ?  74   ASP B OD1 1 
ATOM   4762 O  OD2 . ASP B  1 74  ? 5.998   -12.285 -38.149 1.00 58.20  ?  74   ASP B OD2 1 
ATOM   4763 N  N   . THR B  1 75  ? 7.118   -14.618 -39.997 1.00 67.20  ?  75   THR B N   1 
ATOM   4764 C  CA  . THR B  1 75  ? 6.663   -15.992 -39.757 1.00 70.48  ?  75   THR B CA  1 
ATOM   4765 C  C   . THR B  1 75  ? 6.468   -16.357 -38.293 1.00 71.32  ?  75   THR B C   1 
ATOM   4766 O  O   . THR B  1 75  ? 6.181   -17.517 -37.988 1.00 73.75  ?  75   THR B O   1 
ATOM   4767 C  CB  . THR B  1 75  ? 7.672   -17.028 -40.292 1.00 70.21  ?  75   THR B CB  1 
ATOM   4768 O  OG1 . THR B  1 75  ? 8.920   -16.877 -39.597 1.00 74.90  ?  75   THR B OG1 1 
ATOM   4769 C  CG2 . THR B  1 75  ? 7.890   -16.866 -41.782 1.00 55.87  ?  75   THR B CG2 1 
ATOM   4770 N  N   . LEU B  1 76  ? 6.638   -15.394 -37.391 1.00 65.61  ?  76   LEU B N   1 
ATOM   4771 C  CA  . LEU B  1 76  ? 6.534   -15.686 -35.962 1.00 63.94  ?  76   LEU B CA  1 
ATOM   4772 C  C   . LEU B  1 76  ? 5.166   -16.266 -35.586 1.00 71.32  ?  76   LEU B C   1 
ATOM   4773 O  O   . LEU B  1 76  ? 5.079   -17.283 -34.892 1.00 81.20  ?  76   LEU B O   1 
ATOM   4774 C  CB  . LEU B  1 76  ? 6.845   -14.449 -35.113 1.00 55.78  ?  76   LEU B CB  1 
ATOM   4775 C  CG  . LEU B  1 76  ? 6.953   -14.713 -33.604 1.00 61.18  ?  76   LEU B CG  1 
ATOM   4776 C  CD1 . LEU B  1 76  ? 8.068   -15.715 -33.296 1.00 61.34  ?  76   LEU B CD1 1 
ATOM   4777 C  CD2 . LEU B  1 76  ? 7.168   -13.426 -32.817 1.00 53.94  ?  76   LEU B CD2 1 
ATOM   4778 N  N   . TYR B  1 77  ? 4.100   -15.624 -36.050 1.00 65.56  ?  77   TYR B N   1 
ATOM   4779 C  CA  . TYR B  1 77  ? 2.750   -16.091 -35.759 1.00 69.70  ?  77   TYR B CA  1 
ATOM   4780 C  C   . TYR B  1 77  ? 1.961   -16.240 -37.056 1.00 69.70  ?  77   TYR B C   1 
ATOM   4781 O  O   . TYR B  1 77  ? 1.285   -15.307 -37.481 1.00 68.14  ?  77   TYR B O   1 
ATOM   4782 C  CB  . TYR B  1 77  ? 2.031   -15.120 -34.816 1.00 68.89  ?  77   TYR B CB  1 
ATOM   4783 C  CG  . TYR B  1 77  ? 2.665   -14.979 -33.444 1.00 79.27  ?  77   TYR B CG  1 
ATOM   4784 C  CD1 . TYR B  1 77  ? 2.579   -16.004 -32.508 1.00 82.39  ?  77   TYR B CD1 1 
ATOM   4785 C  CD2 . TYR B  1 77  ? 3.329   -13.809 -33.073 1.00 75.79  ?  77   TYR B CD2 1 
ATOM   4786 C  CE1 . TYR B  1 77  ? 3.147   -15.875 -31.247 1.00 80.51  ?  77   TYR B CE1 1 
ATOM   4787 C  CE2 . TYR B  1 77  ? 3.898   -13.673 -31.814 1.00 68.85  ?  77   TYR B CE2 1 
ATOM   4788 C  CZ  . TYR B  1 77  ? 3.807   -14.709 -30.906 1.00 75.07  ?  77   TYR B CZ  1 
ATOM   4789 O  OH  . TYR B  1 77  ? 4.370   -14.590 -29.649 1.00 72.81  ?  77   TYR B OH  1 
ATOM   4790 N  N   . PRO B  1 78  ? 2.048   -17.418 -37.694 1.00 74.99  ?  78   PRO B N   1 
ATOM   4791 C  CA  . PRO B  1 78  ? 1.446   -17.613 -39.024 1.00 80.81  ?  78   PRO B CA  1 
ATOM   4792 C  C   . PRO B  1 78  ? -0.085  -17.541 -39.012 1.00 77.65  ?  78   PRO B C   1 
ATOM   4793 O  O   . PRO B  1 78  ? -0.737  -18.327 -38.331 1.00 76.91  ?  78   PRO B O   1 
ATOM   4794 C  CB  . PRO B  1 78  ? 1.915   -19.022 -39.428 1.00 79.40  ?  78   PRO B CB  1 
ATOM   4795 C  CG  . PRO B  1 78  ? 3.069   -19.337 -38.496 1.00 83.85  ?  78   PRO B CG  1 
ATOM   4796 C  CD  . PRO B  1 78  ? 2.759   -18.619 -37.222 1.00 75.40  ?  78   PRO B CD  1 
ATOM   4797 N  N   . GLY B  1 79  ? -0.647  -16.594 -39.756 1.00 72.84  ?  79   GLY B N   1 
ATOM   4798 C  CA  . GLY B  1 79  ? -2.088  -16.445 -39.831 1.00 71.92  ?  79   GLY B CA  1 
ATOM   4799 C  C   . GLY B  1 79  ? -2.720  -15.617 -38.723 1.00 75.06  ?  79   GLY B C   1 
ATOM   4800 O  O   . GLY B  1 79  ? -3.946  -15.501 -38.666 1.00 78.16  ?  79   GLY B O   1 
ATOM   4801 N  N   . PHE B  1 80  ? -1.896  -15.047 -37.844 1.00 65.46  ?  80   PHE B N   1 
ATOM   4802 C  CA  . PHE B  1 80  ? -2.382  -14.163 -36.786 1.00 56.89  ?  80   PHE B CA  1 
ATOM   4803 C  C   . PHE B  1 80  ? -2.544  -12.745 -37.330 1.00 57.07  ?  80   PHE B C   1 
ATOM   4804 O  O   . PHE B  1 80  ? -1.585  -12.136 -37.798 1.00 62.83  ?  80   PHE B O   1 
ATOM   4805 C  CB  . PHE B  1 80  ? -1.423  -14.197 -35.581 1.00 59.41  ?  80   PHE B CB  1 
ATOM   4806 C  CG  . PHE B  1 80  ? -1.724  -13.168 -34.516 1.00 55.69  ?  80   PHE B CG  1 
ATOM   4807 C  CD1 . PHE B  1 80  ? -2.910  -13.212 -33.795 1.00 56.00  ?  80   PHE B CD1 1 
ATOM   4808 C  CD2 . PHE B  1 80  ? -0.807  -12.177 -34.217 1.00 59.86  ?  80   PHE B CD2 1 
ATOM   4809 C  CE1 . PHE B  1 80  ? -3.188  -12.275 -32.816 1.00 51.85  ?  80   PHE B CE1 1 
ATOM   4810 C  CE2 . PHE B  1 80  ? -1.072  -11.237 -33.219 1.00 61.94  ?  80   PHE B CE2 1 
ATOM   4811 C  CZ  . PHE B  1 80  ? -2.268  -11.286 -32.524 1.00 57.23  ?  80   PHE B CZ  1 
ATOM   4812 N  N   . GLU B  1 81  ? -3.764  -12.224 -37.262 1.00 58.67  ?  81   GLU B N   1 
ATOM   4813 C  CA  . GLU B  1 81  ? -4.089  -10.911 -37.821 1.00 59.36  ?  81   GLU B CA  1 
ATOM   4814 C  C   . GLU B  1 81  ? -3.234  -9.758  -37.296 1.00 59.37  ?  81   GLU B C   1 
ATOM   4815 O  O   . GLU B  1 81  ? -3.091  -8.744  -37.966 1.00 69.12  ?  81   GLU B O   1 
ATOM   4816 C  CB  . GLU B  1 81  ? -5.578  -10.604 -37.629 1.00 72.99  ?  81   GLU B CB  1 
ATOM   4817 C  CG  . GLU B  1 81  ? -6.149  -11.135 -36.314 1.00 99.71  ?  81   GLU B CG  1 
ATOM   4818 C  CD  . GLU B  1 81  ? -7.675  -11.160 -36.291 1.00 119.26 ?  81   GLU B CD  1 
ATOM   4819 O  OE1 . GLU B  1 81  ? -8.299  -10.915 -37.350 1.00 124.76 ?  81   GLU B OE1 1 
ATOM   4820 O  OE2 . GLU B  1 81  ? -8.248  -11.427 -35.209 1.00 123.94 ?  81   GLU B OE2 1 
ATOM   4821 N  N   . GLY B  1 82  ? -2.651  -9.914  -36.114 1.00 59.63  ?  82   GLY B N   1 
ATOM   4822 C  CA  . GLY B  1 82  ? -1.849  -8.847  -35.534 1.00 56.05  ?  82   GLY B CA  1 
ATOM   4823 C  C   . GLY B  1 82  ? -0.506  -8.664  -36.215 1.00 53.50  ?  82   GLY B C   1 
ATOM   4824 O  O   . GLY B  1 82  ? 0.072   -7.573  -36.188 1.00 50.53  ?  82   GLY B O   1 
ATOM   4825 N  N   . THR B  1 83  ? -0.005  -9.738  -36.822 1.00 53.22  ?  83   THR B N   1 
ATOM   4826 C  CA  . THR B  1 83  ? 1.261   -9.698  -37.553 1.00 53.42  ?  83   THR B CA  1 
ATOM   4827 C  C   . THR B  1 83  ? 1.031   -9.665  -39.057 1.00 56.85  ?  83   THR B C   1 
ATOM   4828 O  O   . THR B  1 83  ? 1.816   -9.070  -39.807 1.00 56.60  ?  83   THR B O   1 
ATOM   4829 C  CB  . THR B  1 83  ? 2.144   -10.931 -37.249 1.00 60.18  ?  83   THR B CB  1 
ATOM   4830 O  OG1 . THR B  1 83  ? 1.357   -12.129 -37.332 1.00 59.17  ?  83   THR B OG1 1 
ATOM   4831 C  CG2 . THR B  1 83  ? 2.792   -10.828 -35.870 1.00 44.84  ?  83   THR B CG2 1 
ATOM   4832 N  N   . GLU B  1 84  ? -0.045  -10.318 -39.489 1.00 54.13  ?  84   GLU B N   1 
ATOM   4833 C  CA  . GLU B  1 84  ? -0.337  -10.468 -40.904 1.00 54.78  ?  84   GLU B CA  1 
ATOM   4834 C  C   . GLU B  1 84  ? -0.735  -9.147  -41.520 1.00 57.42  ?  84   GLU B C   1 
ATOM   4835 O  O   . GLU B  1 84  ? -0.470  -8.900  -42.698 1.00 52.68  ?  84   GLU B O   1 
ATOM   4836 C  CB  . GLU B  1 84  ? -1.452  -11.487 -41.128 1.00 58.27  ?  84   GLU B CB  1 
ATOM   4837 C  CG  . GLU B  1 84  ? -1.099  -12.917 -40.738 1.00 71.44  ?  84   GLU B CG  1 
ATOM   4838 C  CD  . GLU B  1 84  ? -0.023  -13.536 -41.616 1.00 77.72  ?  84   GLU B CD  1 
ATOM   4839 O  OE1 . GLU B  1 84  ? 0.405   -12.897 -42.607 1.00 74.52  ?  84   GLU B OE1 1 
ATOM   4840 O  OE2 . GLU B  1 84  ? 0.395   -14.675 -41.310 1.00 80.58  ?  84   GLU B OE2 1 
ATOM   4841 N  N   . MET B  1 85  ? -1.360  -8.291  -40.718 1.00 56.35  ?  85   MET B N   1 
ATOM   4842 C  CA  . MET B  1 85  ? -1.825  -6.996  -41.200 1.00 54.28  ?  85   MET B CA  1 
ATOM   4843 C  C   . MET B  1 85  ? -0.677  -6.137  -41.728 1.00 53.57  ?  85   MET B C   1 
ATOM   4844 O  O   . MET B  1 85  ? -0.908  -5.134  -42.408 1.00 57.62  ?  85   MET B O   1 
ATOM   4845 C  CB  . MET B  1 85  ? -2.572  -6.257  -40.090 1.00 49.43  ?  85   MET B CB  1 
ATOM   4846 C  CG  . MET B  1 85  ? -1.743  -6.066  -38.848 1.00 50.42  ?  85   MET B CG  1 
ATOM   4847 S  SD  . MET B  1 85  ? -2.667  -5.328  -37.477 1.00 67.00  ?  85   MET B SD  1 
ATOM   4848 C  CE  . MET B  1 85  ? -2.574  -3.601  -37.952 1.00 51.39  ?  85   MET B CE  1 
ATOM   4849 N  N   . TRP B  1 86  ? 0.552   -6.549  -41.414 1.00 48.30  ?  86   TRP B N   1 
ATOM   4850 C  CA  . TRP B  1 86  ? 1.768   -5.854  -41.833 1.00 47.41  ?  86   TRP B CA  1 
ATOM   4851 C  C   . TRP B  1 86  ? 2.484   -6.577  -42.980 1.00 49.46  ?  86   TRP B C   1 
ATOM   4852 O  O   . TRP B  1 86  ? 3.381   -6.020  -43.604 1.00 56.70  ?  86   TRP B O   1 
ATOM   4853 C  CB  . TRP B  1 86  ? 2.718   -5.688  -40.641 1.00 38.54  ?  86   TRP B CB  1 
ATOM   4854 C  CG  . TRP B  1 86  ? 2.039   -5.049  -39.487 1.00 62.02  ?  86   TRP B CG  1 
ATOM   4855 C  CD1 . TRP B  1 86  ? 1.593   -5.660  -38.351 1.00 60.77  ?  86   TRP B CD1 1 
ATOM   4856 C  CD2 . TRP B  1 86  ? 1.685   -3.668  -39.364 1.00 61.71  ?  86   TRP B CD2 1 
ATOM   4857 N  NE1 . TRP B  1 86  ? 0.994   -4.742  -37.525 1.00 56.56  ?  86   TRP B NE1 1 
ATOM   4858 C  CE2 . TRP B  1 86  ? 1.036   -3.512  -38.125 1.00 56.47  ?  86   TRP B CE2 1 
ATOM   4859 C  CE3 . TRP B  1 86  ? 1.857   -2.546  -40.182 1.00 60.51  ?  86   TRP B CE3 1 
ATOM   4860 C  CZ2 . TRP B  1 86  ? 0.561   -2.280  -37.683 1.00 57.19  ?  86   TRP B CZ2 1 
ATOM   4861 C  CZ3 . TRP B  1 86  ? 1.385   -1.324  -39.739 1.00 57.05  ?  86   TRP B CZ3 1 
ATOM   4862 C  CH2 . TRP B  1 86  ? 0.744   -1.200  -38.504 1.00 54.14  ?  86   TRP B CH2 1 
ATOM   4863 N  N   . ASN B  1 87  ? 2.105   -7.823  -43.232 1.00 39.50  ?  87   ASN B N   1 
ATOM   4864 C  CA  . ASN B  1 87  ? 2.718   -8.597  -44.304 1.00 51.51  ?  87   ASN B CA  1 
ATOM   4865 C  C   . ASN B  1 87  ? 2.205   -8.141  -45.677 1.00 55.92  ?  87   ASN B C   1 
ATOM   4866 O  O   . ASN B  1 87  ? 1.088   -7.628  -45.781 1.00 62.35  ?  87   ASN B O   1 
ATOM   4867 C  CB  . ASN B  1 87  ? 2.478   -10.101 -44.096 1.00 54.52  ?  87   ASN B CB  1 
ATOM   4868 C  CG  . ASN B  1 87  ? 3.497   -10.735 -43.161 1.00 59.99  ?  87   ASN B CG  1 
ATOM   4869 O  OD1 . ASN B  1 87  ? 4.616   -10.235 -43.004 1.00 59.91  ?  87   ASN B OD1 1 
ATOM   4870 N  ND2 . ASN B  1 87  ? 3.116   -11.849 -42.540 1.00 59.46  ?  87   ASN B ND2 1 
ATOM   4871 N  N   . PRO B  1 88  ? 3.025   -8.318  -46.727 1.00 50.64  ?  88   PRO B N   1 
ATOM   4872 C  CA  . PRO B  1 88  ? 2.653   -7.945  -48.098 1.00 47.85  ?  88   PRO B CA  1 
ATOM   4873 C  C   . PRO B  1 88  ? 1.294   -8.496  -48.505 1.00 49.81  ?  88   PRO B C   1 
ATOM   4874 O  O   . PRO B  1 88  ? 1.089   -9.709  -48.408 1.00 48.61  ?  88   PRO B O   1 
ATOM   4875 C  CB  . PRO B  1 88  ? 3.738   -8.619  -48.940 1.00 44.99  ?  88   PRO B CB  1 
ATOM   4876 C  CG  . PRO B  1 88  ? 4.931   -8.672  -48.045 1.00 40.37  ?  88   PRO B CG  1 
ATOM   4877 C  CD  . PRO B  1 88  ? 4.369   -8.924  -46.671 1.00 50.79  ?  88   PRO B CD  1 
ATOM   4878 N  N   . ASN B  1 89  ? 0.388   -7.622  -48.944 1.00 52.96  ?  89   ASN B N   1 
ATOM   4879 C  CA  . ASN B  1 89  ? -0.935  -8.047  -49.405 1.00 52.03  ?  89   ASN B CA  1 
ATOM   4880 C  C   . ASN B  1 89  ? -1.037  -8.142  -50.936 1.00 59.34  ?  89   ASN B C   1 
ATOM   4881 O  O   . ASN B  1 89  ? -2.134  -8.270  -51.489 1.00 65.79  ?  89   ASN B O   1 
ATOM   4882 C  CB  . ASN B  1 89  ? -2.043  -7.150  -48.824 1.00 48.62  ?  89   ASN B CB  1 
ATOM   4883 C  CG  . ASN B  1 89  ? -1.949  -5.707  -49.308 1.00 53.02  ?  89   ASN B CG  1 
ATOM   4884 O  OD1 . ASN B  1 89  ? -0.887  -5.248  -49.725 1.00 54.21  ?  89   ASN B OD1 1 
ATOM   4885 N  ND2 . ASN B  1 89  ? -3.066  -4.990  -49.254 1.00 49.61  ?  89   ASN B ND2 1 
ATOM   4886 N  N   . ARG B  1 90  ? 0.110   -8.078  -51.611 1.00 53.61  ?  90   ARG B N   1 
ATOM   4887 C  CA  . ARG B  1 90  ? 0.178   -8.337  -53.050 1.00 54.42  ?  90   ARG B CA  1 
ATOM   4888 C  C   . ARG B  1 90  ? 1.369   -9.230  -53.340 1.00 58.36  ?  90   ARG B C   1 
ATOM   4889 O  O   . ARG B  1 90  ? 2.090   -9.642  -52.423 1.00 53.95  ?  90   ARG B O   1 
ATOM   4890 C  CB  . ARG B  1 90  ? 0.324   -7.040  -53.851 1.00 43.86  ?  90   ARG B CB  1 
ATOM   4891 C  CG  . ARG B  1 90  ? -0.894  -6.151  -53.828 1.00 49.51  ?  90   ARG B CG  1 
ATOM   4892 C  CD  . ARG B  1 90  ? -2.091  -6.883  -54.393 1.00 60.83  ?  90   ARG B CD  1 
ATOM   4893 N  NE  . ARG B  1 90  ? -3.211  -5.990  -54.657 1.00 67.09  ?  90   ARG B NE  1 
ATOM   4894 C  CZ  . ARG B  1 90  ? -4.143  -5.686  -53.761 1.00 68.21  ?  90   ARG B CZ  1 
ATOM   4895 N  NH1 . ARG B  1 90  ? -4.081  -6.206  -52.542 1.00 64.44  ?  90   ARG B NH1 1 
ATOM   4896 N  NH2 . ARG B  1 90  ? -5.135  -4.866  -54.085 1.00 69.98  ?  90   ARG B NH2 1 
ATOM   4897 N  N   . GLU B  1 91  ? 1.577   -9.516  -54.621 1.00 49.80  ?  91   GLU B N   1 
ATOM   4898 C  CA  . GLU B  1 91  ? 2.724   -10.301 -55.053 1.00 49.34  ?  91   GLU B CA  1 
ATOM   4899 C  C   . GLU B  1 91  ? 4.023   -9.532  -54.850 1.00 50.07  ?  91   GLU B C   1 
ATOM   4900 O  O   . GLU B  1 91  ? 4.076   -8.313  -55.038 1.00 51.87  ?  91   GLU B O   1 
ATOM   4901 C  CB  . GLU B  1 91  ? 2.575   -10.693 -56.526 1.00 50.13  ?  91   GLU B CB  1 
ATOM   4902 C  CG  . GLU B  1 91  ? 1.679   -11.897 -56.753 1.00 60.16  ?  91   GLU B CG  1 
ATOM   4903 C  CD  . GLU B  1 91  ? 2.380   -13.208 -56.447 1.00 73.57  ?  91   GLU B CD  1 
ATOM   4904 O  OE1 . GLU B  1 91  ? 3.630   -13.220 -56.397 1.00 75.00  ?  91   GLU B OE1 1 
ATOM   4905 O  OE2 . GLU B  1 91  ? 1.682   -14.227 -56.261 1.00 82.42  ?  91   GLU B OE2 1 
ATOM   4906 N  N   . LEU B  1 92  ? 5.067   -10.254 -54.461 1.00 44.28  ?  92   LEU B N   1 
ATOM   4907 C  CA  . LEU B  1 92  ? 6.398   -9.678  -54.336 1.00 40.20  ?  92   LEU B CA  1 
ATOM   4908 C  C   . LEU B  1 92  ? 7.114   -9.559  -55.690 1.00 44.50  ?  92   LEU B C   1 
ATOM   4909 O  O   . LEU B  1 92  ? 7.109   -10.490 -56.507 1.00 44.15  ?  92   LEU B O   1 
ATOM   4910 C  CB  . LEU B  1 92  ? 7.241   -10.523 -53.384 1.00 40.69  ?  92   LEU B CB  1 
ATOM   4911 C  CG  . LEU B  1 92  ? 6.747   -10.647 -51.939 1.00 53.32  ?  92   LEU B CG  1 
ATOM   4912 C  CD1 . LEU B  1 92  ? 7.866   -11.173 -51.034 1.00 43.55  ?  92   LEU B CD1 1 
ATOM   4913 C  CD2 . LEU B  1 92  ? 6.199   -9.310  -51.431 1.00 50.30  ?  92   LEU B CD2 1 
ATOM   4914 N  N   . SER B  1 93  ? 7.744   -8.415  -55.915 1.00 45.28  ?  93   SER B N   1 
ATOM   4915 C  CA  . SER B  1 93  ? 8.557   -8.229  -57.106 1.00 46.13  ?  93   SER B CA  1 
ATOM   4916 C  C   . SER B  1 93  ? 9.613   -7.147  -56.896 1.00 53.00  ?  93   SER B C   1 
ATOM   4917 O  O   . SER B  1 93  ? 9.383   -6.185  -56.162 1.00 52.77  ?  93   SER B O   1 
ATOM   4918 C  CB  . SER B  1 93  ? 7.669   -7.844  -58.290 1.00 44.24  ?  93   SER B CB  1 
ATOM   4919 O  OG  . SER B  1 93  ? 8.437   -7.777  -59.480 1.00 41.44  ?  93   SER B OG  1 
ATOM   4920 N  N   . GLU B  1 94  ? 10.764  -7.294  -57.549 1.00 51.24  ?  94   GLU B N   1 
ATOM   4921 C  CA  . GLU B  1 94  ? 11.746  -6.214  -57.584 1.00 47.72  ?  94   GLU B CA  1 
ATOM   4922 C  C   . GLU B  1 94  ? 11.196  -5.067  -58.406 1.00 47.95  ?  94   GLU B C   1 
ATOM   4923 O  O   . GLU B  1 94  ? 11.604  -3.912  -58.251 1.00 42.53  ?  94   GLU B O   1 
ATOM   4924 C  CB  . GLU B  1 94  ? 13.057  -6.681  -58.197 1.00 54.83  ?  94   GLU B CB  1 
ATOM   4925 C  CG  . GLU B  1 94  ? 13.775  -7.701  -57.367 1.00 59.76  ?  94   GLU B CG  1 
ATOM   4926 C  CD  . GLU B  1 94  ? 15.265  -7.644  -57.559 1.00 62.21  ?  94   GLU B CD  1 
ATOM   4927 O  OE1 . GLU B  1 94  ? 15.844  -6.537  -57.411 1.00 62.96  ?  94   GLU B OE1 1 
ATOM   4928 O  OE2 . GLU B  1 94  ? 15.847  -8.709  -57.854 1.00 57.91  ?  94   GLU B OE2 1 
ATOM   4929 N  N   . ASP B  1 95  ? 10.278  -5.413  -59.302 1.00 43.95  ?  95   ASP B N   1 
ATOM   4930 C  CA  . ASP B  1 95  ? 9.593   -4.435  -60.113 1.00 47.00  ?  95   ASP B CA  1 
ATOM   4931 C  C   . ASP B  1 95  ? 8.482   -3.894  -59.244 1.00 40.02  ?  95   ASP B C   1 
ATOM   4932 O  O   . ASP B  1 95  ? 7.391   -4.439  -59.227 1.00 42.03  ?  95   ASP B O   1 
ATOM   4933 C  CB  . ASP B  1 95  ? 9.037   -5.122  -61.367 1.00 51.70  ?  95   ASP B CB  1 
ATOM   4934 C  CG  . ASP B  1 95  ? 8.247   -4.190  -62.259 1.00 53.10  ?  95   ASP B CG  1 
ATOM   4935 O  OD1 . ASP B  1 95  ? 8.024   -3.022  -61.877 1.00 51.06  ?  95   ASP B OD1 1 
ATOM   4936 O  OD2 . ASP B  1 95  ? 7.826   -4.646  -63.349 1.00 57.64  ?  95   ASP B OD2 1 
ATOM   4937 N  N   . CYS B  1 96  ? 8.743   -2.813  -58.523 1.00 46.58  ?  96   CYS B N   1 
ATOM   4938 C  CA  . CYS B  1 96  ? 7.761   -2.362  -57.534 1.00 45.00  ?  96   CYS B CA  1 
ATOM   4939 C  C   . CYS B  1 96  ? 7.640   -0.859  -57.387 1.00 46.50  ?  96   CYS B C   1 
ATOM   4940 O  O   . CYS B  1 96  ? 6.897   -0.384  -56.526 1.00 47.49  ?  96   CYS B O   1 
ATOM   4941 C  CB  . CYS B  1 96  ? 8.093   -2.952  -56.170 1.00 38.04  ?  96   CYS B CB  1 
ATOM   4942 S  SG  . CYS B  1 96  ? 9.671   -2.383  -55.481 1.00 52.31  ?  96   CYS B SG  1 
ATOM   4943 N  N   . LEU B  1 97  ? 8.354   -0.107  -58.215 1.00 40.42  ?  97   LEU B N   1 
ATOM   4944 C  CA  . LEU B  1 97  ? 8.367   1.337   -58.047 1.00 35.16  ?  97   LEU B CA  1 
ATOM   4945 C  C   . LEU B  1 97  ? 7.114   2.014   -58.626 1.00 44.37  ?  97   LEU B C   1 
ATOM   4946 O  O   . LEU B  1 97  ? 7.111   2.560   -59.737 1.00 44.33  ?  97   LEU B O   1 
ATOM   4947 C  CB  . LEU B  1 97  ? 9.678   1.918   -58.568 1.00 36.23  ?  97   LEU B CB  1 
ATOM   4948 C  CG  . LEU B  1 97  ? 10.879  1.383   -57.771 1.00 36.93  ?  97   LEU B CG  1 
ATOM   4949 C  CD1 . LEU B  1 97  ? 12.196  2.064   -58.137 1.00 34.47  ?  97   LEU B CD1 1 
ATOM   4950 C  CD2 . LEU B  1 97  ? 10.616  1.519   -56.277 1.00 42.32  ?  97   LEU B CD2 1 
ATOM   4951 N  N   . TYR B  1 98  ? 6.040   1.962   -57.842 1.00 46.28  ?  98   TYR B N   1 
ATOM   4952 C  CA  . TYR B  1 98  ? 4.757   2.530   -58.234 1.00 45.58  ?  98   TYR B CA  1 
ATOM   4953 C  C   . TYR B  1 98  ? 4.197   3.313   -57.063 1.00 50.34  ?  98   TYR B C   1 
ATOM   4954 O  O   . TYR B  1 98  ? 4.450   2.971   -55.906 1.00 61.01  ?  98   TYR B O   1 
ATOM   4955 C  CB  . TYR B  1 98  ? 3.767   1.424   -58.635 1.00 34.60  ?  98   TYR B CB  1 
ATOM   4956 C  CG  . TYR B  1 98  ? 4.271   0.516   -59.735 1.00 47.14  ?  98   TYR B CG  1 
ATOM   4957 C  CD1 . TYR B  1 98  ? 5.099   -0.553  -59.444 1.00 45.43  ?  98   TYR B CD1 1 
ATOM   4958 C  CD2 . TYR B  1 98  ? 3.911   0.730   -61.078 1.00 45.00  ?  98   TYR B CD2 1 
ATOM   4959 C  CE1 . TYR B  1 98  ? 5.570   -1.379  -60.436 1.00 55.13  ?  98   TYR B CE1 1 
ATOM   4960 C  CE2 . TYR B  1 98  ? 4.366   -0.096  -62.066 1.00 41.95  ?  98   TYR B CE2 1 
ATOM   4961 C  CZ  . TYR B  1 98  ? 5.201   -1.151  -61.744 1.00 55.93  ?  98   TYR B CZ  1 
ATOM   4962 O  OH  . TYR B  1 98  ? 5.681   -1.987  -62.725 1.00 62.33  ?  98   TYR B OH  1 
ATOM   4963 N  N   . LEU B  1 99  ? 3.422   4.353   -57.355 1.00 50.09  ?  99   LEU B N   1 
ATOM   4964 C  CA  . LEU B  1 99  ? 2.747   5.091   -56.298 1.00 51.98  ?  99   LEU B CA  1 
ATOM   4965 C  C   . LEU B  1 99  ? 1.227   5.070   -56.430 1.00 53.33  ?  99   LEU B C   1 
ATOM   4966 O  O   . LEU B  1 99  ? 0.692   4.627   -57.438 1.00 56.31  ?  99   LEU B O   1 
ATOM   4967 C  CB  . LEU B  1 99  ? 3.278   6.523   -56.196 1.00 47.70  ?  99   LEU B CB  1 
ATOM   4968 C  CG  . LEU B  1 99  ? 3.347   7.375   -57.458 1.00 41.56  ?  99   LEU B CG  1 
ATOM   4969 C  CD1 . LEU B  1 99  ? 2.046   8.120   -57.691 1.00 36.51  ?  99   LEU B CD1 1 
ATOM   4970 C  CD2 . LEU B  1 99  ? 4.506   8.341   -57.335 1.00 39.35  ?  99   LEU B CD2 1 
ATOM   4971 N  N   . ASN B  1 100 ? 0.543   5.536   -55.387 1.00 52.23  ?  100  ASN B N   1 
ATOM   4972 C  CA  . ASN B  1 100 ? -0.908  5.553   -55.357 1.00 38.14  ?  100  ASN B CA  1 
ATOM   4973 C  C   . ASN B  1 100 ? -1.408  6.945   -55.006 1.00 42.86  ?  100  ASN B C   1 
ATOM   4974 O  O   . ASN B  1 100 ? -0.803  7.644   -54.206 1.00 47.56  ?  100  ASN B O   1 
ATOM   4975 C  CB  . ASN B  1 100 ? -1.428  4.529   -54.350 1.00 33.98  ?  100  ASN B CB  1 
ATOM   4976 C  CG  . ASN B  1 100 ? -0.729  3.186   -54.474 1.00 44.41  ?  100  ASN B CG  1 
ATOM   4977 O  OD1 . ASN B  1 100 ? -0.899  2.474   -55.461 1.00 53.49  ?  100  ASN B OD1 1 
ATOM   4978 N  ND2 . ASN B  1 100 ? 0.070   2.839   -53.476 1.00 48.64  ?  100  ASN B ND2 1 
ATOM   4979 N  N   . VAL B  1 101 ? -2.507  7.360   -55.620 1.00 49.04  ?  101  VAL B N   1 
ATOM   4980 C  CA  . VAL B  1 101 ? -3.066  8.672   -55.345 1.00 45.90  ?  101  VAL B CA  1 
ATOM   4981 C  C   . VAL B  1 101 ? -4.555  8.559   -55.058 1.00 52.96  ?  101  VAL B C   1 
ATOM   4982 O  O   . VAL B  1 101 ? -5.288  7.957   -55.843 1.00 46.75  ?  101  VAL B O   1 
ATOM   4983 C  CB  . VAL B  1 101 ? -2.872  9.631   -56.531 1.00 45.27  ?  101  VAL B CB  1 
ATOM   4984 C  CG1 . VAL B  1 101 ? -3.696  10.900  -56.329 1.00 40.06  ?  101  VAL B CG1 1 
ATOM   4985 C  CG2 . VAL B  1 101 ? -1.397  9.966   -56.718 1.00 48.36  ?  101  VAL B CG2 1 
ATOM   4986 N  N   . TRP B  1 102 ? -4.996  9.119   -53.927 1.00 49.62  ?  102  TRP B N   1 
ATOM   4987 C  CA  . TRP B  1 102 ? -6.422  9.267   -53.670 1.00 44.59  ?  102  TRP B CA  1 
ATOM   4988 C  C   . TRP B  1 102 ? -6.801  10.747  -53.706 1.00 46.28  ?  102  TRP B C   1 
ATOM   4989 O  O   . TRP B  1 102 ? -6.069  11.605  -53.195 1.00 41.11  ?  102  TRP B O   1 
ATOM   4990 C  CB  . TRP B  1 102 ? -6.800  8.676   -52.319 1.00 43.66  ?  102  TRP B CB  1 
ATOM   4991 C  CG  . TRP B  1 102 ? -6.708  7.190   -52.199 1.00 43.23  ?  102  TRP B CG  1 
ATOM   4992 C  CD1 . TRP B  1 102 ? -7.721  6.285   -52.372 1.00 48.30  ?  102  TRP B CD1 1 
ATOM   4993 C  CD2 . TRP B  1 102 ? -5.554  6.431   -51.826 1.00 39.32  ?  102  TRP B CD2 1 
ATOM   4994 N  NE1 . TRP B  1 102 ? -7.260  5.008   -52.146 1.00 49.25  ?  102  TRP B NE1 1 
ATOM   4995 C  CE2 . TRP B  1 102 ? -5.932  5.073   -51.811 1.00 42.09  ?  102  TRP B CE2 1 
ATOM   4996 C  CE3 . TRP B  1 102 ? -4.234  6.769   -51.508 1.00 42.95  ?  102  TRP B CE3 1 
ATOM   4997 C  CZ2 . TRP B  1 102 ? -5.040  4.059   -51.498 1.00 43.37  ?  102  TRP B CZ2 1 
ATOM   4998 C  CZ3 . TRP B  1 102 ? -3.349  5.760   -51.190 1.00 43.29  ?  102  TRP B CZ3 1 
ATOM   4999 C  CH2 . TRP B  1 102 ? -3.754  4.419   -51.188 1.00 47.32  ?  102  TRP B CH2 1 
ATOM   5000 N  N   . THR B  1 103 ? -7.931  11.047  -54.339 1.00 45.06  ?  103  THR B N   1 
ATOM   5001 C  CA  . THR B  1 103 ? -8.470  12.406  -54.359 1.00 51.92  ?  103  THR B CA  1 
ATOM   5002 C  C   . THR B  1 103 ? -9.960  12.307  -54.137 1.00 53.90  ?  103  THR B C   1 
ATOM   5003 O  O   . THR B  1 103 ? -10.532 11.233  -54.289 1.00 60.89  ?  103  THR B O   1 
ATOM   5004 C  CB  . THR B  1 103 ? -8.251  13.126  -55.718 1.00 46.22  ?  103  THR B CB  1 
ATOM   5005 O  OG1 . THR B  1 103 ? -9.242  12.694  -56.658 1.00 47.05  ?  103  THR B OG1 1 
ATOM   5006 C  CG2 . THR B  1 103 ? -6.867  12.846  -56.267 1.00 41.09  ?  103  THR B CG2 1 
ATOM   5007 N  N   . PRO B  1 104 ? -10.600 13.421  -53.768 1.00 53.16  ?  104  PRO B N   1 
ATOM   5008 C  CA  . PRO B  1 104 ? -12.062 13.357  -53.721 1.00 55.08  ?  104  PRO B CA  1 
ATOM   5009 C  C   . PRO B  1 104 ? -12.684 13.225  -55.113 1.00 59.28  ?  104  PRO B C   1 
ATOM   5010 O  O   . PRO B  1 104 ? -12.067 13.551  -56.121 1.00 66.62  ?  104  PRO B O   1 
ATOM   5011 C  CB  . PRO B  1 104 ? -12.457 14.689  -53.086 1.00 54.85  ?  104  PRO B CB  1 
ATOM   5012 C  CG  . PRO B  1 104 ? -11.247 15.561  -53.193 1.00 53.64  ?  104  PRO B CG  1 
ATOM   5013 C  CD  . PRO B  1 104 ? -10.075 14.657  -53.168 1.00 52.07  ?  104  PRO B CD  1 
ATOM   5014 N  N   . TYR B  1 105 ? -13.910 12.724  -55.135 1.00 55.58  ?  105  TYR B N   1 
ATOM   5015 C  CA  . TYR B  1 105 ? -14.706 12.592  -56.330 1.00 56.81  ?  105  TYR B CA  1 
ATOM   5016 C  C   . TYR B  1 105 ? -15.949 13.453  -56.121 1.00 70.53  ?  105  TYR B C   1 
ATOM   5017 O  O   . TYR B  1 105 ? -16.747 13.179  -55.220 1.00 73.88  ?  105  TYR B O   1 
ATOM   5018 C  CB  . TYR B  1 105 ? -15.092 11.126  -56.520 1.00 56.22  ?  105  TYR B CB  1 
ATOM   5019 C  CG  . TYR B  1 105 ? -15.904 10.840  -57.746 1.00 55.95  ?  105  TYR B CG  1 
ATOM   5020 C  CD1 . TYR B  1 105 ? -17.274 11.075  -57.769 1.00 58.39  ?  105  TYR B CD1 1 
ATOM   5021 C  CD2 . TYR B  1 105 ? -15.307 10.325  -58.892 1.00 67.33  ?  105  TYR B CD2 1 
ATOM   5022 C  CE1 . TYR B  1 105 ? -18.023 10.808  -58.900 1.00 67.57  ?  105  TYR B CE1 1 
ATOM   5023 C  CE2 . TYR B  1 105 ? -16.048 10.055  -60.029 1.00 54.36  ?  105  TYR B CE2 1 
ATOM   5024 C  CZ  . TYR B  1 105 ? -17.404 10.299  -60.028 1.00 68.16  ?  105  TYR B CZ  1 
ATOM   5025 O  OH  . TYR B  1 105 ? -18.150 10.031  -61.155 1.00 74.67  ?  105  TYR B OH  1 
ATOM   5026 N  N   . PRO B  1 106 ? -16.131 14.490  -56.957 1.00 75.46  ?  106  PRO B N   1 
ATOM   5027 C  CA  . PRO B  1 106 ? -15.305 14.808  -58.127 1.00 80.02  ?  106  PRO B CA  1 
ATOM   5028 C  C   . PRO B  1 106 ? -13.978 15.426  -57.724 1.00 78.34  ?  106  PRO B C   1 
ATOM   5029 O  O   . PRO B  1 106 ? -13.825 15.844  -56.575 1.00 72.38  ?  106  PRO B O   1 
ATOM   5030 C  CB  . PRO B  1 106 ? -16.143 15.855  -58.856 1.00 78.58  ?  106  PRO B CB  1 
ATOM   5031 C  CG  . PRO B  1 106 ? -16.830 16.582  -57.741 1.00 78.07  ?  106  PRO B CG  1 
ATOM   5032 C  CD  . PRO B  1 106 ? -17.166 15.516  -56.728 1.00 74.08  ?  106  PRO B CD  1 
ATOM   5033 N  N   . ARG B  1 107 ? -13.039 15.461  -58.664 1.00 81.65  ?  107  ARG B N   1 
ATOM   5034 C  CA  . ARG B  1 107 ? -11.729 16.067  -58.457 1.00 83.02  ?  107  ARG B CA  1 
ATOM   5035 C  C   . ARG B  1 107 ? -11.863 17.472  -57.856 1.00 78.86  ?  107  ARG B C   1 
ATOM   5036 O  O   . ARG B  1 107 ? -12.775 18.215  -58.218 1.00 81.73  ?  107  ARG B O   1 
ATOM   5037 C  CB  . ARG B  1 107 ? -11.002 16.135  -59.799 1.00 82.90  ?  107  ARG B CB  1 
ATOM   5038 C  CG  . ARG B  1 107 ? -9.496  16.055  -59.709 1.00 86.10  ?  107  ARG B CG  1 
ATOM   5039 C  CD  . ARG B  1 107 ? -8.887  15.963  -61.093 1.00 94.08  ?  107  ARG B CD  1 
ATOM   5040 N  NE  . ARG B  1 107 ? -9.408  14.810  -61.818 1.00 98.70  ?  107  ARG B NE  1 
ATOM   5041 C  CZ  . ARG B  1 107 ? -9.365  14.678  -63.138 1.00 103.44 ?  107  ARG B CZ  1 
ATOM   5042 N  NH1 . ARG B  1 107 ? -8.822  15.631  -63.884 1.00 105.32 ?  107  ARG B NH1 1 
ATOM   5043 N  NH2 . ARG B  1 107 ? -9.868  13.593  -63.713 1.00 105.40 ?  107  ARG B NH2 1 
ATOM   5044 N  N   . PRO B  1 108 ? -10.966 17.836  -56.926 1.00 68.82  ?  108  PRO B N   1 
ATOM   5045 C  CA  . PRO B  1 108 ? -11.044 19.175  -56.329 1.00 72.14  ?  108  PRO B CA  1 
ATOM   5046 C  C   . PRO B  1 108 ? -10.977 20.287  -57.373 1.00 77.09  ?  108  PRO B C   1 
ATOM   5047 O  O   . PRO B  1 108 ? -10.179 20.209  -58.308 1.00 77.65  ?  108  PRO B O   1 
ATOM   5048 C  CB  . PRO B  1 108 ? -9.804  19.241  -55.437 1.00 64.19  ?  108  PRO B CB  1 
ATOM   5049 C  CG  . PRO B  1 108 ? -9.456  17.832  -55.150 1.00 66.19  ?  108  PRO B CG  1 
ATOM   5050 C  CD  . PRO B  1 108 ? -9.884  17.027  -56.342 1.00 64.37  ?  108  PRO B CD  1 
ATOM   5051 N  N   . ALA B  1 109 ? -11.816 21.305  -57.205 1.00 80.06  ?  109  ALA B N   1 
ATOM   5052 C  CA  . ALA B  1 109 ? -11.788 22.491  -58.054 1.00 86.95  ?  109  ALA B CA  1 
ATOM   5053 C  C   . ALA B  1 109 ? -10.563 23.339  -57.736 1.00 90.71  ?  109  ALA B C   1 
ATOM   5054 O  O   . ALA B  1 109 ? -9.753  23.638  -58.614 1.00 97.62  ?  109  ALA B O   1 
ATOM   5055 C  CB  . ALA B  1 109 ? -13.049 23.305  -57.856 1.00 89.39  ?  109  ALA B CB  1 
ATOM   5056 N  N   . SER B  1 110 ? -10.443 23.727  -56.472 1.00 84.35  ?  110  SER B N   1 
ATOM   5057 C  CA  . SER B  1 110 ? -9.283  24.465  -55.994 1.00 76.91  ?  110  SER B CA  1 
ATOM   5058 C  C   . SER B  1 110 ? -8.135  23.506  -55.713 1.00 79.64  ?  110  SER B C   1 
ATOM   5059 O  O   . SER B  1 110 ? -8.366  22.360  -55.323 1.00 86.56  ?  110  SER B O   1 
ATOM   5060 C  CB  . SER B  1 110 ? -9.633  25.215  -54.710 1.00 69.06  ?  110  SER B CB  1 
ATOM   5061 O  OG  . SER B  1 110 ? -10.682 26.140  -54.927 1.00 72.34  ?  110  SER B OG  1 
ATOM   5062 N  N   . PRO B  1 111 ? -6.891  23.970  -55.913 1.00 69.22  ?  111  PRO B N   1 
ATOM   5063 C  CA  . PRO B  1 111 ? -5.705  23.207  -55.520 1.00 60.16  ?  111  PRO B CA  1 
ATOM   5064 C  C   . PRO B  1 111 ? -5.773  22.842  -54.036 1.00 69.87  ?  111  PRO B C   1 
ATOM   5065 O  O   . PRO B  1 111 ? -6.062  23.690  -53.185 1.00 72.89  ?  111  PRO B O   1 
ATOM   5066 C  CB  . PRO B  1 111 ? -4.565  24.193  -55.764 1.00 60.64  ?  111  PRO B CB  1 
ATOM   5067 C  CG  . PRO B  1 111 ? -5.068  25.089  -56.838 1.00 60.70  ?  111  PRO B CG  1 
ATOM   5068 C  CD  . PRO B  1 111 ? -6.539  25.240  -56.572 1.00 68.87  ?  111  PRO B CD  1 
ATOM   5069 N  N   . THR B  1 112 ? -5.494  21.578  -53.744 1.00 63.72  ?  112  THR B N   1 
ATOM   5070 C  CA  . THR B  1 112 ? -5.737  20.997  -52.441 1.00 54.60  ?  112  THR B CA  1 
ATOM   5071 C  C   . THR B  1 112 ? -4.433  20.529  -51.821 1.00 57.83  ?  112  THR B C   1 
ATOM   5072 O  O   . THR B  1 112 ? -3.591  19.970  -52.518 1.00 67.24  ?  112  THR B O   1 
ATOM   5073 C  CB  . THR B  1 112 ? -6.694  19.806  -52.588 1.00 57.69  ?  112  THR B CB  1 
ATOM   5074 O  OG1 . THR B  1 112 ? -7.996  20.290  -52.943 1.00 68.87  ?  112  THR B OG1 1 
ATOM   5075 C  CG2 . THR B  1 112 ? -6.793  19.014  -51.306 1.00 54.17  ?  112  THR B CG2 1 
ATOM   5076 N  N   . PRO B  1 113 ? -4.250  20.779  -50.511 1.00 55.72  ?  113  PRO B N   1 
ATOM   5077 C  CA  . PRO B  1 113 ? -3.060  20.308  -49.797 1.00 49.38  ?  113  PRO B CA  1 
ATOM   5078 C  C   . PRO B  1 113 ? -2.804  18.825  -50.024 1.00 44.81  ?  113  PRO B C   1 
ATOM   5079 O  O   . PRO B  1 113 ? -3.745  18.036  -50.112 1.00 44.98  ?  113  PRO B O   1 
ATOM   5080 C  CB  . PRO B  1 113 ? -3.411  20.582  -48.336 1.00 46.11  ?  113  PRO B CB  1 
ATOM   5081 C  CG  . PRO B  1 113 ? -4.238  21.817  -48.416 1.00 49.56  ?  113  PRO B CG  1 
ATOM   5082 C  CD  . PRO B  1 113 ? -5.076  21.662  -49.666 1.00 51.82  ?  113  PRO B CD  1 
ATOM   5083 N  N   . VAL B  1 114 ? -1.532  18.462  -50.137 1.00 38.29  ?  114  VAL B N   1 
ATOM   5084 C  CA  . VAL B  1 114 ? -1.152  17.091  -50.419 1.00 36.34  ?  114  VAL B CA  1 
ATOM   5085 C  C   . VAL B  1 114 ? -0.483  16.442  -49.223 1.00 37.69  ?  114  VAL B C   1 
ATOM   5086 O  O   . VAL B  1 114 ? 0.438   16.997  -48.629 1.00 41.72  ?  114  VAL B O   1 
ATOM   5087 C  CB  . VAL B  1 114 ? -0.173  17.010  -51.621 1.00 41.92  ?  114  VAL B CB  1 
ATOM   5088 C  CG1 . VAL B  1 114 ? 0.170   15.562  -51.923 1.00 35.17  ?  114  VAL B CG1 1 
ATOM   5089 C  CG2 . VAL B  1 114 ? -0.778  17.684  -52.861 1.00 41.87  ?  114  VAL B CG2 1 
ATOM   5090 N  N   . LEU B  1 115 ? -0.945  15.253  -48.878 1.00 46.57  ?  115  LEU B N   1 
ATOM   5091 C  CA  . LEU B  1 115 ? -0.271  14.441  -47.883 1.00 41.25  ?  115  LEU B CA  1 
ATOM   5092 C  C   . LEU B  1 115 ? 0.449   13.296  -48.582 1.00 47.49  ?  115  LEU B C   1 
ATOM   5093 O  O   . LEU B  1 115 ? -0.127  12.611  -49.421 1.00 54.87  ?  115  LEU B O   1 
ATOM   5094 C  CB  . LEU B  1 115 ? -1.274  13.902  -46.872 1.00 41.78  ?  115  LEU B CB  1 
ATOM   5095 C  CG  . LEU B  1 115 ? -1.807  14.941  -45.875 1.00 50.66  ?  115  LEU B CG  1 
ATOM   5096 C  CD1 . LEU B  1 115 ? -3.160  15.494  -46.305 1.00 49.56  ?  115  LEU B CD1 1 
ATOM   5097 C  CD2 . LEU B  1 115 ? -1.867  14.375  -44.458 1.00 44.77  ?  115  LEU B CD2 1 
ATOM   5098 N  N   . ILE B  1 116 ? 1.718   13.104  -48.255 1.00 41.15  ?  116  ILE B N   1 
ATOM   5099 C  CA  . ILE B  1 116 ? 2.453   11.979  -48.795 1.00 35.76  ?  116  ILE B CA  1 
ATOM   5100 C  C   . ILE B  1 116 ? 2.870   11.042  -47.674 1.00 39.60  ?  116  ILE B C   1 
ATOM   5101 O  O   . ILE B  1 116 ? 3.586   11.435  -46.763 1.00 42.01  ?  116  ILE B O   1 
ATOM   5102 C  CB  . ILE B  1 116 ? 3.696   12.435  -49.569 1.00 45.33  ?  116  ILE B CB  1 
ATOM   5103 C  CG1 . ILE B  1 116 ? 3.323   13.533  -50.566 1.00 41.81  ?  116  ILE B CG1 1 
ATOM   5104 C  CG2 . ILE B  1 116 ? 4.338   11.254  -50.286 1.00 48.15  ?  116  ILE B CG2 1 
ATOM   5105 C  CD1 . ILE B  1 116 ? 4.396   13.838  -51.574 1.00 38.17  ?  116  ILE B CD1 1 
ATOM   5106 N  N   . TRP B  1 117 ? 2.406   9.802   -47.752 1.00 42.62  ?  117  TRP B N   1 
ATOM   5107 C  CA  . TRP B  1 117 ? 2.711   8.779   -46.759 1.00 36.79  ?  117  TRP B CA  1 
ATOM   5108 C  C   . TRP B  1 117 ? 3.890   7.910   -47.165 1.00 39.10  ?  117  TRP B C   1 
ATOM   5109 O  O   . TRP B  1 117 ? 3.974   7.446   -48.310 1.00 42.51  ?  117  TRP B O   1 
ATOM   5110 C  CB  . TRP B  1 117 ? 1.495   7.890   -46.563 1.00 41.65  ?  117  TRP B CB  1 
ATOM   5111 C  CG  . TRP B  1 117 ? 1.728   6.729   -45.674 1.00 46.76  ?  117  TRP B CG  1 
ATOM   5112 C  CD1 . TRP B  1 117 ? 1.850   5.423   -46.041 1.00 52.09  ?  117  TRP B CD1 1 
ATOM   5113 C  CD2 . TRP B  1 117 ? 1.847   6.761   -44.254 1.00 50.09  ?  117  TRP B CD2 1 
ATOM   5114 N  NE1 . TRP B  1 117 ? 2.037   4.632   -44.935 1.00 48.91  ?  117  TRP B NE1 1 
ATOM   5115 C  CE2 . TRP B  1 117 ? 2.041   5.431   -43.822 1.00 47.46  ?  117  TRP B CE2 1 
ATOM   5116 C  CE3 . TRP B  1 117 ? 1.818   7.787   -43.301 1.00 49.03  ?  117  TRP B CE3 1 
ATOM   5117 C  CZ2 . TRP B  1 117 ? 2.206   5.100   -42.479 1.00 37.42  ?  117  TRP B CZ2 1 
ATOM   5118 C  CZ3 . TRP B  1 117 ? 1.976   7.456   -41.966 1.00 36.91  ?  117  TRP B CZ3 1 
ATOM   5119 C  CH2 . TRP B  1 117 ? 2.169   6.126   -41.569 1.00 36.56  ?  117  TRP B CH2 1 
ATOM   5120 N  N   . ILE B  1 118 ? 4.789   7.691   -46.210 1.00 37.24  ?  118  ILE B N   1 
ATOM   5121 C  CA  . ILE B  1 118 ? 5.941   6.810   -46.363 1.00 37.85  ?  118  ILE B CA  1 
ATOM   5122 C  C   . ILE B  1 118 ? 5.893   5.717   -45.289 1.00 46.72  ?  118  ILE B C   1 
ATOM   5123 O  O   . ILE B  1 118 ? 6.115   5.994   -44.101 1.00 49.75  ?  118  ILE B O   1 
ATOM   5124 C  CB  . ILE B  1 118 ? 7.246   7.593   -46.191 1.00 31.86  ?  118  ILE B CB  1 
ATOM   5125 C  CG1 . ILE B  1 118 ? 7.273   8.806   -47.120 1.00 36.33  ?  118  ILE B CG1 1 
ATOM   5126 C  CG2 . ILE B  1 118 ? 8.426   6.698   -46.441 1.00 33.66  ?  118  ILE B CG2 1 
ATOM   5127 C  CD1 . ILE B  1 118 ? 8.483   9.711   -46.935 1.00 33.89  ?  118  ILE B CD1 1 
ATOM   5128 N  N   . TYR B  1 119 ? 5.612   4.481   -45.692 1.00 39.69  ?  119  TYR B N   1 
ATOM   5129 C  CA  . TYR B  1 119 ? 5.459   3.390   -44.725 1.00 41.55  ?  119  TYR B CA  1 
ATOM   5130 C  C   . TYR B  1 119 ? 6.737   3.057   -43.950 1.00 38.11  ?  119  TYR B C   1 
ATOM   5131 O  O   . TYR B  1 119 ? 7.836   3.381   -44.379 1.00 45.86  ?  119  TYR B O   1 
ATOM   5132 C  CB  . TYR B  1 119 ? 4.909   2.121   -45.388 1.00 45.08  ?  119  TYR B CB  1 
ATOM   5133 C  CG  . TYR B  1 119 ? 5.719   1.594   -46.559 1.00 43.33  ?  119  TYR B CG  1 
ATOM   5134 C  CD1 . TYR B  1 119 ? 6.913   0.916   -46.355 1.00 41.31  ?  119  TYR B CD1 1 
ATOM   5135 C  CD2 . TYR B  1 119 ? 5.271   1.749   -47.866 1.00 43.63  ?  119  TYR B CD2 1 
ATOM   5136 C  CE1 . TYR B  1 119 ? 7.654   0.425   -47.410 1.00 39.63  ?  119  TYR B CE1 1 
ATOM   5137 C  CE2 . TYR B  1 119 ? 6.008   1.257   -48.940 1.00 47.10  ?  119  TYR B CE2 1 
ATOM   5138 C  CZ  . TYR B  1 119 ? 7.201   0.598   -48.704 1.00 45.49  ?  119  TYR B CZ  1 
ATOM   5139 O  OH  . TYR B  1 119 ? 7.945   0.101   -49.760 1.00 42.85  ?  119  TYR B OH  1 
ATOM   5140 N  N   . GLY B  1 120 ? 6.568   2.408   -42.804 1.00 38.43  ?  120  GLY B N   1 
ATOM   5141 C  CA  . GLY B  1 120 ? 7.685   1.854   -42.058 1.00 44.29  ?  120  GLY B CA  1 
ATOM   5142 C  C   . GLY B  1 120 ? 7.827   0.368   -42.330 1.00 45.44  ?  120  GLY B C   1 
ATOM   5143 O  O   . GLY B  1 120 ? 7.211   -0.162  -43.256 1.00 42.71  ?  120  GLY B O   1 
ATOM   5144 N  N   . GLY B  1 121 ? 8.635   -0.311  -41.523 1.00 47.69  ?  121  GLY B N   1 
ATOM   5145 C  CA  . GLY B  1 121 ? 8.969   -1.704  -41.773 1.00 46.70  ?  121  GLY B CA  1 
ATOM   5146 C  C   . GLY B  1 121 ? 10.460  -1.971  -41.610 1.00 52.12  ?  121  GLY B C   1 
ATOM   5147 O  O   . GLY B  1 121 ? 10.995  -2.925  -42.180 1.00 49.18  ?  121  GLY B O   1 
ATOM   5148 N  N   . GLY B  1 122 ? 11.131  -1.116  -40.838 1.00 45.28  ?  122  GLY B N   1 
ATOM   5149 C  CA  . GLY B  1 122 ? 12.541  -1.282  -40.525 1.00 43.83  ?  122  GLY B CA  1 
ATOM   5150 C  C   . GLY B  1 122 ? 13.463  -1.174  -41.725 1.00 42.14  ?  122  GLY B C   1 
ATOM   5151 O  O   . GLY B  1 122 ? 14.586  -1.675  -41.701 1.00 45.35  ?  122  GLY B O   1 
ATOM   5152 N  N   . PHE B  1 123 ? 12.988  -0.520  -42.779 1.00 46.88  ?  123  PHE B N   1 
ATOM   5153 C  CA  . PHE B  1 123 ? 13.725  -0.448  -44.038 1.00 43.96  ?  123  PHE B CA  1 
ATOM   5154 C  C   . PHE B  1 123 ? 13.993  -1.828  -44.640 1.00 43.60  ?  123  PHE B C   1 
ATOM   5155 O  O   . PHE B  1 123 ? 14.897  -1.967  -45.450 1.00 56.36  ?  123  PHE B O   1 
ATOM   5156 C  CB  . PHE B  1 123 ? 15.060  0.287   -43.858 1.00 43.41  ?  123  PHE B CB  1 
ATOM   5157 C  CG  . PHE B  1 123 ? 14.922  1.718   -43.413 1.00 42.42  ?  123  PHE B CG  1 
ATOM   5158 C  CD1 . PHE B  1 123 ? 14.585  2.713   -44.319 1.00 41.33  ?  123  PHE B CD1 1 
ATOM   5159 C  CD2 . PHE B  1 123 ? 15.167  2.075   -42.102 1.00 40.46  ?  123  PHE B CD2 1 
ATOM   5160 C  CE1 . PHE B  1 123 ? 14.469  4.029   -43.923 1.00 37.84  ?  123  PHE B CE1 1 
ATOM   5161 C  CE2 . PHE B  1 123 ? 15.055  3.390   -41.702 1.00 39.68  ?  123  PHE B CE2 1 
ATOM   5162 C  CZ  . PHE B  1 123 ? 14.706  4.370   -42.614 1.00 40.42  ?  123  PHE B CZ  1 
ATOM   5163 N  N   . TYR B  1 124 ? 13.234  -2.845  -44.237 1.00 44.23  ?  124  TYR B N   1 
ATOM   5164 C  CA  . TYR B  1 124 ? 13.381  -4.193  -44.810 1.00 50.23  ?  124  TYR B CA  1 
ATOM   5165 C  C   . TYR B  1 124 ? 12.041  -4.705  -45.322 1.00 51.02  ?  124  TYR B C   1 
ATOM   5166 O  O   . TYR B  1 124 ? 11.965  -5.777  -45.934 1.00 55.55  ?  124  TYR B O   1 
ATOM   5167 C  CB  . TYR B  1 124 ? 13.950  -5.197  -43.797 1.00 52.53  ?  124  TYR B CB  1 
ATOM   5168 C  CG  . TYR B  1 124 ? 12.950  -5.680  -42.756 1.00 53.63  ?  124  TYR B CG  1 
ATOM   5169 C  CD1 . TYR B  1 124 ? 12.144  -6.788  -42.992 1.00 50.00  ?  124  TYR B CD1 1 
ATOM   5170 C  CD2 . TYR B  1 124 ? 12.831  -5.039  -41.527 1.00 49.85  ?  124  TYR B CD2 1 
ATOM   5171 C  CE1 . TYR B  1 124 ? 11.234  -7.229  -42.045 1.00 51.74  ?  124  TYR B CE1 1 
ATOM   5172 C  CE2 . TYR B  1 124 ? 11.916  -5.472  -40.575 1.00 45.63  ?  124  TYR B CE2 1 
ATOM   5173 C  CZ  . TYR B  1 124 ? 11.124  -6.568  -40.840 1.00 48.23  ?  124  TYR B CZ  1 
ATOM   5174 O  OH  . TYR B  1 124 ? 10.215  -7.007  -39.911 1.00 51.12  ?  124  TYR B OH  1 
ATOM   5175 N  N   . SER B  1 125 ? 10.985  -3.938  -45.067 1.00 40.50  ?  125  SER B N   1 
ATOM   5176 C  CA  . SER B  1 125 ? 9.640   -4.389  -45.382 1.00 44.70  ?  125  SER B CA  1 
ATOM   5177 C  C   . SER B  1 125 ? 8.676   -3.222  -45.432 1.00 46.00  ?  125  SER B C   1 
ATOM   5178 O  O   . SER B  1 125 ? 9.044   -2.088  -45.117 1.00 46.68  ?  125  SER B O   1 
ATOM   5179 C  CB  . SER B  1 125 ? 9.152   -5.406  -44.346 1.00 46.59  ?  125  SER B CB  1 
ATOM   5180 O  OG  . SER B  1 125 ? 8.683   -4.746  -43.185 1.00 51.88  ?  125  SER B OG  1 
ATOM   5181 N  N   . GLY B  1 126 ? 7.441   -3.523  -45.826 1.00 41.59  ?  126  GLY B N   1 
ATOM   5182 C  CA  . GLY B  1 126 ? 6.382   -2.541  -45.908 1.00 39.00  ?  126  GLY B CA  1 
ATOM   5183 C  C   . GLY B  1 126 ? 5.844   -2.462  -47.317 1.00 43.26  ?  126  GLY B C   1 
ATOM   5184 O  O   . GLY B  1 126 ? 6.528   -2.866  -48.255 1.00 39.96  ?  126  GLY B O   1 
ATOM   5185 N  N   . ALA B  1 127 ? 4.622   -1.942  -47.459 1.00 45.68  ?  127  ALA B N   1 
ATOM   5186 C  CA  . ALA B  1 127 ? 3.999   -1.713  -48.766 1.00 45.62  ?  127  ALA B CA  1 
ATOM   5187 C  C   . ALA B  1 127 ? 2.936   -0.626  -48.650 1.00 46.97  ?  127  ALA B C   1 
ATOM   5188 O  O   . ALA B  1 127 ? 2.340   -0.462  -47.592 1.00 46.52  ?  127  ALA B O   1 
ATOM   5189 C  CB  . ALA B  1 127 ? 3.377   -2.993  -49.291 1.00 42.83  ?  127  ALA B CB  1 
ATOM   5190 N  N   . ALA B  1 128 ? 2.684   0.108   -49.732 1.00 42.76  ?  128  ALA B N   1 
ATOM   5191 C  CA  . ALA B  1 128 ? 1.677   1.167   -49.687 1.00 40.24  ?  128  ALA B CA  1 
ATOM   5192 C  C   . ALA B  1 128 ? 0.264   0.615   -49.847 1.00 42.68  ?  128  ALA B C   1 
ATOM   5193 O  O   . ALA B  1 128 ? -0.718  1.331   -49.664 1.00 42.72  ?  128  ALA B O   1 
ATOM   5194 C  CB  . ALA B  1 128 ? 1.965   2.238   -50.719 1.00 37.40  ?  128  ALA B CB  1 
ATOM   5195 N  N   . SER B  1 129 ? 0.169   -0.675  -50.152 1.00 44.57  ?  129  SER B N   1 
ATOM   5196 C  CA  . SER B  1 129 ? -1.120  -1.318  -50.393 1.00 41.63  ?  129  SER B CA  1 
ATOM   5197 C  C   . SER B  1 129 ? -1.814  -1.880  -49.142 1.00 38.67  ?  129  SER B C   1 
ATOM   5198 O  O   . SER B  1 129 ? -2.952  -2.367  -49.227 1.00 38.17  ?  129  SER B O   1 
ATOM   5199 C  CB  . SER B  1 129 ? -0.953  -2.428  -51.426 1.00 42.41  ?  129  SER B CB  1 
ATOM   5200 O  OG  . SER B  1 129 ? 0.040   -3.338  -51.009 1.00 44.01  ?  129  SER B OG  1 
ATOM   5201 N  N   . LEU B  1 130 ? -1.131  -1.821  -47.997 1.00 41.83  ?  130  LEU B N   1 
ATOM   5202 C  CA  . LEU B  1 130 ? -1.683  -2.330  -46.738 1.00 48.60  ?  130  LEU B CA  1 
ATOM   5203 C  C   . LEU B  1 130 ? -2.992  -1.644  -46.406 1.00 51.30  ?  130  LEU B C   1 
ATOM   5204 O  O   . LEU B  1 130 ? -3.158  -0.450  -46.653 1.00 51.28  ?  130  LEU B O   1 
ATOM   5205 C  CB  . LEU B  1 130 ? -0.705  -2.150  -45.582 1.00 43.83  ?  130  LEU B CB  1 
ATOM   5206 C  CG  . LEU B  1 130 ? 0.620   -2.909  -45.673 1.00 49.23  ?  130  LEU B CG  1 
ATOM   5207 C  CD1 . LEU B  1 130 ? 1.418   -2.773  -44.367 1.00 43.29  ?  130  LEU B CD1 1 
ATOM   5208 C  CD2 . LEU B  1 130 ? 0.388   -4.366  -46.042 1.00 50.84  ?  130  LEU B CD2 1 
ATOM   5209 N  N   . ASP B  1 131 ? -3.921  -2.413  -45.853 1.00 52.90  ?  131  ASP B N   1 
ATOM   5210 C  CA  . ASP B  1 131 ? -5.257  -1.907  -45.556 1.00 50.61  ?  131  ASP B CA  1 
ATOM   5211 C  C   . ASP B  1 131 ? -5.262  -0.687  -44.625 1.00 50.02  ?  131  ASP B C   1 
ATOM   5212 O  O   . ASP B  1 131 ? -6.142  0.166   -44.745 1.00 54.30  ?  131  ASP B O   1 
ATOM   5213 C  CB  . ASP B  1 131 ? -6.147  -3.029  -45.010 1.00 59.92  ?  131  ASP B CB  1 
ATOM   5214 C  CG  . ASP B  1 131 ? -6.463  -4.088  -46.061 1.00 78.49  ?  131  ASP B CG  1 
ATOM   5215 O  OD1 . ASP B  1 131 ? -5.606  -4.961  -46.326 1.00 85.65  ?  131  ASP B OD1 1 
ATOM   5216 O  OD2 . ASP B  1 131 ? -7.568  -4.043  -46.635 1.00 85.16  ?  131  ASP B OD2 1 
ATOM   5217 N  N   . VAL B  1 132 ? -4.280  -0.583  -43.724 1.00 36.63  ?  132  VAL B N   1 
ATOM   5218 C  CA  . VAL B  1 132 ? -4.238  0.551   -42.801 1.00 47.26  ?  132  VAL B CA  1 
ATOM   5219 C  C   . VAL B  1 132 ? -3.676  1.821   -43.429 1.00 52.47  ?  132  VAL B C   1 
ATOM   5220 O  O   . VAL B  1 132 ? -3.554  2.853   -42.759 1.00 60.91  ?  132  VAL B O   1 
ATOM   5221 C  CB  . VAL B  1 132 ? -3.460  0.234   -41.487 1.00 49.44  ?  132  VAL B CB  1 
ATOM   5222 C  CG1 . VAL B  1 132 ? -4.282  -0.671  -40.593 1.00 49.48  ?  132  VAL B CG1 1 
ATOM   5223 C  CG2 . VAL B  1 132 ? -2.113  -0.391  -41.792 1.00 48.46  ?  132  VAL B CG2 1 
ATOM   5224 N  N   . TYR B  1 133 ? -3.324  1.741   -44.709 1.00 48.27  ?  133  TYR B N   1 
ATOM   5225 C  CA  . TYR B  1 133 ? -2.751  2.885   -45.418 1.00 44.96  ?  133  TYR B CA  1 
ATOM   5226 C  C   . TYR B  1 133 ? -3.746  3.413   -46.423 1.00 43.82  ?  133  TYR B C   1 
ATOM   5227 O  O   . TYR B  1 133 ? -3.437  4.287   -47.219 1.00 55.07  ?  133  TYR B O   1 
ATOM   5228 C  CB  . TYR B  1 133 ? -1.425  2.524   -46.097 1.00 32.81  ?  133  TYR B CB  1 
ATOM   5229 C  CG  . TYR B  1 133 ? -0.354  2.065   -45.119 1.00 39.76  ?  133  TYR B CG  1 
ATOM   5230 C  CD1 . TYR B  1 133 ? -0.431  2.381   -43.761 1.00 36.78  ?  133  TYR B CD1 1 
ATOM   5231 C  CD2 . TYR B  1 133 ? 0.719   1.304   -45.549 1.00 33.46  ?  133  TYR B CD2 1 
ATOM   5232 C  CE1 . TYR B  1 133 ? 0.542   1.952   -42.871 1.00 43.78  ?  133  TYR B CE1 1 
ATOM   5233 C  CE2 . TYR B  1 133 ? 1.690   0.874   -44.679 1.00 36.26  ?  133  TYR B CE2 1 
ATOM   5234 C  CZ  . TYR B  1 133 ? 1.603   1.197   -43.338 1.00 45.73  ?  133  TYR B CZ  1 
ATOM   5235 O  OH  . TYR B  1 133 ? 2.580   0.755   -42.473 1.00 39.65  ?  133  TYR B OH  1 
ATOM   5236 N  N   . ASP B  1 134 ? -4.955  2.875   -46.358 1.00 46.03  ?  134  ASP B N   1 
ATOM   5237 C  CA  . ASP B  1 134 ? -6.041  3.263   -47.238 1.00 47.33  ?  134  ASP B CA  1 
ATOM   5238 C  C   . ASP B  1 134 ? -6.354  4.753   -47.114 1.00 50.57  ?  134  ASP B C   1 
ATOM   5239 O  O   . ASP B  1 134 ? -6.885  5.206   -46.096 1.00 51.49  ?  134  ASP B O   1 
ATOM   5240 C  CB  . ASP B  1 134 ? -7.268  2.423   -46.900 1.00 46.49  ?  134  ASP B CB  1 
ATOM   5241 C  CG  . ASP B  1 134 ? -8.381  2.588   -47.901 1.00 55.59  ?  134  ASP B CG  1 
ATOM   5242 O  OD1 . ASP B  1 134 ? -8.491  3.675   -48.503 1.00 57.67  ?  134  ASP B OD1 1 
ATOM   5243 O  OD2 . ASP B  1 134 ? -9.164  1.629   -48.072 1.00 61.45  ?  134  ASP B OD2 1 
ATOM   5244 N  N   . GLY B  1 135 ? -6.041  5.502   -48.169 1.00 48.48  ?  135  GLY B N   1 
ATOM   5245 C  CA  . GLY B  1 135 ? -6.231  6.944   -48.190 1.00 46.09  ?  135  GLY B CA  1 
ATOM   5246 C  C   . GLY B  1 135 ? -7.640  7.444   -48.490 1.00 47.66  ?  135  GLY B C   1 
ATOM   5247 O  O   . GLY B  1 135 ? -7.879  8.650   -48.501 1.00 53.95  ?  135  GLY B O   1 
ATOM   5248 N  N   . ARG B  1 136 ? -8.583  6.539   -48.714 1.00 38.14  ?  136  ARG B N   1 
ATOM   5249 C  CA  . ARG B  1 136 ? -9.917  6.973   -49.140 1.00 50.46  ?  136  ARG B CA  1 
ATOM   5250 C  C   . ARG B  1 136 ? -10.652 7.796   -48.076 1.00 57.81  ?  136  ARG B C   1 
ATOM   5251 O  O   . ARG B  1 136 ? -11.497 8.627   -48.417 1.00 64.72  ?  136  ARG B O   1 
ATOM   5252 C  CB  . ARG B  1 136 ? -10.791 5.788   -49.583 1.00 40.30  ?  136  ARG B CB  1 
ATOM   5253 C  CG  . ARG B  1 136 ? -11.389 5.007   -48.433 1.00 47.96  ?  136  ARG B CG  1 
ATOM   5254 C  CD  . ARG B  1 136 ? -12.256 3.860   -48.902 1.00 48.20  ?  136  ARG B CD  1 
ATOM   5255 N  NE  . ARG B  1 136 ? -11.438 2.779   -49.427 1.00 55.90  ?  136  ARG B NE  1 
ATOM   5256 C  CZ  . ARG B  1 136 ? -11.888 1.830   -50.244 1.00 66.97  ?  136  ARG B CZ  1 
ATOM   5257 N  NH1 . ARG B  1 136 ? -13.157 1.826   -50.627 1.00 70.34  ?  136  ARG B NH1 1 
ATOM   5258 N  NH2 . ARG B  1 136 ? -11.069 0.885   -50.680 1.00 69.00  ?  136  ARG B NH2 1 
ATOM   5259 N  N   . PHE B  1 137 ? -10.333 7.566   -46.803 1.00 47.84  ?  137  PHE B N   1 
ATOM   5260 C  CA  . PHE B  1 137 ? -11.065 8.203   -45.703 1.00 51.26  ?  137  PHE B CA  1 
ATOM   5261 C  C   . PHE B  1 137 ? -10.669 9.664   -45.570 1.00 47.73  ?  137  PHE B C   1 
ATOM   5262 O  O   . PHE B  1 137 ? -11.522 10.554  -45.465 1.00 47.19  ?  137  PHE B O   1 
ATOM   5263 C  CB  . PHE B  1 137 ? -10.857 7.448   -44.377 1.00 47.15  ?  137  PHE B CB  1 
ATOM   5264 C  CG  . PHE B  1 137 ? -11.312 6.027   -44.428 1.00 49.01  ?  137  PHE B CG  1 
ATOM   5265 C  CD1 . PHE B  1 137 ? -12.662 5.721   -44.405 1.00 51.75  ?  137  PHE B CD1 1 
ATOM   5266 C  CD2 . PHE B  1 137 ? -10.395 4.994   -44.553 1.00 51.49  ?  137  PHE B CD2 1 
ATOM   5267 C  CE1 . PHE B  1 137 ? -13.097 4.402   -44.490 1.00 54.60  ?  137  PHE B CE1 1 
ATOM   5268 C  CE2 . PHE B  1 137 ? -10.821 3.667   -44.641 1.00 46.97  ?  137  PHE B CE2 1 
ATOM   5269 C  CZ  . PHE B  1 137 ? -12.173 3.372   -44.607 1.00 46.93  ?  137  PHE B CZ  1 
ATOM   5270 N  N   . LEU B  1 138 ? -9.366  9.904   -45.595 1.00 41.26  ?  138  LEU B N   1 
ATOM   5271 C  CA  . LEU B  1 138 ? -8.848  11.257  -45.558 1.00 46.60  ?  138  LEU B CA  1 
ATOM   5272 C  C   . LEU B  1 138 ? -9.267  12.042  -46.803 1.00 54.93  ?  138  LEU B C   1 
ATOM   5273 O  O   . LEU B  1 138 ? -9.546  13.238  -46.722 1.00 60.41  ?  138  LEU B O   1 
ATOM   5274 C  CB  . LEU B  1 138 ? -7.333  11.228  -45.416 1.00 41.52  ?  138  LEU B CB  1 
ATOM   5275 C  CG  . LEU B  1 138 ? -6.784  10.794  -44.059 1.00 44.35  ?  138  LEU B CG  1 
ATOM   5276 C  CD1 . LEU B  1 138 ? -5.305  10.468  -44.167 1.00 46.51  ?  138  LEU B CD1 1 
ATOM   5277 C  CD2 . LEU B  1 138 ? -6.996  11.895  -43.031 1.00 43.92  ?  138  LEU B CD2 1 
ATOM   5278 N  N   . ALA B  1 139 ? -9.331  11.365  -47.946 1.00 51.54  ?  139  ALA B N   1 
ATOM   5279 C  CA  . ALA B  1 139 ? -9.737  12.018  -49.189 1.00 49.39  ?  139  ALA B CA  1 
ATOM   5280 C  C   . ALA B  1 139 ? -11.220 12.357  -49.166 1.00 53.59  ?  139  ALA B C   1 
ATOM   5281 O  O   . ALA B  1 139 ? -11.628 13.452  -49.544 1.00 60.06  ?  139  ALA B O   1 
ATOM   5282 C  CB  . ALA B  1 139 ? -9.405  11.142  -50.403 1.00 38.37  ?  139  ALA B CB  1 
ATOM   5283 N  N   . GLN B  1 140 ? -12.032 11.409  -48.724 1.00 53.79  ?  140  GLN B N   1 
ATOM   5284 C  CA  . GLN B  1 140 ? -13.464 11.635  -48.674 1.00 55.36  ?  140  GLN B CA  1 
ATOM   5285 C  C   . GLN B  1 140 ? -13.829 12.682  -47.637 1.00 59.38  ?  140  GLN B C   1 
ATOM   5286 O  O   . GLN B  1 140 ? -14.483 13.671  -47.953 1.00 65.80  ?  140  GLN B O   1 
ATOM   5287 C  CB  . GLN B  1 140 ? -14.202 10.335  -48.369 1.00 57.63  ?  140  GLN B CB  1 
ATOM   5288 C  CG  . GLN B  1 140 ? -15.610 10.298  -48.939 1.00 66.55  ?  140  GLN B CG  1 
ATOM   5289 C  CD  . GLN B  1 140 ? -16.594 11.091  -48.105 1.00 70.30  ?  140  GLN B CD  1 
ATOM   5290 O  OE1 . GLN B  1 140 ? -16.516 11.098  -46.871 1.00 64.91  ?  140  GLN B OE1 1 
ATOM   5291 N  NE2 . GLN B  1 140 ? -17.527 11.766  -48.773 1.00 70.26  ?  140  GLN B NE2 1 
ATOM   5292 N  N   . VAL B  1 141 ? -13.383 12.468  -46.402 1.00 58.34  ?  141  VAL B N   1 
ATOM   5293 C  CA  . VAL B  1 141 ? -13.865 13.242  -45.264 1.00 56.23  ?  141  VAL B CA  1 
ATOM   5294 C  C   . VAL B  1 141 ? -13.204 14.611  -45.134 1.00 57.41  ?  141  VAL B C   1 
ATOM   5295 O  O   . VAL B  1 141 ? -13.884 15.613  -44.885 1.00 57.19  ?  141  VAL B O   1 
ATOM   5296 C  CB  . VAL B  1 141 ? -13.701 12.441  -43.963 1.00 54.82  ?  141  VAL B CB  1 
ATOM   5297 C  CG1 . VAL B  1 141 ? -14.187 13.248  -42.761 1.00 49.76  ?  141  VAL B CG1 1 
ATOM   5298 C  CG2 . VAL B  1 141 ? -14.449 11.121  -44.078 1.00 49.83  ?  141  VAL B CG2 1 
ATOM   5299 N  N   . GLU B  1 142 ? -11.883 14.642  -45.308 1.00 52.39  ?  142  GLU B N   1 
ATOM   5300 C  CA  . GLU B  1 142 ? -11.106 15.880  -45.222 1.00 50.09  ?  142  GLU B CA  1 
ATOM   5301 C  C   . GLU B  1 142 ? -10.818 16.553  -46.574 1.00 56.60  ?  142  GLU B C   1 
ATOM   5302 O  O   . GLU B  1 142 ? -10.144 17.583  -46.628 1.00 50.00  ?  142  GLU B O   1 
ATOM   5303 C  CB  . GLU B  1 142 ? -9.796  15.627  -44.474 1.00 46.99  ?  142  GLU B CB  1 
ATOM   5304 C  CG  . GLU B  1 142 ? -9.990  15.455  -42.984 1.00 65.38  ?  142  GLU B CG  1 
ATOM   5305 C  CD  . GLU B  1 142 ? -10.627 16.678  -42.340 1.00 80.42  ?  142  GLU B CD  1 
ATOM   5306 O  OE1 . GLU B  1 142 ? -10.349 17.809  -42.799 1.00 89.66  ?  142  GLU B OE1 1 
ATOM   5307 O  OE2 . GLU B  1 142 ? -11.410 16.511  -41.380 1.00 80.65  ?  142  GLU B OE2 1 
ATOM   5308 N  N   . GLY B  1 143 ? -11.325 15.971  -47.659 1.00 61.23  ?  143  GLY B N   1 
ATOM   5309 C  CA  . GLY B  1 143 ? -11.089 16.498  -48.992 1.00 59.58  ?  143  GLY B CA  1 
ATOM   5310 C  C   . GLY B  1 143 ? -9.616  16.586  -49.355 1.00 62.80  ?  143  GLY B C   1 
ATOM   5311 O  O   . GLY B  1 143 ? -9.222  17.423  -50.165 1.00 61.48  ?  143  GLY B O   1 
ATOM   5312 N  N   . ALA B  1 144 ? -8.797  15.727  -48.753 1.00 59.62  ?  144  ALA B N   1 
ATOM   5313 C  CA  . ALA B  1 144 ? -7.358  15.754  -48.993 1.00 53.22  ?  144  ALA B CA  1 
ATOM   5314 C  C   . ALA B  1 144 ? -6.983  15.041  -50.284 1.00 55.94  ?  144  ALA B C   1 
ATOM   5315 O  O   . ALA B  1 144 ? -7.729  14.198  -50.772 1.00 58.98  ?  144  ALA B O   1 
ATOM   5316 C  CB  . ALA B  1 144 ? -6.630  15.116  -47.845 1.00 39.73  ?  144  ALA B CB  1 
ATOM   5317 N  N   . VAL B  1 145 ? -5.820  15.387  -50.826 1.00 44.31  ?  145  VAL B N   1 
ATOM   5318 C  CA  . VAL B  1 145 ? -5.187  14.574  -51.838 1.00 44.45  ?  145  VAL B CA  1 
ATOM   5319 C  C   . VAL B  1 145 ? -4.054  13.805  -51.171 1.00 47.45  ?  145  VAL B C   1 
ATOM   5320 O  O   . VAL B  1 145 ? -3.105  14.402  -50.646 1.00 45.38  ?  145  VAL B O   1 
ATOM   5321 C  CB  . VAL B  1 145 ? -4.633  15.425  -53.001 1.00 51.52  ?  145  VAL B CB  1 
ATOM   5322 C  CG1 . VAL B  1 145 ? -3.825  14.566  -53.954 1.00 35.19  ?  145  VAL B CG1 1 
ATOM   5323 C  CG2 . VAL B  1 145 ? -5.761  16.121  -53.733 1.00 48.17  ?  145  VAL B CG2 1 
ATOM   5324 N  N   . LEU B  1 146 ? -4.161  12.478  -51.190 1.00 46.33  ?  146  LEU B N   1 
ATOM   5325 C  CA  . LEU B  1 146 ? -3.213  11.616  -50.492 1.00 42.96  ?  146  LEU B CA  1 
ATOM   5326 C  C   . LEU B  1 146 ? -2.408  10.712  -51.423 1.00 48.69  ?  146  LEU B C   1 
ATOM   5327 O  O   . LEU B  1 146 ? -2.968  10.006  -52.269 1.00 52.94  ?  146  LEU B O   1 
ATOM   5328 C  CB  . LEU B  1 146 ? -3.940  10.760  -49.453 1.00 54.49  ?  146  LEU B CB  1 
ATOM   5329 C  CG  . LEU B  1 146 ? -2.979  10.046  -48.499 1.00 65.36  ?  146  LEU B CG  1 
ATOM   5330 C  CD1 . LEU B  1 146 ? -3.284  10.414  -47.065 1.00 59.60  ?  146  LEU B CD1 1 
ATOM   5331 C  CD2 . LEU B  1 146 ? -3.001  8.535   -48.695 1.00 67.94  ?  146  LEU B CD2 1 
ATOM   5332 N  N   . VAL B  1 147 ? -1.091  10.727  -51.239 1.00 47.58  ?  147  VAL B N   1 
ATOM   5333 C  CA  . VAL B  1 147 ? -0.175  9.956   -52.071 1.00 43.32  ?  147  VAL B CA  1 
ATOM   5334 C  C   . VAL B  1 147 ? 0.643   8.970   -51.234 1.00 47.15  ?  147  VAL B C   1 
ATOM   5335 O  O   . VAL B  1 147 ? 1.071   9.301   -50.135 1.00 45.12  ?  147  VAL B O   1 
ATOM   5336 C  CB  . VAL B  1 147 ? 0.792   10.894  -52.813 1.00 45.31  ?  147  VAL B CB  1 
ATOM   5337 C  CG1 . VAL B  1 147 ? 1.703   10.102  -53.774 1.00 41.87  ?  147  VAL B CG1 1 
ATOM   5338 C  CG2 . VAL B  1 147 ? 0.013   11.975  -53.569 1.00 44.48  ?  147  VAL B CG2 1 
ATOM   5339 N  N   . SER B  1 148 ? 0.844   7.753   -51.741 1.00 46.91  ?  148  SER B N   1 
ATOM   5340 C  CA  . SER B  1 148 ? 1.804   6.826   -51.129 1.00 41.25  ?  148  SER B CA  1 
ATOM   5341 C  C   . SER B  1 148 ? 2.571   6.053   -52.190 1.00 42.96  ?  148  SER B C   1 
ATOM   5342 O  O   . SER B  1 148 ? 1.994   5.671   -53.224 1.00 40.59  ?  148  SER B O   1 
ATOM   5343 C  CB  . SER B  1 148 ? 1.129   5.854   -50.163 1.00 32.71  ?  148  SER B CB  1 
ATOM   5344 O  OG  . SER B  1 148 ? 0.212   5.014   -50.830 1.00 36.92  ?  148  SER B OG  1 
ATOM   5345 N  N   . MET B  1 149 ? 3.864   5.832   -51.928 1.00 41.35  ?  149  MET B N   1 
ATOM   5346 C  CA  . MET B  1 149 ? 4.745   5.123   -52.860 1.00 42.08  ?  149  MET B CA  1 
ATOM   5347 C  C   . MET B  1 149 ? 5.335   3.850   -52.265 1.00 43.88  ?  149  MET B C   1 
ATOM   5348 O  O   . MET B  1 149 ? 5.446   3.712   -51.047 1.00 48.46  ?  149  MET B O   1 
ATOM   5349 C  CB  . MET B  1 149 ? 5.885   6.032   -53.338 1.00 40.60  ?  149  MET B CB  1 
ATOM   5350 C  CG  . MET B  1 149 ? 7.102   6.063   -52.420 1.00 49.08  ?  149  MET B CG  1 
ATOM   5351 S  SD  . MET B  1 149 ? 6.795   6.840   -50.814 1.00 47.32  ?  149  MET B SD  1 
ATOM   5352 C  CE  . MET B  1 149 ? 6.837   8.594   -51.193 1.00 26.68  ?  149  MET B CE  1 
ATOM   5353 N  N   . ASN B  1 150 ? 5.698   2.907   -53.127 1.00 42.24  ?  150  ASN B N   1 
ATOM   5354 C  CA  . ASN B  1 150 ? 6.552   1.821   -52.690 1.00 45.71  ?  150  ASN B CA  1 
ATOM   5355 C  C   . ASN B  1 150 ? 7.986   2.290   -52.875 1.00 45.19  ?  150  ASN B C   1 
ATOM   5356 O  O   . ASN B  1 150 ? 8.272   3.036   -53.799 1.00 40.33  ?  150  ASN B O   1 
ATOM   5357 C  CB  . ASN B  1 150 ? 6.307   0.550   -53.496 1.00 48.52  ?  150  ASN B CB  1 
ATOM   5358 C  CG  . ASN B  1 150 ? 4.976   -0.098  -53.184 1.00 55.51  ?  150  ASN B CG  1 
ATOM   5359 O  OD1 . ASN B  1 150 ? 4.381   0.161   -52.147 1.00 51.83  ?  150  ASN B OD1 1 
ATOM   5360 N  ND2 . ASN B  1 150 ? 4.501   -0.952  -54.090 1.00 62.87  ?  150  ASN B ND2 1 
ATOM   5361 N  N   . TYR B  1 151 ? 8.883   1.884   -51.984 1.00 41.57  ?  151  TYR B N   1 
ATOM   5362 C  CA  . TYR B  1 151 ? 10.303  2.142   -52.180 1.00 38.51  ?  151  TYR B CA  1 
ATOM   5363 C  C   . TYR B  1 151 ? 11.052  0.865   -51.825 1.00 37.56  ?  151  TYR B C   1 
ATOM   5364 O  O   . TYR B  1 151 ? 10.552  0.052   -51.052 1.00 47.23  ?  151  TYR B O   1 
ATOM   5365 C  CB  . TYR B  1 151 ? 10.779  3.352   -51.361 1.00 31.17  ?  151  TYR B CB  1 
ATOM   5366 C  CG  . TYR B  1 151 ? 10.635  3.175   -49.873 1.00 34.96  ?  151  TYR B CG  1 
ATOM   5367 C  CD1 . TYR B  1 151 ? 9.462   3.542   -49.215 1.00 43.90  ?  151  TYR B CD1 1 
ATOM   5368 C  CD2 . TYR B  1 151 ? 11.660  2.619   -49.123 1.00 30.10  ?  151  TYR B CD2 1 
ATOM   5369 C  CE1 . TYR B  1 151 ? 9.325   3.363   -47.842 1.00 45.67  ?  151  TYR B CE1 1 
ATOM   5370 C  CE2 . TYR B  1 151 ? 11.526  2.428   -47.751 1.00 36.53  ?  151  TYR B CE2 1 
ATOM   5371 C  CZ  . TYR B  1 151 ? 10.370  2.807   -47.121 1.00 41.17  ?  151  TYR B CZ  1 
ATOM   5372 O  OH  . TYR B  1 151 ? 10.268  2.620   -45.769 1.00 39.26  ?  151  TYR B OH  1 
ATOM   5373 N  N   . ARG B  1 152 ? 12.230  0.666   -52.402 1.00 39.75  ?  152  ARG B N   1 
ATOM   5374 C  CA  . ARG B  1 152 ? 12.923  -0.599  -52.222 1.00 38.45  ?  152  ARG B CA  1 
ATOM   5375 C  C   . ARG B  1 152 ? 13.410  -0.758  -50.774 1.00 46.32  ?  152  ARG B C   1 
ATOM   5376 O  O   . ARG B  1 152 ? 13.986  0.156   -50.181 1.00 37.80  ?  152  ARG B O   1 
ATOM   5377 C  CB  . ARG B  1 152 ? 14.089  -0.719  -53.189 1.00 36.26  ?  152  ARG B CB  1 
ATOM   5378 C  CG  . ARG B  1 152 ? 13.727  -0.869  -54.657 1.00 38.61  ?  152  ARG B CG  1 
ATOM   5379 C  CD  . ARG B  1 152 ? 14.990  -0.802  -55.503 1.00 43.83  ?  152  ARG B CD  1 
ATOM   5380 N  NE  . ARG B  1 152 ? 15.323  0.575   -55.851 1.00 42.35  ?  152  ARG B NE  1 
ATOM   5381 C  CZ  . ARG B  1 152 ? 16.408  0.940   -56.522 1.00 45.49  ?  152  ARG B CZ  1 
ATOM   5382 N  NH1 . ARG B  1 152 ? 17.295  0.033   -56.916 1.00 35.47  ?  152  ARG B NH1 1 
ATOM   5383 N  NH2 . ARG B  1 152 ? 16.608  2.222   -56.789 1.00 43.19  ?  152  ARG B NH2 1 
ATOM   5384 N  N   . VAL B  1 153 ? 13.164  -1.932  -50.214 1.00 46.59  ?  153  VAL B N   1 
ATOM   5385 C  CA  . VAL B  1 153 ? 13.574  -2.215  -48.860 1.00 45.68  ?  153  VAL B CA  1 
ATOM   5386 C  C   . VAL B  1 153 ? 14.621  -3.314  -48.854 1.00 48.89  ?  153  VAL B C   1 
ATOM   5387 O  O   . VAL B  1 153 ? 14.854  -3.962  -49.877 1.00 50.03  ?  153  VAL B O   1 
ATOM   5388 C  CB  . VAL B  1 153 ? 12.368  -2.604  -47.999 1.00 40.77  ?  153  VAL B CB  1 
ATOM   5389 C  CG1 . VAL B  1 153 ? 11.482  -1.389  -47.788 1.00 39.46  ?  153  VAL B CG1 1 
ATOM   5390 C  CG2 . VAL B  1 153 ? 11.570  -3.743  -48.648 1.00 34.30  ?  153  VAL B CG2 1 
ATOM   5391 N  N   . GLY B  1 154 ? 15.266  -3.501  -47.705 1.00 51.10  ?  154  GLY B N   1 
ATOM   5392 C  CA  . GLY B  1 154 ? 16.220  -4.579  -47.525 1.00 33.37  ?  154  GLY B CA  1 
ATOM   5393 C  C   . GLY B  1 154 ? 17.475  -4.389  -48.352 1.00 47.04  ?  154  GLY B C   1 
ATOM   5394 O  O   . GLY B  1 154 ? 17.889  -3.257  -48.632 1.00 42.33  ?  154  GLY B O   1 
ATOM   5395 N  N   . THR B  1 155 ? 18.083  -5.502  -48.750 1.00 45.20  ?  155  THR B N   1 
ATOM   5396 C  CA  . THR B  1 155 ? 19.261  -5.447  -49.597 1.00 44.95  ?  155  THR B CA  1 
ATOM   5397 C  C   . THR B  1 155 ? 19.015  -4.594  -50.854 1.00 45.47  ?  155  THR B C   1 
ATOM   5398 O  O   . THR B  1 155 ? 19.889  -3.845  -51.273 1.00 48.52  ?  155  THR B O   1 
ATOM   5399 C  CB  . THR B  1 155 ? 19.724  -6.855  -50.006 1.00 45.34  ?  155  THR B CB  1 
ATOM   5400 O  OG1 . THR B  1 155 ? 18.660  -7.522  -50.687 1.00 57.61  ?  155  THR B OG1 1 
ATOM   5401 C  CG2 . THR B  1 155 ? 20.118  -7.677  -48.790 1.00 40.10  ?  155  THR B CG2 1 
ATOM   5402 N  N   . PHE B  1 156 ? 17.815  -4.669  -51.424 1.00 40.42  ?  156  PHE B N   1 
ATOM   5403 C  CA  . PHE B  1 156 ? 17.554  -4.019  -52.716 1.00 45.16  ?  156  PHE B CA  1 
ATOM   5404 C  C   . PHE B  1 156 ? 17.507  -2.503  -52.620 1.00 42.65  ?  156  PHE B C   1 
ATOM   5405 O  O   . PHE B  1 156 ? 17.863  -1.814  -53.557 1.00 44.00  ?  156  PHE B O   1 
ATOM   5406 C  CB  . PHE B  1 156 ? 16.290  -4.586  -53.368 1.00 37.62  ?  156  PHE B CB  1 
ATOM   5407 C  CG  . PHE B  1 156 ? 16.235  -6.083  -53.321 1.00 44.55  ?  156  PHE B CG  1 
ATOM   5408 C  CD1 . PHE B  1 156 ? 15.691  -6.741  -52.214 1.00 45.14  ?  156  PHE B CD1 1 
ATOM   5409 C  CD2 . PHE B  1 156 ? 16.784  -6.839  -54.339 1.00 39.12  ?  156  PHE B CD2 1 
ATOM   5410 C  CE1 . PHE B  1 156 ? 15.673  -8.132  -52.153 1.00 45.96  ?  156  PHE B CE1 1 
ATOM   5411 C  CE2 . PHE B  1 156 ? 16.764  -8.227  -54.287 1.00 53.05  ?  156  PHE B CE2 1 
ATOM   5412 C  CZ  . PHE B  1 156 ? 16.213  -8.877  -53.194 1.00 44.58  ?  156  PHE B CZ  1 
ATOM   5413 N  N   . GLY B  1 157 ? 17.108  -1.981  -51.473 1.00 43.52  ?  157  GLY B N   1 
ATOM   5414 C  CA  . GLY B  1 157 ? 17.050  -0.540  -51.307 1.00 47.66  ?  157  GLY B CA  1 
ATOM   5415 C  C   . GLY B  1 157 ? 18.215  0.067   -50.545 1.00 46.88  ?  157  GLY B C   1 
ATOM   5416 O  O   . GLY B  1 157 ? 18.486  1.264   -50.669 1.00 46.91  ?  157  GLY B O   1 
ATOM   5417 N  N   . PHE B  1 158 ? 18.914  -0.740  -49.754 1.00 42.16  ?  158  PHE B N   1 
ATOM   5418 C  CA  . PHE B  1 158 ? 19.887  -0.153  -48.832 1.00 45.82  ?  158  PHE B CA  1 
ATOM   5419 C  C   . PHE B  1 158 ? 21.243  -0.845  -48.720 1.00 46.01  ?  158  PHE B C   1 
ATOM   5420 O  O   . PHE B  1 158 ? 22.103  -0.366  -47.994 1.00 51.86  ?  158  PHE B O   1 
ATOM   5421 C  CB  . PHE B  1 158 ? 19.260  0.079   -47.442 1.00 39.99  ?  158  PHE B CB  1 
ATOM   5422 C  CG  . PHE B  1 158 ? 18.036  0.968   -47.472 1.00 36.10  ?  158  PHE B CG  1 
ATOM   5423 C  CD1 . PHE B  1 158 ? 18.163  2.347   -47.551 1.00 33.38  ?  158  PHE B CD1 1 
ATOM   5424 C  CD2 . PHE B  1 158 ? 16.763  0.424   -47.441 1.00 43.23  ?  158  PHE B CD2 1 
ATOM   5425 C  CE1 . PHE B  1 158 ? 17.040  3.172   -47.598 1.00 35.78  ?  158  PHE B CE1 1 
ATOM   5426 C  CE2 . PHE B  1 158 ? 15.634  1.246   -47.469 1.00 44.14  ?  158  PHE B CE2 1 
ATOM   5427 C  CZ  . PHE B  1 158 ? 15.776  2.621   -47.557 1.00 38.88  ?  158  PHE B CZ  1 
ATOM   5428 N  N   . LEU B  1 159 ? 21.445  -1.953  -49.429 1.00 50.33  ?  159  LEU B N   1 
ATOM   5429 C  CA  . LEU B  1 159 ? 22.787  -2.544  -49.517 1.00 51.89  ?  159  LEU B CA  1 
ATOM   5430 C  C   . LEU B  1 159 ? 23.745  -1.558  -50.177 1.00 55.57  ?  159  LEU B C   1 
ATOM   5431 O  O   . LEU B  1 159 ? 23.412  -0.943  -51.184 1.00 62.00  ?  159  LEU B O   1 
ATOM   5432 C  CB  . LEU B  1 159 ? 22.779  -3.859  -50.297 1.00 45.37  ?  159  LEU B CB  1 
ATOM   5433 C  CG  . LEU B  1 159 ? 24.127  -4.569  -50.423 1.00 48.30  ?  159  LEU B CG  1 
ATOM   5434 C  CD1 . LEU B  1 159 ? 23.986  -6.062  -50.142 1.00 46.09  ?  159  LEU B CD1 1 
ATOM   5435 C  CD2 . LEU B  1 159 ? 24.717  -4.350  -51.803 1.00 57.43  ?  159  LEU B CD2 1 
ATOM   5436 N  N   . ALA B  1 160 ? 24.934  -1.413  -49.605 1.00 59.26  ?  160  ALA B N   1 
ATOM   5437 C  CA  . ALA B  1 160 ? 25.863  -0.373  -50.026 1.00 54.95  ?  160  ALA B CA  1 
ATOM   5438 C  C   . ALA B  1 160 ? 27.301  -0.817  -49.908 1.00 54.96  ?  160  ALA B C   1 
ATOM   5439 O  O   . ALA B  1 160 ? 27.702  -1.403  -48.909 1.00 63.59  ?  160  ALA B O   1 
ATOM   5440 C  CB  . ALA B  1 160 ? 25.652  0.896   -49.213 1.00 52.26  ?  160  ALA B CB  1 
ATOM   5441 N  N   . LEU B  1 161 ? 28.055  -0.565  -50.969 1.00 62.78  ?  161  LEU B N   1 
ATOM   5442 C  CA  . LEU B  1 161 ? 29.502  -0.575  -50.933 1.00 59.94  ?  161  LEU B CA  1 
ATOM   5443 C  C   . LEU B  1 161 ? 29.880  0.883   -51.115 1.00 62.31  ?  161  LEU B C   1 
ATOM   5444 O  O   . LEU B  1 161 ? 30.065  1.341   -52.248 1.00 59.50  ?  161  LEU B O   1 
ATOM   5445 C  CB  . LEU B  1 161 ? 30.054  -1.439  -52.065 1.00 57.30  ?  161  LEU B CB  1 
ATOM   5446 C  CG  . LEU B  1 161 ? 29.890  -2.931  -51.787 1.00 60.61  ?  161  LEU B CG  1 
ATOM   5447 C  CD1 . LEU B  1 161 ? 30.687  -3.749  -52.756 1.00 67.26  ?  161  LEU B CD1 1 
ATOM   5448 C  CD2 . LEU B  1 161 ? 30.354  -3.236  -50.378 1.00 67.21  ?  161  LEU B CD2 1 
ATOM   5449 N  N   . PRO B  1 162 ? 29.940  1.630   -49.997 1.00 62.38  ?  162  PRO B N   1 
ATOM   5450 C  CA  . PRO B  1 162 ? 30.052  3.089   -50.036 1.00 57.72  ?  162  PRO B CA  1 
ATOM   5451 C  C   . PRO B  1 162 ? 31.243  3.512   -50.860 1.00 59.43  ?  162  PRO B C   1 
ATOM   5452 O  O   . PRO B  1 162 ? 32.342  2.996   -50.662 1.00 58.75  ?  162  PRO B O   1 
ATOM   5453 C  CB  . PRO B  1 162 ? 30.247  3.467   -48.560 1.00 54.28  ?  162  PRO B CB  1 
ATOM   5454 C  CG  . PRO B  1 162 ? 29.636  2.354   -47.809 1.00 50.33  ?  162  PRO B CG  1 
ATOM   5455 C  CD  . PRO B  1 162 ? 29.920  1.124   -48.612 1.00 60.13  ?  162  PRO B CD  1 
ATOM   5456 N  N   . GLY B  1 163 ? 31.005  4.413   -51.806 1.00 63.47  ?  163  GLY B N   1 
ATOM   5457 C  CA  . GLY B  1 163 ? 32.053  4.899   -52.682 1.00 63.99  ?  163  GLY B CA  1 
ATOM   5458 C  C   . GLY B  1 163 ? 32.102  4.207   -54.035 1.00 65.34  ?  163  GLY B C   1 
ATOM   5459 O  O   . GLY B  1 163 ? 32.816  4.646   -54.945 1.00 57.93  ?  163  GLY B O   1 
ATOM   5460 N  N   . SER B  1 164 ? 31.370  3.107   -54.169 1.00 64.89  ?  164  SER B N   1 
ATOM   5461 C  CA  . SER B  1 164 ? 31.304  2.420   -55.454 1.00 65.26  ?  164  SER B CA  1 
ATOM   5462 C  C   . SER B  1 164 ? 30.211  3.075   -56.272 1.00 66.98  ?  164  SER B C   1 
ATOM   5463 O  O   . SER B  1 164 ? 29.339  3.745   -55.718 1.00 71.33  ?  164  SER B O   1 
ATOM   5464 C  CB  . SER B  1 164 ? 30.987  0.939   -55.276 1.00 61.72  ?  164  SER B CB  1 
ATOM   5465 O  OG  . SER B  1 164 ? 29.634  0.762   -54.886 1.00 63.97  ?  164  SER B OG  1 
ATOM   5466 N  N   . ARG B  1 165 ? 30.255  2.881   -57.584 1.00 62.33  ?  165  ARG B N   1 
ATOM   5467 C  CA  . ARG B  1 165 ? 29.279  3.492   -58.463 1.00 69.43  ?  165  ARG B CA  1 
ATOM   5468 C  C   . ARG B  1 165 ? 28.050  2.598   -58.644 1.00 67.71  ?  165  ARG B C   1 
ATOM   5469 O  O   . ARG B  1 165 ? 26.957  3.089   -58.938 1.00 64.89  ?  165  ARG B O   1 
ATOM   5470 C  CB  . ARG B  1 165 ? 29.906  3.823   -59.825 1.00 76.33  ?  165  ARG B CB  1 
ATOM   5471 C  CG  . ARG B  1 165 ? 30.000  2.636   -60.770 1.00 87.96  ?  165  ARG B CG  1 
ATOM   5472 C  CD  . ARG B  1 165 ? 29.813  3.042   -62.233 1.00 94.28  ?  165  ARG B CD  1 
ATOM   5473 N  NE  . ARG B  1 165 ? 29.418  1.900   -63.057 1.00 96.61  ?  165  ARG B NE  1 
ATOM   5474 C  CZ  . ARG B  1 165 ? 28.162  1.620   -63.403 1.00 90.50  ?  165  ARG B CZ  1 
ATOM   5475 N  NH1 . ARG B  1 165 ? 27.169  2.409   -63.014 1.00 85.54  ?  165  ARG B NH1 1 
ATOM   5476 N  NH2 . ARG B  1 165 ? 27.896  0.554   -64.146 1.00 85.75  ?  165  ARG B NH2 1 
ATOM   5477 N  N   . GLU B  1 166 ? 28.219  1.291   -58.455 1.00 63.85  ?  166  GLU B N   1 
ATOM   5478 C  CA  . GLU B  1 166 ? 27.135  0.354   -58.758 1.00 73.66  ?  166  GLU B CA  1 
ATOM   5479 C  C   . GLU B  1 166 ? 26.360  -0.141  -57.530 1.00 69.50  ?  166  GLU B C   1 
ATOM   5480 O  O   . GLU B  1 166 ? 25.536  -1.053  -57.629 1.00 67.73  ?  166  GLU B O   1 
ATOM   5481 C  CB  . GLU B  1 166 ? 27.625  -0.816  -59.631 1.00 82.76  ?  166  GLU B CB  1 
ATOM   5482 C  CG  . GLU B  1 166 ? 28.835  -1.551  -59.101 1.00 92.70  ?  166  GLU B CG  1 
ATOM   5483 C  CD  . GLU B  1 166 ? 30.135  -0.802  -59.341 1.00 95.65  ?  166  GLU B CD  1 
ATOM   5484 O  OE1 . GLU B  1 166 ? 30.749  -1.011  -60.412 1.00 92.76  ?  166  GLU B OE1 1 
ATOM   5485 O  OE2 . GLU B  1 166 ? 30.534  -0.009  -58.456 1.00 89.27  ?  166  GLU B OE2 1 
ATOM   5486 N  N   . ALA B  1 167 ? 26.627  0.481   -56.385 1.00 65.50  ?  167  ALA B N   1 
ATOM   5487 C  CA  . ALA B  1 167 ? 25.882  0.241   -55.153 1.00 63.47  ?  167  ALA B CA  1 
ATOM   5488 C  C   . ALA B  1 167 ? 26.224  1.323   -54.139 1.00 62.41  ?  167  ALA B C   1 
ATOM   5489 O  O   . ALA B  1 167 ? 26.821  1.029   -53.114 1.00 50.52  ?  167  ALA B O   1 
ATOM   5490 C  CB  . ALA B  1 167 ? 26.214  -1.125  -54.580 1.00 57.23  ?  167  ALA B CB  1 
ATOM   5491 N  N   . PRO B  1 168 ? 25.853  2.583   -54.430 1.00 65.64  ?  168  PRO B N   1 
ATOM   5492 C  CA  . PRO B  1 168 ? 26.307  3.711   -53.608 1.00 57.37  ?  168  PRO B CA  1 
ATOM   5493 C  C   . PRO B  1 168 ? 25.505  3.870   -52.318 1.00 56.54  ?  168  PRO B C   1 
ATOM   5494 O  O   . PRO B  1 168 ? 25.831  4.727   -51.502 1.00 49.06  ?  168  PRO B O   1 
ATOM   5495 C  CB  . PRO B  1 168 ? 26.063  4.912   -54.523 1.00 58.64  ?  168  PRO B CB  1 
ATOM   5496 C  CG  . PRO B  1 168 ? 24.853  4.511   -55.314 1.00 59.17  ?  168  PRO B CG  1 
ATOM   5497 C  CD  . PRO B  1 168 ? 25.018  3.028   -55.566 1.00 58.36  ?  168  PRO B CD  1 
ATOM   5498 N  N   . GLY B  1 169 ? 24.465  3.059   -52.152 1.00 58.70  ?  169  GLY B N   1 
ATOM   5499 C  CA  . GLY B  1 169 ? 23.626  3.103   -50.967 1.00 52.15  ?  169  GLY B CA  1 
ATOM   5500 C  C   . GLY B  1 169 ? 22.467  4.079   -51.054 1.00 56.60  ?  169  GLY B C   1 
ATOM   5501 O  O   . GLY B  1 169 ? 22.423  4.937   -51.944 1.00 61.60  ?  169  GLY B O   1 
ATOM   5502 N  N   . ASN B  1 170 ? 21.527  3.938   -50.123 1.00 52.39  ?  170  ASN B N   1 
ATOM   5503 C  CA  . ASN B  1 170 ? 20.406  4.863   -49.976 1.00 49.15  ?  170  ASN B CA  1 
ATOM   5504 C  C   . ASN B  1 170 ? 19.435  4.922   -51.164 1.00 54.99  ?  170  ASN B C   1 
ATOM   5505 O  O   . ASN B  1 170 ? 18.621  5.850   -51.242 1.00 54.39  ?  170  ASN B O   1 
ATOM   5506 C  CB  . ASN B  1 170 ? 20.904  6.281   -49.650 1.00 51.67  ?  170  ASN B CB  1 
ATOM   5507 C  CG  . ASN B  1 170 ? 21.708  6.348   -48.350 1.00 53.06  ?  170  ASN B CG  1 
ATOM   5508 O  OD1 . ASN B  1 170 ? 21.527  5.533   -47.447 1.00 56.01  ?  170  ASN B OD1 1 
ATOM   5509 N  ND2 . ASN B  1 170 ? 22.597  7.333   -48.254 1.00 50.56  ?  170  ASN B ND2 1 
ATOM   5510 N  N   . VAL B  1 171 ? 19.505  3.951   -52.077 1.00 46.95  ?  171  VAL B N   1 
ATOM   5511 C  CA  . VAL B  1 171 ? 18.644  3.992   -53.264 1.00 37.47  ?  171  VAL B CA  1 
ATOM   5512 C  C   . VAL B  1 171 ? 17.160  3.965   -52.903 1.00 39.31  ?  171  VAL B C   1 
ATOM   5513 O  O   . VAL B  1 171 ? 16.340  4.577   -53.591 1.00 37.77  ?  171  VAL B O   1 
ATOM   5514 C  CB  . VAL B  1 171 ? 18.963  2.879   -54.302 1.00 40.85  ?  171  VAL B CB  1 
ATOM   5515 C  CG1 . VAL B  1 171 ? 20.448  2.857   -54.638 1.00 37.40  ?  171  VAL B CG1 1 
ATOM   5516 C  CG2 . VAL B  1 171 ? 18.488  1.514   -53.822 1.00 34.76  ?  171  VAL B CG2 1 
ATOM   5517 N  N   . GLY B  1 172 ? 16.817  3.277   -51.814 1.00 42.81  ?  172  GLY B N   1 
ATOM   5518 C  CA  . GLY B  1 172 ? 15.444  3.268   -51.337 1.00 34.31  ?  172  GLY B CA  1 
ATOM   5519 C  C   . GLY B  1 172 ? 14.997  4.676   -50.998 1.00 34.82  ?  172  GLY B C   1 
ATOM   5520 O  O   . GLY B  1 172 ? 13.858  5.037   -51.237 1.00 42.50  ?  172  GLY B O   1 
ATOM   5521 N  N   . LEU B  1 173 ? 15.899  5.481   -50.441 1.00 36.80  ?  173  LEU B N   1 
ATOM   5522 C  CA  . LEU B  1 173 ? 15.571  6.871   -50.134 1.00 35.55  ?  173  LEU B CA  1 
ATOM   5523 C  C   . LEU B  1 173 ? 15.418  7.676   -51.421 1.00 40.91  ?  173  LEU B C   1 
ATOM   5524 O  O   . LEU B  1 173 ? 14.526  8.521   -51.536 1.00 42.30  ?  173  LEU B O   1 
ATOM   5525 C  CB  . LEU B  1 173 ? 16.629  7.502   -49.220 1.00 36.27  ?  173  LEU B CB  1 
ATOM   5526 C  CG  . LEU B  1 173 ? 16.650  7.007   -47.765 1.00 38.63  ?  173  LEU B CG  1 
ATOM   5527 C  CD1 . LEU B  1 173 ? 17.844  7.547   -47.000 1.00 36.80  ?  173  LEU B CD1 1 
ATOM   5528 C  CD2 . LEU B  1 173 ? 15.369  7.359   -47.047 1.00 28.91  ?  173  LEU B CD2 1 
ATOM   5529 N  N   . LEU B  1 174 ? 16.282  7.399   -52.395 1.00 34.30  ?  174  LEU B N   1 
ATOM   5530 C  CA  . LEU B  1 174 ? 16.165  8.024   -53.711 1.00 43.82  ?  174  LEU B CA  1 
ATOM   5531 C  C   . LEU B  1 174 ? 14.856  7.664   -54.412 1.00 45.76  ?  174  LEU B C   1 
ATOM   5532 O  O   . LEU B  1 174 ? 14.305  8.475   -55.144 1.00 48.60  ?  174  LEU B O   1 
ATOM   5533 C  CB  . LEU B  1 174 ? 17.361  7.669   -54.586 1.00 42.56  ?  174  LEU B CB  1 
ATOM   5534 C  CG  . LEU B  1 174 ? 18.619  8.365   -54.066 1.00 47.54  ?  174  LEU B CG  1 
ATOM   5535 C  CD1 . LEU B  1 174 ? 19.858  7.897   -54.795 1.00 39.21  ?  174  LEU B CD1 1 
ATOM   5536 C  CD2 . LEU B  1 174 ? 18.463  9.876   -54.185 1.00 52.63  ?  174  LEU B CD2 1 
ATOM   5537 N  N   . ASP B  1 175 ? 14.362  6.452   -54.179 1.00 42.02  ?  175  ASP B N   1 
ATOM   5538 C  CA  . ASP B  1 175 ? 13.072  6.054   -54.712 1.00 40.16  ?  175  ASP B CA  1 
ATOM   5539 C  C   . ASP B  1 175 ? 12.025  7.029   -54.188 1.00 47.38  ?  175  ASP B C   1 
ATOM   5540 O  O   . ASP B  1 175 ? 11.281  7.625   -54.965 1.00 48.46  ?  175  ASP B O   1 
ATOM   5541 C  CB  . ASP B  1 175 ? 12.727  4.620   -54.301 1.00 40.45  ?  175  ASP B CB  1 
ATOM   5542 C  CG  . ASP B  1 175 ? 13.644  3.587   -54.940 1.00 45.49  ?  175  ASP B CG  1 
ATOM   5543 O  OD1 . ASP B  1 175 ? 14.572  3.983   -55.673 1.00 46.79  ?  175  ASP B OD1 1 
ATOM   5544 O  OD2 . ASP B  1 175 ? 13.451  2.373   -54.695 1.00 42.53  ?  175  ASP B OD2 1 
ATOM   5545 N  N   . GLN B  1 176 ? 11.990  7.202   -52.868 1.00 42.05  ?  176  GLN B N   1 
ATOM   5546 C  CA  . GLN B  1 176 ? 11.095  8.168   -52.243 1.00 41.11  ?  176  GLN B CA  1 
ATOM   5547 C  C   . GLN B  1 176 ? 11.267  9.580   -52.810 1.00 40.81  ?  176  GLN B C   1 
ATOM   5548 O  O   . GLN B  1 176 ? 10.284  10.242  -53.141 1.00 38.17  ?  176  GLN B O   1 
ATOM   5549 C  CB  . GLN B  1 176 ? 11.321  8.207   -50.735 1.00 39.63  ?  176  GLN B CB  1 
ATOM   5550 C  CG  . GLN B  1 176 ? 11.117  6.883   -50.000 1.00 36.47  ?  176  GLN B CG  1 
ATOM   5551 C  CD  . GLN B  1 176 ? 11.638  6.974   -48.575 1.00 43.42  ?  176  GLN B CD  1 
ATOM   5552 O  OE1 . GLN B  1 176 ? 12.005  8.059   -48.119 1.00 40.74  ?  176  GLN B OE1 1 
ATOM   5553 N  NE2 . GLN B  1 176 ? 11.687  5.843   -47.873 1.00 39.28  ?  176  GLN B NE2 1 
ATOM   5554 N  N   . ARG B  1 177 ? 12.512  10.039  -52.904 1.00 36.00  ?  177  ARG B N   1 
ATOM   5555 C  CA  . ARG B  1 177 ? 12.810  11.350  -53.477 1.00 45.55  ?  177  ARG B CA  1 
ATOM   5556 C  C   . ARG B  1 177 ? 12.252  11.498  -54.905 1.00 48.95  ?  177  ARG B C   1 
ATOM   5557 O  O   . ARG B  1 177 ? 11.760  12.561  -55.289 1.00 48.20  ?  177  ARG B O   1 
ATOM   5558 C  CB  . ARG B  1 177 ? 14.326  11.617  -53.453 1.00 41.88  ?  177  ARG B CB  1 
ATOM   5559 C  CG  . ARG B  1 177 ? 14.739  12.954  -54.052 1.00 42.64  ?  177  ARG B CG  1 
ATOM   5560 C  CD  . ARG B  1 177 ? 16.232  13.219  -53.897 1.00 46.58  ?  177  ARG B CD  1 
ATOM   5561 N  NE  . ARG B  1 177 ? 16.544  13.608  -52.523 1.00 58.42  ?  177  ARG B NE  1 
ATOM   5562 C  CZ  . ARG B  1 177 ? 17.773  13.744  -52.023 1.00 63.05  ?  177  ARG B CZ  1 
ATOM   5563 N  NH1 . ARG B  1 177 ? 18.854  13.526  -52.768 1.00 56.58  ?  177  ARG B NH1 1 
ATOM   5564 N  NH2 . ARG B  1 177 ? 17.920  14.100  -50.759 1.00 61.33  ?  177  ARG B NH2 1 
ATOM   5565 N  N   . LEU B  1 178 ? 12.310  10.425  -55.683 1.00 45.07  ?  178  LEU B N   1 
ATOM   5566 C  CA  . LEU B  1 178 ? 11.822  10.482  -57.059 1.00 45.99  ?  178  LEU B CA  1 
ATOM   5567 C  C   . LEU B  1 178 ? 10.303  10.590  -57.072 1.00 47.42  ?  178  LEU B C   1 
ATOM   5568 O  O   . LEU B  1 178 ? 9.734   11.323  -57.877 1.00 47.98  ?  178  LEU B O   1 
ATOM   5569 C  CB  . LEU B  1 178 ? 12.298  9.274   -57.874 1.00 43.58  ?  178  LEU B CB  1 
ATOM   5570 C  CG  . LEU B  1 178 ? 11.903  9.240   -59.359 1.00 55.18  ?  178  LEU B CG  1 
ATOM   5571 C  CD1 . LEU B  1 178 ? 12.454  10.441  -60.120 1.00 49.48  ?  178  LEU B CD1 1 
ATOM   5572 C  CD2 . LEU B  1 178 ? 12.363  7.945   -60.017 1.00 53.24  ?  178  LEU B CD2 1 
ATOM   5573 N  N   . ALA B  1 179 ? 9.649   9.866   -56.170 1.00 41.74  ?  179  ALA B N   1 
ATOM   5574 C  CA  . ALA B  1 179 ? 8.203   9.943   -56.049 1.00 42.90  ?  179  ALA B CA  1 
ATOM   5575 C  C   . ALA B  1 179 ? 7.780   11.362  -55.659 1.00 48.55  ?  179  ALA B C   1 
ATOM   5576 O  O   . ALA B  1 179 ? 6.759   11.861  -56.116 1.00 58.51  ?  179  ALA B O   1 
ATOM   5577 C  CB  . ALA B  1 179 ? 7.705   8.934   -55.035 1.00 46.05  ?  179  ALA B CB  1 
ATOM   5578 N  N   . LEU B  1 180 ? 8.586   12.015  -54.833 1.00 44.69  ?  180  LEU B N   1 
ATOM   5579 C  CA  . LEU B  1 180 ? 8.324   13.390  -54.421 1.00 44.22  ?  180  LEU B CA  1 
ATOM   5580 C  C   . LEU B  1 180 ? 8.431   14.355  -55.596 1.00 48.20  ?  180  LEU B C   1 
ATOM   5581 O  O   . LEU B  1 180 ? 7.628   15.279  -55.718 1.00 46.85  ?  180  LEU B O   1 
ATOM   5582 C  CB  . LEU B  1 180 ? 9.295   13.803  -53.315 1.00 41.29  ?  180  LEU B CB  1 
ATOM   5583 C  CG  . LEU B  1 180 ? 8.907   13.638  -51.848 1.00 42.73  ?  180  LEU B CG  1 
ATOM   5584 C  CD1 . LEU B  1 180 ? 8.129   12.364  -51.557 1.00 37.92  ?  180  LEU B CD1 1 
ATOM   5585 C  CD2 . LEU B  1 180 ? 10.175  13.678  -51.018 1.00 48.30  ?  180  LEU B CD2 1 
ATOM   5586 N  N   . GLN B  1 181 ? 9.433   14.143  -56.450 1.00 57.03  ?  181  GLN B N   1 
ATOM   5587 C  CA  . GLN B  1 181 ? 9.588   14.930  -57.677 1.00 56.68  ?  181  GLN B CA  1 
ATOM   5588 C  C   . GLN B  1 181 ? 8.379   14.707  -58.578 1.00 54.90  ?  181  GLN B C   1 
ATOM   5589 O  O   . GLN B  1 181 ? 7.882   15.639  -59.214 1.00 56.31  ?  181  GLN B O   1 
ATOM   5590 C  CB  . GLN B  1 181 ? 10.870  14.543  -58.420 1.00 67.19  ?  181  GLN B CB  1 
ATOM   5591 C  CG  . GLN B  1 181 ? 12.004  15.564  -58.323 1.00 82.24  ?  181  GLN B CG  1 
ATOM   5592 C  CD  . GLN B  1 181 ? 13.343  14.931  -57.934 1.00 87.26  ?  181  GLN B CD  1 
ATOM   5593 O  OE1 . GLN B  1 181 ? 13.529  13.715  -58.043 1.00 88.64  ?  181  GLN B OE1 1 
ATOM   5594 N  NE2 . GLN B  1 181 ? 14.276  15.758  -57.469 1.00 81.41  ?  181  GLN B NE2 1 
ATOM   5595 N  N   . TRP B  1 182 ? 7.902   13.467  -58.609 1.00 47.69  ?  182  TRP B N   1 
ATOM   5596 C  CA  . TRP B  1 182 ? 6.759   13.108  -59.434 1.00 46.91  ?  182  TRP B CA  1 
ATOM   5597 C  C   . TRP B  1 182 ? 5.517   13.887  -59.012 1.00 47.62  ?  182  TRP B C   1 
ATOM   5598 O  O   . TRP B  1 182 ? 4.773   14.380  -59.864 1.00 47.04  ?  182  TRP B O   1 
ATOM   5599 C  CB  . TRP B  1 182 ? 6.497   11.598  -59.375 1.00 45.67  ?  182  TRP B CB  1 
ATOM   5600 C  CG  . TRP B  1 182 ? 5.451   11.127  -60.352 1.00 48.19  ?  182  TRP B CG  1 
ATOM   5601 C  CD1 . TRP B  1 182 ? 5.667   10.612  -61.602 1.00 48.33  ?  182  TRP B CD1 1 
ATOM   5602 C  CD2 . TRP B  1 182 ? 4.027   11.130  -60.162 1.00 45.50  ?  182  TRP B CD2 1 
ATOM   5603 N  NE1 . TRP B  1 182 ? 4.467   10.292  -62.197 1.00 44.21  ?  182  TRP B NE1 1 
ATOM   5604 C  CE2 . TRP B  1 182 ? 3.447   10.604  -61.337 1.00 47.02  ?  182  TRP B CE2 1 
ATOM   5605 C  CE3 . TRP B  1 182 ? 3.188   11.525  -59.113 1.00 48.75  ?  182  TRP B CE3 1 
ATOM   5606 C  CZ2 . TRP B  1 182 ? 2.071   10.467  -61.493 1.00 51.16  ?  182  TRP B CZ2 1 
ATOM   5607 C  CZ3 . TRP B  1 182 ? 1.826   11.386  -59.264 1.00 46.61  ?  182  TRP B CZ3 1 
ATOM   5608 C  CH2 . TRP B  1 182 ? 1.277   10.860  -60.445 1.00 56.26  ?  182  TRP B CH2 1 
ATOM   5609 N  N   . VAL B  1 183 ? 5.296   13.975  -57.699 1.00 43.93  ?  183  VAL B N   1 
ATOM   5610 C  CA  . VAL B  1 183 ? 4.219   14.787  -57.137 1.00 45.16  ?  183  VAL B CA  1 
ATOM   5611 C  C   . VAL B  1 183 ? 4.338   16.272  -57.524 1.00 52.63  ?  183  VAL B C   1 
ATOM   5612 O  O   . VAL B  1 183 ? 3.349   16.898  -57.906 1.00 55.06  ?  183  VAL B O   1 
ATOM   5613 C  CB  . VAL B  1 183 ? 4.150   14.662  -55.586 1.00 45.80  ?  183  VAL B CB  1 
ATOM   5614 C  CG1 . VAL B  1 183 ? 3.353   15.823  -54.981 1.00 35.44  ?  183  VAL B CG1 1 
ATOM   5615 C  CG2 . VAL B  1 183 ? 3.561   13.312  -55.174 1.00 36.23  ?  183  VAL B CG2 1 
ATOM   5616 N  N   . GLN B  1 184 ? 5.539   16.837  -57.418 1.00 46.60  ?  184  GLN B N   1 
ATOM   5617 C  CA  . GLN B  1 184 ? 5.761   18.212  -57.864 1.00 50.94  ?  184  GLN B CA  1 
ATOM   5618 C  C   . GLN B  1 184 ? 5.350   18.422  -59.327 1.00 54.49  ?  184  GLN B C   1 
ATOM   5619 O  O   . GLN B  1 184 ? 4.759   19.449  -59.683 1.00 62.11  ?  184  GLN B O   1 
ATOM   5620 C  CB  . GLN B  1 184 ? 7.231   18.592  -57.696 1.00 56.19  ?  184  GLN B CB  1 
ATOM   5621 C  CG  . GLN B  1 184 ? 7.637   18.862  -56.279 1.00 60.56  ?  184  GLN B CG  1 
ATOM   5622 C  CD  . GLN B  1 184 ? 6.872   20.031  -55.696 1.00 68.49  ?  184  GLN B CD  1 
ATOM   5623 O  OE1 . GLN B  1 184 ? 7.012   21.165  -56.152 1.00 72.63  ?  184  GLN B OE1 1 
ATOM   5624 N  NE2 . GLN B  1 184 ? 6.041   19.756  -54.697 1.00 62.20  ?  184  GLN B NE2 1 
ATOM   5625 N  N   . GLU B  1 185 ? 5.651   17.440  -60.169 1.00 44.97  ?  185  GLU B N   1 
ATOM   5626 C  CA  . GLU B  1 185 ? 5.462   17.588  -61.614 1.00 53.69  ?  185  GLU B CA  1 
ATOM   5627 C  C   . GLU B  1 185 ? 4.066   17.223  -62.085 1.00 56.31  ?  185  GLU B C   1 
ATOM   5628 O  O   . GLU B  1 185 ? 3.662   17.597  -63.185 1.00 65.40  ?  185  GLU B O   1 
ATOM   5629 C  CB  . GLU B  1 185 ? 6.458   16.718  -62.385 1.00 55.59  ?  185  GLU B CB  1 
ATOM   5630 C  CG  . GLU B  1 185 ? 7.903   17.132  -62.257 1.00 68.91  ?  185  GLU B CG  1 
ATOM   5631 C  CD  . GLU B  1 185 ? 8.851   16.019  -62.667 1.00 81.34  ?  185  GLU B CD  1 
ATOM   5632 O  OE1 . GLU B  1 185 ? 8.369   14.887  -62.910 1.00 83.20  ?  185  GLU B OE1 1 
ATOM   5633 O  OE2 . GLU B  1 185 ? 10.073  16.273  -62.738 1.00 85.19  ?  185  GLU B OE2 1 
ATOM   5634 N  N   . ASN B  1 186 ? 3.333   16.482  -61.266 1.00 50.06  ?  186  ASN B N   1 
ATOM   5635 C  CA  . ASN B  1 186 ? 2.104   15.861  -61.735 1.00 45.53  ?  186  ASN B CA  1 
ATOM   5636 C  C   . ASN B  1 186 ? 0.860   16.062  -60.867 1.00 46.38  ?  186  ASN B C   1 
ATOM   5637 O  O   . ASN B  1 186 ? -0.263  15.969  -61.364 1.00 50.58  ?  186  ASN B O   1 
ATOM   5638 C  CB  . ASN B  1 186 ? 2.360   14.372  -61.990 1.00 49.74  ?  186  ASN B CB  1 
ATOM   5639 C  CG  . ASN B  1 186 ? 3.370   14.149  -63.100 1.00 48.04  ?  186  ASN B CG  1 
ATOM   5640 O  OD1 . ASN B  1 186 ? 3.203   14.658  -64.205 1.00 54.44  ?  186  ASN B OD1 1 
ATOM   5641 N  ND2 . ASN B  1 186 ? 4.436   13.424  -62.803 1.00 47.09  ?  186  ASN B ND2 1 
ATOM   5642 N  N   . ILE B  1 187 ? 1.050   16.361  -59.586 1.00 46.03  ?  187  ILE B N   1 
ATOM   5643 C  CA  . ILE B  1 187 ? -0.073  16.399  -58.659 1.00 39.36  ?  187  ILE B CA  1 
ATOM   5644 C  C   . ILE B  1 187 ? -1.121  17.448  -59.031 1.00 46.40  ?  187  ILE B C   1 
ATOM   5645 O  O   . ILE B  1 187 ? -2.304  17.240  -58.774 1.00 53.76  ?  187  ILE B O   1 
ATOM   5646 C  CB  . ILE B  1 187 ? 0.382   16.549  -57.169 1.00 46.52  ?  187  ILE B CB  1 
ATOM   5647 C  CG1 . ILE B  1 187 ? -0.558  15.769  -56.245 1.00 45.22  ?  187  ILE B CG1 1 
ATOM   5648 C  CG2 . ILE B  1 187 ? 0.491   18.021  -56.764 1.00 38.79  ?  187  ILE B CG2 1 
ATOM   5649 C  CD1 . ILE B  1 187 ? -0.688  14.294  -56.604 1.00 39.81  ?  187  ILE B CD1 1 
ATOM   5650 N  N   . ALA B  1 188 ? -0.706  18.550  -59.657 1.00 43.82  ?  188  ALA B N   1 
ATOM   5651 C  CA  . ALA B  1 188 ? -1.663  19.587  -60.057 1.00 51.31  ?  188  ALA B CA  1 
ATOM   5652 C  C   . ALA B  1 188 ? -2.758  19.033  -60.979 1.00 55.71  ?  188  ALA B C   1 
ATOM   5653 O  O   . ALA B  1 188 ? -3.874  19.559  -61.026 1.00 56.66  ?  188  ALA B O   1 
ATOM   5654 C  CB  . ALA B  1 188 ? -0.950  20.779  -60.710 1.00 41.61  ?  188  ALA B CB  1 
ATOM   5655 N  N   . ALA B  1 189 ? -2.442  17.956  -61.695 1.00 52.41  ?  189  ALA B N   1 
ATOM   5656 C  CA  . ALA B  1 189 ? -3.395  17.352  -62.621 1.00 56.32  ?  189  ALA B CA  1 
ATOM   5657 C  C   . ALA B  1 189 ? -4.463  16.552  -61.883 1.00 60.75  ?  189  ALA B C   1 
ATOM   5658 O  O   . ALA B  1 189 ? -5.492  16.202  -62.457 1.00 62.91  ?  189  ALA B O   1 
ATOM   5659 C  CB  . ALA B  1 189 ? -2.674  16.478  -63.641 1.00 51.86  ?  189  ALA B CB  1 
ATOM   5660 N  N   . PHE B  1 190 ? -4.212  16.263  -60.610 1.00 58.41  ?  190  PHE B N   1 
ATOM   5661 C  CA  . PHE B  1 190 ? -5.186  15.568  -59.777 1.00 55.67  ?  190  PHE B CA  1 
ATOM   5662 C  C   . PHE B  1 190 ? -5.939  16.547  -58.881 1.00 64.71  ?  190  PHE B C   1 
ATOM   5663 O  O   . PHE B  1 190 ? -6.808  16.142  -58.114 1.00 70.48  ?  190  PHE B O   1 
ATOM   5664 C  CB  . PHE B  1 190 ? -4.505  14.512  -58.907 1.00 48.77  ?  190  PHE B CB  1 
ATOM   5665 C  CG  . PHE B  1 190 ? -3.817  13.437  -59.682 1.00 52.75  ?  190  PHE B CG  1 
ATOM   5666 C  CD1 . PHE B  1 190 ? -2.535  13.628  -60.169 1.00 58.44  ?  190  PHE B CD1 1 
ATOM   5667 C  CD2 . PHE B  1 190 ? -4.444  12.228  -59.915 1.00 55.27  ?  190  PHE B CD2 1 
ATOM   5668 C  CE1 . PHE B  1 190 ? -1.892  12.635  -60.881 1.00 56.89  ?  190  PHE B CE1 1 
ATOM   5669 C  CE2 . PHE B  1 190 ? -3.807  11.229  -60.632 1.00 56.24  ?  190  PHE B CE2 1 
ATOM   5670 C  CZ  . PHE B  1 190 ? -2.530  11.434  -61.116 1.00 55.67  ?  190  PHE B CZ  1 
ATOM   5671 N  N   . GLY B  1 191 ? -5.593  17.829  -58.977 1.00 66.40  ?  191  GLY B N   1 
ATOM   5672 C  CA  . GLY B  1 191 ? -6.200  18.866  -58.159 1.00 61.88  ?  191  GLY B CA  1 
ATOM   5673 C  C   . GLY B  1 191 ? -5.372  19.143  -56.916 1.00 59.62  ?  191  GLY B C   1 
ATOM   5674 O  O   . GLY B  1 191 ? -5.783  19.893  -56.023 1.00 57.16  ?  191  GLY B O   1 
ATOM   5675 N  N   . GLY B  1 192 ? -4.196  18.526  -56.857 1.00 56.13  ?  192  GLY B N   1 
ATOM   5676 C  CA  . GLY B  1 192 ? -3.283  18.715  -55.743 1.00 55.02  ?  192  GLY B CA  1 
ATOM   5677 C  C   . GLY B  1 192 ? -2.533  20.030  -55.832 1.00 59.59  ?  192  GLY B C   1 
ATOM   5678 O  O   . GLY B  1 192 ? -2.352  20.574  -56.924 1.00 67.68  ?  192  GLY B O   1 
ATOM   5679 N  N   . ASP B  1 193 ? -2.105  20.546  -54.682 1.00 56.88  ?  193  ASP B N   1 
ATOM   5680 C  CA  . ASP B  1 193 ? -1.332  21.778  -54.629 1.00 54.82  ?  193  ASP B CA  1 
ATOM   5681 C  C   . ASP B  1 193 ? 0.134   21.407  -54.435 1.00 58.91  ?  193  ASP B C   1 
ATOM   5682 O  O   . ASP B  1 193 ? 0.520   20.957  -53.361 1.00 63.18  ?  193  ASP B O   1 
ATOM   5683 C  CB  . ASP B  1 193 ? -1.830  22.648  -53.475 1.00 52.57  ?  193  ASP B CB  1 
ATOM   5684 C  CG  . ASP B  1 193 ? -1.250  24.063  -53.493 1.00 62.02  ?  193  ASP B CG  1 
ATOM   5685 O  OD1 . ASP B  1 193 ? -0.218  24.293  -54.155 1.00 64.33  ?  193  ASP B OD1 1 
ATOM   5686 O  OD2 . ASP B  1 193 ? -1.821  24.949  -52.810 1.00 67.02  ?  193  ASP B OD2 1 
ATOM   5687 N  N   . PRO B  1 194 ? 0.958   21.576  -55.483 1.00 59.32  ?  194  PRO B N   1 
ATOM   5688 C  CA  . PRO B  1 194 ? 2.368   21.206  -55.301 1.00 51.90  ?  194  PRO B CA  1 
ATOM   5689 C  C   . PRO B  1 194 ? 3.100   22.166  -54.359 1.00 52.71  ?  194  PRO B C   1 
ATOM   5690 O  O   . PRO B  1 194 ? 4.144   21.809  -53.807 1.00 52.97  ?  194  PRO B O   1 
ATOM   5691 C  CB  . PRO B  1 194 ? 2.944   21.257  -56.726 1.00 48.40  ?  194  PRO B CB  1 
ATOM   5692 C  CG  . PRO B  1 194 ? 1.987   22.132  -57.507 1.00 48.26  ?  194  PRO B CG  1 
ATOM   5693 C  CD  . PRO B  1 194 ? 0.638   21.960  -56.874 1.00 48.97  ?  194  PRO B CD  1 
ATOM   5694 N  N   . MET B  1 195 ? 2.549   23.358  -54.153 1.00 56.16  ?  195  MET B N   1 
ATOM   5695 C  CA  . MET B  1 195 ? 3.146   24.304  -53.206 1.00 57.38  ?  195  MET B CA  1 
ATOM   5696 C  C   . MET B  1 195 ? 2.702   24.085  -51.753 1.00 55.83  ?  195  MET B C   1 
ATOM   5697 O  O   . MET B  1 195 ? 2.935   24.927  -50.891 1.00 58.54  ?  195  MET B O   1 
ATOM   5698 C  CB  . MET B  1 195 ? 2.894   25.744  -53.641 1.00 55.12  ?  195  MET B CB  1 
ATOM   5699 C  CG  . MET B  1 195 ? 3.447   26.045  -55.023 1.00 57.97  ?  195  MET B CG  1 
ATOM   5700 S  SD  . MET B  1 195 ? 3.472   27.805  -55.368 1.00 103.42 ?  195  MET B SD  1 
ATOM   5701 C  CE  . MET B  1 195 ? 1.926   28.318  -54.620 1.00 94.88  ?  195  MET B CE  1 
ATOM   5702 N  N   . SER B  1 196 ? 2.084   22.940  -51.488 1.00 49.11  ?  196  SER B N   1 
ATOM   5703 C  CA  . SER B  1 196 ? 1.707   22.567  -50.132 1.00 55.55  ?  196  SER B CA  1 
ATOM   5704 C  C   . SER B  1 196 ? 1.733   21.051  -49.989 1.00 57.14  ?  196  SER B C   1 
ATOM   5705 O  O   . SER B  1 196 ? 0.721   20.370  -50.185 1.00 60.46  ?  196  SER B O   1 
ATOM   5706 C  CB  . SER B  1 196 ? 0.322   23.104  -49.776 1.00 51.96  ?  196  SER B CB  1 
ATOM   5707 O  OG  . SER B  1 196 ? 0.019   22.803  -48.428 1.00 51.46  ?  196  SER B OG  1 
ATOM   5708 N  N   . VAL B  1 197 ? 2.901   20.526  -49.651 1.00 44.61  ?  197  VAL B N   1 
ATOM   5709 C  CA  . VAL B  1 197 ? 3.080   19.090  -49.579 1.00 40.88  ?  197  VAL B CA  1 
ATOM   5710 C  C   . VAL B  1 197 ? 3.568   18.676  -48.216 1.00 45.31  ?  197  VAL B C   1 
ATOM   5711 O  O   . VAL B  1 197 ? 4.630   19.110  -47.764 1.00 54.41  ?  197  VAL B O   1 
ATOM   5712 C  CB  . VAL B  1 197 ? 4.058   18.596  -50.669 1.00 41.32  ?  197  VAL B CB  1 
ATOM   5713 C  CG1 . VAL B  1 197 ? 4.482   17.158  -50.399 1.00 33.52  ?  197  VAL B CG1 1 
ATOM   5714 C  CG2 . VAL B  1 197 ? 3.404   18.731  -52.029 1.00 31.39  ?  197  VAL B CG2 1 
ATOM   5715 N  N   . THR B  1 198 ? 2.784   17.842  -47.551 1.00 43.76  ?  198  THR B N   1 
ATOM   5716 C  CA  . THR B  1 198 ? 3.151   17.379  -46.222 1.00 40.32  ?  198  THR B CA  1 
ATOM   5717 C  C   . THR B  1 198 ? 3.567   15.916  -46.251 1.00 42.12  ?  198  THR B C   1 
ATOM   5718 O  O   . THR B  1 198 ? 2.787   15.039  -46.654 1.00 43.19  ?  198  THR B O   1 
ATOM   5719 C  CB  . THR B  1 198 ? 1.991   17.558  -45.258 1.00 42.89  ?  198  THR B CB  1 
ATOM   5720 O  OG1 . THR B  1 198 ? 1.585   18.933  -45.265 1.00 55.35  ?  198  THR B OG1 1 
ATOM   5721 C  CG2 . THR B  1 198 ? 2.389   17.127  -43.837 1.00 38.02  ?  198  THR B CG2 1 
ATOM   5722 N  N   . LEU B  1 199 ? 4.805   15.651  -45.850 1.00 28.35  ?  199  LEU B N   1 
ATOM   5723 C  CA  . LEU B  1 199 ? 5.235   14.272  -45.660 1.00 32.70  ?  199  LEU B CA  1 
ATOM   5724 C  C   . LEU B  1 199 ? 4.785   13.753  -44.297 1.00 39.29  ?  199  LEU B C   1 
ATOM   5725 O  O   . LEU B  1 199 ? 4.946   14.434  -43.283 1.00 49.29  ?  199  LEU B O   1 
ATOM   5726 C  CB  . LEU B  1 199 ? 6.754   14.159  -45.738 1.00 32.33  ?  199  LEU B CB  1 
ATOM   5727 C  CG  . LEU B  1 199 ? 7.504   14.766  -46.918 1.00 36.05  ?  199  LEU B CG  1 
ATOM   5728 C  CD1 . LEU B  1 199 ? 8.965   14.373  -46.819 1.00 41.03  ?  199  LEU B CD1 1 
ATOM   5729 C  CD2 . LEU B  1 199 ? 6.884   14.341  -48.252 1.00 35.17  ?  199  LEU B CD2 1 
ATOM   5730 N  N   . PHE B  1 200 ? 4.221   12.553  -44.268 1.00 38.87  ?  200  PHE B N   1 
ATOM   5731 C  CA  . PHE B  1 200 ? 4.039   11.862  -42.998 1.00 44.25  ?  200  PHE B CA  1 
ATOM   5732 C  C   . PHE B  1 200 ? 4.404   10.393  -43.074 1.00 48.27  ?  200  PHE B C   1 
ATOM   5733 O  O   . PHE B  1 200 ? 4.179   9.746   -44.082 1.00 57.02  ?  200  PHE B O   1 
ATOM   5734 C  CB  . PHE B  1 200 ? 2.650   12.095  -42.382 1.00 38.54  ?  200  PHE B CB  1 
ATOM   5735 C  CG  . PHE B  1 200 ? 1.513   11.428  -43.094 1.00 39.20  ?  200  PHE B CG  1 
ATOM   5736 C  CD1 . PHE B  1 200 ? 1.413   11.436  -44.468 1.00 41.33  ?  200  PHE B CD1 1 
ATOM   5737 C  CD2 . PHE B  1 200 ? 0.492   10.841  -42.359 1.00 41.24  ?  200  PHE B CD2 1 
ATOM   5738 C  CE1 . PHE B  1 200 ? 0.332   10.841  -45.097 1.00 47.73  ?  200  PHE B CE1 1 
ATOM   5739 C  CE2 . PHE B  1 200 ? -0.587  10.243  -42.980 1.00 44.70  ?  200  PHE B CE2 1 
ATOM   5740 C  CZ  . PHE B  1 200 ? -0.668  10.237  -44.350 1.00 45.08  ?  200  PHE B CZ  1 
ATOM   5741 N  N   . GLY B  1 201 ? 4.999   9.879   -42.007 1.00 48.27  ?  201  GLY B N   1 
ATOM   5742 C  CA  . GLY B  1 201 ? 5.407   8.492   -41.977 1.00 52.72  ?  201  GLY B CA  1 
ATOM   5743 C  C   . GLY B  1 201 ? 5.543   7.964   -40.565 1.00 52.67  ?  201  GLY B C   1 
ATOM   5744 O  O   . GLY B  1 201 ? 5.673   8.738   -39.611 1.00 50.11  ?  201  GLY B O   1 
ATOM   5745 N  N   . GLU B  1 202 ? 5.517   6.639   -40.441 1.00 50.49  ?  202  GLU B N   1 
ATOM   5746 C  CA  . GLU B  1 202 ? 5.577   5.982   -39.147 1.00 46.20  ?  202  GLU B CA  1 
ATOM   5747 C  C   . GLU B  1 202 ? 6.776   5.051   -39.050 1.00 49.29  ?  202  GLU B C   1 
ATOM   5748 O  O   . GLU B  1 202 ? 7.081   4.327   -39.991 1.00 48.85  ?  202  GLU B O   1 
ATOM   5749 C  CB  . GLU B  1 202 ? 4.293   5.211   -38.879 1.00 48.35  ?  202  GLU B CB  1 
ATOM   5750 C  CG  . GLU B  1 202 ? 4.167   4.680   -37.455 1.00 53.38  ?  202  GLU B CG  1 
ATOM   5751 C  CD  . GLU B  1 202 ? 4.679   3.261   -37.294 1.00 55.44  ?  202  GLU B CD  1 
ATOM   5752 O  OE1 . GLU B  1 202 ? 5.045   2.621   -38.298 1.00 53.53  ?  202  GLU B OE1 1 
ATOM   5753 O  OE2 . GLU B  1 202 ? 4.721   2.783   -36.147 1.00 64.35  ?  202  GLU B OE2 1 
ATOM   5754 N  N   . SER B  1 203 ? 7.456   5.091   -37.906 1.00 48.31  ?  203  SER B N   1 
ATOM   5755 C  CA  . SER B  1 203 ? 8.610   4.237   -37.654 1.00 39.63  ?  203  SER B CA  1 
ATOM   5756 C  C   . SER B  1 203 ? 9.698   4.489   -38.699 1.00 44.41  ?  203  SER B C   1 
ATOM   5757 O  O   . SER B  1 203 ? 10.164  5.625   -38.841 1.00 44.30  ?  203  SER B O   1 
ATOM   5758 C  CB  . SER B  1 203 ? 8.184   2.770   -37.631 1.00 34.63  ?  203  SER B CB  1 
ATOM   5759 O  OG  . SER B  1 203 ? 9.218   1.945   -37.130 1.00 45.69  ?  203  SER B OG  1 
ATOM   5760 N  N   . ALA B  1 204 ? 10.084  3.450   -39.442 1.00 42.01  ?  204  ALA B N   1 
ATOM   5761 C  CA  . ALA B  1 204 ? 11.097  3.612   -40.485 1.00 48.76  ?  204  ALA B CA  1 
ATOM   5762 C  C   . ALA B  1 204 ? 10.700  4.718   -41.458 1.00 43.49  ?  204  ALA B C   1 
ATOM   5763 O  O   . ALA B  1 204 ? 11.555  5.442   -41.958 1.00 39.60  ?  204  ALA B O   1 
ATOM   5764 C  CB  . ALA B  1 204 ? 11.353  2.301   -41.224 1.00 48.13  ?  204  ALA B CB  1 
ATOM   5765 N  N   . GLY B  1 205 ? 9.397   4.866   -41.682 1.00 44.20  ?  205  GLY B N   1 
ATOM   5766 C  CA  . GLY B  1 205 ? 8.871   5.940   -42.513 1.00 51.48  ?  205  GLY B CA  1 
ATOM   5767 C  C   . GLY B  1 205 ? 9.058   7.335   -41.928 1.00 49.39  ?  205  GLY B C   1 
ATOM   5768 O  O   . GLY B  1 205 ? 9.365   8.285   -42.652 1.00 43.75  ?  205  GLY B O   1 
ATOM   5769 N  N   . ALA B  1 206 ? 8.860   7.458   -40.619 1.00 44.51  ?  206  ALA B N   1 
ATOM   5770 C  CA  . ALA B  1 206 ? 9.164   8.690   -39.897 1.00 35.55  ?  206  ALA B CA  1 
ATOM   5771 C  C   . ALA B  1 206 ? 10.643  8.992   -40.000 1.00 33.33  ?  206  ALA B C   1 
ATOM   5772 O  O   . ALA B  1 206 ? 11.044  10.142  -40.181 1.00 39.58  ?  206  ALA B O   1 
ATOM   5773 C  CB  . ALA B  1 206 ? 8.752   8.571   -38.415 1.00 42.12  ?  206  ALA B CB  1 
ATOM   5774 N  N   . ALA B  1 207 ? 11.469  7.962   -39.883 1.00 31.32  ?  207  ALA B N   1 
ATOM   5775 C  CA  . ALA B  1 207 ? 12.902  8.170   -40.075 1.00 35.62  ?  207  ALA B CA  1 
ATOM   5776 C  C   . ALA B  1 207 ? 13.214  8.694   -41.487 1.00 42.95  ?  207  ALA B C   1 
ATOM   5777 O  O   . ALA B  1 207 ? 14.025  9.609   -41.645 1.00 47.26  ?  207  ALA B O   1 
ATOM   5778 C  CB  . ALA B  1 207 ? 13.680  6.892   -39.784 1.00 36.01  ?  207  ALA B CB  1 
ATOM   5779 N  N   . SER B  1 208 ? 12.564  8.127   -42.505 1.00 38.63  ?  208  SER B N   1 
ATOM   5780 C  CA  . SER B  1 208 ? 12.801  8.551   -43.892 1.00 40.19  ?  208  SER B CA  1 
ATOM   5781 C  C   . SER B  1 208 ? 12.420  10.010  -44.077 1.00 37.08  ?  208  SER B C   1 
ATOM   5782 O  O   . SER B  1 208 ? 13.207  10.805  -44.588 1.00 35.32  ?  208  SER B O   1 
ATOM   5783 C  CB  . SER B  1 208 ? 12.028  7.679   -44.882 1.00 36.01  ?  208  SER B CB  1 
ATOM   5784 O  OG  . SER B  1 208 ? 12.436  6.329   -44.785 1.00 36.68  ?  208  SER B OG  1 
ATOM   5785 N  N   . VAL B  1 209 ? 11.206  10.351  -43.653 1.00 37.25  ?  209  VAL B N   1 
ATOM   5786 C  CA  . VAL B  1 209 ? 10.773  11.744  -43.594 1.00 39.98  ?  209  VAL B CA  1 
ATOM   5787 C  C   . VAL B  1 209 ? 11.841  12.610  -42.913 1.00 48.07  ?  209  VAL B C   1 
ATOM   5788 O  O   . VAL B  1 209 ? 12.238  13.661  -43.436 1.00 51.62  ?  209  VAL B O   1 
ATOM   5789 C  CB  . VAL B  1 209 ? 9.463   11.873  -42.814 1.00 33.42  ?  209  VAL B CB  1 
ATOM   5790 C  CG1 . VAL B  1 209 ? 9.103   13.334  -42.613 1.00 32.32  ?  209  VAL B CG1 1 
ATOM   5791 C  CG2 . VAL B  1 209 ? 8.369   11.141  -43.532 1.00 28.50  ?  209  VAL B CG2 1 
ATOM   5792 N  N   . GLY B  1 210 ? 12.324  12.150  -41.762 1.00 33.38  ?  210  GLY B N   1 
ATOM   5793 C  CA  . GLY B  1 210 ? 13.415  12.832  -41.095 1.00 45.04  ?  210  GLY B CA  1 
ATOM   5794 C  C   . GLY B  1 210 ? 14.613  13.078  -41.998 1.00 46.41  ?  210  GLY B C   1 
ATOM   5795 O  O   . GLY B  1 210 ? 15.144  14.182  -42.060 1.00 50.18  ?  210  GLY B O   1 
ATOM   5796 N  N   . MET B  1 211 ? 15.045  12.046  -42.708 1.00 46.18  ?  211  MET B N   1 
ATOM   5797 C  CA  . MET B  1 211 ? 16.188  12.195  -43.601 1.00 44.02  ?  211  MET B CA  1 
ATOM   5798 C  C   . MET B  1 211 ? 15.924  13.110  -44.797 1.00 49.88  ?  211  MET B C   1 
ATOM   5799 O  O   . MET B  1 211 ? 16.859  13.727  -45.300 1.00 55.79  ?  211  MET B O   1 
ATOM   5800 C  CB  . MET B  1 211 ? 16.694  10.835  -44.061 1.00 38.55  ?  211  MET B CB  1 
ATOM   5801 C  CG  . MET B  1 211 ? 17.536  10.129  -43.016 1.00 41.86  ?  211  MET B CG  1 
ATOM   5802 S  SD  . MET B  1 211 ? 17.393  8.351   -43.201 1.00 60.81  ?  211  MET B SD  1 
ATOM   5803 C  CE  . MET B  1 211 ? 17.943  7.830   -41.595 1.00 41.54  ?  211  MET B CE  1 
ATOM   5804 N  N   . HIS B  1 212 ? 14.676  13.209  -45.257 1.00 36.04  ?  212  HIS B N   1 
ATOM   5805 C  CA  . HIS B  1 212 ? 14.372  14.205  -46.286 1.00 41.13  ?  212  HIS B CA  1 
ATOM   5806 C  C   . HIS B  1 212 ? 14.514  15.639  -45.738 1.00 47.64  ?  212  HIS B C   1 
ATOM   5807 O  O   . HIS B  1 212 ? 14.904  16.553  -46.465 1.00 54.11  ?  212  HIS B O   1 
ATOM   5808 C  CB  . HIS B  1 212 ? 12.992  13.973  -46.923 1.00 46.64  ?  212  HIS B CB  1 
ATOM   5809 C  CG  . HIS B  1 212 ? 12.914  12.729  -47.761 1.00 48.45  ?  212  HIS B CG  1 
ATOM   5810 N  ND1 . HIS B  1 212 ? 13.645  12.564  -48.919 1.00 44.63  ?  212  HIS B ND1 1 
ATOM   5811 C  CD2 . HIS B  1 212 ? 12.197  11.590  -47.604 1.00 42.18  ?  212  HIS B CD2 1 
ATOM   5812 C  CE1 . HIS B  1 212 ? 13.385  11.377  -49.435 1.00 43.62  ?  212  HIS B CE1 1 
ATOM   5813 N  NE2 . HIS B  1 212 ? 12.511  10.765  -48.657 1.00 44.74  ?  212  HIS B NE2 1 
ATOM   5814 N  N   . ILE B  1 213 ? 14.216  15.828  -44.455 1.00 39.23  ?  213  ILE B N   1 
ATOM   5815 C  CA  . ILE B  1 213 ? 14.463  17.108  -43.796 1.00 40.42  ?  213  ILE B CA  1 
ATOM   5816 C  C   . ILE B  1 213 ? 15.952  17.441  -43.809 1.00 44.09  ?  213  ILE B C   1 
ATOM   5817 O  O   . ILE B  1 213 ? 16.351  18.604  -43.916 1.00 43.33  ?  213  ILE B O   1 
ATOM   5818 C  CB  . ILE B  1 213 ? 13.996  17.064  -42.326 1.00 42.85  ?  213  ILE B CB  1 
ATOM   5819 C  CG1 . ILE B  1 213 ? 12.479  16.920  -42.243 1.00 41.45  ?  213  ILE B CG1 1 
ATOM   5820 C  CG2 . ILE B  1 213 ? 14.475  18.289  -41.538 1.00 38.87  ?  213  ILE B CG2 1 
ATOM   5821 C  CD1 . ILE B  1 213 ? 11.989  16.714  -40.841 1.00 37.52  ?  213  ILE B CD1 1 
ATOM   5822 N  N   . LEU B  1 214 ? 16.776  16.407  -43.700 1.00 47.95  ?  214  LEU B N   1 
ATOM   5823 C  CA  . LEU B  1 214 ? 18.212  16.589  -43.519 1.00 45.74  ?  214  LEU B CA  1 
ATOM   5824 C  C   . LEU B  1 214 ? 19.012  16.505  -44.819 1.00 51.70  ?  214  LEU B C   1 
ATOM   5825 O  O   . LEU B  1 214 ? 20.228  16.699  -44.820 1.00 59.47  ?  214  LEU B O   1 
ATOM   5826 C  CB  . LEU B  1 214 ? 18.738  15.565  -42.514 1.00 44.51  ?  214  LEU B CB  1 
ATOM   5827 C  CG  . LEU B  1 214 ? 18.095  15.656  -41.130 1.00 46.02  ?  214  LEU B CG  1 
ATOM   5828 C  CD1 . LEU B  1 214 ? 18.604  14.560  -40.196 1.00 44.28  ?  214  LEU B CD1 1 
ATOM   5829 C  CD2 . LEU B  1 214 ? 18.386  17.025  -40.554 1.00 40.45  ?  214  LEU B CD2 1 
ATOM   5830 N  N   . SER B  1 215 ? 18.331  16.212  -45.922 1.00 51.73  ?  215  SER B N   1 
ATOM   5831 C  CA  . SER B  1 215 ? 18.995  16.116  -47.218 1.00 49.78  ?  215  SER B CA  1 
ATOM   5832 C  C   . SER B  1 215 ? 18.494  17.224  -48.144 1.00 51.37  ?  215  SER B C   1 
ATOM   5833 O  O   . SER B  1 215 ? 17.356  17.187  -48.608 1.00 51.67  ?  215  SER B O   1 
ATOM   5834 C  CB  . SER B  1 215 ? 18.757  14.741  -47.841 1.00 47.73  ?  215  SER B CB  1 
ATOM   5835 O  OG  . SER B  1 215 ? 19.550  14.558  -49.007 1.00 58.04  ?  215  SER B OG  1 
ATOM   5836 N  N   . LEU B  1 216 ? 19.351  18.209  -48.396 1.00 49.77  ?  216  LEU B N   1 
ATOM   5837 C  CA  . LEU B  1 216 ? 18.956  19.427  -49.102 1.00 57.54  ?  216  LEU B CA  1 
ATOM   5838 C  C   . LEU B  1 216 ? 18.202  19.240  -50.430 1.00 63.05  ?  216  LEU B C   1 
ATOM   5839 O  O   . LEU B  1 216 ? 17.264  19.987  -50.705 1.00 70.53  ?  216  LEU B O   1 
ATOM   5840 C  CB  . LEU B  1 216 ? 20.152  20.364  -49.304 1.00 67.94  ?  216  LEU B CB  1 
ATOM   5841 C  CG  . LEU B  1 216 ? 19.761  21.704  -49.946 1.00 78.75  ?  216  LEU B CG  1 
ATOM   5842 C  CD1 . LEU B  1 216 ? 19.137  22.646  -48.915 1.00 70.80  ?  216  LEU B CD1 1 
ATOM   5843 C  CD2 . LEU B  1 216 ? 20.928  22.369  -50.694 1.00 81.99  ?  216  LEU B CD2 1 
ATOM   5844 N  N   . PRO B  1 217 ? 18.602  18.260  -51.263 1.00 56.02  ?  217  PRO B N   1 
ATOM   5845 C  CA  . PRO B  1 217 ? 17.823  18.115  -52.504 1.00 54.22  ?  217  PRO B CA  1 
ATOM   5846 C  C   . PRO B  1 217 ? 16.347  17.723  -52.298 1.00 54.89  ?  217  PRO B C   1 
ATOM   5847 O  O   . PRO B  1 217 ? 15.542  17.950  -53.203 1.00 58.16  ?  217  PRO B O   1 
ATOM   5848 C  CB  . PRO B  1 217 ? 18.577  17.017  -53.270 1.00 43.94  ?  217  PRO B CB  1 
ATOM   5849 C  CG  . PRO B  1 217 ? 19.977  17.108  -52.759 1.00 46.97  ?  217  PRO B CG  1 
ATOM   5850 C  CD  . PRO B  1 217 ? 19.830  17.447  -51.292 1.00 49.45  ?  217  PRO B CD  1 
ATOM   5851 N  N   . SER B  1 218 ? 15.999  17.168  -51.137 1.00 53.45  ?  218  SER B N   1 
ATOM   5852 C  CA  . SER B  1 218 ? 14.608  16.811  -50.842 1.00 40.53  ?  218  SER B CA  1 
ATOM   5853 C  C   . SER B  1 218 ? 13.814  18.012  -50.376 1.00 48.72  ?  218  SER B C   1 
ATOM   5854 O  O   . SER B  1 218 ? 12.594  18.051  -50.536 1.00 59.56  ?  218  SER B O   1 
ATOM   5855 C  CB  . SER B  1 218 ? 14.527  15.725  -49.771 1.00 41.20  ?  218  SER B CB  1 
ATOM   5856 O  OG  . SER B  1 218 ? 14.884  14.459  -50.285 1.00 45.26  ?  218  SER B OG  1 
ATOM   5857 N  N   . ARG B  1 219 ? 14.512  18.988  -49.803 1.00 46.26  ?  219  ARG B N   1 
ATOM   5858 C  CA  . ARG B  1 219 ? 13.879  20.152  -49.174 1.00 48.11  ?  219  ARG B CA  1 
ATOM   5859 C  C   . ARG B  1 219 ? 12.988  21.000  -50.094 1.00 53.78  ?  219  ARG B C   1 
ATOM   5860 O  O   . ARG B  1 219 ? 12.014  21.592  -49.643 1.00 56.46  ?  219  ARG B O   1 
ATOM   5861 C  CB  . ARG B  1 219 ? 14.937  21.021  -48.484 1.00 51.36  ?  219  ARG B CB  1 
ATOM   5862 C  CG  . ARG B  1 219 ? 15.602  20.333  -47.283 1.00 51.32  ?  219  ARG B CG  1 
ATOM   5863 C  CD  . ARG B  1 219 ? 14.598  20.054  -46.160 1.00 62.18  ?  219  ARG B CD  1 
ATOM   5864 N  NE  . ARG B  1 219 ? 14.891  20.841  -44.959 1.00 75.42  ?  219  ARG B NE  1 
ATOM   5865 C  CZ  . ARG B  1 219 ? 14.288  21.984  -44.640 1.00 83.65  ?  219  ARG B CZ  1 
ATOM   5866 N  NH1 . ARG B  1 219 ? 13.335  22.478  -45.425 1.00 90.65  ?  219  ARG B NH1 1 
ATOM   5867 N  NH2 . ARG B  1 219 ? 14.631  22.633  -43.533 1.00 81.46  ?  219  ARG B NH2 1 
ATOM   5868 N  N   . SER B  1 220 ? 13.294  21.047  -51.386 1.00 56.33  ?  220  SER B N   1 
ATOM   5869 C  CA  . SER B  1 220 ? 12.462  21.831  -52.288 1.00 58.26  ?  220  SER B CA  1 
ATOM   5870 C  C   . SER B  1 220 ? 11.235  21.050  -52.761 1.00 54.80  ?  220  SER B C   1 
ATOM   5871 O  O   . SER B  1 220 ? 10.476  21.527  -53.606 1.00 50.59  ?  220  SER B O   1 
ATOM   5872 C  CB  . SER B  1 220 ? 13.274  22.336  -53.481 1.00 58.82  ?  220  SER B CB  1 
ATOM   5873 O  OG  . SER B  1 220 ? 13.686  21.257  -54.299 1.00 69.65  ?  220  SER B OG  1 
ATOM   5874 N  N   . LEU B  1 221 ? 11.034  19.856  -52.209 1.00 49.50  ?  221  LEU B N   1 
ATOM   5875 C  CA  . LEU B  1 221 ? 9.940   18.988  -52.655 1.00 45.36  ?  221  LEU B CA  1 
ATOM   5876 C  C   . LEU B  1 221 ? 8.818   18.826  -51.621 1.00 47.62  ?  221  LEU B C   1 
ATOM   5877 O  O   . LEU B  1 221 ? 7.829   18.159  -51.891 1.00 51.73  ?  221  LEU B O   1 
ATOM   5878 C  CB  . LEU B  1 221 ? 10.479  17.610  -53.043 1.00 44.65  ?  221  LEU B CB  1 
ATOM   5879 C  CG  . LEU B  1 221 ? 11.729  17.569  -53.916 1.00 47.10  ?  221  LEU B CG  1 
ATOM   5880 C  CD1 . LEU B  1 221 ? 12.193  16.127  -54.119 1.00 43.58  ?  221  LEU B CD1 1 
ATOM   5881 C  CD2 . LEU B  1 221 ? 11.459  18.260  -55.252 1.00 42.88  ?  221  LEU B CD2 1 
ATOM   5882 N  N   . PHE B  1 222 ? 8.978   19.410  -50.436 1.00 49.41  ?  222  PHE B N   1 
ATOM   5883 C  CA  . PHE B  1 222 ? 7.910   19.416  -49.434 1.00 45.81  ?  222  PHE B CA  1 
ATOM   5884 C  C   . PHE B  1 222 ? 8.001   20.652  -48.539 1.00 45.29  ?  222  PHE B C   1 
ATOM   5885 O  O   . PHE B  1 222 ? 8.991   21.381  -48.575 1.00 43.49  ?  222  PHE B O   1 
ATOM   5886 C  CB  . PHE B  1 222 ? 7.916   18.129  -48.597 1.00 39.92  ?  222  PHE B CB  1 
ATOM   5887 C  CG  . PHE B  1 222 ? 9.148   17.953  -47.755 1.00 35.72  ?  222  PHE B CG  1 
ATOM   5888 C  CD1 . PHE B  1 222 ? 10.343  17.546  -48.327 1.00 32.40  ?  222  PHE B CD1 1 
ATOM   5889 C  CD2 . PHE B  1 222 ? 9.107   18.189  -46.388 1.00 38.80  ?  222  PHE B CD2 1 
ATOM   5890 C  CE1 . PHE B  1 222 ? 11.475  17.377  -47.559 1.00 43.54  ?  222  PHE B CE1 1 
ATOM   5891 C  CE2 . PHE B  1 222 ? 10.242  18.026  -45.599 1.00 38.15  ?  222  PHE B CE2 1 
ATOM   5892 C  CZ  . PHE B  1 222 ? 11.428  17.619  -46.182 1.00 46.43  ?  222  PHE B CZ  1 
ATOM   5893 N  N   . HIS B  1 223 ? 6.970   20.883  -47.733 1.00 47.21  ?  223  HIS B N   1 
ATOM   5894 C  CA  . HIS B  1 223 ? 6.908   22.095  -46.922 1.00 42.97  ?  223  HIS B CA  1 
ATOM   5895 C  C   . HIS B  1 223 ? 6.701   21.820  -45.435 1.00 50.06  ?  223  HIS B C   1 
ATOM   5896 O  O   . HIS B  1 223 ? 7.032   22.662  -44.601 1.00 46.32  ?  223  HIS B O   1 
ATOM   5897 C  CB  . HIS B  1 223 ? 5.826   23.029  -47.458 1.00 34.34  ?  223  HIS B CB  1 
ATOM   5898 C  CG  . HIS B  1 223 ? 5.863   23.169  -48.944 1.00 57.33  ?  223  HIS B CG  1 
ATOM   5899 N  ND1 . HIS B  1 223 ? 5.108   22.379  -49.785 1.00 53.98  ?  223  HIS B ND1 1 
ATOM   5900 C  CD2 . HIS B  1 223 ? 6.611   23.965  -49.743 1.00 65.32  ?  223  HIS B CD2 1 
ATOM   5901 C  CE1 . HIS B  1 223 ? 5.373   22.701  -51.037 1.00 60.33  ?  223  HIS B CE1 1 
ATOM   5902 N  NE2 . HIS B  1 223 ? 6.281   23.661  -51.040 1.00 59.61  ?  223  HIS B NE2 1 
ATOM   5903 N  N   . ARG B  1 224 ? 6.170   20.639  -45.117 1.00 52.76  ?  224  ARG B N   1 
ATOM   5904 C  CA  . ARG B  1 224 ? 5.886   20.245  -43.739 1.00 51.15  ?  224  ARG B CA  1 
ATOM   5905 C  C   . ARG B  1 224 ? 6.117   18.749  -43.547 1.00 53.88  ?  224  ARG B C   1 
ATOM   5906 O  O   . ARG B  1 224 ? 6.084   17.981  -44.512 1.00 54.95  ?  224  ARG B O   1 
ATOM   5907 C  CB  . ARG B  1 224 ? 4.442   20.589  -43.385 1.00 51.88  ?  224  ARG B CB  1 
ATOM   5908 C  CG  . ARG B  1 224 ? 4.223   22.053  -43.150 1.00 57.49  ?  224  ARG B CG  1 
ATOM   5909 C  CD  . ARG B  1 224 ? 2.753   22.400  -43.068 1.00 56.48  ?  224  ARG B CD  1 
ATOM   5910 N  NE  . ARG B  1 224 ? 2.127   22.511  -44.376 1.00 53.61  ?  224  ARG B NE  1 
ATOM   5911 C  CZ  . ARG B  1 224 ? 2.304   23.541  -45.195 1.00 61.04  ?  224  ARG B CZ  1 
ATOM   5912 N  NH1 . ARG B  1 224 ? 3.110   24.536  -44.838 1.00 51.32  ?  224  ARG B NH1 1 
ATOM   5913 N  NH2 . ARG B  1 224 ? 1.695   23.566  -46.380 1.00 68.84  ?  224  ARG B NH2 1 
ATOM   5914 N  N   . ALA B  1 225 ? 6.330   18.335  -42.299 1.00 49.05  ?  225  ALA B N   1 
ATOM   5915 C  CA  . ALA B  1 225 ? 6.665   16.946  -42.009 1.00 42.93  ?  225  ALA B CA  1 
ATOM   5916 C  C   . ALA B  1 225 ? 6.016   16.436  -40.736 1.00 44.91  ?  225  ALA B C   1 
ATOM   5917 O  O   . ALA B  1 225 ? 5.836   17.171  -39.769 1.00 50.63  ?  225  ALA B O   1 
ATOM   5918 C  CB  . ALA B  1 225 ? 8.159   16.782  -41.920 1.00 43.81  ?  225  ALA B CB  1 
ATOM   5919 N  N   . VAL B  1 226 ? 5.661   15.161  -40.753 1.00 40.89  ?  226  VAL B N   1 
ATOM   5920 C  CA  . VAL B  1 226 ? 5.071   14.511  -39.607 1.00 37.17  ?  226  VAL B CA  1 
ATOM   5921 C  C   . VAL B  1 226 ? 5.809   13.207  -39.395 1.00 44.06  ?  226  VAL B C   1 
ATOM   5922 O  O   . VAL B  1 226 ? 5.857   12.362  -40.296 1.00 39.99  ?  226  VAL B O   1 
ATOM   5923 C  CB  . VAL B  1 226 ? 3.577   14.208  -39.817 1.00 39.10  ?  226  VAL B CB  1 
ATOM   5924 C  CG1 . VAL B  1 226 ? 2.986   13.487  -38.584 1.00 39.91  ?  226  VAL B CG1 1 
ATOM   5925 C  CG2 . VAL B  1 226 ? 2.803   15.485  -40.126 1.00 32.68  ?  226  VAL B CG2 1 
ATOM   5926 N  N   . LEU B  1 227 ? 6.387   13.053  -38.205 1.00 45.61  ?  227  LEU B N   1 
ATOM   5927 C  CA  . LEU B  1 227 ? 7.141   11.857  -37.867 1.00 42.08  ?  227  LEU B CA  1 
ATOM   5928 C  C   . LEU B  1 227 ? 6.456   11.114  -36.738 1.00 42.23  ?  227  LEU B C   1 
ATOM   5929 O  O   . LEU B  1 227 ? 6.479   11.542  -35.580 1.00 44.85  ?  227  LEU B O   1 
ATOM   5930 C  CB  . LEU B  1 227 ? 8.583   12.189  -37.474 1.00 38.37  ?  227  LEU B CB  1 
ATOM   5931 C  CG  . LEU B  1 227 ? 9.499   12.818  -38.527 1.00 39.37  ?  227  LEU B CG  1 
ATOM   5932 C  CD1 . LEU B  1 227 ? 9.236   14.303  -38.666 1.00 31.24  ?  227  LEU B CD1 1 
ATOM   5933 C  CD2 . LEU B  1 227 ? 10.976  12.588  -38.201 1.00 43.00  ?  227  LEU B CD2 1 
ATOM   5934 N  N   . GLN B  1 228 ? 5.861   9.983   -37.085 1.00 38.05  ?  228  GLN B N   1 
ATOM   5935 C  CA  . GLN B  1 228 ? 5.198   9.135   -36.110 1.00 40.48  ?  228  GLN B CA  1 
ATOM   5936 C  C   . GLN B  1 228 ? 6.107   7.996   -35.647 1.00 40.66  ?  228  GLN B C   1 
ATOM   5937 O  O   . GLN B  1 228 ? 6.387   7.081   -36.408 1.00 47.66  ?  228  GLN B O   1 
ATOM   5938 C  CB  . GLN B  1 228 ? 3.902   8.586   -36.710 1.00 38.95  ?  228  GLN B CB  1 
ATOM   5939 C  CG  . GLN B  1 228 ? 2.975   9.683   -37.222 1.00 40.68  ?  228  GLN B CG  1 
ATOM   5940 C  CD  . GLN B  1 228 ? 1.781   9.147   -37.995 1.00 45.62  ?  228  GLN B CD  1 
ATOM   5941 O  OE1 . GLN B  1 228 ? 1.183   9.859   -38.798 1.00 39.93  ?  228  GLN B OE1 1 
ATOM   5942 N  NE2 . GLN B  1 228 ? 1.421   7.891   -37.747 1.00 45.16  ?  228  GLN B NE2 1 
ATOM   5943 N  N   . SER B  1 229 ? 6.581   8.076   -34.405 1.00 38.71  ?  229  SER B N   1 
ATOM   5944 C  CA  . SER B  1 229 ? 7.314   6.975   -33.763 1.00 40.00  ?  229  SER B CA  1 
ATOM   5945 C  C   . SER B  1 229 ? 8.581   6.560   -34.492 1.00 40.51  ?  229  SER B C   1 
ATOM   5946 O  O   . SER B  1 229 ? 8.828   5.373   -34.661 1.00 46.45  ?  229  SER B O   1 
ATOM   5947 C  CB  . SER B  1 229 ? 6.423   5.736   -33.610 1.00 46.57  ?  229  SER B CB  1 
ATOM   5948 O  OG  . SER B  1 229 ? 5.135   6.084   -33.139 1.00 57.90  ?  229  SER B OG  1 
ATOM   5949 N  N   . GLY B  1 230 ? 9.381   7.527   -34.916 1.00 37.09  ?  230  GLY B N   1 
ATOM   5950 C  CA  . GLY B  1 230 ? 10.601  7.233   -35.643 1.00 26.81  ?  230  GLY B CA  1 
ATOM   5951 C  C   . GLY B  1 230 ? 11.361  8.515   -35.906 1.00 44.32  ?  230  GLY B C   1 
ATOM   5952 O  O   . GLY B  1 230 ? 10.777  9.592   -35.959 1.00 48.91  ?  230  GLY B O   1 
ATOM   5953 N  N   . THR B  1 231 ? 12.675  8.402   -36.049 1.00 37.06  ?  231  THR B N   1 
ATOM   5954 C  CA  . THR B  1 231 ? 13.544  9.560   -36.171 1.00 35.79  ?  231  THR B CA  1 
ATOM   5955 C  C   . THR B  1 231 ? 14.695  9.130   -37.043 1.00 37.59  ?  231  THR B C   1 
ATOM   5956 O  O   . THR B  1 231 ? 15.007  7.940   -37.085 1.00 44.70  ?  231  THR B O   1 
ATOM   5957 C  CB  . THR B  1 231 ? 14.149  9.986   -34.787 1.00 44.56  ?  231  THR B CB  1 
ATOM   5958 O  OG1 . THR B  1 231 ? 14.825  8.878   -34.186 1.00 46.57  ?  231  THR B OG1 1 
ATOM   5959 C  CG2 . THR B  1 231 ? 13.098  10.496  -33.828 1.00 35.37  ?  231  THR B CG2 1 
ATOM   5960 N  N   . PRO B  1 232 ? 15.333  10.083  -37.744 1.00 43.56  ?  232  PRO B N   1 
ATOM   5961 C  CA  . PRO B  1 232 ? 16.544  9.724   -38.493 1.00 47.18  ?  232  PRO B CA  1 
ATOM   5962 C  C   . PRO B  1 232 ? 17.720  9.525   -37.534 1.00 52.60  ?  232  PRO B C   1 
ATOM   5963 O  O   . PRO B  1 232 ? 18.560  8.659   -37.761 1.00 59.87  ?  232  PRO B O   1 
ATOM   5964 C  CB  . PRO B  1 232 ? 16.767  10.930  -39.423 1.00 41.35  ?  232  PRO B CB  1 
ATOM   5965 C  CG  . PRO B  1 232 ? 16.037  12.075  -38.775 1.00 31.98  ?  232  PRO B CG  1 
ATOM   5966 C  CD  . PRO B  1 232 ? 14.884  11.463  -38.020 1.00 41.60  ?  232  PRO B CD  1 
ATOM   5967 N  N   . ASN B  1 233 ? 17.765  10.317  -36.468 1.00 50.19  ?  233  ASN B N   1 
ATOM   5968 C  CA  . ASN B  1 233 ? 18.726  10.107  -35.390 1.00 46.15  ?  233  ASN B CA  1 
ATOM   5969 C  C   . ASN B  1 233 ? 18.345  8.858   -34.598 1.00 48.31  ?  233  ASN B C   1 
ATOM   5970 O  O   . ASN B  1 233 ? 17.248  8.332   -34.762 1.00 41.14  ?  233  ASN B O   1 
ATOM   5971 C  CB  . ASN B  1 233 ? 18.767  11.330  -34.463 1.00 36.83  ?  233  ASN B CB  1 
ATOM   5972 C  CG  . ASN B  1 233 ? 17.421  11.629  -33.831 1.00 46.52  ?  233  ASN B CG  1 
ATOM   5973 O  OD1 . ASN B  1 233 ? 16.465  11.986  -34.514 1.00 49.95  ?  233  ASN B OD1 1 
ATOM   5974 N  ND2 . ASN B  1 233 ? 17.345  11.500  -32.516 1.00 53.43  ?  233  ASN B ND2 1 
ATOM   5975 N  N   . GLY B  1 234 ? 19.239  8.386   -33.735 1.00 51.40  ?  234  GLY B N   1 
ATOM   5976 C  CA  . GLY B  1 234 ? 18.949  7.200   -32.947 1.00 48.43  ?  234  GLY B CA  1 
ATOM   5977 C  C   . GLY B  1 234 ? 19.811  6.004   -33.306 1.00 52.00  ?  234  GLY B C   1 
ATOM   5978 O  O   . GLY B  1 234 ? 20.698  6.104   -34.150 1.00 55.84  ?  234  GLY B O   1 
ATOM   5979 N  N   . PRO B  1 235 ? 19.551  4.856   -32.668 1.00 49.78  ?  235  PRO B N   1 
ATOM   5980 C  CA  . PRO B  1 235 ? 20.472  3.718   -32.772 1.00 53.89  ?  235  PRO B CA  1 
ATOM   5981 C  C   . PRO B  1 235 ? 20.230  2.751   -33.935 1.00 57.05  ?  235  PRO B C   1 
ATOM   5982 O  O   . PRO B  1 235 ? 21.092  1.912   -34.183 1.00 56.78  ?  235  PRO B O   1 
ATOM   5983 C  CB  . PRO B  1 235 ? 20.267  2.992   -31.442 1.00 52.30  ?  235  PRO B CB  1 
ATOM   5984 C  CG  . PRO B  1 235 ? 18.850  3.287   -31.074 1.00 50.80  ?  235  PRO B CG  1 
ATOM   5985 C  CD  . PRO B  1 235 ? 18.528  4.655   -31.626 1.00 50.11  ?  235  PRO B CD  1 
ATOM   5986 N  N   . TRP B  1 236 ? 19.109  2.858   -34.641 1.00 55.13  ?  236  TRP B N   1 
ATOM   5987 C  CA  . TRP B  1 236 ? 18.773  1.834   -35.631 1.00 44.64  ?  236  TRP B CA  1 
ATOM   5988 C  C   . TRP B  1 236 ? 18.589  2.352   -37.057 1.00 48.37  ?  236  TRP B C   1 
ATOM   5989 O  O   . TRP B  1 236 ? 18.614  1.565   -38.007 1.00 56.93  ?  236  TRP B O   1 
ATOM   5990 C  CB  . TRP B  1 236 ? 17.518  1.079   -35.194 1.00 36.73  ?  236  TRP B CB  1 
ATOM   5991 C  CG  . TRP B  1 236 ? 16.365  1.996   -34.949 1.00 43.74  ?  236  TRP B CG  1 
ATOM   5992 C  CD1 . TRP B  1 236 ? 16.026  2.576   -33.771 1.00 40.88  ?  236  TRP B CD1 1 
ATOM   5993 C  CD2 . TRP B  1 236 ? 15.404  2.461   -35.917 1.00 47.78  ?  236  TRP B CD2 1 
ATOM   5994 N  NE1 . TRP B  1 236 ? 14.915  3.372   -33.934 1.00 48.59  ?  236  TRP B NE1 1 
ATOM   5995 C  CE2 . TRP B  1 236 ? 14.507  3.312   -35.238 1.00 47.56  ?  236  TRP B CE2 1 
ATOM   5996 C  CE3 . TRP B  1 236 ? 15.208  2.227   -37.282 1.00 40.37  ?  236  TRP B CE3 1 
ATOM   5997 C  CZ2 . TRP B  1 236 ? 13.435  3.938   -35.876 1.00 47.66  ?  236  TRP B CZ2 1 
ATOM   5998 C  CZ3 . TRP B  1 236 ? 14.139  2.848   -37.918 1.00 40.98  ?  236  TRP B CZ3 1 
ATOM   5999 C  CH2 . TRP B  1 236 ? 13.270  3.696   -37.214 1.00 49.02  ?  236  TRP B CH2 1 
ATOM   6000 N  N   . ALA B  1 237 ? 18.407  3.663   -37.213 1.00 49.14  ?  237  ALA B N   1 
ATOM   6001 C  CA  . ALA B  1 237 ? 17.970  4.223   -38.503 1.00 44.50  ?  237  ALA B CA  1 
ATOM   6002 C  C   . ALA B  1 237 ? 19.081  4.414   -39.547 1.00 44.47  ?  237  ALA B C   1 
ATOM   6003 O  O   . ALA B  1 237 ? 18.802  4.472   -40.743 1.00 45.87  ?  237  ALA B O   1 
ATOM   6004 C  CB  . ALA B  1 237 ? 17.187  5.531   -38.302 1.00 35.70  ?  237  ALA B CB  1 
ATOM   6005 N  N   . THR B  1 238 ? 20.329  4.519   -39.096 1.00 39.53  ?  238  THR B N   1 
ATOM   6006 C  CA  . THR B  1 238 ? 21.455  4.694   -40.002 1.00 40.17  ?  238  THR B CA  1 
ATOM   6007 C  C   . THR B  1 238 ? 22.604  3.788   -39.622 1.00 49.72  ?  238  THR B C   1 
ATOM   6008 O  O   . THR B  1 238 ? 22.715  3.343   -38.475 1.00 47.18  ?  238  THR B O   1 
ATOM   6009 C  CB  . THR B  1 238 ? 22.018  6.147   -39.991 1.00 43.19  ?  238  THR B CB  1 
ATOM   6010 O  OG1 . THR B  1 238 ? 22.509  6.473   -38.685 1.00 46.09  ?  238  THR B OG1 1 
ATOM   6011 C  CG2 . THR B  1 238 ? 20.964  7.134   -40.367 1.00 33.97  ?  238  THR B CG2 1 
ATOM   6012 N  N   . VAL B  1 239 ? 23.481  3.530   -40.584 1.00 47.24  ?  239  VAL B N   1 
ATOM   6013 C  CA  . VAL B  1 239 ? 24.761  2.938   -40.248 1.00 44.57  ?  239  VAL B CA  1 
ATOM   6014 C  C   . VAL B  1 239 ? 25.882  3.797   -40.813 1.00 50.80  ?  239  VAL B C   1 
ATOM   6015 O  O   . VAL B  1 239 ? 25.644  4.682   -41.635 1.00 57.60  ?  239  VAL B O   1 
ATOM   6016 C  CB  . VAL B  1 239 ? 24.870  1.468   -40.700 1.00 45.54  ?  239  VAL B CB  1 
ATOM   6017 C  CG1 . VAL B  1 239 ? 24.041  0.577   -39.782 1.00 46.21  ?  239  VAL B CG1 1 
ATOM   6018 C  CG2 . VAL B  1 239 ? 24.426  1.314   -42.147 1.00 38.74  ?  239  VAL B CG2 1 
ATOM   6019 N  N   . SER B  1 240 ? 27.095  3.561   -40.333 1.00 54.88  ?  240  SER B N   1 
ATOM   6020 C  CA  . SER B  1 240 ? 28.262  4.245   -40.849 1.00 54.27  ?  240  SER B CA  1 
ATOM   6021 C  C   . SER B  1 240 ? 28.668  3.547   -42.129 1.00 57.04  ?  240  SER B C   1 
ATOM   6022 O  O   . SER B  1 240 ? 28.306  2.389   -42.350 1.00 49.49  ?  240  SER B O   1 
ATOM   6023 C  CB  . SER B  1 240 ? 29.402  4.142   -39.855 1.00 45.35  ?  240  SER B CB  1 
ATOM   6024 O  OG  . SER B  1 240 ? 29.779  2.786   -39.723 1.00 54.63  ?  240  SER B OG  1 
ATOM   6025 N  N   . ALA B  1 241 ? 29.433  4.253   -42.957 1.00 61.78  ?  241  ALA B N   1 
ATOM   6026 C  CA  . ALA B  1 241 ? 29.909  3.715   -44.227 1.00 57.59  ?  241  ALA B CA  1 
ATOM   6027 C  C   . ALA B  1 241 ? 30.742  2.448   -44.006 1.00 62.02  ?  241  ALA B C   1 
ATOM   6028 O  O   . ALA B  1 241 ? 30.703  1.512   -44.816 1.00 52.72  ?  241  ALA B O   1 
ATOM   6029 C  CB  . ALA B  1 241 ? 30.716  4.775   -44.975 1.00 48.43  ?  241  ALA B CB  1 
ATOM   6030 N  N   . GLY B  1 242 ? 31.474  2.418   -42.891 1.00 60.16  ?  242  GLY B N   1 
ATOM   6031 C  CA  . GLY B  1 242 ? 32.270  1.260   -42.527 1.00 56.83  ?  242  GLY B CA  1 
ATOM   6032 C  C   . GLY B  1 242 ? 31.423  0.038   -42.215 1.00 56.55  ?  242  GLY B C   1 
ATOM   6033 O  O   . GLY B  1 242 ? 31.759  -1.084  -42.593 1.00 58.08  ?  242  GLY B O   1 
ATOM   6034 N  N   . GLU B  1 243 ? 30.314  0.246   -41.520 1.00 63.43  ?  243  GLU B N   1 
ATOM   6035 C  CA  . GLU B  1 243 ? 29.501  -0.887  -41.094 1.00 63.82  ?  243  GLU B CA  1 
ATOM   6036 C  C   . GLU B  1 243 ? 28.661  -1.431  -42.242 1.00 51.47  ?  243  GLU B C   1 
ATOM   6037 O  O   . GLU B  1 243 ? 28.487  -2.638  -42.367 1.00 55.73  ?  243  GLU B O   1 
ATOM   6038 C  CB  . GLU B  1 243 ? 28.639  -0.532  -39.876 1.00 52.35  ?  243  GLU B CB  1 
ATOM   6039 C  CG  . GLU B  1 243 ? 27.608  -1.596  -39.485 1.00 59.02  ?  243  GLU B CG  1 
ATOM   6040 C  CD  . GLU B  1 243 ? 28.210  -2.856  -38.852 1.00 65.17  ?  243  GLU B CD  1 
ATOM   6041 O  OE1 . GLU B  1 243 ? 29.454  -2.984  -38.787 1.00 66.77  ?  243  GLU B OE1 1 
ATOM   6042 O  OE2 . GLU B  1 243 ? 27.420  -3.726  -38.414 1.00 62.87  ?  243  GLU B OE2 1 
ATOM   6043 N  N   . ALA B  1 244 ? 28.153  -0.534  -43.078 1.00 47.13  ?  244  ALA B N   1 
ATOM   6044 C  CA  . ALA B  1 244 ? 27.415  -0.931  -44.282 1.00 50.29  ?  244  ALA B CA  1 
ATOM   6045 C  C   . ALA B  1 244 ? 28.289  -1.807  -45.173 1.00 48.66  ?  244  ALA B C   1 
ATOM   6046 O  O   . ALA B  1 244 ? 27.838  -2.822  -45.689 1.00 49.11  ?  244  ALA B O   1 
ATOM   6047 C  CB  . ALA B  1 244 ? 26.932  0.296   -45.055 1.00 43.87  ?  244  ALA B CB  1 
ATOM   6048 N  N   . ARG B  1 245 ? 29.550  -1.416  -45.321 1.00 46.96  ?  245  ARG B N   1 
ATOM   6049 C  CA  . ARG B  1 245 ? 30.480  -2.148  -46.162 1.00 53.99  ?  245  ARG B CA  1 
ATOM   6050 C  C   . ARG B  1 245 ? 30.776  -3.537  -45.605 1.00 60.17  ?  245  ARG B C   1 
ATOM   6051 O  O   . ARG B  1 245 ? 30.928  -4.500  -46.371 1.00 57.92  ?  245  ARG B O   1 
ATOM   6052 C  CB  . ARG B  1 245 ? 31.772  -1.353  -46.351 1.00 55.20  ?  245  ARG B CB  1 
ATOM   6053 C  CG  . ARG B  1 245 ? 32.865  -2.133  -47.053 1.00 52.40  ?  245  ARG B CG  1 
ATOM   6054 C  CD  . ARG B  1 245 ? 34.021  -1.230  -47.416 1.00 58.97  ?  245  ARG B CD  1 
ATOM   6055 N  NE  . ARG B  1 245 ? 33.650  -0.325  -48.498 1.00 63.04  ?  245  ARG B NE  1 
ATOM   6056 C  CZ  . ARG B  1 245 ? 33.628  -0.677  -49.782 1.00 60.27  ?  245  ARG B CZ  1 
ATOM   6057 N  NH1 . ARG B  1 245 ? 33.960  -1.915  -50.133 1.00 51.11  ?  245  ARG B NH1 1 
ATOM   6058 N  NH2 . ARG B  1 245 ? 33.272  0.204   -50.712 1.00 56.35  ?  245  ARG B NH2 1 
ATOM   6059 N  N   . ARG B  1 246 ? 30.858  -3.633  -44.277 1.00 60.97  ?  246  ARG B N   1 
ATOM   6060 C  CA  . ARG B  1 246 ? 31.085  -4.912  -43.607 1.00 58.13  ?  246  ARG B CA  1 
ATOM   6061 C  C   . ARG B  1 246 ? 29.927  -5.869  -43.867 1.00 58.48  ?  246  ARG B C   1 
ATOM   6062 O  O   . ARG B  1 246 ? 30.131  -7.030  -44.229 1.00 61.33  ?  246  ARG B O   1 
ATOM   6063 C  CB  . ARG B  1 246 ? 31.253  -4.725  -42.096 1.00 59.42  ?  246  ARG B CB  1 
ATOM   6064 C  CG  . ARG B  1 246 ? 31.565  -6.027  -41.363 1.00 60.66  ?  246  ARG B CG  1 
ATOM   6065 C  CD  . ARG B  1 246 ? 31.408  -5.910  -39.851 1.00 65.50  ?  246  ARG B CD  1 
ATOM   6066 N  NE  . ARG B  1 246 ? 30.012  -5.780  -39.439 1.00 65.04  ?  246  ARG B NE  1 
ATOM   6067 C  CZ  . ARG B  1 246 ? 29.199  -6.804  -39.196 1.00 62.18  ?  246  ARG B CZ  1 
ATOM   6068 N  NH1 . ARG B  1 246 ? 29.632  -8.054  -39.318 1.00 61.63  ?  246  ARG B NH1 1 
ATOM   6069 N  NH2 . ARG B  1 246 ? 27.946  -6.575  -38.826 1.00 56.24  ?  246  ARG B NH2 1 
ATOM   6070 N  N   . ARG B  1 247 ? 28.709  -5.376  -43.684 1.00 53.58  ?  247  ARG B N   1 
ATOM   6071 C  CA  . ARG B  1 247 ? 27.532  -6.218  -43.854 1.00 60.13  ?  247  ARG B CA  1 
ATOM   6072 C  C   . ARG B  1 247 ? 27.356  -6.678  -45.298 1.00 63.06  ?  247  ARG B C   1 
ATOM   6073 O  O   . ARG B  1 247 ? 27.065  -7.846  -45.554 1.00 65.55  ?  247  ARG B O   1 
ATOM   6074 C  CB  . ARG B  1 247 ? 26.279  -5.496  -43.364 1.00 51.99  ?  247  ARG B CB  1 
ATOM   6075 C  CG  . ARG B  1 247 ? 26.305  -5.178  -41.867 1.00 54.60  ?  247  ARG B CG  1 
ATOM   6076 C  CD  . ARG B  1 247 ? 24.991  -4.561  -41.422 1.00 51.11  ?  247  ARG B CD  1 
ATOM   6077 N  NE  . ARG B  1 247 ? 25.041  -4.046  -40.064 1.00 56.73  ?  247  ARG B NE  1 
ATOM   6078 C  CZ  . ARG B  1 247 ? 24.074  -3.314  -39.524 1.00 57.27  ?  247  ARG B CZ  1 
ATOM   6079 N  NH1 . ARG B  1 247 ? 22.996  -3.021  -40.247 1.00 50.98  ?  247  ARG B NH1 1 
ATOM   6080 N  NH2 . ARG B  1 247 ? 24.184  -2.871  -38.271 1.00 44.93  ?  247  ARG B NH2 1 
ATOM   6081 N  N   . ALA B  1 248 ? 27.543  -5.754  -46.234 1.00 60.72  ?  248  ALA B N   1 
ATOM   6082 C  CA  . ALA B  1 248 ? 27.401  -6.053  -47.652 1.00 54.34  ?  248  ALA B CA  1 
ATOM   6083 C  C   . ALA B  1 248 ? 28.407  -7.122  -48.055 1.00 61.61  ?  248  ALA B C   1 
ATOM   6084 O  O   . ALA B  1 248 ? 28.076  -8.077  -48.762 1.00 65.25  ?  248  ALA B O   1 
ATOM   6085 C  CB  . ALA B  1 248 ? 27.601  -4.792  -48.471 1.00 47.87  ?  248  ALA B CB  1 
ATOM   6086 N  N   . THR B  1 249 ? 29.636  -6.956  -47.586 1.00 56.55  ?  249  THR B N   1 
ATOM   6087 C  CA  . THR B  1 249 ? 30.693  -7.919  -47.832 1.00 59.10  ?  249  THR B CA  1 
ATOM   6088 C  C   . THR B  1 249 ? 30.370  -9.277  -47.213 1.00 65.01  ?  249  THR B C   1 
ATOM   6089 O  O   . THR B  1 249 ? 30.693  -10.323 -47.777 1.00 69.40  ?  249  THR B O   1 
ATOM   6090 C  CB  . THR B  1 249 ? 32.026  -7.403  -47.275 1.00 62.14  ?  249  THR B CB  1 
ATOM   6091 O  OG1 . THR B  1 249 ? 32.426  -6.243  -48.014 1.00 68.74  ?  249  THR B OG1 1 
ATOM   6092 C  CG2 . THR B  1 249 ? 33.109  -8.468  -47.378 1.00 55.10  ?  249  THR B CG2 1 
ATOM   6093 N  N   . LEU B  1 250 ? 29.725  -9.264  -46.053 1.00 68.67  ?  250  LEU B N   1 
ATOM   6094 C  CA  . LEU B  1 250 ? 29.422  -10.510 -45.362 1.00 68.12  ?  250  LEU B CA  1 
ATOM   6095 C  C   . LEU B  1 250 ? 28.316  -11.244 -46.099 1.00 65.36  ?  250  LEU B C   1 
ATOM   6096 O  O   . LEU B  1 250 ? 28.387  -12.456 -46.316 1.00 69.84  ?  250  LEU B O   1 
ATOM   6097 C  CB  . LEU B  1 250 ? 29.021  -10.255 -43.910 1.00 60.18  ?  250  LEU B CB  1 
ATOM   6098 C  CG  . LEU B  1 250 ? 28.899  -11.506 -43.032 1.00 63.17  ?  250  LEU B CG  1 
ATOM   6099 C  CD1 . LEU B  1 250 ? 30.178  -12.338 -43.086 1.00 62.33  ?  250  LEU B CD1 1 
ATOM   6100 C  CD2 . LEU B  1 250 ? 28.555  -11.139 -41.585 1.00 51.32  ?  250  LEU B CD2 1 
ATOM   6101 N  N   . LEU B  1 251 ? 27.295  -10.496 -46.489 1.00 56.28  ?  251  LEU B N   1 
ATOM   6102 C  CA  . LEU B  1 251 ? 26.176  -11.084 -47.196 1.00 61.55  ?  251  LEU B CA  1 
ATOM   6103 C  C   . LEU B  1 251 ? 26.644  -11.773 -48.475 1.00 65.71  ?  251  LEU B C   1 
ATOM   6104 O  O   . LEU B  1 251 ? 26.240  -12.902 -48.763 1.00 66.11  ?  251  LEU B O   1 
ATOM   6105 C  CB  . LEU B  1 251 ? 25.139  -10.023 -47.528 1.00 58.68  ?  251  LEU B CB  1 
ATOM   6106 C  CG  . LEU B  1 251 ? 23.905  -10.628 -48.185 1.00 59.16  ?  251  LEU B CG  1 
ATOM   6107 C  CD1 . LEU B  1 251 ? 23.069  -11.343 -47.137 1.00 56.79  ?  251  LEU B CD1 1 
ATOM   6108 C  CD2 . LEU B  1 251 ? 23.119  -9.553  -48.894 1.00 59.53  ?  251  LEU B CD2 1 
ATOM   6109 N  N   . ALA B  1 252 ? 27.505  -11.091 -49.228 1.00 66.54  ?  252  ALA B N   1 
ATOM   6110 C  CA  . ALA B  1 252 ? 28.060  -11.649 -50.453 1.00 67.61  ?  252  ALA B CA  1 
ATOM   6111 C  C   . ALA B  1 252 ? 28.758  -12.961 -50.138 1.00 67.06  ?  252  ALA B C   1 
ATOM   6112 O  O   . ALA B  1 252 ? 28.641  -13.933 -50.883 1.00 67.98  ?  252  ALA B O   1 
ATOM   6113 C  CB  . ALA B  1 252 ? 29.027  -10.672 -51.093 1.00 65.19  ?  252  ALA B CB  1 
ATOM   6114 N  N   . ARG B  1 253 ? 29.468  -12.988 -49.017 1.00 62.52  ?  253  ARG B N   1 
ATOM   6115 C  CA  . ARG B  1 253 ? 30.166  -14.197 -48.597 1.00 71.31  ?  253  ARG B CA  1 
ATOM   6116 C  C   . ARG B  1 253 ? 29.180  -15.330 -48.302 1.00 70.55  ?  253  ARG B C   1 
ATOM   6117 O  O   . ARG B  1 253 ? 29.411  -16.483 -48.679 1.00 71.63  ?  253  ARG B O   1 
ATOM   6118 C  CB  . ARG B  1 253 ? 31.064  -13.906 -47.389 1.00 76.02  ?  253  ARG B CB  1 
ATOM   6119 C  CG  . ARG B  1 253 ? 31.644  -15.137 -46.708 1.00 89.41  ?  253  ARG B CG  1 
ATOM   6120 C  CD  . ARG B  1 253 ? 32.658  -14.728 -45.657 1.00 105.64 ?  253  ARG B CD  1 
ATOM   6121 N  NE  . ARG B  1 253 ? 32.854  -15.743 -44.622 1.00 121.23 ?  253  ARG B NE  1 
ATOM   6122 C  CZ  . ARG B  1 253 ? 33.666  -16.790 -44.744 1.00 129.50 ?  253  ARG B CZ  1 
ATOM   6123 N  NH1 . ARG B  1 253 ? 34.349  -16.976 -45.868 1.00 131.61 ?  253  ARG B NH1 1 
ATOM   6124 N  NH2 . ARG B  1 253 ? 33.788  -17.658 -43.745 1.00 128.86 ?  253  ARG B NH2 1 
ATOM   6125 N  N   . LEU B  1 254 ? 28.073  -14.991 -47.647 1.00 63.87  ?  254  LEU B N   1 
ATOM   6126 C  CA  . LEU B  1 254 ? 27.038  -15.971 -47.329 1.00 68.83  ?  254  LEU B CA  1 
ATOM   6127 C  C   . LEU B  1 254 ? 26.329  -16.537 -48.574 1.00 72.55  ?  254  LEU B C   1 
ATOM   6128 O  O   . LEU B  1 254 ? 25.900  -17.691 -48.580 1.00 77.90  ?  254  LEU B O   1 
ATOM   6129 C  CB  . LEU B  1 254 ? 26.030  -15.374 -46.336 1.00 71.67  ?  254  LEU B CB  1 
ATOM   6130 C  CG  . LEU B  1 254 ? 26.536  -15.147 -44.902 1.00 69.44  ?  254  LEU B CG  1 
ATOM   6131 C  CD1 . LEU B  1 254 ? 25.561  -14.312 -44.094 1.00 64.21  ?  254  LEU B CD1 1 
ATOM   6132 C  CD2 . LEU B  1 254 ? 26.790  -16.472 -44.203 1.00 55.96  ?  254  LEU B CD2 1 
ATOM   6133 N  N   . VAL B  1 255 ? 26.219  -15.739 -49.633 1.00 65.64  ?  255  VAL B N   1 
ATOM   6134 C  CA  . VAL B  1 255 ? 25.574  -16.224 -50.849 1.00 68.15  ?  255  VAL B CA  1 
ATOM   6135 C  C   . VAL B  1 255 ? 26.557  -16.706 -51.930 1.00 79.12  ?  255  VAL B C   1 
ATOM   6136 O  O   . VAL B  1 255 ? 26.143  -17.051 -53.037 1.00 81.07  ?  255  VAL B O   1 
ATOM   6137 C  CB  . VAL B  1 255 ? 24.561  -15.200 -51.431 1.00 61.90  ?  255  VAL B CB  1 
ATOM   6138 C  CG1 . VAL B  1 255 ? 23.366  -15.066 -50.506 1.00 62.53  ?  255  VAL B CG1 1 
ATOM   6139 C  CG2 . VAL B  1 255 ? 25.214  -13.844 -51.668 1.00 55.52  ?  255  VAL B CG2 1 
ATOM   6140 N  N   . GLY B  1 256 ? 27.849  -16.730 -51.602 1.00 81.54  ?  256  GLY B N   1 
ATOM   6141 C  CA  . GLY B  1 256 ? 28.856  -17.313 -52.477 1.00 82.01  ?  256  GLY B CA  1 
ATOM   6142 C  C   . GLY B  1 256 ? 29.670  -16.363 -53.347 1.00 80.81  ?  256  GLY B C   1 
ATOM   6143 O  O   . GLY B  1 256 ? 30.410  -16.804 -54.231 1.00 80.91  ?  256  GLY B O   1 
ATOM   6144 N  N   . CYS B  1 257 ? 29.556  -15.064 -53.090 1.00 75.82  ?  257  CYS B N   1 
ATOM   6145 C  CA  . CYS B  1 257 ? 30.221  -14.053 -53.907 1.00 73.19  ?  257  CYS B CA  1 
ATOM   6146 C  C   . CYS B  1 257 ? 31.602  -13.646 -53.390 1.00 78.35  ?  257  CYS B C   1 
ATOM   6147 O  O   . CYS B  1 257 ? 32.589  -13.691 -54.132 1.00 83.88  ?  257  CYS B O   1 
ATOM   6148 C  CB  . CYS B  1 257 ? 29.324  -12.826 -54.027 1.00 74.34  ?  257  CYS B CB  1 
ATOM   6149 S  SG  . CYS B  1 257 ? 27.686  -13.185 -54.726 1.00 98.97  ?  257  CYS B SG  1 
ATOM   6150 N  N   . GLY B  1 264 ? 38.586  -4.854  -60.635 1.00 113.15 ?  264  GLY B N   1 
ATOM   6151 C  CA  . GLY B  1 264 ? 37.855  -4.063  -59.648 1.00 115.97 ?  264  GLY B CA  1 
ATOM   6152 C  C   . GLY B  1 264 ? 37.039  -4.946  -58.698 1.00 112.66 ?  264  GLY B C   1 
ATOM   6153 O  O   . GLY B  1 264 ? 36.082  -5.598  -59.114 1.00 118.62 ?  264  GLY B O   1 
ATOM   6154 N  N   . ASN B  1 265 ? 37.412  -4.956  -57.422 1.00 102.34 ?  265  ASN B N   1 
ATOM   6155 C  CA  . ASN B  1 265 ? 36.789  -5.860  -56.454 1.00 99.04  ?  265  ASN B CA  1 
ATOM   6156 C  C   . ASN B  1 265 ? 35.383  -5.453  -56.003 1.00 89.21  ?  265  ASN B C   1 
ATOM   6157 O  O   . ASN B  1 265 ? 34.541  -6.319  -55.771 1.00 88.91  ?  265  ASN B O   1 
ATOM   6158 C  CB  . ASN B  1 265 ? 37.697  -6.081  -55.238 1.00 103.67 ?  265  ASN B CB  1 
ATOM   6159 C  CG  . ASN B  1 265 ? 37.160  -7.144  -54.292 1.00 106.12 ?  265  ASN B CG  1 
ATOM   6160 O  OD1 . ASN B  1 265 ? 36.419  -6.840  -53.353 1.00 111.94 ?  265  ASN B OD1 1 
ATOM   6161 N  ND2 . ASN B  1 265 ? 37.532  -8.398  -54.533 1.00 101.55 ?  265  ASN B ND2 1 
ATOM   6162 N  N   . ASP B  1 266 ? 35.131  -4.154  -55.861 1.00 79.71  ?  266  ASP B N   1 
ATOM   6163 C  CA  . ASP B  1 266 ? 33.772  -3.684  -55.597 1.00 81.76  ?  266  ASP B CA  1 
ATOM   6164 C  C   . ASP B  1 266 ? 32.836  -4.082  -56.735 1.00 76.87  ?  266  ASP B C   1 
ATOM   6165 O  O   . ASP B  1 266 ? 31.721  -4.552  -56.506 1.00 66.17  ?  266  ASP B O   1 
ATOM   6166 C  CB  . ASP B  1 266 ? 33.735  -2.166  -55.426 1.00 88.00  ?  266  ASP B CB  1 
ATOM   6167 C  CG  . ASP B  1 266 ? 33.794  -1.742  -53.974 1.00 92.85  ?  266  ASP B CG  1 
ATOM   6168 O  OD1 . ASP B  1 266 ? 33.796  -2.628  -53.094 1.00 91.04  ?  266  ASP B OD1 1 
ATOM   6169 O  OD2 . ASP B  1 266 ? 33.822  -0.521  -53.714 1.00 94.13  ?  266  ASP B OD2 1 
ATOM   6170 N  N   . THR B  1 267 ? 33.311  -3.893  -57.963 1.00 74.57  ?  267  THR B N   1 
ATOM   6171 C  CA  . THR B  1 267 ? 32.519  -4.149  -59.155 1.00 68.22  ?  267  THR B CA  1 
ATOM   6172 C  C   . THR B  1 267 ? 32.183  -5.622  -59.325 1.00 69.38  ?  267  THR B C   1 
ATOM   6173 O  O   . THR B  1 267 ? 31.032  -5.980  -59.590 1.00 72.75  ?  267  THR B O   1 
ATOM   6174 C  CB  . THR B  1 267 ? 33.250  -3.674  -60.420 1.00 72.03  ?  267  THR B CB  1 
ATOM   6175 O  OG1 . THR B  1 267 ? 33.295  -2.243  -60.436 1.00 78.13  ?  267  THR B OG1 1 
ATOM   6176 C  CG2 . THR B  1 267 ? 32.521  -4.153  -61.658 1.00 62.80  ?  267  THR B CG2 1 
ATOM   6177 N  N   . GLU B  1 268 ? 33.192  -6.473  -59.183 1.00 69.93  ?  268  GLU B N   1 
ATOM   6178 C  CA  . GLU B  1 268 ? 32.992  -7.902  -59.382 1.00 75.48  ?  268  GLU B CA  1 
ATOM   6179 C  C   . GLU B  1 268 ? 32.073  -8.474  -58.307 1.00 77.54  ?  268  GLU B C   1 
ATOM   6180 O  O   . GLU B  1 268 ? 31.285  -9.382  -58.571 1.00 82.39  ?  268  GLU B O   1 
ATOM   6181 C  CB  . GLU B  1 268 ? 34.329  -8.649  -59.420 1.00 77.62  ?  268  GLU B CB  1 
ATOM   6182 N  N   . LEU B  1 269 ? 32.156  -7.918  -57.102 1.00 72.84  ?  269  LEU B N   1 
ATOM   6183 C  CA  . LEU B  1 269 ? 31.341  -8.392  -55.988 1.00 65.88  ?  269  LEU B CA  1 
ATOM   6184 C  C   . LEU B  1 269 ? 29.862  -8.077  -56.185 1.00 64.39  ?  269  LEU B C   1 
ATOM   6185 O  O   . LEU B  1 269 ? 29.003  -8.941  -56.001 1.00 68.96  ?  269  LEU B O   1 
ATOM   6186 C  CB  . LEU B  1 269 ? 31.840  -7.803  -54.671 1.00 61.59  ?  269  LEU B CB  1 
ATOM   6187 C  CG  . LEU B  1 269 ? 31.253  -8.403  -53.397 1.00 65.13  ?  269  LEU B CG  1 
ATOM   6188 C  CD1 . LEU B  1 269 ? 32.313  -8.408  -52.305 1.00 71.03  ?  269  LEU B CD1 1 
ATOM   6189 C  CD2 . LEU B  1 269 ? 30.044  -7.618  -52.941 1.00 61.26  ?  269  LEU B CD2 1 
ATOM   6190 N  N   . ILE B  1 270 ? 29.567  -6.834  -56.543 1.00 53.32  ?  270  ILE B N   1 
ATOM   6191 C  CA  . ILE B  1 270 ? 28.198  -6.431  -56.825 1.00 54.26  ?  270  ILE B CA  1 
ATOM   6192 C  C   . ILE B  1 270 ? 27.627  -7.121  -58.085 1.00 62.13  ?  270  ILE B C   1 
ATOM   6193 O  O   . ILE B  1 270 ? 26.414  -7.342  -58.188 1.00 64.41  ?  270  ILE B O   1 
ATOM   6194 C  CB  . ILE B  1 270 ? 28.101  -4.900  -56.931 1.00 59.73  ?  270  ILE B CB  1 
ATOM   6195 C  CG1 . ILE B  1 270 ? 28.724  -4.273  -55.681 1.00 58.67  ?  270  ILE B CG1 1 
ATOM   6196 C  CG2 . ILE B  1 270 ? 26.642  -4.442  -57.096 1.00 54.81  ?  270  ILE B CG2 1 
ATOM   6197 C  CD1 . ILE B  1 270 ? 29.086  -2.816  -55.827 1.00 62.52  ?  270  ILE B CD1 1 
ATOM   6198 N  N   . ALA B  1 271 ? 28.488  -7.486  -59.030 1.00 51.14  ?  271  ALA B N   1 
ATOM   6199 C  CA  . ALA B  1 271 ? 27.999  -8.216  -60.191 1.00 59.66  ?  271  ALA B CA  1 
ATOM   6200 C  C   . ALA B  1 271 ? 27.480  -9.610  -59.817 1.00 63.20  ?  271  ALA B C   1 
ATOM   6201 O  O   . ALA B  1 271 ? 26.388  -10.000 -60.243 1.00 60.88  ?  271  ALA B O   1 
ATOM   6202 C  CB  . ALA B  1 271 ? 29.057  -8.294  -61.282 1.00 58.60  ?  271  ALA B CB  1 
ATOM   6203 N  N   . CYS B  1 272 ? 28.243  -10.354 -59.012 1.00 61.13  ?  272  CYS B N   1 
ATOM   6204 C  CA  . CYS B  1 272 ? 27.805  -11.696 -58.606 1.00 65.76  ?  272  CYS B CA  1 
ATOM   6205 C  C   . CYS B  1 272 ? 26.508  -11.625 -57.792 1.00 66.68  ?  272  CYS B C   1 
ATOM   6206 O  O   . CYS B  1 272 ? 25.671  -12.531 -57.853 1.00 73.20  ?  272  CYS B O   1 
ATOM   6207 C  CB  . CYS B  1 272 ? 28.907  -12.475 -57.863 1.00 52.60  ?  272  CYS B CB  1 
ATOM   6208 S  SG  . CYS B  1 272 ? 28.302  -13.659 -56.619 1.00 159.52 ?  272  CYS B SG  1 
ATOM   6209 N  N   . LEU B  1 273 ? 26.336  -10.532 -57.056 1.00 61.41  ?  273  LEU B N   1 
ATOM   6210 C  CA  . LEU B  1 273 ? 25.127  -10.325 -56.271 1.00 58.37  ?  273  LEU B CA  1 
ATOM   6211 C  C   . LEU B  1 273 ? 23.924  -10.098 -57.172 1.00 61.02  ?  273  LEU B C   1 
ATOM   6212 O  O   . LEU B  1 273 ? 22.811  -10.507 -56.849 1.00 58.40  ?  273  LEU B O   1 
ATOM   6213 C  CB  . LEU B  1 273 ? 25.286  -9.132  -55.327 1.00 57.49  ?  273  LEU B CB  1 
ATOM   6214 C  CG  . LEU B  1 273 ? 26.026  -9.362  -54.015 1.00 55.43  ?  273  LEU B CG  1 
ATOM   6215 C  CD1 . LEU B  1 273 ? 26.117  -8.052  -53.250 1.00 50.82  ?  273  LEU B CD1 1 
ATOM   6216 C  CD2 . LEU B  1 273 ? 25.336  -10.434 -53.180 1.00 55.55  ?  273  LEU B CD2 1 
ATOM   6217 N  N   A ARG B  1 274 ? 24.151  -9.441  -58.306 0.50 62.49  ?  274  ARG B N   1 
ATOM   6218 N  N   B ARG B  1 274 ? 24.158  -9.440  -58.303 0.50 62.52  ?  274  ARG B N   1 
ATOM   6219 C  CA  A ARG B  1 274 ? 23.076  -9.169  -59.251 0.50 59.77  ?  274  ARG B CA  1 
ATOM   6220 C  CA  B ARG B  1 274 ? 23.097  -9.163  -59.262 0.50 59.82  ?  274  ARG B CA  1 
ATOM   6221 C  C   A ARG B  1 274 ? 22.555  -10.437 -59.918 0.50 58.11  ?  274  ARG B C   1 
ATOM   6222 C  C   B ARG B  1 274 ? 22.558  -10.434 -59.909 0.50 58.11  ?  274  ARG B C   1 
ATOM   6223 O  O   A ARG B  1 274 ? 21.420  -10.469 -60.389 0.50 59.08  ?  274  ARG B O   1 
ATOM   6224 O  O   B ARG B  1 274 ? 21.415  -10.465 -60.361 0.50 59.12  ?  274  ARG B O   1 
ATOM   6225 C  CB  A ARG B  1 274 ? 23.519  -8.151  -60.302 0.50 60.87  ?  274  ARG B CB  1 
ATOM   6226 C  CB  B ARG B  1 274 ? 23.588  -8.195  -60.337 0.50 60.76  ?  274  ARG B CB  1 
ATOM   6227 C  CG  A ARG B  1 274 ? 23.698  -6.767  -59.726 0.50 59.83  ?  274  ARG B CG  1 
ATOM   6228 C  CG  B ARG B  1 274 ? 22.942  -6.828  -60.259 0.50 60.70  ?  274  ARG B CG  1 
ATOM   6229 C  CD  A ARG B  1 274 ? 23.859  -5.703  -60.793 0.50 58.72  ?  274  ARG B CD  1 
ATOM   6230 C  CD  B ARG B  1 274 ? 23.980  -5.739  -60.361 0.50 59.43  ?  274  ARG B CD  1 
ATOM   6231 N  NE  A ARG B  1 274 ? 23.977  -4.397  -60.156 0.50 60.88  ?  274  ARG B NE  1 
ATOM   6232 N  NE  B ARG B  1 274 ? 24.812  -5.891  -61.548 0.50 51.67  ?  274  ARG B NE  1 
ATOM   6233 C  CZ  A ARG B  1 274 ? 24.661  -3.373  -60.652 0.50 60.74  ?  274  ARG B CZ  1 
ATOM   6234 C  CZ  B ARG B  1 274 ? 25.927  -5.203  -61.756 0.50 50.78  ?  274  ARG B CZ  1 
ATOM   6235 N  NH1 A ARG B  1 274 ? 25.298  -3.488  -61.811 0.50 60.90  ?  274  ARG B NH1 1 
ATOM   6236 N  NH1 B ARG B  1 274 ? 26.341  -4.324  -60.849 0.50 48.58  ?  274  ARG B NH1 1 
ATOM   6237 N  NH2 A ARG B  1 274 ? 24.704  -2.232  -59.981 0.50 51.55  ?  274  ARG B NH2 1 
ATOM   6238 N  NH2 B ARG B  1 274 ? 26.634  -5.396  -62.859 0.50 48.29  ?  274  ARG B NH2 1 
ATOM   6239 N  N   . THR B  1 275 ? 23.380  -11.480 -59.953 1.00 50.56  ?  275  THR B N   1 
ATOM   6240 C  CA  . THR B  1 275 ? 22.948  -12.751 -60.528 1.00 53.56  ?  275  THR B CA  1 
ATOM   6241 C  C   . THR B  1 275 ? 22.121  -13.575 -59.551 1.00 65.03  ?  275  THR B C   1 
ATOM   6242 O  O   . THR B  1 275 ? 21.530  -14.580 -59.931 1.00 73.49  ?  275  THR B O   1 
ATOM   6243 C  CB  . THR B  1 275 ? 24.126  -13.622 -61.000 1.00 59.56  ?  275  THR B CB  1 
ATOM   6244 O  OG1 . THR B  1 275 ? 24.817  -14.166 -59.868 1.00 58.25  ?  275  THR B OG1 1 
ATOM   6245 C  CG2 . THR B  1 275 ? 25.088  -12.820 -61.883 1.00 58.30  ?  275  THR B CG2 1 
ATOM   6246 N  N   . ARG B  1 276 ? 22.086  -13.161 -58.289 1.00 63.72  ?  276  ARG B N   1 
ATOM   6247 C  CA  . ARG B  1 276 ? 21.359  -13.921 -57.280 1.00 61.84  ?  276  ARG B CA  1 
ATOM   6248 C  C   . ARG B  1 276 ? 19.846  -13.666 -57.282 1.00 55.99  ?  276  ARG B C   1 
ATOM   6249 O  O   . ARG B  1 276 ? 19.398  -12.513 -57.217 1.00 50.54  ?  276  ARG B O   1 
ATOM   6250 C  CB  . ARG B  1 276 ? 21.939  -13.665 -55.881 1.00 61.24  ?  276  ARG B CB  1 
ATOM   6251 C  CG  . ARG B  1 276 ? 23.322  -14.246 -55.663 1.00 62.39  ?  276  ARG B CG  1 
ATOM   6252 C  CD  . ARG B  1 276 ? 23.319  -15.760 -55.781 1.00 61.44  ?  276  ARG B CD  1 
ATOM   6253 N  NE  . ARG B  1 276 ? 24.630  -16.324 -55.467 1.00 71.54  ?  276  ARG B NE  1 
ATOM   6254 C  CZ  . ARG B  1 276 ? 25.609  -16.475 -56.355 1.00 74.09  ?  276  ARG B CZ  1 
ATOM   6255 N  NH1 . ARG B  1 276 ? 25.421  -16.099 -57.609 1.00 77.43  ?  276  ARG B NH1 1 
ATOM   6256 N  NH2 . ARG B  1 276 ? 26.778  -16.997 -55.992 1.00 72.50  ?  276  ARG B NH2 1 
ATOM   6257 N  N   . PRO B  1 277 ? 19.060  -14.754 -57.341 1.00 52.96  ?  277  PRO B N   1 
ATOM   6258 C  CA  . PRO B  1 277 ? 17.610  -14.725 -57.115 1.00 55.32  ?  277  PRO B CA  1 
ATOM   6259 C  C   . PRO B  1 277 ? 17.275  -13.925 -55.868 1.00 54.82  ?  277  PRO B C   1 
ATOM   6260 O  O   . PRO B  1 277 ? 17.971  -14.031 -54.857 1.00 59.27  ?  277  PRO B O   1 
ATOM   6261 C  CB  . PRO B  1 277 ? 17.271  -16.196 -56.881 1.00 59.12  ?  277  PRO B CB  1 
ATOM   6262 C  CG  . PRO B  1 277 ? 18.272  -16.927 -57.712 1.00 61.11  ?  277  PRO B CG  1 
ATOM   6263 C  CD  . PRO B  1 277 ? 19.542  -16.115 -57.629 1.00 55.46  ?  277  PRO B CD  1 
ATOM   6264 N  N   . ALA B  1 278 ? 16.213  -13.139 -55.953 1.00 51.18  ?  278  ALA B N   1 
ATOM   6265 C  CA  . ALA B  1 278 ? 15.803  -12.247 -54.887 1.00 49.19  ?  278  ALA B CA  1 
ATOM   6266 C  C   . ALA B  1 278 ? 15.763  -12.938 -53.521 1.00 58.71  ?  278  ALA B C   1 
ATOM   6267 O  O   . ALA B  1 278 ? 16.327  -12.436 -52.549 1.00 57.09  ?  278  ALA B O   1 
ATOM   6268 C  CB  . ALA B  1 278 ? 14.453  -11.649 -55.220 1.00 42.54  ?  278  ALA B CB  1 
ATOM   6269 N  N   . GLN B  1 279 ? 15.127  -14.106 -53.471 1.00 63.30  ?  279  GLN B N   1 
ATOM   6270 C  CA  . GLN B  1 279 ? 14.892  -14.813 -52.217 1.00 60.48  ?  279  GLN B CA  1 
ATOM   6271 C  C   . GLN B  1 279 ? 16.191  -15.297 -51.591 1.00 62.42  ?  279  GLN B C   1 
ATOM   6272 O  O   . GLN B  1 279 ? 16.259  -15.510 -50.377 1.00 59.22  ?  279  GLN B O   1 
ATOM   6273 C  CB  . GLN B  1 279 ? 13.922  -15.982 -52.427 1.00 59.94  ?  279  GLN B CB  1 
ATOM   6274 C  CG  . GLN B  1 279 ? 13.431  -16.645 -51.142 1.00 54.69  ?  279  GLN B CG  1 
ATOM   6275 C  CD  . GLN B  1 279 ? 13.006  -15.638 -50.080 1.00 54.60  ?  279  GLN B CD  1 
ATOM   6276 O  OE1 . GLN B  1 279 ? 12.098  -14.830 -50.286 1.00 52.67  ?  279  GLN B OE1 1 
ATOM   6277 N  NE2 . GLN B  1 279 ? 13.675  -15.678 -48.939 1.00 54.74  ?  279  GLN B NE2 1 
ATOM   6278 N  N   . ASP B  1 280 ? 17.222  -15.461 -52.414 1.00 63.51  ?  280  ASP B N   1 
ATOM   6279 C  CA  . ASP B  1 280 ? 18.537  -15.853 -51.907 1.00 66.91  ?  280  ASP B CA  1 
ATOM   6280 C  C   . ASP B  1 280 ? 19.167  -14.766 -51.036 1.00 66.10  ?  280  ASP B C   1 
ATOM   6281 O  O   . ASP B  1 280 ? 19.909  -15.073 -50.108 1.00 70.92  ?  280  ASP B O   1 
ATOM   6282 C  CB  . ASP B  1 280 ? 19.485  -16.221 -53.050 1.00 64.23  ?  280  ASP B CB  1 
ATOM   6283 C  CG  . ASP B  1 280 ? 19.181  -17.581 -53.648 1.00 72.04  ?  280  ASP B CG  1 
ATOM   6284 O  OD1 . ASP B  1 280 ? 18.058  -18.100 -53.447 1.00 77.11  ?  280  ASP B OD1 1 
ATOM   6285 O  OD2 . ASP B  1 280 ? 20.072  -18.125 -54.332 1.00 72.49  ?  280  ASP B OD2 1 
ATOM   6286 N  N   . LEU B  1 281 ? 18.879  -13.499 -51.332 1.00 64.36  ?  281  LEU B N   1 
ATOM   6287 C  CA  . LEU B  1 281 ? 19.440  -12.405 -50.539 1.00 60.77  ?  281  LEU B CA  1 
ATOM   6288 C  C   . LEU B  1 281 ? 18.658  -12.246 -49.241 1.00 57.15  ?  281  LEU B C   1 
ATOM   6289 O  O   . LEU B  1 281 ? 19.242  -12.123 -48.169 1.00 51.95  ?  281  LEU B O   1 
ATOM   6290 C  CB  . LEU B  1 281 ? 19.481  -11.091 -51.327 1.00 57.56  ?  281  LEU B CB  1 
ATOM   6291 C  CG  . LEU B  1 281 ? 20.269  -11.118 -52.648 1.00 53.66  ?  281  LEU B CG  1 
ATOM   6292 C  CD1 . LEU B  1 281 ? 20.454  -9.721  -53.195 1.00 56.61  ?  281  LEU B CD1 1 
ATOM   6293 C  CD2 . LEU B  1 281 ? 21.619  -11.787 -52.482 1.00 45.92  ?  281  LEU B CD2 1 
ATOM   6294 N  N   . VAL B  1 282 ? 17.335  -12.275 -49.346 1.00 55.82  ?  282  VAL B N   1 
ATOM   6295 C  CA  . VAL B  1 282 ? 16.462  -12.253 -48.177 1.00 51.58  ?  282  VAL B CA  1 
ATOM   6296 C  C   . VAL B  1 282 ? 16.757  -13.391 -47.174 1.00 55.32  ?  282  VAL B C   1 
ATOM   6297 O  O   . VAL B  1 282 ? 16.693  -13.178 -45.958 1.00 58.78  ?  282  VAL B O   1 
ATOM   6298 C  CB  . VAL B  1 282 ? 14.981  -12.245 -48.622 1.00 55.55  ?  282  VAL B CB  1 
ATOM   6299 C  CG1 . VAL B  1 282 ? 14.059  -12.674 -47.506 1.00 60.24  ?  282  VAL B CG1 1 
ATOM   6300 C  CG2 . VAL B  1 282 ? 14.606  -10.869 -49.127 1.00 58.95  ?  282  VAL B CG2 1 
ATOM   6301 N  N   . ASP B  1 283 ? 17.110  -14.576 -47.679 1.00 52.65  ?  283  ASP B N   1 
ATOM   6302 C  CA  . ASP B  1 283 ? 17.433  -15.741 -46.838 1.00 53.36  ?  283  ASP B CA  1 
ATOM   6303 C  C   . ASP B  1 283 ? 18.560  -15.485 -45.818 1.00 61.31  ?  283  ASP B C   1 
ATOM   6304 O  O   . ASP B  1 283 ? 18.587  -16.090 -44.735 1.00 60.54  ?  283  ASP B O   1 
ATOM   6305 C  CB  . ASP B  1 283 ? 17.844  -16.945 -47.700 1.00 59.66  ?  283  ASP B CB  1 
ATOM   6306 C  CG  . ASP B  1 283 ? 16.655  -17.717 -48.272 1.00 66.00  ?  283  ASP B CG  1 
ATOM   6307 O  OD1 . ASP B  1 283 ? 15.512  -17.516 -47.811 1.00 55.43  ?  283  ASP B OD1 1 
ATOM   6308 O  OD2 . ASP B  1 283 ? 16.880  -18.546 -49.187 1.00 75.99  ?  283  ASP B OD2 1 
ATOM   6309 N  N   . HIS B  1 284 ? 19.498  -14.614 -46.179 1.00 57.18  ?  284  HIS B N   1 
ATOM   6310 C  CA  . HIS B  1 284 ? 20.670  -14.365 -45.350 1.00 58.34  ?  284  HIS B CA  1 
ATOM   6311 C  C   . HIS B  1 284 ? 20.681  -12.942 -44.810 1.00 60.07  ?  284  HIS B C   1 
ATOM   6312 O  O   . HIS B  1 284 ? 21.605  -12.558 -44.088 1.00 57.80  ?  284  HIS B O   1 
ATOM   6313 C  CB  . HIS B  1 284 ? 21.958  -14.617 -46.134 1.00 65.08  ?  284  HIS B CB  1 
ATOM   6314 C  CG  . HIS B  1 284 ? 22.196  -16.056 -46.468 1.00 75.05  ?  284  HIS B CG  1 
ATOM   6315 N  ND1 . HIS B  1 284 ? 22.761  -16.942 -45.577 1.00 85.30  ?  284  HIS B ND1 1 
ATOM   6316 C  CD2 . HIS B  1 284 ? 21.955  -16.759 -47.599 1.00 71.75  ?  284  HIS B CD2 1 
ATOM   6317 C  CE1 . HIS B  1 284 ? 22.856  -18.132 -46.144 1.00 84.11  ?  284  HIS B CE1 1 
ATOM   6318 N  NE2 . HIS B  1 284 ? 22.374  -18.047 -47.371 1.00 77.54  ?  284  HIS B NE2 1 
ATOM   6319 N  N   . GLU B  1 285 ? 19.652  -12.175 -45.165 1.00 54.12  ?  285  GLU B N   1 
ATOM   6320 C  CA  . GLU B  1 285 ? 19.531  -10.777 -44.761 1.00 50.54  ?  285  GLU B CA  1 
ATOM   6321 C  C   . GLU B  1 285 ? 19.775  -10.558 -43.263 1.00 60.75  ?  285  GLU B C   1 
ATOM   6322 O  O   . GLU B  1 285 ? 20.499  -9.644  -42.870 1.00 63.96  ?  285  GLU B O   1 
ATOM   6323 C  CB  . GLU B  1 285 ? 18.147  -10.257 -45.123 1.00 49.00  ?  285  GLU B CB  1 
ATOM   6324 C  CG  . GLU B  1 285 ? 18.036  -8.760  -45.033 1.00 61.80  ?  285  GLU B CG  1 
ATOM   6325 C  CD  . GLU B  1 285 ? 16.611  -8.267  -45.165 1.00 71.20  ?  285  GLU B CD  1 
ATOM   6326 O  OE1 . GLU B  1 285 ? 15.914  -8.703  -46.105 1.00 66.42  ?  285  GLU B OE1 1 
ATOM   6327 O  OE2 . GLU B  1 285 ? 16.191  -7.440  -44.318 1.00 85.80  ?  285  GLU B OE2 1 
ATOM   6328 N  N   . TRP B  1 286 ? 19.181  -11.403 -42.427 1.00 59.17  ?  286  TRP B N   1 
ATOM   6329 C  CA  . TRP B  1 286 ? 19.307  -11.233 -40.981 1.00 59.27  ?  286  TRP B CA  1 
ATOM   6330 C  C   . TRP B  1 286 ? 20.655  -11.698 -40.419 1.00 60.33  ?  286  TRP B C   1 
ATOM   6331 O  O   . TRP B  1 286 ? 21.042  -11.303 -39.328 1.00 63.71  ?  286  TRP B O   1 
ATOM   6332 C  CB  . TRP B  1 286 ? 18.145  -11.917 -40.248 1.00 59.57  ?  286  TRP B CB  1 
ATOM   6333 C  CG  . TRP B  1 286 ? 16.824  -11.248 -40.502 1.00 68.17  ?  286  TRP B CG  1 
ATOM   6334 C  CD1 . TRP B  1 286 ? 15.829  -11.683 -41.329 1.00 68.89  ?  286  TRP B CD1 1 
ATOM   6335 C  CD2 . TRP B  1 286 ? 16.366  -10.007 -39.941 1.00 68.79  ?  286  TRP B CD2 1 
ATOM   6336 N  NE1 . TRP B  1 286 ? 14.778  -10.797 -41.309 1.00 65.42  ?  286  TRP B NE1 1 
ATOM   6337 C  CE2 . TRP B  1 286 ? 15.084  -9.760  -40.465 1.00 63.46  ?  286  TRP B CE2 1 
ATOM   6338 C  CE3 . TRP B  1 286 ? 16.915  -9.084  -39.043 1.00 73.24  ?  286  TRP B CE3 1 
ATOM   6339 C  CZ2 . TRP B  1 286 ? 14.344  -8.626  -40.127 1.00 59.20  ?  286  TRP B CZ2 1 
ATOM   6340 C  CZ3 . TRP B  1 286 ? 16.176  -7.958  -38.707 1.00 67.28  ?  286  TRP B CZ3 1 
ATOM   6341 C  CH2 . TRP B  1 286 ? 14.909  -7.739  -39.251 1.00 61.36  ?  286  TRP B CH2 1 
ATOM   6342 N  N   . HIS B  1 287 ? 21.381  -12.515 -41.172 1.00 63.30  ?  287  HIS B N   1 
ATOM   6343 C  CA  . HIS B  1 287 ? 22.606  -13.112 -40.654 1.00 64.63  ?  287  HIS B CA  1 
ATOM   6344 C  C   . HIS B  1 287 ? 23.804  -12.163 -40.557 1.00 63.03  ?  287  HIS B C   1 
ATOM   6345 O  O   . HIS B  1 287 ? 24.868  -12.579 -40.100 1.00 65.00  ?  287  HIS B O   1 
ATOM   6346 C  CB  . HIS B  1 287 ? 23.000  -14.340 -41.475 1.00 73.08  ?  287  HIS B CB  1 
ATOM   6347 C  CG  . HIS B  1 287 ? 21.950  -15.403 -41.513 1.00 81.36  ?  287  HIS B CG  1 
ATOM   6348 N  ND1 . HIS B  1 287 ? 20.964  -15.506 -40.559 1.00 84.23  ?  287  HIS B ND1 1 
ATOM   6349 C  CD2 . HIS B  1 287 ? 21.729  -16.404 -42.396 1.00 89.69  ?  287  HIS B CD2 1 
ATOM   6350 C  CE1 . HIS B  1 287 ? 20.179  -16.529 -40.849 1.00 88.14  ?  287  HIS B CE1 1 
ATOM   6351 N  NE2 . HIS B  1 287 ? 20.622  -17.091 -41.958 1.00 94.89  ?  287  HIS B NE2 1 
ATOM   6352 N  N   . VAL B  1 288 ? 23.651  -10.903 -40.969 1.00 54.48  ?  288  VAL B N   1 
ATOM   6353 C  CA  . VAL B  1 288 ? 24.798  -9.982  -40.951 1.00 59.02  ?  288  VAL B CA  1 
ATOM   6354 C  C   . VAL B  1 288 ? 24.820  -8.956  -39.809 1.00 62.41  ?  288  VAL B C   1 
ATOM   6355 O  O   . VAL B  1 288 ? 25.667  -8.063  -39.805 1.00 62.63  ?  288  VAL B O   1 
ATOM   6356 C  CB  . VAL B  1 288 ? 24.999  -9.239  -42.304 1.00 56.41  ?  288  VAL B CB  1 
ATOM   6357 C  CG1 . VAL B  1 288 ? 25.151  -10.234 -43.445 1.00 61.95  ?  288  VAL B CG1 1 
ATOM   6358 C  CG2 . VAL B  1 288 ? 23.860  -8.275  -42.565 1.00 47.16  ?  288  VAL B CG2 1 
ATOM   6359 N  N   . LEU B  1 289 ? 23.910  -9.080  -38.844 1.00 63.04  ?  289  LEU B N   1 
ATOM   6360 C  CA  . LEU B  1 289 ? 23.917  -8.187  -37.684 1.00 59.92  ?  289  LEU B CA  1 
ATOM   6361 C  C   . LEU B  1 289 ? 25.089  -8.522  -36.755 1.00 59.15  ?  289  LEU B C   1 
ATOM   6362 O  O   . LEU B  1 289 ? 25.366  -9.691  -36.502 1.00 67.28  ?  289  LEU B O   1 
ATOM   6363 C  CB  . LEU B  1 289 ? 22.577  -8.245  -36.936 1.00 54.84  ?  289  LEU B CB  1 
ATOM   6364 C  CG  . LEU B  1 289 ? 21.409  -7.558  -37.650 1.00 55.07  ?  289  LEU B CG  1 
ATOM   6365 C  CD1 . LEU B  1 289 ? 20.058  -7.940  -37.056 1.00 53.05  ?  289  LEU B CD1 1 
ATOM   6366 C  CD2 . LEU B  1 289 ? 21.601  -6.053  -37.618 1.00 52.41  ?  289  LEU B CD2 1 
ATOM   6367 N  N   . PRO B  1 290 ? 25.790  -7.490  -36.257 1.00 53.76  ?  290  PRO B N   1 
ATOM   6368 C  CA  . PRO B  1 290 ? 26.978  -7.682  -35.409 1.00 61.63  ?  290  PRO B CA  1 
ATOM   6369 C  C   . PRO B  1 290 ? 26.696  -8.381  -34.069 1.00 61.71  ?  290  PRO B C   1 
ATOM   6370 O  O   . PRO B  1 290 ? 27.528  -9.156  -33.605 1.00 69.75  ?  290  PRO B O   1 
ATOM   6371 C  CB  . PRO B  1 290 ? 27.481  -6.248  -35.177 1.00 55.82  ?  290  PRO B CB  1 
ATOM   6372 C  CG  . PRO B  1 290 ? 26.278  -5.392  -35.366 1.00 52.16  ?  290  PRO B CG  1 
ATOM   6373 C  CD  . PRO B  1 290 ? 25.485  -6.062  -36.460 1.00 47.27  ?  290  PRO B CD  1 
ATOM   6374 N  N   . GLN B  1 291 ? 25.548  -8.112  -33.457 1.00 57.22  ?  291  GLN B N   1 
ATOM   6375 C  CA  . GLN B  1 291 ? 25.191  -8.766  -32.201 1.00 61.59  ?  291  GLN B CA  1 
ATOM   6376 C  C   . GLN B  1 291 ? 23.754  -9.268  -32.221 1.00 62.92  ?  291  GLN B C   1 
ATOM   6377 O  O   . GLN B  1 291 ? 22.929  -8.799  -33.000 1.00 62.28  ?  291  GLN B O   1 
ATOM   6378 C  CB  . GLN B  1 291 ? 25.363  -7.816  -30.996 1.00 60.39  ?  291  GLN B CB  1 
ATOM   6379 C  CG  . GLN B  1 291 ? 26.658  -7.013  -30.955 1.00 63.43  ?  291  GLN B CG  1 
ATOM   6380 C  CD  . GLN B  1 291 ? 26.484  -5.603  -31.501 1.00 72.28  ?  291  GLN B CD  1 
ATOM   6381 O  OE1 . GLN B  1 291 ? 25.359  -5.135  -31.695 1.00 74.09  ?  291  GLN B OE1 1 
ATOM   6382 N  NE2 . GLN B  1 291 ? 27.600  -4.923  -31.760 1.00 73.91  ?  291  GLN B NE2 1 
ATOM   6383 N  N   . GLU B  1 292 ? 23.462  -10.222 -31.345 1.00 74.35  ?  292  GLU B N   1 
ATOM   6384 C  CA  . GLU B  1 292 ? 22.088  -10.616 -31.071 1.00 73.29  ?  292  GLU B CA  1 
ATOM   6385 C  C   . GLU B  1 292 ? 21.340  -9.383  -30.581 1.00 67.88  ?  292  GLU B C   1 
ATOM   6386 O  O   . GLU B  1 292 ? 21.801  -8.690  -29.674 1.00 75.89  ?  292  GLU B O   1 
ATOM   6387 C  CB  . GLU B  1 292 ? 22.059  -11.708 -30.001 1.00 78.42  ?  292  GLU B CB  1 
ATOM   6388 C  CG  . GLU B  1 292 ? 20.664  -12.139 -29.592 1.00 83.37  ?  292  GLU B CG  1 
ATOM   6389 C  CD  . GLU B  1 292 ? 20.675  -13.274 -28.592 1.00 94.00  ?  292  GLU B CD  1 
ATOM   6390 O  OE1 . GLU B  1 292 ? 21.771  -13.644 -28.118 1.00 95.78  ?  292  GLU B OE1 1 
ATOM   6391 O  OE2 . GLU B  1 292 ? 19.583  -13.797 -28.283 1.00 99.39  ?  292  GLU B OE2 1 
ATOM   6392 N  N   . SER B  1 293 ? 20.189  -9.104  -31.176 1.00 59.29  ?  293  SER B N   1 
ATOM   6393 C  CA  . SER B  1 293 ? 19.496  -7.863  -30.879 1.00 54.66  ?  293  SER B CA  1 
ATOM   6394 C  C   . SER B  1 293 ? 18.015  -7.872  -31.228 1.00 51.04  ?  293  SER B C   1 
ATOM   6395 O  O   . SER B  1 293 ? 17.527  -8.761  -31.926 1.00 55.70  ?  293  SER B O   1 
ATOM   6396 C  CB  . SER B  1 293 ? 20.185  -6.706  -31.609 1.00 52.82  ?  293  SER B CB  1 
ATOM   6397 O  OG  . SER B  1 293 ? 20.442  -7.033  -32.966 1.00 51.24  ?  293  SER B OG  1 
ATOM   6398 N  N   . ILE B  1 294 ? 17.305  -6.874  -30.714 1.00 52.53  ?  294  ILE B N   1 
ATOM   6399 C  CA  . ILE B  1 294 ? 16.009  -6.498  -31.257 1.00 55.32  ?  294  ILE B CA  1 
ATOM   6400 C  C   . ILE B  1 294 ? 16.035  -5.022  -31.630 1.00 52.08  ?  294  ILE B C   1 
ATOM   6401 O  O   . ILE B  1 294 ? 16.888  -4.275  -31.160 1.00 60.01  ?  294  ILE B O   1 
ATOM   6402 C  CB  . ILE B  1 294 ? 14.830  -6.787  -30.304 1.00 56.63  ?  294  ILE B CB  1 
ATOM   6403 C  CG1 . ILE B  1 294 ? 15.016  -6.048  -28.983 1.00 56.47  ?  294  ILE B CG1 1 
ATOM   6404 C  CG2 . ILE B  1 294 ? 14.656  -8.288  -30.090 1.00 58.52  ?  294  ILE B CG2 1 
ATOM   6405 C  CD1 . ILE B  1 294 ? 13.839  -6.181  -28.066 1.00 64.30  ?  294  ILE B CD1 1 
ATOM   6406 N  N   . PHE B  1 295 ? 15.100  -4.622  -32.485 1.00 47.86  ?  295  PHE B N   1 
ATOM   6407 C  CA  . PHE B  1 295 ? 15.034  -3.261  -33.007 1.00 48.56  ?  295  PHE B CA  1 
ATOM   6408 C  C   . PHE B  1 295 ? 16.324  -2.873  -33.724 1.00 54.13  ?  295  PHE B C   1 
ATOM   6409 O  O   . PHE B  1 295 ? 16.748  -1.718  -33.671 1.00 53.65  ?  295  PHE B O   1 
ATOM   6410 C  CB  . PHE B  1 295 ? 14.702  -2.261  -31.899 1.00 47.52  ?  295  PHE B CB  1 
ATOM   6411 C  CG  . PHE B  1 295 ? 13.752  -1.171  -32.324 1.00 47.76  ?  295  PHE B CG  1 
ATOM   6412 C  CD1 . PHE B  1 295 ? 13.899  -0.536  -33.550 1.00 41.37  ?  295  PHE B CD1 1 
ATOM   6413 C  CD2 . PHE B  1 295 ? 12.701  -0.788  -31.500 1.00 46.31  ?  295  PHE B CD2 1 
ATOM   6414 C  CE1 . PHE B  1 295 ? 13.018  0.461   -33.944 1.00 36.91  ?  295  PHE B CE1 1 
ATOM   6415 C  CE2 . PHE B  1 295 ? 11.825  0.222   -31.880 1.00 45.24  ?  295  PHE B CE2 1 
ATOM   6416 C  CZ  . PHE B  1 295 ? 11.976  0.840   -33.101 1.00 42.71  ?  295  PHE B CZ  1 
ATOM   6417 N  N   . ARG B  1 296 ? 16.941  -3.853  -34.380 1.00 36.16  ?  296  ARG B N   1 
ATOM   6418 C  CA  . ARG B  1 296 ? 18.070  -3.615  -35.267 1.00 41.44  ?  296  ARG B CA  1 
ATOM   6419 C  C   . ARG B  1 296 ? 17.800  -4.230  -36.642 1.00 54.26  ?  296  ARG B C   1 
ATOM   6420 O  O   . ARG B  1 296 ? 17.293  -5.345  -36.745 1.00 63.65  ?  296  ARG B O   1 
ATOM   6421 C  CB  . ARG B  1 296 ? 19.351  -4.201  -34.686 1.00 46.43  ?  296  ARG B CB  1 
ATOM   6422 C  CG  . ARG B  1 296 ? 19.881  -3.459  -33.473 1.00 58.16  ?  296  ARG B CG  1 
ATOM   6423 C  CD  . ARG B  1 296 ? 20.234  -2.025  -33.783 1.00 36.82  ?  296  ARG B CD  1 
ATOM   6424 N  NE  . ARG B  1 296 ? 20.759  -1.388  -32.590 1.00 49.05  ?  296  ARG B NE  1 
ATOM   6425 C  CZ  . ARG B  1 296 ? 20.013  -0.741  -31.695 1.00 53.43  ?  296  ARG B CZ  1 
ATOM   6426 N  NH1 . ARG B  1 296 ? 18.697  -0.615  -31.868 1.00 41.29  ?  296  ARG B NH1 1 
ATOM   6427 N  NH2 . ARG B  1 296 ? 20.586  -0.209  -30.627 1.00 57.90  ?  296  ARG B NH2 1 
ATOM   6428 N  N   . PHE B  1 297 ? 18.139  -3.506  -37.700 1.00 53.23  ?  297  PHE B N   1 
ATOM   6429 C  CA  . PHE B  1 297 ? 17.834  -3.969  -39.058 1.00 50.52  ?  297  PHE B CA  1 
ATOM   6430 C  C   . PHE B  1 297 ? 19.086  -3.965  -39.929 1.00 54.60  ?  297  PHE B C   1 
ATOM   6431 O  O   . PHE B  1 297 ? 19.921  -3.058  -39.833 1.00 55.48  ?  297  PHE B O   1 
ATOM   6432 C  CB  . PHE B  1 297 ? 16.704  -3.134  -39.657 1.00 35.68  ?  297  PHE B CB  1 
ATOM   6433 C  CG  . PHE B  1 297 ? 15.606  -2.837  -38.669 1.00 43.13  ?  297  PHE B CG  1 
ATOM   6434 C  CD1 . PHE B  1 297 ? 14.810  -3.860  -38.172 1.00 43.04  ?  297  PHE B CD1 1 
ATOM   6435 C  CD2 . PHE B  1 297 ? 15.408  -1.547  -38.192 1.00 44.86  ?  297  PHE B CD2 1 
ATOM   6436 C  CE1 . PHE B  1 297 ? 13.820  -3.600  -37.244 1.00 47.08  ?  297  PHE B CE1 1 
ATOM   6437 C  CE2 . PHE B  1 297 ? 14.418  -1.275  -37.264 1.00 41.93  ?  297  PHE B CE2 1 
ATOM   6438 C  CZ  . PHE B  1 297 ? 13.620  -2.305  -36.792 1.00 44.04  ?  297  PHE B CZ  1 
ATOM   6439 N  N   . SER B  1 298 ? 19.220  -5.003  -40.751 1.00 47.92  ?  298  SER B N   1 
ATOM   6440 C  CA  . SER B  1 298 ? 20.453  -5.244  -41.500 1.00 52.67  ?  298  SER B CA  1 
ATOM   6441 C  C   . SER B  1 298 ? 20.789  -4.180  -42.550 1.00 50.32  ?  298  SER B C   1 
ATOM   6442 O  O   . SER B  1 298 ? 21.947  -3.809  -42.705 1.00 57.29  ?  298  SER B O   1 
ATOM   6443 C  CB  . SER B  1 298 ? 20.422  -6.629  -42.148 1.00 53.59  ?  298  SER B CB  1 
ATOM   6444 O  OG  . SER B  1 298 ? 20.399  -7.641  -41.161 1.00 61.64  ?  298  SER B OG  1 
ATOM   6445 N  N   . PHE B  1 299 ? 19.794  -3.683  -43.270 1.00 44.89  ?  299  PHE B N   1 
ATOM   6446 C  CA  . PHE B  1 299 ? 20.096  -2.755  -44.354 1.00 50.09  ?  299  PHE B CA  1 
ATOM   6447 C  C   . PHE B  1 299 ? 19.248  -1.507  -44.296 1.00 50.68  ?  299  PHE B C   1 
ATOM   6448 O  O   . PHE B  1 299 ? 18.070  -1.517  -44.635 1.00 55.84  ?  299  PHE B O   1 
ATOM   6449 C  CB  . PHE B  1 299 ? 20.019  -3.460  -45.712 1.00 41.88  ?  299  PHE B CB  1 
ATOM   6450 C  CG  . PHE B  1 299 ? 21.022  -4.561  -45.842 1.00 43.15  ?  299  PHE B CG  1 
ATOM   6451 C  CD1 . PHE B  1 299 ? 22.340  -4.273  -46.160 1.00 41.15  ?  299  PHE B CD1 1 
ATOM   6452 C  CD2 . PHE B  1 299 ? 20.667  -5.880  -45.577 1.00 47.20  ?  299  PHE B CD2 1 
ATOM   6453 C  CE1 . PHE B  1 299 ? 23.281  -5.291  -46.246 1.00 48.49  ?  299  PHE B CE1 1 
ATOM   6454 C  CE2 . PHE B  1 299 ? 21.602  -6.904  -45.644 1.00 43.36  ?  299  PHE B CE2 1 
ATOM   6455 C  CZ  . PHE B  1 299 ? 22.909  -6.612  -45.984 1.00 47.82  ?  299  PHE B CZ  1 
ATOM   6456 N  N   . VAL B  1 300 ? 19.890  -0.432  -43.863 1.00 41.72  ?  300  VAL B N   1 
ATOM   6457 C  CA  . VAL B  1 300 ? 19.225  0.802   -43.497 1.00 45.37  ?  300  VAL B CA  1 
ATOM   6458 C  C   . VAL B  1 300 ? 20.022  1.901   -44.183 1.00 43.77  ?  300  VAL B C   1 
ATOM   6459 O  O   . VAL B  1 300 ? 21.078  1.617   -44.732 1.00 42.74  ?  300  VAL B O   1 
ATOM   6460 C  CB  . VAL B  1 300 ? 19.291  0.989   -41.956 1.00 38.68  ?  300  VAL B CB  1 
ATOM   6461 C  CG1 . VAL B  1 300 ? 18.570  -0.149  -41.234 1.00 33.56  ?  300  VAL B CG1 1 
ATOM   6462 C  CG2 . VAL B  1 300 ? 20.730  1.061   -41.518 1.00 46.22  ?  300  VAL B CG2 1 
ATOM   6463 N  N   . PRO B  1 301 ? 19.526  3.154   -44.164 1.00 44.74  ?  301  PRO B N   1 
ATOM   6464 C  CA  . PRO B  1 301 ? 20.280  4.263   -44.762 1.00 43.36  ?  301  PRO B CA  1 
ATOM   6465 C  C   . PRO B  1 301 ? 21.707  4.339   -44.238 1.00 51.65  ?  301  PRO B C   1 
ATOM   6466 O  O   . PRO B  1 301 ? 21.942  3.996   -43.084 1.00 57.65  ?  301  PRO B O   1 
ATOM   6467 C  CB  . PRO B  1 301 ? 19.503  5.492   -44.295 1.00 38.29  ?  301  PRO B CB  1 
ATOM   6468 C  CG  . PRO B  1 301 ? 18.113  5.021   -44.188 1.00 42.89  ?  301  PRO B CG  1 
ATOM   6469 C  CD  . PRO B  1 301 ? 18.173  3.578   -43.758 1.00 43.24  ?  301  PRO B CD  1 
ATOM   6470 N  N   . VAL B  1 302 ? 22.639  4.783   -45.077 1.00 52.20  ?  302  VAL B N   1 
ATOM   6471 C  CA  . VAL B  1 302 ? 24.056  4.822   -44.723 1.00 48.34  ?  302  VAL B CA  1 
ATOM   6472 C  C   . VAL B  1 302 ? 24.569  6.264   -44.747 1.00 51.22  ?  302  VAL B C   1 
ATOM   6473 O  O   . VAL B  1 302 ? 24.179  7.055   -45.600 1.00 61.46  ?  302  VAL B O   1 
ATOM   6474 C  CB  . VAL B  1 302 ? 24.891  3.940   -45.696 1.00 38.36  ?  302  VAL B CB  1 
ATOM   6475 C  CG1 . VAL B  1 302 ? 24.695  4.397   -47.135 1.00 44.20  ?  302  VAL B CG1 1 
ATOM   6476 C  CG2 . VAL B  1 302 ? 26.376  3.946   -45.331 1.00 37.21  ?  302  VAL B CG2 1 
ATOM   6477 N  N   . VAL B  1 303 ? 25.431  6.619   -43.804 1.00 46.77  ?  303  VAL B N   1 
ATOM   6478 C  CA  . VAL B  1 303 ? 26.038  7.942   -43.828 1.00 47.48  ?  303  VAL B CA  1 
ATOM   6479 C  C   . VAL B  1 303 ? 27.091  7.939   -44.919 1.00 52.77  ?  303  VAL B C   1 
ATOM   6480 O  O   . VAL B  1 303 ? 28.229  7.536   -44.691 1.00 63.74  ?  303  VAL B O   1 
ATOM   6481 C  CB  . VAL B  1 303 ? 26.657  8.321   -42.456 1.00 54.75  ?  303  VAL B CB  1 
ATOM   6482 C  CG1 . VAL B  1 303 ? 27.210  9.737   -42.489 1.00 44.02  ?  303  VAL B CG1 1 
ATOM   6483 C  CG2 . VAL B  1 303 ? 25.613  8.191   -41.359 1.00 33.93  ?  303  VAL B CG2 1 
ATOM   6484 N  N   . ASP B  1 304 ? 26.691  8.365   -46.115 1.00 60.63  ?  304  ASP B N   1 
ATOM   6485 C  CA  . ASP B  1 304 ? 27.544  8.293   -47.307 1.00 58.52  ?  304  ASP B CA  1 
ATOM   6486 C  C   . ASP B  1 304 ? 28.342  9.566   -47.538 1.00 61.54  ?  304  ASP B C   1 
ATOM   6487 O  O   . ASP B  1 304 ? 29.361  9.552   -48.231 1.00 66.70  ?  304  ASP B O   1 
ATOM   6488 C  CB  . ASP B  1 304 ? 26.706  7.975   -48.556 1.00 57.43  ?  304  ASP B CB  1 
ATOM   6489 C  CG  . ASP B  1 304 ? 25.500  8.893   -48.704 1.00 61.64  ?  304  ASP B CG  1 
ATOM   6490 O  OD1 . ASP B  1 304 ? 25.244  9.685   -47.769 1.00 57.73  ?  304  ASP B OD1 1 
ATOM   6491 O  OD2 . ASP B  1 304 ? 24.800  8.815   -49.746 1.00 59.32  ?  304  ASP B OD2 1 
ATOM   6492 N  N   . GLY B  1 305 ? 27.882  10.666  -46.953 1.00 61.20  ?  305  GLY B N   1 
ATOM   6493 C  CA  . GLY B  1 305 ? 28.478  11.959  -47.217 1.00 64.54  ?  305  GLY B CA  1 
ATOM   6494 C  C   . GLY B  1 305 ? 27.862  12.510  -48.481 1.00 69.28  ?  305  GLY B C   1 
ATOM   6495 O  O   . GLY B  1 305 ? 28.368  13.461  -49.073 1.00 70.16  ?  305  GLY B O   1 
ATOM   6496 N  N   . ASP B  1 306 ? 26.758  11.897  -48.897 1.00 72.07  ?  306  ASP B N   1 
ATOM   6497 C  CA  . ASP B  1 306 ? 26.048  12.314  -50.101 1.00 67.44  ?  306  ASP B CA  1 
ATOM   6498 C  C   . ASP B  1 306 ? 24.606  12.639  -49.738 1.00 60.31  ?  306  ASP B C   1 
ATOM   6499 O  O   . ASP B  1 306 ? 24.275  13.807  -49.534 1.00 61.31  ?  306  ASP B O   1 
ATOM   6500 C  CB  . ASP B  1 306 ? 26.115  11.227  -51.176 1.00 65.14  ?  306  ASP B CB  1 
ATOM   6501 C  CG  . ASP B  1 306 ? 25.755  11.741  -52.561 1.00 78.67  ?  306  ASP B CG  1 
ATOM   6502 O  OD1 . ASP B  1 306 ? 24.984  12.724  -52.664 1.00 83.28  ?  306  ASP B OD1 1 
ATOM   6503 O  OD2 . ASP B  1 306 ? 26.245  11.151  -53.554 1.00 78.84  ?  306  ASP B OD2 1 
ATOM   6504 N  N   . PHE B  1 307 ? 23.748  11.622  -49.670 1.00 57.46  ?  307  PHE B N   1 
ATOM   6505 C  CA  . PHE B  1 307 ? 22.384  11.849  -49.193 1.00 59.76  ?  307  PHE B CA  1 
ATOM   6506 C  C   . PHE B  1 307 ? 22.499  12.462  -47.815 1.00 50.20  ?  307  PHE B C   1 
ATOM   6507 O  O   . PHE B  1 307 ? 22.015  13.563  -47.579 1.00 53.86  ?  307  PHE B O   1 
ATOM   6508 C  CB  . PHE B  1 307 ? 21.572  10.553  -49.109 1.00 57.43  ?  307  PHE B CB  1 
ATOM   6509 C  CG  . PHE B  1 307 ? 20.080  10.774  -49.131 1.00 53.75  ?  307  PHE B CG  1 
ATOM   6510 C  CD1 . PHE B  1 307 ? 19.386  11.062  -47.970 1.00 52.10  ?  307  PHE B CD1 1 
ATOM   6511 C  CD2 . PHE B  1 307 ? 19.372  10.706  -50.325 1.00 58.15  ?  307  PHE B CD2 1 
ATOM   6512 C  CE1 . PHE B  1 307 ? 18.009  11.267  -47.993 1.00 45.69  ?  307  PHE B CE1 1 
ATOM   6513 C  CE2 . PHE B  1 307 ? 18.003  10.911  -50.354 1.00 49.73  ?  307  PHE B CE2 1 
ATOM   6514 C  CZ  . PHE B  1 307 ? 17.323  11.190  -49.189 1.00 50.85  ?  307  PHE B CZ  1 
ATOM   6515 N  N   . LEU B  1 308 ? 23.175  11.743  -46.924 1.00 44.54  ?  308  LEU B N   1 
ATOM   6516 C  CA  . LEU B  1 308 ? 23.501  12.242  -45.591 1.00 46.53  ?  308  LEU B CA  1 
ATOM   6517 C  C   . LEU B  1 308 ? 24.951  12.717  -45.545 1.00 50.91  ?  308  LEU B C   1 
ATOM   6518 O  O   . LEU B  1 308 ? 25.880  11.905  -45.519 1.00 52.84  ?  308  LEU B O   1 
ATOM   6519 C  CB  . LEU B  1 308 ? 23.278  11.144  -44.552 1.00 42.46  ?  308  LEU B CB  1 
ATOM   6520 C  CG  . LEU B  1 308 ? 21.873  10.545  -44.585 1.00 46.24  ?  308  LEU B CG  1 
ATOM   6521 C  CD1 . LEU B  1 308 ? 21.778  9.290   -43.727 1.00 47.46  ?  308  LEU B CD1 1 
ATOM   6522 C  CD2 . LEU B  1 308 ? 20.855  11.590  -44.154 1.00 48.94  ?  308  LEU B CD2 1 
ATOM   6523 N  N   . SER B  1 309 ? 25.141  14.033  -45.530 1.00 52.46  ?  309  SER B N   1 
ATOM   6524 C  CA  . SER B  1 309 ? 26.482  14.616  -45.526 1.00 56.46  ?  309  SER B CA  1 
ATOM   6525 C  C   . SER B  1 309 ? 27.251  14.294  -44.241 1.00 62.12  ?  309  SER B C   1 
ATOM   6526 O  O   . SER B  1 309 ? 28.471  14.136  -44.258 1.00 76.35  ?  309  SER B O   1 
ATOM   6527 C  CB  . SER B  1 309 ? 26.392  16.126  -45.727 1.00 56.43  ?  309  SER B CB  1 
ATOM   6528 O  OG  . SER B  1 309 ? 25.394  16.679  -44.885 1.00 65.37  ?  309  SER B OG  1 
ATOM   6529 N  N   . ASP B  1 310 ? 26.532  14.205  -43.129 1.00 55.40  ?  310  ASP B N   1 
ATOM   6530 C  CA  . ASP B  1 310 ? 27.116  13.794  -41.859 1.00 57.04  ?  310  ASP B CA  1 
ATOM   6531 C  C   . ASP B  1 310 ? 26.115  12.892  -41.164 1.00 54.45  ?  310  ASP B C   1 
ATOM   6532 O  O   . ASP B  1 310 ? 25.095  12.550  -41.755 1.00 52.37  ?  310  ASP B O   1 
ATOM   6533 C  CB  . ASP B  1 310 ? 27.407  15.007  -40.985 1.00 59.36  ?  310  ASP B CB  1 
ATOM   6534 C  CG  . ASP B  1 310 ? 28.541  14.763  -40.027 1.00 68.11  ?  310  ASP B CG  1 
ATOM   6535 O  OD1 . ASP B  1 310 ? 28.714  13.598  -39.611 1.00 70.41  ?  310  ASP B OD1 1 
ATOM   6536 O  OD2 . ASP B  1 310 ? 29.264  15.729  -39.699 1.00 72.37  ?  310  ASP B OD2 1 
ATOM   6537 N  N   . THR B  1 311 ? 26.384  12.503  -39.920 1.00 53.34  ?  311  THR B N   1 
ATOM   6538 C  CA  . THR B  1 311 ? 25.398  11.719  -39.167 1.00 56.72  ?  311  THR B CA  1 
ATOM   6539 C  C   . THR B  1 311 ? 24.148  12.554  -38.895 1.00 50.12  ?  311  THR B C   1 
ATOM   6540 O  O   . THR B  1 311 ? 24.217  13.778  -38.835 1.00 59.44  ?  311  THR B O   1 
ATOM   6541 C  CB  . THR B  1 311 ? 25.953  11.235  -37.817 1.00 58.43  ?  311  THR B CB  1 
ATOM   6542 O  OG1 . THR B  1 311 ? 25.915  12.310  -36.873 1.00 57.43  ?  311  THR B OG1 1 
ATOM   6543 C  CG2 . THR B  1 311 ? 27.386  10.739  -37.973 1.00 62.95  ?  311  THR B CG2 1 
ATOM   6544 N  N   . PRO B  1 312 ? 22.998  11.898  -38.746 1.00 46.67  ?  312  PRO B N   1 
ATOM   6545 C  CA  . PRO B  1 312 ? 21.790  12.636  -38.360 1.00 52.51  ?  312  PRO B CA  1 
ATOM   6546 C  C   . PRO B  1 312 ? 21.959  13.494  -37.101 1.00 56.83  ?  312  PRO B C   1 
ATOM   6547 O  O   . PRO B  1 312 ? 21.373  14.580  -37.054 1.00 56.08  ?  312  PRO B O   1 
ATOM   6548 C  CB  . PRO B  1 312 ? 20.768  11.525  -38.119 1.00 46.17  ?  312  PRO B CB  1 
ATOM   6549 C  CG  . PRO B  1 312 ? 21.174  10.464  -39.103 1.00 41.13  ?  312  PRO B CG  1 
ATOM   6550 C  CD  . PRO B  1 312 ? 22.699  10.501  -39.111 1.00 45.41  ?  312  PRO B CD  1 
ATOM   6551 N  N   . GLU B  1 313 ? 22.742  13.047  -36.118 1.00 52.00  ?  313  GLU B N   1 
ATOM   6552 C  CA  . GLU B  1 313 ? 22.887  13.839  -34.894 1.00 57.26  ?  313  GLU B CA  1 
ATOM   6553 C  C   . GLU B  1 313 ? 23.658  15.111  -35.183 1.00 58.03  ?  313  GLU B C   1 
ATOM   6554 O  O   . GLU B  1 313 ? 23.249  16.190  -34.774 1.00 59.60  ?  313  GLU B O   1 
ATOM   6555 C  CB  . GLU B  1 313 ? 23.537  13.063  -33.739 1.00 63.47  ?  313  GLU B CB  1 
ATOM   6556 C  CG  . GLU B  1 313 ? 24.003  11.661  -34.082 1.00 77.64  ?  313  GLU B CG  1 
ATOM   6557 C  CD  . GLU B  1 313 ? 22.861  10.658  -34.197 1.00 81.59  ?  313  GLU B CD  1 
ATOM   6558 O  OE1 . GLU B  1 313 ? 22.185  10.397  -33.165 1.00 72.82  ?  313  GLU B OE1 1 
ATOM   6559 O  OE2 . GLU B  1 313 ? 22.656  10.133  -35.326 1.00 81.10  ?  313  GLU B OE2 1 
ATOM   6560 N  N   . ALA B  1 314 ? 24.769  14.982  -35.899 1.00 54.05  ?  314  ALA B N   1 
ATOM   6561 C  CA  . ALA B  1 314 ? 25.545  16.145  -36.304 1.00 53.59  ?  314  ALA B CA  1 
ATOM   6562 C  C   . ALA B  1 314 ? 24.675  17.125  -37.086 1.00 64.64  ?  314  ALA B C   1 
ATOM   6563 O  O   . ALA B  1 314 ? 24.780  18.341  -36.912 1.00 67.77  ?  314  ALA B O   1 
ATOM   6564 C  CB  . ALA B  1 314 ? 26.735  15.722  -37.138 1.00 49.13  ?  314  ALA B CB  1 
ATOM   6565 N  N   . LEU B  1 315 ? 23.803  16.581  -37.932 1.00 59.62  ?  315  LEU B N   1 
ATOM   6566 C  CA  . LEU B  1 315 ? 22.955  17.391  -38.798 1.00 55.99  ?  315  LEU B CA  1 
ATOM   6567 C  C   . LEU B  1 315 ? 21.855  18.130  -38.044 1.00 57.06  ?  315  LEU B C   1 
ATOM   6568 O  O   . LEU B  1 315 ? 21.612  19.315  -38.299 1.00 57.73  ?  315  LEU B O   1 
ATOM   6569 C  CB  . LEU B  1 315 ? 22.337  16.525  -39.890 1.00 49.66  ?  315  LEU B CB  1 
ATOM   6570 C  CG  . LEU B  1 315 ? 23.339  16.042  -40.932 1.00 50.20  ?  315  LEU B CG  1 
ATOM   6571 C  CD1 . LEU B  1 315 ? 22.643  15.137  -41.919 1.00 49.27  ?  315  LEU B CD1 1 
ATOM   6572 C  CD2 . LEU B  1 315 ? 23.977  17.227  -41.630 1.00 46.05  ?  315  LEU B CD2 1 
ATOM   6573 N  N   . ILE B  1 316 ? 21.181  17.434  -37.131 1.00 49.82  ?  316  ILE B N   1 
ATOM   6574 C  CA  . ILE B  1 316 ? 20.152  18.085  -36.327 1.00 61.94  ?  316  ILE B CA  1 
ATOM   6575 C  C   . ILE B  1 316 ? 20.762  19.024  -35.292 1.00 71.73  ?  316  ILE B C   1 
ATOM   6576 O  O   . ILE B  1 316 ? 20.134  20.012  -34.921 1.00 77.65  ?  316  ILE B O   1 
ATOM   6577 C  CB  . ILE B  1 316 ? 19.189  17.088  -35.629 1.00 43.35  ?  316  ILE B CB  1 
ATOM   6578 C  CG1 . ILE B  1 316 ? 19.880  16.322  -34.512 1.00 40.16  ?  316  ILE B CG1 1 
ATOM   6579 C  CG2 . ILE B  1 316 ? 18.602  16.096  -36.630 1.00 38.32  ?  316  ILE B CG2 1 
ATOM   6580 C  CD1 . ILE B  1 316 ? 18.995  15.208  -33.936 1.00 50.29  ?  316  ILE B CD1 1 
ATOM   6581 N  N   . ASN B  1 317 ? 21.984  18.726  -34.842 1.00 68.91  ?  317  ASN B N   1 
ATOM   6582 C  CA  . ASN B  1 317 ? 22.632  19.522  -33.800 1.00 70.03  ?  317  ASN B CA  1 
ATOM   6583 C  C   . ASN B  1 317 ? 23.087  20.872  -34.329 1.00 74.18  ?  317  ASN B C   1 
ATOM   6584 O  O   . ASN B  1 317 ? 23.345  21.794  -33.556 1.00 80.89  ?  317  ASN B O   1 
ATOM   6585 C  CB  . ASN B  1 317 ? 23.843  18.792  -33.198 1.00 68.87  ?  317  ASN B CB  1 
ATOM   6586 C  CG  . ASN B  1 317 ? 23.458  17.742  -32.159 1.00 66.04  ?  317  ASN B CG  1 
ATOM   6587 O  OD1 . ASN B  1 317 ? 22.279  17.471  -31.926 1.00 67.67  ?  317  ASN B OD1 1 
ATOM   6588 N  ND2 . ASN B  1 317 ? 24.464  17.137  -31.540 1.00 64.96  ?  317  ASN B ND2 1 
ATOM   6589 N  N   . THR B  1 318 ? 23.187  20.982  -35.650 1.00 64.89  ?  318  THR B N   1 
ATOM   6590 C  CA  . THR B  1 318 ? 23.802  22.152  -36.264 1.00 67.83  ?  318  THR B CA  1 
ATOM   6591 C  C   . THR B  1 318 ? 22.953  22.778  -37.360 1.00 66.78  ?  318  THR B C   1 
ATOM   6592 O  O   . THR B  1 318 ? 23.207  23.911  -37.770 1.00 66.45  ?  318  THR B O   1 
ATOM   6593 C  CB  . THR B  1 318 ? 25.162  21.796  -36.895 1.00 75.01  ?  318  THR B CB  1 
ATOM   6594 O  OG1 . THR B  1 318 ? 24.965  20.846  -37.954 1.00 69.43  ?  318  THR B OG1 1 
ATOM   6595 C  CG2 . THR B  1 318 ? 26.115  21.219  -35.852 1.00 73.04  ?  318  THR B CG2 1 
ATOM   6596 N  N   . GLY B  1 319 ? 21.963  22.036  -37.847 1.00 64.60  ?  319  GLY B N   1 
ATOM   6597 C  CA  . GLY B  1 319 ? 21.139  22.506  -38.946 1.00 69.41  ?  319  GLY B CA  1 
ATOM   6598 C  C   . GLY B  1 319 ? 20.341  23.759  -38.631 1.00 72.37  ?  319  GLY B C   1 
ATOM   6599 O  O   . GLY B  1 319 ? 20.086  24.070  -37.465 1.00 67.95  ?  319  GLY B O   1 
ATOM   6600 N  N   . ASP B  1 320 ? 19.949  24.488  -39.673 1.00 77.30  ?  320  ASP B N   1 
ATOM   6601 C  CA  . ASP B  1 320 ? 19.057  25.631  -39.504 1.00 76.94  ?  320  ASP B CA  1 
ATOM   6602 C  C   . ASP B  1 320 ? 17.638  25.311  -39.996 1.00 71.50  ?  320  ASP B C   1 
ATOM   6603 O  O   . ASP B  1 320 ? 17.396  25.131  -41.198 1.00 63.64  ?  320  ASP B O   1 
ATOM   6604 C  CB  . ASP B  1 320 ? 19.616  26.875  -40.193 1.00 80.70  ?  320  ASP B CB  1 
ATOM   6605 C  CG  . ASP B  1 320 ? 18.754  28.097  -39.962 1.00 87.22  ?  320  ASP B CG  1 
ATOM   6606 O  OD1 . ASP B  1 320 ? 18.025  28.118  -38.947 1.00 86.43  ?  320  ASP B OD1 1 
ATOM   6607 O  OD2 . ASP B  1 320 ? 18.802  29.033  -40.789 1.00 91.78  ?  320  ASP B OD2 1 
ATOM   6608 N  N   . PHE B  1 321 ? 16.703  25.246  -39.050 1.00 65.33  ?  321  PHE B N   1 
ATOM   6609 C  CA  . PHE B  1 321 ? 15.347  24.812  -39.353 1.00 59.79  ?  321  PHE B CA  1 
ATOM   6610 C  C   . PHE B  1 321 ? 14.294  25.921  -39.251 1.00 65.80  ?  321  PHE B C   1 
ATOM   6611 O  O   . PHE B  1 321 ? 13.126  25.630  -38.985 1.00 63.61  ?  321  PHE B O   1 
ATOM   6612 C  CB  . PHE B  1 321 ? 14.956  23.639  -38.450 1.00 57.37  ?  321  PHE B CB  1 
ATOM   6613 C  CG  . PHE B  1 321 ? 15.890  22.463  -38.538 1.00 61.92  ?  321  PHE B CG  1 
ATOM   6614 C  CD1 . PHE B  1 321 ? 15.871  21.624  -39.641 1.00 64.77  ?  321  PHE B CD1 1 
ATOM   6615 C  CD2 . PHE B  1 321 ? 16.781  22.189  -37.514 1.00 66.30  ?  321  PHE B CD2 1 
ATOM   6616 C  CE1 . PHE B  1 321 ? 16.730  20.538  -39.725 1.00 63.90  ?  321  PHE B CE1 1 
ATOM   6617 C  CE2 . PHE B  1 321 ? 17.639  21.101  -37.592 1.00 67.59  ?  321  PHE B CE2 1 
ATOM   6618 C  CZ  . PHE B  1 321 ? 17.612  20.276  -38.699 1.00 62.42  ?  321  PHE B CZ  1 
ATOM   6619 N  N   . GLN B  1 322 ? 14.704  27.170  -39.495 1.00 72.15  ?  322  GLN B N   1 
ATOM   6620 C  CA  . GLN B  1 322 ? 13.838  28.347  -39.329 1.00 76.77  ?  322  GLN B CA  1 
ATOM   6621 C  C   . GLN B  1 322 ? 12.422  28.204  -39.884 1.00 81.83  ?  322  GLN B C   1 
ATOM   6622 O  O   . GLN B  1 322 ? 11.448  28.387  -39.157 1.00 93.08  ?  322  GLN B O   1 
ATOM   6623 C  CB  . GLN B  1 322 ? 14.484  29.601  -39.928 1.00 88.96  ?  322  GLN B CB  1 
ATOM   6624 C  CG  . GLN B  1 322 ? 15.630  30.201  -39.120 1.00 104.11 ?  322  GLN B CG  1 
ATOM   6625 C  CD  . GLN B  1 322 ? 15.165  31.074  -37.962 1.00 115.50 ?  322  GLN B CD  1 
ATOM   6626 O  OE1 . GLN B  1 322 ? 14.156  30.790  -37.311 1.00 117.52 ?  322  GLN B OE1 1 
ATOM   6627 N  NE2 . GLN B  1 322 ? 15.909  32.146  -37.699 1.00 118.17 ?  322  GLN B NE2 1 
ATOM   6628 N  N   . ASP B  1 323 ? 12.297  27.871  -41.162 1.00 80.84  ?  323  ASP B N   1 
ATOM   6629 C  CA  . ASP B  1 323 ? 10.976  27.874  -41.791 1.00 88.90  ?  323  ASP B CA  1 
ATOM   6630 C  C   . ASP B  1 323 ? 10.328  26.499  -41.872 1.00 82.19  ?  323  ASP B C   1 
ATOM   6631 O  O   . ASP B  1 323 ? 9.543   26.228  -42.778 1.00 87.49  ?  323  ASP B O   1 
ATOM   6632 C  CB  . ASP B  1 323 ? 11.025  28.528  -43.177 1.00 98.20  ?  323  ASP B CB  1 
ATOM   6633 C  CG  . ASP B  1 323 ? 11.047  30.048  -43.106 1.00 105.35 ?  323  ASP B CG  1 
ATOM   6634 O  OD1 . ASP B  1 323 ? 10.552  30.610  -42.101 1.00 106.78 ?  323  ASP B OD1 1 
ATOM   6635 O  OD2 . ASP B  1 323 ? 11.557  30.680  -44.058 1.00 106.94 ?  323  ASP B OD2 1 
ATOM   6636 N  N   . LEU B  1 324 ? 10.640  25.643  -40.911 1.00 70.09  ?  324  LEU B N   1 
ATOM   6637 C  CA  . LEU B  1 324 ? 10.106  24.294  -40.906 1.00 56.96  ?  324  LEU B CA  1 
ATOM   6638 C  C   . LEU B  1 324 ? 8.975   24.127  -39.883 1.00 55.74  ?  324  LEU B C   1 
ATOM   6639 O  O   . LEU B  1 324 ? 9.004   24.725  -38.813 1.00 59.54  ?  324  LEU B O   1 
ATOM   6640 C  CB  . LEU B  1 324 ? 11.230  23.299  -40.624 1.00 50.71  ?  324  LEU B CB  1 
ATOM   6641 C  CG  . LEU B  1 324 ? 10.820  21.850  -40.878 1.00 56.02  ?  324  LEU B CG  1 
ATOM   6642 C  CD1 . LEU B  1 324 ? 10.153  21.751  -42.248 1.00 60.38  ?  324  LEU B CD1 1 
ATOM   6643 C  CD2 . LEU B  1 324 ? 12.003  20.908  -40.789 1.00 53.95  ?  324  LEU B CD2 1 
ATOM   6644 N  N   . GLN B  1 325 ? 7.974   23.321  -40.225 1.00 49.77  ?  325  GLN B N   1 
ATOM   6645 C  CA  . GLN B  1 325 ? 6.923   22.959  -39.284 1.00 41.52  ?  325  GLN B CA  1 
ATOM   6646 C  C   . GLN B  1 325 ? 6.815   21.445  -39.174 1.00 42.92  ?  325  GLN B C   1 
ATOM   6647 O  O   . GLN B  1 325 ? 6.684   20.742  -40.177 1.00 43.51  ?  325  GLN B O   1 
ATOM   6648 C  CB  . GLN B  1 325 ? 5.589   23.543  -39.711 1.00 45.31  ?  325  GLN B CB  1 
ATOM   6649 C  CG  . GLN B  1 325 ? 5.560   25.049  -39.732 1.00 51.55  ?  325  GLN B CG  1 
ATOM   6650 C  CD  . GLN B  1 325 ? 4.968   25.570  -41.015 1.00 58.96  ?  325  GLN B CD  1 
ATOM   6651 O  OE1 . GLN B  1 325 ? 5.012   24.894  -42.036 1.00 53.84  ?  325  GLN B OE1 1 
ATOM   6652 N  NE2 . GLN B  1 325 ? 4.401   26.770  -40.972 1.00 67.08  ?  325  GLN B NE2 1 
ATOM   6653 N  N   . VAL B  1 326 ? 6.886   20.936  -37.951 1.00 47.25  ?  326  VAL B N   1 
ATOM   6654 C  CA  . VAL B  1 326 ? 6.942   19.497  -37.767 1.00 47.98  ?  326  VAL B CA  1 
ATOM   6655 C  C   . VAL B  1 326 ? 6.010   19.032  -36.673 1.00 41.40  ?  326  VAL B C   1 
ATOM   6656 O  O   . VAL B  1 326 ? 5.839   19.701  -35.670 1.00 52.91  ?  326  VAL B O   1 
ATOM   6657 C  CB  . VAL B  1 326 ? 8.367   19.009  -37.416 1.00 54.15  ?  326  VAL B CB  1 
ATOM   6658 C  CG1 . VAL B  1 326 ? 8.474   17.526  -37.659 1.00 55.71  ?  326  VAL B CG1 1 
ATOM   6659 C  CG2 . VAL B  1 326 ? 9.421   19.737  -38.236 1.00 49.06  ?  326  VAL B CG2 1 
ATOM   6660 N  N   . LEU B  1 327 ? 5.425   17.864  -36.877 1.00 37.98  ?  327  LEU B N   1 
ATOM   6661 C  CA  . LEU B  1 327 ? 4.552   17.241  -35.906 1.00 39.50  ?  327  LEU B CA  1 
ATOM   6662 C  C   . LEU B  1 327 ? 5.145   15.872  -35.582 1.00 44.11  ?  327  LEU B C   1 
ATOM   6663 O  O   . LEU B  1 327 ? 5.375   15.052  -36.481 1.00 40.69  ?  327  LEU B O   1 
ATOM   6664 C  CB  . LEU B  1 327 ? 3.141   17.120  -36.476 1.00 40.30  ?  327  LEU B CB  1 
ATOM   6665 C  CG  . LEU B  1 327 ? 2.193   16.133  -35.802 1.00 47.94  ?  327  LEU B CG  1 
ATOM   6666 C  CD1 . LEU B  1 327 ? 2.011   16.488  -34.361 1.00 48.36  ?  327  LEU B CD1 1 
ATOM   6667 C  CD2 . LEU B  1 327 ? 0.863   16.131  -36.529 1.00 50.52  ?  327  LEU B CD2 1 
ATOM   6668 N  N   . VAL B  1 328 ? 5.423   15.639  -34.302 1.00 36.46  ?  328  VAL B N   1 
ATOM   6669 C  CA  . VAL B  1 328 ? 6.161   14.453  -33.902 1.00 33.07  ?  328  VAL B CA  1 
ATOM   6670 C  C   . VAL B  1 328 ? 5.519   13.801  -32.701 1.00 42.03  ?  328  VAL B C   1 
ATOM   6671 O  O   . VAL B  1 328 ? 4.884   14.468  -31.872 1.00 47.57  ?  328  VAL B O   1 
ATOM   6672 C  CB  . VAL B  1 328 ? 7.611   14.788  -33.521 1.00 37.88  ?  328  VAL B CB  1 
ATOM   6673 C  CG1 . VAL B  1 328 ? 8.344   15.378  -34.694 1.00 53.94  ?  328  VAL B CG1 1 
ATOM   6674 C  CG2 . VAL B  1 328 ? 7.643   15.756  -32.366 1.00 47.98  ?  328  VAL B CG2 1 
ATOM   6675 N  N   . GLY B  1 329 ? 5.693   12.494  -32.581 1.00 34.20  ?  329  GLY B N   1 
ATOM   6676 C  CA  . GLY B  1 329 ? 5.059   11.812  -31.483 1.00 34.69  ?  329  GLY B CA  1 
ATOM   6677 C  C   . GLY B  1 329 ? 5.350   10.345  -31.391 1.00 37.83  ?  329  GLY B C   1 
ATOM   6678 O  O   . GLY B  1 329 ? 6.037   9.774   -32.236 1.00 41.10  ?  329  GLY B O   1 
ATOM   6679 N  N   . VAL B  1 330 ? 4.811   9.739   -30.339 1.00 37.69  ?  330  VAL B N   1 
ATOM   6680 C  CA  . VAL B  1 330 ? 5.042   8.345   -30.030 1.00 35.00  ?  330  VAL B CA  1 
ATOM   6681 C  C   . VAL B  1 330 ? 3.746   7.756   -29.481 1.00 42.75  ?  330  VAL B C   1 
ATOM   6682 O  O   . VAL B  1 330 ? 2.866   8.489   -29.026 1.00 44.41  ?  330  VAL B O   1 
ATOM   6683 C  CB  . VAL B  1 330 ? 6.153   8.194   -28.957 1.00 41.18  ?  330  VAL B CB  1 
ATOM   6684 C  CG1 . VAL B  1 330 ? 7.404   8.973   -29.341 1.00 32.79  ?  330  VAL B CG1 1 
ATOM   6685 C  CG2 . VAL B  1 330 ? 5.656   8.666   -27.586 1.00 42.60  ?  330  VAL B CG2 1 
ATOM   6686 N  N   . VAL B  1 331 ? 3.634   6.432   -29.535 1.00 42.61  ?  331  VAL B N   1 
ATOM   6687 C  CA  . VAL B  1 331 ? 2.566   5.713   -28.855 1.00 38.37  ?  331  VAL B CA  1 
ATOM   6688 C  C   . VAL B  1 331 ? 3.011   5.376   -27.434 1.00 49.69  ?  331  VAL B C   1 
ATOM   6689 O  O   . VAL B  1 331 ? 4.197   5.498   -27.088 1.00 45.58  ?  331  VAL B O   1 
ATOM   6690 C  CB  . VAL B  1 331 ? 2.188   4.405   -29.597 1.00 44.91  ?  331  VAL B CB  1 
ATOM   6691 C  CG1 . VAL B  1 331 ? 1.787   4.700   -31.039 1.00 42.66  ?  331  VAL B CG1 1 
ATOM   6692 C  CG2 . VAL B  1 331 ? 3.334   3.405   -29.560 1.00 29.93  ?  331  VAL B CG2 1 
ATOM   6693 N  N   . LYS B  1 332 ? 2.062   4.937   -26.614 1.00 54.97  ?  332  LYS B N   1 
ATOM   6694 C  CA  . LYS B  1 332 ? 2.310   4.739   -25.188 1.00 51.28  ?  332  LYS B CA  1 
ATOM   6695 C  C   . LYS B  1 332 ? 3.304   3.620   -24.899 1.00 52.71  ?  332  LYS B C   1 
ATOM   6696 O  O   . LYS B  1 332 ? 4.113   3.724   -23.979 1.00 55.65  ?  332  LYS B O   1 
ATOM   6697 C  CB  . LYS B  1 332 ? 0.995   4.467   -24.446 1.00 54.88  ?  332  LYS B CB  1 
ATOM   6698 C  CG  . LYS B  1 332 ? 1.143   4.394   -22.928 1.00 52.16  ?  332  LYS B CG  1 
ATOM   6699 C  CD  . LYS B  1 332 ? -0.184  4.095   -22.241 1.00 61.08  ?  332  LYS B CD  1 
ATOM   6700 C  CE  . LYS B  1 332 ? 0.005   4.078   -20.730 1.00 73.67  ?  332  LYS B CE  1 
ATOM   6701 N  NZ  . LYS B  1 332 ? -1.150  3.460   -20.020 1.00 82.95  ?  332  LYS B NZ  1 
ATOM   6702 N  N   . ASP B  1 333 ? 3.246   2.549   -25.681 1.00 50.39  ?  333  ASP B N   1 
ATOM   6703 C  CA  . ASP B  1 333 ? 4.064   1.370   -25.405 1.00 46.80  ?  333  ASP B CA  1 
ATOM   6704 C  C   . ASP B  1 333 ? 4.973   1.001   -26.569 1.00 46.69  ?  333  ASP B C   1 
ATOM   6705 O  O   . ASP B  1 333 ? 4.860   -0.076  -27.146 1.00 53.05  ?  333  ASP B O   1 
ATOM   6706 C  CB  . ASP B  1 333 ? 3.178   0.191   -25.005 1.00 39.73  ?  333  ASP B CB  1 
ATOM   6707 C  CG  . ASP B  1 333 ? 2.440   0.439   -23.692 1.00 56.69  ?  333  ASP B CG  1 
ATOM   6708 O  OD1 . ASP B  1 333 ? 3.034   0.189   -22.605 1.00 55.35  ?  333  ASP B OD1 1 
ATOM   6709 O  OD2 . ASP B  1 333 ? 1.270   0.889   -23.751 1.00 53.66  ?  333  ASP B OD2 1 
ATOM   6710 N  N   . GLU B  1 334 ? 5.885   1.909   -26.889 1.00 46.04  ?  334  GLU B N   1 
ATOM   6711 C  CA  . GLU B  1 334 ? 6.771   1.773   -28.045 1.00 43.58  ?  334  GLU B CA  1 
ATOM   6712 C  C   . GLU B  1 334 ? 7.507   0.430   -28.160 1.00 49.37  ?  334  GLU B C   1 
ATOM   6713 O  O   . GLU B  1 334 ? 7.525   -0.168  -29.226 1.00 59.30  ?  334  GLU B O   1 
ATOM   6714 C  CB  . GLU B  1 334 ? 7.760   2.946   -28.090 1.00 29.51  ?  334  GLU B CB  1 
ATOM   6715 C  CG  . GLU B  1 334 ? 7.138   4.286   -28.533 1.00 38.13  ?  334  GLU B CG  1 
ATOM   6716 C  CD  . GLU B  1 334 ? 6.648   4.291   -29.993 1.00 48.96  ?  334  GLU B CD  1 
ATOM   6717 O  OE1 . GLU B  1 334 ? 7.085   3.423   -30.775 1.00 52.36  ?  334  GLU B OE1 1 
ATOM   6718 O  OE2 . GLU B  1 334 ? 5.825   5.166   -30.362 1.00 47.66  ?  334  GLU B OE2 1 
ATOM   6719 N  N   . GLY B  1 335 ? 8.082   -0.064  -27.069 1.00 47.87  ?  335  GLY B N   1 
ATOM   6720 C  CA  . GLY B  1 335 ? 8.923   -1.250  -27.155 1.00 48.03  ?  335  GLY B CA  1 
ATOM   6721 C  C   . GLY B  1 335 ? 8.262   -2.621  -27.078 1.00 48.04  ?  335  GLY B C   1 
ATOM   6722 O  O   . GLY B  1 335 ? 8.881   -3.632  -27.424 1.00 48.00  ?  335  GLY B O   1 
ATOM   6723 N  N   . SER B  1 336 ? 7.008   -2.663  -26.635 1.00 44.72  ?  336  SER B N   1 
ATOM   6724 C  CA  . SER B  1 336 ? 6.347   -3.926  -26.312 1.00 47.50  ?  336  SER B CA  1 
ATOM   6725 C  C   . SER B  1 336 ? 6.305   -4.947  -27.455 1.00 52.62  ?  336  SER B C   1 
ATOM   6726 O  O   . SER B  1 336 ? 6.551   -6.142  -27.243 1.00 50.96  ?  336  SER B O   1 
ATOM   6727 C  CB  . SER B  1 336 ? 4.933   -3.662  -25.792 1.00 54.13  ?  336  SER B CB  1 
ATOM   6728 O  OG  . SER B  1 336 ? 4.073   -3.256  -26.837 1.00 58.01  ?  336  SER B OG  1 
ATOM   6729 N  N   . TYR B  1 337 ? 5.994   -4.468  -28.659 1.00 52.91  ?  337  TYR B N   1 
ATOM   6730 C  CA  . TYR B  1 337 ? 5.871   -5.311  -29.847 1.00 46.70  ?  337  TYR B CA  1 
ATOM   6731 C  C   . TYR B  1 337 ? 7.144   -6.118  -30.099 1.00 47.83  ?  337  TYR B C   1 
ATOM   6732 O  O   . TYR B  1 337 ? 7.084   -7.291  -30.467 1.00 48.71  ?  337  TYR B O   1 
ATOM   6733 C  CB  . TYR B  1 337 ? 5.567   -4.426  -31.062 1.00 50.55  ?  337  TYR B CB  1 
ATOM   6734 C  CG  . TYR B  1 337 ? 5.148   -5.143  -32.335 1.00 49.85  ?  337  TYR B CG  1 
ATOM   6735 C  CD1 . TYR B  1 337 ? 6.088   -5.729  -33.181 1.00 52.66  ?  337  TYR B CD1 1 
ATOM   6736 C  CD2 . TYR B  1 337 ? 3.811   -5.205  -32.704 1.00 49.87  ?  337  TYR B CD2 1 
ATOM   6737 C  CE1 . TYR B  1 337 ? 5.696   -6.381  -34.353 1.00 47.98  ?  337  TYR B CE1 1 
ATOM   6738 C  CE2 . TYR B  1 337 ? 3.413   -5.846  -33.866 1.00 54.11  ?  337  TYR B CE2 1 
ATOM   6739 C  CZ  . TYR B  1 337 ? 4.355   -6.431  -34.688 1.00 53.12  ?  337  TYR B CZ  1 
ATOM   6740 O  OH  . TYR B  1 337 ? 3.938   -7.062  -35.848 1.00 60.24  ?  337  TYR B OH  1 
ATOM   6741 N  N   . PHE B  1 338 ? 8.291   -5.482  -29.881 1.00 47.43  ?  338  PHE B N   1 
ATOM   6742 C  CA  . PHE B  1 338 ? 9.586   -6.049  -30.245 1.00 48.48  ?  338  PHE B CA  1 
ATOM   6743 C  C   . PHE B  1 338 ? 10.058  -7.172  -29.351 1.00 50.38  ?  338  PHE B C   1 
ATOM   6744 O  O   . PHE B  1 338 ? 10.870  -7.993  -29.773 1.00 47.85  ?  338  PHE B O   1 
ATOM   6745 C  CB  . PHE B  1 338 ? 10.643  -4.954  -30.255 1.00 52.36  ?  338  PHE B CB  1 
ATOM   6746 C  CG  . PHE B  1 338 ? 10.379  -3.898  -31.261 1.00 56.17  ?  338  PHE B CG  1 
ATOM   6747 C  CD1 . PHE B  1 338 ? 10.810  -4.055  -32.567 1.00 63.17  ?  338  PHE B CD1 1 
ATOM   6748 C  CD2 . PHE B  1 338 ? 9.670   -2.762  -30.915 1.00 55.40  ?  338  PHE B CD2 1 
ATOM   6749 C  CE1 . PHE B  1 338 ? 10.557  -3.085  -33.516 1.00 60.44  ?  338  PHE B CE1 1 
ATOM   6750 C  CE2 . PHE B  1 338 ? 9.403   -1.796  -31.850 1.00 60.42  ?  338  PHE B CE2 1 
ATOM   6751 C  CZ  . PHE B  1 338 ? 9.849   -1.957  -33.160 1.00 65.73  ?  338  PHE B CZ  1 
ATOM   6752 N  N   . LEU B  1 339 ? 9.562   -7.205  -28.117 1.00 49.54  ?  339  LEU B N   1 
ATOM   6753 C  CA  . LEU B  1 339 ? 10.078  -8.142  -27.131 1.00 48.51  ?  339  LEU B CA  1 
ATOM   6754 C  C   . LEU B  1 339 ? 9.797   -9.583  -27.526 1.00 52.15  ?  339  LEU B C   1 
ATOM   6755 O  O   . LEU B  1 339 ? 10.625  -10.464 -27.313 1.00 57.99  ?  339  LEU B O   1 
ATOM   6756 C  CB  . LEU B  1 339 ? 9.507   -7.844  -25.741 1.00 49.91  ?  339  LEU B CB  1 
ATOM   6757 C  CG  . LEU B  1 339 ? 9.683   -6.398  -25.288 1.00 51.30  ?  339  LEU B CG  1 
ATOM   6758 C  CD1 . LEU B  1 339 ? 9.065   -6.182  -23.911 1.00 58.25  ?  339  LEU B CD1 1 
ATOM   6759 C  CD2 . LEU B  1 339 ? 11.152  -6.021  -25.300 1.00 38.92  ?  339  LEU B CD2 1 
ATOM   6760 N  N   . VAL B  1 340 ? 8.633   -9.821  -28.117 1.00 53.36  ?  340  VAL B N   1 
ATOM   6761 C  CA  . VAL B  1 340 ? 8.252   -11.177 -28.502 1.00 62.31  ?  340  VAL B CA  1 
ATOM   6762 C  C   . VAL B  1 340 ? 9.114   -11.689 -29.653 1.00 61.47  ?  340  VAL B C   1 
ATOM   6763 O  O   . VAL B  1 340 ? 9.056   -12.869 -30.015 1.00 62.02  ?  340  VAL B O   1 
ATOM   6764 C  CB  . VAL B  1 340 ? 6.764   -11.254 -28.898 1.00 62.30  ?  340  VAL B CB  1 
ATOM   6765 C  CG1 . VAL B  1 340 ? 5.905   -10.739 -27.771 1.00 59.89  ?  340  VAL B CG1 1 
ATOM   6766 C  CG2 . VAL B  1 340 ? 6.504   -10.450 -30.165 1.00 57.02  ?  340  VAL B CG2 1 
ATOM   6767 N  N   . TYR B  1 341 ? 9.923   -10.792 -30.210 1.00 56.64  ?  341  TYR B N   1 
ATOM   6768 C  CA  . TYR B  1 341 ? 10.718  -11.083 -31.397 1.00 61.13  ?  341  TYR B CA  1 
ATOM   6769 C  C   . TYR B  1 341 ? 12.193  -11.349 -31.104 1.00 69.35  ?  341  TYR B C   1 
ATOM   6770 O  O   . TYR B  1 341 ? 13.022  -11.302 -32.010 1.00 72.75  ?  341  TYR B O   1 
ATOM   6771 C  CB  . TYR B  1 341 ? 10.579  -9.944  -32.422 1.00 56.42  ?  341  TYR B CB  1 
ATOM   6772 C  CG  . TYR B  1 341 ? 9.371   -10.082 -33.326 1.00 51.37  ?  341  TYR B CG  1 
ATOM   6773 C  CD1 . TYR B  1 341 ? 9.366   -11.004 -34.366 1.00 54.79  ?  341  TYR B CD1 1 
ATOM   6774 C  CD2 . TYR B  1 341 ? 8.231   -9.306  -33.135 1.00 48.11  ?  341  TYR B CD2 1 
ATOM   6775 C  CE1 . TYR B  1 341 ? 8.263   -11.148 -35.199 1.00 57.25  ?  341  TYR B CE1 1 
ATOM   6776 C  CE2 . TYR B  1 341 ? 7.113   -9.449  -33.968 1.00 52.39  ?  341  TYR B CE2 1 
ATOM   6777 C  CZ  . TYR B  1 341 ? 7.143   -10.371 -35.001 1.00 53.99  ?  341  TYR B CZ  1 
ATOM   6778 O  OH  . TYR B  1 341 ? 6.062   -10.536 -35.841 1.00 56.79  ?  341  TYR B OH  1 
ATOM   6779 N  N   . GLY B  1 342 ? 12.529  -11.630 -29.849 1.00 72.61  ?  342  GLY B N   1 
ATOM   6780 C  CA  . GLY B  1 342 ? 13.910  -11.938 -29.516 1.00 71.27  ?  342  GLY B CA  1 
ATOM   6781 C  C   . GLY B  1 342 ? 14.247  -12.105 -28.047 1.00 69.67  ?  342  GLY B C   1 
ATOM   6782 O  O   . GLY B  1 342 ? 15.202  -12.804 -27.704 1.00 78.46  ?  342  GLY B O   1 
ATOM   6783 N  N   . VAL B  1 343 ? 13.479  -11.460 -27.178 1.00 56.43  ?  343  VAL B N   1 
ATOM   6784 C  CA  . VAL B  1 343 ? 13.779  -11.483 -25.754 1.00 56.30  ?  343  VAL B CA  1 
ATOM   6785 C  C   . VAL B  1 343 ? 13.162  -12.695 -25.071 1.00 55.84  ?  343  VAL B C   1 
ATOM   6786 O  O   . VAL B  1 343 ? 11.940  -12.802 -24.989 1.00 58.95  ?  343  VAL B O   1 
ATOM   6787 C  CB  . VAL B  1 343 ? 13.287  -10.210 -25.052 1.00 51.15  ?  343  VAL B CB  1 
ATOM   6788 C  CG1 . VAL B  1 343 ? 13.808  -10.179 -23.615 1.00 50.16  ?  343  VAL B CG1 1 
ATOM   6789 C  CG2 . VAL B  1 343 ? 13.738  -8.980  -25.823 1.00 43.60  ?  343  VAL B CG2 1 
ATOM   6790 N  N   . PRO B  1 344 ? 14.006  -13.612 -24.574 1.00 57.06  ?  344  PRO B N   1 
ATOM   6791 C  CA  . PRO B  1 344 ? 13.467  -14.821 -23.937 1.00 64.13  ?  344  PRO B CA  1 
ATOM   6792 C  C   . PRO B  1 344 ? 12.519  -14.447 -22.803 1.00 66.91  ?  344  PRO B C   1 
ATOM   6793 O  O   . PRO B  1 344 ? 12.807  -13.507 -22.056 1.00 60.50  ?  344  PRO B O   1 
ATOM   6794 C  CB  . PRO B  1 344 ? 14.717  -15.525 -23.389 1.00 54.63  ?  344  PRO B CB  1 
ATOM   6795 C  CG  . PRO B  1 344 ? 15.851  -15.001 -24.220 1.00 54.16  ?  344  PRO B CG  1 
ATOM   6796 C  CD  . PRO B  1 344 ? 15.478  -13.564 -24.521 1.00 53.98  ?  344  PRO B CD  1 
ATOM   6797 N  N   . GLY B  1 345 ? 11.392  -15.151 -22.715 1.00 68.38  ?  345  GLY B N   1 
ATOM   6798 C  CA  . GLY B  1 345 ? 10.383  -14.872 -21.713 1.00 66.07  ?  345  GLY B CA  1 
ATOM   6799 C  C   . GLY B  1 345 ? 9.116   -14.240 -22.263 1.00 71.15  ?  345  GLY B C   1 
ATOM   6800 O  O   . GLY B  1 345 ? 8.048   -14.338 -21.656 1.00 80.53  ?  345  GLY B O   1 
ATOM   6801 N  N   . PHE B  1 346 ? 9.220   -13.593 -23.418 1.00 64.95  ?  346  PHE B N   1 
ATOM   6802 C  CA  . PHE B  1 346 ? 8.079   -12.870 -23.969 1.00 63.77  ?  346  PHE B CA  1 
ATOM   6803 C  C   . PHE B  1 346 ? 7.327   -13.614 -25.077 1.00 68.62  ?  346  PHE B C   1 
ATOM   6804 O  O   . PHE B  1 346 ? 7.918   -14.331 -25.883 1.00 65.74  ?  346  PHE B O   1 
ATOM   6805 C  CB  . PHE B  1 346 ? 8.505   -11.486 -24.446 1.00 58.96  ?  346  PHE B CB  1 
ATOM   6806 C  CG  . PHE B  1 346 ? 8.988   -10.599 -23.344 1.00 58.88  ?  346  PHE B CG  1 
ATOM   6807 C  CD1 . PHE B  1 346 ? 10.260  -10.752 -22.822 1.00 52.94  ?  346  PHE B CD1 1 
ATOM   6808 C  CD2 . PHE B  1 346 ? 8.168   -9.611  -22.824 1.00 61.78  ?  346  PHE B CD2 1 
ATOM   6809 C  CE1 . PHE B  1 346 ? 10.706  -9.937  -21.812 1.00 51.30  ?  346  PHE B CE1 1 
ATOM   6810 C  CE2 . PHE B  1 346 ? 8.613   -8.790  -21.806 1.00 53.67  ?  346  PHE B CE2 1 
ATOM   6811 C  CZ  . PHE B  1 346 ? 9.881   -8.951  -21.307 1.00 52.88  ?  346  PHE B CZ  1 
ATOM   6812 N  N   . SER B  1 347 ? 6.011   -13.416 -25.094 1.00 65.80  ?  347  SER B N   1 
ATOM   6813 C  CA  . SER B  1 347 ? 5.109   -14.086 -26.012 1.00 60.66  ?  347  SER B CA  1 
ATOM   6814 C  C   . SER B  1 347 ? 3.795   -13.320 -26.016 1.00 64.72  ?  347  SER B C   1 
ATOM   6815 O  O   . SER B  1 347 ? 3.483   -12.627 -25.051 1.00 66.39  ?  347  SER B O   1 
ATOM   6816 C  CB  . SER B  1 347 ? 4.864   -15.525 -25.556 1.00 61.90  ?  347  SER B CB  1 
ATOM   6817 O  OG  . SER B  1 347 ? 3.808   -16.126 -26.293 1.00 66.21  ?  347  SER B OG  1 
ATOM   6818 N  N   . LYS B  1 348 ? 3.032   -13.432 -27.100 1.00 62.17  ?  348  LYS B N   1 
ATOM   6819 C  CA  . LYS B  1 348 ? 1.708   -12.829 -27.152 1.00 55.24  ?  348  LYS B CA  1 
ATOM   6820 C  C   . LYS B  1 348 ? 0.695   -13.773 -26.527 1.00 63.60  ?  348  LYS B C   1 
ATOM   6821 O  O   . LYS B  1 348 ? -0.444  -13.391 -26.260 1.00 69.90  ?  348  LYS B O   1 
ATOM   6822 C  CB  . LYS B  1 348 ? 1.289   -12.545 -28.591 1.00 50.00  ?  348  LYS B CB  1 
ATOM   6823 C  CG  . LYS B  1 348 ? 0.778   -13.778 -29.330 1.00 55.78  ?  348  LYS B CG  1 
ATOM   6824 C  CD  . LYS B  1 348 ? -0.195  -13.394 -30.421 1.00 54.76  ?  348  LYS B CD  1 
ATOM   6825 C  CE  . LYS B  1 348 ? -0.408  -14.535 -31.406 1.00 59.13  ?  348  LYS B CE  1 
ATOM   6826 N  NZ  . LYS B  1 348 ? -1.284  -15.623 -30.895 1.00 64.27  ?  348  LYS B NZ  1 
ATOM   6827 N  N   . ASP B  1 349 ? 1.108   -15.014 -26.305 1.00 65.04  ?  349  ASP B N   1 
ATOM   6828 C  CA  . ASP B  1 349 ? 0.188   -16.026 -25.804 1.00 69.73  ?  349  ASP B CA  1 
ATOM   6829 C  C   . ASP B  1 349 ? 0.184   -16.169 -24.275 1.00 70.06  ?  349  ASP B C   1 
ATOM   6830 O  O   . ASP B  1 349 ? -0.534  -17.015 -23.734 1.00 73.71  ?  349  ASP B O   1 
ATOM   6831 C  CB  . ASP B  1 349 ? 0.442   -17.365 -26.500 1.00 74.27  ?  349  ASP B CB  1 
ATOM   6832 C  CG  . ASP B  1 349 ? 0.181   -17.296 -28.002 1.00 78.00  ?  349  ASP B CG  1 
ATOM   6833 O  OD1 . ASP B  1 349 ? -0.869  -16.738 -28.393 1.00 79.94  ?  349  ASP B OD1 1 
ATOM   6834 O  OD2 . ASP B  1 349 ? 1.027   -17.785 -28.788 1.00 72.39  ?  349  ASP B OD2 1 
ATOM   6835 N  N   . ASN B  1 350 ? 0.976   -15.345 -23.585 1.00 63.78  ?  350  ASN B N   1 
ATOM   6836 C  CA  . ASN B  1 350 ? 0.907   -15.263 -22.119 1.00 67.66  ?  350  ASN B CA  1 
ATOM   6837 C  C   . ASN B  1 350 ? 1.270   -13.883 -21.554 1.00 69.53  ?  350  ASN B C   1 
ATOM   6838 O  O   . ASN B  1 350 ? 1.599   -12.955 -22.302 1.00 61.11  ?  350  ASN B O   1 
ATOM   6839 C  CB  . ASN B  1 350 ? 1.682   -16.402 -21.421 1.00 74.32  ?  350  ASN B CB  1 
ATOM   6840 C  CG  . ASN B  1 350 ? 3.166   -16.452 -21.794 1.00 94.86  ?  350  ASN B CG  1 
ATOM   6841 O  OD1 . ASN B  1 350 ? 3.836   -15.421 -21.891 1.00 91.49  ?  350  ASN B OD1 1 
ATOM   6842 N  ND2 . ASN B  1 350 ? 3.685   -17.679 -21.979 1.00 124.00 ?  350  ASN B ND2 1 
ATOM   6843 N  N   . GLU B  1 351 ? 1.205   -13.749 -20.233 1.00 70.56  ?  351  GLU B N   1 
ATOM   6844 C  CA  . GLU B  1 351 ? 1.380   -12.449 -19.598 1.00 62.09  ?  351  GLU B CA  1 
ATOM   6845 C  C   . GLU B  1 351 ? 2.829   -11.986 -19.613 1.00 57.63  ?  351  GLU B C   1 
ATOM   6846 O  O   . GLU B  1 351 ? 3.125   -10.827 -19.291 1.00 51.84  ?  351  GLU B O   1 
ATOM   6847 C  CB  . GLU B  1 351 ? 0.825   -12.467 -18.177 1.00 73.32  ?  351  GLU B CB  1 
ATOM   6848 C  CG  . GLU B  1 351 ? -0.688  -12.554 -18.126 1.00 87.92  ?  351  GLU B CG  1 
ATOM   6849 C  CD  . GLU B  1 351 ? -1.216  -12.822 -16.727 1.00 105.45 ?  351  GLU B CD  1 
ATOM   6850 O  OE1 . GLU B  1 351 ? -0.493  -12.542 -15.742 1.00 105.01 ?  351  GLU B OE1 1 
ATOM   6851 O  OE2 . GLU B  1 351 ? -2.357  -13.322 -16.615 1.00 114.97 ?  351  GLU B OE2 1 
ATOM   6852 N  N   . SER B  1 352 ? 3.724   -12.894 -19.999 1.00 61.06  ?  352  SER B N   1 
ATOM   6853 C  CA  . SER B  1 352 ? 5.150   -12.586 -20.155 1.00 62.29  ?  352  SER B CA  1 
ATOM   6854 C  C   . SER B  1 352 ? 5.781   -12.013 -18.886 1.00 62.29  ?  352  SER B C   1 
ATOM   6855 O  O   . SER B  1 352 ? 6.518   -11.028 -18.934 1.00 58.32  ?  352  SER B O   1 
ATOM   6856 C  CB  . SER B  1 352 ? 5.374   -11.633 -21.327 1.00 52.38  ?  352  SER B CB  1 
ATOM   6857 O  OG  . SER B  1 352 ? 4.551   -12.001 -22.410 1.00 61.04  ?  352  SER B OG  1 
ATOM   6858 N  N   . LEU B  1 353 ? 5.486   -12.637 -17.754 1.00 63.70  ?  353  LEU B N   1 
ATOM   6859 C  CA  . LEU B  1 353 ? 6.071   -12.214 -16.494 1.00 60.71  ?  353  LEU B CA  1 
ATOM   6860 C  C   . LEU B  1 353 ? 7.490   -12.749 -16.416 1.00 63.90  ?  353  LEU B C   1 
ATOM   6861 O  O   . LEU B  1 353 ? 7.713   -13.949 -16.544 1.00 66.48  ?  353  LEU B O   1 
ATOM   6862 C  CB  . LEU B  1 353 ? 5.233   -12.721 -15.331 1.00 60.48  ?  353  LEU B CB  1 
ATOM   6863 C  CG  . LEU B  1 353 ? 3.809   -12.165 -15.286 1.00 65.47  ?  353  LEU B CG  1 
ATOM   6864 C  CD1 . LEU B  1 353 ? 3.051   -12.747 -14.093 1.00 62.65  ?  353  LEU B CD1 1 
ATOM   6865 C  CD2 . LEU B  1 353 ? 3.823   -10.637 -15.232 1.00 64.09  ?  353  LEU B CD2 1 
ATOM   6866 N  N   . ILE B  1 354 ? 8.453   -11.857 -16.227 1.00 65.59  ?  354  ILE B N   1 
ATOM   6867 C  CA  . ILE B  1 354 ? 9.856   -12.257 -16.258 1.00 67.57  ?  354  ILE B CA  1 
ATOM   6868 C  C   . ILE B  1 354 ? 10.573  -12.156 -14.916 1.00 71.95  ?  354  ILE B C   1 
ATOM   6869 O  O   . ILE B  1 354 ? 10.221  -11.341 -14.064 1.00 74.15  ?  354  ILE B O   1 
ATOM   6870 C  CB  . ILE B  1 354 ? 10.641  -11.449 -17.295 1.00 57.36  ?  354  ILE B CB  1 
ATOM   6871 C  CG1 . ILE B  1 354 ? 10.289  -9.964  -17.174 1.00 52.56  ?  354  ILE B CG1 1 
ATOM   6872 C  CG2 . ILE B  1 354 ? 10.324  -11.961 -18.679 1.00 56.02  ?  354  ILE B CG2 1 
ATOM   6873 C  CD1 . ILE B  1 354 ? 11.169  -9.051  -17.990 1.00 43.95  ?  354  ILE B CD1 1 
ATOM   6874 N  N   . SER B  1 355 ? 11.586  -13.000 -14.743 1.00 72.27  ?  355  SER B N   1 
ATOM   6875 C  CA  . SER B  1 355 ? 12.446  -12.935 -13.575 1.00 74.04  ?  355  SER B CA  1 
ATOM   6876 C  C   . SER B  1 355 ? 13.437  -11.795 -13.750 1.00 68.48  ?  355  SER B C   1 
ATOM   6877 O  O   . SER B  1 355 ? 13.523  -11.189 -14.826 1.00 55.60  ?  355  SER B O   1 
ATOM   6878 C  CB  . SER B  1 355 ? 13.216  -14.243 -13.407 1.00 80.65  ?  355  SER B CB  1 
ATOM   6879 O  OG  . SER B  1 355 ? 14.151  -14.402 -14.460 1.00 84.50  ?  355  SER B OG  1 
ATOM   6880 N  N   . ARG B  1 356 ? 14.190  -11.511 -12.692 1.00 71.17  ?  356  ARG B N   1 
ATOM   6881 C  CA  . ARG B  1 356 ? 15.235  -10.500 -12.754 1.00 67.26  ?  356  ARG B CA  1 
ATOM   6882 C  C   . ARG B  1 356 ? 16.331  -10.908 -13.743 1.00 67.72  ?  356  ARG B C   1 
ATOM   6883 O  O   . ARG B  1 356 ? 16.840  -10.073 -14.501 1.00 66.27  ?  356  ARG B O   1 
ATOM   6884 C  CB  . ARG B  1 356 ? 15.828  -10.258 -11.369 1.00 61.03  ?  356  ARG B CB  1 
ATOM   6885 C  CG  . ARG B  1 356 ? 16.919  -9.221  -11.373 1.00 60.40  ?  356  ARG B CG  1 
ATOM   6886 C  CD  . ARG B  1 356 ? 16.859  -8.336  -10.148 1.00 69.30  ?  356  ARG B CD  1 
ATOM   6887 N  NE  . ARG B  1 356 ? 17.788  -7.219  -10.280 1.00 72.52  ?  356  ARG B NE  1 
ATOM   6888 C  CZ  . ARG B  1 356 ? 17.447  -6.014  -10.723 1.00 63.73  ?  356  ARG B CZ  1 
ATOM   6889 N  NH1 . ARG B  1 356 ? 16.194  -5.765  -11.064 1.00 57.19  ?  356  ARG B NH1 1 
ATOM   6890 N  NH2 . ARG B  1 356 ? 18.358  -5.056  -10.812 1.00 65.17  ?  356  ARG B NH2 1 
ATOM   6891 N  N   . ALA B  1 357 ? 16.667  -12.199 -13.731 1.00 61.65  ?  357  ALA B N   1 
ATOM   6892 C  CA  . ALA B  1 357 ? 17.675  -12.774 -14.617 1.00 62.28  ?  357  ALA B CA  1 
ATOM   6893 C  C   . ALA B  1 357 ? 17.358  -12.506 -16.080 1.00 60.88  ?  357  ALA B C   1 
ATOM   6894 O  O   . ALA B  1 357 ? 18.202  -12.006 -16.817 1.00 60.22  ?  357  ALA B O   1 
ATOM   6895 C  CB  . ALA B  1 357 ? 17.801  -14.268 -14.374 1.00 57.32  ?  357  ALA B CB  1 
ATOM   6896 N  N   . GLN B  1 358 ? 16.133  -12.833 -16.482 1.00 63.58  ?  358  GLN B N   1 
ATOM   6897 C  CA  . GLN B  1 358 ? 15.671  -12.616 -17.846 1.00 61.09  ?  358  GLN B CA  1 
ATOM   6898 C  C   . GLN B  1 358 ? 15.626  -11.139 -18.201 1.00 62.83  ?  358  GLN B C   1 
ATOM   6899 O  O   . GLN B  1 358 ? 15.769  -10.774 -19.369 1.00 65.72  ?  358  GLN B O   1 
ATOM   6900 C  CB  . GLN B  1 358 ? 14.282  -13.222 -18.044 1.00 63.40  ?  358  GLN B CB  1 
ATOM   6901 C  CG  . GLN B  1 358 ? 14.229  -14.734 -17.937 1.00 67.57  ?  358  GLN B CG  1 
ATOM   6902 C  CD  . GLN B  1 358 ? 12.806  -15.259 -17.993 1.00 73.63  ?  358  GLN B CD  1 
ATOM   6903 O  OE1 . GLN B  1 358 ? 11.905  -14.696 -17.376 1.00 79.26  ?  358  GLN B OE1 1 
ATOM   6904 N  NE2 . GLN B  1 358 ? 12.595  -16.337 -18.740 1.00 71.85  ?  358  GLN B NE2 1 
ATOM   6905 N  N   . PHE B  1 359 ? 15.416  -10.289 -17.203 1.00 60.75  ?  359  PHE B N   1 
ATOM   6906 C  CA  . PHE B  1 359 ? 15.417  -8.851  -17.445 1.00 59.51  ?  359  PHE B CA  1 
ATOM   6907 C  C   . PHE B  1 359 ? 16.826  -8.339  -17.735 1.00 60.94  ?  359  PHE B C   1 
ATOM   6908 O  O   . PHE B  1 359 ? 17.012  -7.496  -18.610 1.00 61.97  ?  359  PHE B O   1 
ATOM   6909 C  CB  . PHE B  1 359 ? 14.808  -8.088  -16.272 1.00 64.96  ?  359  PHE B CB  1 
ATOM   6910 C  CG  . PHE B  1 359 ? 14.996  -6.596  -16.357 1.00 60.09  ?  359  PHE B CG  1 
ATOM   6911 C  CD1 . PHE B  1 359 ? 14.490  -5.878  -17.424 1.00 55.15  ?  359  PHE B CD1 1 
ATOM   6912 C  CD2 . PHE B  1 359 ? 15.691  -5.913  -15.377 1.00 59.22  ?  359  PHE B CD2 1 
ATOM   6913 C  CE1 . PHE B  1 359 ? 14.662  -4.501  -17.504 1.00 54.10  ?  359  PHE B CE1 1 
ATOM   6914 C  CE2 . PHE B  1 359 ? 15.865  -4.536  -15.457 1.00 55.12  ?  359  PHE B CE2 1 
ATOM   6915 C  CZ  . PHE B  1 359 ? 15.344  -3.830  -16.517 1.00 48.30  ?  359  PHE B CZ  1 
ATOM   6916 N  N   . LEU B  1 360 ? 17.814  -8.843  -16.998 1.00 59.23  ?  360  LEU B N   1 
ATOM   6917 C  CA  . LEU B  1 360 ? 19.205  -8.475  -17.245 1.00 58.02  ?  360  LEU B CA  1 
ATOM   6918 C  C   . LEU B  1 360 ? 19.600  -8.941  -18.642 1.00 64.42  ?  360  LEU B C   1 
ATOM   6919 O  O   . LEU B  1 360 ? 20.139  -8.172  -19.437 1.00 59.76  ?  360  LEU B O   1 
ATOM   6920 C  CB  . LEU B  1 360 ? 20.136  -9.114  -16.215 1.00 57.26  ?  360  LEU B CB  1 
ATOM   6921 C  CG  . LEU B  1 360 ? 19.815  -8.936  -14.718 1.00 73.95  ?  360  LEU B CG  1 
ATOM   6922 C  CD1 . LEU B  1 360 ? 20.870  -9.605  -13.837 1.00 79.24  ?  360  LEU B CD1 1 
ATOM   6923 C  CD2 . LEU B  1 360 ? 19.645  -7.478  -14.313 1.00 67.76  ?  360  LEU B CD2 1 
ATOM   6924 N  N   . ALA B  1 361 ? 19.313  -10.207 -18.930 1.00 63.88  ?  361  ALA B N   1 
ATOM   6925 C  CA  . ALA B  1 361 ? 19.672  -10.816 -20.199 1.00 65.47  ?  361  ALA B CA  1 
ATOM   6926 C  C   . ALA B  1 361 ? 19.023  -10.083 -21.376 1.00 63.91  ?  361  ALA B C   1 
ATOM   6927 O  O   . ALA B  1 361 ? 19.665  -9.847  -22.404 1.00 60.87  ?  361  ALA B O   1 
ATOM   6928 C  CB  . ALA B  1 361 ? 19.287  -12.290 -20.199 1.00 67.10  ?  361  ALA B CB  1 
ATOM   6929 N  N   . GLY B  1 362 ? 17.758  -9.706  -21.207 1.00 59.31  ?  362  GLY B N   1 
ATOM   6930 C  CA  . GLY B  1 362 ? 17.032  -8.972  -22.228 1.00 49.61  ?  362  GLY B CA  1 
ATOM   6931 C  C   . GLY B  1 362 ? 17.488  -7.535  -22.436 1.00 50.44  ?  362  GLY B C   1 
ATOM   6932 O  O   . GLY B  1 362 ? 17.181  -6.929  -23.464 1.00 53.83  ?  362  GLY B O   1 
ATOM   6933 N  N   . VAL B  1 363 ? 18.203  -6.979  -21.462 1.00 51.96  ?  363  VAL B N   1 
ATOM   6934 C  CA  . VAL B  1 363 ? 18.748  -5.626  -21.588 1.00 52.26  ?  363  VAL B CA  1 
ATOM   6935 C  C   . VAL B  1 363 ? 19.988  -5.582  -22.515 1.00 48.77  ?  363  VAL B C   1 
ATOM   6936 O  O   . VAL B  1 363 ? 20.200  -4.589  -23.213 1.00 49.69  ?  363  VAL B O   1 
ATOM   6937 C  CB  . VAL B  1 363 ? 19.001  -4.967  -20.182 1.00 46.98  ?  363  VAL B CB  1 
ATOM   6938 C  CG1 . VAL B  1 363 ? 20.172  -3.994  -20.197 1.00 45.64  ?  363  VAL B CG1 1 
ATOM   6939 C  CG2 . VAL B  1 363 ? 17.749  -4.264  -19.696 1.00 45.35  ?  363  VAL B CG2 1 
ATOM   6940 N  N   . ARG B  1 364 ? 20.784  -6.656  -22.542 1.00 40.44  ?  364  ARG B N   1 
ATOM   6941 C  CA  . ARG B  1 364 ? 21.921  -6.741  -23.460 1.00 46.48  ?  364  ARG B CA  1 
ATOM   6942 C  C   . ARG B  1 364 ? 21.415  -6.920  -24.894 1.00 59.21  ?  364  ARG B C   1 
ATOM   6943 O  O   . ARG B  1 364 ? 22.149  -6.713  -25.860 1.00 64.63  ?  364  ARG B O   1 
ATOM   6944 C  CB  . ARG B  1 364 ? 22.826  -7.926  -23.125 1.00 47.88  ?  364  ARG B CB  1 
ATOM   6945 C  CG  . ARG B  1 364 ? 23.274  -8.027  -21.685 1.00 62.92  ?  364  ARG B CG  1 
ATOM   6946 C  CD  . ARG B  1 364 ? 23.917  -6.739  -21.191 1.00 71.21  ?  364  ARG B CD  1 
ATOM   6947 N  NE  . ARG B  1 364 ? 25.116  -6.368  -21.940 1.00 78.26  ?  364  ARG B NE  1 
ATOM   6948 C  CZ  . ARG B  1 364 ? 26.359  -6.590  -21.521 1.00 83.65  ?  364  ARG B CZ  1 
ATOM   6949 N  NH1 . ARG B  1 364 ? 26.574  -7.189  -20.354 1.00 84.24  ?  364  ARG B NH1 1 
ATOM   6950 N  NH2 . ARG B  1 364 ? 27.388  -6.211  -22.269 1.00 84.95  ?  364  ARG B NH2 1 
ATOM   6951 N  N   . ILE B  1 365 ? 20.159  -7.330  -25.018 1.00 55.83  ?  365  ILE B N   1 
ATOM   6952 C  CA  . ILE B  1 365 ? 19.578  -7.643  -26.311 1.00 56.95  ?  365  ILE B CA  1 
ATOM   6953 C  C   . ILE B  1 365 ? 18.881  -6.409  -26.845 1.00 54.93  ?  365  ILE B C   1 
ATOM   6954 O  O   . ILE B  1 365 ? 19.011  -6.073  -28.023 1.00 57.50  ?  365  ILE B O   1 
ATOM   6955 C  CB  . ILE B  1 365 ? 18.588  -8.822  -26.207 1.00 52.22  ?  365  ILE B CB  1 
ATOM   6956 C  CG1 . ILE B  1 365 ? 19.343  -10.124 -25.937 1.00 46.84  ?  365  ILE B CG1 1 
ATOM   6957 C  CG2 . ILE B  1 365 ? 17.781  -8.963  -27.469 1.00 51.88  ?  365  ILE B CG2 1 
ATOM   6958 C  CD1 . ILE B  1 365 ? 18.444  -11.327 -25.811 1.00 43.09  ?  365  ILE B CD1 1 
ATOM   6959 N  N   . GLY B  1 366 ? 18.169  -5.720  -25.960 1.00 45.10  ?  366  GLY B N   1 
ATOM   6960 C  CA  . GLY B  1 366 ? 17.482  -4.494  -26.319 1.00 40.75  ?  366  GLY B CA  1 
ATOM   6961 C  C   . GLY B  1 366 ? 18.425  -3.312  -26.400 1.00 47.64  ?  366  GLY B C   1 
ATOM   6962 O  O   . GLY B  1 366 ? 18.082  -2.265  -26.942 1.00 58.52  ?  366  GLY B O   1 
ATOM   6963 N  N   . VAL B  1 367 ? 19.617  -3.465  -25.838 1.00 45.03  ?  367  VAL B N   1 
ATOM   6964 C  CA  . VAL B  1 367 ? 20.655  -2.455  -26.015 1.00 47.98  ?  367  VAL B CA  1 
ATOM   6965 C  C   . VAL B  1 367 ? 21.936  -3.146  -26.446 1.00 51.53  ?  367  VAL B C   1 
ATOM   6966 O  O   . VAL B  1 367 ? 22.911  -3.178  -25.703 1.00 50.23  ?  367  VAL B O   1 
ATOM   6967 C  CB  . VAL B  1 367 ? 20.926  -1.652  -24.732 1.00 43.93  ?  367  VAL B CB  1 
ATOM   6968 C  CG1 . VAL B  1 367 ? 21.707  -0.393  -25.065 1.00 39.00  ?  367  VAL B CG1 1 
ATOM   6969 C  CG2 . VAL B  1 367 ? 19.622  -1.297  -24.040 1.00 30.60  ?  367  VAL B CG2 1 
ATOM   6970 N  N   . PRO B  1 368 ? 21.936  -3.695  -27.667 1.00 53.64  ?  368  PRO B N   1 
ATOM   6971 C  CA  . PRO B  1 368 ? 22.997  -4.586  -28.148 1.00 51.07  ?  368  PRO B CA  1 
ATOM   6972 C  C   . PRO B  1 368 ? 24.365  -3.922  -28.170 1.00 47.14  ?  368  PRO B C   1 
ATOM   6973 O  O   . PRO B  1 368 ? 25.383  -4.614  -28.091 1.00 48.13  ?  368  PRO B O   1 
ATOM   6974 C  CB  . PRO B  1 368 ? 22.554  -4.907  -29.578 1.00 58.98  ?  368  PRO B CB  1 
ATOM   6975 C  CG  . PRO B  1 368 ? 21.691  -3.754  -29.976 1.00 58.57  ?  368  PRO B CG  1 
ATOM   6976 C  CD  . PRO B  1 368 ? 20.950  -3.396  -28.718 1.00 51.24  ?  368  PRO B CD  1 
ATOM   6977 N  N   . GLN B  1 369 ? 24.385  -2.597  -28.266 1.00 51.17  ?  369  GLN B N   1 
ATOM   6978 C  CA  A GLN B  1 369 ? 25.640  -1.851  -28.347 0.46 54.22  ?  369  GLN B CA  1 
ATOM   6979 C  CA  B GLN B  1 369 ? 25.644  -1.874  -28.362 0.54 54.30  ?  369  GLN B CA  1 
ATOM   6980 C  C   . GLN B  1 369 ? 26.230  -1.533  -26.987 1.00 58.66  ?  369  GLN B C   1 
ATOM   6981 O  O   . GLN B  1 369 ? 27.338  -1.008  -26.900 1.00 66.24  ?  369  GLN B O   1 
ATOM   6982 C  CB  A GLN B  1 369 ? 25.459  -0.541  -29.111 0.46 51.39  ?  369  GLN B CB  1 
ATOM   6983 C  CB  B GLN B  1 369 ? 25.479  -0.615  -29.225 0.54 51.69  ?  369  GLN B CB  1 
ATOM   6984 C  CG  A GLN B  1 369 ? 24.071  -0.312  -29.651 0.46 47.44  ?  369  GLN B CG  1 
ATOM   6985 C  CG  B GLN B  1 369 ? 25.704  -0.829  -30.747 0.54 55.03  ?  369  GLN B CG  1 
ATOM   6986 C  CD  A GLN B  1 369 ? 23.107  0.191   -28.611 0.46 36.18  ?  369  GLN B CD  1 
ATOM   6987 C  CD  B GLN B  1 369 ? 24.566  -1.578  -31.451 0.54 47.48  ?  369  GLN B CD  1 
ATOM   6988 O  OE1 A GLN B  1 369 ? 22.123  -0.472  -28.301 0.46 31.50  ?  369  GLN B OE1 1 
ATOM   6989 O  OE1 B GLN B  1 369 ? 23.503  -1.019  -31.720 0.54 31.07  ?  369  GLN B OE1 1 
ATOM   6990 N  NE2 A GLN B  1 369 ? 23.369  1.377   -28.082 0.46 34.90  ?  369  GLN B NE2 1 
ATOM   6991 N  NE2 B GLN B  1 369 ? 24.798  -2.845  -31.752 0.54 34.17  ?  369  GLN B NE2 1 
ATOM   6992 N  N   . ALA B  1 370 ? 25.494  -1.848  -25.920 1.00 59.19  ?  370  ALA B N   1 
ATOM   6993 C  CA  . ALA B  1 370 ? 25.928  -1.492  -24.554 1.00 55.39  ?  370  ALA B CA  1 
ATOM   6994 C  C   . ALA B  1 370 ? 27.065  -2.328  -23.982 1.00 56.87  ?  370  ALA B C   1 
ATOM   6995 O  O   . ALA B  1 370 ? 27.018  -3.561  -23.991 1.00 57.95  ?  370  ALA B O   1 
ATOM   6996 C  CB  . ALA B  1 370 ? 24.750  -1.510  -23.583 1.00 52.66  ?  370  ALA B CB  1 
ATOM   6997 N  N   . SER B  1 371 ? 28.071  -1.633  -23.463 1.00 60.13  ?  371  SER B N   1 
ATOM   6998 C  CA  . SER B  1 371 ? 29.102  -2.241  -22.627 1.00 63.81  ?  371  SER B CA  1 
ATOM   6999 C  C   . SER B  1 371 ? 28.495  -2.801  -21.345 1.00 62.53  ?  371  SER B C   1 
ATOM   7000 O  O   . SER B  1 371 ? 27.364  -2.468  -20.982 1.00 59.60  ?  371  SER B O   1 
ATOM   7001 C  CB  . SER B  1 371 ? 30.165  -1.202  -22.273 1.00 67.92  ?  371  SER B CB  1 
ATOM   7002 O  OG  . SER B  1 371 ? 29.553  -0.006  -21.814 1.00 73.80  ?  371  SER B OG  1 
ATOM   7003 N  N   . ASP B  1 372 ? 29.256  -3.652  -20.666 1.00 68.42  ?  372  ASP B N   1 
ATOM   7004 C  CA  . ASP B  1 372 ? 28.829  -4.233  -19.398 1.00 70.38  ?  372  ASP B CA  1 
ATOM   7005 C  C   . ASP B  1 372 ? 28.387  -3.138  -18.438 1.00 68.81  ?  372  ASP B C   1 
ATOM   7006 O  O   . ASP B  1 372 ? 27.338  -3.240  -17.795 1.00 64.44  ?  372  ASP B O   1 
ATOM   7007 C  CB  . ASP B  1 372 ? 29.964  -5.054  -18.780 1.00 69.44  ?  372  ASP B CB  1 
ATOM   7008 C  CG  . ASP B  1 372 ? 30.418  -6.194  -19.684 1.00 80.01  ?  372  ASP B CG  1 
ATOM   7009 O  OD1 . ASP B  1 372 ? 30.146  -6.133  -20.904 1.00 79.42  ?  372  ASP B OD1 1 
ATOM   7010 O  OD2 . ASP B  1 372 ? 31.052  -7.148  -19.179 1.00 83.35  ?  372  ASP B OD2 1 
ATOM   7011 N  N   . LEU B  1 373 ? 29.176  -2.072  -18.374 1.00 64.33  ?  373  LEU B N   1 
ATOM   7012 C  CA  . LEU B  1 373 ? 28.892  -0.983  -17.449 1.00 57.50  ?  373  LEU B CA  1 
ATOM   7013 C  C   . LEU B  1 373 ? 27.697  -0.136  -17.876 1.00 56.64  ?  373  LEU B C   1 
ATOM   7014 O  O   . LEU B  1 373 ? 26.927  0.329   -17.036 1.00 58.31  ?  373  LEU B O   1 
ATOM   7015 C  CB  . LEU B  1 373 ? 30.127  -0.108  -17.259 1.00 58.25  ?  373  LEU B CB  1 
ATOM   7016 C  CG  . LEU B  1 373 ? 29.947  1.147   -16.408 1.00 59.06  ?  373  LEU B CG  1 
ATOM   7017 C  CD1 . LEU B  1 373 ? 29.535  0.811   -14.963 1.00 56.25  ?  373  LEU B CD1 1 
ATOM   7018 C  CD2 . LEU B  1 373 ? 31.225  1.948   -16.446 1.00 54.38  ?  373  LEU B CD2 1 
ATOM   7019 N  N   . ALA B  1 374 ? 27.541  0.067   -19.178 1.00 57.06  ?  374  ALA B N   1 
ATOM   7020 C  CA  . ALA B  1 374 ? 26.404  0.825   -19.683 1.00 53.97  ?  374  ALA B CA  1 
ATOM   7021 C  C   . ALA B  1 374 ? 25.091  0.078   -19.451 1.00 49.20  ?  374  ALA B C   1 
ATOM   7022 O  O   . ALA B  1 374 ? 24.078  0.685   -19.103 1.00 48.36  ?  374  ALA B O   1 
ATOM   7023 C  CB  . ALA B  1 374 ? 26.592  1.147   -21.157 1.00 52.39  ?  374  ALA B CB  1 
ATOM   7024 N  N   . ALA B  1 375 ? 25.119  -1.239  -19.639 1.00 45.26  ?  375  ALA B N   1 
ATOM   7025 C  CA  . ALA B  1 375 ? 23.946  -2.075  -19.411 1.00 45.63  ?  375  ALA B CA  1 
ATOM   7026 C  C   . ALA B  1 375 ? 23.643  -2.161  -17.920 1.00 56.72  ?  375  ALA B C   1 
ATOM   7027 O  O   . ALA B  1 375 ? 22.488  -2.283  -17.508 1.00 65.90  ?  375  ALA B O   1 
ATOM   7028 C  CB  . ALA B  1 375 ? 24.169  -3.457  -19.974 1.00 42.84  ?  375  ALA B CB  1 
ATOM   7029 N  N   . GLU B  1 376 ? 24.681  -2.105  -17.104 1.00 54.87  ?  376  GLU B N   1 
ATOM   7030 C  CA  . GLU B  1 376 ? 24.464  -2.038  -15.672 1.00 62.75  ?  376  GLU B CA  1 
ATOM   7031 C  C   . GLU B  1 376 ? 23.713  -0.743  -15.349 1.00 62.39  ?  376  GLU B C   1 
ATOM   7032 O  O   . GLU B  1 376 ? 22.721  -0.758  -14.620 1.00 64.49  ?  376  GLU B O   1 
ATOM   7033 C  CB  . GLU B  1 376 ? 25.790  -2.109  -14.915 1.00 75.10  ?  376  GLU B CB  1 
ATOM   7034 C  CG  . GLU B  1 376 ? 25.633  -2.450  -13.447 1.00 92.67  ?  376  GLU B CG  1 
ATOM   7035 C  CD  . GLU B  1 376 ? 24.843  -3.728  -13.238 1.00 102.20 ?  376  GLU B CD  1 
ATOM   7036 O  OE1 . GLU B  1 376 ? 25.220  -4.755  -13.847 1.00 107.90 ?  376  GLU B OE1 1 
ATOM   7037 O  OE2 . GLU B  1 376 ? 23.843  -3.699  -12.479 1.00 95.63  ?  376  GLU B OE2 1 
ATOM   7038 N  N   . ALA B  1 377 ? 24.175  0.369   -15.919 1.00 54.27  ?  377  ALA B N   1 
ATOM   7039 C  CA  . ALA B  1 377 ? 23.521  1.659   -15.725 1.00 50.40  ?  377  ALA B CA  1 
ATOM   7040 C  C   . ALA B  1 377 ? 22.047  1.608   -16.105 1.00 50.30  ?  377  ALA B C   1 
ATOM   7041 O  O   . ALA B  1 377 ? 21.209  2.198   -15.434 1.00 53.24  ?  377  ALA B O   1 
ATOM   7042 C  CB  . ALA B  1 377 ? 24.233  2.741   -16.513 1.00 51.39  ?  377  ALA B CB  1 
ATOM   7043 N  N   . VAL B  1 378 ? 21.736  0.892   -17.180 1.00 46.79  ?  378  VAL B N   1 
ATOM   7044 C  CA  . VAL B  1 378 ? 20.366  0.798   -17.663 1.00 42.39  ?  378  VAL B CA  1 
ATOM   7045 C  C   . VAL B  1 378 ? 19.509  -0.008  -16.702 1.00 47.45  ?  378  VAL B C   1 
ATOM   7046 O  O   . VAL B  1 378 ? 18.467  0.461   -16.258 1.00 55.56  ?  378  VAL B O   1 
ATOM   7047 C  CB  . VAL B  1 378 ? 20.311  0.205   -19.092 1.00 43.60  ?  378  VAL B CB  1 
ATOM   7048 C  CG1 . VAL B  1 378 ? 18.910  -0.240  -19.459 1.00 35.65  ?  378  VAL B CG1 1 
ATOM   7049 C  CG2 . VAL B  1 378 ? 20.812  1.230   -20.094 1.00 48.71  ?  378  VAL B CG2 1 
ATOM   7050 N  N   . VAL B  1 379 ? 19.955  -1.217  -16.381 1.00 46.34  ?  379  VAL B N   1 
ATOM   7051 C  CA  . VAL B  1 379 ? 19.273  -2.055  -15.400 1.00 50.68  ?  379  VAL B CA  1 
ATOM   7052 C  C   . VAL B  1 379 ? 19.018  -1.335  -14.051 1.00 47.44  ?  379  VAL B C   1 
ATOM   7053 O  O   . VAL B  1 379 ? 17.951  -1.464  -13.455 1.00 47.33  ?  379  VAL B O   1 
ATOM   7054 C  CB  . VAL B  1 379 ? 20.065  -3.355  -15.155 1.00 50.91  ?  379  VAL B CB  1 
ATOM   7055 C  CG1 . VAL B  1 379 ? 19.600  -4.045  -13.862 1.00 44.13  ?  379  VAL B CG1 1 
ATOM   7056 C  CG2 . VAL B  1 379 ? 19.957  -4.280  -16.362 1.00 48.38  ?  379  VAL B CG2 1 
ATOM   7057 N  N   . LEU B  1 380 ? 19.989  -0.564  -13.583 1.00 42.67  ?  380  LEU B N   1 
ATOM   7058 C  CA  . LEU B  1 380 ? 19.822  0.176   -12.335 1.00 46.45  ?  380  LEU B CA  1 
ATOM   7059 C  C   . LEU B  1 380 ? 18.805  1.326   -12.444 1.00 53.94  ?  380  LEU B C   1 
ATOM   7060 O  O   . LEU B  1 380 ? 18.085  1.624   -11.491 1.00 52.83  ?  380  LEU B O   1 
ATOM   7061 C  CB  . LEU B  1 380 ? 21.182  0.660   -11.820 1.00 46.91  ?  380  LEU B CB  1 
ATOM   7062 C  CG  . LEU B  1 380 ? 22.121  -0.510  -11.466 1.00 59.07  ?  380  LEU B CG  1 
ATOM   7063 C  CD1 . LEU B  1 380 ? 23.548  -0.046  -11.275 1.00 66.52  ?  380  LEU B CD1 1 
ATOM   7064 C  CD2 . LEU B  1 380 ? 21.654  -1.269  -10.222 1.00 59.64  ?  380  LEU B CD2 1 
ATOM   7065 N  N   . HIS B  1 381 ? 18.724  1.944   -13.618 1.00 53.57  ?  381  HIS B N   1 
ATOM   7066 C  CA  . HIS B  1 381 ? 17.796  3.049   -13.840 1.00 50.50  ?  381  HIS B CA  1 
ATOM   7067 C  C   . HIS B  1 381 ? 16.346  2.582   -13.954 1.00 48.22  ?  381  HIS B C   1 
ATOM   7068 O  O   . HIS B  1 381 ? 15.420  3.282   -13.542 1.00 52.52  ?  381  HIS B O   1 
ATOM   7069 C  CB  . HIS B  1 381 ? 18.172  3.809   -15.114 1.00 54.00  ?  381  HIS B CB  1 
ATOM   7070 C  CG  . HIS B  1 381 ? 17.281  4.975   -15.397 1.00 54.00  ?  381  HIS B CG  1 
ATOM   7071 N  ND1 . HIS B  1 381 ? 17.543  6.241   -14.920 1.00 50.31  ?  381  HIS B ND1 1 
ATOM   7072 C  CD2 . HIS B  1 381 ? 16.116  5.062   -16.081 1.00 57.00  ?  381  HIS B CD2 1 
ATOM   7073 C  CE1 . HIS B  1 381 ? 16.581  7.061   -15.305 1.00 57.74  ?  381  HIS B CE1 1 
ATOM   7074 N  NE2 . HIS B  1 381 ? 15.703  6.371   -16.012 1.00 61.28  ?  381  HIS B NE2 1 
ATOM   7075 N  N   . TYR B  1 382 ? 16.154  1.394   -14.512 1.00 39.94  ?  382  TYR B N   1 
ATOM   7076 C  CA  . TYR B  1 382 ? 14.812  0.908   -14.819 1.00 45.77  ?  382  TYR B CA  1 
ATOM   7077 C  C   . TYR B  1 382 ? 14.207  -0.009  -13.755 1.00 48.89  ?  382  TYR B C   1 
ATOM   7078 O  O   . TYR B  1 382 ? 12.986  -0.192  -13.710 1.00 49.90  ?  382  TYR B O   1 
ATOM   7079 C  CB  . TYR B  1 382 ? 14.772  0.243   -16.212 1.00 43.95  ?  382  TYR B CB  1 
ATOM   7080 C  CG  . TYR B  1 382 ? 14.651  1.244   -17.338 1.00 47.33  ?  382  TYR B CG  1 
ATOM   7081 C  CD1 . TYR B  1 382 ? 15.778  1.855   -17.880 1.00 47.42  ?  382  TYR B CD1 1 
ATOM   7082 C  CD2 . TYR B  1 382 ? 13.410  1.593   -17.848 1.00 53.30  ?  382  TYR B CD2 1 
ATOM   7083 C  CE1 . TYR B  1 382 ? 15.668  2.779   -18.905 1.00 49.66  ?  382  TYR B CE1 1 
ATOM   7084 C  CE2 . TYR B  1 382 ? 13.287  2.512   -18.873 1.00 55.23  ?  382  TYR B CE2 1 
ATOM   7085 C  CZ  . TYR B  1 382 ? 14.417  3.104   -19.398 1.00 55.73  ?  382  TYR B CZ  1 
ATOM   7086 O  OH  . TYR B  1 382 ? 14.291  4.023   -20.417 1.00 52.84  ?  382  TYR B OH  1 
ATOM   7087 N  N   . THR B  1 383 ? 15.053  -0.594  -12.914 1.00 52.51  ?  383  THR B N   1 
ATOM   7088 C  CA  . THR B  1 383 ? 14.568  -1.366  -11.776 1.00 49.02  ?  383  THR B CA  1 
ATOM   7089 C  C   . THR B  1 383 ? 13.781  -0.445  -10.846 1.00 49.24  ?  383  THR B C   1 
ATOM   7090 O  O   . THR B  1 383 ? 14.224  0.666   -10.558 1.00 53.64  ?  383  THR B O   1 
ATOM   7091 C  CB  . THR B  1 383 ? 15.733  -2.027  -11.012 1.00 50.58  ?  383  THR B CB  1 
ATOM   7092 O  OG1 . THR B  1 383 ? 16.343  -3.026  -11.841 1.00 47.79  ?  383  THR B OG1 1 
ATOM   7093 C  CG2 . THR B  1 383 ? 15.240  -2.674  -9.705  1.00 51.79  ?  383  THR B CG2 1 
ATOM   7094 N  N   . ASP B  1 384 ? 12.595  -0.879  -10.424 1.00 53.08  ?  384  ASP B N   1 
ATOM   7095 C  CA  . ASP B  1 384 ? 11.883  -0.196  -9.342  1.00 60.94  ?  384  ASP B CA  1 
ATOM   7096 C  C   . ASP B  1 384 ? 12.407  -0.757  -8.022  1.00 63.26  ?  384  ASP B C   1 
ATOM   7097 O  O   . ASP B  1 384 ? 12.066  -1.871  -7.630  1.00 58.71  ?  384  ASP B O   1 
ATOM   7098 C  CB  . ASP B  1 384 ? 10.361  -0.391  -9.444  1.00 58.27  ?  384  ASP B CB  1 
ATOM   7099 C  CG  . ASP B  1 384 ? 9.583   0.455   -8.430  1.00 72.23  ?  384  ASP B CG  1 
ATOM   7100 O  OD1 . ASP B  1 384 ? 10.147  0.843   -7.384  1.00 84.71  ?  384  ASP B OD1 1 
ATOM   7101 O  OD2 . ASP B  1 384 ? 8.392   0.733   -8.667  1.00 75.00  ?  384  ASP B OD2 1 
ATOM   7102 N  N   . TRP B  1 385 ? 13.231  0.019   -7.330  1.00 58.98  ?  385  TRP B N   1 
ATOM   7103 C  CA  . TRP B  1 385 ? 13.853  -0.475  -6.104  1.00 58.65  ?  385  TRP B CA  1 
ATOM   7104 C  C   . TRP B  1 385 ? 12.884  -0.673  -4.943  1.00 59.30  ?  385  TRP B C   1 
ATOM   7105 O  O   . TRP B  1 385 ? 13.267  -1.172  -3.895  1.00 67.81  ?  385  TRP B O   1 
ATOM   7106 C  CB  . TRP B  1 385 ? 15.089  0.364   -5.745  1.00 57.14  ?  385  TRP B CB  1 
ATOM   7107 C  CG  . TRP B  1 385 ? 16.084  0.178   -6.820  1.00 65.95  ?  385  TRP B CG  1 
ATOM   7108 C  CD1 . TRP B  1 385 ? 16.315  1.007   -7.885  1.00 61.18  ?  385  TRP B CD1 1 
ATOM   7109 C  CD2 . TRP B  1 385 ? 16.908  -0.972  -7.022  1.00 62.45  ?  385  TRP B CD2 1 
ATOM   7110 N  NE1 . TRP B  1 385 ? 17.273  0.467   -8.700  1.00 47.07  ?  385  TRP B NE1 1 
ATOM   7111 C  CE2 . TRP B  1 385 ? 17.644  -0.754  -8.203  1.00 56.87  ?  385  TRP B CE2 1 
ATOM   7112 C  CE3 . TRP B  1 385 ? 17.107  -2.157  -6.310  1.00 59.66  ?  385  TRP B CE3 1 
ATOM   7113 C  CZ2 . TRP B  1 385 ? 18.569  -1.676  -8.686  1.00 61.69  ?  385  TRP B CZ2 1 
ATOM   7114 C  CZ3 . TRP B  1 385 ? 18.023  -3.070  -6.790  1.00 66.66  ?  385  TRP B CZ3 1 
ATOM   7115 C  CH2 . TRP B  1 385 ? 18.741  -2.828  -7.971  1.00 65.40  ?  385  TRP B CH2 1 
ATOM   7116 N  N   . LEU B  1 386 ? 11.623  -0.311  -5.144  1.00 63.85  ?  386  LEU B N   1 
ATOM   7117 C  CA  . LEU B  1 386 ? 10.585  -0.658  -4.181  1.00 80.19  ?  386  LEU B CA  1 
ATOM   7118 C  C   . LEU B  1 386 ? 10.099  -2.077  -4.457  1.00 83.32  ?  386  LEU B C   1 
ATOM   7119 O  O   . LEU B  1 386 ? 9.692   -2.796  -3.542  1.00 90.17  ?  386  LEU B O   1 
ATOM   7120 C  CB  . LEU B  1 386 ? 9.423   0.336   -4.256  1.00 86.31  ?  386  LEU B CB  1 
ATOM   7121 C  CG  . LEU B  1 386 ? 9.788   1.765   -3.850  1.00 85.15  ?  386  LEU B CG  1 
ATOM   7122 C  CD1 . LEU B  1 386 ? 8.644   2.747   -4.069  1.00 82.34  ?  386  LEU B CD1 1 
ATOM   7123 C  CD2 . LEU B  1 386 ? 10.217  1.754   -2.406  1.00 80.81  ?  386  LEU B CD2 1 
ATOM   7124 N  N   . HIS B  1 387 ? 10.157  -2.465  -5.730  1.00 79.42  ?  387  HIS B N   1 
ATOM   7125 C  CA  . HIS B  1 387 ? 9.719   -3.783  -6.184  1.00 78.74  ?  387  HIS B CA  1 
ATOM   7126 C  C   . HIS B  1 387 ? 10.715  -4.360  -7.175  1.00 67.96  ?  387  HIS B C   1 
ATOM   7127 O  O   . HIS B  1 387 ? 10.364  -4.613  -8.320  1.00 75.64  ?  387  HIS B O   1 
ATOM   7128 C  CB  . HIS B  1 387 ? 8.361   -3.669  -6.874  1.00 83.08  ?  387  HIS B CB  1 
ATOM   7129 C  CG  . HIS B  1 387 ? 7.327   -2.963  -6.053  1.00 90.22  ?  387  HIS B CG  1 
ATOM   7130 N  ND1 . HIS B  1 387 ? 7.079   -1.612  -6.171  1.00 89.67  ?  387  HIS B ND1 1 
ATOM   7131 C  CD2 . HIS B  1 387 ? 6.485   -3.419  -5.096  1.00 90.86  ?  387  HIS B CD2 1 
ATOM   7132 C  CE1 . HIS B  1 387 ? 6.125   -1.267  -5.324  1.00 91.04  ?  387  HIS B CE1 1 
ATOM   7133 N  NE2 . HIS B  1 387 ? 5.748   -2.345  -4.660  1.00 94.29  ?  387  HIS B NE2 1 
ATOM   7134 N  N   . PRO B  1 388 ? 11.966  -4.567  -6.739  1.00 62.89  ?  388  PRO B N   1 
ATOM   7135 C  CA  . PRO B  1 388 ? 13.054  -4.906  -7.663  1.00 55.90  ?  388  PRO B CA  1 
ATOM   7136 C  C   . PRO B  1 388 ? 12.923  -6.284  -8.305  1.00 63.94  ?  388  PRO B C   1 
ATOM   7137 O  O   . PRO B  1 388 ? 13.566  -6.544  -9.330  1.00 56.15  ?  388  PRO B O   1 
ATOM   7138 C  CB  . PRO B  1 388 ? 14.294  -4.864  -6.768  1.00 60.57  ?  388  PRO B CB  1 
ATOM   7139 C  CG  . PRO B  1 388 ? 13.779  -5.174  -5.393  1.00 61.35  ?  388  PRO B CG  1 
ATOM   7140 C  CD  . PRO B  1 388 ? 12.410  -4.565  -5.328  1.00 65.23  ?  388  PRO B CD  1 
ATOM   7141 N  N   . GLU B  1 389 ? 12.099  -7.149  -7.721  1.00 75.24  ?  389  GLU B N   1 
ATOM   7142 C  CA  . GLU B  1 389 ? 11.984  -8.530  -8.188  1.00 76.32  ?  389  GLU B CA  1 
ATOM   7143 C  C   . GLU B  1 389 ? 10.655  -8.806  -8.879  1.00 71.16  ?  389  GLU B C   1 
ATOM   7144 O  O   . GLU B  1 389 ? 10.494  -9.839  -9.530  1.00 72.69  ?  389  GLU B O   1 
ATOM   7145 C  CB  . GLU B  1 389 ? 12.147  -9.501  -7.016  1.00 83.78  ?  389  GLU B CB  1 
ATOM   7146 C  CG  . GLU B  1 389 ? 13.423  -9.302  -6.211  1.00 94.33  ?  389  GLU B CG  1 
ATOM   7147 C  CD  . GLU B  1 389 ? 14.621  -9.992  -6.833  1.00 96.88  ?  389  GLU B CD  1 
ATOM   7148 O  OE1 . GLU B  1 389 ? 14.445  -10.685 -7.856  1.00 98.67  ?  389  GLU B OE1 1 
ATOM   7149 O  OE2 . GLU B  1 389 ? 15.738  -9.846  -6.296  1.00 95.64  ?  389  GLU B OE2 1 
ATOM   7150 N  N   . ASP B  1 390 ? 9.710   -7.882  -8.732  1.00 61.22  ?  390  ASP B N   1 
ATOM   7151 C  CA  . ASP B  1 390 ? 8.338   -8.100  -9.177  1.00 58.97  ?  390  ASP B CA  1 
ATOM   7152 C  C   . ASP B  1 390 ? 8.195   -8.250  -10.694 1.00 58.21  ?  390  ASP B C   1 
ATOM   7153 O  O   . ASP B  1 390 ? 8.431   -7.305  -11.438 1.00 59.45  ?  390  ASP B O   1 
ATOM   7154 C  CB  . ASP B  1 390 ? 7.439   -6.975  -8.681  1.00 63.19  ?  390  ASP B CB  1 
ATOM   7155 C  CG  . ASP B  1 390 ? 6.100   -6.959  -9.380  1.00 75.71  ?  390  ASP B CG  1 
ATOM   7156 O  OD1 . ASP B  1 390 ? 5.270   -7.844  -9.084  1.00 85.91  ?  390  ASP B OD1 1 
ATOM   7157 O  OD2 . ASP B  1 390 ? 5.876   -6.067  -10.227 1.00 73.00  ?  390  ASP B OD2 1 
ATOM   7158 N  N   . PRO B  1 391 ? 7.792   -9.447  -11.146 1.00 59.37  ?  391  PRO B N   1 
ATOM   7159 C  CA  . PRO B  1 391 ? 7.621   -9.815  -12.559 1.00 56.16  ?  391  PRO B CA  1 
ATOM   7160 C  C   . PRO B  1 391 ? 6.870   -8.798  -13.427 1.00 62.14  ?  391  PRO B C   1 
ATOM   7161 O  O   . PRO B  1 391 ? 7.324   -8.538  -14.538 1.00 63.83  ?  391  PRO B O   1 
ATOM   7162 C  CB  . PRO B  1 391 ? 6.855   -11.143 -12.492 1.00 59.05  ?  391  PRO B CB  1 
ATOM   7163 C  CG  . PRO B  1 391 ? 6.540   -11.375 -10.997 1.00 65.31  ?  391  PRO B CG  1 
ATOM   7164 C  CD  . PRO B  1 391 ? 7.539   -10.589 -10.250 1.00 58.84  ?  391  PRO B CD  1 
ATOM   7165 N  N   . THR B  1 392 ? 5.760   -8.240  -12.949 1.00 69.03  ?  392  THR B N   1 
ATOM   7166 C  CA  . THR B  1 392 ? 4.990   -7.276  -13.745 1.00 65.08  ?  392  THR B CA  1 
ATOM   7167 C  C   . THR B  1 392 ? 5.792   -5.998  -14.004 1.00 61.72  ?  392  THR B C   1 
ATOM   7168 O  O   . THR B  1 392 ? 5.704   -5.402  -15.074 1.00 59.28  ?  392  THR B O   1 
ATOM   7169 C  CB  . THR B  1 392 ? 3.629   -6.921  -13.075 1.00 60.88  ?  392  THR B CB  1 
ATOM   7170 O  OG1 . THR B  1 392 ? 2.719   -8.018  -13.212 1.00 65.69  ?  392  THR B OG1 1 
ATOM   7171 C  CG2 . THR B  1 392 ? 2.997   -5.699  -13.725 1.00 59.28  ?  392  THR B CG2 1 
ATOM   7172 N  N   . HIS B  1 393 ? 6.580   -5.582  -13.020 1.00 61.28  ?  393  HIS B N   1 
ATOM   7173 C  CA  . HIS B  1 393 ? 7.387   -4.377  -13.157 1.00 59.24  ?  393  HIS B CA  1 
ATOM   7174 C  C   . HIS B  1 393 ? 8.549   -4.606  -14.101 1.00 54.52  ?  393  HIS B C   1 
ATOM   7175 O  O   . HIS B  1 393 ? 8.916   -3.716  -14.861 1.00 54.05  ?  393  HIS B O   1 
ATOM   7176 C  CB  . HIS B  1 393 ? 7.922   -3.907  -11.798 1.00 54.52  ?  393  HIS B CB  1 
ATOM   7177 C  CG  . HIS B  1 393 ? 6.939   -3.109  -11.008 1.00 69.47  ?  393  HIS B CG  1 
ATOM   7178 N  ND1 . HIS B  1 393 ? 6.252   -3.628  -9.931  1.00 80.09  ?  393  HIS B ND1 1 
ATOM   7179 C  CD2 . HIS B  1 393 ? 6.523   -1.827  -11.139 1.00 77.93  ?  393  HIS B CD2 1 
ATOM   7180 C  CE1 . HIS B  1 393 ? 5.460   -2.698  -9.427  1.00 84.02  ?  393  HIS B CE1 1 
ATOM   7181 N  NE2 . HIS B  1 393 ? 5.603   -1.598  -10.144 1.00 86.66  ?  393  HIS B NE2 1 
ATOM   7182 N  N   . LEU B  1 394 ? 9.138   -5.794  -14.024 1.00 55.22  ?  394  LEU B N   1 
ATOM   7183 C  CA  . LEU B  1 394 ? 10.273  -6.147  -14.868 1.00 60.70  ?  394  LEU B CA  1 
ATOM   7184 C  C   . LEU B  1 394 ? 9.841   -6.251  -16.335 1.00 59.65  ?  394  LEU B C   1 
ATOM   7185 O  O   . LEU B  1 394 ? 10.510  -5.746  -17.239 1.00 55.93  ?  394  LEU B O   1 
ATOM   7186 C  CB  . LEU B  1 394 ? 10.908  -7.449  -14.372 1.00 55.86  ?  394  LEU B CB  1 
ATOM   7187 C  CG  . LEU B  1 394 ? 11.423  -7.308  -12.933 1.00 54.44  ?  394  LEU B CG  1 
ATOM   7188 C  CD1 . LEU B  1 394 ? 11.841  -8.649  -12.323 1.00 51.09  ?  394  LEU B CD1 1 
ATOM   7189 C  CD2 . LEU B  1 394 ? 12.571  -6.296  -12.870 1.00 46.61  ?  394  LEU B CD2 1 
ATOM   7190 N  N   . ARG B  1 395 ? 8.702   -6.893  -16.557 1.00 57.61  ?  395  ARG B N   1 
ATOM   7191 C  CA  . ARG B  1 395 ? 8.145   -7.009  -17.890 1.00 56.36  ?  395  ARG B CA  1 
ATOM   7192 C  C   . ARG B  1 395 ? 7.825   -5.627  -18.464 1.00 56.03  ?  395  ARG B C   1 
ATOM   7193 O  O   . ARG B  1 395 ? 8.172   -5.328  -19.605 1.00 54.59  ?  395  ARG B O   1 
ATOM   7194 C  CB  . ARG B  1 395 ? 6.904   -7.897  -17.860 1.00 55.22  ?  395  ARG B CB  1 
ATOM   7195 C  CG  . ARG B  1 395 ? 6.196   -7.997  -19.174 1.00 52.52  ?  395  ARG B CG  1 
ATOM   7196 C  CD  . ARG B  1 395 ? 4.930   -7.199  -19.124 1.00 55.57  ?  395  ARG B CD  1 
ATOM   7197 N  NE  . ARG B  1 395 ? 3.812   -7.953  -18.580 1.00 49.14  ?  395  ARG B NE  1 
ATOM   7198 C  CZ  . ARG B  1 395 ? 2.776   -7.387  -17.975 1.00 57.39  ?  395  ARG B CZ  1 
ATOM   7199 N  NH1 . ARG B  1 395 ? 2.742   -6.067  -17.819 1.00 42.38  ?  395  ARG B NH1 1 
ATOM   7200 N  NH2 . ARG B  1 395 ? 1.781   -8.138  -17.515 1.00 60.95  ?  395  ARG B NH2 1 
ATOM   7201 N  N   . ASP B  1 396 ? 7.188   -4.777  -17.667 1.00 52.75  ?  396  ASP B N   1 
ATOM   7202 C  CA  . ASP B  1 396 ? 6.857   -3.436  -18.132 1.00 45.35  ?  396  ASP B CA  1 
ATOM   7203 C  C   . ASP B  1 396 ? 8.093   -2.573  -18.343 1.00 46.82  ?  396  ASP B C   1 
ATOM   7204 O  O   . ASP B  1 396 ? 8.090   -1.684  -19.196 1.00 53.93  ?  396  ASP B O   1 
ATOM   7205 C  CB  . ASP B  1 396 ? 5.856   -2.741  -17.201 1.00 48.28  ?  396  ASP B CB  1 
ATOM   7206 C  CG  . ASP B  1 396 ? 4.441   -3.310  -17.332 1.00 62.76  ?  396  ASP B CG  1 
ATOM   7207 O  OD1 . ASP B  1 396 ? 4.202   -4.122  -18.259 1.00 54.89  ?  396  ASP B OD1 1 
ATOM   7208 O  OD2 . ASP B  1 396 ? 3.564   -2.943  -16.512 1.00 66.61  ?  396  ASP B OD2 1 
ATOM   7209 N  N   . ALA B  1 397 ? 9.156   -2.846  -17.591 1.00 40.88  ?  397  ALA B N   1 
ATOM   7210 C  CA  . ALA B  1 397 ? 10.353  -2.009  -17.667 1.00 45.10  ?  397  ALA B CA  1 
ATOM   7211 C  C   . ALA B  1 397 ? 11.237  -2.426  -18.833 1.00 48.30  ?  397  ALA B C   1 
ATOM   7212 O  O   . ALA B  1 397 ? 11.865  -1.587  -19.482 1.00 49.00  ?  397  ALA B O   1 
ATOM   7213 C  CB  . ALA B  1 397 ? 11.140  -2.036  -16.346 1.00 34.56  ?  397  ALA B CB  1 
ATOM   7214 N  N   . MET B  1 398 ? 11.289  -3.729  -19.079 1.00 50.77  ?  398  MET B N   1 
ATOM   7215 C  CA  . MET B  1 398 ? 11.927  -4.267  -20.274 1.00 46.89  ?  398  MET B CA  1 
ATOM   7216 C  C   . MET B  1 398 ? 11.393  -3.556  -21.525 1.00 44.75  ?  398  MET B C   1 
ATOM   7217 O  O   . MET B  1 398 ? 12.160  -3.041  -22.333 1.00 47.56  ?  398  MET B O   1 
ATOM   7218 C  CB  . MET B  1 398 ? 11.660  -5.771  -20.367 1.00 47.43  ?  398  MET B CB  1 
ATOM   7219 C  CG  . MET B  1 398 ? 12.348  -6.467  -21.526 1.00 51.53  ?  398  MET B CG  1 
ATOM   7220 S  SD  . MET B  1 398 ? 14.145  -6.435  -21.395 1.00 56.37  ?  398  MET B SD  1 
ATOM   7221 C  CE  . MET B  1 398 ? 14.578  -5.092  -22.501 1.00 62.20  ?  398  MET B CE  1 
ATOM   7222 N  N   . SER B  1 399 ? 10.071  -3.509  -21.652 1.00 41.87  ?  399  SER B N   1 
ATOM   7223 C  CA  . SER B  1 399 ? 9.413   -2.836  -22.765 1.00 44.87  ?  399  SER B CA  1 
ATOM   7224 C  C   . SER B  1 399 ? 9.728   -1.343  -22.819 1.00 48.58  ?  399  SER B C   1 
ATOM   7225 O  O   . SER B  1 399 ? 9.865   -0.770  -23.904 1.00 50.98  ?  399  SER B O   1 
ATOM   7226 C  CB  . SER B  1 399 ? 7.899   -3.073  -22.701 1.00 47.80  ?  399  SER B CB  1 
ATOM   7227 O  OG  . SER B  1 399 ? 7.162   -1.958  -23.159 1.00 45.01  ?  399  SER B OG  1 
ATOM   7228 N  N   . ALA B  1 400 ? 9.856   -0.713  -21.654 1.00 43.31  ?  400  ALA B N   1 
ATOM   7229 C  CA  . ALA B  1 400 ? 10.155  0.716   -21.616 1.00 43.28  ?  400  ALA B CA  1 
ATOM   7230 C  C   . ALA B  1 400 ? 11.598  1.003   -22.040 1.00 45.31  ?  400  ALA B C   1 
ATOM   7231 O  O   . ALA B  1 400 ? 11.865  2.008   -22.695 1.00 45.87  ?  400  ALA B O   1 
ATOM   7232 C  CB  . ALA B  1 400 ? 9.861   1.303   -20.236 1.00 42.45  ?  400  ALA B CB  1 
ATOM   7233 N  N   . VAL B  1 401 ? 12.519  0.117   -21.669 1.00 42.19  ?  401  VAL B N   1 
ATOM   7234 C  CA  . VAL B  1 401 ? 13.911  0.225   -22.105 1.00 50.03  ?  401  VAL B CA  1 
ATOM   7235 C  C   . VAL B  1 401 ? 14.026  0.247   -23.639 1.00 53.02  ?  401  VAL B C   1 
ATOM   7236 O  O   . VAL B  1 401 ? 14.713  1.096   -24.214 1.00 45.43  ?  401  VAL B O   1 
ATOM   7237 C  CB  . VAL B  1 401 ? 14.768  -0.940  -21.561 1.00 48.94  ?  401  VAL B CB  1 
ATOM   7238 C  CG1 . VAL B  1 401 ? 16.088  -1.031  -22.309 1.00 44.73  ?  401  VAL B CG1 1 
ATOM   7239 C  CG2 . VAL B  1 401 ? 15.015  -0.766  -20.078 1.00 48.09  ?  401  VAL B CG2 1 
ATOM   7240 N  N   . VAL B  1 402 ? 13.340  -0.685  -24.291 1.00 47.99  ?  402  VAL B N   1 
ATOM   7241 C  CA  . VAL B  1 402 ? 13.371  -0.789  -25.743 1.00 42.52  ?  402  VAL B CA  1 
ATOM   7242 C  C   . VAL B  1 402 ? 12.720  0.428   -26.394 1.00 41.16  ?  402  VAL B C   1 
ATOM   7243 O  O   . VAL B  1 402 ? 13.297  1.048   -27.282 1.00 44.84  ?  402  VAL B O   1 
ATOM   7244 C  CB  . VAL B  1 402 ? 12.670  -2.073  -26.220 1.00 39.65  ?  402  VAL B CB  1 
ATOM   7245 C  CG1 . VAL B  1 402 ? 12.549  -2.078  -27.733 1.00 42.79  ?  402  VAL B CG1 1 
ATOM   7246 C  CG2 . VAL B  1 402 ? 13.428  -3.289  -25.741 1.00 27.20  ?  402  VAL B CG2 1 
ATOM   7247 N  N   . GLY B  1 403 ? 11.525  0.774   -25.931 1.00 34.90  ?  403  GLY B N   1 
ATOM   7248 C  CA  . GLY B  1 403 ? 10.810  1.914   -26.464 1.00 33.38  ?  403  GLY B CA  1 
ATOM   7249 C  C   . GLY B  1 403 ? 11.513  3.245   -26.256 1.00 40.31  ?  403  GLY B C   1 
ATOM   7250 O  O   . GLY B  1 403 ? 11.388  4.149   -27.075 1.00 48.31  ?  403  GLY B O   1 
ATOM   7251 N  N   . ASP B  1 404 ? 12.243  3.381   -25.157 1.00 37.21  ?  404  ASP B N   1 
ATOM   7252 C  CA  . ASP B  1 404 ? 12.867  4.657   -24.843 1.00 45.26  ?  404  ASP B CA  1 
ATOM   7253 C  C   . ASP B  1 404 ? 14.175  4.823   -25.593 1.00 41.41  ?  404  ASP B C   1 
ATOM   7254 O  O   . ASP B  1 404 ? 14.481  5.897   -26.121 1.00 34.58  ?  404  ASP B O   1 
ATOM   7255 C  CB  . ASP B  1 404 ? 13.126  4.788   -23.342 1.00 43.31  ?  404  ASP B CB  1 
ATOM   7256 C  CG  . ASP B  1 404 ? 11.851  4.928   -22.534 1.00 49.70  ?  404  ASP B CG  1 
ATOM   7257 O  OD1 . ASP B  1 404 ? 10.766  5.098   -23.136 1.00 54.64  ?  404  ASP B OD1 1 
ATOM   7258 O  OD2 . ASP B  1 404 ? 11.942  4.877   -21.284 1.00 51.60  ?  404  ASP B OD2 1 
ATOM   7259 N  N   . HIS B  1 405 ? 14.950  3.748   -25.614 1.00 40.11  ?  405  HIS B N   1 
ATOM   7260 C  CA  . HIS B  1 405 ? 16.231  3.724   -26.302 1.00 45.81  ?  405  HIS B CA  1 
ATOM   7261 C  C   . HIS B  1 405 ? 16.034  3.964   -27.799 1.00 50.42  ?  405  HIS B C   1 
ATOM   7262 O  O   . HIS B  1 405 ? 16.773  4.732   -28.410 1.00 53.66  ?  405  HIS B O   1 
ATOM   7263 C  CB  . HIS B  1 405 ? 16.913  2.377   -26.043 1.00 45.86  ?  405  HIS B CB  1 
ATOM   7264 C  CG  . HIS B  1 405 ? 18.150  2.138   -26.850 1.00 46.55  ?  405  HIS B CG  1 
ATOM   7265 N  ND1 . HIS B  1 405 ? 19.179  3.055   -26.933 1.00 40.57  ?  405  HIS B ND1 1 
ATOM   7266 C  CD2 . HIS B  1 405 ? 18.537  1.066   -27.586 1.00 42.73  ?  405  HIS B CD2 1 
ATOM   7267 C  CE1 . HIS B  1 405 ? 20.142  2.558   -27.692 1.00 45.95  ?  405  HIS B CE1 1 
ATOM   7268 N  NE2 . HIS B  1 405 ? 19.777  1.355   -28.103 1.00 41.63  ?  405  HIS B NE2 1 
ATOM   7269 N  N   . ASN B  1 406 ? 15.011  3.335   -28.370 1.00 41.17  ?  406  ASN B N   1 
ATOM   7270 C  CA  . ASN B  1 406 ? 14.852  3.300   -29.818 1.00 38.98  ?  406  ASN B CA  1 
ATOM   7271 C  C   . ASN B  1 406 ? 13.946  4.378   -30.385 1.00 42.31  ?  406  ASN B C   1 
ATOM   7272 O  O   . ASN B  1 406 ? 14.198  4.870   -31.475 1.00 51.84  ?  406  ASN B O   1 
ATOM   7273 C  CB  . ASN B  1 406 ? 14.379  1.918   -30.272 1.00 33.41  ?  406  ASN B CB  1 
ATOM   7274 C  CG  . ASN B  1 406 ? 15.440  0.862   -30.087 1.00 42.14  ?  406  ASN B CG  1 
ATOM   7275 O  OD1 . ASN B  1 406 ? 16.570  1.032   -30.538 1.00 47.08  ?  406  ASN B OD1 1 
ATOM   7276 N  ND2 . ASN B  1 406 ? 15.097  -0.223  -29.397 1.00 49.63  ?  406  ASN B ND2 1 
ATOM   7277 N  N   . VAL B  1 407 ? 12.902  4.750   -29.652 1.00 42.40  ?  407  VAL B N   1 
ATOM   7278 C  CA  . VAL B  1 407 ? 11.947  5.731   -30.162 1.00 37.30  ?  407  VAL B CA  1 
ATOM   7279 C  C   . VAL B  1 407 ? 11.819  6.999   -29.308 1.00 46.00  ?  407  VAL B C   1 
ATOM   7280 O  O   . VAL B  1 407 ? 12.212  8.089   -29.740 1.00 49.19  ?  407  VAL B O   1 
ATOM   7281 C  CB  . VAL B  1 407 ? 10.540  5.112   -30.365 1.00 44.68  ?  407  VAL B CB  1 
ATOM   7282 C  CG1 . VAL B  1 407 ? 9.568   6.149   -30.937 1.00 36.45  ?  407  VAL B CG1 1 
ATOM   7283 C  CG2 . VAL B  1 407 ? 10.605  3.878   -31.267 1.00 43.46  ?  407  VAL B CG2 1 
ATOM   7284 N  N   . VAL B  1 408 ? 11.285  6.845   -28.094 1.00 46.80  ?  408  VAL B N   1 
ATOM   7285 C  CA  . VAL B  1 408 ? 10.876  7.977   -27.256 1.00 43.68  ?  408  VAL B CA  1 
ATOM   7286 C  C   . VAL B  1 408 ? 11.972  9.008   -27.003 1.00 42.77  ?  408  VAL B C   1 
ATOM   7287 O  O   . VAL B  1 408 ? 11.758  10.218  -27.109 1.00 45.23  ?  408  VAL B O   1 
ATOM   7288 C  CB  . VAL B  1 408 ? 10.341  7.502   -25.904 1.00 45.25  ?  408  VAL B CB  1 
ATOM   7289 C  CG1 . VAL B  1 408 ? 9.891   8.704   -25.068 1.00 39.33  ?  408  VAL B CG1 1 
ATOM   7290 C  CG2 . VAL B  1 408 ? 9.201   6.516   -26.112 1.00 37.35  ?  408  VAL B CG2 1 
ATOM   7291 N  N   . CYS B  1 409 ? 13.155  8.535   -26.664 1.00 39.38  ?  409  CYS B N   1 
ATOM   7292 C  CA  . CYS B  1 409 ? 14.233  9.461   -26.431 1.00 38.95  ?  409  CYS B CA  1 
ATOM   7293 C  C   . CYS B  1 409 ? 14.827  10.053  -27.720 1.00 55.73  ?  409  CYS B C   1 
ATOM   7294 O  O   . CYS B  1 409 ? 15.036  11.264  -27.785 1.00 51.68  ?  409  CYS B O   1 
ATOM   7295 C  CB  . CYS B  1 409 ? 15.255  8.857   -25.476 1.00 41.61  ?  409  CYS B CB  1 
ATOM   7296 S  SG  . CYS B  1 409 ? 14.530  8.600   -23.828 1.00 56.28  ?  409  CYS B SG  1 
ATOM   7297 N  N   . PRO B  1 410 ? 15.071  9.216   -28.752 1.00 56.58  ?  410  PRO B N   1 
ATOM   7298 C  CA  . PRO B  1 410 ? 15.372  9.765   -30.080 1.00 49.45  ?  410  PRO B CA  1 
ATOM   7299 C  C   . PRO B  1 410 ? 14.395  10.862  -30.508 1.00 40.58  ?  410  PRO B C   1 
ATOM   7300 O  O   . PRO B  1 410 ? 14.832  11.917  -30.978 1.00 37.08  ?  410  PRO B O   1 
ATOM   7301 C  CB  . PRO B  1 410 ? 15.218  8.548   -30.984 1.00 48.11  ?  410  PRO B CB  1 
ATOM   7302 C  CG  . PRO B  1 410 ? 15.698  7.440   -30.146 1.00 57.75  ?  410  PRO B CG  1 
ATOM   7303 C  CD  . PRO B  1 410 ? 15.253  7.753   -28.735 1.00 60.06  ?  410  PRO B CD  1 
ATOM   7304 N  N   . VAL B  1 411 ? 13.101  10.621  -30.321 1.00 34.59  ?  411  VAL B N   1 
ATOM   7305 C  CA  . VAL B  1 411 ? 12.085  11.616  -30.640 1.00 33.59  ?  411  VAL B CA  1 
ATOM   7306 C  C   . VAL B  1 411 ? 12.253  12.895  -29.817 1.00 50.38  ?  411  VAL B C   1 
ATOM   7307 O  O   . VAL B  1 411 ? 12.200  14.005  -30.359 1.00 52.14  ?  411  VAL B O   1 
ATOM   7308 C  CB  . VAL B  1 411 ? 10.660  11.050  -30.457 1.00 35.27  ?  411  VAL B CB  1 
ATOM   7309 C  CG1 . VAL B  1 411 ? 9.642   12.173  -30.326 1.00 32.93  ?  411  VAL B CG1 1 
ATOM   7310 C  CG2 . VAL B  1 411 ? 10.280  10.121  -31.617 1.00 30.94  ?  411  VAL B CG2 1 
ATOM   7311 N  N   . ALA B  1 412 ? 12.468  12.732  -28.510 1.00 54.72  ?  412  ALA B N   1 
ATOM   7312 C  CA  . ALA B  1 412 ? 12.610  13.863  -27.603 1.00 50.42  ?  412  ALA B CA  1 
ATOM   7313 C  C   . ALA B  1 412 ? 13.808  14.715  -27.989 1.00 46.75  ?  412  ALA B C   1 
ATOM   7314 O  O   . ALA B  1 412 ? 13.721  15.942  -28.052 1.00 48.54  ?  412  ALA B O   1 
ATOM   7315 C  CB  . ALA B  1 412 ? 12.741  13.382  -26.179 1.00 54.93  ?  412  ALA B CB  1 
ATOM   7316 N  N   . GLN B  1 413 ? 14.926  14.056  -28.261 1.00 41.40  ?  413  GLN B N   1 
ATOM   7317 C  CA  . GLN B  1 413 ? 16.098  14.746  -28.789 1.00 44.42  ?  413  GLN B CA  1 
ATOM   7318 C  C   . GLN B  1 413 ? 15.840  15.544  -30.076 1.00 45.87  ?  413  GLN B C   1 
ATOM   7319 O  O   . GLN B  1 413 ? 16.299  16.681  -30.205 1.00 43.18  ?  413  GLN B O   1 
ATOM   7320 C  CB  . GLN B  1 413 ? 17.231  13.767  -29.041 1.00 44.79  ?  413  GLN B CB  1 
ATOM   7321 C  CG  . GLN B  1 413 ? 18.520  14.474  -29.387 1.00 59.35  ?  413  GLN B CG  1 
ATOM   7322 C  CD  . GLN B  1 413 ? 19.681  13.528  -29.461 1.00 75.34  ?  413  GLN B CD  1 
ATOM   7323 O  OE1 . GLN B  1 413 ? 19.673  12.579  -30.250 1.00 74.11  ?  413  GLN B OE1 1 
ATOM   7324 N  NE2 . GLN B  1 413 ? 20.692  13.764  -28.624 1.00 87.11  ?  413  GLN B NE2 1 
ATOM   7325 N  N   . LEU B  1 414 ? 15.126  14.942  -31.028 1.00 43.43  ?  414  LEU B N   1 
ATOM   7326 C  CA  . LEU B  1 414 ? 14.835  15.607  -32.294 1.00 47.42  ?  414  LEU B CA  1 
ATOM   7327 C  C   . LEU B  1 414 ? 13.930  16.821  -32.076 1.00 49.57  ?  414  LEU B C   1 
ATOM   7328 O  O   . LEU B  1 414 ? 14.217  17.917  -32.565 1.00 50.20  ?  414  LEU B O   1 
ATOM   7329 C  CB  . LEU B  1 414 ? 14.188  14.629  -33.277 1.00 45.21  ?  414  LEU B CB  1 
ATOM   7330 C  CG  . LEU B  1 414 ? 13.799  15.174  -34.657 1.00 42.20  ?  414  LEU B CG  1 
ATOM   7331 C  CD1 . LEU B  1 414 ? 15.019  15.472  -35.508 1.00 40.99  ?  414  LEU B CD1 1 
ATOM   7332 C  CD2 . LEU B  1 414 ? 12.912  14.187  -35.363 1.00 41.95  ?  414  LEU B CD2 1 
ATOM   7333 N  N   . ALA B  1 415 ? 12.838  16.610  -31.344 1.00 38.38  ?  415  ALA B N   1 
ATOM   7334 C  CA  . ALA B  1 415 ? 11.904  17.676  -31.010 1.00 38.53  ?  415  ALA B CA  1 
ATOM   7335 C  C   . ALA B  1 415 ? 12.638  18.852  -30.385 1.00 49.88  ?  415  ALA B C   1 
ATOM   7336 O  O   . ALA B  1 415 ? 12.384  20.014  -30.720 1.00 48.69  ?  415  ALA B O   1 
ATOM   7337 C  CB  . ALA B  1 415 ? 10.859  17.162  -30.053 1.00 39.67  ?  415  ALA B CB  1 
ATOM   7338 N  N   . GLY B  1 416 ? 13.550  18.533  -29.473 1.00 47.47  ?  416  GLY B N   1 
ATOM   7339 C  CA  . GLY B  1 416 ? 14.349  19.535  -28.806 1.00 50.53  ?  416  GLY B CA  1 
ATOM   7340 C  C   . GLY B  1 416 ? 15.282  20.294  -29.731 1.00 54.80  ?  416  GLY B C   1 
ATOM   7341 O  O   . GLY B  1 416 ? 15.313  21.525  -29.712 1.00 60.90  ?  416  GLY B O   1 
ATOM   7342 N  N   . ARG B  1 417 ? 16.054  19.576  -30.539 1.00 49.48  ?  417  ARG B N   1 
ATOM   7343 C  CA  . ARG B  1 417 ? 16.994  20.248  -31.431 1.00 48.61  ?  417  ARG B CA  1 
ATOM   7344 C  C   . ARG B  1 417 ? 16.269  21.088  -32.489 1.00 49.08  ?  417  ARG B C   1 
ATOM   7345 O  O   . ARG B  1 417 ? 16.703  22.191  -32.808 1.00 55.33  ?  417  ARG B O   1 
ATOM   7346 C  CB  . ARG B  1 417 ? 17.960  19.260  -32.084 1.00 47.87  ?  417  ARG B CB  1 
ATOM   7347 C  CG  . ARG B  1 417 ? 18.836  18.450  -31.119 1.00 56.95  ?  417  ARG B CG  1 
ATOM   7348 C  CD  . ARG B  1 417 ? 19.562  19.301  -30.063 1.00 66.30  ?  417  ARG B CD  1 
ATOM   7349 N  NE  . ARG B  1 417 ? 20.470  20.289  -30.640 1.00 74.45  ?  417  ARG B NE  1 
ATOM   7350 C  CZ  . ARG B  1 417 ? 21.678  20.575  -30.160 1.00 82.42  ?  417  ARG B CZ  1 
ATOM   7351 N  NH1 . ARG B  1 417 ? 22.148  19.942  -29.089 1.00 86.72  ?  417  ARG B NH1 1 
ATOM   7352 N  NH2 . ARG B  1 417 ? 22.424  21.494  -30.758 1.00 84.57  ?  417  ARG B NH2 1 
ATOM   7353 N  N   . LEU B  1 418 ? 15.156  20.584  -33.010 1.00 48.11  ?  418  LEU B N   1 
ATOM   7354 C  CA  . LEU B  1 418 ? 14.399  21.334  -34.009 1.00 51.90  ?  418  LEU B CA  1 
ATOM   7355 C  C   . LEU B  1 418 ? 13.830  22.622  -33.415 1.00 53.25  ?  418  LEU B C   1 
ATOM   7356 O  O   . LEU B  1 418 ? 14.006  23.705  -33.973 1.00 55.69  ?  418  LEU B O   1 
ATOM   7357 C  CB  . LEU B  1 418 ? 13.279  20.486  -34.614 1.00 47.69  ?  418  LEU B CB  1 
ATOM   7358 C  CG  . LEU B  1 418 ? 13.634  19.233  -35.425 1.00 50.73  ?  418  LEU B CG  1 
ATOM   7359 C  CD1 . LEU B  1 418 ? 12.406  18.683  -36.128 1.00 49.42  ?  418  LEU B CD1 1 
ATOM   7360 C  CD2 . LEU B  1 418 ? 14.707  19.501  -36.432 1.00 49.68  ?  418  LEU B CD2 1 
ATOM   7361 N  N   . ALA B  1 419 ? 13.156  22.497  -32.277 1.00 46.49  ?  419  ALA B N   1 
ATOM   7362 C  CA  . ALA B  1 419 ? 12.568  23.650  -31.601 1.00 50.50  ?  419  ALA B CA  1 
ATOM   7363 C  C   . ALA B  1 419 ? 13.588  24.755  -31.288 1.00 63.50  ?  419  ALA B C   1 
ATOM   7364 O  O   . ALA B  1 419 ? 13.329  25.936  -31.533 1.00 70.40  ?  419  ALA B O   1 
ATOM   7365 C  CB  . ALA B  1 419 ? 11.864  23.208  -30.340 1.00 41.86  ?  419  ALA B CB  1 
ATOM   7366 N  N   . ALA B  1 420 ? 14.744  24.362  -30.755 1.00 59.34  ?  420  ALA B N   1 
ATOM   7367 C  CA  . ALA B  1 420 ? 15.812  25.302  -30.429 1.00 60.21  ?  420  ALA B CA  1 
ATOM   7368 C  C   . ALA B  1 420 ? 16.311  26.041  -31.664 1.00 72.43  ?  420  ALA B C   1 
ATOM   7369 O  O   . ALA B  1 420 ? 16.673  27.217  -31.592 1.00 81.35  ?  420  ALA B O   1 
ATOM   7370 C  CB  . ALA B  1 420 ? 16.977  24.578  -29.752 1.00 54.18  ?  420  ALA B CB  1 
ATOM   7371 N  N   . GLN B  1 421 ? 16.332  25.349  -32.796 1.00 62.89  ?  421  GLN B N   1 
ATOM   7372 C  CA  . GLN B  1 421 ? 16.898  25.922  -34.001 1.00 65.15  ?  421  GLN B CA  1 
ATOM   7373 C  C   . GLN B  1 421 ? 15.851  26.452  -34.982 1.00 63.04  ?  421  GLN B C   1 
ATOM   7374 O  O   . GLN B  1 421 ? 16.031  26.370  -36.195 1.00 60.11  ?  421  GLN B O   1 
ATOM   7375 C  CB  . GLN B  1 421 ? 17.847  24.926  -34.668 1.00 73.17  ?  421  GLN B CB  1 
ATOM   7376 C  CG  . GLN B  1 421 ? 19.221  24.892  -34.011 1.00 84.09  ?  421  GLN B CG  1 
ATOM   7377 C  CD  . GLN B  1 421 ? 19.710  23.485  -33.734 1.00 88.09  ?  421  GLN B CD  1 
ATOM   7378 O  OE1 . GLN B  1 421 ? 20.005  23.127  -32.590 1.00 91.66  ?  421  GLN B OE1 1 
ATOM   7379 N  NE2 . GLN B  1 421 ? 19.804  22.679  -34.782 1.00 85.02  ?  421  GLN B NE2 1 
ATOM   7380 N  N   . GLY B  1 422 ? 14.761  26.997  -34.449 1.00 62.02  ?  422  GLY B N   1 
ATOM   7381 C  CA  . GLY B  1 422 ? 13.838  27.781  -35.253 1.00 62.10  ?  422  GLY B CA  1 
ATOM   7382 C  C   . GLY B  1 422 ? 12.626  27.073  -35.836 1.00 58.07  ?  422  GLY B C   1 
ATOM   7383 O  O   . GLY B  1 422 ? 11.710  27.734  -36.325 1.00 58.74  ?  422  GLY B O   1 
ATOM   7384 N  N   . ALA B  1 423 ? 12.614  25.743  -35.788 1.00 50.32  ?  423  ALA B N   1 
ATOM   7385 C  CA  . ALA B  1 423 ? 11.485  24.976  -36.308 1.00 50.50  ?  423  ALA B CA  1 
ATOM   7386 C  C   . ALA B  1 423 ? 10.236  25.104  -35.448 1.00 55.30  ?  423  ALA B C   1 
ATOM   7387 O  O   . ALA B  1 423 ? 10.307  25.342  -34.247 1.00 56.29  ?  423  ALA B O   1 
ATOM   7388 C  CB  . ALA B  1 423 ? 11.855  23.506  -36.469 1.00 47.04  ?  423  ALA B CB  1 
ATOM   7389 N  N   . ARG B  1 424 ? 9.085   24.923  -36.077 1.00 56.06  ?  424  ARG B N   1 
ATOM   7390 C  CA  . ARG B  1 424 ? 7.828   24.895  -35.356 1.00 52.01  ?  424  ARG B CA  1 
ATOM   7391 C  C   . ARG B  1 424 ? 7.399   23.445  -35.104 1.00 50.26  ?  424  ARG B C   1 
ATOM   7392 O  O   . ARG B  1 424 ? 7.192   22.662  -36.044 1.00 42.57  ?  424  ARG B O   1 
ATOM   7393 C  CB  . ARG B  1 424 ? 6.778   25.638  -36.150 1.00 56.24  ?  424  ARG B CB  1 
ATOM   7394 C  CG  . ARG B  1 424 ? 5.753   26.294  -35.300 1.00 67.74  ?  424  ARG B CG  1 
ATOM   7395 C  CD  . ARG B  1 424 ? 5.152   27.456  -36.040 1.00 76.61  ?  424  ARG B CD  1 
ATOM   7396 N  NE  . ARG B  1 424 ? 3.825   27.763  -35.538 1.00 76.13  ?  424  ARG B NE  1 
ATOM   7397 C  CZ  . ARG B  1 424 ? 3.588   28.318  -34.357 1.00 65.26  ?  424  ARG B CZ  1 
ATOM   7398 N  NH1 . ARG B  1 424 ? 4.589   28.629  -33.542 1.00 62.38  ?  424  ARG B NH1 1 
ATOM   7399 N  NH2 . ARG B  1 424 ? 2.342   28.560  -33.994 1.00 63.37  ?  424  ARG B NH2 1 
ATOM   7400 N  N   . VAL B  1 425 ? 7.280   23.094  -33.827 1.00 44.14  ?  425  VAL B N   1 
ATOM   7401 C  CA  . VAL B  1 425 ? 7.104   21.703  -33.427 1.00 42.30  ?  425  VAL B CA  1 
ATOM   7402 C  C   . VAL B  1 425 ? 5.845   21.474  -32.597 1.00 40.23  ?  425  VAL B C   1 
ATOM   7403 O  O   . VAL B  1 425 ? 5.533   22.248  -31.700 1.00 44.54  ?  425  VAL B O   1 
ATOM   7404 C  CB  . VAL B  1 425 ? 8.330   21.204  -32.629 1.00 44.83  ?  425  VAL B CB  1 
ATOM   7405 C  CG1 . VAL B  1 425 ? 8.285   19.690  -32.468 1.00 45.46  ?  425  VAL B CG1 1 
ATOM   7406 C  CG2 . VAL B  1 425 ? 9.624   21.627  -33.324 1.00 32.23  ?  425  VAL B CG2 1 
ATOM   7407 N  N   . TYR B  1 426 ? 5.112   20.417  -32.918 1.00 36.35  ?  426  TYR B N   1 
ATOM   7408 C  CA  . TYR B  1 426 ? 4.001   19.978  -32.089 1.00 34.19  ?  426  TYR B CA  1 
ATOM   7409 C  C   . TYR B  1 426 ? 4.271   18.531  -31.750 1.00 42.79  ?  426  TYR B C   1 
ATOM   7410 O  O   . TYR B  1 426 ? 4.665   17.737  -32.623 1.00 42.28  ?  426  TYR B O   1 
ATOM   7411 C  CB  . TYR B  1 426 ? 2.654   20.131  -32.806 1.00 38.09  ?  426  TYR B CB  1 
ATOM   7412 C  CG  . TYR B  1 426 ? 2.318   21.567  -33.124 1.00 38.33  ?  426  TYR B CG  1 
ATOM   7413 C  CD1 . TYR B  1 426 ? 2.771   22.167  -34.301 1.00 41.01  ?  426  TYR B CD1 1 
ATOM   7414 C  CD2 . TYR B  1 426 ? 1.575   22.331  -32.242 1.00 37.17  ?  426  TYR B CD2 1 
ATOM   7415 C  CE1 . TYR B  1 426 ? 2.479   23.492  -34.585 1.00 39.73  ?  426  TYR B CE1 1 
ATOM   7416 C  CE2 . TYR B  1 426 ? 1.281   23.651  -32.512 1.00 46.77  ?  426  TYR B CE2 1 
ATOM   7417 C  CZ  . TYR B  1 426 ? 1.731   24.225  -33.687 1.00 47.15  ?  426  TYR B CZ  1 
ATOM   7418 O  OH  . TYR B  1 426 ? 1.429   25.538  -33.947 1.00 52.61  ?  426  TYR B OH  1 
ATOM   7419 N  N   . ALA B  1 427 ? 4.089   18.197  -30.476 1.00 38.56  ?  427  ALA B N   1 
ATOM   7420 C  CA  . ALA B  1 427 ? 4.420   16.873  -29.995 1.00 32.47  ?  427  ALA B CA  1 
ATOM   7421 C  C   . ALA B  1 427 ? 3.218   16.259  -29.330 1.00 35.72  ?  427  ALA B C   1 
ATOM   7422 O  O   . ALA B  1 427 ? 2.413   16.960  -28.724 1.00 41.10  ?  427  ALA B O   1 
ATOM   7423 C  CB  . ALA B  1 427 ? 5.587   16.934  -29.038 1.00 36.11  ?  427  ALA B CB  1 
ATOM   7424 N  N   . TYR B  1 428 ? 3.093   14.943  -29.455 1.00 36.07  ?  428  TYR B N   1 
ATOM   7425 C  CA  . TYR B  1 428 ? 1.952   14.237  -28.888 1.00 35.59  ?  428  TYR B CA  1 
ATOM   7426 C  C   . TYR B  1 428 ? 2.431   12.898  -28.392 1.00 38.62  ?  428  TYR B C   1 
ATOM   7427 O  O   . TYR B  1 428 ? 3.491   12.409  -28.802 1.00 35.32  ?  428  TYR B O   1 
ATOM   7428 C  CB  . TYR B  1 428 ? 0.847   13.985  -29.945 1.00 42.49  ?  428  TYR B CB  1 
ATOM   7429 C  CG  . TYR B  1 428 ? 1.272   12.986  -31.010 1.00 44.25  ?  428  TYR B CG  1 
ATOM   7430 C  CD1 . TYR B  1 428 ? 1.160   11.611  -30.802 1.00 48.08  ?  428  TYR B CD1 1 
ATOM   7431 C  CD2 . TYR B  1 428 ? 1.819   13.421  -32.209 1.00 41.18  ?  428  TYR B CD2 1 
ATOM   7432 C  CE1 . TYR B  1 428 ? 1.585   10.700  -31.762 1.00 55.52  ?  428  TYR B CE1 1 
ATOM   7433 C  CE2 . TYR B  1 428 ? 2.232   12.517  -33.187 1.00 48.63  ?  428  TYR B CE2 1 
ATOM   7434 C  CZ  . TYR B  1 428 ? 2.115   11.158  -32.956 1.00 52.05  ?  428  TYR B CZ  1 
ATOM   7435 O  OH  . TYR B  1 428 ? 2.535   10.258  -33.913 1.00 46.72  ?  428  TYR B OH  1 
ATOM   7436 N  N   . ILE B  1 429 ? 1.620   12.299  -27.531 1.00 44.73  ?  429  ILE B N   1 
ATOM   7437 C  CA  . ILE B  1 429 ? 1.721   10.884  -27.224 1.00 43.54  ?  429  ILE B CA  1 
ATOM   7438 C  C   . ILE B  1 429 ? 0.340   10.251  -27.382 1.00 44.95  ?  429  ILE B C   1 
ATOM   7439 O  O   . ILE B  1 429 ? -0.669  10.805  -26.951 1.00 45.98  ?  429  ILE B O   1 
ATOM   7440 C  CB  . ILE B  1 429 ? 2.288   10.643  -25.825 1.00 41.75  ?  429  ILE B CB  1 
ATOM   7441 C  CG1 . ILE B  1 429 ? 2.314   9.144   -25.526 1.00 43.74  ?  429  ILE B CG1 1 
ATOM   7442 C  CG2 . ILE B  1 429 ? 1.482   11.414  -24.783 1.00 47.27  ?  429  ILE B CG2 1 
ATOM   7443 C  CD1 . ILE B  1 429 ? 3.057   8.794   -24.240 1.00 53.11  ?  429  ILE B CD1 1 
ATOM   7444 N  N   . PHE B  1 430 ? 0.300   9.103   -28.042 1.00 45.30  ?  430  PHE B N   1 
ATOM   7445 C  CA  . PHE B  1 430 ? -0.951  8.445   -28.373 1.00 39.18  ?  430  PHE B CA  1 
ATOM   7446 C  C   . PHE B  1 430 ? -1.223  7.321   -27.379 1.00 37.99  ?  430  PHE B C   1 
ATOM   7447 O  O   . PHE B  1 430 ? -0.456  6.355   -27.305 1.00 43.02  ?  430  PHE B O   1 
ATOM   7448 C  CB  . PHE B  1 430 ? -0.830  7.880   -29.787 1.00 45.14  ?  430  PHE B CB  1 
ATOM   7449 C  CG  . PHE B  1 430 ? -2.093  7.287   -30.323 1.00 44.32  ?  430  PHE B CG  1 
ATOM   7450 C  CD1 . PHE B  1 430 ? -3.018  8.081   -30.981 1.00 43.14  ?  430  PHE B CD1 1 
ATOM   7451 C  CD2 . PHE B  1 430 ? -2.350  5.929   -30.185 1.00 44.17  ?  430  PHE B CD2 1 
ATOM   7452 C  CE1 . PHE B  1 430 ? -4.188  7.531   -31.503 1.00 48.20  ?  430  PHE B CE1 1 
ATOM   7453 C  CE2 . PHE B  1 430 ? -3.518  5.372   -30.699 1.00 48.66  ?  430  PHE B CE2 1 
ATOM   7454 C  CZ  . PHE B  1 430 ? -4.437  6.175   -31.365 1.00 44.92  ?  430  PHE B CZ  1 
ATOM   7455 N  N   . GLU B  1 431 ? -2.328  7.430   -26.644 1.00 39.13  ?  431  GLU B N   1 
ATOM   7456 C  CA  . GLU B  1 431 ? -2.562  6.590   -25.462 1.00 47.71  ?  431  GLU B CA  1 
ATOM   7457 C  C   . GLU B  1 431 ? -3.813  5.731   -25.549 1.00 51.26  ?  431  GLU B C   1 
ATOM   7458 O  O   . GLU B  1 431 ? -4.191  5.074   -24.578 1.00 58.59  ?  431  GLU B O   1 
ATOM   7459 C  CB  . GLU B  1 431 ? -2.661  7.449   -24.186 1.00 37.40  ?  431  GLU B CB  1 
ATOM   7460 C  CG  . GLU B  1 431 ? -1.388  8.177   -23.774 1.00 41.01  ?  431  GLU B CG  1 
ATOM   7461 C  CD  . GLU B  1 431 ? -1.558  8.942   -22.462 1.00 56.79  ?  431  GLU B CD  1 
ATOM   7462 O  OE1 . GLU B  1 431 ? -2.556  9.681   -22.325 1.00 60.65  ?  431  GLU B OE1 1 
ATOM   7463 O  OE2 . GLU B  1 431 ? -0.705  8.799   -21.559 1.00 60.62  ?  431  GLU B OE2 1 
ATOM   7464 N  N   . HIS B  1 432 ? -4.476  5.749   -26.689 1.00 51.36  ?  432  HIS B N   1 
ATOM   7465 C  CA  . HIS B  1 432 ? -5.670  4.935   -26.834 1.00 54.75  ?  432  HIS B CA  1 
ATOM   7466 C  C   . HIS B  1 432 ? -5.374  3.576   -27.456 1.00 54.22  ?  432  HIS B C   1 
ATOM   7467 O  O   . HIS B  1 432 ? -4.883  3.504   -28.580 1.00 53.22  ?  432  HIS B O   1 
ATOM   7468 C  CB  . HIS B  1 432 ? -6.711  5.632   -27.690 1.00 52.36  ?  432  HIS B CB  1 
ATOM   7469 C  CG  . HIS B  1 432 ? -7.858  4.745   -28.030 1.00 52.39  ?  432  HIS B CG  1 
ATOM   7470 N  ND1 . HIS B  1 432 ? -8.893  4.509   -27.155 1.00 57.14  ?  432  HIS B ND1 1 
ATOM   7471 C  CD2 . HIS B  1 432 ? -8.103  3.981   -29.120 1.00 54.76  ?  432  HIS B CD2 1 
ATOM   7472 C  CE1 . HIS B  1 432 ? -9.748  3.666   -27.705 1.00 58.62  ?  432  HIS B CE1 1 
ATOM   7473 N  NE2 . HIS B  1 432 ? -9.293  3.331   -28.898 1.00 59.96  ?  432  HIS B NE2 1 
ATOM   7474 N  N   . ARG B  1 433 ? -5.693  2.504   -26.735 1.00 49.44  ?  433  ARG B N   1 
ATOM   7475 C  CA  . ARG B  1 433 ? -5.547  1.153   -27.271 1.00 54.45  ?  433  ARG B CA  1 
ATOM   7476 C  C   . ARG B  1 433 ? -6.816  0.733   -28.024 1.00 55.64  ?  433  ARG B C   1 
ATOM   7477 O  O   . ARG B  1 433 ? -7.929  0.836   -27.500 1.00 54.97  ?  433  ARG B O   1 
ATOM   7478 C  CB  . ARG B  1 433 ? -5.248  0.162   -26.145 1.00 58.08  ?  433  ARG B CB  1 
ATOM   7479 C  CG  . ARG B  1 433 ? -5.164  -1.290  -26.594 1.00 62.13  ?  433  ARG B CG  1 
ATOM   7480 C  CD  . ARG B  1 433 ? -4.937  -2.209  -25.407 1.00 59.69  ?  433  ARG B CD  1 
ATOM   7481 N  NE  . ARG B  1 433 ? -5.337  -3.585  -25.681 1.00 62.81  ?  433  ARG B NE  1 
ATOM   7482 C  CZ  . ARG B  1 433 ? -4.489  -4.590  -25.871 1.00 62.43  ?  433  ARG B CZ  1 
ATOM   7483 N  NH1 . ARG B  1 433 ? -3.182  -4.376  -25.814 1.00 60.28  ?  433  ARG B NH1 1 
ATOM   7484 N  NH2 . ARG B  1 433 ? -4.951  -5.810  -26.111 1.00 59.07  ?  433  ARG B NH2 1 
ATOM   7485 N  N   . ALA B  1 434 ? -6.643  0.263   -29.252 1.00 54.45  ?  434  ALA B N   1 
ATOM   7486 C  CA  . ALA B  1 434 ? -7.776  -0.148  -30.081 1.00 57.18  ?  434  ALA B CA  1 
ATOM   7487 C  C   . ALA B  1 434 ? -8.636  -1.219  -29.412 1.00 59.73  ?  434  ALA B C   1 
ATOM   7488 O  O   . ALA B  1 434 ? -8.120  -2.154  -28.808 1.00 60.08  ?  434  ALA B O   1 
ATOM   7489 C  CB  . ALA B  1 434 ? -7.290  -0.629  -31.439 1.00 49.56  ?  434  ALA B CB  1 
ATOM   7490 N  N   . SER B  1 435 ? -9.953  -1.065  -29.516 1.00 60.35  ?  435  SER B N   1 
ATOM   7491 C  CA  . SER B  1 435 ? -10.884 -2.064  -29.009 1.00 59.95  ?  435  SER B CA  1 
ATOM   7492 C  C   . SER B  1 435 ? -10.815 -3.332  -29.856 1.00 66.96  ?  435  SER B C   1 
ATOM   7493 O  O   . SER B  1 435 ? -11.213 -4.413  -29.416 1.00 72.23  ?  435  SER B O   1 
ATOM   7494 C  CB  . SER B  1 435 ? -12.318 -1.516  -28.998 1.00 61.83  ?  435  SER B CB  1 
ATOM   7495 O  OG  . SER B  1 435 ? -12.817 -1.314  -30.311 1.00 65.92  ?  435  SER B OG  1 
ATOM   7496 N  N   . THR B  1 436 ? -10.301 -3.190  -31.074 1.00 61.29  ?  436  THR B N   1 
ATOM   7497 C  CA  . THR B  1 436 ? -10.216 -4.300  -32.007 1.00 59.19  ?  436  THR B CA  1 
ATOM   7498 C  C   . THR B  1 436 ? -8.831  -4.932  -32.029 1.00 60.02  ?  436  THR B C   1 
ATOM   7499 O  O   . THR B  1 436 ? -8.556  -5.818  -32.841 1.00 61.27  ?  436  THR B O   1 
ATOM   7500 C  CB  . THR B  1 436 ? -10.543 -3.831  -33.426 1.00 60.09  ?  436  THR B CB  1 
ATOM   7501 O  OG1 . THR B  1 436 ? -9.761  -2.667  -33.728 1.00 58.15  ?  436  THR B OG1 1 
ATOM   7502 C  CG2 . THR B  1 436 ? -12.020 -3.494  -33.542 1.00 45.83  ?  436  THR B CG2 1 
ATOM   7503 N  N   . LEU B  1 437 ? -7.956  -4.472  -31.143 1.00 57.38  ?  437  LEU B N   1 
ATOM   7504 C  CA  . LEU B  1 437 ? -6.573  -4.936  -31.128 1.00 57.82  ?  437  LEU B CA  1 
ATOM   7505 C  C   . LEU B  1 437 ? -6.458  -6.406  -30.718 1.00 59.12  ?  437  LEU B C   1 
ATOM   7506 O  O   . LEU B  1 437 ? -7.164  -6.863  -29.826 1.00 59.73  ?  437  LEU B O   1 
ATOM   7507 C  CB  . LEU B  1 437 ? -5.758  -4.068  -30.192 1.00 53.97  ?  437  LEU B CB  1 
ATOM   7508 C  CG  . LEU B  1 437 ? -4.279  -4.001  -30.516 1.00 57.51  ?  437  LEU B CG  1 
ATOM   7509 C  CD1 . LEU B  1 437 ? -3.923  -2.554  -30.732 1.00 61.07  ?  437  LEU B CD1 1 
ATOM   7510 C  CD2 . LEU B  1 437 ? -3.492  -4.583  -29.365 1.00 64.73  ?  437  LEU B CD2 1 
ATOM   7511 N  N   . THR B  1 438 ? -5.561  -7.140  -31.366 1.00 52.40  ?  438  THR B N   1 
ATOM   7512 C  CA  . THR B  1 438 ? -5.483  -8.590  -31.186 1.00 58.00  ?  438  THR B CA  1 
ATOM   7513 C  C   . THR B  1 438 ? -4.334  -9.058  -30.286 1.00 66.22  ?  438  THR B C   1 
ATOM   7514 O  O   . THR B  1 438 ? -4.322  -10.203 -29.822 1.00 67.78  ?  438  THR B O   1 
ATOM   7515 C  CB  . THR B  1 438 ? -5.400  -9.300  -32.547 1.00 60.98  ?  438  THR B CB  1 
ATOM   7516 O  OG1 . THR B  1 438 ? -4.513  -8.575  -33.418 1.00 52.55  ?  438  THR B OG1 1 
ATOM   7517 C  CG2 . THR B  1 438 ? -6.777  -9.348  -33.179 1.00 65.22  ?  438  THR B CG2 1 
ATOM   7518 N  N   . TRP B  1 439 ? -3.370  -8.173  -30.044 1.00 64.67  ?  439  TRP B N   1 
ATOM   7519 C  CA  . TRP B  1 439 ? -2.265  -8.460  -29.130 1.00 57.41  ?  439  TRP B CA  1 
ATOM   7520 C  C   . TRP B  1 439 ? -2.755  -8.454  -27.679 1.00 55.31  ?  439  TRP B C   1 
ATOM   7521 O  O   . TRP B  1 439 ? -3.772  -7.829  -27.370 1.00 57.85  ?  439  TRP B O   1 
ATOM   7522 C  CB  . TRP B  1 439 ? -1.143  -7.434  -29.321 1.00 55.81  ?  439  TRP B CB  1 
ATOM   7523 C  CG  . TRP B  1 439 ? -0.540  -7.447  -30.694 1.00 54.24  ?  439  TRP B CG  1 
ATOM   7524 C  CD1 . TRP B  1 439 ? -0.858  -6.624  -31.739 1.00 52.20  ?  439  TRP B CD1 1 
ATOM   7525 C  CD2 . TRP B  1 439 ? 0.486   -8.329  -31.178 1.00 53.78  ?  439  TRP B CD2 1 
ATOM   7526 N  NE1 . TRP B  1 439 ? -0.095  -6.938  -32.838 1.00 39.83  ?  439  TRP B NE1 1 
ATOM   7527 C  CE2 . TRP B  1 439 ? 0.735   -7.982  -32.524 1.00 52.74  ?  439  TRP B CE2 1 
ATOM   7528 C  CE3 . TRP B  1 439 ? 1.212   -9.382  -30.607 1.00 48.30  ?  439  TRP B CE3 1 
ATOM   7529 C  CZ2 . TRP B  1 439 ? 1.680   -8.645  -33.302 1.00 50.36  ?  439  TRP B CZ2 1 
ATOM   7530 C  CZ3 . TRP B  1 439 ? 2.157   -10.030 -31.374 1.00 49.23  ?  439  TRP B CZ3 1 
ATOM   7531 C  CH2 . TRP B  1 439 ? 2.381   -9.663  -32.712 1.00 54.47  ?  439  TRP B CH2 1 
ATOM   7532 N  N   . PRO B  1 440 ? -2.044  -9.156  -26.780 1.00 51.49  ?  440  PRO B N   1 
ATOM   7533 C  CA  . PRO B  1 440 ? -2.494  -9.190  -25.379 1.00 56.91  ?  440  PRO B CA  1 
ATOM   7534 C  C   . PRO B  1 440 ? -2.452  -7.824  -24.688 1.00 56.56  ?  440  PRO B C   1 
ATOM   7535 O  O   . PRO B  1 440 ? -1.787  -6.895  -25.153 1.00 58.51  ?  440  PRO B O   1 
ATOM   7536 C  CB  . PRO B  1 440 ? -1.519  -10.167 -24.708 1.00 52.15  ?  440  PRO B CB  1 
ATOM   7537 C  CG  . PRO B  1 440 ? -0.328  -10.180 -25.579 1.00 53.16  ?  440  PRO B CG  1 
ATOM   7538 C  CD  . PRO B  1 440 ? -0.843  -9.980  -26.991 1.00 49.97  ?  440  PRO B CD  1 
ATOM   7539 N  N   . LEU B  1 441 ? -3.177  -7.715  -23.584 1.00 54.35  ?  441  LEU B N   1 
ATOM   7540 C  CA  . LEU B  1 441 ? -3.280  -6.463  -22.840 1.00 64.92  ?  441  LEU B CA  1 
ATOM   7541 C  C   . LEU B  1 441 ? -1.946  -5.911  -22.344 1.00 60.49  ?  441  LEU B C   1 
ATOM   7542 O  O   . LEU B  1 441 ? -1.793  -4.699  -22.174 1.00 61.65  ?  441  LEU B O   1 
ATOM   7543 C  CB  . LEU B  1 441 ? -4.230  -6.635  -21.652 1.00 68.37  ?  441  LEU B CB  1 
ATOM   7544 C  CG  . LEU B  1 441 ? -5.706  -6.741  -22.035 1.00 74.79  ?  441  LEU B CG  1 
ATOM   7545 C  CD1 . LEU B  1 441 ? -6.556  -7.112  -20.828 1.00 76.03  ?  441  LEU B CD1 1 
ATOM   7546 C  CD2 . LEU B  1 441 ? -6.168  -5.425  -22.635 1.00 71.67  ?  441  LEU B CD2 1 
ATOM   7547 N  N   . TRP B  1 442 ? -0.986  -6.794  -22.100 1.00 55.87  ?  442  TRP B N   1 
ATOM   7548 C  CA  . TRP B  1 442 ? 0.264   -6.356  -21.490 1.00 59.76  ?  442  TRP B CA  1 
ATOM   7549 C  C   . TRP B  1 442 ? 1.106   -5.518  -22.442 1.00 57.76  ?  442  TRP B C   1 
ATOM   7550 O  O   . TRP B  1 442 ? 1.949   -4.732  -22.004 1.00 55.74  ?  442  TRP B O   1 
ATOM   7551 C  CB  . TRP B  1 442 ? 1.070   -7.538  -20.926 1.00 62.82  ?  442  TRP B CB  1 
ATOM   7552 C  CG  . TRP B  1 442 ? 1.692   -8.470  -21.947 1.00 65.07  ?  442  TRP B CG  1 
ATOM   7553 C  CD1 . TRP B  1 442 ? 1.248   -9.711  -22.293 1.00 64.10  ?  442  TRP B CD1 1 
ATOM   7554 C  CD2 . TRP B  1 442 ? 2.888   -8.243  -22.719 1.00 59.72  ?  442  TRP B CD2 1 
ATOM   7555 N  NE1 . TRP B  1 442 ? 2.080   -10.265 -23.235 1.00 64.77  ?  442  TRP B NE1 1 
ATOM   7556 C  CE2 . TRP B  1 442 ? 3.093   -9.386  -23.513 1.00 59.03  ?  442  TRP B CE2 1 
ATOM   7557 C  CE3 . TRP B  1 442 ? 3.802   -7.184  -22.811 1.00 52.44  ?  442  TRP B CE3 1 
ATOM   7558 C  CZ2 . TRP B  1 442 ? 4.167   -9.503  -24.392 1.00 60.11  ?  442  TRP B CZ2 1 
ATOM   7559 C  CZ3 . TRP B  1 442 ? 4.869   -7.300  -23.676 1.00 52.41  ?  442  TRP B CZ3 1 
ATOM   7560 C  CH2 . TRP B  1 442 ? 5.043   -8.452  -24.460 1.00 59.81  ?  442  TRP B CH2 1 
ATOM   7561 N  N   . MET B  1 443 ? 0.881   -5.685  -23.741 1.00 52.39  ?  443  MET B N   1 
ATOM   7562 C  CA  . MET B  1 443 ? 1.634   -4.917  -24.716 1.00 46.94  ?  443  MET B CA  1 
ATOM   7563 C  C   . MET B  1 443 ? 1.139   -3.477  -24.784 1.00 52.79  ?  443  MET B C   1 
ATOM   7564 O  O   . MET B  1 443 ? 1.809   -2.611  -25.353 1.00 50.46  ?  443  MET B O   1 
ATOM   7565 C  CB  . MET B  1 443 ? 1.581   -5.568  -26.091 1.00 44.29  ?  443  MET B CB  1 
ATOM   7566 C  CG  . MET B  1 443 ? 2.287   -6.910  -26.181 1.00 43.67  ?  443  MET B CG  1 
ATOM   7567 S  SD  . MET B  1 443 ? 2.292   -7.541  -27.889 1.00 49.17  ?  443  MET B SD  1 
ATOM   7568 C  CE  . MET B  1 443 ? 2.724   -9.243  -27.564 1.00 95.78  ?  443  MET B CE  1 
ATOM   7569 N  N   . GLY B  1 444 ? -0.032  -3.227  -24.202 1.00 50.48  ?  444  GLY B N   1 
ATOM   7570 C  CA  . GLY B  1 444 ? -0.584  -1.883  -24.144 1.00 53.03  ?  444  GLY B CA  1 
ATOM   7571 C  C   . GLY B  1 444 ? -0.963  -1.300  -25.498 1.00 56.00  ?  444  GLY B C   1 
ATOM   7572 O  O   . GLY B  1 444 ? -1.756  -1.888  -26.232 1.00 54.91  ?  444  GLY B O   1 
ATOM   7573 N  N   . VAL B  1 445 ? -0.421  -0.124  -25.811 1.00 51.16  ?  445  VAL B N   1 
ATOM   7574 C  CA  . VAL B  1 445 ? -0.610  0.500   -27.119 1.00 45.14  ?  445  VAL B CA  1 
ATOM   7575 C  C   . VAL B  1 445 ? 0.677   0.339   -27.918 1.00 47.24  ?  445  VAL B C   1 
ATOM   7576 O  O   . VAL B  1 445 ? 1.589   1.151   -27.797 1.00 45.23  ?  445  VAL B O   1 
ATOM   7577 C  CB  . VAL B  1 445 ? -0.890  2.005   -27.002 1.00 39.94  ?  445  VAL B CB  1 
ATOM   7578 C  CG1 . VAL B  1 445 ? -1.290  2.569   -28.354 1.00 34.82  ?  445  VAL B CG1 1 
ATOM   7579 C  CG2 . VAL B  1 445 ? -1.958  2.277   -25.973 1.00 34.29  ?  445  VAL B CG2 1 
ATOM   7580 N  N   . PRO B  1 446 ? 0.766   -0.721  -28.729 1.00 44.83  ?  446  PRO B N   1 
ATOM   7581 C  CA  . PRO B  1 446 ? 2.056   -1.063  -29.347 1.00 44.68  ?  446  PRO B CA  1 
ATOM   7582 C  C   . PRO B  1 446 ? 2.492   -0.124  -30.478 1.00 42.89  ?  446  PRO B C   1 
ATOM   7583 O  O   . PRO B  1 446 ? 1.694   0.638   -31.021 1.00 41.88  ?  446  PRO B O   1 
ATOM   7584 C  CB  . PRO B  1 446 ? 1.825   -2.482  -29.895 1.00 40.69  ?  446  PRO B CB  1 
ATOM   7585 C  CG  . PRO B  1 446 ? 0.558   -2.970  -29.228 1.00 45.74  ?  446  PRO B CG  1 
ATOM   7586 C  CD  . PRO B  1 446 ? -0.261  -1.742  -28.983 1.00 41.59  ?  446  PRO B CD  1 
ATOM   7587 N  N   . HIS B  1 447 ? 3.779   -0.188  -30.801 1.00 44.68  ?  447  HIS B N   1 
ATOM   7588 C  CA  . HIS B  1 447 ? 4.350   0.485   -31.958 1.00 47.80  ?  447  HIS B CA  1 
ATOM   7589 C  C   . HIS B  1 447 ? 3.437   0.271   -33.179 1.00 50.12  ?  447  HIS B C   1 
ATOM   7590 O  O   . HIS B  1 447 ? 3.112   -0.864  -33.530 1.00 47.35  ?  447  HIS B O   1 
ATOM   7591 C  CB  . HIS B  1 447 ? 5.753   -0.097  -32.195 1.00 47.36  ?  447  HIS B CB  1 
ATOM   7592 C  CG  . HIS B  1 447 ? 6.566   0.628   -33.222 1.00 48.31  ?  447  HIS B CG  1 
ATOM   7593 N  ND1 . HIS B  1 447 ? 6.946   1.946   -33.084 1.00 47.70  ?  447  HIS B ND1 1 
ATOM   7594 C  CD2 . HIS B  1 447 ? 7.098   0.205   -34.393 1.00 50.03  ?  447  HIS B CD2 1 
ATOM   7595 C  CE1 . HIS B  1 447 ? 7.668   2.307   -34.130 1.00 43.85  ?  447  HIS B CE1 1 
ATOM   7596 N  NE2 . HIS B  1 447 ? 7.776   1.267   -34.938 1.00 46.91  ?  447  HIS B NE2 1 
ATOM   7597 N  N   . GLY B  1 448 ? 2.968   1.359   -33.782 1.00 48.04  ?  448  GLY B N   1 
ATOM   7598 C  CA  . GLY B  1 448 ? 2.220   1.260   -35.029 1.00 39.87  ?  448  GLY B CA  1 
ATOM   7599 C  C   . GLY B  1 448 ? 0.705   1.282   -34.955 1.00 46.43  ?  448  GLY B C   1 
ATOM   7600 O  O   . GLY B  1 448 ? 0.041   1.313   -35.991 1.00 55.67  ?  448  GLY B O   1 
ATOM   7601 N  N   . TYR B  1 449 ? 0.134   1.289   -33.755 1.00 42.96  ?  449  TYR B N   1 
ATOM   7602 C  CA  . TYR B  1 449 ? -1.320  1.184   -33.656 1.00 39.21  ?  449  TYR B CA  1 
ATOM   7603 C  C   . TYR B  1 449 ? -2.096  2.496   -33.543 1.00 36.17  ?  449  TYR B C   1 
ATOM   7604 O  O   . TYR B  1 449 ? -3.314  2.497   -33.380 1.00 38.26  ?  449  TYR B O   1 
ATOM   7605 C  CB  . TYR B  1 449 ? -1.730  0.120   -32.631 1.00 46.31  ?  449  TYR B CB  1 
ATOM   7606 C  CG  . TYR B  1 449 ? -1.417  -1.245  -33.184 1.00 52.50  ?  449  TYR B CG  1 
ATOM   7607 C  CD1 . TYR B  1 449 ? -0.158  -1.807  -33.023 1.00 47.33  ?  449  TYR B CD1 1 
ATOM   7608 C  CD2 . TYR B  1 449 ? -2.356  -1.937  -33.946 1.00 52.79  ?  449  TYR B CD2 1 
ATOM   7609 C  CE1 . TYR B  1 449 ? 0.145   -3.044  -33.572 1.00 49.32  ?  449  TYR B CE1 1 
ATOM   7610 C  CE2 . TYR B  1 449 ? -2.070  -3.174  -34.483 1.00 45.17  ?  449  TYR B CE2 1 
ATOM   7611 C  CZ  . TYR B  1 449 ? -0.814  -3.724  -34.298 1.00 50.07  ?  449  TYR B CZ  1 
ATOM   7612 O  OH  . TYR B  1 449 ? -0.517  -4.956  -34.845 1.00 53.40  ?  449  TYR B OH  1 
ATOM   7613 N  N   . GLU B  1 450 ? -1.397  3.613   -33.695 1.00 31.51  ?  450  GLU B N   1 
ATOM   7614 C  CA  . GLU B  1 450 ? -2.071  4.881   -33.948 1.00 39.02  ?  450  GLU B CA  1 
ATOM   7615 C  C   . GLU B  1 450 ? -2.444  5.035   -35.444 1.00 44.50  ?  450  GLU B C   1 
ATOM   7616 O  O   . GLU B  1 450 ? -3.368  5.779   -35.785 1.00 47.70  ?  450  GLU B O   1 
ATOM   7617 C  CB  . GLU B  1 450 ? -1.175  6.044   -33.533 1.00 41.40  ?  450  GLU B CB  1 
ATOM   7618 C  CG  . GLU B  1 450 ? -0.162  6.491   -34.601 1.00 38.29  ?  450  GLU B CG  1 
ATOM   7619 C  CD  . GLU B  1 450 ? 1.008   5.534   -34.774 1.00 42.07  ?  450  GLU B CD  1 
ATOM   7620 O  OE1 . GLU B  1 450 ? 0.877   4.340   -34.423 1.00 43.84  ?  450  GLU B OE1 1 
ATOM   7621 O  OE2 . GLU B  1 450 ? 2.075   5.976   -35.260 1.00 41.69  ?  450  GLU B OE2 1 
ATOM   7622 N  N   . ILE B  1 451 ? -1.732  4.332   -36.325 1.00 38.85  ?  451  ILE B N   1 
ATOM   7623 C  CA  . ILE B  1 451 ? -1.908  4.499   -37.770 1.00 38.81  ?  451  ILE B CA  1 
ATOM   7624 C  C   . ILE B  1 451 ? -3.351  4.314   -38.247 1.00 43.01  ?  451  ILE B C   1 
ATOM   7625 O  O   . ILE B  1 451 ? -3.885  5.163   -38.963 1.00 57.65  ?  451  ILE B O   1 
ATOM   7626 C  CB  . ILE B  1 451 ? -0.982  3.567   -38.566 1.00 40.53  ?  451  ILE B CB  1 
ATOM   7627 C  CG1 . ILE B  1 451 ? 0.490   3.834   -38.218 1.00 37.55  ?  451  ILE B CG1 1 
ATOM   7628 C  CG2 . ILE B  1 451 ? -1.179  3.767   -40.050 1.00 37.78  ?  451  ILE B CG2 1 
ATOM   7629 C  CD1 . ILE B  1 451 ? 1.433   2.855   -38.902 1.00 34.02  ?  451  ILE B CD1 1 
ATOM   7630 N  N   . GLU B  1 452 ? -3.986  3.218   -37.836 1.00 42.47  ?  452  GLU B N   1 
ATOM   7631 C  CA  . GLU B  1 452 ? -5.366  2.932   -38.233 1.00 41.11  ?  452  GLU B CA  1 
ATOM   7632 C  C   . GLU B  1 452 ? -6.339  4.065   -37.873 1.00 47.69  ?  452  GLU B C   1 
ATOM   7633 O  O   . GLU B  1 452 ? -7.366  4.246   -38.535 1.00 54.73  ?  452  GLU B O   1 
ATOM   7634 C  CB  . GLU B  1 452 ? -5.838  1.588   -37.650 1.00 44.34  ?  452  GLU B CB  1 
ATOM   7635 C  CG  . GLU B  1 452 ? -5.661  1.435   -36.140 1.00 51.17  ?  452  GLU B CG  1 
ATOM   7636 C  CD  . GLU B  1 452 ? -6.076  0.051   -35.627 1.00 59.64  ?  452  GLU B CD  1 
ATOM   7637 O  OE1 . GLU B  1 452 ? -5.277  -0.906  -35.722 1.00 55.24  ?  452  GLU B OE1 1 
ATOM   7638 O  OE2 . GLU B  1 452 ? -7.210  -0.084  -35.125 1.00 67.82  ?  452  GLU B OE2 1 
ATOM   7639 N  N   . PHE B  1 453 ? -6.007  4.824   -36.829 1.00 44.21  ?  453  PHE B N   1 
ATOM   7640 C  CA  . PHE B  1 453 ? -6.814  5.970   -36.413 1.00 40.59  ?  453  PHE B CA  1 
ATOM   7641 C  C   . PHE B  1 453 ? -6.565  7.217   -37.259 1.00 37.72  ?  453  PHE B C   1 
ATOM   7642 O  O   . PHE B  1 453 ? -7.509  7.852   -37.716 1.00 50.53  ?  453  PHE B O   1 
ATOM   7643 C  CB  . PHE B  1 453 ? -6.638  6.257   -34.909 1.00 40.24  ?  453  PHE B CB  1 
ATOM   7644 C  CG  . PHE B  1 453 ? -7.197  5.174   -34.036 1.00 43.68  ?  453  PHE B CG  1 
ATOM   7645 C  CD1 . PHE B  1 453 ? -8.532  5.174   -33.684 1.00 46.00  ?  453  PHE B CD1 1 
ATOM   7646 C  CD2 . PHE B  1 453 ? -6.400  4.125   -33.611 1.00 49.43  ?  453  PHE B CD2 1 
ATOM   7647 C  CE1 . PHE B  1 453 ? -9.060  4.161   -32.898 1.00 47.69  ?  453  PHE B CE1 1 
ATOM   7648 C  CE2 . PHE B  1 453 ? -6.921  3.109   -32.825 1.00 49.76  ?  453  PHE B CE2 1 
ATOM   7649 C  CZ  . PHE B  1 453 ? -8.255  3.129   -32.472 1.00 47.71  ?  453  PHE B CZ  1 
ATOM   7650 N  N   . ILE B  1 454 ? -5.299  7.560   -37.473 1.00 39.59  ?  454  ILE B N   1 
ATOM   7651 C  CA  . ILE B  1 454 ? -4.939  8.644   -38.387 1.00 42.99  ?  454  ILE B CA  1 
ATOM   7652 C  C   . ILE B  1 454 ? -5.578  8.474   -39.778 1.00 43.14  ?  454  ILE B C   1 
ATOM   7653 O  O   . ILE B  1 454 ? -6.015  9.453   -40.384 1.00 48.74  ?  454  ILE B O   1 
ATOM   7654 C  CB  . ILE B  1 454 ? -3.415  8.739   -38.577 1.00 47.90  ?  454  ILE B CB  1 
ATOM   7655 C  CG1 . ILE B  1 454 ? -2.675  8.643   -37.228 1.00 51.16  ?  454  ILE B CG1 1 
ATOM   7656 C  CG2 . ILE B  1 454 ? -3.050  10.000  -39.361 1.00 45.78  ?  454  ILE B CG2 1 
ATOM   7657 C  CD1 . ILE B  1 454 ? -2.968  9.762   -36.268 1.00 48.70  ?  454  ILE B CD1 1 
ATOM   7658 N  N   . PHE B  1 455 ? -5.644  7.240   -40.280 1.00 41.42  ?  455  PHE B N   1 
ATOM   7659 C  CA  . PHE B  1 455 ? -6.113  7.022   -41.660 1.00 47.59  ?  455  PHE B CA  1 
ATOM   7660 C  C   . PHE B  1 455 ? -7.622  6.915   -41.776 1.00 47.44  ?  455  PHE B C   1 
ATOM   7661 O  O   . PHE B  1 455 ? -8.145  6.850   -42.870 1.00 55.25  ?  455  PHE B O   1 
ATOM   7662 C  CB  . PHE B  1 455 ? -5.450  5.806   -42.317 1.00 40.24  ?  455  PHE B CB  1 
ATOM   7663 C  CG  . PHE B  1 455 ? -4.170  6.130   -43.034 1.00 44.44  ?  455  PHE B CG  1 
ATOM   7664 C  CD1 . PHE B  1 455 ? -2.962  6.102   -42.369 1.00 42.71  ?  455  PHE B CD1 1 
ATOM   7665 C  CD2 . PHE B  1 455 ? -4.178  6.466   -44.378 1.00 52.78  ?  455  PHE B CD2 1 
ATOM   7666 C  CE1 . PHE B  1 455 ? -1.778  6.406   -43.029 1.00 43.78  ?  455  PHE B CE1 1 
ATOM   7667 C  CE2 . PHE B  1 455 ? -3.006  6.772   -45.039 1.00 50.18  ?  455  PHE B CE2 1 
ATOM   7668 C  CZ  . PHE B  1 455 ? -1.798  6.743   -44.354 1.00 49.00  ?  455  PHE B CZ  1 
ATOM   7669 N  N   . GLY B  1 456 ? -8.315  6.870   -40.645 1.00 49.23  ?  456  GLY B N   1 
ATOM   7670 C  CA  . GLY B  1 456 ? -9.761  6.967   -40.657 1.00 45.09  ?  456  GLY B CA  1 
ATOM   7671 C  C   . GLY B  1 456 ? -10.526 5.666   -40.627 1.00 47.44  ?  456  GLY B C   1 
ATOM   7672 O  O   . GLY B  1 456 ? -11.760 5.680   -40.709 1.00 48.41  ?  456  GLY B O   1 
ATOM   7673 N  N   . LEU B  1 457 ? -9.813  4.549   -40.496 1.00 48.12  ?  457  LEU B N   1 
ATOM   7674 C  CA  . LEU B  1 457 ? -10.438 3.213   -40.542 1.00 48.74  ?  457  LEU B CA  1 
ATOM   7675 C  C   . LEU B  1 457 ? -11.696 2.973   -39.670 1.00 53.61  ?  457  LEU B C   1 
ATOM   7676 O  O   . LEU B  1 457 ? -12.613 2.275   -40.108 1.00 51.14  ?  457  LEU B O   1 
ATOM   7677 C  CB  . LEU B  1 457 ? -9.404  2.109   -40.301 1.00 44.14  ?  457  LEU B CB  1 
ATOM   7678 C  CG  . LEU B  1 457 ? -8.732  1.597   -41.571 1.00 50.91  ?  457  LEU B CG  1 
ATOM   7679 C  CD1 . LEU B  1 457 ? -7.805  2.659   -42.163 1.00 47.03  ?  457  LEU B CD1 1 
ATOM   7680 C  CD2 . LEU B  1 457 ? -7.988  0.302   -41.283 1.00 52.01  ?  457  LEU B CD2 1 
ATOM   7681 N  N   . PRO B  1 458 ? -11.740 3.533   -38.437 1.00 48.20  ?  458  PRO B N   1 
ATOM   7682 C  CA  . PRO B  1 458 ? -12.968 3.398   -37.641 1.00 51.43  ?  458  PRO B CA  1 
ATOM   7683 C  C   . PRO B  1 458 ? -14.239 3.872   -38.348 1.00 65.16  ?  458  PRO B C   1 
ATOM   7684 O  O   . PRO B  1 458 ? -15.340 3.434   -37.981 1.00 71.02  ?  458  PRO B O   1 
ATOM   7685 C  CB  . PRO B  1 458 ? -12.680 4.263   -36.414 1.00 53.52  ?  458  PRO B CB  1 
ATOM   7686 C  CG  . PRO B  1 458 ? -11.196 4.120   -36.221 1.00 48.74  ?  458  PRO B CG  1 
ATOM   7687 C  CD  . PRO B  1 458 ? -10.616 4.033   -37.619 1.00 42.78  ?  458  PRO B CD  1 
ATOM   7688 N  N   . LEU B  1 459 ? -14.094 4.730   -39.355 1.00 60.22  ?  459  LEU B N   1 
ATOM   7689 C  CA  . LEU B  1 459 ? -15.255 5.248   -40.073 1.00 59.11  ?  459  LEU B CA  1 
ATOM   7690 C  C   . LEU B  1 459 ? -15.931 4.175   -40.928 1.00 59.16  ?  459  LEU B C   1 
ATOM   7691 O  O   . LEU B  1 459 ? -17.069 4.340   -41.358 1.00 63.02  ?  459  LEU B O   1 
ATOM   7692 C  CB  . LEU B  1 459 ? -14.875 6.458   -40.925 1.00 60.10  ?  459  LEU B CB  1 
ATOM   7693 C  CG  . LEU B  1 459 ? -14.727 7.804   -40.216 1.00 58.74  ?  459  LEU B CG  1 
ATOM   7694 C  CD1 . LEU B  1 459 ? -13.463 7.873   -39.390 1.00 54.82  ?  459  LEU B CD1 1 
ATOM   7695 C  CD2 . LEU B  1 459 ? -14.741 8.917   -41.231 1.00 60.03  ?  459  LEU B CD2 1 
ATOM   7696 N  N   . ASP B  1 460 ? -15.221 3.079   -41.169 1.00 63.96  ?  460  ASP B N   1 
ATOM   7697 C  CA  . ASP B  1 460 ? -15.797 1.919   -41.834 1.00 68.62  ?  460  ASP B CA  1 
ATOM   7698 C  C   . ASP B  1 460 ? -16.589 1.112   -40.807 1.00 76.43  ?  460  ASP B C   1 
ATOM   7699 O  O   . ASP B  1 460 ? -16.014 0.512   -39.898 1.00 79.38  ?  460  ASP B O   1 
ATOM   7700 C  CB  . ASP B  1 460 ? -14.692 1.059   -42.447 1.00 66.25  ?  460  ASP B CB  1 
ATOM   7701 C  CG  . ASP B  1 460 ? -15.230 -0.041  -43.342 1.00 73.64  ?  460  ASP B CG  1 
ATOM   7702 O  OD1 . ASP B  1 460 ? -16.417 -0.412  -43.215 1.00 67.43  ?  460  ASP B OD1 1 
ATOM   7703 O  OD2 . ASP B  1 460 ? -14.450 -0.540  -44.183 1.00 85.21  ?  460  ASP B OD2 1 
ATOM   7704 N  N   . PRO B  1 461 ? -17.917 1.089   -40.959 1.00 82.87  ?  461  PRO B N   1 
ATOM   7705 C  CA  . PRO B  1 461 ? -18.815 0.447   -39.991 1.00 84.77  ?  461  PRO B CA  1 
ATOM   7706 C  C   . PRO B  1 461 ? -18.511 -1.036  -39.787 1.00 86.41  ?  461  PRO B C   1 
ATOM   7707 O  O   . PRO B  1 461 ? -18.651 -1.549  -38.676 1.00 94.83  ?  461  PRO B O   1 
ATOM   7708 C  CB  . PRO B  1 461 ? -20.196 0.612   -40.637 1.00 88.40  ?  461  PRO B CB  1 
ATOM   7709 C  CG  . PRO B  1 461 ? -20.044 1.762   -41.582 1.00 88.02  ?  461  PRO B CG  1 
ATOM   7710 C  CD  . PRO B  1 461 ? -18.649 1.659   -42.103 1.00 83.68  ?  461  PRO B CD  1 
ATOM   7711 N  N   . SER B  1 462 ? -18.086 -1.706  -40.852 1.00 81.82  ?  462  SER B N   1 
ATOM   7712 C  CA  . SER B  1 462 ? -17.904 -3.153  -40.841 1.00 82.15  ?  462  SER B CA  1 
ATOM   7713 C  C   . SER B  1 462 ? -16.633 -3.597  -40.132 1.00 82.96  ?  462  SER B C   1 
ATOM   7714 O  O   . SER B  1 462 ? -16.341 -4.792  -40.078 1.00 86.97  ?  462  SER B O   1 
ATOM   7715 C  CB  . SER B  1 462 ? -17.889 -3.690  -42.271 1.00 84.41  ?  462  SER B CB  1 
ATOM   7716 O  OG  . SER B  1 462 ? -16.792 -3.157  -42.992 1.00 80.56  ?  462  SER B OG  1 
ATOM   7717 N  N   . LEU B  1 463 ? -15.872 -2.643  -39.603 1.00 79.04  ?  463  LEU B N   1 
ATOM   7718 C  CA  . LEU B  1 463 ? -14.680 -2.975  -38.831 1.00 75.43  ?  463  LEU B CA  1 
ATOM   7719 C  C   . LEU B  1 463 ? -15.008 -3.095  -37.347 1.00 83.23  ?  463  LEU B C   1 
ATOM   7720 O  O   . LEU B  1 463 ? -14.172 -3.526  -36.548 1.00 88.00  ?  463  LEU B O   1 
ATOM   7721 C  CB  . LEU B  1 463 ? -13.579 -1.942  -39.055 1.00 65.82  ?  463  LEU B CB  1 
ATOM   7722 C  CG  . LEU B  1 463 ? -12.983 -1.952  -40.459 1.00 64.02  ?  463  LEU B CG  1 
ATOM   7723 C  CD1 . LEU B  1 463 ? -11.757 -1.059  -40.530 1.00 51.59  ?  463  LEU B CD1 1 
ATOM   7724 C  CD2 . LEU B  1 463 ? -12.652 -3.379  -40.869 1.00 65.85  ?  463  LEU B CD2 1 
ATOM   7725 N  N   . ASN B  1 464 ? -16.229 -2.702  -36.995 1.00 85.28  ?  464  ASN B N   1 
ATOM   7726 C  CA  . ASN B  1 464 ? -16.751 -2.859  -35.638 1.00 90.54  ?  464  ASN B CA  1 
ATOM   7727 C  C   . ASN B  1 464 ? -16.012 -2.079  -34.533 1.00 78.71  ?  464  ASN B C   1 
ATOM   7728 O  O   . ASN B  1 464 ? -15.999 -2.499  -33.374 1.00 74.56  ?  464  ASN B O   1 
ATOM   7729 C  CB  . ASN B  1 464 ? -16.875 -4.347  -35.276 1.00 104.25 ?  464  ASN B CB  1 
ATOM   7730 C  CG  . ASN B  1 464 ? -17.939 -5.064  -36.097 1.00 123.05 ?  464  ASN B CG  1 
ATOM   7731 O  OD1 . ASN B  1 464 ? -18.630 -4.451  -36.913 1.00 119.89 ?  464  ASN B OD1 1 
ATOM   7732 N  ND2 . ASN B  1 464 ? -18.063 -6.374  -35.893 1.00 146.44 ?  464  ASN B ND2 1 
ATOM   7733 N  N   . TYR B  1 465 ? -15.403 -0.949  -34.893 1.00 72.61  ?  465  TYR B N   1 
ATOM   7734 C  CA  . TYR B  1 465 ? -14.882 -0.014  -33.897 1.00 62.45  ?  465  TYR B CA  1 
ATOM   7735 C  C   . TYR B  1 465 ? -16.051 0.628   -33.178 1.00 65.42  ?  465  TYR B C   1 
ATOM   7736 O  O   . TYR B  1 465 ? -17.145 0.714   -33.732 1.00 73.60  ?  465  TYR B O   1 
ATOM   7737 C  CB  . TYR B  1 465 ? -14.073 1.102   -34.551 1.00 58.49  ?  465  TYR B CB  1 
ATOM   7738 C  CG  . TYR B  1 465 ? -12.722 0.695   -35.073 1.00 51.25  ?  465  TYR B CG  1 
ATOM   7739 C  CD1 . TYR B  1 465 ? -11.599 0.705   -34.249 1.00 51.34  ?  465  TYR B CD1 1 
ATOM   7740 C  CD2 . TYR B  1 465 ? -12.565 0.310   -36.393 1.00 45.01  ?  465  TYR B CD2 1 
ATOM   7741 C  CE1 . TYR B  1 465 ? -10.355 0.337   -34.736 1.00 52.16  ?  465  TYR B CE1 1 
ATOM   7742 C  CE2 . TYR B  1 465 ? -11.338 -0.049  -36.890 1.00 46.76  ?  465  TYR B CE2 1 
ATOM   7743 C  CZ  . TYR B  1 465 ? -10.236 -0.038  -36.067 1.00 50.96  ?  465  TYR B CZ  1 
ATOM   7744 O  OH  . TYR B  1 465 ? -9.020  -0.414  -36.586 1.00 47.05  ?  465  TYR B OH  1 
ATOM   7745 N  N   . THR B  1 466 ? -15.817 1.104   -31.960 1.00 57.05  ?  466  THR B N   1 
ATOM   7746 C  CA  . THR B  1 466 ? -16.863 1.765   -31.185 1.00 59.02  ?  466  THR B CA  1 
ATOM   7747 C  C   . THR B  1 466 ? -17.117 3.186   -31.680 1.00 56.94  ?  466  THR B C   1 
ATOM   7748 O  O   . THR B  1 466 ? -16.232 3.825   -32.254 1.00 55.45  ?  466  THR B O   1 
ATOM   7749 C  CB  . THR B  1 466 ? -16.515 1.821   -29.670 1.00 59.18  ?  466  THR B CB  1 
ATOM   7750 O  OG1 . THR B  1 466 ? -15.419 2.724   -29.449 1.00 53.57  ?  466  THR B OG1 1 
ATOM   7751 C  CG2 . THR B  1 466 ? -16.150 0.436   -29.149 1.00 54.44  ?  466  THR B CG2 1 
ATOM   7752 N  N   . THR B  1 467 ? -18.329 3.673   -31.439 1.00 58.57  ?  467  THR B N   1 
ATOM   7753 C  CA  . THR B  1 467 ? -18.711 5.042   -31.773 1.00 68.47  ?  467  THR B CA  1 
ATOM   7754 C  C   . THR B  1 467 ? -17.715 6.085   -31.269 1.00 70.76  ?  467  THR B C   1 
ATOM   7755 O  O   . THR B  1 467 ? -17.379 7.038   -31.980 1.00 69.00  ?  467  THR B O   1 
ATOM   7756 C  CB  . THR B  1 467 ? -20.087 5.364   -31.194 1.00 74.36  ?  467  THR B CB  1 
ATOM   7757 O  OG1 . THR B  1 467 ? -21.061 4.525   -31.822 1.00 81.82  ?  467  THR B OG1 1 
ATOM   7758 C  CG2 . THR B  1 467 ? -20.444 6.822   -31.435 1.00 76.20  ?  467  THR B CG2 1 
ATOM   7759 N  N   . GLU B  1 468 ? -17.241 5.899   -30.042 1.00 70.18  ?  468  GLU B N   1 
ATOM   7760 C  CA  . GLU B  1 468 ? -16.266 6.814   -29.469 1.00 67.05  ?  468  GLU B CA  1 
ATOM   7761 C  C   . GLU B  1 468 ? -14.963 6.765   -30.263 1.00 61.13  ?  468  GLU B C   1 
ATOM   7762 O  O   . GLU B  1 468 ? -14.338 7.797   -30.500 1.00 59.20  ?  468  GLU B O   1 
ATOM   7763 C  CB  . GLU B  1 468 ? -16.021 6.500   -27.987 1.00 72.58  ?  468  GLU B CB  1 
ATOM   7764 C  CG  . GLU B  1 468 ? -17.270 6.587   -27.111 1.00 81.89  ?  468  GLU B CG  1 
ATOM   7765 C  CD  . GLU B  1 468 ? -18.049 5.276   -27.055 1.00 91.83  ?  468  GLU B CD  1 
ATOM   7766 O  OE1 . GLU B  1 468 ? -17.426 4.221   -26.799 1.00 95.24  ?  468  GLU B OE1 1 
ATOM   7767 O  OE2 . GLU B  1 468 ? -19.284 5.300   -27.266 1.00 92.38  ?  468  GLU B OE2 1 
ATOM   7768 N  N   . GLU B  1 469 ? -14.567 5.565   -30.683 1.00 60.10  ?  469  GLU B N   1 
ATOM   7769 C  CA  . GLU B  1 469 ? -13.358 5.393   -31.481 1.00 55.50  ?  469  GLU B CA  1 
ATOM   7770 C  C   . GLU B  1 469 ? -13.486 6.073   -32.837 1.00 55.50  ?  469  GLU B C   1 
ATOM   7771 O  O   . GLU B  1 469 ? -12.511 6.596   -33.374 1.00 58.07  ?  469  GLU B O   1 
ATOM   7772 C  CB  . GLU B  1 469 ? -13.039 3.912   -31.661 1.00 55.17  ?  469  GLU B CB  1 
ATOM   7773 C  CG  . GLU B  1 469 ? -12.210 3.341   -30.533 1.00 60.28  ?  469  GLU B CG  1 
ATOM   7774 C  CD  . GLU B  1 469 ? -12.137 1.831   -30.566 1.00 62.67  ?  469  GLU B CD  1 
ATOM   7775 O  OE1 . GLU B  1 469 ? -13.100 1.198   -31.057 1.00 66.00  ?  469  GLU B OE1 1 
ATOM   7776 O  OE2 . GLU B  1 469 ? -11.117 1.280   -30.097 1.00 52.95  ?  469  GLU B OE2 1 
ATOM   7777 N  N   . ARG B  1 470 ? -14.701 6.070   -33.371 1.00 52.61  ?  470  ARG B N   1 
ATOM   7778 C  CA  . ARG B  1 470 ? -15.001 6.716   -34.637 1.00 54.44  ?  470  ARG B CA  1 
ATOM   7779 C  C   . ARG B  1 470 ? -14.886 8.231   -34.478 1.00 59.15  ?  470  ARG B C   1 
ATOM   7780 O  O   . ARG B  1 470 ? -14.197 8.889   -35.254 1.00 60.69  ?  470  ARG B O   1 
ATOM   7781 C  CB  . ARG B  1 470 ? -16.400 6.304   -35.105 1.00 61.79  ?  470  ARG B CB  1 
ATOM   7782 C  CG  . ARG B  1 470 ? -16.771 6.749   -36.501 1.00 76.04  ?  470  ARG B CG  1 
ATOM   7783 C  CD  . ARG B  1 470 ? -17.770 7.895   -36.473 1.00 88.01  ?  470  ARG B CD  1 
ATOM   7784 N  NE  . ARG B  1 470 ? -19.088 7.473   -36.003 1.00 96.74  ?  470  ARG B NE  1 
ATOM   7785 C  CZ  . ARG B  1 470 ? -20.020 8.303   -35.542 1.00 98.35  ?  470  ARG B CZ  1 
ATOM   7786 N  NH1 . ARG B  1 470 ? -19.781 9.609   -35.478 1.00 92.80  ?  470  ARG B NH1 1 
ATOM   7787 N  NH2 . ARG B  1 470 ? -21.191 7.828   -35.137 1.00 100.96 ?  470  ARG B NH2 1 
ATOM   7788 N  N   . ILE B  1 471 ? -15.545 8.775   -33.457 1.00 62.35  ?  471  ILE B N   1 
ATOM   7789 C  CA  . ILE B  1 471 ? -15.448 10.200  -33.119 1.00 58.22  ?  471  ILE B CA  1 
ATOM   7790 C  C   . ILE B  1 471 ? -13.997 10.634  -32.917 1.00 58.08  ?  471  ILE B C   1 
ATOM   7791 O  O   . ILE B  1 471 ? -13.588 11.724  -33.340 1.00 65.20  ?  471  ILE B O   1 
ATOM   7792 C  CB  . ILE B  1 471 ? -16.263 10.516  -31.847 1.00 58.04  ?  471  ILE B CB  1 
ATOM   7793 C  CG1 . ILE B  1 471 ? -17.747 10.579  -32.194 1.00 56.22  ?  471  ILE B CG1 1 
ATOM   7794 C  CG2 . ILE B  1 471 ? -15.793 11.818  -31.199 1.00 48.31  ?  471  ILE B CG2 1 
ATOM   7795 C  CD1 . ILE B  1 471 ? -18.652 10.704  -31.001 1.00 60.53  ?  471  ILE B CD1 1 
ATOM   7796 N  N   . PHE B  1 472 ? -13.224 9.753   -32.289 1.00 48.82  ?  472  PHE B N   1 
ATOM   7797 C  CA  . PHE B  1 472 ? -11.803 9.966   -32.051 1.00 39.25  ?  472  PHE B CA  1 
ATOM   7798 C  C   . PHE B  1 472 ? -10.997 10.003  -33.348 1.00 52.37  ?  472  PHE B C   1 
ATOM   7799 O  O   . PHE B  1 472 ? -10.141 10.868  -33.521 1.00 55.01  ?  472  PHE B O   1 
ATOM   7800 C  CB  . PHE B  1 472 ? -11.279 8.859   -31.139 1.00 49.92  ?  472  PHE B CB  1 
ATOM   7801 C  CG  . PHE B  1 472 ? -9.821  8.986   -30.786 1.00 49.17  ?  472  PHE B CG  1 
ATOM   7802 C  CD1 . PHE B  1 472 ? -9.314  10.172  -30.274 1.00 43.48  ?  472  PHE B CD1 1 
ATOM   7803 C  CD2 . PHE B  1 472 ? -8.964  7.905   -30.940 1.00 44.75  ?  472  PHE B CD2 1 
ATOM   7804 C  CE1 . PHE B  1 472 ? -7.973  10.284  -29.948 1.00 37.88  ?  472  PHE B CE1 1 
ATOM   7805 C  CE2 . PHE B  1 472 ? -7.621  8.009   -30.607 1.00 46.64  ?  472  PHE B CE2 1 
ATOM   7806 C  CZ  . PHE B  1 472 ? -7.127  9.201   -30.106 1.00 41.79  ?  472  PHE B CZ  1 
ATOM   7807 N  N   . ALA B  1 473 ? -11.258 9.063   -34.257 1.00 55.88  ?  473  ALA B N   1 
ATOM   7808 C  CA  . ALA B  1 473 ? -10.532 9.019   -35.538 1.00 48.51  ?  473  ALA B CA  1 
ATOM   7809 C  C   . ALA B  1 473 ? -10.767 10.307  -36.328 1.00 40.94  ?  473  ALA B C   1 
ATOM   7810 O  O   . ALA B  1 473 ? -9.844  10.871  -36.884 1.00 50.02  ?  473  ALA B O   1 
ATOM   7811 C  CB  . ALA B  1 473 ? -10.927 7.788   -36.355 1.00 39.70  ?  473  ALA B CB  1 
ATOM   7812 N  N   . GLN B  1 474 ? -12.001 10.792  -36.331 1.00 40.83  ?  474  GLN B N   1 
ATOM   7813 C  CA  . GLN B  1 474 ? -12.305 12.073  -36.963 1.00 50.99  ?  474  GLN B CA  1 
ATOM   7814 C  C   . GLN B  1 474 ? -11.481 13.215  -36.354 1.00 56.89  ?  474  GLN B C   1 
ATOM   7815 O  O   . GLN B  1 474 ? -10.997 14.088  -37.071 1.00 58.99  ?  474  GLN B O   1 
ATOM   7816 C  CB  . GLN B  1 474 ? -13.815 12.381  -36.905 1.00 45.08  ?  474  GLN B CB  1 
ATOM   7817 C  CG  . GLN B  1 474 ? -14.702 11.225  -37.365 1.00 53.04  ?  474  GLN B CG  1 
ATOM   7818 C  CD  . GLN B  1 474 ? -16.154 11.626  -37.650 1.00 68.14  ?  474  GLN B CD  1 
ATOM   7819 O  OE1 . GLN B  1 474 ? -17.056 11.328  -36.868 1.00 67.50  ?  474  GLN B OE1 1 
ATOM   7820 N  NE2 . GLN B  1 474 ? -16.384 12.275  -38.792 1.00 75.54  ?  474  GLN B NE2 1 
ATOM   7821 N  N   . ARG B  1 475 ? -11.303 13.198  -35.036 1.00 60.76  ?  475  ARG B N   1 
ATOM   7822 C  CA  . ARG B  1 475 ? -10.503 14.232  -34.390 1.00 51.42  ?  475  ARG B CA  1 
ATOM   7823 C  C   . ARG B  1 475 ? -9.075  14.229  -34.926 1.00 46.59  ?  475  ARG B C   1 
ATOM   7824 O  O   . ARG B  1 475 ? -8.511  15.290  -35.212 1.00 42.44  ?  475  ARG B O   1 
ATOM   7825 C  CB  . ARG B  1 475 ? -10.510 14.077  -32.864 1.00 50.25  ?  475  ARG B CB  1 
ATOM   7826 C  CG  . ARG B  1 475 ? -11.759 14.631  -32.172 1.00 66.79  ?  475  ARG B CG  1 
ATOM   7827 C  CD  . ARG B  1 475 ? -11.658 14.562  -30.640 1.00 63.76  ?  475  ARG B CD  1 
ATOM   7828 N  NE  . ARG B  1 475 ? -10.295 14.840  -30.198 1.00 63.67  ?  475  ARG B NE  1 
ATOM   7829 C  CZ  . ARG B  1 475 ? -9.687  14.228  -29.185 1.00 55.31  ?  475  ARG B CZ  1 
ATOM   7830 N  NH1 . ARG B  1 475 ? -10.324 13.300  -28.480 1.00 61.04  ?  475  ARG B NH1 1 
ATOM   7831 N  NH2 . ARG B  1 475 ? -8.436  14.548  -28.878 1.00 41.00  ?  475  ARG B NH2 1 
ATOM   7832 N  N   . LEU B  1 476 ? -8.497  13.040  -35.073 1.00 34.25  ?  476  LEU B N   1 
ATOM   7833 C  CA  . LEU B  1 476 ? -7.100  12.926  -35.497 1.00 35.37  ?  476  LEU B CA  1 
ATOM   7834 C  C   . LEU B  1 476 ? -6.883  13.316  -36.968 1.00 44.80  ?  476  LEU B C   1 
ATOM   7835 O  O   . LEU B  1 476 ? -5.906  13.986  -37.304 1.00 53.79  ?  476  LEU B O   1 
ATOM   7836 C  CB  . LEU B  1 476 ? -6.572  11.519  -35.215 1.00 43.52  ?  476  LEU B CB  1 
ATOM   7837 C  CG  . LEU B  1 476 ? -6.595  11.138  -33.723 1.00 54.03  ?  476  LEU B CG  1 
ATOM   7838 C  CD1 . LEU B  1 476 ? -5.898  9.817   -33.474 1.00 58.76  ?  476  LEU B CD1 1 
ATOM   7839 C  CD2 . LEU B  1 476 ? -5.966  12.227  -32.878 1.00 49.46  ?  476  LEU B CD2 1 
ATOM   7840 N  N   . MET B  1 477 ? -7.803  12.905  -37.836 1.00 43.88  ?  477  MET B N   1 
ATOM   7841 C  CA  . MET B  1 477 ? -7.733  13.257  -39.239 1.00 49.89  ?  477  MET B CA  1 
ATOM   7842 C  C   . MET B  1 477 ? -7.775  14.770  -39.362 1.00 53.27  ?  477  MET B C   1 
ATOM   7843 O  O   . MET B  1 477 ? -7.114  15.351  -40.218 1.00 55.02  ?  477  MET B O   1 
ATOM   7844 C  CB  . MET B  1 477 ? -8.901  12.631  -39.999 1.00 58.14  ?  477  MET B CB  1 
ATOM   7845 C  CG  . MET B  1 477 ? -8.900  11.107  -40.007 1.00 59.71  ?  477  MET B CG  1 
ATOM   7846 S  SD  . MET B  1 477 ? -10.424 10.427  -40.708 1.00 64.74  ?  477  MET B SD  1 
ATOM   7847 C  CE  . MET B  1 477 ? -10.469 11.249  -42.287 1.00 64.66  ?  477  MET B CE  1 
ATOM   7848 N  N   . LYS B  1 478 ? -8.555  15.396  -38.489 1.00 55.55  ?  478  LYS B N   1 
ATOM   7849 C  CA  . LYS B  1 478 ? -8.641  16.851  -38.409 1.00 52.51  ?  478  LYS B CA  1 
ATOM   7850 C  C   . LYS B  1 478 ? -7.303  17.486  -38.045 1.00 45.99  ?  478  LYS B C   1 
ATOM   7851 O  O   . LYS B  1 478 ? -6.889  18.445  -38.684 1.00 47.67  ?  478  LYS B O   1 
ATOM   7852 C  CB  . LYS B  1 478 ? -9.675  17.260  -37.366 1.00 54.27  ?  478  LYS B CB  1 
ATOM   7853 C  CG  . LYS B  1 478 ? -10.992 17.693  -37.923 1.00 60.34  ?  478  LYS B CG  1 
ATOM   7854 C  CD  . LYS B  1 478 ? -10.985 19.153  -38.320 1.00 65.33  ?  478  LYS B CD  1 
ATOM   7855 C  CE  . LYS B  1 478 ? -12.373 19.557  -38.805 1.00 77.87  ?  478  LYS B CE  1 
ATOM   7856 N  NZ  . LYS B  1 478 ? -12.874 18.657  -39.897 1.00 79.79  ?  478  LYS B NZ  1 
ATOM   7857 N  N   . TYR B  1 479 ? -6.645  16.966  -37.008 1.00 40.45  ?  479  TYR B N   1 
ATOM   7858 C  CA  . TYR B  1 479 ? -5.373  17.527  -36.552 1.00 44.67  ?  479  TYR B CA  1 
ATOM   7859 C  C   . TYR B  1 479 ? -4.341  17.412  -37.655 1.00 40.54  ?  479  TYR B C   1 
ATOM   7860 O  O   . TYR B  1 479 ? -3.665  18.388  -37.979 1.00 43.00  ?  479  TYR B O   1 
ATOM   7861 C  CB  . TYR B  1 479 ? -4.819  16.788  -35.324 1.00 42.51  ?  479  TYR B CB  1 
ATOM   7862 C  CG  . TYR B  1 479 ? -5.572  16.967  -34.037 1.00 46.13  ?  479  TYR B CG  1 
ATOM   7863 C  CD1 . TYR B  1 479 ? -6.042  18.211  -33.644 1.00 50.41  ?  479  TYR B CD1 1 
ATOM   7864 C  CD2 . TYR B  1 479 ? -5.802  15.883  -33.195 1.00 48.61  ?  479  TYR B CD2 1 
ATOM   7865 C  CE1 . TYR B  1 479 ? -6.739  18.371  -32.443 1.00 44.27  ?  479  TYR B CE1 1 
ATOM   7866 C  CE2 . TYR B  1 479 ? -6.501  16.029  -32.004 1.00 43.65  ?  479  TYR B CE2 1 
ATOM   7867 C  CZ  . TYR B  1 479 ? -6.966  17.275  -31.626 1.00 49.13  ?  479  TYR B CZ  1 
ATOM   7868 O  OH  . TYR B  1 479 ? -7.664  17.425  -30.426 1.00 58.22  ?  479  TYR B OH  1 
ATOM   7869 N  N   . TRP B  1 480 ? -4.201  16.200  -38.193 1.00 35.38  ?  480  TRP B N   1 
ATOM   7870 C  CA  . TRP B  1 480 ? -3.232  15.932  -39.262 1.00 40.79  ?  480  TRP B CA  1 
ATOM   7871 C  C   . TRP B  1 480 ? -3.482  16.816  -40.474 1.00 38.80  ?  480  TRP B C   1 
ATOM   7872 O  O   . TRP B  1 480 ? -2.566  17.479  -40.945 1.00 35.75  ?  480  TRP B O   1 
ATOM   7873 C  CB  . TRP B  1 480 ? -3.235  14.451  -39.672 1.00 45.78  ?  480  TRP B CB  1 
ATOM   7874 C  CG  . TRP B  1 480 ? -2.199  13.618  -38.963 1.00 45.21  ?  480  TRP B CG  1 
ATOM   7875 C  CD1 . TRP B  1 480 ? -1.196  12.901  -39.539 1.00 42.39  ?  480  TRP B CD1 1 
ATOM   7876 C  CD2 . TRP B  1 480 ? -2.060  13.430  -37.545 1.00 48.94  ?  480  TRP B CD2 1 
ATOM   7877 N  NE1 . TRP B  1 480 ? -0.440  12.274  -38.575 1.00 43.02  ?  480  TRP B NE1 1 
ATOM   7878 C  CE2 . TRP B  1 480 ? -0.950  12.586  -37.342 1.00 48.05  ?  480  TRP B CE2 1 
ATOM   7879 C  CE3 . TRP B  1 480 ? -2.765  13.896  -36.430 1.00 49.64  ?  480  TRP B CE3 1 
ATOM   7880 C  CZ2 . TRP B  1 480 ? -0.530  12.199  -36.072 1.00 45.38  ?  480  TRP B CZ2 1 
ATOM   7881 C  CZ3 . TRP B  1 480 ? -2.347  13.507  -35.168 1.00 44.42  ?  480  TRP B CZ3 1 
ATOM   7882 C  CH2 . TRP B  1 480 ? -1.242  12.669  -35.000 1.00 41.62  ?  480  TRP B CH2 1 
ATOM   7883 N  N   . THR B  1 481 ? -4.726  16.856  -40.950 1.00 34.70  ?  481  THR B N   1 
ATOM   7884 C  CA  . THR B  1 481 ? -5.032  17.639  -42.140 1.00 40.28  ?  481  THR B CA  1 
ATOM   7885 C  C   . THR B  1 481 ? -4.983  19.141  -41.875 1.00 51.85  ?  481  THR B C   1 
ATOM   7886 O  O   . THR B  1 481 ? -4.661  19.917  -42.774 1.00 59.52  ?  481  THR B O   1 
ATOM   7887 C  CB  . THR B  1 481 ? -6.374  17.242  -42.793 1.00 44.77  ?  481  THR B CB  1 
ATOM   7888 O  OG1 . THR B  1 481 ? -7.439  17.395  -41.850 1.00 50.37  ?  481  THR B OG1 1 
ATOM   7889 C  CG2 . THR B  1 481 ? -6.332  15.795  -43.282 1.00 38.13  ?  481  THR B CG2 1 
ATOM   7890 N  N   . ASN B  1 482 ? -5.292  19.561  -40.652 1.00 51.40  ?  482  ASN B N   1 
ATOM   7891 C  CA  . ASN B  1 482 ? -5.179  20.978  -40.324 1.00 50.20  ?  482  ASN B CA  1 
ATOM   7892 C  C   . ASN B  1 482 ? -3.720  21.333  -40.314 1.00 43.37  ?  482  ASN B C   1 
ATOM   7893 O  O   . ASN B  1 482 ? -3.320  22.419  -40.735 1.00 41.62  ?  482  ASN B O   1 
ATOM   7894 C  CB  . ASN B  1 482 ? -5.812  21.321  -38.977 1.00 50.39  ?  482  ASN B CB  1 
ATOM   7895 C  CG  . ASN B  1 482 ? -7.324  21.485  -39.065 1.00 54.93  ?  482  ASN B CG  1 
ATOM   7896 O  OD1 . ASN B  1 482 ? -7.853  22.003  -40.047 1.00 53.17  ?  482  ASN B OD1 1 
ATOM   7897 N  ND2 . ASN B  1 482 ? -8.021  21.047  -38.031 1.00 61.36  ?  482  ASN B ND2 1 
ATOM   7898 N  N   . PHE B  1 483 ? -2.918  20.394  -39.840 1.00 39.50  ?  483  PHE B N   1 
ATOM   7899 C  CA  . PHE B  1 483 ? -1.485  20.593  -39.834 1.00 44.19  ?  483  PHE B CA  1 
ATOM   7900 C  C   . PHE B  1 483 ? -0.962  20.662  -41.281 1.00 49.16  ?  483  PHE B C   1 
ATOM   7901 O  O   . PHE B  1 483 ? -0.062  21.441  -41.590 1.00 47.90  ?  483  PHE B O   1 
ATOM   7902 C  CB  . PHE B  1 483 ? -0.774  19.496  -39.036 1.00 36.35  ?  483  PHE B CB  1 
ATOM   7903 C  CG  . PHE B  1 483 ? 0.722   19.561  -39.143 1.00 42.03  ?  483  PHE B CG  1 
ATOM   7904 C  CD1 . PHE B  1 483 ? 1.439   20.478  -38.388 1.00 30.10  ?  483  PHE B CD1 1 
ATOM   7905 C  CD2 . PHE B  1 483 ? 1.411   18.729  -40.027 1.00 37.68  ?  483  PHE B CD2 1 
ATOM   7906 C  CE1 . PHE B  1 483 ? 2.813   20.557  -38.493 1.00 38.85  ?  483  PHE B CE1 1 
ATOM   7907 C  CE2 . PHE B  1 483 ? 2.787   18.806  -40.147 1.00 32.79  ?  483  PHE B CE2 1 
ATOM   7908 C  CZ  . PHE B  1 483 ? 3.489   19.719  -39.377 1.00 41.46  ?  483  PHE B CZ  1 
ATOM   7909 N  N   . ALA B  1 484 ? -1.546  19.858  -42.163 1.00 49.22  ?  484  ALA B N   1 
ATOM   7910 C  CA  . ALA B  1 484 ? -1.138  19.838  -43.571 1.00 38.66  ?  484  ALA B CA  1 
ATOM   7911 C  C   . ALA B  1 484 ? -1.492  21.162  -44.234 1.00 38.27  ?  484  ALA B C   1 
ATOM   7912 O  O   . ALA B  1 484 ? -0.713  21.711  -45.009 1.00 44.96  ?  484  ALA B O   1 
ATOM   7913 C  CB  . ALA B  1 484 ? -1.792  18.674  -44.291 1.00 34.08  ?  484  ALA B CB  1 
ATOM   7914 N  N   . ARG B  1 485 ? -2.666  21.680  -43.896 1.00 40.06  ?  485  ARG B N   1 
ATOM   7915 C  CA  . ARG B  1 485 ? -3.153  22.947  -44.440 1.00 47.14  ?  485  ARG B CA  1 
ATOM   7916 C  C   . ARG B  1 485 ? -2.340  24.153  -43.988 1.00 49.06  ?  485  ARG B C   1 
ATOM   7917 O  O   . ARG B  1 485 ? -2.162  25.108  -44.745 1.00 53.28  ?  485  ARG B O   1 
ATOM   7918 C  CB  . ARG B  1 485 ? -4.622  23.168  -44.046 1.00 48.01  ?  485  ARG B CB  1 
ATOM   7919 C  CG  . ARG B  1 485 ? -5.631  22.444  -44.929 1.00 62.05  ?  485  ARG B CG  1 
ATOM   7920 C  CD  . ARG B  1 485 ? -7.074  22.631  -44.436 1.00 67.76  ?  485  ARG B CD  1 
ATOM   7921 N  NE  . ARG B  1 485 ? -7.399  21.746  -43.320 1.00 71.85  ?  485  ARG B NE  1 
ATOM   7922 C  CZ  . ARG B  1 485 ? -8.071  20.600  -43.427 1.00 69.58  ?  485  ARG B CZ  1 
ATOM   7923 N  NH1 . ARG B  1 485 ? -8.515  20.183  -44.608 1.00 62.21  ?  485  ARG B NH1 1 
ATOM   7924 N  NH2 . ARG B  1 485 ? -8.309  19.873  -42.341 1.00 66.62  ?  485  ARG B NH2 1 
ATOM   7925 N  N   . THR B  1 486 ? -1.853  24.115  -42.751 1.00 46.75  ?  486  THR B N   1 
ATOM   7926 C  CA  . THR B  1 486 ? -1.404  25.338  -42.104 1.00 43.28  ?  486  THR B CA  1 
ATOM   7927 C  C   . THR B  1 486 ? -0.097  25.202  -41.336 1.00 47.53  ?  486  THR B C   1 
ATOM   7928 O  O   . THR B  1 486 ? 0.514   26.208  -40.980 1.00 64.23  ?  486  THR B O   1 
ATOM   7929 C  CB  . THR B  1 486 ? -2.472  25.852  -41.109 1.00 45.20  ?  486  THR B CB  1 
ATOM   7930 O  OG1 . THR B  1 486 ? -2.793  24.807  -40.183 1.00 52.20  ?  486  THR B OG1 1 
ATOM   7931 C  CG2 . THR B  1 486 ? -3.749  26.278  -41.828 1.00 42.57  ?  486  THR B CG2 1 
ATOM   7932 N  N   . GLY B  1 487 ? 0.326   23.976  -41.052 1.00 44.28  ?  487  GLY B N   1 
ATOM   7933 C  CA  . GLY B  1 487 ? 1.464   23.778  -40.162 1.00 48.16  ?  487  GLY B CA  1 
ATOM   7934 C  C   . GLY B  1 487 ? 1.093   23.896  -38.688 1.00 48.49  ?  487  GLY B C   1 
ATOM   7935 O  O   . GLY B  1 487 ? 1.963   23.987  -37.811 1.00 39.62  ?  487  GLY B O   1 
ATOM   7936 N  N   . ASP B  1 488 ? -0.214  23.881  -38.431 1.00 54.29  ?  488  ASP B N   1 
ATOM   7937 C  CA  . ASP B  1 488 ? -0.773  23.993  -37.094 1.00 52.16  ?  488  ASP B CA  1 
ATOM   7938 C  C   . ASP B  1 488 ? -1.982  23.053  -37.016 1.00 45.87  ?  488  ASP B C   1 
ATOM   7939 O  O   . ASP B  1 488 ? -2.951  23.233  -37.744 1.00 43.44  ?  488  ASP B O   1 
ATOM   7940 C  CB  . ASP B  1 488 ? -1.192  25.445  -36.862 1.00 59.33  ?  488  ASP B CB  1 
ATOM   7941 C  CG  . ASP B  1 488 ? -1.656  25.714  -35.448 1.00 59.83  ?  488  ASP B CG  1 
ATOM   7942 O  OD1 . ASP B  1 488 ? -1.969  24.755  -34.717 1.00 63.58  ?  488  ASP B OD1 1 
ATOM   7943 O  OD2 . ASP B  1 488 ? -1.726  26.904  -35.074 1.00 58.68  ?  488  ASP B OD2 1 
ATOM   7944 N  N   . PRO B  1 489 ? -1.928  22.044  -36.129 1.00 39.70  ?  489  PRO B N   1 
ATOM   7945 C  CA  . PRO B  1 489 ? -2.980  21.027  -36.010 1.00 46.07  ?  489  PRO B CA  1 
ATOM   7946 C  C   . PRO B  1 489 ? -4.239  21.563  -35.325 1.00 55.96  ?  489  PRO B C   1 
ATOM   7947 O  O   . PRO B  1 489 ? -5.239  20.852  -35.184 1.00 55.80  ?  489  PRO B O   1 
ATOM   7948 C  CB  . PRO B  1 489 ? -2.321  19.962  -35.130 1.00 43.99  ?  489  PRO B CB  1 
ATOM   7949 C  CG  . PRO B  1 489 ? -1.415  20.743  -34.254 1.00 42.33  ?  489  PRO B CG  1 
ATOM   7950 C  CD  . PRO B  1 489 ? -0.841  21.810  -35.165 1.00 39.17  ?  489  PRO B CD  1 
ATOM   7951 N  N   . ASN B  1 490 ? -4.190  22.821  -34.908 1.00 52.61  ?  490  ASN B N   1 
ATOM   7952 C  CA  . ASN B  1 490 ? -5.352  23.449  -34.309 1.00 53.27  ?  490  ASN B CA  1 
ATOM   7953 C  C   . ASN B  1 490 ? -6.377  23.944  -35.316 1.00 56.84  ?  490  ASN B C   1 
ATOM   7954 O  O   . ASN B  1 490 ? -6.038  24.667  -36.253 1.00 64.31  ?  490  ASN B O   1 
ATOM   7955 C  CB  . ASN B  1 490 ? -4.930  24.596  -33.388 1.00 54.15  ?  490  ASN B CB  1 
ATOM   7956 C  CG  . ASN B  1 490 ? -4.316  24.101  -32.095 1.00 51.76  ?  490  ASN B CG  1 
ATOM   7957 O  OD1 . ASN B  1 490 ? -4.994  23.465  -31.286 1.00 52.37  ?  490  ASN B OD1 1 
ATOM   7958 N  ND2 . ASN B  1 490 ? -3.032  24.385  -31.893 1.00 42.92  ?  490  ASN B ND2 1 
ATOM   7959 N  N   . ASP B  1 491 ? -7.628  23.545  -35.109 1.00 59.69  ?  491  ASP B N   1 
ATOM   7960 C  CA  . ASP B  1 491 ? -8.768  24.127  -35.810 1.00 63.57  ?  491  ASP B CA  1 
ATOM   7961 C  C   . ASP B  1 491 ? -8.656  25.655  -35.806 1.00 75.09  ?  491  ASP B C   1 
ATOM   7962 O  O   . ASP B  1 491 ? -8.394  26.261  -34.766 1.00 79.52  ?  491  ASP B O   1 
ATOM   7963 C  CB  . ASP B  1 491 ? -10.061 23.702  -35.123 1.00 71.16  ?  491  ASP B CB  1 
ATOM   7964 C  CG  . ASP B  1 491 ? -11.075 23.122  -36.086 1.00 85.79  ?  491  ASP B CG  1 
ATOM   7965 O  OD1 . ASP B  1 491 ? -11.560 23.869  -36.970 1.00 88.28  ?  491  ASP B OD1 1 
ATOM   7966 O  OD2 . ASP B  1 491 ? -11.400 21.922  -35.939 1.00 86.16  ?  491  ASP B OD2 1 
ATOM   7967 N  N   . PRO B  1 492 ? -8.843  26.280  -36.977 1.00 87.85  ?  492  PRO B N   1 
ATOM   7968 C  CA  . PRO B  1 492 ? -8.545  27.705  -37.171 1.00 87.59  ?  492  PRO B CA  1 
ATOM   7969 C  C   . PRO B  1 492 ? -9.619  28.651  -36.644 1.00 84.91  ?  492  PRO B C   1 
ATOM   7970 O  O   . PRO B  1 492 ? -9.290  29.776  -36.252 1.00 83.76  ?  492  PRO B O   1 
ATOM   7971 C  CB  . PRO B  1 492 ? -8.445  27.836  -38.699 1.00 90.81  ?  492  PRO B CB  1 
ATOM   7972 C  CG  . PRO B  1 492 ? -8.377  26.414  -39.223 1.00 90.19  ?  492  PRO B CG  1 
ATOM   7973 C  CD  . PRO B  1 492 ? -9.171  25.618  -38.248 1.00 90.16  ?  492  PRO B CD  1 
ATOM   7974 N  N   . ARG B  1 493 ? -10.876 28.215  -36.640 1.00 83.97  ?  493  ARG B N   1 
ATOM   7975 C  CA  . ARG B  1 493 ? -11.965 29.081  -36.195 1.00 95.86  ?  493  ARG B CA  1 
ATOM   7976 C  C   . ARG B  1 493 ? -12.738 28.483  -35.017 1.00 104.02 ?  493  ARG B C   1 
ATOM   7977 O  O   . ARG B  1 493 ? -13.561 29.158  -34.394 1.00 106.52 ?  493  ARG B O   1 
ATOM   7978 C  CB  . ARG B  1 493 ? -12.905 29.432  -37.358 1.00 99.48  ?  493  ARG B CB  1 
ATOM   7979 N  N   . ASP B  1 494 ? -12.386 27.299  -34.733 1.00 111.36 ?  494  ASP B N   1 
ATOM   7980 C  CA  . ASP B  1 494 ? -12.974 26.645  -33.566 1.00 124.36 ?  494  ASP B CA  1 
ATOM   7981 C  C   . ASP B  1 494 ? -12.375 27.129  -32.245 1.00 127.28 ?  494  ASP B C   1 
ATOM   7982 O  O   . ASP B  1 494 ? -11.162 27.034  -32.012 1.00 118.03 ?  494  ASP B O   1 
ATOM   7983 C  CB  . ASP B  1 494 ? -12.846 25.119  -33.672 1.00 124.42 ?  494  ASP B CB  1 
ATOM   7984 C  CG  . ASP B  1 494 ? -12.676 24.439  -32.312 1.00 121.92 ?  494  ASP B CG  1 
ATOM   7985 O  OD1 . ASP B  1 494 ? -13.703 24.119  -31.675 1.00 128.32 ?  494  ASP B OD1 1 
ATOM   7986 O  OD2 . ASP B  1 494 ? -11.515 24.215  -31.889 1.00 110.67 ?  494  ASP B OD2 1 
ATOM   7987 N  N   . SER B  1 495 ? -13.242 27.665  -31.393 1.00 136.32 ?  495  SER B N   1 
ATOM   7988 C  CA  . SER B  1 495 ? -12.912 27.881  -29.994 1.00 140.16 ?  495  SER B CA  1 
ATOM   7989 C  C   . SER B  1 495 ? -13.539 26.715  -29.234 1.00 149.00 ?  495  SER B C   1 
ATOM   7990 O  O   . SER B  1 495 ? -14.369 25.995  -29.794 1.00 153.91 ?  495  SER B O   1 
ATOM   7991 C  CB  . SER B  1 495 ? -13.452 29.223  -29.510 1.00 142.86 ?  495  SER B CB  1 
ATOM   7992 O  OG  . SER B  1 495 ? -13.077 29.477  -28.169 1.00 141.67 ?  495  SER B OG  1 
ATOM   7993 N  N   . LYS B  1 496 ? -13.138 26.527  -27.977 1.00 150.13 ?  496  LYS B N   1 
ATOM   7994 C  CA  . LYS B  1 496 ? -13.401 25.289  -27.232 1.00 148.59 ?  496  LYS B CA  1 
ATOM   7995 C  C   . LYS B  1 496 ? -12.672 24.122  -27.908 1.00 145.80 ?  496  LYS B C   1 
ATOM   7996 O  O   . LYS B  1 496 ? -12.207 24.252  -29.044 1.00 143.23 ?  496  LYS B O   1 
ATOM   7997 C  CB  . LYS B  1 496 ? -14.899 25.010  -27.046 1.00 150.81 ?  496  LYS B CB  1 
ATOM   7998 N  N   . SER B  1 497 ? -12.584 22.991  -27.209 1.00 145.94 ?  497  SER B N   1 
ATOM   7999 C  CA  . SER B  1 497 ? -11.579 21.960  -27.492 1.00 135.89 ?  497  SER B CA  1 
ATOM   8000 C  C   . SER B  1 497 ? -10.197 22.581  -27.253 1.00 127.10 ?  497  SER B C   1 
ATOM   8001 O  O   . SER B  1 497 ? -9.707  23.346  -28.087 1.00 130.56 ?  497  SER B O   1 
ATOM   8002 C  CB  . SER B  1 497 ? -11.699 21.392  -28.916 1.00 130.37 ?  497  SER B CB  1 
ATOM   8003 O  OG  . SER B  1 497 ? -13.047 21.117  -29.252 1.00 134.78 ?  497  SER B OG  1 
ATOM   8004 N  N   . PRO B  1 498 ? -9.573  22.258  -26.103 1.00 115.29 ?  498  PRO B N   1 
ATOM   8005 C  CA  . PRO B  1 498 ? -8.348  22.906  -25.600 1.00 103.36 ?  498  PRO B CA  1 
ATOM   8006 C  C   . PRO B  1 498 ? -7.219  22.931  -26.625 1.00 85.73  ?  498  PRO B C   1 
ATOM   8007 O  O   . PRO B  1 498 ? -7.045  21.956  -27.349 1.00 87.43  ?  498  PRO B O   1 
ATOM   8008 C  CB  . PRO B  1 498 ? -7.966  22.054  -24.377 1.00 102.35 ?  498  PRO B CB  1 
ATOM   8009 C  CG  . PRO B  1 498 ? -8.732  20.779  -24.525 1.00 105.69 ?  498  PRO B CG  1 
ATOM   8010 C  CD  . PRO B  1 498 ? -9.991  21.135  -25.247 1.00 113.60 ?  498  PRO B CD  1 
ATOM   8011 N  N   . GLN B  1 499 ? -6.469  24.029  -26.680 1.00 74.61  ?  499  GLN B N   1 
ATOM   8012 C  CA  . GLN B  1 499 ? -5.475  24.238  -27.741 1.00 57.71  ?  499  GLN B CA  1 
ATOM   8013 C  C   . GLN B  1 499 ? -4.208  23.391  -27.595 1.00 56.15  ?  499  GLN B C   1 
ATOM   8014 O  O   . GLN B  1 499 ? -3.734  23.141  -26.488 1.00 48.47  ?  499  GLN B O   1 
ATOM   8015 C  CB  . GLN B  1 499 ? -5.108  25.724  -27.859 1.00 54.64  ?  499  GLN B CB  1 
ATOM   8016 C  CG  . GLN B  1 499 ? -6.294  26.646  -28.167 1.00 64.21  ?  499  GLN B CG  1 
ATOM   8017 C  CD  . GLN B  1 499 ? -6.687  26.655  -29.645 1.00 72.70  ?  499  GLN B CD  1 
ATOM   8018 O  OE1 . GLN B  1 499 ? -7.857  26.450  -29.992 1.00 77.83  ?  499  GLN B OE1 1 
ATOM   8019 N  NE2 . GLN B  1 499 ? -5.713  26.917  -30.519 1.00 69.93  ?  499  GLN B NE2 1 
ATOM   8020 N  N   . TRP B  1 500 ? -3.663  22.986  -28.741 1.00 58.11  ?  500  TRP B N   1 
ATOM   8021 C  CA  . TRP B  1 500 ? -2.438  22.195  -28.803 1.00 57.18  ?  500  TRP B CA  1 
ATOM   8022 C  C   . TRP B  1 500 ? -1.258  23.148  -28.968 1.00 54.53  ?  500  TRP B C   1 
ATOM   8023 O  O   . TRP B  1 500 ? -1.089  23.742  -30.030 1.00 50.95  ?  500  TRP B O   1 
ATOM   8024 C  CB  . TRP B  1 500 ? -2.508  21.234  -30.003 1.00 52.33  ?  500  TRP B CB  1 
ATOM   8025 C  CG  . TRP B  1 500 ? -1.361  20.265  -30.138 1.00 45.15  ?  500  TRP B CG  1 
ATOM   8026 C  CD1 . TRP B  1 500 ? -0.123  20.376  -29.591 1.00 48.35  ?  500  TRP B CD1 1 
ATOM   8027 C  CD2 . TRP B  1 500 ? -1.364  19.027  -30.867 1.00 51.83  ?  500  TRP B CD2 1 
ATOM   8028 N  NE1 . TRP B  1 500 ? 0.651   19.297  -29.937 1.00 48.57  ?  500  TRP B NE1 1 
ATOM   8029 C  CE2 . TRP B  1 500 ? -0.088  18.452  -30.718 1.00 48.56  ?  500  TRP B CE2 1 
ATOM   8030 C  CE3 . TRP B  1 500 ? -2.322  18.356  -31.642 1.00 53.08  ?  500  TRP B CE3 1 
ATOM   8031 C  CZ2 . TRP B  1 500 ? 0.259   17.237  -31.310 1.00 49.55  ?  500  TRP B CZ2 1 
ATOM   8032 C  CZ3 . TRP B  1 500 ? -1.978  17.148  -32.225 1.00 44.44  ?  500  TRP B CZ3 1 
ATOM   8033 C  CH2 . TRP B  1 500 ? -0.700  16.603  -32.057 1.00 47.50  ?  500  TRP B CH2 1 
ATOM   8034 N  N   . PRO B  1 501 ? -0.427  23.288  -27.923 1.00 54.27  ?  501  PRO B N   1 
ATOM   8035 C  CA  . PRO B  1 501 ? 0.630   24.299  -27.977 1.00 46.44  ?  501  PRO B CA  1 
ATOM   8036 C  C   . PRO B  1 501 ? 1.888   23.748  -28.638 1.00 44.67  ?  501  PRO B C   1 
ATOM   8037 O  O   . PRO B  1 501 ? 2.080   22.532  -28.659 1.00 46.59  ?  501  PRO B O   1 
ATOM   8038 C  CB  . PRO B  1 501 ? 0.867   24.618  -26.491 1.00 41.09  ?  501  PRO B CB  1 
ATOM   8039 C  CG  . PRO B  1 501 ? 0.596   23.331  -25.799 1.00 42.96  ?  501  PRO B CG  1 
ATOM   8040 C  CD  . PRO B  1 501 ? -0.471  22.613  -26.611 1.00 57.86  ?  501  PRO B CD  1 
ATOM   8041 N  N   . PRO B  1 502 ? 2.725   24.633  -29.202 1.00 41.88  ?  502  PRO B N   1 
ATOM   8042 C  CA  . PRO B  1 502 ? 4.000   24.219  -29.794 1.00 40.86  ?  502  PRO B CA  1 
ATOM   8043 C  C   . PRO B  1 502 ? 4.936   23.628  -28.740 1.00 50.35  ?  502  PRO B C   1 
ATOM   8044 O  O   . PRO B  1 502 ? 5.004   24.130  -27.611 1.00 53.43  ?  502  PRO B O   1 
ATOM   8045 C  CB  . PRO B  1 502 ? 4.586   25.535  -30.320 1.00 33.51  ?  502  PRO B CB  1 
ATOM   8046 C  CG  . PRO B  1 502 ? 3.421   26.440  -30.481 1.00 35.65  ?  502  PRO B CG  1 
ATOM   8047 C  CD  . PRO B  1 502 ? 2.457   26.065  -29.410 1.00 37.22  ?  502  PRO B CD  1 
ATOM   8048 N  N   . TYR B  1 503 ? 5.644   22.564  -29.098 1.00 50.01  ?  503  TYR B N   1 
ATOM   8049 C  CA  . TYR B  1 503 ? 6.692   22.054  -28.230 1.00 49.71  ?  503  TYR B CA  1 
ATOM   8050 C  C   . TYR B  1 503 ? 7.859   23.024  -28.288 1.00 48.35  ?  503  TYR B C   1 
ATOM   8051 O  O   . TYR B  1 503 ? 8.274   23.440  -29.365 1.00 54.50  ?  503  TYR B O   1 
ATOM   8052 C  CB  . TYR B  1 503 ? 7.133   20.652  -28.660 1.00 47.12  ?  503  TYR B CB  1 
ATOM   8053 C  CG  . TYR B  1 503 ? 8.247   20.056  -27.818 1.00 45.75  ?  503  TYR B CG  1 
ATOM   8054 C  CD1 . TYR B  1 503 ? 9.578   20.344  -28.089 1.00 39.65  ?  503  TYR B CD1 1 
ATOM   8055 C  CD2 . TYR B  1 503 ? 7.967   19.196  -26.754 1.00 48.73  ?  503  TYR B CD2 1 
ATOM   8056 C  CE1 . TYR B  1 503 ? 10.603  19.804  -27.322 1.00 45.14  ?  503  TYR B CE1 1 
ATOM   8057 C  CE2 . TYR B  1 503 ? 8.992   18.646  -25.976 1.00 41.61  ?  503  TYR B CE2 1 
ATOM   8058 C  CZ  . TYR B  1 503 ? 10.303  18.952  -26.268 1.00 44.01  ?  503  TYR B CZ  1 
ATOM   8059 O  OH  . TYR B  1 503 ? 11.328  18.420  -25.523 1.00 47.56  ?  503  TYR B OH  1 
ATOM   8060 N  N   . THR B  1 504 ? 8.380   23.387  -27.125 1.00 48.24  ?  504  THR B N   1 
ATOM   8061 C  CA  . THR B  1 504 ? 9.505   24.306  -27.032 1.00 53.98  ?  504  THR B CA  1 
ATOM   8062 C  C   . THR B  1 504 ? 10.525  23.733  -26.069 1.00 59.12  ?  504  THR B C   1 
ATOM   8063 O  O   . THR B  1 504 ? 10.209  22.849  -25.283 1.00 62.36  ?  504  THR B O   1 
ATOM   8064 C  CB  . THR B  1 504 ? 9.062   25.689  -26.510 1.00 51.76  ?  504  THR B CB  1 
ATOM   8065 O  OG1 . THR B  1 504 ? 8.399   25.533  -25.247 1.00 50.48  ?  504  THR B OG1 1 
ATOM   8066 C  CG2 . THR B  1 504 ? 8.114   26.356  -27.500 1.00 41.04  ?  504  THR B CG2 1 
ATOM   8067 N  N   . THR B  1 505 ? 11.751  24.232  -26.126 1.00 60.05  ?  505  THR B N   1 
ATOM   8068 C  CA  . THR B  1 505 ? 12.777  23.761  -25.214 1.00 63.70  ?  505  THR B CA  1 
ATOM   8069 C  C   . THR B  1 505 ? 12.501  24.250  -23.795 1.00 65.79  ?  505  THR B C   1 
ATOM   8070 O  O   . THR B  1 505 ? 12.751  23.526  -22.831 1.00 70.50  ?  505  THR B O   1 
ATOM   8071 C  CB  . THR B  1 505 ? 14.188  24.179  -25.672 1.00 69.24  ?  505  THR B CB  1 
ATOM   8072 O  OG1 . THR B  1 505 ? 14.119  25.438  -26.357 1.00 75.19  ?  505  THR B OG1 1 
ATOM   8073 C  CG2 . THR B  1 505 ? 14.772  23.123  -26.615 1.00 58.11  ?  505  THR B CG2 1 
ATOM   8074 N  N   . ALA B  1 506 ? 11.958  25.460  -23.669 1.00 61.96  ?  506  ALA B N   1 
ATOM   8075 C  CA  . ALA B  1 506 ? 11.672  26.029  -22.349 1.00 69.17  ?  506  ALA B CA  1 
ATOM   8076 C  C   . ALA B  1 506 ? 10.572  25.281  -21.596 1.00 74.09  ?  506  ALA B C   1 
ATOM   8077 O  O   . ALA B  1 506 ? 10.763  24.890  -20.437 1.00 77.51  ?  506  ALA B O   1 
ATOM   8078 C  CB  . ALA B  1 506 ? 11.323  27.507  -22.457 1.00 67.31  ?  506  ALA B CB  1 
ATOM   8079 N  N   . ALA B  1 507 ? 9.428   25.080  -22.254 1.00 64.54  ?  507  ALA B N   1 
ATOM   8080 C  CA  . ALA B  1 507 ? 8.260   24.503  -21.586 1.00 57.15  ?  507  ALA B CA  1 
ATOM   8081 C  C   . ALA B  1 507 ? 7.990   23.026  -21.915 1.00 53.63  ?  507  ALA B C   1 
ATOM   8082 O  O   . ALA B  1 507 ? 7.278   22.346  -21.184 1.00 55.72  ?  507  ALA B O   1 
ATOM   8083 C  CB  . ALA B  1 507 ? 7.022   25.359  -21.833 1.00 48.63  ?  507  ALA B CB  1 
ATOM   8084 N  N   . GLN B  1 508 ? 8.564   22.538  -23.005 1.00 50.40  ?  508  GLN B N   1 
ATOM   8085 C  CA  . GLN B  1 508 ? 8.511   21.114  -23.339 1.00 54.21  ?  508  GLN B CA  1 
ATOM   8086 C  C   . GLN B  1 508 ? 7.100   20.537  -23.325 1.00 53.28  ?  508  GLN B C   1 
ATOM   8087 O  O   . GLN B  1 508 ? 6.888   19.392  -22.922 1.00 55.51  ?  508  GLN B O   1 
ATOM   8088 C  CB  . GLN B  1 508 ? 9.444   20.320  -22.422 1.00 48.86  ?  508  GLN B CB  1 
ATOM   8089 C  CG  . GLN B  1 508 ? 10.826  20.963  -22.307 1.00 56.41  ?  508  GLN B CG  1 
ATOM   8090 C  CD  . GLN B  1 508 ? 11.805  20.178  -21.442 1.00 59.91  ?  508  GLN B CD  1 
ATOM   8091 O  OE1 . GLN B  1 508 ? 11.796  18.941  -21.415 1.00 55.67  ?  508  GLN B OE1 1 
ATOM   8092 N  NE2 . GLN B  1 508 ? 12.661  20.900  -20.734 1.00 59.90  ?  508  GLN B NE2 1 
ATOM   8093 N  N   . GLN B  1 509 ? 6.147   21.348  -23.780 1.00 44.93  ?  509  GLN B N   1 
ATOM   8094 C  CA  . GLN B  1 509 ? 4.735   20.974  -23.811 1.00 42.60  ?  509  GLN B CA  1 
ATOM   8095 C  C   . GLN B  1 509 ? 4.398   19.986  -24.918 1.00 42.46  ?  509  GLN B C   1 
ATOM   8096 O  O   . GLN B  1 509 ? 4.810   20.155  -26.075 1.00 41.07  ?  509  GLN B O   1 
ATOM   8097 C  CB  . GLN B  1 509 ? 3.868   22.217  -23.981 1.00 38.02  ?  509  GLN B CB  1 
ATOM   8098 C  CG  . GLN B  1 509 ? 3.588   22.986  -22.705 1.00 45.99  ?  509  GLN B CG  1 
ATOM   8099 C  CD  . GLN B  1 509 ? 3.108   24.392  -22.997 1.00 49.44  ?  509  GLN B CD  1 
ATOM   8100 O  OE1 . GLN B  1 509 ? 3.695   25.106  -23.816 1.00 44.15  ?  509  GLN B OE1 1 
ATOM   8101 N  NE2 . GLN B  1 509 ? 2.028   24.791  -22.351 1.00 46.87  ?  509  GLN B NE2 1 
ATOM   8102 N  N   . TYR B  1 510 ? 3.642   18.956  -24.563 1.00 39.89  ?  510  TYR B N   1 
ATOM   8103 C  CA  . TYR B  1 510 ? 3.143   18.006  -25.549 1.00 42.29  ?  510  TYR B CA  1 
ATOM   8104 C  C   . TYR B  1 510 ? 1.736   17.613  -25.140 1.00 44.50  ?  510  TYR B C   1 
ATOM   8105 O  O   . TYR B  1 510 ? 1.319   17.921  -24.032 1.00 51.06  ?  510  TYR B O   1 
ATOM   8106 C  CB  . TYR B  1 510 ? 4.058   16.787  -25.644 1.00 35.39  ?  510  TYR B CB  1 
ATOM   8107 C  CG  . TYR B  1 510 ? 4.066   15.909  -24.414 1.00 34.27  ?  510  TYR B CG  1 
ATOM   8108 C  CD1 . TYR B  1 510 ? 4.809   16.252  -23.284 1.00 38.03  ?  510  TYR B CD1 1 
ATOM   8109 C  CD2 . TYR B  1 510 ? 3.346   14.720  -24.387 1.00 40.31  ?  510  TYR B CD2 1 
ATOM   8110 C  CE1 . TYR B  1 510 ? 4.817   15.431  -22.145 1.00 38.51  ?  510  TYR B CE1 1 
ATOM   8111 C  CE2 . TYR B  1 510 ? 3.348   13.896  -23.256 1.00 41.58  ?  510  TYR B CE2 1 
ATOM   8112 C  CZ  . TYR B  1 510 ? 4.080   14.253  -22.146 1.00 41.33  ?  510  TYR B CZ  1 
ATOM   8113 O  OH  . TYR B  1 510 ? 4.066   13.417  -21.050 1.00 55.16  ?  510  TYR B OH  1 
ATOM   8114 N  N   . VAL B  1 511 ? 0.984   16.957  -26.017 1.00 37.63  ?  511  VAL B N   1 
ATOM   8115 C  CA  . VAL B  1 511 ? -0.383  16.588  -25.646 1.00 40.11  ?  511  VAL B CA  1 
ATOM   8116 C  C   . VAL B  1 511 ? -0.650  15.086  -25.725 1.00 42.64  ?  511  VAL B C   1 
ATOM   8117 O  O   . VAL B  1 511 ? 0.024   14.350  -26.440 1.00 41.85  ?  511  VAL B O   1 
ATOM   8118 C  CB  . VAL B  1 511 ? -1.425  17.336  -26.496 1.00 42.79  ?  511  VAL B CB  1 
ATOM   8119 C  CG1 . VAL B  1 511 ? -1.113  18.813  -26.521 1.00 39.86  ?  511  VAL B CG1 1 
ATOM   8120 C  CG2 . VAL B  1 511 ? -1.454  16.788  -27.911 1.00 48.36  ?  511  VAL B CG2 1 
ATOM   8121 N  N   . SER B  1 512 ? -1.645  14.627  -24.984 1.00 39.61  ?  512  SER B N   1 
ATOM   8122 C  CA  . SER B  1 512 ? -2.023  13.229  -25.061 1.00 44.04  ?  512  SER B CA  1 
ATOM   8123 C  C   . SER B  1 512 ? -3.209  13.022  -26.016 1.00 55.39  ?  512  SER B C   1 
ATOM   8124 O  O   . SER B  1 512 ? -4.268  13.631  -25.863 1.00 57.51  ?  512  SER B O   1 
ATOM   8125 C  CB  . SER B  1 512 ? -2.342  12.700  -23.669 1.00 41.37  ?  512  SER B CB  1 
ATOM   8126 O  OG  . SER B  1 512 ? -3.325  13.515  -23.066 1.00 47.27  ?  512  SER B OG  1 
ATOM   8127 N  N   . LEU B  1 513 ? -3.017  12.176  -27.021 1.00 58.82  ?  513  LEU B N   1 
ATOM   8128 C  CA  . LEU B  1 513 ? -4.109  11.806  -27.908 1.00 50.04  ?  513  LEU B CA  1 
ATOM   8129 C  C   . LEU B  1 513 ? -4.787  10.562  -27.355 1.00 51.33  ?  513  LEU B C   1 
ATOM   8130 O  O   . LEU B  1 513 ? -4.169  9.501   -27.250 1.00 51.99  ?  513  LEU B O   1 
ATOM   8131 C  CB  . LEU B  1 513 ? -3.589  11.542  -29.316 1.00 46.32  ?  513  LEU B CB  1 
ATOM   8132 C  CG  . LEU B  1 513 ? -2.887  12.740  -29.948 1.00 47.42  ?  513  LEU B CG  1 
ATOM   8133 C  CD1 . LEU B  1 513 ? -2.378  12.401  -31.331 1.00 48.39  ?  513  LEU B CD1 1 
ATOM   8134 C  CD2 . LEU B  1 513 ? -3.828  13.920  -30.016 1.00 46.15  ?  513  LEU B CD2 1 
ATOM   8135 N  N   . ASN B  1 514 ? -6.050  10.705  -26.971 1.00 43.32  ?  514  ASN B N   1 
ATOM   8136 C  CA  . ASN B  1 514 ? -6.835  9.582   -26.482 1.00 50.16  ?  514  ASN B CA  1 
ATOM   8137 C  C   . ASN B  1 514 ? -8.292  9.997   -26.510 1.00 56.16  ?  514  ASN B C   1 
ATOM   8138 O  O   . ASN B  1 514 ? -8.612  11.041  -27.085 1.00 56.77  ?  514  ASN B O   1 
ATOM   8139 C  CB  . ASN B  1 514 ? -6.383  9.134   -25.076 1.00 54.03  ?  514  ASN B CB  1 
ATOM   8140 C  CG  . ASN B  1 514 ? -6.619  10.194  -23.997 1.00 55.51  ?  514  ASN B CG  1 
ATOM   8141 O  OD1 . ASN B  1 514 ? -7.616  10.916  -24.008 1.00 67.36  ?  514  ASN B OD1 1 
ATOM   8142 N  ND2 . ASN B  1 514 ? -5.704  10.267  -23.046 1.00 54.60  ?  514  ASN B ND2 1 
ATOM   8143 N  N   . LEU B  1 515 ? -9.165  9.227   -25.860 1.00 49.33  ?  515  LEU B N   1 
ATOM   8144 C  CA  . LEU B  1 515 ? -10.601 9.463   -26.004 1.00 52.45  ?  515  LEU B CA  1 
ATOM   8145 C  C   . LEU B  1 515 ? -11.070 10.708  -25.274 1.00 60.25  ?  515  LEU B C   1 
ATOM   8146 O  O   . LEU B  1 515 ? -12.127 11.251  -25.585 1.00 64.41  ?  515  LEU B O   1 
ATOM   8147 C  CB  . LEU B  1 515 ? -11.402 8.258   -25.533 1.00 53.79  ?  515  LEU B CB  1 
ATOM   8148 C  CG  . LEU B  1 515 ? -11.136 6.982   -26.319 1.00 62.62  ?  515  LEU B CG  1 
ATOM   8149 C  CD1 . LEU B  1 515 ? -12.053 5.872   -25.835 1.00 54.93  ?  515  LEU B CD1 1 
ATOM   8150 C  CD2 . LEU B  1 515 ? -11.317 7.237   -27.819 1.00 57.44  ?  515  LEU B CD2 1 
ATOM   8151 N  N   . LYS B  1 516 ? -10.286 11.154  -24.300 1.00 56.46  ?  516  LYS B N   1 
ATOM   8152 C  CA  . LYS B  1 516 ? -10.634 12.349  -23.543 1.00 65.42  ?  516  LYS B CA  1 
ATOM   8153 C  C   . LYS B  1 516 ? -10.146 13.578  -24.309 1.00 63.57  ?  516  LYS B C   1 
ATOM   8154 O  O   . LYS B  1 516 ? -9.311  13.450  -25.199 1.00 56.49  ?  516  LYS B O   1 
ATOM   8155 C  CB  . LYS B  1 516 ? -10.026 12.277  -22.137 1.00 64.40  ?  516  LYS B CB  1 
ATOM   8156 C  CG  . LYS B  1 516 ? -10.514 11.078  -21.329 1.00 74.99  ?  516  LYS B CG  1 
ATOM   8157 C  CD  . LYS B  1 516 ? -9.925  11.049  -19.922 1.00 87.51  ?  516  LYS B CD  1 
ATOM   8158 C  CE  . LYS B  1 516 ? -8.433  10.741  -19.938 1.00 96.47  ?  516  LYS B CE  1 
ATOM   8159 N  NZ  . LYS B  1 516 ? -7.848  10.728  -18.558 1.00 105.56 ?  516  LYS B NZ  1 
ATOM   8160 N  N   . PRO B  1 517 ? -10.687 14.766  -23.990 1.00 63.15  ?  517  PRO B N   1 
ATOM   8161 C  CA  . PRO B  1 517 ? -10.225 16.014  -24.609 1.00 61.53  ?  517  PRO B CA  1 
ATOM   8162 C  C   . PRO B  1 517 ? -8.718  16.175  -24.500 1.00 63.51  ?  517  PRO B C   1 
ATOM   8163 O  O   . PRO B  1 517 ? -8.137  15.648  -23.554 1.00 62.28  ?  517  PRO B O   1 
ATOM   8164 C  CB  . PRO B  1 517 ? -10.915 17.084  -23.765 1.00 61.87  ?  517  PRO B CB  1 
ATOM   8165 C  CG  . PRO B  1 517 ? -12.194 16.443  -23.362 1.00 57.91  ?  517  PRO B CG  1 
ATOM   8166 C  CD  . PRO B  1 517 ? -11.870 14.987  -23.138 1.00 58.43  ?  517  PRO B CD  1 
ATOM   8167 N  N   . LEU B  1 518 ? -8.100  16.860  -25.462 1.00 66.33  ?  518  LEU B N   1 
ATOM   8168 C  CA  . LEU B  1 518 ? -6.667  17.139  -25.414 1.00 62.44  ?  518  LEU B CA  1 
ATOM   8169 C  C   . LEU B  1 518 ? -6.230  17.586  -24.028 1.00 65.91  ?  518  LEU B C   1 
ATOM   8170 O  O   . LEU B  1 518 ? -6.850  18.449  -23.410 1.00 67.90  ?  518  LEU B O   1 
ATOM   8171 C  CB  . LEU B  1 518 ? -6.285  18.235  -26.405 1.00 56.25  ?  518  LEU B CB  1 
ATOM   8172 C  CG  . LEU B  1 518 ? -5.813  17.834  -27.795 1.00 64.92  ?  518  LEU B CG  1 
ATOM   8173 C  CD1 . LEU B  1 518 ? -5.048  18.983  -28.423 1.00 65.03  ?  518  LEU B CD1 1 
ATOM   8174 C  CD2 . LEU B  1 518 ? -4.959  16.580  -27.744 1.00 68.48  ?  518  LEU B CD2 1 
ATOM   8175 N  N   . GLU B  1 519 ? -5.150  16.995  -23.547 1.00 65.95  ?  519  GLU B N   1 
ATOM   8176 C  CA  . GLU B  1 519 ? -4.583  17.388  -22.273 1.00 56.51  ?  519  GLU B CA  1 
ATOM   8177 C  C   . GLU B  1 519 ? -3.113  17.727  -22.499 1.00 46.78  ?  519  GLU B C   1 
ATOM   8178 O  O   . GLU B  1 519 ? -2.394  16.974  -23.134 1.00 47.50  ?  519  GLU B O   1 
ATOM   8179 C  CB  . GLU B  1 519 ? -4.753  16.245  -21.278 1.00 58.41  ?  519  GLU B CB  1 
ATOM   8180 C  CG  . GLU B  1 519 ? -4.066  16.434  -19.961 1.00 66.25  ?  519  GLU B CG  1 
ATOM   8181 C  CD  . GLU B  1 519 ? -4.116  15.172  -19.131 1.00 79.10  ?  519  GLU B CD  1 
ATOM   8182 O  OE1 . GLU B  1 519 ? -5.232  14.640  -18.930 1.00 83.06  ?  519  GLU B OE1 1 
ATOM   8183 O  OE2 . GLU B  1 519 ? -3.039  14.705  -18.697 1.00 80.48  ?  519  GLU B OE2 1 
ATOM   8184 N  N   . VAL B  1 520 ? -2.686  18.879  -21.995 1.00 46.80  ?  520  VAL B N   1 
ATOM   8185 C  CA  . VAL B  1 520 ? -1.316  19.355  -22.147 1.00 42.69  ?  520  VAL B CA  1 
ATOM   8186 C  C   . VAL B  1 520 ? -0.397  18.870  -21.016 1.00 48.97  ?  520  VAL B C   1 
ATOM   8187 O  O   . VAL B  1 520 ? -0.671  19.102  -19.833 1.00 49.13  ?  520  VAL B O   1 
ATOM   8188 C  CB  . VAL B  1 520 ? -1.297  20.901  -22.137 1.00 44.62  ?  520  VAL B CB  1 
ATOM   8189 C  CG1 . VAL B  1 520 ? 0.133   21.424  -22.239 1.00 38.97  ?  520  VAL B CG1 1 
ATOM   8190 C  CG2 . VAL B  1 520 ? -2.180  21.451  -23.255 1.00 48.03  ?  520  VAL B CG2 1 
ATOM   8191 N  N   . ARG B  1 521 ? 0.704   18.223  -21.377 1.00 45.05  ?  521  ARG B N   1 
ATOM   8192 C  CA  . ARG B  1 521 ? 1.690   17.786  -20.392 1.00 45.44  ?  521  ARG B CA  1 
ATOM   8193 C  C   . ARG B  1 521 ? 3.064   18.398  -20.659 1.00 43.36  ?  521  ARG B C   1 
ATOM   8194 O  O   . ARG B  1 521 ? 3.359   18.796  -21.776 1.00 48.27  ?  521  ARG B O   1 
ATOM   8195 C  CB  . ARG B  1 521 ? 1.791   16.265  -20.394 1.00 53.74  ?  521  ARG B CB  1 
ATOM   8196 C  CG  . ARG B  1 521 ? 0.459   15.578  -20.205 1.00 55.81  ?  521  ARG B CG  1 
ATOM   8197 C  CD  . ARG B  1 521 ? 0.632   14.086  -20.169 1.00 55.25  ?  521  ARG B CD  1 
ATOM   8198 N  NE  . ARG B  1 521 ? -0.656  13.415  -20.077 1.00 54.14  ?  521  ARG B NE  1 
ATOM   8199 C  CZ  . ARG B  1 521 ? -0.867  12.156  -20.445 1.00 53.03  ?  521  ARG B CZ  1 
ATOM   8200 N  NH1 . ARG B  1 521 ? 0.134   11.429  -20.931 1.00 36.91  ?  521  ARG B NH1 1 
ATOM   8201 N  NH2 . ARG B  1 521 ? -2.080  11.626  -20.324 1.00 48.98  ?  521  ARG B NH2 1 
ATOM   8202 N  N   . ARG B  1 522 ? 3.905   18.486  -19.631 1.00 48.58  ?  522  ARG B N   1 
ATOM   8203 C  CA  . ARG B  1 522 ? 5.243   19.045  -19.818 1.00 43.71  ?  522  ARG B CA  1 
ATOM   8204 C  C   . ARG B  1 522 ? 6.328   17.989  -19.643 1.00 43.70  ?  522  ARG B C   1 
ATOM   8205 O  O   . ARG B  1 522 ? 6.240   17.145  -18.759 1.00 45.84  ?  522  ARG B O   1 
ATOM   8206 C  CB  . ARG B  1 522 ? 5.476   20.263  -18.919 1.00 38.08  ?  522  ARG B CB  1 
ATOM   8207 C  CG  . ARG B  1 522 ? 4.570   21.447  -19.271 1.00 49.02  ?  522  ARG B CG  1 
ATOM   8208 C  CD  . ARG B  1 522 ? 4.799   22.678  -18.387 1.00 55.63  ?  522  ARG B CD  1 
ATOM   8209 N  NE  . ARG B  1 522 ? 6.165   23.192  -18.479 1.00 67.34  ?  522  ARG B NE  1 
ATOM   8210 C  CZ  . ARG B  1 522 ? 6.630   24.240  -17.798 1.00 62.39  ?  522  ARG B CZ  1 
ATOM   8211 N  NH1 . ARG B  1 522 ? 5.835   24.908  -16.967 1.00 48.79  ?  522  ARG B NH1 1 
ATOM   8212 N  NH2 . ARG B  1 522 ? 7.895   24.625  -17.954 1.00 58.12  ?  522  ARG B NH2 1 
ATOM   8213 N  N   . GLY B  1 523 ? 7.319   18.016  -20.531 1.00 43.69  ?  523  GLY B N   1 
ATOM   8214 C  CA  . GLY B  1 523 ? 8.467   17.131  -20.450 1.00 41.03  ?  523  GLY B CA  1 
ATOM   8215 C  C   . GLY B  1 523 ? 8.167   15.734  -20.938 1.00 49.08  ?  523  GLY B C   1 
ATOM   8216 O  O   . GLY B  1 523 ? 7.348   15.028  -20.364 1.00 57.46  ?  523  GLY B O   1 
ATOM   8217 N  N   . LEU B  1 524 ? 8.841   15.332  -22.007 1.00 53.61  ?  524  LEU B N   1 
ATOM   8218 C  CA  . LEU B  1 524 ? 8.620   14.020  -22.596 1.00 52.97  ?  524  LEU B CA  1 
ATOM   8219 C  C   . LEU B  1 524 ? 9.662   13.038  -22.069 1.00 50.79  ?  524  LEU B C   1 
ATOM   8220 O  O   . LEU B  1 524 ? 10.761  12.970  -22.611 1.00 54.62  ?  524  LEU B O   1 
ATOM   8221 C  CB  . LEU B  1 524 ? 8.708   14.130  -24.119 1.00 56.45  ?  524  LEU B CB  1 
ATOM   8222 C  CG  . LEU B  1 524 ? 7.989   13.084  -24.969 1.00 61.39  ?  524  LEU B CG  1 
ATOM   8223 C  CD1 . LEU B  1 524 ? 6.691   12.636  -24.322 1.00 58.43  ?  524  LEU B CD1 1 
ATOM   8224 C  CD2 . LEU B  1 524 ? 7.711   13.661  -26.349 1.00 65.98  ?  524  LEU B CD2 1 
ATOM   8225 N  N   . ARG B  1 525 ? 9.305   12.286  -21.023 1.00 47.31  ?  525  ARG B N   1 
ATOM   8226 C  CA  . ARG B  1 525 ? 10.252  11.442  -20.282 1.00 46.97  ?  525  ARG B CA  1 
ATOM   8227 C  C   . ARG B  1 525 ? 11.568  12.179  -20.029 1.00 48.46  ?  525  ARG B C   1 
ATOM   8228 O  O   . ARG B  1 525 ? 12.644  11.679  -20.371 1.00 48.34  ?  525  ARG B O   1 
ATOM   8229 C  CB  . ARG B  1 525 ? 10.542  10.148  -21.039 1.00 51.95  ?  525  ARG B CB  1 
ATOM   8230 C  CG  . ARG B  1 525 ? 9.324   9.375   -21.432 1.00 62.62  ?  525  ARG B CG  1 
ATOM   8231 C  CD  . ARG B  1 525 ? 8.873   8.443   -20.336 1.00 70.60  ?  525  ARG B CD  1 
ATOM   8232 N  NE  . ARG B  1 525 ? 8.697   7.094   -20.862 1.00 83.88  ?  525  ARG B NE  1 
ATOM   8233 C  CZ  . ARG B  1 525 ? 7.655   6.697   -21.589 1.00 84.48  ?  525  ARG B CZ  1 
ATOM   8234 N  NH1 . ARG B  1 525 ? 6.674   7.546   -21.879 1.00 85.64  ?  525  ARG B NH1 1 
ATOM   8235 N  NH2 . ARG B  1 525 ? 7.593   5.444   -22.024 1.00 81.18  ?  525  ARG B NH2 1 
ATOM   8236 N  N   . ALA B  1 526 ? 11.481  13.371  -19.448 1.00 41.92  ?  526  ALA B N   1 
ATOM   8237 C  CA  . ALA B  1 526 ? 12.630  14.268  -19.407 1.00 41.69  ?  526  ALA B CA  1 
ATOM   8238 C  C   . ALA B  1 526 ? 13.811  13.690  -18.639 1.00 45.48  ?  526  ALA B C   1 
ATOM   8239 O  O   . ALA B  1 526 ? 14.936  13.739  -19.128 1.00 56.52  ?  526  ALA B O   1 
ATOM   8240 C  CB  . ALA B  1 526 ? 12.235  15.630  -18.853 1.00 48.31  ?  526  ALA B CB  1 
ATOM   8241 N  N   . GLN B  1 527 ? 13.566  13.138  -17.448 1.00 46.09  ?  527  GLN B N   1 
ATOM   8242 C  CA  . GLN B  1 527 ? 14.664  12.594  -16.644 1.00 46.08  ?  527  GLN B CA  1 
ATOM   8243 C  C   . GLN B  1 527 ? 15.268  11.371  -17.306 1.00 41.67  ?  527  GLN B C   1 
ATOM   8244 O  O   . GLN B  1 527 ? 16.483  11.267  -17.415 1.00 49.23  ?  527  GLN B O   1 
ATOM   8245 C  CB  . GLN B  1 527 ? 14.236  12.245  -15.207 1.00 48.39  ?  527  GLN B CB  1 
ATOM   8246 C  CG  . GLN B  1 527 ? 13.789  13.426  -14.359 1.00 49.26  ?  527  GLN B CG  1 
ATOM   8247 C  CD  . GLN B  1 527 ? 14.800  14.555  -14.321 1.00 52.60  ?  527  GLN B CD  1 
ATOM   8248 O  OE1 . GLN B  1 527 ? 14.539  15.652  -14.829 1.00 54.63  ?  527  GLN B OE1 1 
ATOM   8249 N  NE2 . GLN B  1 527 ? 15.954  14.302  -13.700 1.00 50.78  ?  527  GLN B NE2 1 
ATOM   8250 N  N   . THR B  1 528 ? 14.419  10.445  -17.739 1.00 34.80  ?  528  THR B N   1 
ATOM   8251 C  CA  . THR B  1 528 ? 14.887  9.243   -18.411 1.00 48.02  ?  528  THR B CA  1 
ATOM   8252 C  C   . THR B  1 528 ? 15.618  9.552   -19.730 1.00 48.75  ?  528  THR B C   1 
ATOM   8253 O  O   . THR B  1 528 ? 16.630  8.924   -20.052 1.00 57.63  ?  528  THR B O   1 
ATOM   8254 C  CB  . THR B  1 528 ? 13.728  8.271   -18.673 1.00 52.05  ?  528  THR B CB  1 
ATOM   8255 O  OG1 . THR B  1 528 ? 13.310  7.687   -17.434 1.00 45.29  ?  528  THR B OG1 1 
ATOM   8256 C  CG2 . THR B  1 528 ? 14.142  7.158   -19.657 1.00 50.53  ?  528  THR B CG2 1 
ATOM   8257 N  N   . CYS B  1 529 ? 15.130  10.519  -20.494 1.00 40.61  ?  529  CYS B N   1 
ATOM   8258 C  CA  . CYS B  1 529 ? 15.792  10.799  -21.765 1.00 42.98  ?  529  CYS B CA  1 
ATOM   8259 C  C   . CYS B  1 529 ? 17.115  11.512  -21.548 1.00 40.27  ?  529  CYS B C   1 
ATOM   8260 O  O   . CYS B  1 529 ? 18.073  11.262  -22.268 1.00 49.19  ?  529  CYS B O   1 
ATOM   8261 C  CB  . CYS B  1 529 ? 14.869  11.518  -22.769 1.00 44.67  ?  529  CYS B CB  1 
ATOM   8262 S  SG  . CYS B  1 529 ? 13.610  10.402  -23.469 1.00 57.42  ?  529  CYS B SG  1 
ATOM   8263 N  N   . ALA B  1 530 ? 17.185  12.357  -20.525 1.00 40.64  ?  530  ALA B N   1 
ATOM   8264 C  CA  . ALA B  1 530 ? 18.470  12.924  -20.119 1.00 49.22  ?  530  ALA B CA  1 
ATOM   8265 C  C   . ALA B  1 530 ? 19.505  11.818  -19.892 1.00 51.48  ?  530  ALA B C   1 
ATOM   8266 O  O   . ALA B  1 530 ? 20.673  11.972  -20.245 1.00 53.96  ?  530  ALA B O   1 
ATOM   8267 C  CB  . ALA B  1 530 ? 18.313  13.767  -18.857 1.00 48.07  ?  530  ALA B CB  1 
ATOM   8268 N  N   . PHE B  1 531 ? 19.064  10.704  -19.309 1.00 42.10  ?  531  PHE B N   1 
ATOM   8269 C  CA  . PHE B  1 531 ? 19.918  9.534   -19.126 1.00 40.57  ?  531  PHE B CA  1 
ATOM   8270 C  C   . PHE B  1 531 ? 20.397  8.914   -20.440 1.00 46.75  ?  531  PHE B C   1 
ATOM   8271 O  O   . PHE B  1 531 ? 21.571  8.562   -20.581 1.00 48.16  ?  531  PHE B O   1 
ATOM   8272 C  CB  . PHE B  1 531 ? 19.196  8.475   -18.302 1.00 41.87  ?  531  PHE B CB  1 
ATOM   8273 C  CG  . PHE B  1 531 ? 19.905  7.155   -18.256 1.00 41.11  ?  531  PHE B CG  1 
ATOM   8274 C  CD1 . PHE B  1 531 ? 21.040  6.992   -17.484 1.00 46.19  ?  531  PHE B CD1 1 
ATOM   8275 C  CD2 . PHE B  1 531 ? 19.427  6.071   -18.973 1.00 41.83  ?  531  PHE B CD2 1 
ATOM   8276 C  CE1 . PHE B  1 531 ? 21.688  5.766   -17.431 1.00 56.81  ?  531  PHE B CE1 1 
ATOM   8277 C  CE2 . PHE B  1 531 ? 20.070  4.844   -18.929 1.00 46.39  ?  531  PHE B CE2 1 
ATOM   8278 C  CZ  . PHE B  1 531 ? 21.199  4.691   -18.159 1.00 56.25  ?  531  PHE B CZ  1 
ATOM   8279 N  N   . TRP B  1 532 ? 19.493  8.776   -21.405 1.00 48.37  ?  532  TRP B N   1 
ATOM   8280 C  CA  . TRP B  1 532 ? 19.876  8.207   -22.683 1.00 41.48  ?  532  TRP B CA  1 
ATOM   8281 C  C   . TRP B  1 532 ? 20.587  9.215   -23.540 1.00 44.72  ?  532  TRP B C   1 
ATOM   8282 O  O   . TRP B  1 532 ? 21.561  8.887   -24.207 1.00 49.75  ?  532  TRP B O   1 
ATOM   8283 C  CB  . TRP B  1 532 ? 18.664  7.698   -23.446 1.00 44.72  ?  532  TRP B CB  1 
ATOM   8284 C  CG  . TRP B  1 532 ? 18.060  6.465   -22.885 1.00 46.52  ?  532  TRP B CG  1 
ATOM   8285 C  CD1 . TRP B  1 532 ? 16.952  6.385   -22.102 1.00 40.80  ?  532  TRP B CD1 1 
ATOM   8286 C  CD2 . TRP B  1 532 ? 18.515  5.116   -23.081 1.00 48.61  ?  532  TRP B CD2 1 
ATOM   8287 N  NE1 . TRP B  1 532 ? 16.686  5.071   -21.792 1.00 43.75  ?  532  TRP B NE1 1 
ATOM   8288 C  CE2 . TRP B  1 532 ? 17.633  4.273   -22.379 1.00 47.54  ?  532  TRP B CE2 1 
ATOM   8289 C  CE3 . TRP B  1 532 ? 19.590  4.543   -23.767 1.00 48.64  ?  532  TRP B CE3 1 
ATOM   8290 C  CZ2 . TRP B  1 532 ? 17.784  2.889   -22.355 1.00 41.39  ?  532  TRP B CZ2 1 
ATOM   8291 C  CZ3 . TRP B  1 532 ? 19.744  3.162   -23.733 1.00 43.27  ?  532  TRP B CZ3 1 
ATOM   8292 C  CH2 . TRP B  1 532 ? 18.845  2.356   -23.040 1.00 54.53  ?  532  TRP B CH2 1 
ATOM   8293 N  N   . ASN B  1 533 ? 20.088  10.443  -23.550 1.00 46.33  ?  533  ASN B N   1 
ATOM   8294 C  CA  . ASN B  1 533 ? 20.556  11.413  -24.540 1.00 47.18  ?  533  ASN B CA  1 
ATOM   8295 C  C   . ASN B  1 533 ? 21.804  12.143  -24.111 1.00 51.75  ?  533  ASN B C   1 
ATOM   8296 O  O   . ASN B  1 533 ? 22.580  12.587  -24.956 1.00 46.14  ?  533  ASN B O   1 
ATOM   8297 C  CB  . ASN B  1 533 ? 19.468  12.430  -24.890 1.00 52.34  ?  533  ASN B CB  1 
ATOM   8298 C  CG  . ASN B  1 533 ? 18.294  11.803  -25.605 1.00 51.10  ?  533  ASN B CG  1 
ATOM   8299 O  OD1 . ASN B  1 533 ? 18.416  10.733  -26.189 1.00 59.63  ?  533  ASN B OD1 1 
ATOM   8300 N  ND2 . ASN B  1 533 ? 17.148  12.463  -25.558 1.00 44.68  ?  533  ASN B ND2 1 
ATOM   8301 N  N   . ARG B  1 534 ? 21.998  12.262  -22.797 1.00 54.23  ?  534  ARG B N   1 
ATOM   8302 C  CA  . ARG B  1 534 ? 23.093  13.067  -22.267 1.00 53.91  ?  534  ARG B CA  1 
ATOM   8303 C  C   . ARG B  1 534 ? 24.144  12.256  -21.519 1.00 53.39  ?  534  ARG B C   1 
ATOM   8304 O  O   . ARG B  1 534 ? 25.332  12.513  -21.659 1.00 54.27  ?  534  ARG B O   1 
ATOM   8305 C  CB  . ARG B  1 534 ? 22.561  14.176  -21.355 1.00 57.72  ?  534  ARG B CB  1 
ATOM   8306 C  CG  . ARG B  1 534 ? 21.556  15.102  -21.996 1.00 57.42  ?  534  ARG B CG  1 
ATOM   8307 C  CD  . ARG B  1 534 ? 20.950  16.019  -20.954 1.00 60.98  ?  534  ARG B CD  1 
ATOM   8308 N  NE  . ARG B  1 534 ? 20.031  16.980  -21.551 1.00 69.16  ?  534  ARG B NE  1 
ATOM   8309 C  CZ  . ARG B  1 534 ? 20.379  18.203  -21.933 1.00 64.15  ?  534  ARG B CZ  1 
ATOM   8310 N  NH1 . ARG B  1 534 ? 21.629  18.620  -21.774 1.00 53.43  ?  534  ARG B NH1 1 
ATOM   8311 N  NH2 . ARG B  1 534 ? 19.474  19.008  -22.467 1.00 66.91  ?  534  ARG B NH2 1 
ATOM   8312 N  N   . PHE B  1 535 ? 23.718  11.289  -20.712 1.00 54.33  ?  535  PHE B N   1 
ATOM   8313 C  CA  . PHE B  1 535 ? 24.681  10.549  -19.914 1.00 50.30  ?  535  PHE B CA  1 
ATOM   8314 C  C   . PHE B  1 535 ? 25.289  9.355   -20.618 1.00 56.57  ?  535  PHE B C   1 
ATOM   8315 O  O   . PHE B  1 535 ? 26.509  9.259   -20.713 1.00 68.83  ?  535  PHE B O   1 
ATOM   8316 C  CB  . PHE B  1 535 ? 24.123  10.089  -18.568 1.00 46.00  ?  535  PHE B CB  1 
ATOM   8317 C  CG  . PHE B  1 535 ? 25.100  9.267   -17.799 1.00 49.44  ?  535  PHE B CG  1 
ATOM   8318 C  CD1 . PHE B  1 535 ? 26.232  9.857   -17.257 1.00 49.79  ?  535  PHE B CD1 1 
ATOM   8319 C  CD2 . PHE B  1 535 ? 24.922  7.898   -17.661 1.00 50.14  ?  535  PHE B CD2 1 
ATOM   8320 C  CE1 . PHE B  1 535 ? 27.159  9.106   -16.567 1.00 51.32  ?  535  PHE B CE1 1 
ATOM   8321 C  CE2 . PHE B  1 535 ? 25.843  7.139   -16.979 1.00 48.50  ?  535  PHE B CE2 1 
ATOM   8322 C  CZ  . PHE B  1 535 ? 26.965  7.744   -16.427 1.00 50.60  ?  535  PHE B CZ  1 
ATOM   8323 N  N   . LEU B  1 536 ? 24.457  8.428   -21.074 1.00 44.99  ?  536  LEU B N   1 
ATOM   8324 C  CA  . LEU B  1 536 ? 24.983  7.234   -21.733 1.00 57.49  ?  536  LEU B CA  1 
ATOM   8325 C  C   . LEU B  1 536 ? 26.064  7.459   -22.808 1.00 63.81  ?  536  LEU B C   1 
ATOM   8326 O  O   . LEU B  1 536 ? 27.067  6.736   -22.815 1.00 69.57  ?  536  LEU B O   1 
ATOM   8327 C  CB  . LEU B  1 536 ? 23.869  6.323   -22.248 1.00 46.73  ?  536  LEU B CB  1 
ATOM   8328 C  CG  . LEU B  1 536 ? 23.447  5.229   -21.270 1.00 53.88  ?  536  LEU B CG  1 
ATOM   8329 C  CD1 . LEU B  1 536 ? 22.987  4.009   -22.021 1.00 56.93  ?  536  LEU B CD1 1 
ATOM   8330 C  CD2 . LEU B  1 536 ? 24.580  4.857   -20.304 1.00 52.37  ?  536  LEU B CD2 1 
ATOM   8331 N  N   . PRO B  1 537 ? 25.882  8.455   -23.703 1.00 57.88  ?  537  PRO B N   1 
ATOM   8332 C  CA  . PRO B  1 537 ? 26.945  8.687   -24.695 1.00 61.00  ?  537  PRO B CA  1 
ATOM   8333 C  C   . PRO B  1 537 ? 28.300  8.985   -24.056 1.00 65.88  ?  537  PRO B C   1 
ATOM   8334 O  O   . PRO B  1 537 ? 29.323  8.582   -24.605 1.00 77.18  ?  537  PRO B O   1 
ATOM   8335 C  CB  . PRO B  1 537 ? 26.444  9.913   -25.467 1.00 49.33  ?  537  PRO B CB  1 
ATOM   8336 C  CG  . PRO B  1 537 ? 24.986  9.838   -25.361 1.00 46.37  ?  537  PRO B CG  1 
ATOM   8337 C  CD  . PRO B  1 537 ? 24.709  9.307   -23.974 1.00 53.44  ?  537  PRO B CD  1 
ATOM   8338 N  N   . LYS B  1 538 ? 28.311  9.665   -22.912 1.00 64.39  ?  538  LYS B N   1 
ATOM   8339 C  CA  . LYS B  1 538 ? 29.568  9.916   -22.219 1.00 61.11  ?  538  LYS B CA  1 
ATOM   8340 C  C   . LYS B  1 538 ? 30.128  8.601   -21.707 1.00 66.42  ?  538  LYS B C   1 
ATOM   8341 O  O   . LYS B  1 538 ? 31.343  8.419   -21.622 1.00 77.87  ?  538  LYS B O   1 
ATOM   8342 C  CB  . LYS B  1 538 ? 29.384  10.895  -21.066 1.00 59.09  ?  538  LYS B CB  1 
ATOM   8343 C  CG  . LYS B  1 538 ? 28.957  12.290  -21.492 1.00 71.15  ?  538  LYS B CG  1 
ATOM   8344 C  CD  . LYS B  1 538 ? 28.567  13.135  -20.278 1.00 82.47  ?  538  LYS B CD  1 
ATOM   8345 C  CE  . LYS B  1 538 ? 28.067  14.514  -20.695 1.00 85.60  ?  538  LYS B CE  1 
ATOM   8346 N  NZ  . LYS B  1 538 ? 29.051  15.209  -21.576 1.00 87.45  ?  538  LYS B NZ  1 
ATOM   8347 N  N   . LEU B  1 539 ? 29.235  7.673   -21.392 1.00 62.43  ?  539  LEU B N   1 
ATOM   8348 C  CA  . LEU B  1 539 ? 29.648  6.416   -20.788 1.00 72.50  ?  539  LEU B CA  1 
ATOM   8349 C  C   . LEU B  1 539 ? 30.243  5.458   -21.809 1.00 83.68  ?  539  LEU B C   1 
ATOM   8350 O  O   . LEU B  1 539 ? 31.402  5.069   -21.690 1.00 95.54  ?  539  LEU B O   1 
ATOM   8351 C  CB  . LEU B  1 539 ? 28.484  5.760   -20.054 1.00 64.79  ?  539  LEU B CB  1 
ATOM   8352 C  CG  . LEU B  1 539 ? 28.833  4.474   -19.334 1.00 61.90  ?  539  LEU B CG  1 
ATOM   8353 C  CD1 . LEU B  1 539 ? 30.093  4.710   -18.542 1.00 72.82  ?  539  LEU B CD1 1 
ATOM   8354 C  CD2 . LEU B  1 539 ? 27.689  4.083   -18.414 1.00 65.70  ?  539  LEU B CD2 1 
ATOM   8355 N  N   . LEU B  1 540 ? 29.449  5.069   -22.799 1.00 82.65  ?  540  LEU B N   1 
ATOM   8356 C  CA  . LEU B  1 540 ? 29.947  4.237   -23.886 1.00 99.74  ?  540  LEU B CA  1 
ATOM   8357 C  C   . LEU B  1 540 ? 31.250  4.794   -24.486 1.00 108.21 ?  540  LEU B C   1 
ATOM   8358 O  O   . LEU B  1 540 ? 32.127  4.032   -24.894 1.00 111.82 ?  540  LEU B O   1 
ATOM   8359 C  CB  . LEU B  1 540 ? 28.877  4.083   -24.976 1.00 103.13 ?  540  LEU B CB  1 
ATOM   8360 C  CG  . LEU B  1 540 ? 27.656  3.230   -24.617 1.00 101.94 ?  540  LEU B CG  1 
ATOM   8361 C  CD1 . LEU B  1 540 ? 26.486  3.569   -25.520 1.00 98.52  ?  540  LEU B CD1 1 
ATOM   8362 C  CD2 . LEU B  1 540 ? 27.990  1.747   -24.706 1.00 103.16 ?  540  LEU B CD2 1 
ATOM   8363 N  N   . SER B  1 541 ? 31.379  6.120   -24.520 1.00 105.29 ?  541  SER B N   1 
ATOM   8364 C  CA  . SER B  1 541 ? 32.597  6.758   -25.022 1.00 102.41 ?  541  SER B CA  1 
ATOM   8365 C  C   . SER B  1 541 ? 33.756  6.680   -24.019 1.00 111.42 ?  541  SER B C   1 
ATOM   8366 O  O   . SER B  1 541 ? 34.866  7.136   -24.302 1.00 117.67 ?  541  SER B O   1 
ATOM   8367 C  CB  . SER B  1 541 ? 32.326  8.210   -25.438 1.00 93.11  ?  541  SER B CB  1 
ATOM   8368 O  OG  . SER B  1 541 ? 32.967  9.135   -24.577 1.00 90.15  ?  541  SER B OG  1 
ATOM   8369 N  N   . ALA B  1 542 ? 33.492  6.110   -22.846 1.00 110.63 ?  542  ALA B N   1 
ATOM   8370 C  CA  . ALA B  1 542 ? 34.553  5.762   -21.907 1.00 107.79 ?  542  ALA B CA  1 
ATOM   8371 C  C   . ALA B  1 542 ? 34.749  4.247   -21.921 1.00 114.88 ?  542  ALA B C   1 
ATOM   8372 O  O   . ALA B  1 542 ? 34.624  3.584   -20.892 1.00 112.37 ?  542  ALA B O   1 
ATOM   8373 C  CB  . ALA B  1 542 ? 34.219  6.251   -20.513 1.00 96.52  ?  542  ALA B CB  1 
ATOM   8374 N  N   . THR B  1 543 ? 35.039  3.713   -23.108 1.00 126.77 ?  543  THR B N   1 
ATOM   8375 C  CA  . THR B  1 543 ? 35.249  2.278   -23.309 1.00 132.53 ?  543  THR B CA  1 
ATOM   8376 C  C   . THR B  1 543 ? 36.624  1.997   -23.920 1.00 133.22 ?  543  THR B C   1 
ATOM   8377 O  O   . THR B  1 543 ? 36.782  1.972   -25.143 1.00 131.12 ?  543  THR B O   1 
ATOM   8378 C  CB  . THR B  1 543 ? 34.167  1.667   -24.231 1.00 133.10 ?  543  THR B CB  1 
ATOM   8379 O  OG1 . THR B  1 543 ? 32.865  1.987   -23.727 1.00 130.05 ?  543  THR B OG1 1 
ATOM   8380 C  CG2 . THR B  1 543 ? 34.315  0.154   -24.312 1.00 137.00 ?  543  THR B CG2 1 
HETATM 8381 CL CL  . 5GZ C  2 .   ? 32.509  24.139  10.494  0.88 108.52 ?  1543 5GZ A CL  1 
HETATM 8382 O  O01 . 5GZ C  2 .   ? 27.623  18.960  11.765  0.88 48.69  ?  1543 5GZ A O01 1 
HETATM 8383 S  S02 . 5GZ C  2 .   ? 29.021  18.892  12.020  0.88 52.81  ?  1543 5GZ A S02 1 
HETATM 8384 C  C03 . 5GZ C  2 .   ? 29.795  19.915  10.899  0.88 30.96  ?  1543 5GZ A C03 1 
HETATM 8385 C  C04 . 5GZ C  2 .   ? 31.169  19.996  10.722  0.88 36.31  ?  1543 5GZ A C04 1 
HETATM 8386 C  C05 . 5GZ C  2 .   ? 31.798  20.830  9.828   0.88 42.47  ?  1543 5GZ A C05 1 
HETATM 8387 C  C06 . 5GZ C  2 .   ? 29.068  20.793  10.101  0.88 32.93  ?  1543 5GZ A C06 1 
HETATM 8388 C  C07 . 5GZ C  2 .   ? 29.658  21.669  9.180   0.88 40.15  ?  1543 5GZ A C07 1 
HETATM 8389 C  C08 . 5GZ C  2 .   ? 31.050  21.687  9.047   0.88 42.24  ?  1543 5GZ A C08 1 
HETATM 8390 O  O09 . 5GZ C  2 .   ? 31.656  22.516  8.158   0.88 41.09  ?  1543 5GZ A O09 1 
HETATM 8391 C  C10 . 5GZ C  2 .   ? 32.997  22.822  8.235   0.88 49.28  ?  1543 5GZ A C10 1 
HETATM 8392 C  C11 . 5GZ C  2 .   ? 33.891  22.436  7.243   0.88 50.54  ?  1543 5GZ A C11 1 
HETATM 8393 N  N12 . 5GZ C  2 .   ? 33.487  21.547  6.148   0.88 64.67  1  1543 5GZ A N12 1 
HETATM 8394 O  O13 . 5GZ C  2 .   ? 34.156  21.586  5.128   0.88 78.94  ?  1543 5GZ A O13 1 
HETATM 8395 O  O14 . 5GZ C  2 .   ? 32.538  20.795  6.320   0.88 55.32  -1 1543 5GZ A O14 1 
HETATM 8396 C  C15 . 5GZ C  2 .   ? 35.242  22.790  7.288   0.88 46.32  ?  1543 5GZ A C15 1 
HETATM 8397 C  C16 . 5GZ C  2 .   ? 35.717  23.561  8.341   0.88 53.64  ?  1543 5GZ A C16 1 
HETATM 8398 C  C17 . 5GZ C  2 .   ? 34.848  23.976  9.341   0.88 54.09  ?  1543 5GZ A C17 1 
HETATM 8399 C  C18 . 5GZ C  2 .   ? 33.513  23.614  9.269   0.88 55.12  ?  1543 5GZ A C18 1 
HETATM 8400 N  N20 . 5GZ C  2 .   ? 29.234  19.502  13.548  0.88 47.96  ?  1543 5GZ A N20 1 
HETATM 8401 C  C21 . 5GZ C  2 .   ? 28.518  20.741  14.000  0.88 38.55  ?  1543 5GZ A C21 1 
HETATM 8402 C  C22 . 5GZ C  2 .   ? 27.106  20.591  14.669  0.88 19.70  ?  1543 5GZ A C22 1 
HETATM 8403 N  N23 . 5GZ C  2 .   ? 26.351  19.328  14.217  0.88 37.73  ?  1543 5GZ A N23 1 
HETATM 8404 C  C24 . 5GZ C  2 .   ? 26.176  18.417  15.401  0.88 48.33  ?  1543 5GZ A C24 1 
HETATM 8405 C  C25 . 5GZ C  2 .   ? 27.304  17.433  15.626  0.88 54.84  ?  1543 5GZ A C25 1 
HETATM 8406 C  C26 . 5GZ C  2 .   ? 24.990  19.734  13.732  0.88 43.99  ?  1543 5GZ A C26 1 
HETATM 8407 C  C27 . 5GZ C  2 .   ? 25.038  20.660  12.526  0.88 51.09  ?  1543 5GZ A C27 1 
HETATM 8408 O  O28 . 5GZ C  2 .   ? 29.628  17.616  11.970  0.88 56.05  ?  1543 5GZ A O28 1 
HETATM 8409 C  C1  . NAG D  3 .   ? 24.267  35.065  -0.882  1.00 94.17  ?  1544 NAG A C1  1 
HETATM 8410 C  C2  . NAG D  3 .   ? 25.801  35.130  -0.833  1.00 107.54 ?  1544 NAG A C2  1 
HETATM 8411 C  C3  . NAG D  3 .   ? 26.411  35.184  -2.240  1.00 112.04 ?  1544 NAG A C3  1 
HETATM 8412 C  C4  . NAG D  3 .   ? 25.519  34.504  -3.282  1.00 115.68 ?  1544 NAG A C4  1 
HETATM 8413 C  C5  . NAG D  3 .   ? 24.102  35.093  -3.285  1.00 113.00 ?  1544 NAG A C5  1 
HETATM 8414 C  C6  . NAG D  3 .   ? 23.052  34.030  -3.626  1.00 111.33 ?  1544 NAG A C6  1 
HETATM 8415 C  C7  . NAG D  3 .   ? 27.211  36.291  0.831   1.00 109.38 ?  1544 NAG A C7  1 
HETATM 8416 C  C8  . NAG D  3 .   ? 27.198  37.407  1.841   1.00 102.29 ?  1544 NAG A C8  1 
HETATM 8417 N  N2  . NAG D  3 .   ? 26.223  36.296  -0.066  1.00 112.24 ?  1544 NAG A N2  1 
HETATM 8418 O  O3  . NAG D  3 .   ? 27.690  34.578  -2.239  1.00 109.93 ?  1544 NAG A O3  1 
HETATM 8419 O  O4  . NAG D  3 .   ? 26.095  34.642  -4.568  1.00 113.97 ?  1544 NAG A O4  1 
HETATM 8420 O  O5  . NAG D  3 .   ? 23.795  35.726  -2.049  1.00 107.76 ?  1544 NAG A O5  1 
HETATM 8421 O  O6  . NAG D  3 .   ? 21.758  34.600  -3.650  1.00 110.92 ?  1544 NAG A O6  1 
HETATM 8422 O  O7  . NAG D  3 .   ? 28.098  35.437  0.845   1.00 108.88 ?  1544 NAG A O7  1 
HETATM 8423 O  O43 . PE3 E  4 .   ? 13.955  15.963  -10.272 1.00 66.60  ?  1545 PE3 A O43 1 
HETATM 8424 C  C42 . PE3 E  4 .   ? 15.285  15.663  -9.862  1.00 66.29  ?  1545 PE3 A C42 1 
HETATM 8425 C  C41 . PE3 E  4 .   ? 15.234  14.155  -9.631  1.00 68.28  ?  1545 PE3 A C41 1 
HETATM 8426 O  O40 . PE3 E  4 .   ? 16.235  13.949  -8.639  1.00 70.77  ?  1545 PE3 A O40 1 
HETATM 8427 C  C39 . PE3 E  4 .   ? 15.735  14.241  -7.335  1.00 73.15  ?  1545 PE3 A C39 1 
HETATM 8428 O  O43 . PE3 F  4 .   ? 41.621  27.133  8.497   1.00 68.81  ?  1546 PE3 A O43 1 
HETATM 8429 C  C42 . PE3 F  4 .   ? 40.271  27.568  8.382   1.00 75.13  ?  1546 PE3 A C42 1 
HETATM 8430 C  C41 . PE3 F  4 .   ? 39.499  26.253  8.312   1.00 78.51  ?  1546 PE3 A C41 1 
HETATM 8431 O  O40 . PE3 F  4 .   ? 38.147  26.646  8.548   1.00 77.70  ?  1546 PE3 A O40 1 
HETATM 8432 C  C39 . PE3 F  4 .   ? 37.579  27.262  7.397   1.00 81.11  ?  1546 PE3 A C39 1 
HETATM 8433 C  C38 . PE3 F  4 .   ? 36.077  27.035  7.591   1.00 82.67  ?  1546 PE3 A C38 1 
HETATM 8434 O  O37 . PE3 F  4 .   ? 35.645  26.574  6.312   1.00 81.51  ?  1546 PE3 A O37 1 
HETATM 8435 C  C1  . NAG G  3 .   ? 11.428  33.810  25.498  1.00 94.37  ?  1547 NAG A C1  1 
HETATM 8436 C  C2  . NAG G  3 .   ? 12.849  34.373  25.322  1.00 103.40 ?  1547 NAG A C2  1 
HETATM 8437 C  C3  . NAG G  3 .   ? 13.112  35.578  26.236  1.00 104.52 ?  1547 NAG A C3  1 
HETATM 8438 C  C4  . NAG G  3 .   ? 12.034  36.632  26.025  1.00 101.76 ?  1547 NAG A C4  1 
HETATM 8439 C  C5  . NAG G  3 .   ? 10.664  35.997  26.255  1.00 105.14 ?  1547 NAG A C5  1 
HETATM 8440 C  C6  . NAG G  3 .   ? 9.568   37.028  25.994  1.00 107.21 ?  1547 NAG A C6  1 
HETATM 8441 C  C7  . NAG G  3 .   ? 14.531  32.784  24.535  1.00 103.82 ?  1547 NAG A C7  1 
HETATM 8442 C  C8  . NAG G  3 .   ? 15.613  31.817  24.917  1.00 98.19  ?  1547 NAG A C8  1 
HETATM 8443 N  N2  . NAG G  3 .   ? 13.840  33.328  25.537  1.00 103.95 ?  1547 NAG A N2  1 
HETATM 8444 O  O3  . NAG G  3 .   ? 14.380  36.148  25.987  1.00 103.31 ?  1547 NAG A O3  1 
HETATM 8445 O  O4  . NAG G  3 .   ? 12.233  37.744  26.882  1.00 90.57  ?  1547 NAG A O4  1 
HETATM 8446 O  O5  . NAG G  3 .   ? 10.459  34.851  25.429  1.00 100.84 ?  1547 NAG A O5  1 
HETATM 8447 O  O6  . NAG G  3 .   ? 8.305   36.491  26.332  1.00 106.88 ?  1547 NAG A O6  1 
HETATM 8448 O  O7  . NAG G  3 .   ? 14.313  33.039  23.348  1.00 107.08 ?  1547 NAG A O7  1 
HETATM 8449 C  C1  . EDO H  5 .   ? 23.990  29.610  21.521  1.00 84.72  ?  1548 EDO A C1  1 
HETATM 8450 O  O1  . EDO H  5 .   ? 22.756  29.167  22.047  1.00 81.86  ?  1548 EDO A O1  1 
HETATM 8451 C  C2  . EDO H  5 .   ? 24.913  29.924  22.740  1.00 78.81  ?  1548 EDO A C2  1 
HETATM 8452 O  O2  . EDO H  5 .   ? 25.300  28.684  23.265  1.00 76.49  ?  1548 EDO A O2  1 
HETATM 8453 CL CL  . 5GZ I  2 .   ? 42.501  24.405  4.407   0.84 86.58  ?  1549 5GZ A CL  1 
HETATM 8454 O  O01 . 5GZ I  2 .   ? 42.181  23.122  -3.148  0.84 83.97  ?  1549 5GZ A O01 1 
HETATM 8455 S  S02 . 5GZ I  2 .   ? 43.188  22.474  -2.383  0.84 87.04  ?  1549 5GZ A S02 1 
HETATM 8456 C  C03 . 5GZ I  2 .   ? 42.601  22.339  -0.722  0.84 74.59  ?  1549 5GZ A C03 1 
HETATM 8457 C  C04 . 5GZ I  2 .   ? 42.868  21.270  0.140   0.84 72.88  ?  1549 5GZ A C04 1 
HETATM 8458 C  C05 . 5GZ I  2 .   ? 42.401  21.177  1.447   0.84 72.16  ?  1549 5GZ A C05 1 
HETATM 8459 C  C06 . 5GZ I  2 .   ? 41.798  23.342  -0.125  0.84 70.37  ?  1549 5GZ A C06 1 
HETATM 8460 C  C07 . 5GZ I  2 .   ? 41.307  23.290  1.192   0.84 72.98  ?  1549 5GZ A C07 1 
HETATM 8461 C  C08 . 5GZ I  2 .   ? 41.610  22.184  1.996   0.84 71.71  ?  1549 5GZ A C08 1 
HETATM 8462 O  O09 . 5GZ I  2 .   ? 41.171  22.043  3.309   0.84 64.72  ?  1549 5GZ A O09 1 
HETATM 8463 C  C10 . 5GZ I  2 .   ? 40.319  23.000  3.842   0.84 61.90  ?  1549 5GZ A C10 1 
HETATM 8464 C  C11 . 5GZ I  2 .   ? 38.919  22.858  3.889   0.84 62.71  ?  1549 5GZ A C11 1 
HETATM 8465 N  N12 . 5GZ I  2 .   ? 38.175  21.692  3.342   0.84 73.26  ?  1549 5GZ A N12 1 
HETATM 8466 O  O13 . 5GZ I  2 .   ? 37.077  21.463  3.730   0.84 79.71  ?  1549 5GZ A O13 1 
HETATM 8467 O  O14 . 5GZ I  2 .   ? 38.744  21.013  2.480   0.84 69.33  ?  1549 5GZ A O14 1 
HETATM 8468 C  C15 . 5GZ I  2 .   ? 38.094  23.840  4.459   0.84 57.46  ?  1549 5GZ A C15 1 
HETATM 8469 C  C16 . 5GZ I  2 .   ? 38.661  24.985  5.000   0.84 57.62  ?  1549 5GZ A C16 1 
HETATM 8470 C  C17 . 5GZ I  2 .   ? 40.035  25.145  4.974   0.84 59.72  ?  1549 5GZ A C17 1 
HETATM 8471 C  C18 . 5GZ I  2 .   ? 40.837  24.159  4.408   0.84 61.42  ?  1549 5GZ A C18 1 
HETATM 8472 N  N20 . 5GZ I  2 .   ? 43.399  20.944  -3.095  0.84 95.44  ?  1549 5GZ A N20 1 
HETATM 8473 C  C21 . 5GZ I  2 .   ? 43.912  20.776  -4.517  0.84 94.58  ?  1549 5GZ A C21 1 
HETATM 8474 O  O28 . 5GZ I  2 .   ? 44.452  23.112  -2.339  0.84 90.76  ?  1549 5GZ A O28 1 
HETATM 8475 O  O43 . PE3 J  4 .   ? 17.919  17.618  51.286  1.00 74.92  ?  1550 PE3 A O43 1 
HETATM 8476 C  C42 . PE3 J  4 .   ? 18.765  18.745  51.380  1.00 80.05  ?  1550 PE3 A C42 1 
HETATM 8477 C  C41 . PE3 J  4 .   ? 20.027  18.271  52.176  1.00 66.74  ?  1550 PE3 A C41 1 
HETATM 8478 O  O40 . PE3 J  4 .   ? 20.624  19.430  52.700  1.00 67.19  ?  1550 PE3 A O40 1 
HETATM 8479 C  C1  . EDO K  5 .   ? 40.278  15.078  46.105  1.00 85.69  ?  1551 EDO A C1  1 
HETATM 8480 O  O1  . EDO K  5 .   ? 39.647  14.760  44.903  1.00 84.73  ?  1551 EDO A O1  1 
HETATM 8481 C  C2  . EDO K  5 .   ? 39.276  15.975  46.859  1.00 87.89  ?  1551 EDO A C2  1 
HETATM 8482 O  O2  . EDO K  5 .   ? 39.940  16.389  48.018  1.00 89.25  ?  1551 EDO A O2  1 
HETATM 8483 O  O43 . PE3 L  4 .   ? 41.784  -6.220  5.563   1.00 89.46  ?  1552 PE3 A O43 1 
HETATM 8484 C  C42 . PE3 L  4 .   ? 42.123  -4.841  5.652   1.00 85.17  ?  1552 PE3 A C42 1 
HETATM 8485 C  C41 . PE3 L  4 .   ? 43.137  -4.814  6.787   1.00 75.60  ?  1552 PE3 A C41 1 
HETATM 8486 O  O40 . PE3 L  4 .   ? 43.546  -3.453  6.806   1.00 68.81  ?  1552 PE3 A O40 1 
HETATM 8487 C  C39 . PE3 L  4 .   ? 44.350  -3.225  7.952   1.00 69.31  ?  1552 PE3 A C39 1 
HETATM 8488 C  C38 . PE3 L  4 .   ? 45.652  -2.688  7.385   1.00 70.97  ?  1552 PE3 A C38 1 
HETATM 8489 O  O37 . PE3 L  4 .   ? 46.622  -3.566  7.945   1.00 70.43  ?  1552 PE3 A O37 1 
HETATM 8490 O  O43 . PE3 M  4 .   ? 11.950  28.892  2.003   1.00 70.60  ?  1553 PE3 A O43 1 
HETATM 8491 C  C42 . PE3 M  4 .   ? 11.557  28.137  0.894   1.00 77.75  ?  1553 PE3 A C42 1 
HETATM 8492 C  C41 . PE3 M  4 .   ? 10.910  26.860  1.482   1.00 79.58  ?  1553 PE3 A C41 1 
HETATM 8493 O  O40 . PE3 M  4 .   ? 12.005  25.982  1.636   1.00 76.95  ?  1553 PE3 A O40 1 
HETATM 8494 C  C39 . PE3 M  4 .   ? 11.616  24.652  1.882   1.00 70.38  ?  1553 PE3 A C39 1 
HETATM 8495 C  C38 . PE3 M  4 .   ? 12.969  23.925  1.965   1.00 66.78  ?  1553 PE3 A C38 1 
HETATM 8496 O  O37 . PE3 M  4 .   ? 12.782  22.834  1.108   1.00 66.44  ?  1553 PE3 A O37 1 
HETATM 8497 C  C36 . PE3 M  4 .   ? 13.983  22.136  0.853   1.00 65.41  ?  1553 PE3 A C36 1 
HETATM 8498 C  C35 . PE3 M  4 .   ? 13.499  20.806  0.220   1.00 70.27  ?  1553 PE3 A C35 1 
HETATM 8499 O  O34 . PE3 M  4 .   ? 13.537  19.865  1.273   1.00 73.35  ?  1553 PE3 A O34 1 
HETATM 8500 CL CL  . 5GZ N  2 .   ? 10.187  -9.642  -37.378 0.97 89.46  ?  1544 5GZ B CL  1 
HETATM 8501 O  O01 . 5GZ N  2 .   ? 7.914   -2.311  -36.279 0.97 64.33  ?  1544 5GZ B O01 1 
HETATM 8502 S  S02 . 5GZ N  2 .   ? 8.652   -2.903  -37.332 0.97 63.85  ?  1544 5GZ B S02 1 
HETATM 8503 C  C03 . 5GZ N  2 .   ? 9.398   -4.316  -36.722 0.97 51.69  ?  1544 5GZ B C03 1 
HETATM 8504 C  C04 . 5GZ N  2 .   ? 10.602  -4.859  -37.158 0.97 52.90  ?  1544 5GZ B C04 1 
HETATM 8505 C  C05 . 5GZ N  2 .   ? 11.165  -6.010  -36.639 0.97 52.47  ?  1544 5GZ B C05 1 
HETATM 8506 C  C06 . 5GZ N  2 .   ? 8.787   -5.045  -35.713 0.97 53.58  ?  1544 5GZ B C06 1 
HETATM 8507 C  C07 . 5GZ N  2 .   ? 9.308   -6.205  -35.167 0.97 54.63  ?  1544 5GZ B C07 1 
HETATM 8508 C  C08 . 5GZ N  2 .   ? 10.509  -6.700  -35.628 0.97 53.37  ?  1544 5GZ B C08 1 
HETATM 8509 O  O09 . 5GZ N  2 .   ? 11.033  -7.840  -35.095 0.97 56.19  ?  1544 5GZ B O09 1 
HETATM 8510 C  C10 . 5GZ N  2 .   ? 12.044  -8.514  -35.758 0.97 65.57  ?  1544 5GZ B C10 1 
HETATM 8511 C  C11 . 5GZ N  2 .   ? 13.381  -8.396  -35.369 0.97 76.42  ?  1544 5GZ B C11 1 
HETATM 8512 N  N12 . 5GZ N  2 .   ? 13.909  -7.488  -34.277 0.97 86.90  ?  1544 5GZ B N12 1 
HETATM 8513 O  O13 . 5GZ N  2 .   ? 13.323  -6.491  -33.991 0.97 84.48  ?  1544 5GZ B O13 1 
HETATM 8514 O  O14 . 5GZ N  2 .   ? 14.982  -7.805  -33.746 0.97 94.21  ?  1544 5GZ B O14 1 
HETATM 8515 C  C15 . 5GZ N  2 .   ? 14.396  -9.114  -36.022 0.97 80.99  ?  1544 5GZ B C15 1 
HETATM 8516 C  C16 . 5GZ N  2 .   ? 14.075  -9.977  -37.066 0.97 80.66  ?  1544 5GZ B C16 1 
HETATM 8517 C  C17 . 5GZ N  2 .   ? 12.757  -10.120 -37.470 0.97 72.29  ?  1544 5GZ B C17 1 
HETATM 8518 C  C18 . 5GZ N  2 .   ? 11.769  -9.408  -36.822 0.97 69.05  ?  1544 5GZ B C18 1 
HETATM 8519 N  N20 . 5GZ N  2 .   ? 7.523   -3.319  -38.486 0.97 41.24  ?  1544 5GZ B N20 1 
HETATM 8520 C  C21 . 5GZ N  2 .   ? 6.317   -4.097  -38.132 0.97 34.20  ?  1544 5GZ B C21 1 
HETATM 8521 C  C22 . 5GZ N  2 .   ? 4.987   -3.343  -38.178 0.97 39.43  ?  1544 5GZ B C22 1 
HETATM 8522 N  N23 . 5GZ N  2 .   ? 5.150   -1.945  -37.550 0.97 51.90  ?  1544 5GZ B N23 1 
HETATM 8523 C  C24 . 5GZ N  2 .   ? 4.821   -0.877  -38.567 0.97 48.84  ?  1544 5GZ B C24 1 
HETATM 8524 C  C25 . 5GZ N  2 .   ? 5.776   -0.784  -39.744 0.97 52.74  ?  1544 5GZ B C25 1 
HETATM 8525 C  C26 . 5GZ N  2 .   ? 4.228   -1.823  -36.355 0.97 53.98  ?  1544 5GZ B C26 1 
HETATM 8526 C  C27 . 5GZ N  2 .   ? 4.346   -2.978  -35.361 0.97 49.38  ?  1544 5GZ B C27 1 
HETATM 8527 O  O28 . 5GZ N  2 .   ? 9.644   -2.104  -37.950 0.97 67.30  ?  1544 5GZ B O28 1 
HETATM 8528 O  O43 . PE3 O  4 .   ? 16.415  -16.161 -40.038 1.00 83.66  ?  1545 PE3 B O43 1 
HETATM 8529 C  C42 . PE3 O  4 .   ? 15.797  -14.943 -39.631 1.00 88.18  ?  1545 PE3 B C42 1 
HETATM 8530 C  C41 . PE3 O  4 .   ? 14.651  -15.401 -38.726 1.00 91.34  ?  1545 PE3 B C41 1 
HETATM 8531 O  O40 . PE3 O  4 .   ? 14.344  -14.222 -37.975 1.00 95.24  ?  1545 PE3 B O40 1 
HETATM 8532 C  C39 . PE3 O  4 .   ? 13.486  -14.523 -36.869 1.00 93.40  ?  1545 PE3 B C39 1 
HETATM 8533 C  C38 . PE3 O  4 .   ? 13.874  -13.471 -35.815 1.00 88.03  ?  1545 PE3 B C38 1 
HETATM 8534 O  O37 . PE3 O  4 .   ? 12.988  -13.731 -34.731 1.00 82.31  ?  1545 PE3 B O37 1 
HETATM 8535 C  C1  . NAG P  3 .   ? -18.217 -7.049  -37.158 1.00 108.19 ?  1546 NAG B C1  1 
HETATM 8536 C  C2  . NAG P  3 .   ? -19.362 -7.772  -37.885 1.00 120.04 ?  1546 NAG B C2  1 
HETATM 8537 C  C3  . NAG P  3 .   ? -18.898 -8.993  -38.689 1.00 123.80 ?  1546 NAG B C3  1 
HETATM 8538 C  C4  . NAG P  3 .   ? -17.617 -8.693  -39.458 1.00 122.68 ?  1546 NAG B C4  1 
HETATM 8539 C  C5  . NAG P  3 .   ? -16.575 -8.140  -38.493 1.00 120.49 ?  1546 NAG B C5  1 
HETATM 8540 C  C6  . NAG P  3 .   ? -15.224 -7.918  -39.168 1.00 116.39 ?  1546 NAG B C6  1 
HETATM 8541 C  C7  . NAG P  3 .   ? -20.526 -9.312  -36.336 1.00 128.49 ?  1546 NAG B C7  1 
HETATM 8542 C  C8  . NAG P  3 .   ? -19.966 -9.422  -34.946 1.00 126.70 ?  1546 NAG B C8  1 
HETATM 8543 N  N2  . NAG P  3 .   ? -20.414 -8.121  -36.935 1.00 125.02 ?  1546 NAG B N2  1 
HETATM 8544 O  O3  . NAG P  3 .   ? -19.906 -9.411  -39.590 1.00 123.77 ?  1546 NAG B O3  1 
HETATM 8545 O  O4  . NAG P  3 .   ? -17.144 -9.875  -40.065 1.00 121.60 ?  1546 NAG B O4  1 
HETATM 8546 O  O5  . NAG P  3 .   ? -17.052 -6.923  -37.955 1.00 117.38 ?  1546 NAG B O5  1 
HETATM 8547 O  O6  . NAG P  3 .   ? -14.229 -7.720  -38.187 1.00 111.29 ?  1546 NAG B O6  1 
HETATM 8548 O  O7  . NAG P  3 .   ? -21.068 -10.291 -36.857 1.00 129.15 ?  1546 NAG B O7  1 
HETATM 8549 O  O43 . PE3 Q  4 .   ? 9.228   4.799   -9.739  1.00 67.54  ?  1547 PE3 B O43 1 
HETATM 8550 C  C42 . PE3 Q  4 .   ? 10.220  4.962   -10.725 1.00 70.26  ?  1547 PE3 B C42 1 
HETATM 8551 C  C41 . PE3 Q  4 .   ? 11.041  3.643   -10.677 1.00 57.65  ?  1547 PE3 B C41 1 
HETATM 8552 O  O40 . PE3 Q  4 .   ? 11.245  3.301   -12.046 1.00 64.70  ?  1547 PE3 B O40 1 
HETATM 8553 C  C39 . PE3 Q  4 .   ? 11.959  4.267   -12.808 1.00 61.62  ?  1547 PE3 B C39 1 
HETATM 8554 C  C38 . PE3 Q  4 .   ? 12.237  3.541   -14.160 1.00 99.71  ?  1547 PE3 B C38 1 
HETATM 8555 O  O37 . PE3 Q  4 .   ? 11.047  3.698   -14.922 1.00 98.25  ?  1547 PE3 B O37 1 
HETATM 8556 C  C36 . PE3 Q  4 .   ? 10.697  2.520   -15.633 1.00 96.04  ?  1547 PE3 B C36 1 
HETATM 8557 C  C35 . PE3 Q  4 .   ? 9.265   2.804   -16.161 1.00 79.53  ?  1547 PE3 B C35 1 
HETATM 8558 O  O34 . PE3 Q  4 .   ? 8.699   1.530   -16.402 1.00 76.33  ?  1547 PE3 B O34 1 
HETATM 8559 C  C1  . NAG R  3 .   ? 5.059   -17.703 -22.455 1.00 93.24  ?  1548 NAG B C1  1 
HETATM 8560 C  C2  . NAG R  3 .   ? 5.875   -18.399 -23.561 1.00 100.88 ?  1548 NAG B C2  1 
HETATM 8561 C  C3  . NAG R  3 .   ? 6.964   -19.339 -23.014 1.00 105.17 ?  1548 NAG B C3  1 
HETATM 8562 C  C4  . NAG R  3 .   ? 7.343   -19.187 -21.525 1.00 106.18 ?  1548 NAG B C4  1 
HETATM 8563 C  C5  . NAG R  3 .   ? 6.588   -18.136 -20.699 1.00 106.57 ?  1548 NAG B C5  1 
HETATM 8564 C  C6  . NAG R  3 .   ? 7.554   -17.477 -19.701 1.00 104.35 ?  1548 NAG B C6  1 
HETATM 8565 C  C7  . NAG R  3 .   ? 5.149   -20.305 -25.045 1.00 90.72  ?  1548 NAG B C7  1 
HETATM 8566 C  C8  . NAG R  3 .   ? 4.037   -21.276 -24.756 1.00 84.03  ?  1548 NAG B C8  1 
HETATM 8567 N  N2  . NAG R  3 .   ? 5.007   -19.066 -24.546 1.00 99.42  ?  1548 NAG B N2  1 
HETATM 8568 O  O3  . NAG R  3 .   ? 8.133   -19.194 -23.809 1.00 98.96  ?  1548 NAG B O3  1 
HETATM 8569 O  O4  . NAG R  3 .   ? 7.184   -20.440 -20.881 1.00 101.96 ?  1548 NAG B O4  1 
HETATM 8570 O  O5  . NAG R  3 .   ? 5.969   -17.160 -21.516 1.00 104.95 ?  1548 NAG B O5  1 
HETATM 8571 O  O6  . NAG R  3 .   ? 6.932   -16.489 -18.899 1.00 99.77  ?  1548 NAG B O6  1 
HETATM 8572 O  O7  . NAG R  3 .   ? 6.109   -20.669 -25.730 1.00 85.04  ?  1548 NAG B O7  1 
HETATM 8573 C  C1  . EDO S  5 .   ? -8.213  21.066  -47.775 1.00 80.63  ?  1549 EDO B C1  1 
HETATM 8574 O  O1  . EDO S  5 .   ? -9.497  21.336  -47.275 1.00 82.34  ?  1549 EDO B O1  1 
HETATM 8575 C  C2  . EDO S  5 .   ? -8.185  19.532  -47.998 1.00 61.53  ?  1549 EDO B C2  1 
HETATM 8576 O  O2  . EDO S  5 .   ? -6.995  19.060  -47.432 1.00 61.88  ?  1549 EDO B O2  1 
HETATM 8577 O  O43 . PE3 T  4 .   ? -0.227  28.272  -44.528 1.00 93.78  ?  1550 PE3 B O43 1 
HETATM 8578 C  C42 . PE3 T  4 .   ? 1.135   28.480  -44.825 1.00 95.01  ?  1550 PE3 B C42 1 
HETATM 8579 C  C41 . PE3 T  4 .   ? 1.923   27.567  -43.848 1.00 77.84  ?  1550 PE3 B C41 1 
HETATM 8580 O  O40 . PE3 T  4 .   ? 3.036   28.312  -43.438 1.00 78.10  ?  1550 PE3 B O40 1 
HETATM 8581 O  O43 . PE3 U  4 .   ? 2.149   0.722   -19.604 1.00 80.28  ?  1551 PE3 B O43 1 
HETATM 8582 C  C42 . PE3 U  4 .   ? 2.578   -0.334  -18.747 1.00 75.32  ?  1551 PE3 B C42 1 
HETATM 8583 C  C41 . PE3 U  4 .   ? 2.045   -1.600  -19.442 1.00 73.89  ?  1551 PE3 B C41 1 
HETATM 8584 O  O40 . PE3 U  4 .   ? 0.647   -1.347  -19.542 1.00 76.46  ?  1551 PE3 B O40 1 
HETATM 8585 C  C39 . PE3 U  4 .   ? -0.051  -2.524  -19.922 1.00 71.66  ?  1551 PE3 B C39 1 
HETATM 8586 C  C38 . PE3 U  4 .   ? -0.428  -3.144  -18.572 1.00 67.94  ?  1551 PE3 B C38 1 
HETATM 8587 O  O37 . PE3 U  4 .   ? -1.784  -2.748  -18.392 1.00 62.05  ?  1551 PE3 B O37 1 
HETATM 8588 CL CL  . 5GZ V  2 .   ? 20.705  -14.560 -37.748 0.85 127.92 ?  1552 5GZ B CL  1 
HETATM 8589 O  O01 . 5GZ V  2 .   ? 25.300  -13.543 -31.706 0.85 139.34 ?  1552 5GZ B O01 1 
HETATM 8590 S  S02 . 5GZ V  2 .   ? 25.649  -13.799 -33.057 0.85 141.81 ?  1552 5GZ B S02 1 
HETATM 8591 C  C03 . 5GZ V  2 .   ? 24.301  -13.245 -34.054 0.85 101.86 ?  1552 5GZ B C03 1 
HETATM 8592 C  C04 . 5GZ V  2 .   ? 24.369  -12.896 -35.411 0.85 101.10 ?  1552 5GZ B C04 1 
HETATM 8593 C  C05 . 5GZ V  2 .   ? 23.283  -12.462 -36.168 0.85 96.08  ?  1552 5GZ B C05 1 
HETATM 8594 C  C06 . 5GZ V  2 .   ? 22.999  -13.118 -33.522 0.85 98.39  ?  1552 5GZ B C06 1 
HETATM 8595 C  C07 . 5GZ V  2 .   ? 21.878  -12.688 -34.248 0.85 93.45  ?  1552 5GZ B C07 1 
HETATM 8596 C  C08 . 5GZ V  2 .   ? 22.016  -12.355 -35.595 0.85 91.54  ?  1552 5GZ B C08 1 
HETATM 8597 O  O09 . 5GZ V  2 .   ? 20.950  -11.918 -36.375 0.85 88.75  ?  1552 5GZ B O09 1 
HETATM 8598 C  C10 . 5GZ V  2 .   ? 19.725  -12.561 -36.220 0.85 89.01  ?  1552 5GZ B C10 1 
HETATM 8599 C  C11 . 5GZ V  2 .   ? 18.654  -12.011 -35.475 0.85 90.06  ?  1552 5GZ B C11 1 
HETATM 8600 N  N12 . 5GZ V  2 .   ? 18.712  -10.681 -34.744 0.85 89.86  ?  1552 5GZ B N12 1 
HETATM 8601 O  O13 . 5GZ V  2 .   ? 19.720  -10.326 -34.202 0.85 83.96  ?  1552 5GZ B O13 1 
HETATM 8602 O  O14 . 5GZ V  2 .   ? 17.679  -10.014 -34.732 0.85 90.90  ?  1552 5GZ B O14 1 
HETATM 8603 C  C15 . 5GZ V  2 .   ? 17.423  -12.686 -35.357 0.85 92.48  ?  1552 5GZ B C15 1 
HETATM 8604 C  C16 . 5GZ V  2 .   ? 17.247  -13.918 -35.974 0.85 94.59  ?  1552 5GZ B C16 1 
HETATM 8605 C  C17 . 5GZ V  2 .   ? 18.277  -14.477 -36.712 0.85 92.92  ?  1552 5GZ B C17 1 
HETATM 8606 C  C18 . 5GZ V  2 .   ? 19.486  -13.807 -36.831 0.85 91.43  ?  1552 5GZ B C18 1 
HETATM 8607 N  N20 . 5GZ V  2 .   ? 27.069  -12.901 -33.329 0.85 153.10 ?  1552 5GZ B N20 1 
HETATM 8608 C  C21 . 5GZ V  2 .   ? 27.720  -12.767 -34.706 0.85 153.18 ?  1552 5GZ B C21 1 
HETATM 8609 C  C22 . 5GZ V  2 .   ? 27.863  -14.004 -35.700 0.85 67.72  ?  1552 5GZ B C22 1 
HETATM 8610 O  O28 . 5GZ V  2 .   ? 25.909  -15.151 -33.394 0.85 143.12 ?  1552 5GZ B O28 1 
HETATM 8611 O  O43 . PE3 W  4 .   ? 32.287  8.657   -46.013 1.00 79.40  ?  1553 PE3 B O43 1 
HETATM 8612 C  C42 . PE3 W  4 .   ? 32.112  10.061  -45.886 1.00 83.24  ?  1553 PE3 B C42 1 
HETATM 8613 C  C41 . PE3 W  4 .   ? 31.294  10.174  -44.615 1.00 86.52  ?  1553 PE3 B C41 1 
HETATM 8614 O  O40 . PE3 W  4 .   ? 31.210  11.578  -44.425 1.00 90.92  ?  1553 PE3 B O40 1 
HETATM 8615 C  C39 . PE3 W  4 .   ? 31.176  11.881  -43.039 1.00 92.65  ?  1553 PE3 B C39 1 
HETATM 8616 C  C38 . PE3 W  4 .   ? 31.641  13.329  -43.015 1.00 95.62  ?  1553 PE3 B C38 1 
HETATM 8617 O  O37 . PE3 W  4 .   ? 32.345  13.410  -41.781 1.00 96.89  ?  1553 PE3 B O37 1 
HETATM 8618 C  C1  . EDO X  5 .   ? 21.393  17.514  -26.141 1.00 73.98  ?  1554 EDO B C1  1 
HETATM 8619 O  O1  . EDO X  5 .   ? 20.335  16.599  -26.076 1.00 80.31  ?  1554 EDO B O1  1 
HETATM 8620 C  C2  . EDO X  5 .   ? 22.654  16.660  -26.424 1.00 71.38  ?  1554 EDO B C2  1 
HETATM 8621 O  O2  . EDO X  5 .   ? 23.625  17.570  -26.853 1.00 72.46  ?  1554 EDO B O2  1 
HETATM 8622 O  O43 . PE3 Y  4 .   ? 16.825  10.666  -12.528 1.00 92.71  ?  1555 PE3 B O43 1 
HETATM 8623 C  C42 . PE3 Y  4 .   ? 17.710  9.741   -13.125 1.00 94.27  ?  1555 PE3 B C42 1 
HETATM 8624 C  C41 . PE3 Y  4 .   ? 18.401  10.516  -14.278 1.00 98.44  ?  1555 PE3 B C41 1 
HETATM 8625 O  O40 . PE3 Y  4 .   ? 19.737  10.037  -14.247 1.00 103.17 ?  1555 PE3 B O40 1 
HETATM 8626 C  C39 . PE3 Y  4 .   ? 20.570  10.593  -15.255 1.00 102.43 ?  1555 PE3 B C39 1 
HETATM 8627 C  C38 . PE3 Y  4 .   ? 22.023  10.272  -14.781 1.00 73.09  ?  1555 PE3 B C38 1 
HETATM 8628 O  O37 . PE3 Y  4 .   ? 22.052  8.863   -14.578 1.00 70.20  ?  1555 PE3 B O37 1 
HETATM 8629 C  C36 . PE3 Y  4 .   ? 23.219  8.429   -13.926 1.00 55.22  ?  1555 PE3 B C36 1 
HETATM 8630 C  C35 . PE3 Y  4 .   ? 23.314  6.925   -14.237 1.00 44.61  ?  1555 PE3 B C35 1 
HETATM 8631 O  O34 . PE3 Y  4 .   ? 22.290  6.317   -13.474 1.00 54.28  ?  1555 PE3 B O34 1 
HETATM 8632 C  C33 . PE3 Y  4 .   ? 22.603  4.975   -13.137 1.00 55.29  ?  1555 PE3 B C33 1 
HETATM 8633 C  C32 . PE3 Y  4 .   ? 21.241  4.253   -13.018 1.00 65.63  ?  1555 PE3 B C32 1 
HETATM 8634 O  O31 . PE3 Y  4 .   ? 20.949  4.174   -11.634 1.00 71.91  ?  1555 PE3 B O31 1 
HETATM 8635 C  C30 . PE3 Y  4 .   ? 20.163  5.271   -11.200 1.00 75.70  ?  1555 PE3 B C30 1 
HETATM 8636 C  C29 . PE3 Y  4 .   ? 18.923  4.638   -10.523 1.00 68.12  ?  1555 PE3 B C29 1 
HETATM 8637 O  O28 . PE3 Y  4 .   ? 18.018  5.719   -10.356 1.00 64.76  ?  1555 PE3 B O28 1 
HETATM 8638 C  C27 . PE3 Y  4 .   ? 17.622  6.328   -11.576 1.00 65.13  ?  1555 PE3 B C27 1 
HETATM 8639 C  C26 . PE3 Y  4 .   ? 16.130  5.944   -11.773 1.00 88.07  ?  1555 PE3 B C26 1 
HETATM 8640 O  O25 . PE3 Y  4 .   ? 15.535  7.166   -12.163 1.00 91.71  ?  1555 PE3 B O25 1 
HETATM 8641 C  C24 . PE3 Y  4 .   ? 14.207  7.053   -12.644 1.00 94.52  ?  1555 PE3 B C24 1 
HETATM 8642 C  C23 . PE3 Y  4 .   ? 13.809  8.523   -12.982 1.00 85.65  ?  1555 PE3 B C23 1 
HETATM 8643 O  O22 . PE3 Y  4 .   ? 12.397  8.544   -13.026 1.00 81.38  ?  1555 PE3 B O22 1 
HETATM 8644 O  O   . HOH Z  6 .   ? 25.525  10.722  54.784  1.00 44.12  ?  2001 HOH A O   1 
HETATM 8645 O  O   . HOH Z  6 .   ? 25.129  13.387  55.191  1.00 34.35  ?  2002 HOH A O   1 
HETATM 8646 O  O   . HOH Z  6 .   ? 23.477  8.497   48.086  1.00 40.79  ?  2003 HOH A O   1 
HETATM 8647 O  O   . HOH Z  6 .   ? 28.004  4.174   46.489  1.00 55.71  ?  2004 HOH A O   1 
HETATM 8648 O  O   . HOH Z  6 .   ? 29.087  1.888   45.681  1.00 44.70  ?  2005 HOH A O   1 
HETATM 8649 O  O   . HOH Z  6 .   ? 35.956  2.470   45.536  1.00 46.33  ?  2006 HOH A O   1 
HETATM 8650 O  O   . HOH Z  6 .   ? 39.528  15.005  38.797  1.00 49.62  ?  2007 HOH A O   1 
HETATM 8651 O  O   . HOH Z  6 .   ? 38.550  3.134   45.182  1.00 43.77  ?  2008 HOH A O   1 
HETATM 8652 O  O   . HOH Z  6 .   ? 37.706  8.317   47.331  1.00 50.03  ?  2009 HOH A O   1 
HETATM 8653 O  O   . HOH Z  6 .   ? 35.582  17.307  47.885  1.00 50.53  ?  2010 HOH A O   1 
HETATM 8654 O  O   . HOH Z  6 .   ? 13.161  20.636  42.542  1.00 70.99  ?  2011 HOH A O   1 
HETATM 8655 O  O   . HOH Z  6 .   ? 19.324  23.615  38.481  1.00 62.63  ?  2012 HOH A O   1 
HETATM 8656 O  O   . HOH Z  6 .   ? 31.218  23.381  16.019  1.00 43.32  ?  2013 HOH A O   1 
HETATM 8657 O  O   . HOH Z  6 .   ? 10.835  17.604  33.872  1.00 52.56  ?  2014 HOH A O   1 
HETATM 8658 O  O   . HOH Z  6 .   ? 13.531  23.805  34.569  1.00 65.89  ?  2015 HOH A O   1 
HETATM 8659 O  O   . HOH Z  6 .   ? 12.110  13.861  40.026  1.00 38.76  ?  2016 HOH A O   1 
HETATM 8660 O  O   . HOH Z  6 .   ? 32.210  16.556  32.456  1.00 45.93  ?  2017 HOH A O   1 
HETATM 8661 O  O   . HOH Z  6 .   ? 36.328  16.218  38.176  1.00 52.64  ?  2018 HOH A O   1 
HETATM 8662 O  O   . HOH Z  6 .   ? 40.289  12.095  33.348  1.00 45.04  ?  2019 HOH A O   1 
HETATM 8663 O  O   . HOH Z  6 .   ? 45.176  7.808   29.351  1.00 36.06  ?  2020 HOH A O   1 
HETATM 8664 O  O   . HOH Z  6 .   ? 50.499  17.074  26.050  1.00 50.95  ?  2021 HOH A O   1 
HETATM 8665 O  O   . HOH Z  6 .   ? 52.365  16.135  24.352  1.00 43.69  ?  2022 HOH A O   1 
HETATM 8666 O  O   . HOH Z  6 .   ? 56.294  14.350  25.674  1.00 46.81  ?  2023 HOH A O   1 
HETATM 8667 O  O   . HOH Z  6 .   ? 46.544  8.061   26.780  1.00 51.84  ?  2024 HOH A O   1 
HETATM 8668 O  O   . HOH Z  6 .   ? 45.824  12.038  22.592  1.00 49.47  ?  2025 HOH A O   1 
HETATM 8669 O  O   . HOH Z  6 .   ? 46.617  7.642   17.816  1.00 47.62  ?  2026 HOH A O   1 
HETATM 8670 O  O   . HOH Z  6 .   ? 49.788  5.671   27.703  1.00 50.45  ?  2027 HOH A O   1 
HETATM 8671 O  O   . HOH Z  6 .   ? 41.327  13.028  35.620  1.00 61.68  ?  2028 HOH A O   1 
HETATM 8672 O  O   . HOH Z  6 .   ? 44.128  10.128  41.255  1.00 63.44  ?  2029 HOH A O   1 
HETATM 8673 O  O   . HOH Z  6 .   ? 32.627  18.891  28.960  1.00 38.45  ?  2030 HOH A O   1 
HETATM 8674 O  O   . HOH Z  6 .   ? 36.249  23.323  33.345  1.00 56.15  ?  2031 HOH A O   1 
HETATM 8675 O  O   . HOH Z  6 .   ? 35.028  17.016  24.415  1.00 44.73  ?  2032 HOH A O   1 
HETATM 8676 O  O   . HOH Z  6 .   ? 40.901  16.387  22.069  1.00 52.77  ?  2033 HOH A O   1 
HETATM 8677 O  O   . HOH Z  6 .   ? 41.187  18.758  17.776  1.00 36.23  ?  2034 HOH A O   1 
HETATM 8678 O  O   . HOH Z  6 .   ? 48.112  25.288  23.234  1.00 55.26  ?  2035 HOH A O   1 
HETATM 8679 O  O   . HOH Z  6 .   ? 34.210  23.061  18.065  1.00 54.56  ?  2036 HOH A O   1 
HETATM 8680 O  O   . HOH Z  6 .   ? 31.865  21.553  21.372  1.00 46.56  ?  2037 HOH A O   1 
HETATM 8681 O  O   . HOH Z  6 .   ? 39.470  19.881  16.196  1.00 41.17  ?  2038 HOH A O   1 
HETATM 8682 O  O   . HOH Z  6 .   ? 34.558  27.706  11.285  1.00 62.43  ?  2039 HOH A O   1 
HETATM 8683 O  O   . HOH Z  6 .   ? 40.208  27.443  16.256  1.00 48.67  ?  2040 HOH A O   1 
HETATM 8684 O  O   . HOH Z  6 .   ? 33.235  23.625  13.719  1.00 54.50  ?  2041 HOH A O   1 
HETATM 8685 O  O   . HOH Z  6 .   ? 27.537  25.363  23.435  1.00 62.41  ?  2042 HOH A O   1 
HETATM 8686 O  O   . HOH Z  6 .   ? 23.611  23.474  22.982  1.00 53.98  ?  2043 HOH A O   1 
HETATM 8687 O  O   . HOH Z  6 .   ? 29.225  20.195  18.629  1.00 34.07  ?  2044 HOH A O   1 
HETATM 8688 O  O   . HOH Z  6 .   ? 41.321  0.017   4.164   1.00 43.36  ?  2045 HOH A O   1 
HETATM 8689 O  O   . HOH Z  6 .   ? 51.625  4.558   2.867   1.00 58.08  ?  2046 HOH A O   1 
HETATM 8690 O  O   . HOH Z  6 .   ? 50.497  3.182   4.401   1.00 53.14  ?  2047 HOH A O   1 
HETATM 8691 O  O   . HOH Z  6 .   ? 39.822  27.485  26.332  1.00 46.03  ?  2048 HOH A O   1 
HETATM 8692 O  O   . HOH Z  6 .   ? 43.287  15.243  24.718  1.00 49.02  ?  2049 HOH A O   1 
HETATM 8693 O  O   . HOH Z  6 .   ? 41.638  13.521  31.380  1.00 49.98  ?  2050 HOH A O   1 
HETATM 8694 O  O   . HOH Z  6 .   ? 31.765  16.506  29.513  1.00 33.82  ?  2051 HOH A O   1 
HETATM 8695 O  O   . HOH Z  6 .   ? 36.535  22.027  -6.580  1.00 52.39  ?  2052 HOH A O   1 
HETATM 8696 O  O   . HOH Z  6 .   ? 23.045  19.546  32.875  1.00 80.47  ?  2053 HOH A O   1 
HETATM 8697 O  O   . HOH Z  6 .   ? 11.497  13.195  43.686  1.00 57.76  ?  2054 HOH A O   1 
HETATM 8698 O  O   . HOH Z  6 .   ? 12.688  8.333   41.613  1.00 52.66  ?  2055 HOH A O   1 
HETATM 8699 O  O   . HOH Z  6 .   ? 29.147  12.116  24.527  1.00 37.51  ?  2056 HOH A O   1 
HETATM 8700 O  O   . HOH Z  6 .   ? 25.837  15.049  18.074  1.00 41.09  ?  2057 HOH A O   1 
HETATM 8701 O  O   . HOH Z  6 .   ? 28.684  17.667  19.610  1.00 35.49  ?  2058 HOH A O   1 
HETATM 8702 O  O   . HOH Z  6 .   ? 32.932  14.199  17.044  1.00 33.86  ?  2059 HOH A O   1 
HETATM 8703 O  O   . HOH Z  6 .   ? 29.475  15.262  13.164  1.00 46.99  ?  2060 HOH A O   1 
HETATM 8704 O  O   . HOH Z  6 .   ? 38.012  14.978  12.370  1.00 31.94  ?  2061 HOH A O   1 
HETATM 8705 O  O   . HOH Z  6 .   ? 30.952  20.611  16.085  1.00 37.81  ?  2062 HOH A O   1 
HETATM 8706 O  O   . HOH Z  6 .   ? 25.382  14.961  27.808  1.00 48.44  ?  2063 HOH A O   1 
HETATM 8707 O  O   . HOH Z  6 .   ? 24.720  18.316  28.825  1.00 56.69  ?  2064 HOH A O   1 
HETATM 8708 O  O   . HOH Z  6 .   ? 25.108  22.220  29.749  1.00 45.55  ?  2065 HOH A O   1 
HETATM 8709 O  O   . HOH Z  6 .   ? 17.065  15.057  28.573  1.00 51.09  ?  2066 HOH A O   1 
HETATM 8710 O  O   . HOH Z  6 .   ? 15.976  22.631  -21.087 1.00 59.95  ?  2067 HOH A O   1 
HETATM 8711 O  O   . HOH Z  6 .   ? 12.844  3.665   32.683  1.00 54.44  ?  2068 HOH A O   1 
HETATM 8712 O  O   . HOH Z  6 .   ? 7.834   11.545  27.698  1.00 44.51  ?  2069 HOH A O   1 
HETATM 8713 O  O   . HOH Z  6 .   ? 43.663  18.351  16.295  1.00 43.89  ?  2070 HOH A O   1 
HETATM 8714 O  O   . HOH Z  6 .   ? 42.893  9.170   11.039  1.00 41.80  ?  2071 HOH A O   1 
HETATM 8715 O  O   . HOH Z  6 .   ? 42.512  7.245   14.033  1.00 42.38  ?  2072 HOH A O   1 
HETATM 8716 O  O   . HOH Z  6 .   ? 46.225  10.329  10.766  1.00 40.10  ?  2073 HOH A O   1 
HETATM 8717 O  O   . HOH Z  6 .   ? 0.097   10.801  18.379  1.00 53.62  ?  2074 HOH A O   1 
HETATM 8718 O  O   . HOH Z  6 .   ? 40.007  -2.238  23.714  1.00 53.60  ?  2075 HOH A O   1 
HETATM 8719 O  O   . HOH Z  6 .   ? 28.221  -0.429  29.153  1.00 37.86  ?  2076 HOH A O   1 
HETATM 8720 O  O   . HOH Z  6 .   ? 27.355  -1.334  37.205  1.00 38.34  ?  2077 HOH A O   1 
HETATM 8721 O  O   . HOH Z  6 .   ? 36.219  1.569   36.851  1.00 36.29  ?  2078 HOH A O   1 
HETATM 8722 O  O   . HOH Z  6 .   ? 33.286  -1.916  41.387  1.00 47.28  ?  2079 HOH A O   1 
HETATM 8723 O  O   . HOH Z  6 .   ? 18.775  -5.858  28.386  1.00 47.57  ?  2080 HOH A O   1 
HETATM 8724 O  O   . HOH Z  6 .   ? 20.738  14.989  12.680  1.00 44.07  ?  2081 HOH A O   1 
HETATM 8725 O  O   . HOH Z  6 .   ? 38.662  -5.527  16.938  1.00 58.59  ?  2082 HOH A O   1 
HETATM 8726 O  O   . HOH Z  6 .   ? 36.658  -6.641  15.962  1.00 52.28  ?  2083 HOH A O   1 
HETATM 8727 O  O   . HOH Z  6 .   ? 18.311  12.054  12.952  1.00 40.27  ?  2084 HOH A O   1 
HETATM 8728 O  O   . HOH Z  6 .   ? 26.584  8.555   7.592   1.00 45.05  ?  2085 HOH A O   1 
HETATM 8729 O  O   . HOH Z  6 .   ? 33.736  4.553   6.107   1.00 50.09  ?  2086 HOH A O   1 
HETATM 8730 O  O   . HOH Z  6 .   ? 30.514  8.193   6.464   1.00 34.56  ?  2087 HOH A O   1 
HETATM 8731 O  O   . HOH Z  6 .   ? 27.798  3.274   1.961   1.00 42.83  ?  2088 HOH A O   1 
HETATM 8732 O  O   . HOH Z  6 .   ? 30.961  5.951   0.409   1.00 54.26  ?  2089 HOH A O   1 
HETATM 8733 O  O   . HOH Z  6 .   ? 37.082  9.428   4.081   1.00 33.89  ?  2090 HOH A O   1 
HETATM 8734 O  O   . HOH Z  6 .   ? 36.547  12.565  6.887   1.00 33.49  ?  2091 HOH A O   1 
HETATM 8735 O  O   . HOH Z  6 .   ? 40.658  7.004   2.562   1.00 38.15  ?  2092 HOH A O   1 
HETATM 8736 O  O   . HOH Z  6 .   ? 42.563  6.003   0.089   1.00 46.87  ?  2093 HOH A O   1 
HETATM 8737 O  O   . HOH Z  6 .   ? 43.441  0.259   5.586   1.00 46.51  ?  2094 HOH A O   1 
HETATM 8738 O  O   . HOH Z  6 .   ? 46.013  1.611   3.056   1.00 50.08  ?  2095 HOH A O   1 
HETATM 8739 O  O   . HOH Z  6 .   ? 50.976  7.164   3.056   1.00 60.63  ?  2096 HOH A O   1 
HETATM 8740 O  O   . HOH Z  6 .   ? 44.851  11.235  -1.273  1.00 46.32  ?  2097 HOH A O   1 
HETATM 8741 O  O   . HOH Z  6 .   ? 50.512  2.940   7.004   1.00 56.61  ?  2098 HOH A O   1 
HETATM 8742 O  O   . HOH Z  6 .   ? 38.051  11.754  4.585   1.00 32.37  ?  2099 HOH A O   1 
HETATM 8743 O  O   . HOH Z  6 .   ? 64.164  4.579   17.039  1.00 69.52  ?  2100 HOH A O   1 
HETATM 8744 O  O   . HOH Z  6 .   ? 57.396  8.529   20.409  1.00 65.44  ?  2101 HOH A O   1 
HETATM 8745 O  O   . HOH Z  6 .   ? 53.744  19.835  25.465  1.00 57.09  ?  2102 HOH A O   1 
HETATM 8746 O  O   . HOH Z  6 .   ? 43.173  24.246  9.917   1.00 65.48  ?  2103 HOH A O   1 
HETATM 8747 O  O   . HOH Z  6 .   ? 40.158  16.086  12.537  1.00 47.19  ?  2104 HOH A O   1 
HETATM 8748 O  O   . HOH Z  6 .   ? 38.822  18.359  10.215  1.00 49.01  ?  2105 HOH A O   1 
HETATM 8749 O  O   . HOH Z  6 .   ? 45.905  19.347  1.626   1.00 43.64  ?  2106 HOH A O   1 
HETATM 8750 O  O   . HOH Z  6 .   ? 38.457  15.481  1.068   1.00 42.69  ?  2107 HOH A O   1 
HETATM 8751 O  O   . HOH Z  6 .   ? 40.589  20.265  -5.070  1.00 53.23  ?  2108 HOH A O   1 
HETATM 8752 O  O   . HOH Z  6 .   ? 36.785  19.322  -5.050  1.00 46.96  ?  2109 HOH A O   1 
HETATM 8753 O  O   . HOH Z  6 .   ? 35.462  19.038  4.479   1.00 48.84  ?  2110 HOH A O   1 
HETATM 8754 O  O   . HOH Z  6 .   ? 30.529  16.110  0.756   1.00 47.73  ?  2111 HOH A O   1 
HETATM 8755 O  O   . HOH Z  6 .   ? 42.841  0.032   18.569  1.00 51.25  ?  2112 HOH A O   1 
HETATM 8756 O  O   . HOH Z  6 .   ? 35.587  0.864   1.223   1.00 61.43  ?  2113 HOH A O   1 
HETATM 8757 O  O   . HOH Z  6 .   ? 31.823  -0.954  -0.413  1.00 66.70  ?  2114 HOH A O   1 
HETATM 8758 O  O   . HOH Z  6 .   ? 17.725  14.642  3.898   1.00 46.74  ?  2115 HOH A O   1 
HETATM 8759 O  O   . HOH Z  6 .   ? 11.094  22.384  6.381   1.00 57.42  ?  2116 HOH A O   1 
HETATM 8760 O  O   . HOH Z  6 .   ? 21.583  20.045  6.946   1.00 44.87  ?  2117 HOH A O   1 
HETATM 8761 O  O   . HOH Z  6 .   ? 19.589  17.709  2.155   1.00 31.51  ?  2118 HOH A O   1 
HETATM 8762 O  O   . HOH Z  6 .   ? 28.811  24.611  12.775  1.00 49.09  ?  2119 HOH A O   1 
HETATM 8763 O  O   . HOH Z  6 .   ? 30.378  28.754  1.208   1.00 52.53  ?  2120 HOH A O   1 
HETATM 8764 O  O   . HOH Z  6 .   ? 29.282  27.094  -6.268  1.00 44.35  ?  2121 HOH A O   1 
HETATM 8765 O  O   . HOH Z  6 .   ? 29.953  32.134  -1.241  1.00 67.58  ?  2122 HOH A O   1 
HETATM 8766 O  O   . HOH Z  6 .   ? 20.019  33.124  10.213  1.00 45.93  ?  2123 HOH A O   1 
HETATM 8767 O  O   . HOH Z  6 .   ? 18.336  36.172  -1.691  1.00 56.50  ?  2124 HOH A O   1 
HETATM 8768 O  O   . HOH Z  6 .   ? 15.238  31.213  3.478   1.00 61.33  ?  2125 HOH A O   1 
HETATM 8769 O  O   . HOH Z  6 .   ? 25.296  29.432  -14.794 1.00 37.98  ?  2126 HOH A O   1 
HETATM 8770 O  O   . HOH Z  6 .   ? 31.215  25.288  -12.655 1.00 45.87  ?  2127 HOH A O   1 
HETATM 8771 O  O   . HOH Z  6 .   ? 34.960  15.821  -7.564  1.00 49.26  ?  2128 HOH A O   1 
HETATM 8772 O  O   . HOH Z  6 .   ? 36.196  10.592  -15.489 1.00 50.62  ?  2129 HOH A O   1 
HETATM 8773 O  O   . HOH Z  6 .   ? 17.213  21.959  -12.102 1.00 63.70  ?  2130 HOH A O   1 
HETATM 8774 O  O   . HOH Z  6 .   ? 15.700  19.128  -21.064 1.00 56.36  ?  2131 HOH A O   1 
HETATM 8775 O  O   . HOH Z  6 .   ? 15.405  26.151  -16.375 1.00 42.43  ?  2132 HOH A O   1 
HETATM 8776 O  O   . HOH Z  6 .   ? 17.302  30.439  -14.461 1.00 52.06  ?  2133 HOH A O   1 
HETATM 8777 O  O   . HOH Z  6 .   ? 13.586  29.937  -8.613  1.00 38.53  ?  2134 HOH A O   1 
HETATM 8778 O  O   . HOH Z  6 .   ? 10.973  26.322  -8.532  1.00 52.35  ?  2135 HOH A O   1 
HETATM 8779 O  O   . HOH Z  6 .   ? 16.725  19.395  -1.112  1.00 49.53  ?  2136 HOH A O   1 
HETATM 8780 O  O   . HOH Z  6 .   ? 19.491  14.966  1.672   1.00 46.81  ?  2137 HOH A O   1 
HETATM 8781 O  O   . HOH Z  6 .   ? 27.356  7.790   -0.643  1.00 44.50  ?  2138 HOH A O   1 
HETATM 8782 O  O   . HOH Z  6 .   ? 29.259  7.207   -2.433  1.00 59.08  ?  2139 HOH A O   1 
HETATM 8783 O  O   . HOH Z  6 .   ? 23.347  -2.983  -1.355  1.00 60.19  ?  2140 HOH A O   1 
HETATM 8784 O  O   . HOH Z  6 .   ? 25.337  -3.825  -2.096  1.00 62.97  ?  2141 HOH A O   1 
HETATM 8785 O  O   . HOH Z  6 .   ? 21.713  -13.705 8.639   1.00 67.29  ?  2142 HOH A O   1 
HETATM 8786 O  O   . HOH Z  6 .   ? 18.942  -13.658 8.863   1.00 60.40  ?  2143 HOH A O   1 
HETATM 8787 O  O   . HOH Z  6 .   ? 7.634   -3.531  16.211  1.00 60.04  ?  2144 HOH A O   1 
HETATM 8788 O  O   . HOH Z  6 .   ? 11.304  0.958   10.402  1.00 42.53  ?  2145 HOH A O   1 
HETATM 8789 O  O   . HOH Z  6 .   ? 13.657  20.734  13.934  1.00 41.44  ?  2146 HOH A O   1 
HETATM 8790 O  O   . HOH Z  6 .   ? 5.809   20.233  11.446  1.00 52.88  ?  2147 HOH A O   1 
HETATM 8791 O  O   . HOH Z  6 .   ? 11.193  27.582  12.024  1.00 54.78  ?  2148 HOH A O   1 
HETATM 8792 O  O   . HOH Z  6 .   ? 15.732  25.649  17.698  1.00 42.02  ?  2149 HOH A O   1 
HETATM 8793 O  O   . HOH Z  6 .   ? 14.393  32.401  6.190   1.00 61.25  ?  2150 HOH A O   1 
HETATM 8794 O  O   . HOH Z  6 .   ? 19.045  19.869  18.346  1.00 50.42  ?  2151 HOH A O   1 
HETATM 8795 O  O   . HOH Z  6 .   ? 17.699  25.347  17.914  1.00 38.66  ?  2152 HOH A O   1 
HETATM 8796 O  O   . HOH Z  6 .   ? 9.871   25.107  25.728  1.00 45.85  ?  2153 HOH A O   1 
HETATM 8797 O  O   . HOH Z  6 .   ? 15.567  23.598  32.949  1.00 48.63  ?  2154 HOH A O   1 
HETATM 8798 O  O   . HOH Z  6 .   ? 14.806  28.697  22.480  1.00 53.53  ?  2155 HOH A O   1 
HETATM 8799 O  O   . HOH Z  6 .   ? 2.357   17.700  19.006  1.00 56.97  ?  2156 HOH A O   1 
HETATM 8800 O  O   . HOH Z  6 .   ? 2.620   18.888  27.586  1.00 65.54  ?  2157 HOH A O   1 
HETATM 8801 O  O   . HOH Z  6 .   ? 2.683   15.278  18.263  1.00 52.17  ?  2158 HOH A O   1 
HETATM 8802 O  O   . HOH Z  6 .   ? 5.254   11.407  13.827  1.00 45.52  ?  2159 HOH A O   1 
HETATM 8803 O  O   . HOH Z  6 .   ? 1.605   8.372   16.738  1.00 47.08  ?  2160 HOH A O   1 
HETATM 8804 O  O   . HOH Z  6 .   ? 15.008  -7.517  24.305  1.00 59.12  ?  2161 HOH A O   1 
HETATM 8805 O  O   . HOH Z  6 .   ? 9.242   -3.140  6.216   1.00 48.09  ?  2162 HOH A O   1 
HETATM 8806 O  O   . HOH Z  6 .   ? 14.710  1.590   1.220   1.00 43.21  ?  2163 HOH A O   1 
HETATM 8807 O  O   . HOH Z  6 .   ? 9.097   6.785   0.653   1.00 51.88  ?  2164 HOH A O   1 
HETATM 8808 O  O   . HOH Z  6 .   ? 12.615  9.047   1.038   1.00 59.46  ?  2165 HOH A O   1 
HETATM 8809 O  O   . HOH Z  6 .   ? 3.591   11.595  10.813  1.00 53.53  ?  2166 HOH A O   1 
HETATM 8810 O  O   . HOH Z  6 .   ? 16.934  2.127   0.481   1.00 42.81  ?  2167 HOH A O   1 
HETATM 8811 O  O   . HOH Z  6 .   ? 14.433  8.007   -4.792  1.00 46.68  ?  2168 HOH A O   1 
HETATM 8812 O  O   . HOH Z  6 .   ? 19.638  0.900   -3.152  1.00 44.21  ?  2169 HOH A O   1 
HETATM 8813 O  O   . HOH AA 6 .   ? -13.192 5.889   -66.958 1.00 70.59  ?  2001 HOH B O   1 
HETATM 8814 O  O   . HOH AA 6 .   ? 0.885   17.090  -65.916 1.00 59.35  ?  2002 HOH B O   1 
HETATM 8815 O  O   . HOH AA 6 .   ? 16.107  -0.467  -66.571 1.00 52.37  ?  2003 HOH B O   1 
HETATM 8816 O  O   . HOH AA 6 .   ? 2.983   9.024   -73.539 1.00 60.14  ?  2004 HOH B O   1 
HETATM 8817 O  O   . HOH AA 6 .   ? -0.047  7.894   -73.160 1.00 43.77  ?  2005 HOH B O   1 
HETATM 8818 O  O   . HOH AA 6 .   ? -16.346 8.461   -45.726 1.00 59.96  ?  2006 HOH B O   1 
HETATM 8819 O  O   . HOH AA 6 .   ? -16.989 11.918  -51.920 1.00 56.66  ?  2007 HOH B O   1 
HETATM 8820 O  O   . HOH AA 6 .   ? -6.616  -4.490  -41.288 1.00 61.37  ?  2008 HOH B O   1 
HETATM 8821 O  O   . HOH AA 6 .   ? -1.187  -12.092 -50.904 1.00 72.87  ?  2009 HOH B O   1 
HETATM 8822 O  O   . HOH AA 6 .   ? -0.465  -12.829 -53.560 1.00 62.90  ?  2010 HOH B O   1 
HETATM 8823 O  O   . HOH AA 6 .   ? -2.751  -0.708  -61.658 1.00 53.52  ?  2011 HOH B O   1 
HETATM 8824 O  O   . HOH AA 6 .   ? 0.631   0.437   -56.313 1.00 47.73  ?  2012 HOH B O   1 
HETATM 8825 O  O   . HOH AA 6 .   ? 4.954   8.838   -64.554 1.00 39.30  ?  2013 HOH B O   1 
HETATM 8826 O  O   . HOH AA 6 .   ? 8.121   1.444   -62.111 1.00 41.60  ?  2014 HOH B O   1 
HETATM 8827 O  O   . HOH AA 6 .   ? 15.154  2.649   -61.994 1.00 35.53  ?  2015 HOH B O   1 
HETATM 8828 O  O   . HOH AA 6 .   ? 9.244   1.698   -68.524 1.00 54.90  ?  2016 HOH B O   1 
HETATM 8829 O  O   . HOH AA 6 .   ? 12.389  -0.511  -68.487 1.00 51.57  ?  2017 HOH B O   1 
HETATM 8830 O  O   . HOH AA 6 .   ? 16.867  -3.399  -66.327 1.00 47.27  ?  2018 HOH B O   1 
HETATM 8831 O  O   . HOH AA 6 .   ? 17.644  -2.888  -56.220 1.00 46.10  ?  2019 HOH B O   1 
HETATM 8832 O  O   . HOH AA 6 .   ? 23.237  0.732   -53.360 1.00 52.34  ?  2020 HOH B O   1 
HETATM 8833 O  O   . HOH AA 6 .   ? 7.106   9.903   -65.270 1.00 51.16  ?  2021 HOH B O   1 
HETATM 8834 O  O   . HOH AA 6 .   ? 4.735   1.516   -69.404 1.00 45.55  ?  2022 HOH B O   1 
HETATM 8835 O  O   . HOH AA 6 .   ? 7.536   -0.191  -72.323 1.00 44.63  ?  2023 HOH B O   1 
HETATM 8836 O  O   . HOH AA 6 .   ? -2.670  -0.528  -69.155 1.00 46.46  ?  2024 HOH B O   1 
HETATM 8837 O  O   . HOH AA 6 .   ? -3.938  -5.198  -57.405 1.00 60.87  ?  2025 HOH B O   1 
HETATM 8838 O  O   . HOH AA 6 .   ? 1.971   -2.629  -53.355 1.00 43.76  ?  2026 HOH B O   1 
HETATM 8839 O  O   . HOH AA 6 .   ? 5.305   -5.256  -60.821 1.00 46.28  ?  2027 HOH B O   1 
HETATM 8840 O  O   . HOH AA 6 .   ? 6.741   -2.347  -50.963 1.00 42.76  ?  2028 HOH B O   1 
HETATM 8841 O  O   . HOH AA 6 .   ? 14.931  -7.500  -48.971 1.00 45.46  ?  2029 HOH B O   1 
HETATM 8842 O  O   . HOH AA 6 .   ? 12.838  -4.144  -51.906 1.00 48.30  ?  2030 HOH B O   1 
HETATM 8843 O  O   . HOH AA 6 .   ? 7.274   -8.256  -44.523 1.00 69.23  ?  2031 HOH B O   1 
HETATM 8844 O  O   . HOH AA 6 .   ? 13.383  -7.873  -46.305 1.00 51.30  ?  2032 HOH B O   1 
HETATM 8845 O  O   . HOH AA 6 .   ? 9.104   -15.915 -44.779 1.00 55.42  ?  2033 HOH B O   1 
HETATM 8846 O  O   . HOH AA 6 .   ? 3.661   -13.617 -38.119 1.00 63.41  ?  2034 HOH B O   1 
HETATM 8847 O  O   . HOH AA 6 .   ? 23.869  17.066  -52.025 1.00 49.07  ?  2035 HOH B O   1 
HETATM 8848 O  O   . HOH AA 6 .   ? -5.656  -9.107  -41.719 1.00 56.35  ?  2036 HOH B O   1 
HETATM 8849 O  O   . HOH AA 6 .   ? -3.420  -3.179  -42.994 1.00 54.69  ?  2037 HOH B O   1 
HETATM 8850 O  O   . HOH AA 6 .   ? 4.625   -3.881  -42.731 1.00 42.28  ?  2038 HOH B O   1 
HETATM 8851 O  O   . HOH AA 6 .   ? 6.679   -7.943  -41.052 1.00 66.92  ?  2039 HOH B O   1 
HETATM 8852 O  O   . HOH AA 6 .   ? 32.531  -2.627  -35.878 1.00 57.32  ?  2040 HOH B O   1 
HETATM 8853 O  O   . HOH AA 6 .   ? 32.056  -2.824  -32.930 1.00 63.58  ?  2041 HOH B O   1 
HETATM 8854 O  O   . HOH AA 6 .   ? 2.616   -11.999 -47.166 1.00 57.50  ?  2042 HOH B O   1 
HETATM 8855 O  O   . HOH AA 6 .   ? -2.744  -10.923 -53.882 1.00 68.48  ?  2043 HOH B O   1 
HETATM 8856 O  O   . HOH AA 6 .   ? -5.226  -7.157  -47.781 1.00 56.62  ?  2044 HOH B O   1 
HETATM 8857 O  O   . HOH AA 6 .   ? 28.420  -20.709 -50.288 1.00 73.33  ?  2045 HOH B O   1 
HETATM 8858 O  O   . HOH AA 6 .   ? 4.853   -13.294 -53.833 1.00 44.96  ?  2046 HOH B O   1 
HETATM 8859 O  O   . HOH AA 6 .   ? 12.970  -4.250  -55.432 1.00 50.13  ?  2047 HOH B O   1 
HETATM 8860 O  O   . HOH AA 6 .   ? 9.205   -0.912  -61.142 1.00 47.06  ?  2048 HOH B O   1 
HETATM 8861 O  O   . HOH AA 6 .   ? 10.061  -5.994  -64.404 1.00 40.81  ?  2049 HOH B O   1 
HETATM 8862 O  O   . HOH AA 6 .   ? 6.717   0.199   -64.834 1.00 70.81  ?  2050 HOH B O   1 
HETATM 8863 O  O   . HOH AA 6 .   ? 1.737   0.148   -53.404 1.00 41.92  ?  2051 HOH B O   1 
HETATM 8864 O  O   . HOH AA 6 .   ? -9.772  22.015  -52.187 1.00 57.72  ?  2052 HOH B O   1 
HETATM 8865 O  O   . HOH AA 6 .   ? 0.121   19.834  -47.405 1.00 42.88  ?  2053 HOH B O   1 
HETATM 8866 O  O   . HOH AA 6 .   ? 4.368   4.710   -48.478 1.00 36.39  ?  2054 HOH B O   1 
HETATM 8867 O  O   . HOH AA 6 .   ? -3.108  0.264   -22.444 1.00 55.50  ?  2055 HOH B O   1 
HETATM 8868 O  O   . HOH AA 6 .   ? 4.313   2.241   -41.117 1.00 48.37  ?  2056 HOH B O   1 
HETATM 8869 O  O   . HOH AA 6 .   ? 4.377   -0.793  -43.635 1.00 39.42  ?  2057 HOH B O   1 
HETATM 8870 O  O   . HOH AA 6 .   ? 10.658  0.073   -44.248 1.00 38.73  ?  2058 HOH B O   1 
HETATM 8871 O  O   . HOH AA 6 .   ? 9.755   0.486   -38.974 1.00 52.01  ?  2059 HOH B O   1 
HETATM 8872 O  O   . HOH AA 6 .   ? 16.377  -3.440  -43.031 1.00 44.07  ?  2060 HOH B O   1 
HETATM 8873 O  O   . HOH AA 6 .   ? 6.755   -5.077  -41.268 1.00 54.85  ?  2061 HOH B O   1 
HETATM 8874 O  O   . HOH AA 6 .   ? -1.133  3.985   -48.902 1.00 47.47  ?  2062 HOH B O   1 
HETATM 8875 O  O   . HOH AA 6 .   ? -3.475  1.033   -48.826 1.00 42.64  ?  2063 HOH B O   1 
HETATM 8876 O  O   . HOH AA 6 .   ? -3.171  -5.545  -45.457 1.00 47.36  ?  2064 HOH B O   1 
HETATM 8877 O  O   . HOH AA 6 .   ? -7.849  7.533   -45.292 1.00 42.17  ?  2065 HOH B O   1 
HETATM 8878 O  O   . HOH AA 6 .   ? -12.302 -1.152  -52.304 1.00 58.47  ?  2066 HOH B O   1 
HETATM 8879 O  O   . HOH AA 6 .   ? 23.156  -0.608  -45.079 1.00 49.90  ?  2067 HOH B O   1 
HETATM 8880 O  O   . HOH AA 6 .   ? 21.704  2.399   -47.949 1.00 41.74  ?  2068 HOH B O   1 
HETATM 8881 O  O   . HOH AA 6 .   ? 25.121  -2.850  -47.027 1.00 47.46  ?  2069 HOH B O   1 
HETATM 8882 O  O   . HOH AA 6 .   ? 30.931  6.609   -58.071 1.00 52.92  ?  2070 HOH B O   1 
HETATM 8883 O  O   . HOH AA 6 .   ? 33.586  6.887   -58.803 1.00 67.56  ?  2071 HOH B O   1 
HETATM 8884 O  O   . HOH AA 6 .   ? 25.470  7.318   -51.879 1.00 58.74  ?  2072 HOH B O   1 
HETATM 8885 O  O   . HOH AA 6 .   ? 22.895  7.630   -53.175 1.00 56.94  ?  2073 HOH B O   1 
HETATM 8886 O  O   . HOH AA 6 .   ? -1.722  26.942  -26.894 1.00 52.81  ?  2074 HOH B O   1 
HETATM 8887 O  O   . HOH AA 6 .   ? 6.205   16.926  -53.934 1.00 45.80  ?  2075 HOH B O   1 
HETATM 8888 O  O   . HOH AA 6 .   ? 36.279  -4.677  -25.718 1.00 60.72  ?  2076 HOH B O   1 
HETATM 8889 O  O   . HOH AA 6 .   ? 38.452  -3.699  -26.591 1.00 63.31  ?  2077 HOH B O   1 
HETATM 8890 O  O   . HOH AA 6 .   ? 3.441   4.154   -33.950 1.00 29.53  ?  2078 HOH B O   1 
HETATM 8891 O  O   . HOH AA 6 .   ? 22.709  15.735  -45.786 1.00 45.35  ?  2079 HOH B O   1 
HETATM 8892 O  O   . HOH AA 6 .   ? 22.763  15.657  -49.848 1.00 61.26  ?  2080 HOH B O   1 
HETATM 8893 O  O   . HOH AA 6 .   ? 22.222  17.677  -47.837 1.00 44.39  ?  2081 HOH B O   1 
HETATM 8894 O  O   . HOH AA 6 .   ? 3.000   7.535   -33.211 1.00 35.12  ?  2082 HOH B O   1 
HETATM 8895 O  O   . HOH AA 6 .   ? 13.349  6.689   -33.560 1.00 51.73  ?  2083 HOH B O   1 
HETATM 8896 O  O   . HOH AA 6 .   ? 20.914  7.274   -36.809 1.00 50.76  ?  2084 HOH B O   1 
HETATM 8897 O  O   . HOH AA 6 .   ? 17.276  5.344   -35.079 1.00 48.98  ?  2085 HOH B O   1 
HETATM 8898 O  O   . HOH AA 6 .   ? 19.353  9.987   -30.290 1.00 49.11  ?  2086 HOH B O   1 
HETATM 8899 O  O   . HOH AA 6 .   ? 22.573  0.875   -36.454 1.00 36.35  ?  2087 HOH B O   1 
HETATM 8900 O  O   . HOH AA 6 .   ? 23.712  1.628   -32.512 1.00 51.50  ?  2088 HOH B O   1 
HETATM 8901 O  O   . HOH AA 6 .   ? 18.815  -1.075  -37.783 1.00 46.08  ?  2089 HOH B O   1 
HETATM 8902 O  O   . HOH AA 6 .   ? 30.645  1.609   -36.773 1.00 58.35  ?  2090 HOH B O   1 
HETATM 8903 O  O   . HOH AA 6 .   ? 34.848  -1.526  -43.503 1.00 50.16  ?  2091 HOH B O   1 
HETATM 8904 O  O   . HOH AA 6 .   ? 30.531  -4.043  -35.961 1.00 59.10  ?  2092 HOH B O   1 
HETATM 8905 O  O   . HOH AA 6 .   ? 31.519  -17.691 -50.304 1.00 60.23  ?  2093 HOH B O   1 
HETATM 8906 O  O   . HOH AA 6 .   ? 30.722  -17.237 -42.980 1.00 58.57  ?  2094 HOH B O   1 
HETATM 8907 O  O   . HOH AA 6 .   ? 26.079  -20.290 -50.279 1.00 61.83  ?  2095 HOH B O   1 
HETATM 8908 O  O   . HOH AA 6 .   ? 15.653  -19.183 -51.957 1.00 57.20  ?  2096 HOH B O   1 
HETATM 8909 O  O   . HOH AA 6 .   ? 17.273  -7.040  -41.442 1.00 68.86  ?  2097 HOH B O   1 
HETATM 8910 O  O   . HOH AA 6 .   ? 31.265  -3.711  -30.647 1.00 58.55  ?  2098 HOH B O   1 
HETATM 8911 O  O   . HOH AA 6 .   ? 30.151  -3.961  -28.488 1.00 58.18  ?  2099 HOH B O   1 
HETATM 8912 O  O   . HOH AA 6 .   ? 24.149  -8.154  -27.611 1.00 55.35  ?  2100 HOH B O   1 
HETATM 8913 O  O   . HOH AA 6 .   ? 17.401  -6.855  -34.539 1.00 57.66  ?  2101 HOH B O   1 
HETATM 8914 O  O   . HOH AA 6 .   ? 22.839  10.326  -53.085 1.00 49.50  ?  2102 HOH B O   1 
HETATM 8915 O  O   . HOH AA 6 .   ? 26.879  8.579   -53.306 1.00 49.00  ?  2103 HOH B O   1 
HETATM 8916 O  O   . HOH AA 6 .   ? 6.973   4.054   -24.857 1.00 41.25  ?  2104 HOH B O   1 
HETATM 8917 O  O   . HOH AA 6 .   ? -0.480  0.995   -21.520 1.00 60.85  ?  2105 HOH B O   1 
HETATM 8918 O  O   . HOH AA 6 .   ? 5.363   -1.897  -29.266 1.00 47.75  ?  2106 HOH B O   1 
HETATM 8919 O  O   . HOH AA 6 .   ? 7.442   1.049   -24.048 1.00 58.61  ?  2107 HOH B O   1 
HETATM 8920 O  O   . HOH AA 6 .   ? 5.970   -8.163  -37.494 1.00 53.87  ?  2108 HOH B O   1 
HETATM 8921 O  O   . HOH AA 6 .   ? 21.078  -12.416 -17.119 1.00 58.81  ?  2109 HOH B O   1 
HETATM 8922 O  O   . HOH AA 6 .   ? 10.020  -7.484  -5.566  1.00 55.48  ?  2110 HOH B O   1 
HETATM 8923 O  O   . HOH AA 6 .   ? 4.652   -2.244  -14.049 1.00 71.13  ?  2111 HOH B O   1 
HETATM 8924 O  O   . HOH AA 6 .   ? 4.197   -3.946  -20.991 1.00 49.63  ?  2112 HOH B O   1 
HETATM 8925 O  O   . HOH AA 6 .   ? 18.776  6.094   -27.306 1.00 38.43  ?  2113 HOH B O   1 
HETATM 8926 O  O   . HOH AA 6 .   ? 18.451  8.587   -27.761 1.00 47.87  ?  2114 HOH B O   1 
HETATM 8927 O  O   . HOH AA 6 .   ? 8.150   25.024  -31.831 1.00 46.86  ?  2115 HOH B O   1 
HETATM 8928 O  O   . HOH AA 6 .   ? -0.200  26.949  -32.349 1.00 44.49  ?  2116 HOH B O   1 
HETATM 8929 O  O   . HOH AA 6 .   ? 3.215   19.942  -28.694 1.00 32.93  ?  2117 HOH B O   1 
HETATM 8930 O  O   . HOH AA 6 .   ? 1.234   7.346   -20.861 1.00 54.67  ?  2118 HOH B O   1 
HETATM 8931 O  O   . HOH AA 6 .   ? -5.980  6.379   -21.283 1.00 58.53  ?  2119 HOH B O   1 
HETATM 8932 O  O   . HOH AA 6 .   ? -4.502  1.152   -30.823 1.00 47.51  ?  2120 HOH B O   1 
HETATM 8933 O  O   . HOH AA 6 .   ? -7.215  -3.134  -34.234 1.00 58.09  ?  2121 HOH B O   1 
HETATM 8934 O  O   . HOH AA 6 .   ? -1.604  -9.487  -21.427 1.00 53.44  ?  2122 HOH B O   1 
HETATM 8935 O  O   . HOH AA 6 .   ? -4.547  -10.316 -22.856 1.00 52.64  ?  2123 HOH B O   1 
HETATM 8936 O  O   . HOH AA 6 .   ? -2.703  0.724   -36.973 1.00 51.99  ?  2124 HOH B O   1 
HETATM 8937 O  O   . HOH AA 6 .   ? -5.582  -3.742  -35.390 1.00 36.33  ?  2125 HOH B O   1 
HETATM 8938 O  O   . HOH AA 6 .   ? -15.348 1.423   -46.888 1.00 59.82  ?  2126 HOH B O   1 
HETATM 8939 O  O   . HOH AA 6 .   ? -9.039  -3.660  -37.622 1.00 60.14  ?  2127 HOH B O   1 
HETATM 8940 O  O   . HOH AA 6 .   ? -7.116  13.624  -26.593 1.00 33.05  ?  2128 HOH B O   1 
HETATM 8941 O  O   . HOH AA 6 .   ? -4.742  25.028  -38.608 1.00 49.53  ?  2129 HOH B O   1 
HETATM 8942 O  O   . HOH AA 6 .   ? -1.806  26.518  -29.725 1.00 37.08  ?  2130 HOH B O   1 
HETATM 8943 O  O   . HOH AA 6 .   ? 6.065   24.333  -24.929 1.00 40.51  ?  2131 HOH B O   1 
HETATM 8944 O  O   . HOH AA 6 .   ? 10.721  17.077  -23.107 1.00 41.79  ?  2132 HOH B O   1 
HETATM 8945 O  O   . HOH AA 6 .   ? 11.922  26.666  -28.162 1.00 58.58  ?  2133 HOH B O   1 
HETATM 8946 O  O   . HOH AA 6 .   ? 12.110  28.200  -25.450 1.00 48.85  ?  2134 HOH B O   1 
HETATM 8947 O  O   . HOH AA 6 .   ? 5.340   14.659  -18.801 1.00 42.68  ?  2135 HOH B O   1 
HETATM 8948 O  O   . HOH AA 6 .   ? -6.434  13.768  -23.337 1.00 43.47  ?  2136 HOH B O   1 
HETATM 8949 O  O   . HOH AA 6 .   ? -5.428  12.281  -20.752 1.00 49.39  ?  2137 HOH B O   1 
HETATM 8950 O  O   . HOH AA 6 .   ? -8.618  7.000   -23.809 1.00 59.77  ?  2138 HOH B O   1 
HETATM 8951 O  O   . HOH AA 6 .   ? -4.412  20.869  -20.553 1.00 53.14  ?  2139 HOH B O   1 
HETATM 8952 O  O   . HOH AA 6 .   ? 3.014   17.055  -16.899 1.00 49.28  ?  2140 HOH B O   1 
HETATM 8953 O  O   . HOH AA 6 .   ? 8.833   13.926  -17.743 1.00 60.40  ?  2141 HOH B O   1 
HETATM 8954 O  O   . HOH AA 6 .   ? 12.749  15.124  -22.970 1.00 41.08  ?  2142 HOH B O   1 
HETATM 8955 O  O   . HOH AA 6 .   ? 16.012  15.665  -21.304 1.00 44.07  ?  2143 HOH B O   1 
HETATM 8956 O  O   . HOH AA 6 .   ? 22.228  7.205   -26.333 1.00 55.58  ?  2144 HOH B O   1 
HETATM 8957 O  O   . HOH AA 6 .   ? 16.959  15.075  -24.776 1.00 51.25  ?  2145 HOH B O   1 
HETATM 8958 O  O   . HOH AA 6 .   ? 36.924  3.802   -18.172 1.00 63.32  ?  2146 HOH B O   1 
HETATM 8959 O  O   . HOH AA 6 .   ? 37.735  -1.327  -25.903 1.00 68.54  ?  2147 HOH B O   1 
HETATM 8960 O  O   . HOH AA 6 .   ? 14.867  -14.937 -32.930 1.00 63.05  ?  2148 HOH B O   1 
HETATM 8961 O  O   . HOH AA 6 .   ? 31.794  1.224   -2.112  1.00 61.29  ?  2149 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 1.2949 1.2965 0.7931 0.1501  -0.0548 -0.0597 1   GLU A N   
2    C CA  . GLU A 1   ? 1.2560 1.2625 0.7666 0.1485  -0.0403 -0.0569 1   GLU A CA  
3    C C   . GLU A 1   ? 1.2928 1.3027 0.7848 0.1677  -0.0314 -0.0683 1   GLU A C   
4    O O   . GLU A 1   ? 1.4575 1.4503 0.9438 0.1759  -0.0449 -0.0921 1   GLU A O   
5    C CB  . GLU A 1   ? 1.1975 1.2196 0.7174 0.1386  -0.0188 -0.0292 1   GLU A CB  
6    C CG  . GLU A 1   ? 1.1286 1.1438 0.6620 0.1230  -0.0255 -0.0169 1   GLU A CG  
7    C CD  . GLU A 1   ? 1.1076 1.1303 0.6428 0.1134  -0.0048 0.0100  1   GLU A CD  
8    O OE1 . GLU A 1   ? 1.0267 1.0637 0.5526 0.1176  0.0145  0.0212  1   GLU A OE1 
9    O OE2 . GLU A 1   ? 1.0990 1.1124 0.6503 0.0995  -0.0077 0.0197  1   GLU A OE2 
10   N N   . GLY A 2   ? 1.1100 1.1410 0.5934 0.1746  -0.0084 -0.0509 2   GLY A N   
11   C CA  . GLY A 2   ? 1.0470 1.0866 0.5096 0.1961  0.0013  -0.0587 2   GLY A CA  
12   C C   . GLY A 2   ? 1.0574 1.1101 0.5293 0.2062  0.0160  -0.0610 2   GLY A C   
13   O O   . GLY A 2   ? 0.9891 1.0707 0.4626 0.2115  0.0384  -0.0441 2   GLY A O   
14   N N   . ARG A 3   ? 1.1999 1.2324 0.6790 0.2093  0.0034  -0.0810 3   ARG A N   
15   C CA  . ARG A 3   ? 1.2044 1.2440 0.6866 0.2265  0.0147  -0.0877 3   ARG A CA  
16   C C   . ARG A 3   ? 1.0268 1.0776 0.5389 0.2165  0.0214  -0.0788 3   ARG A C   
17   O O   . ARG A 3   ? 1.0766 1.1336 0.5931 0.2327  0.0298  -0.0842 3   ARG A O   
18   C CB  . ARG A 3   ? 1.2760 1.2791 0.7378 0.2442  -0.0027 -0.1191 3   ARG A CB  
19   C CG  . ARG A 3   ? 1.4274 1.4261 0.8571 0.2613  -0.0058 -0.1303 3   ARG A CG  
20   C CD  . ARG A 3   ? 1.5163 1.4990 0.9365 0.2479  -0.0267 -0.1371 3   ARG A CD  
21   N NE  . ARG A 3   ? 1.6677 1.6464 1.0550 0.2656  -0.0317 -0.1504 3   ARG A NE  
22   C CZ  . ARG A 3   ? 1.6966 1.6687 1.0707 0.2596  -0.0483 -0.1567 3   ARG A CZ  
23   N NH1 . ARG A 3   ? 1.7130 1.6823 1.1060 0.2371  -0.0611 -0.1500 3   ARG A NH1 
24   N NH2 . ARG A 3   ? 1.6713 1.6425 1.0136 0.2774  -0.0522 -0.1692 3   ARG A NH2 
25   N N   . GLU A 4   ? 0.9458 0.9996 0.4830 0.1903  0.0176  -0.0643 4   GLU A N   
26   C CA  . GLU A 4   ? 1.0165 1.0803 0.6012 0.1729  0.0210  -0.0537 4   GLU A CA  
27   C C   . GLU A 4   ? 1.0430 1.1518 0.6468 0.1654  0.0447  -0.0287 4   GLU A C   
28   O O   . GLU A 4   ? 1.1426 1.2725 0.7255 0.1698  0.0592  -0.0166 4   GLU A O   
29   C CB  . GLU A 4   ? 1.1104 1.1559 0.7219 0.1458  0.0044  -0.0509 4   GLU A CB  
30   C CG  . GLU A 4   ? 1.2075 1.2171 0.8045 0.1453  -0.0197 -0.0706 4   GLU A CG  
31   C CD  . GLU A 4   ? 1.2753 1.2842 0.8694 0.1306  -0.0273 -0.0620 4   GLU A CD  
32   O OE1 . GLU A 4   ? 1.2866 1.3012 0.8469 0.1412  -0.0233 -0.0591 4   GLU A OE1 
33   O OE2 . GLU A 4   ? 1.2324 1.2364 0.8565 0.1107  -0.0362 -0.0568 4   GLU A OE2 
34   N N   . ASP A 5   ? 0.9153 1.0401 0.5593 0.1526  0.0480  -0.0202 5   ASP A N   
35   C CA  . ASP A 5   ? 0.8309 1.0002 0.5000 0.1389  0.0668  0.0024  5   ASP A CA  
36   C C   . ASP A 5   ? 0.8468 1.0105 0.5190 0.1127  0.0658  0.0164  5   ASP A C   
37   O O   . ASP A 5   ? 0.8444 0.9835 0.5301 0.0962  0.0509  0.0132  5   ASP A O   
38   C CB  . ASP A 5   ? 0.7870 0.9731 0.4972 0.1308  0.0659  0.0058  5   ASP A CB  
39   C CG  . ASP A 5   ? 0.8469 1.0884 0.5835 0.1206  0.0850  0.0260  5   ASP A CG  
40   O OD1 . ASP A 5   ? 0.9524 1.2134 0.6824 0.1095  0.0977  0.0404  5   ASP A OD1 
41   O OD2 . ASP A 5   ? 0.7467 1.0138 0.5118 0.1232  0.0869  0.0284  5   ASP A OD2 
42   N N   . PRO A 6   ? 0.8522 1.0377 0.5106 0.1100  0.0827  0.0329  6   PRO A N   
43   C CA  . PRO A 6   ? 0.8111 0.9856 0.4696 0.0863  0.0837  0.0482  6   PRO A CA  
44   C C   . PRO A 6   ? 0.7546 0.9437 0.4539 0.0571  0.0862  0.0601  6   PRO A C   
45   O O   . PRO A 6   ? 0.7149 0.8870 0.4158 0.0366  0.0851  0.0701  6   PRO A O   
46   C CB  . PRO A 6   ? 0.8949 1.0913 0.5272 0.0935  0.1040  0.0648  6   PRO A CB  
47   C CG  . PRO A 6   ? 0.9069 1.1416 0.5485 0.1107  0.1172  0.0629  6   PRO A CG  
48   C CD  . PRO A 6   ? 0.8882 1.1067 0.5262 0.1312  0.1023  0.0386  6   PRO A CD  
49   N N   . GLN A 7   ? 0.7965 1.0156 0.5262 0.0563  0.0891  0.0585  7   GLN A N   
50   C CA  . GLN A 7   ? 0.9161 1.1503 0.6824 0.0288  0.0885  0.0667  7   GLN A CA  
51   C C   . GLN A 7   ? 0.8361 1.0406 0.6158 0.0223  0.0686  0.0542  7   GLN A C   
52   O O   . GLN A 7   ? 0.8869 1.0975 0.6915 0.0011  0.0651  0.0579  7   GLN A O   
53   C CB  . GLN A 7   ? 1.1314 1.4215 0.9264 0.0287  0.1014  0.0745  7   GLN A CB  
54   C CG  . GLN A 7   ? 1.2632 1.5898 1.0694 0.0074  0.1197  0.0954  7   GLN A CG  
55   C CD  . GLN A 7   ? 1.2542 1.5704 1.0818 -0.0288 0.1142  0.1019  7   GLN A CD  
56   O OE1 . GLN A 7   ? 1.1531 1.4528 0.9951 -0.0362 0.0988  0.0914  7   GLN A OE1 
57   N NE2 . GLN A 7   ? 1.3002 1.6244 1.1281 -0.0512 0.1272  0.1193  7   GLN A NE2 
58   N N   . LEU A 8   ? 0.7468 0.9202 0.5089 0.0397  0.0555  0.0392  8   LEU A N   
59   C CA  . LEU A 8   ? 0.6592 0.8084 0.4347 0.0348  0.0379  0.0289  8   LEU A CA  
60   C C   . LEU A 8   ? 0.7564 0.8694 0.5157 0.0291  0.0259  0.0251  8   LEU A C   
61   O O   . LEU A 8   ? 0.8086 0.9042 0.5785 0.0253  0.0118  0.0176  8   LEU A O   
62   C CB  . LEU A 8   ? 0.5779 0.7192 0.3522 0.0558  0.0304  0.0152  8   LEU A CB  
63   C CG  . LEU A 8   ? 0.5936 0.7714 0.3846 0.0665  0.0418  0.0193  8   LEU A CG  
64   C CD1 . LEU A 8   ? 0.6357 0.7962 0.4210 0.0900  0.0350  0.0059  8   LEU A CD1 
65   C CD2 . LEU A 8   ? 0.5721 0.7770 0.3977 0.0466  0.0427  0.0294  8   LEU A CD2 
66   N N   . LEU A 9   ? 0.6877 0.7924 0.4218 0.0298  0.0321  0.0322  9   LEU A N   
67   C CA  . LEU A 9   ? 0.6378 0.7117 0.3552 0.0279  0.0212  0.0305  9   LEU A CA  
68   C C   . LEU A 9   ? 0.6019 0.6687 0.3248 0.0082  0.0269  0.0441  9   LEU A C   
69   O O   . LEU A 9   ? 0.5799 0.6571 0.2985 -0.0002 0.0421  0.0581  9   LEU A O   
70   C CB  . LEU A 9   ? 0.6252 0.6884 0.3045 0.0466  0.0208  0.0277  9   LEU A CB  
71   C CG  . LEU A 9   ? 0.7900 0.8579 0.4569 0.0676  0.0176  0.0126  9   LEU A CG  
72   C CD1 . LEU A 9   ? 0.6995 0.7590 0.3232 0.0871  0.0168  0.0085  9   LEU A CD1 
73   C CD2 . LEU A 9   ? 0.7231 0.7764 0.4079 0.0677  -0.0004 -0.0039 9   LEU A CD2 
74   N N   . VAL A 10  ? 0.5169 0.5650 0.2489 0.0011  0.0148  0.0400  10  VAL A N   
75   C CA  . VAL A 10  ? 0.5528 0.5887 0.2919 -0.0166 0.0177  0.0483  10  VAL A CA  
76   C C   . VAL A 10  ? 0.6814 0.6905 0.4114 -0.0112 0.0049  0.0442  10  VAL A C   
77   O O   . VAL A 10  ? 0.6601 0.6707 0.3964 -0.0022 -0.0083 0.0333  10  VAL A O   
78   C CB  . VAL A 10  ? 0.6649 0.7207 0.4369 -0.0320 0.0176  0.0455  10  VAL A CB  
79   C CG1 . VAL A 10  ? 0.6112 0.6486 0.3892 -0.0463 0.0138  0.0461  10  VAL A CG1 
80   C CG2 . VAL A 10  ? 0.5743 0.6618 0.3581 -0.0408 0.0317  0.0533  10  VAL A CG2 
81   N N   . ARG A 11  ? 0.6459 0.6307 0.3616 -0.0164 0.0088  0.0535  11  ARG A N   
82   C CA  . ARG A 11  ? 0.6206 0.5831 0.3290 -0.0087 -0.0022 0.0507  11  ARG A CA  
83   C C   . ARG A 11  ? 0.6888 0.6393 0.4115 -0.0223 -0.0021 0.0497  11  ARG A C   
84   O O   . ARG A 11  ? 0.7319 0.6722 0.4544 -0.0381 0.0079  0.0564  11  ARG A O   
85   C CB  . ARG A 11  ? 0.5466 0.4850 0.2212 0.0040  0.0000  0.0612  11  ARG A CB  
86   C CG  . ARG A 11  ? 0.5840 0.5007 0.2509 0.0142  -0.0097 0.0607  11  ARG A CG  
87   C CD  . ARG A 11  ? 0.6319 0.5259 0.2635 0.0304  -0.0081 0.0731  11  ARG A CD  
88   N NE  . ARG A 11  ? 0.7450 0.6577 0.3620 0.0471  -0.0160 0.0690  11  ARG A NE  
89   C CZ  . ARG A 11  ? 0.7721 0.6958 0.3891 0.0620  -0.0329 0.0597  11  ARG A CZ  
90   N NH1 . ARG A 11  ? 0.8254 0.7472 0.4579 0.0641  -0.0416 0.0558  11  ARG A NH1 
91   N NH2 . ARG A 11  ? 0.7036 0.6428 0.3050 0.0749  -0.0413 0.0537  11  ARG A NH2 
92   N N   . VAL A 12  ? 0.6829 0.6360 0.4175 -0.0164 -0.0136 0.0409  12  VAL A N   
93   C CA  . VAL A 12  ? 0.6967 0.6374 0.4388 -0.0234 -0.0146 0.0380  12  VAL A CA  
94   C C   . VAL A 12  ? 0.7394 0.6615 0.4670 -0.0058 -0.0218 0.0383  12  VAL A C   
95   O O   . VAL A 12  ? 0.7080 0.6349 0.4260 0.0090  -0.0281 0.0397  12  VAL A O   
96   C CB  . VAL A 12  ? 0.5218 0.4909 0.2929 -0.0301 -0.0197 0.0289  12  VAL A CB  
97   C CG1 . VAL A 12  ? 0.4939 0.4856 0.2791 -0.0432 -0.0131 0.0297  12  VAL A CG1 
98   C CG2 . VAL A 12  ? 0.5842 0.5717 0.3663 -0.0176 -0.0307 0.0239  12  VAL A CG2 
99   N N   . ARG A 13  ? 0.7684 0.6712 0.4936 -0.0060 -0.0216 0.0362  13  ARG A N   
100  C CA  . ARG A 13  ? 0.7083 0.5939 0.4192 0.0140  -0.0269 0.0373  13  ARG A CA  
101  C C   . ARG A 13  ? 0.6420 0.5591 0.3648 0.0299  -0.0390 0.0341  13  ARG A C   
102  O O   . ARG A 13  ? 0.6025 0.5139 0.3112 0.0487  -0.0443 0.0383  13  ARG A O   
103  C CB  . ARG A 13  ? 0.6888 0.5589 0.4011 0.0130  -0.0258 0.0306  13  ARG A CB  
104  C CG  . ARG A 13  ? 0.6962 0.5493 0.3934 0.0373  -0.0297 0.0317  13  ARG A CG  
105  C CD  . ARG A 13  ? 0.7014 0.5131 0.3664 0.0479  -0.0252 0.0438  13  ARG A CD  
106  N NE  . ARG A 13  ? 0.8383 0.6328 0.4874 0.0750  -0.0286 0.0457  13  ARG A NE  
107  C CZ  . ARG A 13  ? 0.8588 0.6820 0.5116 0.0972  -0.0378 0.0485  13  ARG A CZ  
108  N NH1 . ARG A 13  ? 0.7047 0.5699 0.3753 0.0931  -0.0456 0.0477  13  ARG A NH1 
109  N NH2 . ARG A 13  ? 0.8233 0.6336 0.4621 0.1241  -0.0400 0.0513  13  ARG A NH2 
110  N N   . GLY A 14  ? 0.6185 0.5694 0.3681 0.0216  -0.0439 0.0274  14  GLY A N   
111  C CA  . GLY A 14  ? 0.6325 0.6129 0.3978 0.0307  -0.0560 0.0240  14  GLY A CA  
112  C C   . GLY A 14  ? 0.7181 0.7060 0.4768 0.0338  -0.0623 0.0235  14  GLY A C   
113  O O   . GLY A 14  ? 0.7562 0.7644 0.5236 0.0411  -0.0745 0.0199  14  GLY A O   
114  N N   . GLY A 15  ? 0.7972 0.7714 0.5406 0.0279  -0.0542 0.0263  15  GLY A N   
115  C CA  . GLY A 15  ? 0.7268 0.7062 0.4575 0.0336  -0.0588 0.0245  15  GLY A CA  
116  C C   . GLY A 15  ? 0.6939 0.6752 0.4245 0.0235  -0.0496 0.0237  15  GLY A C   
117  O O   . GLY A 15  ? 0.6750 0.6525 0.4124 0.0113  -0.0385 0.0275  15  GLY A O   
118  N N   . GLN A 16  ? 0.7823 0.7716 0.5050 0.0296  -0.0549 0.0176  16  GLN A N   
119  C CA  . GLN A 16  ? 0.7831 0.7763 0.5021 0.0258  -0.0453 0.0169  16  GLN A CA  
120  C C   . GLN A 16  ? 0.6400 0.6477 0.3871 0.0178  -0.0482 0.0086  16  GLN A C   
121  O O   . GLN A 16  ? 0.7046 0.7182 0.4686 0.0171  -0.0607 0.0012  16  GLN A O   
122  C CB  . GLN A 16  ? 0.7809 0.7726 0.4708 0.0402  -0.0483 0.0135  16  GLN A CB  
123  C CG  . GLN A 16  ? 0.7482 0.7260 0.4062 0.0487  -0.0404 0.0267  16  GLN A CG  
124  C CD  . GLN A 16  ? 0.8401 0.8200 0.4664 0.0659  -0.0461 0.0226  16  GLN A CD  
125  O OE1 . GLN A 16  ? 0.9547 0.9364 0.5724 0.0766  -0.0620 0.0164  16  GLN A OE1 
126  N NE2 . GLN A 16  ? 0.8068 0.7907 0.4153 0.0698  -0.0335 0.0259  16  GLN A NE2 
127  N N   . LEU A 17  ? 0.5795 0.5948 0.3321 0.0120  -0.0363 0.0114  17  LEU A N   
128  C CA  . LEU A 17  ? 0.6060 0.6345 0.3830 0.0073  -0.0374 0.0062  17  LEU A CA  
129  C C   . LEU A 17  ? 0.5663 0.6016 0.3346 0.0151  -0.0299 0.0036  17  LEU A C   
130  O O   . LEU A 17  ? 0.6440 0.6847 0.3982 0.0163  -0.0172 0.0110  17  LEU A O   
131  C CB  . LEU A 17  ? 0.6184 0.6580 0.4167 -0.0064 -0.0300 0.0128  17  LEU A CB  
132  C CG  . LEU A 17  ? 0.6011 0.6358 0.4075 -0.0136 -0.0336 0.0152  17  LEU A CG  
133  C CD1 . LEU A 17  ? 0.5153 0.5601 0.3343 -0.0269 -0.0249 0.0197  17  LEU A CD1 
134  C CD2 . LEU A 17  ? 0.6570 0.6975 0.4812 -0.0118 -0.0457 0.0100  17  LEU A CD2 
135  N N   . ARG A 18  ? 0.5783 0.6135 0.3559 0.0205  -0.0368 -0.0057 18  ARG A N   
136  C CA  . ARG A 18  ? 0.5945 0.6370 0.3676 0.0308  -0.0290 -0.0087 18  ARG A CA  
137  C C   . ARG A 18  ? 0.6522 0.7089 0.4539 0.0259  -0.0258 -0.0052 18  ARG A C   
138  O O   . ARG A 18  ? 0.7040 0.7525 0.5219 0.0231  -0.0356 -0.0089 18  ARG A O   
139  C CB  . ARG A 18  ? 0.5848 0.6089 0.3384 0.0455  -0.0393 -0.0240 18  ARG A CB  
140  C CG  . ARG A 18  ? 0.6706 0.6985 0.4162 0.0611  -0.0309 -0.0291 18  ARG A CG  
141  C CD  . ARG A 18  ? 0.8396 0.8428 0.5603 0.0767  -0.0421 -0.0479 18  ARG A CD  
142  N NE  . ARG A 18  ? 0.9241 0.9052 0.6555 0.0674  -0.0618 -0.0580 18  ARG A NE  
143  C CZ  . ARG A 18  ? 0.9946 0.9658 0.7116 0.0654  -0.0761 -0.0665 18  ARG A CZ  
144  N NH1 . ARG A 18  ? 0.8750 0.8526 0.5626 0.0743  -0.0727 -0.0656 18  ARG A NH1 
145  N NH2 . ARG A 18  ? 1.0551 1.0129 0.7878 0.0544  -0.0937 -0.0743 18  ARG A NH2 
146  N N   . GLY A 19  ? 0.5482 0.6291 0.3565 0.0245  -0.0119 0.0034  19  GLY A N   
147  C CA  . GLY A 19  ? 0.4957 0.5967 0.3294 0.0223  -0.0089 0.0080  19  GLY A CA  
148  C C   . GLY A 19  ? 0.6932 0.8005 0.5244 0.0413  -0.0040 0.0043  19  GLY A C   
149  O O   . GLY A 19  ? 0.7368 0.8257 0.5454 0.0566  -0.0056 -0.0055 19  GLY A O   
150  N N   . ILE A 20  ? 0.7050 0.8389 0.5573 0.0426  0.0017  0.0115  20  ILE A N   
151  C CA  . ILE A 20  ? 0.6225 0.7617 0.4736 0.0647  0.0063  0.0091  20  ILE A CA  
152  C C   . ILE A 20  ? 0.6137 0.8023 0.4804 0.0680  0.0201  0.0200  20  ILE A C   
153  O O   . ILE A 20  ? 0.7151 0.9327 0.6020 0.0505  0.0219  0.0293  20  ILE A O   
154  C CB  . ILE A 20  ? 0.5766 0.6911 0.4381 0.0701  -0.0044 0.0062  20  ILE A CB  
155  C CG1 . ILE A 20  ? 0.5540 0.6632 0.4096 0.0967  -0.0001 0.0027  20  ILE A CG1 
156  C CG2 . ILE A 20  ? 0.4618 0.5967 0.3502 0.0548  -0.0069 0.0177  20  ILE A CG2 
157  C CD1 . ILE A 20  ? 0.5653 0.6408 0.4285 0.1016  -0.0102 0.0015  20  ILE A CD1 
158  N N   . ARG A 21  ? 0.5257 0.7258 0.3820 0.0911  0.0295  0.0179  21  ARG A N   
159  C CA  . ARG A 21  ? 0.5507 0.8050 0.4231 0.0980  0.0433  0.0285  21  ARG A CA  
160  C C   . ARG A 21  ? 0.5728 0.8378 0.4640 0.1125  0.0403  0.0322  21  ARG A C   
161  O O   . ARG A 21  ? 0.5987 0.8413 0.4779 0.1390  0.0399  0.0257  21  ARG A O   
162  C CB  . ARG A 21  ? 0.5597 0.8241 0.4098 0.1210  0.0563  0.0251  21  ARG A CB  
163  C CG  . ARG A 21  ? 0.6413 0.9707 0.5089 0.1288  0.0732  0.0375  21  ARG A CG  
164  C CD  . ARG A 21  ? 0.7326 1.0665 0.5754 0.1625  0.0852  0.0315  21  ARG A CD  
165  N NE  . ARG A 21  ? 0.8662 1.2667 0.7208 0.1660  0.1047  0.0451  21  ARG A NE  
166  C CZ  . ARG A 21  ? 0.9548 1.4064 0.8282 0.1872  0.1148  0.0522  21  ARG A CZ  
167  N NH1 . ARG A 21  ? 0.9475 1.3861 0.8273 0.2088  0.1073  0.0476  21  ARG A NH1 
168  N NH2 . ARG A 21  ? 0.9568 1.4747 0.8435 0.1872  0.1331  0.0658  21  ARG A NH2 
169  N N   . LEU A 22  ? 0.5234 0.8192 0.4412 0.0963  0.0375  0.0423  22  LEU A N   
170  C CA  . LEU A 22  ? 0.5460 0.8549 0.4804 0.1113  0.0344  0.0487  22  LEU A CA  
171  C C   . LEU A 22  ? 0.5375 0.9088 0.4881 0.1269  0.0463  0.0580  22  LEU A C   
172  O O   . LEU A 22  ? 0.5513 0.9681 0.5124 0.1126  0.0547  0.0632  22  LEU A O   
173  C CB  . LEU A 22  ? 0.5203 0.8331 0.4725 0.0900  0.0241  0.0547  22  LEU A CB  
174  C CG  . LEU A 22  ? 0.5030 0.7616 0.4443 0.0770  0.0126  0.0478  22  LEU A CG  
175  C CD1 . LEU A 22  ? 0.4092 0.6779 0.3673 0.0642  0.0049  0.0557  22  LEU A CD1 
176  C CD2 . LEU A 22  ? 0.5458 0.7537 0.4701 0.0969  0.0086  0.0401  22  LEU A CD2 
177  N N   . LYS A 23  ? 0.5708 0.9443 0.5241 0.1563  0.0472  0.0613  23  LYS A N   
178  C CA  . LYS A 23  ? 0.6006 1.0403 0.5734 0.1749  0.0570  0.0721  23  LYS A CA  
179  C C   . LYS A 23  ? 0.5382 1.0224 0.5401 0.1604  0.0500  0.0842  23  LYS A C   
180  O O   . LYS A 23  ? 0.5674 1.0216 0.5695 0.1567  0.0390  0.0861  23  LYS A O   
181  C CB  . LYS A 23  ? 0.7280 1.1475 0.6874 0.2182  0.0614  0.0702  23  LYS A CB  
182  C CG  . LYS A 23  ? 0.9470 1.4249 0.9114 0.2451  0.0776  0.0747  23  LYS A CG  
183  C CD  . LYS A 23  ? 1.0157 1.5704 1.0142 0.2526  0.0798  0.0914  23  LYS A CD  
184  C CE  . LYS A 23  ? 0.9952 1.6263 1.0070 0.2707  0.0969  0.0981  23  LYS A CE  
185  N NZ  . LYS A 23  ? 0.9317 1.5940 0.9496 0.2370  0.1042  0.0980  23  LYS A NZ  
186  N N   . ALA A 24  ? 0.4781 1.0359 0.5042 0.1502  0.0560  0.0923  24  ALA A N   
187  C CA  . ALA A 24  ? 0.5173 1.1303 0.5711 0.1413  0.0491  0.1027  24  ALA A CA  
188  C C   . ALA A 24  ? 0.5570 1.2440 0.6307 0.1662  0.0595  0.1127  24  ALA A C   
189  O O   . ALA A 24  ? 0.6693 1.3707 0.7382 0.1782  0.0730  0.1113  24  ALA A O   
190  C CB  . ALA A 24  ? 0.3150 0.9494 0.3813 0.0975  0.0436  0.1005  24  ALA A CB  
191  N N   . PRO A 25  ? 0.5344 1.2729 0.6301 0.1762  0.0538  0.1237  25  PRO A N   
192  C CA  . PRO A 25  ? 0.4107 1.2072 0.5185 0.2021  0.0608  0.1334  25  PRO A CA  
193  C C   . PRO A 25  ? 0.4339 1.2712 0.5495 0.1837  0.0691  0.1332  25  PRO A C   
194  O O   . PRO A 25  ? 0.4641 1.3222 0.5765 0.2100  0.0787  0.1374  25  PRO A O   
195  C CB  . PRO A 25  ? 0.3870 1.2150 0.5065 0.1936  0.0475  0.1417  25  PRO A CB  
196  C CG  . PRO A 25  ? 0.4240 1.2076 0.5374 0.1900  0.0375  0.1403  25  PRO A CG  
197  C CD  . PRO A 25  ? 0.4593 1.1921 0.5601 0.1643  0.0387  0.1274  25  PRO A CD  
198  N N   . GLY A 26  ? 0.3897 1.2346 0.5144 0.1400  0.0654  0.1289  26  GLY A N   
199  C CA  . GLY A 26  ? 0.4091 1.2913 0.5446 0.1187  0.0717  0.1314  26  GLY A CA  
200  C C   . GLY A 26  ? 0.4504 1.3034 0.5711 0.1137  0.0854  0.1267  26  GLY A C   
201  O O   . GLY A 26  ? 0.3802 1.2622 0.5086 0.1015  0.0931  0.1314  26  GLY A O   
202  N N   . GLY A 27  ? 0.4306 1.2267 0.5285 0.1229  0.0886  0.1182  27  GLY A N   
203  C CA  . GLY A 27  ? 0.3772 1.1378 0.4517 0.1197  0.1008  0.1126  27  GLY A CA  
204  C C   . GLY A 27  ? 0.4594 1.1386 0.5064 0.1100  0.0917  0.1007  27  GLY A C   
205  O O   . GLY A 27  ? 0.4945 1.1467 0.5428 0.1069  0.0771  0.0976  27  GLY A O   
206  N N   . PRO A 28  ? 0.4005 1.0356 0.4203 0.1048  0.0977  0.0944  28  PRO A N   
207  C CA  . PRO A 28  ? 0.3976 0.9513 0.3901 0.0953  0.0859  0.0824  28  PRO A CA  
208  C C   . PRO A 28  ? 0.4775 1.0172 0.4778 0.0544  0.0757  0.0820  28  PRO A C   
209  O O   . PRO A 28  ? 0.5025 1.0848 0.5226 0.0277  0.0798  0.0894  28  PRO A O   
210  C CB  . PRO A 28  ? 0.3986 0.9225 0.3597 0.1062  0.0963  0.0770  28  PRO A CB  
211  C CG  . PRO A 28  ? 0.4046 0.9982 0.3811 0.1044  0.1147  0.0897  28  PRO A CG  
212  C CD  . PRO A 28  ? 0.4005 1.0606 0.4105 0.1166  0.1164  0.0984  28  PRO A CD  
213  N N   . VAL A 29  ? 0.4136 0.8935 0.3985 0.0498  0.0625  0.0730  29  VAL A N   
214  C CA  . VAL A 29  ? 0.4034 0.8591 0.3878 0.0172  0.0537  0.0702  29  VAL A CA  
215  C C   . VAL A 29  ? 0.4332 0.8208 0.3879 0.0206  0.0483  0.0605  29  VAL A C   
216  O O   . VAL A 29  ? 0.4317 0.7895 0.3716 0.0449  0.0460  0.0546  29  VAL A O   
217  C CB  . VAL A 29  ? 0.3170 0.7816 0.3188 0.0069  0.0402  0.0701  29  VAL A CB  
218  C CG1 . VAL A 29  ? 0.3005 0.8368 0.3321 0.0034  0.0421  0.0785  29  VAL A CG1 
219  C CG2 . VAL A 29  ? 0.3115 0.7397 0.3042 0.0295  0.0320  0.0668  29  VAL A CG2 
220  N N   . SER A 30  ? 0.4624 0.8247 0.4087 -0.0036 0.0452  0.0586  30  SER A N   
221  C CA  . SER A 30  ? 0.4987 0.8030 0.4205 -0.0022 0.0377  0.0502  30  SER A CA  
222  C C   . SER A 30  ? 0.4567 0.7393 0.3850 -0.0103 0.0238  0.0459  30  SER A C   
223  O O   . SER A 30  ? 0.5179 0.8157 0.4592 -0.0294 0.0203  0.0478  30  SER A O   
224  C CB  . SER A 30  ? 0.6180 0.9055 0.5239 -0.0188 0.0432  0.0523  30  SER A CB  
225  O OG  . SER A 30  ? 0.7606 1.0767 0.6632 -0.0146 0.0584  0.0601  30  SER A OG  
226  N N   . ALA A 31  ? 0.4145 0.6624 0.3330 0.0038  0.0159  0.0398  31  ALA A N   
227  C CA  . ALA A 31  ? 0.4408 0.6688 0.3643 -0.0035 0.0044  0.0377  31  ALA A CA  
228  C C   . ALA A 31  ? 0.5554 0.7400 0.4608 -0.0057 -0.0023 0.0305  31  ALA A C   
229  O O   . ALA A 31  ? 0.6021 0.7634 0.4917 0.0070  -0.0033 0.0248  31  ALA A O   
230  C CB  . ALA A 31  ? 0.3740 0.6047 0.3086 0.0118  0.0000  0.0403  31  ALA A CB  
231  N N   . PHE A 32  ? 0.5878 0.7639 0.4945 -0.0206 -0.0075 0.0300  32  PHE A N   
232  C CA  . PHE A 32  ? 0.4569 0.5999 0.3514 -0.0217 -0.0151 0.0248  32  PHE A CA  
233  C C   . PHE A 32  ? 0.5136 0.6559 0.4219 -0.0245 -0.0233 0.0260  32  PHE A C   
234  O O   . PHE A 32  ? 0.6966 0.8493 0.6107 -0.0346 -0.0240 0.0276  32  PHE A O   
235  C CB  . PHE A 32  ? 0.3309 0.4636 0.2119 -0.0331 -0.0120 0.0247  32  PHE A CB  
236  C CG  . PHE A 32  ? 0.4085 0.5426 0.2750 -0.0309 -0.0023 0.0272  32  PHE A CG  
237  C CD1 . PHE A 32  ? 0.3747 0.5373 0.2501 -0.0395 0.0077  0.0333  32  PHE A CD1 
238  C CD2 . PHE A 32  ? 0.4926 0.6045 0.3373 -0.0200 -0.0032 0.0239  32  PHE A CD2 
239  C CE1 . PHE A 32  ? 0.4758 0.6451 0.3396 -0.0378 0.0188  0.0383  32  PHE A CE1 
240  C CE2 . PHE A 32  ? 0.5728 0.6892 0.4019 -0.0160 0.0073  0.0278  32  PHE A CE2 
241  C CZ  . PHE A 32  ? 0.5370 0.6823 0.3760 -0.0250 0.0194  0.0361  32  PHE A CZ  
242  N N   . LEU A 33  ? 0.5203 0.6495 0.4325 -0.0154 -0.0291 0.0251  33  LEU A N   
243  C CA  . LEU A 33  ? 0.4222 0.5546 0.3502 -0.0169 -0.0346 0.0303  33  LEU A CA  
244  C C   . LEU A 33  ? 0.5158 0.6282 0.4432 -0.0204 -0.0432 0.0272  33  LEU A C   
245  O O   . LEU A 33  ? 0.5809 0.6721 0.4977 -0.0168 -0.0479 0.0200  33  LEU A O   
246  C CB  . LEU A 33  ? 0.3810 0.5126 0.3171 -0.0052 -0.0342 0.0345  33  LEU A CB  
247  C CG  . LEU A 33  ? 0.3861 0.5454 0.3256 0.0022  -0.0258 0.0387  33  LEU A CG  
248  C CD1 . LEU A 33  ? 0.4355 0.5910 0.3818 0.0180  -0.0255 0.0445  33  LEU A CD1 
249  C CD2 . LEU A 33  ? 0.3468 0.5404 0.2961 -0.0087 -0.0235 0.0439  33  LEU A CD2 
250  N N   . GLY A 34  ? 0.4546 0.5778 0.3930 -0.0268 -0.0455 0.0323  34  GLY A N   
251  C CA  . GLY A 34  ? 0.3633 0.4775 0.3060 -0.0301 -0.0529 0.0314  34  GLY A CA  
252  C C   . GLY A 34  ? 0.4390 0.5454 0.3677 -0.0308 -0.0551 0.0247  34  GLY A C   
253  O O   . GLY A 34  ? 0.4478 0.5473 0.3784 -0.0308 -0.0628 0.0221  34  GLY A O   
254  N N   . ILE A 35  ? 0.4630 0.5711 0.3786 -0.0319 -0.0488 0.0226  35  ILE A N   
255  C CA  . ILE A 35  ? 0.4422 0.5393 0.3429 -0.0310 -0.0496 0.0188  35  ILE A CA  
256  C C   . ILE A 35  ? 0.5846 0.6927 0.4939 -0.0306 -0.0523 0.0211  35  ILE A C   
257  O O   . ILE A 35  ? 0.6032 0.7255 0.5177 -0.0334 -0.0484 0.0234  35  ILE A O   
258  C CB  . ILE A 35  ? 0.4498 0.5423 0.3361 -0.0354 -0.0415 0.0177  35  ILE A CB  
259  C CG1 . ILE A 35  ? 0.4446 0.5366 0.3254 -0.0358 -0.0360 0.0179  35  ILE A CG1 
260  C CG2 . ILE A 35  ? 0.3966 0.4697 0.2646 -0.0325 -0.0417 0.0155  35  ILE A CG2 
261  C CD1 . ILE A 35  ? 0.4773 0.5702 0.3497 -0.0450 -0.0276 0.0189  35  ILE A CD1 
262  N N   . PRO A 36  ? 0.6091 0.7147 0.5193 -0.0259 -0.0591 0.0201  36  PRO A N   
263  C CA  . PRO A 36  ? 0.5751 0.6969 0.4937 -0.0226 -0.0600 0.0231  36  PRO A CA  
264  C C   . PRO A 36  ? 0.6389 0.7489 0.5374 -0.0171 -0.0548 0.0192  36  PRO A C   
265  O O   . PRO A 36  ? 0.7141 0.8010 0.5929 -0.0141 -0.0541 0.0160  36  PRO A O   
266  C CB  . PRO A 36  ? 0.5917 0.7175 0.5176 -0.0189 -0.0697 0.0228  36  PRO A CB  
267  C CG  . PRO A 36  ? 0.5049 0.6080 0.4131 -0.0170 -0.0733 0.0166  36  PRO A CG  
268  C CD  . PRO A 36  ? 0.5555 0.6493 0.4601 -0.0224 -0.0670 0.0160  36  PRO A CD  
269  N N   . PHE A 37  ? 0.5880 0.7110 0.4888 -0.0151 -0.0509 0.0198  37  PHE A N   
270  C CA  . PHE A 37  ? 0.5202 0.6249 0.3990 -0.0097 -0.0466 0.0136  37  PHE A CA  
271  C C   . PHE A 37  ? 0.4912 0.6075 0.3699 0.0047  -0.0469 0.0137  37  PHE A C   
272  O O   . PHE A 37  ? 0.5676 0.6632 0.4253 0.0137  -0.0439 0.0078  37  PHE A O   
273  C CB  . PHE A 37  ? 0.6457 0.7490 0.5184 -0.0192 -0.0416 0.0092  37  PHE A CB  
274  C CG  . PHE A 37  ? 0.6727 0.8077 0.5592 -0.0193 -0.0405 0.0119  37  PHE A CG  
275  C CD1 . PHE A 37  ? 0.6159 0.7729 0.5214 -0.0261 -0.0411 0.0195  37  PHE A CD1 
276  C CD2 . PHE A 37  ? 0.6091 0.7506 0.4864 -0.0102 -0.0383 0.0073  37  PHE A CD2 
277  C CE1 . PHE A 37  ? 0.5791 0.7652 0.4949 -0.0249 -0.0394 0.0250  37  PHE A CE1 
278  C CE2 . PHE A 37  ? 0.5440 0.7178 0.4308 -0.0087 -0.0364 0.0110  37  PHE A CE2 
279  C CZ  . PHE A 37  ? 0.5611 0.7579 0.4675 -0.0165 -0.0369 0.0211  37  PHE A CZ  
280  N N   . ALA A 38  ? 0.4824 0.6309 0.3848 0.0070  -0.0502 0.0210  38  ALA A N   
281  C CA  . ALA A 38  ? 0.4472 0.6193 0.3557 0.0215  -0.0497 0.0237  38  ALA A CA  
282  C C   . ALA A 38  ? 0.4446 0.6445 0.3796 0.0203  -0.0571 0.0319  38  ALA A C   
283  O O   . ALA A 38  ? 0.5344 0.7371 0.4854 0.0063  -0.0617 0.0356  38  ALA A O   
284  C CB  . ALA A 38  ? 0.4906 0.6877 0.4041 0.0232  -0.0431 0.0256  38  ALA A CB  
285  N N   . GLU A 39  ? 0.3956 0.6167 0.3359 0.0350  -0.0587 0.0344  39  GLU A N   
286  C CA  . GLU A 39  ? 0.4620 0.7206 0.4335 0.0312  -0.0662 0.0428  39  GLU A CA  
287  C C   . GLU A 39  ? 0.5791 0.8696 0.5778 0.0185  -0.0619 0.0533  39  GLU A C   
288  O O   . GLU A 39  ? 0.6091 0.9108 0.6027 0.0243  -0.0522 0.0555  39  GLU A O   
289  C CB  . GLU A 39  ? 0.4675 0.7531 0.4420 0.0518  -0.0672 0.0449  39  GLU A CB  
290  C CG  . GLU A 39  ? 0.6768 0.9384 0.6303 0.0650  -0.0743 0.0391  39  GLU A CG  
291  C CD  . GLU A 39  ? 0.6695 0.9345 0.6360 0.0520  -0.0881 0.0389  39  GLU A CD  
292  O OE1 . GLU A 39  ? 0.6469 0.9547 0.6437 0.0480  -0.0964 0.0445  39  GLU A OE1 
293  O OE2 . GLU A 39  ? 0.5856 0.8122 0.5318 0.0454  -0.0906 0.0328  39  GLU A OE2 
294  N N   . PRO A 40  ? 0.5807 0.8838 0.6064 0.0013  -0.0695 0.0599  40  PRO A N   
295  C CA  . PRO A 40  ? 0.5547 0.8821 0.6063 -0.0125 -0.0651 0.0733  40  PRO A CA  
296  C C   . PRO A 40  ? 0.5558 0.9318 0.6229 -0.0027 -0.0565 0.0845  40  PRO A C   
297  O O   . PRO A 40  ? 0.5902 0.9994 0.6755 0.0023  -0.0604 0.0884  40  PRO A O   
298  C CB  . PRO A 40  ? 0.5991 0.9288 0.6766 -0.0309 -0.0773 0.0765  40  PRO A CB  
299  C CG  . PRO A 40  ? 0.5135 0.8106 0.5702 -0.0272 -0.0875 0.0616  40  PRO A CG  
300  C CD  . PRO A 40  ? 0.5187 0.8152 0.5514 -0.0051 -0.0831 0.0557  40  PRO A CD  
301  N N   . PRO A 41  ? 0.5430 0.9275 0.6024 0.0014  -0.0450 0.0897  41  PRO A N   
302  C CA  . PRO A 41  ? 0.5548 0.9845 0.6203 0.0157  -0.0344 0.0985  41  PRO A CA  
303  C C   . PRO A 41  ? 0.5264 1.0034 0.6327 0.0018  -0.0321 0.1200  41  PRO A C   
304  O O   . PRO A 41  ? 0.5670 1.0667 0.6790 0.0000  -0.0218 0.1337  41  PRO A O   
305  C CB  . PRO A 41  ? 0.5410 0.9577 0.5807 0.0215  -0.0252 0.0949  41  PRO A CB  
306  C CG  . PRO A 41  ? 0.5288 0.9164 0.5710 0.0022  -0.0297 0.0969  41  PRO A CG  
307  C CD  . PRO A 41  ? 0.4831 0.8407 0.5294 -0.0070 -0.0418 0.0888  41  PRO A CD  
308  N N   . VAL A 42  ? 0.4198 0.9128 0.5540 -0.0089 -0.0421 0.1237  42  VAL A N   
309  C CA  . VAL A 42  ? 0.3009 0.8337 0.4781 -0.0293 -0.0422 0.1442  42  VAL A CA  
310  C C   . VAL A 42  ? 0.2794 0.8737 0.4843 -0.0216 -0.0417 0.1523  42  VAL A C   
311  O O   . VAL A 42  ? 0.2832 0.8830 0.4733 0.0003  -0.0442 0.1403  42  VAL A O   
312  C CB  . VAL A 42  ? 0.3909 0.8901 0.5834 -0.0560 -0.0569 0.1420  42  VAL A CB  
313  C CG1 . VAL A 42  ? 0.3621 0.8024 0.5253 -0.0584 -0.0574 0.1322  42  VAL A CG1 
314  C CG2 . VAL A 42  ? 0.3201 0.8171 0.5160 -0.0554 -0.0727 0.1279  42  VAL A CG2 
315  N N   . GLY A 43  ? 0.2745 0.9166 0.5206 -0.0392 -0.0381 0.1742  43  GLY A N   
316  C CA  . GLY A 43  ? 0.3105 0.9989 0.5756 -0.0328 -0.0347 0.1809  43  GLY A CA  
317  C C   . GLY A 43  ? 0.4411 1.1598 0.6840 0.0018  -0.0195 0.1800  43  GLY A C   
318  O O   . GLY A 43  ? 0.4966 1.2194 0.7233 0.0113  -0.0057 0.1865  43  GLY A O   
319  N N   . SER A 44  ? 0.4305 1.1679 0.6695 0.0226  -0.0226 0.1707  44  SER A N   
320  C CA  . SER A 44  ? 0.4135 1.1768 0.6297 0.0593  -0.0092 0.1676  44  SER A CA  
321  C C   . SER A 44  ? 0.3721 1.1010 0.5482 0.0829  -0.0066 0.1512  44  SER A C   
322  O O   . SER A 44  ? 0.4525 1.1929 0.6037 0.1157  0.0038  0.1447  44  SER A O   
323  C CB  . SER A 44  ? 0.4577 1.2443 0.6791 0.0769  -0.0149 0.1617  44  SER A CB  
324  O OG  . SER A 44  ? 0.5284 1.2759 0.7326 0.0844  -0.0298 0.1436  44  SER A OG  
325  N N   . ARG A 45  ? 0.2929 0.9630 0.4533 0.0650  -0.0153 0.1417  45  ARG A N   
326  C CA  . ARG A 45  ? 0.3686 0.9800 0.4802 0.0781  -0.0118 0.1238  45  ARG A CA  
327  C C   . ARG A 45  ? 0.3860 0.9921 0.4876 0.0698  -0.0015 0.1303  45  ARG A C   
328  O O   . ARG A 45  ? 0.3076 0.8755 0.3708 0.0802  0.0017  0.1159  45  ARG A O   
329  C CB  . ARG A 45  ? 0.3069 0.8544 0.4000 0.0675  -0.0260 0.1077  45  ARG A CB  
330  C CG  . ARG A 45  ? 0.3293 0.8662 0.4094 0.0874  -0.0336 0.0962  45  ARG A CG  
331  C CD  . ARG A 45  ? 0.6692 1.1346 0.7152 0.0835  -0.0415 0.0794  45  ARG A CD  
332  N NE  . ARG A 45  ? 0.7101 1.1655 0.7653 0.0753  -0.0564 0.0767  45  ARG A NE  
333  C CZ  . ARG A 45  ? 0.7934 1.2264 0.8263 0.0938  -0.0620 0.0677  45  ARG A CZ  
334  N NH1 . ARG A 45  ? 0.7354 1.1477 0.7360 0.1207  -0.0536 0.0603  45  ARG A NH1 
335  N NH2 . ARG A 45  ? 0.9218 1.3502 0.9618 0.0863  -0.0762 0.0658  45  ARG A NH2 
336  N N   . ARG A 46  ? 0.5253 0.8268 0.4743 0.0170  -0.0449 0.0572  46  ARG A N   
337  C CA  . ARG A 46  ? 0.4554 0.7303 0.4069 0.0056  -0.0353 0.0573  46  ARG A CA  
338  C C   . ARG A 46  ? 0.4611 0.7140 0.4016 0.0113  -0.0210 0.0727  46  ARG A C   
339  O O   . ARG A 46  ? 0.4858 0.7508 0.4335 0.0211  -0.0188 0.0807  46  ARG A O   
340  C CB  . ARG A 46  ? 0.3639 0.6517 0.3491 -0.0059 -0.0391 0.0479  46  ARG A CB  
341  C CG  . ARG A 46  ? 0.3989 0.6611 0.3874 -0.0183 -0.0314 0.0457  46  ARG A CG  
342  C CD  . ARG A 46  ? 0.4041 0.6794 0.4261 -0.0291 -0.0348 0.0380  46  ARG A CD  
343  N NE  . ARG A 46  ? 0.4232 0.7051 0.4524 -0.0384 -0.0461 0.0221  46  ARG A NE  
344  C CZ  . ARG A 46  ? 0.4221 0.7139 0.4777 -0.0496 -0.0512 0.0130  46  ARG A CZ  
345  N NH1 . ARG A 46  ? 0.4176 0.7165 0.4965 -0.0532 -0.0457 0.0186  46  ARG A NH1 
346  N NH2 . ARG A 46  ? 0.3643 0.6582 0.4223 -0.0574 -0.0615 -0.0017 46  ARG A NH2 
347  N N   . PHE A 47  ? 0.3408 0.5621 0.2628 0.0058  -0.0117 0.0767  47  PHE A N   
348  C CA  . PHE A 47  ? 0.4297 0.6241 0.3352 0.0098  0.0019  0.0907  47  PHE A CA  
349  C C   . PHE A 47  ? 0.5388 0.7257 0.4158 0.0235  0.0048  0.1020  47  PHE A C   
350  O O   . PHE A 47  ? 0.6071 0.7683 0.4659 0.0270  0.0158  0.1133  47  PHE A O   
351  C CB  . PHE A 47  ? 0.4496 0.6465 0.3782 0.0097  0.0091  0.0954  47  PHE A CB  
352  C CG  . PHE A 47  ? 0.4050 0.6120 0.3639 -0.0032 0.0058  0.0851  47  PHE A CG  
353  C CD1 . PHE A 47  ? 0.4731 0.6597 0.4291 -0.0155 0.0082  0.0797  47  PHE A CD1 
354  C CD2 . PHE A 47  ? 0.4007 0.6376 0.3905 -0.0031 0.0003  0.0811  47  PHE A CD2 
355  C CE1 . PHE A 47  ? 0.4366 0.6295 0.4186 -0.0272 0.0054  0.0706  47  PHE A CE1 
356  C CE2 . PHE A 47  ? 0.3660 0.6101 0.3825 -0.0163 -0.0025 0.0718  47  PHE A CE2 
357  C CZ  . PHE A 47  ? 0.3411 0.5615 0.3526 -0.0282 0.0001  0.0666  47  PHE A CZ  
358  N N   . MET A 48  ? 0.5188 0.7263 0.3902 0.0312  -0.0050 0.0990  48  MET A N   
359  C CA  . MET A 48  ? 0.5292 0.7292 0.3723 0.0444  -0.0028 0.1099  48  MET A CA  
360  C C   . MET A 48  ? 0.5958 0.7655 0.4159 0.0387  -0.0011 0.1061  48  MET A C   
361  O O   . MET A 48  ? 0.5451 0.7170 0.3664 0.0290  -0.0052 0.0973  48  MET A O   
362  C CB  . MET A 48  ? 0.6081 0.8417 0.4599 0.0561  -0.0139 0.1075  48  MET A CB  
363  C CG  . MET A 48  ? 0.6987 0.9566 0.5814 0.0613  -0.0150 0.1082  48  MET A CG  
364  S SD  . MET A 48  ? 0.8607 1.0982 0.7334 0.0739  -0.0001 0.1255  48  MET A SD  
365  C CE  . MET A 48  ? 0.6393 0.8735 0.4773 0.0920  -0.0025 0.1354  48  MET A CE  
366  N N   . PRO A 49  ? 0.6617 0.7991 0.4658 0.0431  0.0048  0.1098  49  PRO A N   
367  C CA  . PRO A 49  ? 0.5783 0.6869 0.3652 0.0368  0.0047  0.1044  49  PRO A CA  
368  C C   . PRO A 49  ? 0.6054 0.7393 0.3929 0.0392  -0.0053 0.0978  49  PRO A C   
369  O O   . PRO A 49  ? 0.5580 0.7247 0.3534 0.0490  -0.0124 0.0986  49  PRO A O   
370  C CB  . PRO A 49  ? 0.5519 0.6377 0.3244 0.0433  0.0089  0.1107  49  PRO A CB  
371  C CG  . PRO A 49  ? 0.6388 0.7260 0.4195 0.0499  0.0151  0.1184  49  PRO A CG  
372  C CD  . PRO A 49  ? 0.6189 0.7465 0.4203 0.0533  0.0114  0.1193  49  PRO A CD  
373  N N   . PRO A 50  ? 0.6229 0.7419 0.4025 0.0308  -0.0062 0.0909  50  PRO A N   
374  C CA  . PRO A 50  ? 0.6995 0.8401 0.4792 0.0331  -0.0150 0.0840  50  PRO A CA  
375  C C   . PRO A 50  ? 0.7626 0.9018 0.5305 0.0423  -0.0170 0.0881  50  PRO A C   
376  O O   . PRO A 50  ? 0.7457 0.8556 0.4996 0.0419  -0.0109 0.0940  50  PRO A O   
377  C CB  . PRO A 50  ? 0.6209 0.7393 0.3932 0.0228  -0.0124 0.0782  50  PRO A CB  
378  C CG  . PRO A 50  ? 0.6376 0.7164 0.3984 0.0173  -0.0032 0.0832  50  PRO A CG  
379  C CD  . PRO A 50  ? 0.6214 0.7019 0.3903 0.0199  0.0007  0.0892  50  PRO A CD  
380  N N   . GLU A 51  ? 0.7750 0.9457 0.5487 0.0497  -0.0263 0.0841  51  GLU A N   
381  C CA  . GLU A 51  ? 0.7779 0.9483 0.5396 0.0575  -0.0292 0.0862  51  GLU A CA  
382  C C   . GLU A 51  ? 0.6864 0.8548 0.4415 0.0520  -0.0327 0.0784  51  GLU A C   
383  O O   . GLU A 51  ? 0.6629 0.8493 0.4282 0.0482  -0.0381 0.0693  51  GLU A O   
384  C CB  . GLU A 51  ? 0.9613 1.1672 0.7333 0.0703  -0.0374 0.0870  51  GLU A CB  
385  C CG  . GLU A 51  ? 1.1243 1.3349 0.9030 0.0787  -0.0335 0.0964  51  GLU A CG  
386  C CD  . GLU A 51  ? 1.2426 1.4856 1.0288 0.0933  -0.0414 0.0987  51  GLU A CD  
387  O OE1 . GLU A 51  ? 1.2000 1.4582 0.9843 0.0961  -0.0497 0.0927  51  GLU A OE1 
388  O OE2 . GLU A 51  ? 1.2649 1.5180 1.0592 0.1021  -0.0390 0.1065  51  GLU A OE2 
389  N N   . PRO A 52  ? 0.7121 0.8575 0.4495 0.0512  -0.0296 0.0818  52  PRO A N   
390  C CA  . PRO A 52  ? 0.7269 0.8682 0.4553 0.0471  -0.0316 0.0766  52  PRO A CA  
391  C C   . PRO A 52  ? 0.7138 0.8888 0.4509 0.0528  -0.0415 0.0683  52  PRO A C   
392  O O   . PRO A 52  ? 0.6159 0.8133 0.3581 0.0625  -0.0477 0.0690  52  PRO A O   
393  C CB  . PRO A 52  ? 0.7493 0.8703 0.4587 0.0494  -0.0288 0.0841  52  PRO A CB  
394  C CG  . PRO A 52  ? 0.8233 0.9229 0.5293 0.0482  -0.0222 0.0918  52  PRO A CG  
395  C CD  . PRO A 52  ? 0.7462 0.8687 0.4706 0.0543  -0.0240 0.0915  52  PRO A CD  
396  N N   . LYS A 53  ? 0.7070 0.8845 0.4452 0.0469  -0.0432 0.0601  53  LYS A N   
397  C CA  . LYS A 53  ? 0.6645 0.8689 0.4089 0.0505  -0.0525 0.0504  53  LYS A CA  
398  C C   . LYS A 53  ? 0.7059 0.9178 0.4398 0.0591  -0.0570 0.0526  53  LYS A C   
399  O O   . LYS A 53  ? 0.8511 1.0432 0.5688 0.0588  -0.0522 0.0590  53  LYS A O   
400  C CB  . LYS A 53  ? 0.5949 0.7947 0.3386 0.0433  -0.0515 0.0425  53  LYS A CB  
401  C CG  . LYS A 53  ? 0.6986 0.9221 0.4469 0.0463  -0.0608 0.0313  53  LYS A CG  
402  C CD  . LYS A 53  ? 0.6574 0.9053 0.4234 0.0471  -0.0692 0.0231  53  LYS A CD  
403  C CE  . LYS A 53  ? 0.6430 0.9085 0.4123 0.0479  -0.0786 0.0099  53  LYS A CE  
404  N NZ  . LYS A 53  ? 0.6014 0.8899 0.3882 0.0477  -0.0886 0.0014  53  LYS A NZ  
405  N N   . ARG A 54  ? 0.6464 0.8867 0.3896 0.0661  -0.0666 0.0472  54  ARG A N   
406  C CA  . ARG A 54  ? 0.6873 0.9379 0.4216 0.0747  -0.0722 0.0480  54  ARG A CA  
407  C C   . ARG A 54  ? 0.7405 0.9933 0.4678 0.0721  -0.0754 0.0398  54  ARG A C   
408  O O   . ARG A 54  ? 0.7569 1.0198 0.4938 0.0676  -0.0793 0.0293  54  ARG A O   
409  C CB  . ARG A 54  ? 0.6730 0.9540 0.4211 0.0827  -0.0822 0.0449  54  ARG A CB  
410  C CG  . ARG A 54  ? 0.8024 1.0842 0.5548 0.0892  -0.0792 0.0550  54  ARG A CG  
411  C CD  . ARG A 54  ? 0.9632 1.2759 0.7261 0.0994  -0.0894 0.0536  54  ARG A CD  
412  N NE  . ARG A 54  ? 1.1232 1.4524 0.9050 0.1007  -0.0909 0.0550  54  ARG A NE  
413  C CZ  . ARG A 54  ? 1.2539 1.6049 1.0558 0.0948  -0.0986 0.0449  54  ARG A CZ  
414  N NH1 . ARG A 54  ? 1.2148 1.5713 1.0189 0.0879  -0.1053 0.0321  54  ARG A NH1 
415  N NH2 . ARG A 54  ? 1.2975 1.6640 1.1174 0.0956  -0.0996 0.0476  54  ARG A NH2 
416  N N   . PRO A 55  ? 0.6751 0.9179 0.3851 0.0752  -0.0736 0.0446  55  PRO A N   
417  C CA  . PRO A 55  ? 0.6570 0.9010 0.3577 0.0738  -0.0755 0.0385  55  PRO A CA  
418  C C   . PRO A 55  ? 0.6306 0.8995 0.3416 0.0756  -0.0856 0.0255  55  PRO A C   
419  O O   . PRO A 55  ? 0.6364 0.9253 0.3576 0.0808  -0.0939 0.0224  55  PRO A O   
420  C CB  . PRO A 55  ? 0.5434 0.7831 0.2270 0.0807  -0.0758 0.0460  55  PRO A CB  
421  C CG  . PRO A 55  ? 0.6750 0.8957 0.3538 0.0808  -0.0689 0.0577  55  PRO A CG  
422  C CD  . PRO A 55  ? 0.5232 0.7520 0.2203 0.0803  -0.0694 0.0566  55  PRO A CD  
423  N N   . TRP A 56  ? 0.6299 0.8970 0.3384 0.0711  -0.0853 0.0178  56  TRP A N   
424  C CA  . TRP A 56  ? 0.7450 1.0314 0.4599 0.0723  -0.0950 0.0045  56  TRP A CA  
425  C C   . TRP A 56  ? 0.8060 1.0957 0.5056 0.0767  -0.0979 0.0021  56  TRP A C   
426  O O   . TRP A 56  ? 0.7787 1.0545 0.4630 0.0772  -0.0913 0.0101  56  TRP A O   
427  C CB  . TRP A 56  ? 0.7449 1.0284 0.4693 0.0647  -0.0934 -0.0043 56  TRP A CB  
428  C CG  . TRP A 56  ? 0.7589 1.0244 0.4738 0.0602  -0.0837 -0.0012 56  TRP A CG  
429  C CD1 . TRP A 56  ? 0.7150 0.9800 0.4203 0.0606  -0.0831 -0.0062 56  TRP A CD1 
430  C CD2 . TRP A 56  ? 0.6886 0.9346 0.4031 0.0546  -0.0734 0.0076  56  TRP A CD2 
431  N NE1 . TRP A 56  ? 0.6679 0.9165 0.3681 0.0557  -0.0732 -0.0008 56  TRP A NE1 
432  C CE2 . TRP A 56  ? 0.6610 0.8969 0.3667 0.0515  -0.0674 0.0074  56  TRP A CE2 
433  C CE3 . TRP A 56  ? 0.7359 0.9719 0.4563 0.0519  -0.0688 0.0154  56  TRP A CE3 
434  C CZ2 . TRP A 56  ? 0.6182 0.8348 0.3218 0.0453  -0.0577 0.0144  56  TRP A CZ2 
435  C CZ3 . TRP A 56  ? 0.7370 0.9514 0.4537 0.0455  -0.0590 0.0222  56  TRP A CZ3 
436  C CH2 . TRP A 56  ? 0.6187 0.8237 0.3274 0.0421  -0.0539 0.0215  56  TRP A CH2 
437  N N   . SER A 57  ? 0.8209 1.1280 0.5238 0.0791  -0.1081 -0.0091 57  SER A N   
438  C CA  . SER A 57  ? 0.8298 1.1404 0.5179 0.0830  -0.1113 -0.0129 57  SER A CA  
439  C C   . SER A 57  ? 0.7749 1.0822 0.4621 0.0785  -0.1099 -0.0229 57  SER A C   
440  O O   . SER A 57  ? 0.7717 1.0794 0.4718 0.0733  -0.1108 -0.0301 57  SER A O   
441  C CB  . SER A 57  ? 0.8628 1.1935 0.5517 0.0894  -0.1238 -0.0183 57  SER A CB  
442  O OG  . SER A 57  ? 0.8487 1.1930 0.5556 0.0865  -0.1324 -0.0280 57  SER A OG  
443  N N   . GLY A 58  ? 0.7542 1.0581 0.4255 0.0808  -0.1075 -0.0231 58  GLY A N   
444  C CA  . GLY A 58  ? 0.5926 0.8940 0.2610 0.0783  -0.1054 -0.0317 58  GLY A CA  
445  C C   . GLY A 58  ? 0.7395 1.0262 0.4108 0.0723  -0.0942 -0.0271 58  GLY A C   
446  O O   . GLY A 58  ? 0.5638 0.8390 0.2367 0.0693  -0.0869 -0.0161 58  GLY A O   
447  N N   . VAL A 59  ? 0.6293 0.9160 0.3008 0.0707  -0.0929 -0.0358 59  VAL A N   
448  C CA  . VAL A 59  ? 0.5968 0.8722 0.2712 0.0658  -0.0829 -0.0323 59  VAL A CA  
449  C C   . VAL A 59  ? 0.6866 0.9616 0.3772 0.0613  -0.0846 -0.0389 59  VAL A C   
450  O O   . VAL A 59  ? 0.7569 1.0383 0.4508 0.0619  -0.0907 -0.0513 59  VAL A O   
451  C CB  . VAL A 59  ? 0.6082 0.8850 0.2720 0.0679  -0.0795 -0.0370 59  VAL A CB  
452  C CG1 . VAL A 59  ? 0.5584 0.8254 0.2257 0.0631  -0.0688 -0.0319 59  VAL A CG1 
453  C CG2 . VAL A 59  ? 0.5960 0.8755 0.2425 0.0729  -0.0795 -0.0324 59  VAL A CG2 
454  N N   . LEU A 60  ? 0.5644 0.8306 0.2639 0.0566  -0.0795 -0.0307 60  LEU A N   
455  C CA  . LEU A 60  ? 0.6768 0.9404 0.3911 0.0516  -0.0793 -0.0349 60  LEU A CA  
456  C C   . LEU A 60  ? 0.6561 0.9153 0.3707 0.0495  -0.0741 -0.0398 60  LEU A C   
457  O O   . LEU A 60  ? 0.6585 0.9105 0.3672 0.0485  -0.0656 -0.0328 60  LEU A O   
458  C CB  . LEU A 60  ? 0.6102 0.8632 0.3305 0.0474  -0.0733 -0.0233 60  LEU A CB  
459  C CG  . LEU A 60  ? 0.6420 0.8930 0.3776 0.0422  -0.0735 -0.0261 60  LEU A CG  
460  C CD1 . LEU A 60  ? 0.5950 0.8482 0.3374 0.0422  -0.0760 -0.0202 60  LEU A CD1 
461  C CD2 . LEU A 60  ? 0.6804 0.9174 0.4175 0.0370  -0.0635 -0.0205 60  LEU A CD2 
462  N N   . ASP A 61  ? 0.5627 0.8262 0.2841 0.0489  -0.0796 -0.0520 61  ASP A N   
463  C CA  . ASP A 61  ? 0.5534 0.8125 0.2761 0.0476  -0.0747 -0.0565 61  ASP A CA  
464  C C   . ASP A 61  ? 0.6365 0.8856 0.3694 0.0415  -0.0676 -0.0490 61  ASP A C   
465  O O   . ASP A 61  ? 0.6654 0.9131 0.4088 0.0379  -0.0706 -0.0491 61  ASP A O   
466  C CB  . ASP A 61  ? 0.6376 0.9007 0.3628 0.0488  -0.0827 -0.0722 61  ASP A CB  
467  C CG  . ASP A 61  ? 0.8121 1.0714 0.5355 0.0497  -0.0775 -0.0772 61  ASP A CG  
468  O OD1 . ASP A 61  ? 0.8361 1.0887 0.5686 0.0455  -0.0729 -0.0751 61  ASP A OD1 
469  O OD2 . ASP A 61  ? 0.8423 1.1058 0.5548 0.0553  -0.0777 -0.0829 61  ASP A OD2 
470  N N   . ALA A 62  ? 0.6136 0.8568 0.3436 0.0403  -0.0585 -0.0423 62  ALA A N   
471  C CA  . ALA A 62  ? 0.5184 0.7513 0.2562 0.0345  -0.0513 -0.0345 62  ALA A CA  
472  C C   . ALA A 62  ? 0.5650 0.7981 0.3045 0.0345  -0.0467 -0.0385 62  ALA A C   
473  O O   . ALA A 62  ? 0.5038 0.7319 0.2431 0.0319  -0.0388 -0.0303 62  ALA A O   
474  C CB  . ALA A 62  ? 0.4445 0.6684 0.1770 0.0320  -0.0445 -0.0208 62  ALA A CB  
475  N N   . THR A 63  ? 0.5742 0.8128 0.3149 0.0377  -0.0521 -0.0513 63  THR A N   
476  C CA  . THR A 63  ? 0.5858 0.8256 0.3266 0.0397  -0.0485 -0.0565 63  THR A CA  
477  C C   . THR A 63  ? 0.6966 0.9302 0.4479 0.0359  -0.0492 -0.0610 63  THR A C   
478  O O   . THR A 63  ? 0.6879 0.9209 0.4409 0.0369  -0.0450 -0.0629 63  THR A O   
479  C CB  . THR A 63  ? 0.6807 0.9287 0.4121 0.0472  -0.0532 -0.0685 63  THR A CB  
480  O OG1 . THR A 63  ? 0.7037 0.9512 0.4368 0.0475  -0.0631 -0.0802 63  THR A OG1 
481  C CG2 . THR A 63  ? 0.6851 0.9396 0.4049 0.0511  -0.0523 -0.0639 63  THR A CG2 
482  N N   . THR A 64  ? 0.7403 0.9702 0.4987 0.0318  -0.0546 -0.0626 64  THR A N   
483  C CA  . THR A 64  ? 0.6331 0.8565 0.4009 0.0276  -0.0556 -0.0671 64  THR A CA  
484  C C   . THR A 64  ? 0.6487 0.8657 0.4250 0.0208  -0.0528 -0.0569 64  THR A C   
485  O O   . THR A 64  ? 0.6074 0.8249 0.3826 0.0198  -0.0525 -0.0488 64  THR A O   
486  C CB  . THR A 64  ? 0.6532 0.8772 0.4228 0.0282  -0.0659 -0.0824 64  THR A CB  
487  O OG1 . THR A 64  ? 0.6964 0.9242 0.4703 0.0255  -0.0726 -0.0821 64  THR A OG1 
488  C CG2 . THR A 64  ? 0.6123 0.8408 0.3712 0.0355  -0.0692 -0.0931 64  THR A CG2 
489  N N   . PHE A 65  ? 0.6761 0.8862 0.4596 0.0165  -0.0505 -0.0573 65  PHE A N   
490  C CA  . PHE A 65  ? 0.5653 0.7688 0.3564 0.0100  -0.0480 -0.0488 65  PHE A CA  
491  C C   . PHE A 65  ? 0.5738 0.7816 0.3709 0.0079  -0.0564 -0.0543 65  PHE A C   
492  O O   . PHE A 65  ? 0.5894 0.8012 0.3882 0.0090  -0.0646 -0.0674 65  PHE A O   
493  C CB  . PHE A 65  ? 0.5612 0.7569 0.3578 0.0060  -0.0437 -0.0483 65  PHE A CB  
494  C CG  . PHE A 65  ? 0.5409 0.7325 0.3352 0.0058  -0.0346 -0.0384 65  PHE A CG  
495  C CD1 . PHE A 65  ? 0.4449 0.6301 0.2388 0.0025  -0.0288 -0.0251 65  PHE A CD1 
496  C CD2 . PHE A 65  ? 0.4669 0.6606 0.2597 0.0090  -0.0322 -0.0429 65  PHE A CD2 
497  C CE1 . PHE A 65  ? 0.4492 0.6301 0.2424 0.0011  -0.0215 -0.0169 65  PHE A CE1 
498  C CE2 . PHE A 65  ? 0.4931 0.6858 0.2857 0.0083  -0.0245 -0.0339 65  PHE A CE2 
499  C CZ  . PHE A 65  ? 0.5042 0.6905 0.2975 0.0037  -0.0195 -0.0211 65  PHE A CZ  
500  N N   . GLN A 66  ? 0.5363 0.7430 0.3367 0.0048  -0.0546 -0.0446 66  GLN A N   
501  C CA  . GLN A 66  ? 0.5623 0.7762 0.3704 0.0026  -0.0622 -0.0481 66  GLN A CA  
502  C C   . GLN A 66  ? 0.6183 0.8287 0.4374 -0.0048 -0.0627 -0.0499 66  GLN A C   
503  O O   . GLN A 66  ? 0.5525 0.7532 0.3721 -0.0080 -0.0568 -0.0478 66  GLN A O   
504  C CB  . GLN A 66  ? 0.6035 0.8200 0.4088 0.0044  -0.0603 -0.0368 66  GLN A CB  
505  C CG  . GLN A 66  ? 0.7766 1.0029 0.5751 0.0107  -0.0660 -0.0401 66  GLN A CG  
506  C CD  . GLN A 66  ? 0.8072 1.0470 0.6140 0.0106  -0.0777 -0.0508 66  GLN A CD  
507  O OE1 . GLN A 66  ? 0.7390 0.9816 0.5580 0.0052  -0.0814 -0.0544 66  GLN A OE1 
508  N NE2 . GLN A 66  ? 0.8014 1.0497 0.6022 0.0157  -0.0838 -0.0560 66  GLN A NE2 
509  N N   . ASN A 67  ? 0.6176 0.8371 0.4462 -0.0077 -0.0700 -0.0536 67  ASN A N   
510  C CA  . ASN A 67  ? 0.5030 0.7221 0.3442 -0.0161 -0.0718 -0.0560 67  ASN A CA  
511  C C   . ASN A 67  ? 0.5268 0.7352 0.3664 -0.0204 -0.0614 -0.0431 67  ASN A C   
512  O O   . ASN A 67  ? 0.4916 0.6946 0.3236 -0.0174 -0.0540 -0.0300 67  ASN A O   
513  C CB  . ASN A 67  ? 0.4420 0.6762 0.2950 -0.0183 -0.0800 -0.0580 67  ASN A CB  
514  C CG  . ASN A 67  ? 0.5399 0.7831 0.3978 -0.0168 -0.0916 -0.0724 67  ASN A CG  
515  O OD1 . ASN A 67  ? 0.5486 0.7844 0.4049 -0.0175 -0.0948 -0.0842 67  ASN A OD1 
516  N ND2 . ASN A 67  ? 0.6245 0.8828 0.4875 -0.0145 -0.0979 -0.0712 67  ASN A ND2 
517  N N   . VAL A 68  ? 0.5549 0.7576 0.4017 -0.0281 -0.0612 -0.0474 68  VAL A N   
518  C CA  . VAL A 68  ? 0.4409 0.6325 0.2864 -0.0340 -0.0520 -0.0357 68  VAL A CA  
519  C C   . VAL A 68  ? 0.4646 0.6538 0.3261 -0.0385 -0.0509 -0.0289 68  VAL A C   
520  O O   . VAL A 68  ? 0.5234 0.7169 0.4029 -0.0417 -0.0576 -0.0371 68  VAL A O   
521  C CB  . VAL A 68  ? 0.5161 0.6924 0.3670 -0.0384 -0.0493 -0.0414 68  VAL A CB  
522  C CG1 . VAL A 68  ? 0.5393 0.6977 0.3945 -0.0446 -0.0392 -0.0288 68  VAL A CG1 
523  C CG2 . VAL A 68  ? 0.5059 0.6822 0.3438 -0.0315 -0.0478 -0.0450 68  VAL A CG2 
524  N N   . CYS A 69  ? 0.4559 0.6384 0.3101 -0.0386 -0.0425 -0.0138 69  CYS A N   
525  C CA  . CYS A 69  ? 0.4840 0.6636 0.3511 -0.0409 -0.0398 -0.0057 69  CYS A CA  
526  C C   . CYS A 69  ? 0.5225 0.6906 0.4120 -0.0491 -0.0388 -0.0101 69  CYS A C   
527  O O   . CYS A 69  ? 0.4352 0.5880 0.3248 -0.0536 -0.0347 -0.0117 69  CYS A O   
528  C CB  . CYS A 69  ? 0.4724 0.6404 0.3243 -0.0400 -0.0295 0.0109  69  CYS A CB  
529  S SG  . CYS A 69  ? 0.6702 0.8460 0.5039 -0.0295 -0.0301 0.0172  69  CYS A SG  
530  N N   . TYR A 70  ? 0.3903 0.5671 0.2988 -0.0509 -0.0427 -0.0119 70  TYR A N   
531  C CA  . TYR A 70  ? 0.4460 0.6145 0.3768 -0.0594 -0.0429 -0.0173 70  TYR A CA  
532  C C   . TYR A 70  ? 0.5630 0.7079 0.4938 -0.0646 -0.0314 -0.0076 70  TYR A C   
533  O O   . TYR A 70  ? 0.5336 0.6721 0.4570 -0.0628 -0.0233 0.0057  70  TYR A O   
534  C CB  . TYR A 70  ? 0.4282 0.6127 0.3799 -0.0609 -0.0477 -0.0181 70  TYR A CB  
535  C CG  . TYR A 70  ? 0.4704 0.6580 0.4419 -0.0687 -0.0559 -0.0321 70  TYR A CG  
536  C CD1 . TYR A 70  ? 0.4873 0.6565 0.4718 -0.0780 -0.0513 -0.0334 70  TYR A CD1 
537  C CD2 . TYR A 70  ? 0.4327 0.6400 0.4082 -0.0674 -0.0685 -0.0442 70  TYR A CD2 
538  C CE1 . TYR A 70  ? 0.4953 0.6643 0.4963 -0.0862 -0.0587 -0.0461 70  TYR A CE1 
539  C CE2 . TYR A 70  ? 0.5435 0.7512 0.5353 -0.0759 -0.0764 -0.0576 70  TYR A CE2 
540  C CZ  . TYR A 70  ? 0.6351 0.8230 0.6396 -0.0855 -0.0713 -0.0584 70  TYR A CZ  
541  O OH  . TYR A 70  ? 0.7898 0.9754 0.8091 -0.0949 -0.0791 -0.0714 70  TYR A OH  
542  N N   . GLN A 71  ? 0.5095 0.6402 0.4465 -0.0707 -0.0310 -0.0143 71  GLN A N   
543  C CA  . GLN A 71  ? 0.4700 0.5782 0.4032 -0.0749 -0.0210 -0.0059 71  GLN A CA  
544  C C   . GLN A 71  ? 0.5670 0.6597 0.5130 -0.0822 -0.0210 -0.0132 71  GLN A C   
545  O O   . GLN A 71  ? 0.4524 0.5488 0.4061 -0.0838 -0.0292 -0.0265 71  GLN A O   
546  C CB  . GLN A 71  ? 0.4511 0.5543 0.3607 -0.0705 -0.0170 -0.0008 71  GLN A CB  
547  C CG  . GLN A 71  ? 0.4615 0.5672 0.3643 -0.0682 -0.0225 -0.0123 71  GLN A CG  
548  C CD  . GLN A 71  ? 0.5206 0.6291 0.4012 -0.0633 -0.0193 -0.0068 71  GLN A CD  
549  O OE1 . GLN A 71  ? 0.5918 0.6902 0.4655 -0.0643 -0.0153 -0.0055 71  GLN A OE1 
550  N NE2 . GLN A 71  ? 0.4754 0.5983 0.3445 -0.0580 -0.0209 -0.0028 71  GLN A NE2 
551  N N   . TYR A 72  ? 0.6910 0.7646 0.6375 -0.0866 -0.0118 -0.0041 72  TYR A N   
552  C CA  . TYR A 72  ? 0.6270 0.6819 0.5823 -0.0931 -0.0100 -0.0081 72  TYR A CA  
553  C C   . TYR A 72  ? 0.6028 0.6519 0.5458 -0.0899 -0.0129 -0.0156 72  TYR A C   
554  O O   . TYR A 72  ? 0.6237 0.6750 0.5493 -0.0848 -0.0104 -0.0108 72  TYR A O   
555  C CB  . TYR A 72  ? 0.6641 0.7006 0.6182 -0.0970 0.0010  0.0050  72  TYR A CB  
556  C CG  . TYR A 72  ? 0.6197 0.6350 0.5794 -0.1029 0.0038  0.0026  72  TYR A CG  
557  C CD1 . TYR A 72  ? 0.5966 0.6066 0.5759 -0.1101 0.0025  -0.0024 72  TYR A CD1 
558  C CD2 . TYR A 72  ? 0.6168 0.6178 0.5622 -0.1015 0.0074  0.0056  72  TYR A CD2 
559  C CE1 . TYR A 72  ? 0.6576 0.6461 0.6405 -0.1154 0.0050  -0.0042 72  TYR A CE1 
560  C CE2 . TYR A 72  ? 0.6931 0.6741 0.6426 -0.1058 0.0097  0.0038  72  TYR A CE2 
561  C CZ  . TYR A 72  ? 0.7162 0.6897 0.6837 -0.1126 0.0086  -0.0010 72  TYR A CZ  
562  O OH  . TYR A 72  ? 0.7972 0.7490 0.7675 -0.1168 0.0110  -0.0024 72  TYR A OH  
563  N N   . VAL A 73  ? 0.6173 0.6589 0.5690 -0.0929 -0.0180 -0.0273 73  VAL A N   
564  C CA  . VAL A 73  ? 0.6865 0.7211 0.6269 -0.0884 -0.0203 -0.0349 73  VAL A CA  
565  C C   . VAL A 73  ? 0.6694 0.6793 0.6114 -0.0922 -0.0151 -0.0329 73  VAL A C   
566  O O   . VAL A 73  ? 0.6521 0.6490 0.6082 -0.0994 -0.0147 -0.0350 73  VAL A O   
567  C CB  . VAL A 73  ? 0.6466 0.6900 0.5889 -0.0859 -0.0310 -0.0512 73  VAL A CB  
568  C CG1 . VAL A 73  ? 0.5725 0.6086 0.5016 -0.0794 -0.0326 -0.0587 73  VAL A CG1 
569  C CG2 . VAL A 73  ? 0.6158 0.6840 0.5538 -0.0811 -0.0362 -0.0522 73  VAL A CG2 
570  N N   . ASP A 74  ? 0.7333 0.7382 0.6610 -0.0874 -0.0112 -0.0285 74  ASP A N   
571  C CA  . ASP A 74  ? 0.7213 0.7045 0.6479 -0.0896 -0.0058 -0.0245 74  ASP A CA  
572  C C   . ASP A 74  ? 0.7609 0.7284 0.6929 -0.0898 -0.0101 -0.0363 74  ASP A C   
573  O O   . ASP A 74  ? 0.7186 0.6914 0.6453 -0.0837 -0.0165 -0.0479 74  ASP A O   
574  C CB  . ASP A 74  ? 0.8091 0.7949 0.7191 -0.0840 -0.0017 -0.0173 74  ASP A CB  
575  C CG  . ASP A 74  ? 1.0036 0.9688 0.9121 -0.0866 0.0043  -0.0103 74  ASP A CG  
576  O OD1 . ASP A 74  ? 1.0303 0.9874 0.9400 -0.0924 0.0106  0.0009  74  ASP A OD1 
577  O OD2 . ASP A 74  ? 1.0366 0.9931 0.9419 -0.0822 0.0027  -0.0160 74  ASP A OD2 
578  N N   . THR A 75  ? 0.7629 0.7091 0.7035 -0.0966 -0.0060 -0.0329 75  THR A N   
579  C CA  . THR A 75  ? 0.7660 0.6929 0.7122 -0.0988 -0.0096 -0.0432 75  THR A CA  
580  C C   . THR A 75  ? 0.7863 0.6899 0.7266 -0.0977 -0.0042 -0.0381 75  THR A C   
581  O O   . THR A 75  ? 0.7379 0.6212 0.6808 -0.0990 -0.0062 -0.0453 75  THR A O   
582  C CB  . THR A 75  ? 0.7458 0.6677 0.7104 -0.1098 -0.0108 -0.0455 75  THR A CB  
583  O OG1 . THR A 75  ? 0.7863 0.7053 0.7571 -0.1159 -0.0024 -0.0316 75  THR A OG1 
584  C CG2 . THR A 75  ? 0.5585 0.5032 0.5296 -0.1103 -0.0185 -0.0535 75  THR A CG2 
585  N N   . LEU A 76  ? 0.7155 0.6212 0.6470 -0.0954 0.0023  -0.0258 76  LEU A N   
586  C CA  . LEU A 76  ? 0.6931 0.5786 0.6187 -0.0945 0.0074  -0.0194 76  LEU A CA  
587  C C   . LEU A 76  ? 0.7312 0.6082 0.6491 -0.0855 0.0033  -0.0287 76  LEU A C   
588  O O   . LEU A 76  ? 0.7968 0.6499 0.7165 -0.0867 0.0038  -0.0312 76  LEU A O   
589  C CB  . LEU A 76  ? 0.5994 0.4917 0.5149 -0.0934 0.0136  -0.0055 76  LEU A CB  
590  C CG  . LEU A 76  ? 0.7915 0.6633 0.7013 -0.0937 0.0188  0.0025  76  LEU A CG  
591  C CD1 . LEU A 76  ? 0.7890 0.6372 0.7094 -0.1021 0.0221  0.0040  76  LEU A CD1 
592  C CD2 . LEU A 76  ? 0.7626 0.6403 0.6618 -0.0946 0.0243  0.0162  76  LEU A CD2 
593  N N   . TYR A 77  ? 0.7065 0.6022 0.6150 -0.0760 -0.0003 -0.0336 77  TYR A N   
594  C CA  . TYR A 77  ? 0.7853 0.6754 0.6855 -0.0653 -0.0039 -0.0428 77  TYR A CA  
595  C C   . TYR A 77  ? 0.8270 0.7307 0.7249 -0.0596 -0.0113 -0.0570 77  TYR A C   
596  O O   . TYR A 77  ? 0.7269 0.6532 0.6163 -0.0518 -0.0125 -0.0577 77  TYR A O   
597  C CB  . TYR A 77  ? 0.6865 0.5862 0.5750 -0.0570 -0.0004 -0.0348 77  TYR A CB  
598  C CG  . TYR A 77  ? 0.6655 0.5526 0.5535 -0.0618 0.0061  -0.0211 77  TYR A CG  
599  C CD1 . TYR A 77  ? 0.6901 0.5503 0.5790 -0.0619 0.0077  -0.0207 77  TYR A CD1 
600  C CD2 . TYR A 77  ? 0.6572 0.5579 0.5416 -0.0661 0.0106  -0.0085 77  TYR A CD2 
601  C CE1 . TYR A 77  ? 0.6123 0.4609 0.4991 -0.0659 0.0135  -0.0081 77  TYR A CE1 
602  C CE2 . TYR A 77  ? 0.6707 0.5591 0.5526 -0.0706 0.0161  0.0035  77  TYR A CE2 
603  C CZ  . TYR A 77  ? 0.7327 0.5958 0.6160 -0.0704 0.0175  0.0037  77  TYR A CZ  
604  O OH  . TYR A 77  ? 0.8743 0.7252 0.7538 -0.0746 0.0228  0.0158  77  TYR A OH  
605  N N   . PRO A 78  ? 0.8306 0.7204 0.7356 -0.0640 -0.0164 -0.0682 78  PRO A N   
606  C CA  . PRO A 78  ? 0.8385 0.7385 0.7415 -0.0604 -0.0243 -0.0827 78  PRO A CA  
607  C C   . PRO A 78  ? 0.9186 0.8222 0.8066 -0.0455 -0.0268 -0.0911 78  PRO A C   
608  O O   . PRO A 78  ? 0.9210 0.8039 0.8034 -0.0396 -0.0258 -0.0938 78  PRO A O   
609  C CB  . PRO A 78  ? 0.8088 0.6850 0.7213 -0.0694 -0.0284 -0.0918 78  PRO A CB  
610  C CG  . PRO A 78  ? 0.7662 0.6290 0.6898 -0.0803 -0.0218 -0.0795 78  PRO A CG  
611  C CD  . PRO A 78  ? 0.7332 0.5958 0.6481 -0.0738 -0.0148 -0.0675 78  PRO A CD  
612  N N   . GLY A 79  ? 0.9255 0.8549 0.8064 -0.0388 -0.0296 -0.0947 79  GLY A N   
613  C CA  . GLY A 79  ? 0.8069 0.7437 0.6734 -0.0239 -0.0316 -0.1030 79  GLY A CA  
614  C C   . GLY A 79  ? 0.7673 0.7163 0.6261 -0.0152 -0.0252 -0.0924 79  GLY A C   
615  O O   . GLY A 79  ? 0.8033 0.7630 0.6509 -0.0020 -0.0256 -0.0973 79  GLY A O   
616  N N   . PHE A 80  ? 0.6711 0.6193 0.5358 -0.0226 -0.0193 -0.0776 80  PHE A N   
617  C CA  . PHE A 80  ? 0.6531 0.6133 0.5116 -0.0168 -0.0137 -0.0664 80  PHE A CA  
618  C C   . PHE A 80  ? 0.6862 0.6783 0.5399 -0.0163 -0.0125 -0.0605 80  PHE A C   
619  O O   . PHE A 80  ? 0.7311 0.7305 0.5893 -0.0257 -0.0120 -0.0550 80  PHE A O   
620  C CB  . PHE A 80  ? 0.6843 0.6288 0.5491 -0.0259 -0.0084 -0.0533 80  PHE A CB  
621  C CG  . PHE A 80  ? 0.6735 0.6320 0.5327 -0.0230 -0.0032 -0.0404 80  PHE A CG  
622  C CD1 . PHE A 80  ? 0.6770 0.6391 0.5290 -0.0105 -0.0026 -0.0415 80  PHE A CD1 
623  C CD2 . PHE A 80  ? 0.5932 0.5607 0.4537 -0.0327 0.0009  -0.0272 80  PHE A CD2 
624  C CE1 . PHE A 80  ? 0.6518 0.6291 0.4997 -0.0089 0.0014  -0.0295 80  PHE A CE1 
625  C CE2 . PHE A 80  ? 0.5324 0.5119 0.3871 -0.0318 0.0050  -0.0155 80  PHE A CE2 
626  C CZ  . PHE A 80  ? 0.6575 0.6433 0.5067 -0.0204 0.0050  -0.0166 80  PHE A CZ  
627  N N   . GLU A 81  ? 0.6749 0.6855 0.5189 -0.0047 -0.0115 -0.0611 81  GLU A N   
628  C CA  . GLU A 81  ? 0.6621 0.7037 0.4994 -0.0027 -0.0103 -0.0567 81  GLU A CA  
629  C C   . GLU A 81  ? 0.6877 0.7381 0.5267 -0.0138 -0.0054 -0.0405 81  GLU A C   
630  O O   . GLU A 81  ? 0.6419 0.7101 0.4775 -0.0175 -0.0052 -0.0368 81  GLU A O   
631  C CB  . GLU A 81  ? 0.7975 0.8566 0.6255 0.0115  -0.0087 -0.0584 81  GLU A CB  
632  C CG  . GLU A 81  ? 1.0909 1.1368 0.9146 0.0248  -0.0123 -0.0735 81  GLU A CG  
633  C CD  . GLU A 81  ? 1.2184 1.2350 1.0460 0.0264  -0.0116 -0.0737 81  GLU A CD  
634  O OE1 . GLU A 81  ? 1.2251 1.2415 1.0554 0.0239  -0.0072 -0.0615 81  GLU A OE1 
635  O OE2 . GLU A 81  ? 1.2327 1.2253 1.0595 0.0299  -0.0157 -0.0862 81  GLU A OE2 
636  N N   . GLY A 82  ? 0.6376 0.6740 0.4804 -0.0190 -0.0016 -0.0310 82  GLY A N   
637  C CA  . GLY A 82  ? 0.6594 0.7017 0.5012 -0.0290 0.0031  -0.0158 82  GLY A CA  
638  C C   . GLY A 82  ? 0.6024 0.6370 0.4490 -0.0402 0.0033  -0.0125 82  GLY A C   
639  O O   . GLY A 82  ? 0.5754 0.6188 0.4178 -0.0471 0.0065  -0.0019 82  GLY A O   
640  N N   . THR A 83  ? 0.5225 0.5406 0.3778 -0.0421 -0.0001 -0.0214 83  THR A N   
641  C CA  . THR A 83  ? 0.5643 0.5790 0.4259 -0.0510 -0.0005 -0.0195 83  THR A CA  
642  C C   . THR A 83  ? 0.6179 0.6492 0.4780 -0.0472 -0.0060 -0.0291 83  THR A C   
643  O O   . THR A 83  ? 0.6228 0.6667 0.4803 -0.0507 -0.0054 -0.0239 83  THR A O   
644  C CB  . THR A 83  ? 0.5761 0.5647 0.4498 -0.0578 -0.0004 -0.0214 83  THR A CB  
645  O OG1 . THR A 83  ? 0.6974 0.6747 0.5744 -0.0523 -0.0051 -0.0347 83  THR A OG1 
646  C CG2 . THR A 83  ? 0.5820 0.5553 0.4554 -0.0624 0.0056  -0.0100 83  THR A CG2 
647  N N   . GLU A 84  ? 0.5537 0.5837 0.4138 -0.0396 -0.0113 -0.0431 84  GLU A N   
648  C CA  . GLU A 84  ? 0.5882 0.6319 0.4459 -0.0356 -0.0175 -0.0539 84  GLU A CA  
649  C C   . GLU A 84  ? 0.6531 0.7234 0.4997 -0.0323 -0.0164 -0.0488 84  GLU A C   
650  O O   . GLU A 84  ? 0.6959 0.7769 0.5419 -0.0335 -0.0199 -0.0513 84  GLU A O   
651  C CB  . GLU A 84  ? 0.5544 0.5917 0.4091 -0.0263 -0.0227 -0.0695 84  GLU A CB  
652  C CG  . GLU A 84  ? 0.7126 0.7224 0.5774 -0.0307 -0.0257 -0.0775 84  GLU A CG  
653  C CD  . GLU A 84  ? 0.9074 0.9141 0.7832 -0.0404 -0.0305 -0.0819 84  GLU A CD  
654  O OE1 . GLU A 84  ? 0.9323 0.9583 0.8077 -0.0422 -0.0320 -0.0793 84  GLU A OE1 
655  O OE2 . GLU A 84  ? 0.9394 0.9247 0.8247 -0.0462 -0.0328 -0.0876 84  GLU A OE2 
656  N N   . MET A 85  ? 0.6402 0.7214 0.4780 -0.0285 -0.0116 -0.0410 85  MET A N   
657  C CA  . MET A 85  ? 0.5825 0.6884 0.4090 -0.0264 -0.0098 -0.0350 85  MET A CA  
658  C C   . MET A 85  ? 0.6637 0.7716 0.4898 -0.0357 -0.0079 -0.0246 85  MET A C   
659  O O   . MET A 85  ? 0.7449 0.8656 0.5674 -0.0333 -0.0071 -0.0199 85  MET A O   
660  C CB  . MET A 85  ? 0.5018 0.6182 0.3214 -0.0238 -0.0044 -0.0262 85  MET A CB  
661  C CG  . MET A 85  ? 0.5491 0.6521 0.3723 -0.0336 0.0009  -0.0126 85  MET A CG  
662  S SD  . MET A 85  ? 0.7332 0.8453 0.5546 -0.0299 0.0056  -0.0033 85  MET A SD  
663  C CE  . MET A 85  ? 0.5210 0.6461 0.3493 -0.0267 0.0070  0.0031  85  MET A CE  
664  N N   . TRP A 86  ? 0.5120 0.6012 0.3481 -0.0441 -0.0064 -0.0200 86  TRP A N   
665  C CA  . TRP A 86  ? 0.4785 0.5671 0.3141 -0.0516 -0.0041 -0.0101 86  TRP A CA  
666  C C   . TRP A 86  ? 0.4911 0.5773 0.3364 -0.0529 -0.0093 -0.0174 86  TRP A C   
667  O O   . TRP A 86  ? 0.5714 0.6609 0.4160 -0.0565 -0.0084 -0.0110 86  TRP A O   
668  C CB  . TRP A 86  ? 0.5047 0.5759 0.3430 -0.0600 0.0022  0.0019  86  TRP A CB  
669  C CG  . TRP A 86  ? 0.5636 0.6368 0.3951 -0.0594 0.0065  0.0095  86  TRP A CG  
670  C CD1 . TRP A 86  ? 0.6134 0.6761 0.4470 -0.0595 0.0081  0.0097  86  TRP A CD1 
671  C CD2 . TRP A 86  ? 0.5648 0.6437 0.4024 -0.0534 0.0086  0.0164  86  TRP A CD2 
672  N NE1 . TRP A 86  ? 0.6729 0.7414 0.5069 -0.0562 0.0110  0.0171  86  TRP A NE1 
673  C CE2 . TRP A 86  ? 0.5830 0.6593 0.4225 -0.0522 0.0110  0.0203  86  TRP A CE2 
674  C CE3 . TRP A 86  ? 0.5960 0.6804 0.4362 -0.0498 0.0084  0.0190  86  TRP A CE3 
675  C CZ2 . TRP A 86  ? 0.5625 0.6428 0.4072 -0.0488 0.0126  0.0257  86  TRP A CZ2 
676  C CZ3 . TRP A 86  ? 0.5340 0.6195 0.3778 -0.0467 0.0106  0.0243  86  TRP A CZ3 
677  C CH2 . TRP A 86  ? 0.6298 0.7139 0.4763 -0.0468 0.0124  0.0273  86  TRP A CH2 
678  N N   . ASN A 87  ? 0.4775 0.5582 0.3313 -0.0499 -0.0150 -0.0309 87  ASN A N   
679  C CA  . ASN A 87  ? 0.5233 0.6029 0.3880 -0.0523 -0.0211 -0.0391 87  ASN A CA  
680  C C   . ASN A 87  ? 0.5902 0.6909 0.4474 -0.0469 -0.0267 -0.0445 87  ASN A C   
681  O O   . ASN A 87  ? 0.6423 0.7566 0.4861 -0.0397 -0.0271 -0.0465 87  ASN A O   
682  C CB  . ASN A 87  ? 0.5693 0.6337 0.4436 -0.0521 -0.0256 -0.0520 87  ASN A CB  
683  C CG  . ASN A 87  ? 0.6798 0.7219 0.5667 -0.0604 -0.0216 -0.0469 87  ASN A CG  
684  O OD1 . ASN A 87  ? 0.7149 0.7538 0.6053 -0.0665 -0.0162 -0.0351 87  ASN A OD1 
685  N ND2 . ASN A 87  ? 0.7440 0.7693 0.6366 -0.0605 -0.0239 -0.0560 87  ASN A ND2 
686  N N   . PRO A 88  ? 0.5634 0.6681 0.4292 -0.0501 -0.0311 -0.0466 88  PRO A N   
687  C CA  . PRO A 88  ? 0.4879 0.6123 0.3474 -0.0450 -0.0378 -0.0525 88  PRO A CA  
688  C C   . PRO A 88  ? 0.5686 0.6988 0.4210 -0.0375 -0.0445 -0.0678 88  PRO A C   
689  O O   . PRO A 88  ? 0.5213 0.6391 0.3818 -0.0387 -0.0486 -0.0790 88  PRO A O   
690  C CB  . PRO A 88  ? 0.4325 0.5564 0.3081 -0.0507 -0.0427 -0.0551 88  PRO A CB  
691  C CG  . PRO A 88  ? 0.5018 0.6100 0.3878 -0.0584 -0.0349 -0.0434 88  PRO A CG  
692  C CD  . PRO A 88  ? 0.4753 0.5679 0.3572 -0.0587 -0.0294 -0.0419 88  PRO A CD  
693  N N   . ASN A 89  ? 0.5993 0.7472 0.4355 -0.0298 -0.0453 -0.0682 89  ASN A N   
694  C CA  . ASN A 89  ? 0.4733 0.6269 0.3009 -0.0211 -0.0507 -0.0820 89  ASN A CA  
695  C C   . ASN A 89  ? 0.5797 0.7426 0.4073 -0.0172 -0.0580 -0.0879 89  ASN A C   
696  O O   . ASN A 89  ? 0.7435 0.9086 0.5641 -0.0092 -0.0605 -0.0951 89  ASN A O   
697  C CB  . ASN A 89  ? 0.4995 0.6548 0.3184 -0.0132 -0.0431 -0.0744 89  ASN A CB  
698  C CG  . ASN A 89  ? 0.5643 0.7265 0.3808 -0.0118 -0.0376 -0.0596 89  ASN A CG  
699  O OD1 . ASN A 89  ? 0.4837 0.6466 0.3038 -0.0167 -0.0372 -0.0519 89  ASN A OD1 
700  N ND2 . ASN A 89  ? 0.5443 0.7112 0.3552 -0.0052 -0.0332 -0.0559 89  ASN A ND2 
701  N N   . ARG A 90  ? 0.5202 0.6894 0.3550 -0.0227 -0.0611 -0.0841 90  ARG A N   
702  C CA  A ARG A 90  ? 0.5335 0.7119 0.3705 -0.0204 -0.0697 -0.0911 90  ARG A CA  
703  C CA  B ARG A 90  ? 0.5353 0.7142 0.3722 -0.0203 -0.0693 -0.0903 90  ARG A CA  
704  C C   . ARG A 90  ? 0.5733 0.7548 0.4254 -0.0301 -0.0762 -0.0951 90  ARG A C   
705  O O   . ARG A 90  ? 0.6564 0.8254 0.5206 -0.0373 -0.0705 -0.0877 90  ARG A O   
706  C CB  A ARG A 90  ? 0.5336 0.7216 0.3632 -0.0143 -0.0662 -0.0796 90  ARG A CB  
707  C CB  B ARG A 90  ? 0.5409 0.7290 0.3714 -0.0153 -0.0653 -0.0773 90  ARG A CB  
708  C CG  A ARG A 90  ? 0.5052 0.6929 0.3226 -0.0058 -0.0611 -0.0772 90  ARG A CG  
709  C CG  B ARG A 90  ? 0.5222 0.7084 0.3414 -0.0084 -0.0571 -0.0695 90  ARG A CG  
710  C CD  A ARG A 90  ? 0.4902 0.6777 0.3026 -0.0003 -0.0676 -0.0924 90  ARG A CD  
711  C CD  B ARG A 90  ? 0.4864 0.6742 0.2984 -0.0012 -0.0608 -0.0809 90  ARG A CD  
712  N NE  A ARG A 90  ? 0.5074 0.6971 0.3092 0.0076  -0.0619 -0.0897 90  ARG A NE  
713  N NE  B ARG A 90  ? 0.4709 0.6677 0.2791 0.0029  -0.0665 -0.0842 90  ARG A NE  
714  C CZ  A ARG A 90  ? 0.5501 0.7350 0.3485 0.0107  -0.0570 -0.0910 90  ARG A CZ  
715  C CZ  B ARG A 90  ? 0.4933 0.6916 0.2965 0.0074  -0.0730 -0.0969 90  ARG A CZ  
716  N NH1 A ARG A 90  ? 0.5589 0.7342 0.3620 0.0069  -0.0570 -0.0954 90  ARG A NH1 
717  N NH1 B ARG A 90  ? 0.4717 0.6618 0.2729 0.0090  -0.0745 -0.1079 90  ARG A NH1 
718  N NH2 A ARG A 90  ? 0.5628 0.7533 0.3534 0.0177  -0.0520 -0.0881 90  ARG A NH2 
719  N NH2 B ARG A 90  ? 0.4717 0.6785 0.2709 0.0106  -0.0781 -0.0986 90  ARG A NH2 
720  N N   . GLU A 91  ? 0.6041 0.7943 0.4615 -0.0297 -0.0854 -0.1029 91  GLU A N   
721  C CA  . GLU A 91  ? 0.5136 0.7083 0.3898 -0.0388 -0.0918 -0.1059 91  GLU A CA  
722  C C   . GLU A 91  ? 0.5765 0.7740 0.4611 -0.0419 -0.0843 -0.0885 91  GLU A C   
723  O O   . GLU A 91  ? 0.5631 0.7696 0.4343 -0.0361 -0.0797 -0.0777 91  GLU A O   
724  C CB  . GLU A 91  ? 0.4880 0.6955 0.3652 -0.0360 -0.1025 -0.1142 91  GLU A CB  
725  C CG  . GLU A 91  ? 0.6773 0.8962 0.5750 -0.0450 -0.1101 -0.1168 91  GLU A CG  
726  C CD  . GLU A 91  ? 0.7560 0.9855 0.6549 -0.0421 -0.1204 -0.1240 91  GLU A CD  
727  O OE1 . GLU A 91  ? 0.6794 0.9049 0.5621 -0.0339 -0.1215 -0.1283 91  GLU A OE1 
728  O OE2 . GLU A 91  ? 0.8235 1.0662 0.7397 -0.0484 -0.1271 -0.1249 91  GLU A OE2 
729  N N   . LEU A 92  ? 0.6127 0.8015 0.5182 -0.0508 -0.0829 -0.0860 92  LEU A N   
730  C CA  . LEU A 92  ? 0.5223 0.7119 0.4363 -0.0534 -0.0755 -0.0703 92  LEU A CA  
731  C C   . LEU A 92  ? 0.4895 0.7004 0.4127 -0.0524 -0.0823 -0.0693 92  LEU A C   
732  O O   . LEU A 92  ? 0.4320 0.6510 0.3692 -0.0569 -0.0919 -0.0801 92  LEU A O   
733  C CB  . LEU A 92  ? 0.5049 0.6758 0.4368 -0.0629 -0.0696 -0.0671 92  LEU A CB  
734  C CG  . LEU A 92  ? 0.5645 0.7128 0.4905 -0.0645 -0.0618 -0.0655 92  LEU A CG  
735  C CD1 . LEU A 92  ? 0.4537 0.5857 0.3973 -0.0737 -0.0558 -0.0598 92  LEU A CD1 
736  C CD2 . LEU A 92  ? 0.6402 0.7883 0.5468 -0.0582 -0.0538 -0.0539 92  LEU A CD2 
737  N N   . SER A 93  ? 0.3952 0.6145 0.3103 -0.0467 -0.0775 -0.0560 93  SER A N   
738  C CA  . SER A 93  ? 0.3605 0.6011 0.2824 -0.0434 -0.0836 -0.0536 93  SER A CA  
739  C C   . SER A 93  ? 0.4227 0.6622 0.3392 -0.0391 -0.0743 -0.0359 93  SER A C   
740  O O   . SER A 93  ? 0.4386 0.6648 0.3382 -0.0367 -0.0652 -0.0268 93  SER A O   
741  C CB  . SER A 93  ? 0.4189 0.6774 0.3249 -0.0355 -0.0936 -0.0620 93  SER A CB  
742  O OG  . SER A 93  ? 0.3908 0.6716 0.3030 -0.0316 -0.1006 -0.0599 93  SER A OG  
743  N N   . GLU A 94  ? 0.4762 0.7301 0.4065 -0.0379 -0.0766 -0.0311 94  GLU A N   
744  C CA  . GLU A 94  ? 0.4555 0.7098 0.3777 -0.0311 -0.0691 -0.0151 94  GLU A CA  
745  C C   . GLU A 94  ? 0.5386 0.8038 0.4366 -0.0205 -0.0724 -0.0124 94  GLU A C   
746  O O   . GLU A 94  ? 0.6030 0.8618 0.4848 -0.0145 -0.0649 0.0010  94  GLU A O   
747  C CB  . GLU A 94  ? 0.4746 0.7433 0.4194 -0.0313 -0.0707 -0.0110 94  GLU A CB  
748  C CG  . GLU A 94  ? 0.5248 0.7792 0.4883 -0.0397 -0.0621 -0.0063 94  GLU A CG  
749  C CD  . GLU A 94  ? 0.5722 0.8431 0.5565 -0.0381 -0.0621 -0.0001 94  GLU A CD  
750  O OE1 . GLU A 94  ? 0.5863 0.8536 0.5633 -0.0308 -0.0538 0.0138  94  GLU A OE1 
751  O OE2 . GLU A 94  ? 0.5300 0.8178 0.5376 -0.0443 -0.0705 -0.0092 94  GLU A OE2 
752  N N   . ASP A 95  ? 0.3837 0.6641 0.2781 -0.0185 -0.0836 -0.0251 95  ASP A N   
753  C CA  . ASP A 95  ? 0.4788 0.7640 0.3506 -0.0088 -0.0853 -0.0237 95  ASP A CA  
754  C C   . ASP A 95  ? 0.4776 0.7403 0.3345 -0.0096 -0.0772 -0.0240 95  ASP A C   
755  O O   . ASP A 95  ? 0.6220 0.8821 0.4797 -0.0115 -0.0813 -0.0361 95  ASP A O   
756  C CB  . ASP A 95  ? 0.6371 0.9375 0.5159 -0.0061 -0.0974 -0.0365 95  ASP A CB  
757  C CG  . ASP A 95  ? 0.6340 0.9288 0.4945 0.0031  -0.0961 -0.0350 95  ASP A CG  
758  O OD1 . ASP A 95  ? 0.6044 0.8861 0.4496 0.0079  -0.0864 -0.0232 95  ASP A OD1 
759  O OD2 . ASP A 95  ? 0.7311 1.0336 0.5930 0.0046  -0.1048 -0.0459 95  ASP A OD2 
760  N N   . CYS A 96  ? 0.4747 0.7203 0.3190 -0.0079 -0.0657 -0.0104 96  CYS A N   
761  C CA  . CYS A 96  ? 0.4293 0.6545 0.2649 -0.0107 -0.0573 -0.0091 96  CYS A CA  
762  C C   . CYS A 96  ? 0.4282 0.6344 0.2504 -0.0071 -0.0468 0.0043  96  CYS A C   
763  O O   . CYS A 96  ? 0.4609 0.6500 0.2785 -0.0101 -0.0395 0.0073  96  CYS A O   
764  C CB  . CYS A 96  ? 0.4760 0.6948 0.3187 -0.0202 -0.0540 -0.0089 96  CYS A CB  
765  S SG  . CYS A 96  ? 0.5887 0.7984 0.4303 -0.0230 -0.0447 0.0086  96  CYS A SG  
766  N N   . LEU A 97  ? 0.4436 0.6513 0.2605 -0.0010 -0.0464 0.0119  97  LEU A N   
767  C CA  . LEU A 97  ? 0.4811 0.6667 0.2854 0.0012  -0.0375 0.0228  97  LEU A CA  
768  C C   . LEU A 97  ? 0.5404 0.7227 0.3348 0.0046  -0.0380 0.0196  97  LEU A C   
769  O O   . LEU A 97  ? 0.5401 0.7259 0.3271 0.0104  -0.0404 0.0217  97  LEU A O   
770  C CB  . LEU A 97  ? 0.4989 0.6820 0.2998 0.0058  -0.0356 0.0329  97  LEU A CB  
771  C CG  . LEU A 97  ? 0.5911 0.7718 0.4000 0.0017  -0.0319 0.0385  97  LEU A CG  
772  C CD1 . LEU A 97  ? 0.5079 0.6822 0.3127 0.0072  -0.0280 0.0497  97  LEU A CD1 
773  C CD2 . LEU A 97  ? 0.5833 0.7408 0.3911 -0.0059 -0.0236 0.0405  97  LEU A CD2 
774  N N   . TYR A 98  ? 0.4374 0.6138 0.2318 0.0012  -0.0356 0.0151  98  TYR A N   
775  C CA  . TYR A 98  ? 0.4727 0.6479 0.2589 0.0039  -0.0354 0.0124  98  TYR A CA  
776  C C   . TYR A 98  ? 0.4875 0.6434 0.2698 -0.0002 -0.0268 0.0179  98  TYR A C   
777  O O   . TYR A 98  ? 0.5297 0.6764 0.3178 -0.0050 -0.0227 0.0202  98  TYR A O   
778  C CB  . TYR A 98  ? 0.5209 0.7128 0.3118 0.0052  -0.0426 -0.0009 98  TYR A CB  
779  C CG  . TYR A 98  ? 0.5789 0.7897 0.3752 0.0085  -0.0527 -0.0083 98  TYR A CG  
780  C CD1 . TYR A 98  ? 0.5245 0.7438 0.3329 0.0049  -0.0573 -0.0125 98  TYR A CD1 
781  C CD2 . TYR A 98  ? 0.4902 0.7106 0.2801 0.0147  -0.0580 -0.0111 98  TYR A CD2 
782  C CE1 . TYR A 98  ? 0.5052 0.7429 0.3211 0.0070  -0.0675 -0.0197 98  TYR A CE1 
783  C CE2 . TYR A 98  ? 0.4787 0.7168 0.2747 0.0175  -0.0680 -0.0181 98  TYR A CE2 
784  C CZ  . TYR A 98  ? 0.5719 0.8187 0.3818 0.0135  -0.0730 -0.0226 98  TYR A CZ  
785  O OH  . TYR A 98  ? 0.5763 0.8416 0.3949 0.0152  -0.0837 -0.0298 98  TYR A OH  
786  N N   . LEU A 99  ? 0.4782 0.6287 0.2510 0.0017  -0.0244 0.0200  99  LEU A N   
787  C CA  . LEU A 99  ? 0.4319 0.5677 0.2020 -0.0019 -0.0175 0.0240  99  LEU A CA  
788  C C   . LEU A 99  ? 0.5436 0.6897 0.3108 0.0002  -0.0182 0.0189  99  LEU A C   
789  O O   . LEU A 99  ? 0.5496 0.7095 0.3131 0.0049  -0.0234 0.0135  99  LEU A O   
790  C CB  . LEU A 99  ? 0.4759 0.5897 0.2360 -0.0029 -0.0119 0.0337  99  LEU A CB  
791  C CG  . LEU A 99  ? 0.4969 0.6084 0.2440 0.0009  -0.0132 0.0375  99  LEU A CG  
792  C CD1 . LEU A 99  ? 0.4359 0.5579 0.1768 0.0021  -0.0126 0.0366  99  LEU A CD1 
793  C CD2 . LEU A 99  ? 0.5826 0.6765 0.3227 -0.0009 -0.0079 0.0468  99  LEU A CD2 
794  N N   . ASN A 100 ? 0.5204 0.6602 0.2893 -0.0030 -0.0131 0.0206  100 ASN A N   
795  C CA  . ASN A 100 ? 0.5104 0.6610 0.2777 -0.0012 -0.0126 0.0164  100 ASN A CA  
796  C C   . ASN A 100 ? 0.5560 0.7043 0.3186 -0.0036 -0.0066 0.0241  100 ASN A C   
797  O O   . ASN A 100 ? 0.5607 0.6984 0.3246 -0.0081 -0.0024 0.0314  100 ASN A O   
798  C CB  . ASN A 100 ? 0.5227 0.6803 0.2996 -0.0024 -0.0127 0.0105  100 ASN A CB  
799  C CG  . ASN A 100 ? 0.5342 0.6968 0.3180 -0.0024 -0.0178 0.0040  100 ASN A CG  
800  O OD1 . ASN A 100 ? 0.6071 0.7819 0.3901 0.0017  -0.0242 -0.0043 100 ASN A OD1 
801  N ND2 . ASN A 100 ? 0.5131 0.6661 0.3037 -0.0071 -0.0155 0.0073  100 ASN A ND2 
802  N N   . VAL A 101 ? 0.5886 0.7500 0.3461 -0.0007 -0.0064 0.0224  101 VAL A N   
803  C CA  . VAL A 101 ? 0.5088 0.6742 0.2623 -0.0033 -0.0011 0.0293  101 VAL A CA  
804  C C   . VAL A 101 ? 0.5580 0.7404 0.3137 -0.0013 0.0001  0.0253  101 VAL A C   
805  O O   . VAL A 101 ? 0.6018 0.7938 0.3538 0.0046  -0.0033 0.0181  101 VAL A O   
806  C CB  . VAL A 101 ? 0.5082 0.6725 0.2486 -0.0011 -0.0015 0.0337  101 VAL A CB  
807  C CG1 . VAL A 101 ? 0.4740 0.6402 0.2092 -0.0050 0.0041  0.0414  101 VAL A CG1 
808  C CG2 . VAL A 101 ? 0.4233 0.5720 0.1598 -0.0013 -0.0031 0.0373  101 VAL A CG2 
809  N N   . TRP A 102 ? 0.4417 0.6281 0.2028 -0.0059 0.0048  0.0298  102 TRP A N   
810  C CA  . TRP A 102 ? 0.4317 0.6362 0.1943 -0.0038 0.0068  0.0276  102 TRP A CA  
811  C C   . TRP A 102 ? 0.5276 0.7381 0.2855 -0.0079 0.0112  0.0360  102 TRP A C   
812  O O   . TRP A 102 ? 0.5279 0.7284 0.2867 -0.0148 0.0137  0.0434  102 TRP A O   
813  C CB  . TRP A 102 ? 0.5745 0.7827 0.3486 -0.0056 0.0081  0.0254  102 TRP A CB  
814  C CG  . TRP A 102 ? 0.5878 0.7902 0.3658 -0.0020 0.0043  0.0168  102 TRP A CG  
815  C CD1 . TRP A 102 ? 0.5782 0.7890 0.3554 0.0045  0.0021  0.0078  102 TRP A CD1 
816  C CD2 . TRP A 102 ? 0.5052 0.6910 0.2875 -0.0049 0.0024  0.0163  102 TRP A CD2 
817  N NE1 . TRP A 102 ? 0.6403 0.8436 0.4213 0.0053  -0.0015 0.0016  102 TRP A NE1 
818  C CE2 . TRP A 102 ? 0.5378 0.7244 0.3220 -0.0006 -0.0013 0.0069  102 TRP A CE2 
819  C CE3 . TRP A 102 ? 0.5967 0.7679 0.3811 -0.0104 0.0035  0.0227  102 TRP A CE3 
820  C CZ2 . TRP A 102 ? 0.5565 0.7354 0.3460 -0.0024 -0.0039 0.0042  102 TRP A CZ2 
821  C CZ3 . TRP A 102 ? 0.5411 0.6993 0.3298 -0.0113 0.0013  0.0201  102 TRP A CZ3 
822  C CH2 . TRP A 102 ? 0.5280 0.6905 0.3193 -0.0078 -0.0025 0.0112  102 TRP A CH2 
823  N N   . THR A 103 ? 0.5129 0.7389 0.2647 -0.0037 0.0121  0.0347  103 THR A N   
824  C CA  . THR A 103 ? 0.5906 0.8240 0.3367 -0.0075 0.0162  0.0424  103 THR A CA  
825  C C   . THR A 103 ? 0.5656 0.8221 0.3144 -0.0042 0.0184  0.0400  103 THR A C   
826  O O   . THR A 103 ? 0.6496 0.9144 0.4002 0.0031  0.0164  0.0316  103 THR A O   
827  C CB  . THR A 103 ? 0.6106 0.8380 0.3413 -0.0051 0.0154  0.0451  103 THR A CB  
828  O OG1 . THR A 103 ? 0.6621 0.8990 0.3875 0.0036  0.0122  0.0374  103 THR A OG1 
829  C CG2 . THR A 103 ? 0.5833 0.7887 0.3100 -0.0071 0.0134  0.0478  103 THR A CG2 
830  N N   . PRO A 104 ? 0.5204 0.7872 0.2691 -0.0096 0.0226  0.0471  104 PRO A N   
831  C CA  . PRO A 104 ? 0.5742 0.8652 0.3235 -0.0057 0.0252  0.0459  104 PRO A CA  
832  C C   . PRO A 104 ? 0.6817 0.9786 0.4194 0.0038  0.0236  0.0402  104 PRO A C   
833  O O   . PRO A 104 ? 0.7344 1.0186 0.4615 0.0050  0.0215  0.0406  104 PRO A O   
834  C CB  . PRO A 104 ? 0.5575 0.8537 0.3037 -0.0142 0.0293  0.0560  104 PRO A CB  
835  C CG  . PRO A 104 ? 0.6252 0.9037 0.3772 -0.0236 0.0289  0.0609  104 PRO A CG  
836  C CD  . PRO A 104 ? 0.4990 0.7563 0.2490 -0.0199 0.0250  0.0562  104 PRO A CD  
837  N N   . TYR A 105 ? 0.6465 0.9625 0.3859 0.0108  0.0246  0.0348  105 TYR A N   
838  C CA  . TYR A 105 ? 0.6174 0.9414 0.3454 0.0201  0.0235  0.0291  105 TYR A CA  
839  C C   . TYR A 105 ? 0.7201 1.0659 0.4448 0.0208  0.0286  0.0336  105 TYR A C   
840  O O   . TYR A 105 ? 0.7692 1.1317 0.5030 0.0217  0.0313  0.0333  105 TYR A O   
841  C CB  . TYR A 105 ? 0.5838 0.9102 0.3145 0.0293  0.0201  0.0173  105 TYR A CB  
842  C CG  . TYR A 105 ? 0.5464 0.8786 0.2644 0.0391  0.0179  0.0099  105 TYR A CG  
843  C CD1 . TYR A 105 ? 0.5055 0.8580 0.2183 0.0450  0.0215  0.0093  105 TYR A CD1 
844  C CD2 . TYR A 105 ? 0.4946 0.8129 0.2058 0.0424  0.0119  0.0033  105 TYR A CD2 
845  C CE1 . TYR A 105 ? 0.5722 0.9292 0.2724 0.0542  0.0194  0.0021  105 TYR A CE1 
846  C CE2 . TYR A 105 ? 0.5259 0.8494 0.2250 0.0511  0.0091  -0.0040 105 TYR A CE2 
847  C CZ  . TYR A 105 ? 0.5608 0.9029 0.2539 0.0571  0.0130  -0.0047 105 TYR A CZ  
848  O OH  . TYR A 105 ? 0.5884 0.9351 0.2682 0.0659  0.0103  -0.0122 105 TYR A OH  
849  N N   . PRO A 106 ? 0.7530 1.0992 0.4642 0.0206  0.0299  0.0379  106 PRO A N   
850  C CA  . PRO A 106 ? 0.6856 1.0126 0.3848 0.0198  0.0269  0.0394  106 PRO A CA  
851  C C   . PRO A 106 ? 0.6819 0.9907 0.3834 0.0092  0.0275  0.0479  106 PRO A C   
852  O O   . PRO A 106 ? 0.6139 0.9266 0.3252 0.0018  0.0305  0.0531  106 PRO A O   
853  C CB  . PRO A 106 ? 0.6984 1.0355 0.3827 0.0222  0.0299  0.0433  106 PRO A CB  
854  C CG  . PRO A 106 ? 0.6673 1.0248 0.3576 0.0187  0.0356  0.0484  106 PRO A CG  
855  C CD  . PRO A 106 ? 0.7698 1.1373 0.4757 0.0220  0.0349  0.0419  106 PRO A CD  
856  N N   . ARG A 107 ? 0.6708 0.9603 0.3629 0.0090  0.0245  0.0490  107 ARG A N   
857  C CA  . ARG A 107 ? 0.6969 0.9661 0.3890 0.0006  0.0249  0.0562  107 ARG A CA  
858  C C   . ARG A 107 ? 0.7053 0.9763 0.3920 -0.0075 0.0303  0.0664  107 ARG A C   
859  O O   . ARG A 107 ? 0.9317 1.2126 0.6074 -0.0059 0.0329  0.0691  107 ARG A O   
860  C CB  . ARG A 107 ? 0.6833 0.9334 0.3642 0.0036  0.0208  0.0556  107 ARG A CB  
861  C CG  . ARG A 107 ? 0.7087 0.9566 0.3961 0.0100  0.0148  0.0457  107 ARG A CG  
862  C CD  . ARG A 107 ? 0.7788 1.0091 0.4574 0.0117  0.0105  0.0463  107 ARG A CD  
863  N NE  . ARG A 107 ? 0.7500 0.9809 0.4113 0.0152  0.0104  0.0493  107 ARG A NE  
864  C CZ  . ARG A 107 ? 0.7891 1.0294 0.4438 0.0231  0.0063  0.0429  107 ARG A CZ  
865  N NH1 . ARG A 107 ? 0.7182 0.9668 0.3819 0.0281  0.0022  0.0327  107 ARG A NH1 
866  N NH2 . ARG A 107 ? 0.8693 1.1098 0.5074 0.0260  0.0063  0.0463  107 ARG A NH2 
867  N N   . PRO A 108 ? 0.8916 1.1531 0.5855 -0.0166 0.0319  0.0718  108 PRO A N   
868  C CA  . PRO A 108 ? 0.9437 1.2081 0.6348 -0.0260 0.0366  0.0810  108 PRO A CA  
869  C C   . PRO A 108 ? 1.0100 1.2643 0.6805 -0.0273 0.0391  0.0879  108 PRO A C   
870  O O   . PRO A 108 ? 0.9584 1.1956 0.6162 -0.0226 0.0369  0.0873  108 PRO A O   
871  C CB  . PRO A 108 ? 0.8367 1.0851 0.5366 -0.0343 0.0361  0.0841  108 PRO A CB  
872  C CG  . PRO A 108 ? 0.7561 0.9902 0.4602 -0.0286 0.0316  0.0775  108 PRO A CG  
873  C CD  . PRO A 108 ? 0.7810 1.0303 0.4874 -0.0187 0.0292  0.0689  108 PRO A CD  
874  N N   . ALA A 109 ? 1.1466 1.4122 0.8137 -0.0338 0.0437  0.0947  109 ALA A N   
875  C CA  . ALA A 109 ? 1.2316 1.4897 0.8781 -0.0354 0.0470  0.1018  109 ALA A CA  
876  C C   . ALA A 109 ? 1.1948 1.4232 0.8300 -0.0419 0.0478  0.1088  109 ALA A C   
877  O O   . ALA A 109 ? 1.2070 1.4168 0.8227 -0.0387 0.0481  0.1118  109 ALA A O   
878  C CB  . ALA A 109 ? 1.2408 1.5222 0.8882 -0.0409 0.0519  0.1069  109 ALA A CB  
879  N N   . SER A 110 ? 1.0714 1.2954 0.7182 -0.0507 0.0481  0.1112  110 SER A N   
880  C CA  . SER A 110 ? 1.0293 1.2254 0.6667 -0.0567 0.0491  0.1173  110 SER A CA  
881  C C   . SER A 110 ? 0.9712 1.1523 0.6192 -0.0545 0.0452  0.1124  110 SER A C   
882  O O   . SER A 110 ? 0.9312 1.1258 0.5962 -0.0512 0.0422  0.1052  110 SER A O   
883  C CB  . SER A 110 ? 1.0824 1.2848 0.7231 -0.0698 0.0525  0.1246  110 SER A CB  
884  O OG  . SER A 110 ? 1.1368 1.3681 0.7979 -0.0736 0.0517  0.1216  110 SER A OG  
885  N N   . PRO A 111 ? 0.9004 1.0528 0.5371 -0.0553 0.0456  0.1162  111 PRO A N   
886  C CA  . PRO A 111 ? 0.8428 0.9791 0.4877 -0.0532 0.0426  0.1126  111 PRO A CA  
887  C C   . PRO A 111 ? 0.7685 0.9154 0.4355 -0.0606 0.0413  0.1101  111 PRO A C   
888  O O   . PRO A 111 ? 0.7880 0.9371 0.4579 -0.0710 0.0431  0.1150  111 PRO A O   
889  C CB  . PRO A 111 ? 0.8583 0.9647 0.4850 -0.0542 0.0452  0.1195  111 PRO A CB  
890  C CG  . PRO A 111 ? 0.8687 0.9718 0.4734 -0.0511 0.0481  0.1244  111 PRO A CG  
891  C CD  . PRO A 111 ? 0.7711 0.9037 0.3837 -0.0559 0.0493  0.1241  111 PRO A CD  
892  N N   . THR A 112 ? 0.7446 0.7755 0.4453 -0.1734 0.0720  0.0995  112 THR A N   
893  C CA  . THR A 112 ? 0.7361 0.8215 0.4741 -0.1751 0.0672  0.0857  112 THR A CA  
894  C C   . THR A 112 ? 0.6059 0.6745 0.3575 -0.1684 0.0544  0.0774  112 THR A C   
895  O O   . THR A 112 ? 0.5914 0.6264 0.3343 -0.1475 0.0439  0.0798  112 THR A O   
896  C CB  . THR A 112 ? 0.7642 0.8930 0.5162 -0.1504 0.0623  0.0821  112 THR A CB  
897  O OG1 . THR A 112 ? 0.8641 1.0034 0.5986 -0.1534 0.0745  0.0899  112 THR A OG1 
898  C CG2 . THR A 112 ? 0.6179 0.8065 0.4056 -0.1501 0.0602  0.0708  112 THR A CG2 
899  N N   . PRO A 113 ? 0.5483 0.6441 0.3212 -0.1867 0.0553  0.0676  113 PRO A N   
900  C CA  . PRO A 113 ? 0.5647 0.6449 0.3480 -0.1802 0.0439  0.0595  113 PRO A CA  
901  C C   . PRO A 113 ? 0.6011 0.6936 0.3980 -0.1477 0.0300  0.0572  113 PRO A C   
902  O O   . PRO A 113 ? 0.6296 0.7622 0.4392 -0.1349 0.0290  0.0561  113 PRO A O   
903  C CB  . PRO A 113 ? 0.5192 0.6460 0.3260 -0.2032 0.0463  0.0486  113 PRO A CB  
904  C CG  . PRO A 113 ? 0.6147 0.7575 0.4139 -0.2323 0.0621  0.0524  113 PRO A CG  
905  C CD  . PRO A 113 ? 0.5768 0.7199 0.3638 -0.2154 0.0665  0.0632  113 PRO A CD  
906  N N   . VAL A 114 ? 0.5177 0.5728 0.3093 -0.1348 0.0208  0.0566  114 VAL A N   
907  C CA  . VAL A 114 ? 0.4940 0.5526 0.2949 -0.1073 0.0082  0.0549  114 VAL A CA  
908  C C   . VAL A 114 ? 0.5602 0.6387 0.3842 -0.1041 0.0004  0.0449  114 VAL A C   
909  O O   . VAL A 114 ? 0.5589 0.6260 0.3837 -0.1184 0.0018  0.0403  114 VAL A O   
910  C CB  . VAL A 114 ? 0.6072 0.6168 0.3877 -0.0938 0.0031  0.0620  114 VAL A CB  
911  C CG1 . VAL A 114 ? 0.5669 0.5835 0.3583 -0.0696 -0.0100 0.0591  114 VAL A CG1 
912  C CG2 . VAL A 114 ? 0.6405 0.6281 0.3937 -0.0954 0.0104  0.0738  114 VAL A CG2 
913  N N   . LEU A 115 ? 0.6210 0.7264 0.4606 -0.0859 -0.0067 0.0416  115 LEU A N   
914  C CA  . LEU A 115 ? 0.5081 0.6306 0.3667 -0.0798 -0.0140 0.0344  115 LEU A CA  
915  C C   . LEU A 115 ? 0.5463 0.6485 0.4044 -0.0593 -0.0235 0.0348  115 LEU A C   
916  O O   . LEU A 115 ? 0.6969 0.8002 0.5512 -0.0458 -0.0257 0.0370  115 LEU A O   
917  C CB  . LEU A 115 ? 0.5240 0.6977 0.4012 -0.0757 -0.0127 0.0311  115 LEU A CB  
918  C CG  . LEU A 115 ? 0.6646 0.8761 0.5512 -0.0970 -0.0055 0.0284  115 LEU A CG  
919  C CD1 . LEU A 115 ? 0.7386 1.0027 0.6411 -0.0856 -0.0033 0.0282  115 LEU A CD1 
920  C CD2 . LEU A 115 ? 0.7318 0.9464 0.6262 -0.1091 -0.0096 0.0214  115 LEU A CD2 
921  N N   . ILE A 116 ? 0.5090 0.5942 0.3702 -0.0583 -0.0284 0.0317  116 ILE A N   
922  C CA  . ILE A 116 ? 0.5059 0.5777 0.3697 -0.0415 -0.0369 0.0316  116 ILE A CA  
923  C C   . ILE A 116 ? 0.5039 0.5955 0.3847 -0.0356 -0.0414 0.0261  116 ILE A C   
924  O O   . ILE A 116 ? 0.4142 0.5086 0.3002 -0.0433 -0.0410 0.0218  116 ILE A O   
925  C CB  . ILE A 116 ? 0.5016 0.5376 0.3545 -0.0401 -0.0386 0.0342  116 ILE A CB  
926  C CG1 . ILE A 116 ? 0.4808 0.4917 0.3125 -0.0454 -0.0329 0.0419  116 ILE A CG1 
927  C CG2 . ILE A 116 ? 0.5504 0.5821 0.4083 -0.0234 -0.0473 0.0345  116 ILE A CG2 
928  C CD1 . ILE A 116 ? 0.5003 0.4748 0.3181 -0.0359 -0.0352 0.0474  116 ILE A CD1 
929  N N   . TRP A 117 ? 0.4404 0.5424 0.3265 -0.0224 -0.0449 0.0260  117 TRP A N   
930  C CA  . TRP A 117 ? 0.4116 0.5286 0.3100 -0.0152 -0.0479 0.0230  117 TRP A CA  
931  C C   . TRP A 117 ? 0.5472 0.6463 0.4476 -0.0091 -0.0535 0.0220  117 TRP A C   
932  O O   . TRP A 117 ? 0.5844 0.6684 0.4796 -0.0037 -0.0569 0.0234  117 TRP A O   
933  C CB  . TRP A 117 ? 0.4434 0.5749 0.3430 -0.0038 -0.0464 0.0236  117 TRP A CB  
934  C CG  . TRP A 117 ? 0.5544 0.6935 0.4617 0.0063  -0.0484 0.0228  117 TRP A CG  
935  C CD1 . TRP A 117 ? 0.5390 0.6619 0.4432 0.0158  -0.0506 0.0226  117 TRP A CD1 
936  C CD2 . TRP A 117 ? 0.4816 0.6460 0.3986 0.0066  -0.0479 0.0227  117 TRP A CD2 
937  N NE1 . TRP A 117 ? 0.5838 0.7156 0.4935 0.0229  -0.0502 0.0236  117 TRP A NE1 
938  C CE2 . TRP A 117 ? 0.5126 0.6718 0.4303 0.0190  -0.0492 0.0242  117 TRP A CE2 
939  C CE3 . TRP A 117 ? 0.4579 0.6499 0.3817 -0.0037 -0.0465 0.0212  117 TRP A CE3 
940  C CZ2 . TRP A 117 ? 0.4609 0.6412 0.3846 0.0245  -0.0494 0.0260  117 TRP A CZ2 
941  C CZ3 . TRP A 117 ? 0.4857 0.7035 0.4172 0.0005  -0.0480 0.0214  117 TRP A CZ3 
942  C CH2 . TRP A 117 ? 0.4812 0.6931 0.4122 0.0160  -0.0496 0.0246  117 TRP A CH2 
943  N N   . ILE A 118 ? 0.4468 0.5520 0.3550 -0.0106 -0.0544 0.0194  118 ILE A N   
944  C CA  . ILE A 118 ? 0.3934 0.4875 0.3054 -0.0049 -0.0582 0.0186  118 ILE A CA  
945  C C   . ILE A 118 ? 0.3662 0.4740 0.2850 0.0011  -0.0585 0.0184  118 ILE A C   
946  O O   . ILE A 118 ? 0.4843 0.6079 0.4068 -0.0014 -0.0572 0.0171  118 ILE A O   
947  C CB  . ILE A 118 ? 0.3130 0.3970 0.2244 -0.0101 -0.0575 0.0159  118 ILE A CB  
948  C CG1 . ILE A 118 ? 0.3824 0.4458 0.2826 -0.0151 -0.0553 0.0175  118 ILE A CG1 
949  C CG2 . ILE A 118 ? 0.4022 0.4805 0.3193 -0.0028 -0.0604 0.0156  118 ILE A CG2 
950  C CD1 . ILE A 118 ? 0.4256 0.4722 0.3201 -0.0209 -0.0519 0.0137  118 ILE A CD1 
951  N N   . TYR A 119 ? 0.3110 0.4120 0.2290 0.0083  -0.0598 0.0198  119 TYR A N   
952  C CA  . TYR A 119 ? 0.4488 0.5559 0.3685 0.0151  -0.0581 0.0214  119 TYR A CA  
953  C C   . TYR A 119 ? 0.4828 0.5925 0.4079 0.0138  -0.0585 0.0212  119 TYR A C   
954  O O   . TYR A 119 ? 0.4728 0.5759 0.4012 0.0096  -0.0602 0.0190  119 TYR A O   
955  C CB  . TYR A 119 ? 0.3908 0.4818 0.3041 0.0203  -0.0575 0.0219  119 TYR A CB  
956  C CG  . TYR A 119 ? 0.4447 0.5223 0.3591 0.0151  -0.0614 0.0195  119 TYR A CG  
957  C CD1 . TYR A 119 ? 0.4870 0.5634 0.4077 0.0127  -0.0618 0.0196  119 TYR A CD1 
958  C CD2 . TYR A 119 ? 0.3705 0.4411 0.2794 0.0128  -0.0646 0.0175  119 TYR A CD2 
959  C CE1 . TYR A 119 ? 0.4264 0.4994 0.3511 0.0075  -0.0654 0.0173  119 TYR A CE1 
960  C CE2 . TYR A 119 ? 0.4742 0.5411 0.3854 0.0086  -0.0695 0.0154  119 TYR A CE2 
961  C CZ  . TYR A 119 ? 0.4990 0.5691 0.4196 0.0057  -0.0699 0.0151  119 TYR A CZ  
962  O OH  . TYR A 119 ? 0.4481 0.5229 0.3738 0.0011  -0.0750 0.0130  119 TYR A OH  
963  N N   . GLY A 120 ? 0.5636 0.6843 0.4883 0.0193  -0.0564 0.0242  120 GLY A N   
964  C CA  . GLY A 120 ? 0.5543 0.6773 0.4807 0.0195  -0.0557 0.0252  120 GLY A CA  
965  C C   . GLY A 120 ? 0.5684 0.6747 0.4908 0.0238  -0.0532 0.0290  120 GLY A C   
966  O O   . GLY A 120 ? 0.5320 0.6224 0.4504 0.0243  -0.0528 0.0286  120 GLY A O   
967  N N   . GLY A 121 ? 0.6438 0.7522 0.5649 0.0252  -0.0507 0.0323  121 GLY A N   
968  C CA  . GLY A 121 ? 0.5292 0.6193 0.4454 0.0251  -0.0466 0.0361  121 GLY A CA  
969  C C   . GLY A 121 ? 0.5269 0.6214 0.4498 0.0179  -0.0455 0.0345  121 GLY A C   
970  O O   . GLY A 121 ? 0.5019 0.5865 0.4278 0.0111  -0.0438 0.0338  121 GLY A O   
971  N N   . GLY A 122 ? 0.4051 0.5169 0.3301 0.0183  -0.0461 0.0330  122 GLY A N   
972  C CA  . GLY A 122 ? 0.4897 0.6078 0.4182 0.0145  -0.0431 0.0317  122 GLY A CA  
973  C C   . GLY A 122 ? 0.5147 0.6320 0.4549 0.0086  -0.0436 0.0267  122 GLY A C   
974  O O   . GLY A 122 ? 0.4457 0.5686 0.3902 0.0059  -0.0393 0.0270  122 GLY A O   
975  N N   . PHE A 123 ? 0.4678 0.5813 0.4129 0.0079  -0.0485 0.0228  123 PHE A N   
976  C CA  . PHE A 123 ? 0.3230 0.4390 0.2789 0.0055  -0.0506 0.0196  123 PHE A CA  
977  C C   . PHE A 123 ? 0.3540 0.4704 0.3154 -0.0012 -0.0491 0.0214  123 PHE A C   
978  O O   . PHE A 123 ? 0.4689 0.5977 0.4420 -0.0035 -0.0506 0.0192  123 PHE A O   
979  C CB  . PHE A 123 ? 0.3011 0.4267 0.2623 0.0087  -0.0485 0.0158  123 PHE A CB  
980  C CG  . PHE A 123 ? 0.4141 0.5342 0.3674 0.0112  -0.0492 0.0118  123 PHE A CG  
981  C CD1 . PHE A 123 ? 0.3946 0.5051 0.3467 0.0129  -0.0526 0.0098  123 PHE A CD1 
982  C CD2 . PHE A 123 ? 0.4509 0.5753 0.3960 0.0103  -0.0461 0.0099  123 PHE A CD2 
983  C CE1 . PHE A 123 ? 0.4606 0.5619 0.4033 0.0114  -0.0517 0.0056  123 PHE A CE1 
984  C CE2 . PHE A 123 ? 0.4606 0.5805 0.3974 0.0082  -0.0465 0.0042  123 PHE A CE2 
985  C CZ  . PHE A 123 ? 0.5488 0.6552 0.4843 0.0076  -0.0486 0.0019  123 PHE A CZ  
986  N N   . TYR A 124 ? 0.4345 0.5378 0.3866 -0.0044 -0.0457 0.0255  124 TYR A N   
987  C CA  . TYR A 124 ? 0.4688 0.5662 0.4222 -0.0151 -0.0429 0.0261  124 TYR A CA  
988  C C   . TYR A 124 ? 0.5117 0.5856 0.4528 -0.0177 -0.0441 0.0257  124 TYR A C   
989  O O   . TYR A 124 ? 0.5893 0.6518 0.5270 -0.0292 -0.0417 0.0243  124 TYR A O   
990  C CB  . TYR A 124 ? 0.5425 0.6370 0.4906 -0.0187 -0.0340 0.0318  124 TYR A CB  
991  C CG  . TYR A 124 ? 0.4968 0.5675 0.4254 -0.0128 -0.0294 0.0389  124 TYR A CG  
992  C CD1 . TYR A 124 ? 0.4637 0.5403 0.3855 -0.0006 -0.0296 0.0426  124 TYR A CD1 
993  C CD2 . TYR A 124 ? 0.3979 0.4404 0.3133 -0.0190 -0.0246 0.0416  124 TYR A CD2 
994  C CE1 . TYR A 124 ? 0.4923 0.5529 0.3969 0.0085  -0.0261 0.0505  124 TYR A CE1 
995  C CE2 . TYR A 124 ? 0.4226 0.4404 0.3178 -0.0092 -0.0193 0.0493  124 TYR A CE2 
996  C CZ  . TYR A 124 ? 0.5263 0.5561 0.4174 0.0062  -0.0205 0.0546  124 TYR A CZ  
997  O OH  . TYR A 124 ? 0.6187 0.6295 0.4905 0.0194  -0.0157 0.0639  124 TYR A OH  
998  N N   . SER A 125 ? 0.5566 0.6232 0.4897 -0.0080 -0.0467 0.0261  125 SER A N   
999  C CA  . SER A 125 ? 0.5639 0.6077 0.4830 -0.0068 -0.0460 0.0256  125 SER A CA  
1000 C C   . SER A 125 ? 0.4798 0.5288 0.3973 0.0025  -0.0505 0.0242  125 SER A C   
1001 O O   . SER A 125 ? 0.3453 0.4121 0.2710 0.0061  -0.0536 0.0240  125 SER A O   
1002 C CB  . SER A 125 ? 0.5830 0.6045 0.4859 -0.0016 -0.0375 0.0325  125 SER A CB  
1003 O OG  . SER A 125 ? 0.6036 0.6376 0.5053 0.0114  -0.0368 0.0383  125 SER A OG  
1004 N N   . GLY A 126 ? 0.4688 0.5004 0.3738 0.0054  -0.0495 0.0227  126 GLY A N   
1005 C CA  . GLY A 126 ? 0.5058 0.5437 0.4085 0.0131  -0.0521 0.0217  126 GLY A CA  
1006 C C   . GLY A 126 ? 0.5802 0.6114 0.4783 0.0077  -0.0562 0.0156  126 GLY A C   
1007 O O   . GLY A 126 ? 0.5915 0.6206 0.4921 -0.0028 -0.0594 0.0114  126 GLY A O   
1008 N N   . ALA A 127 ? 0.5747 0.6069 0.4663 0.0145  -0.0562 0.0150  127 ALA A N   
1009 C CA  . ALA A 127 ? 0.5261 0.5517 0.4086 0.0112  -0.0594 0.0097  127 ALA A CA  
1010 C C   . ALA A 127 ? 0.5758 0.6104 0.4545 0.0193  -0.0577 0.0113  127 ALA A C   
1011 O O   . ALA A 127 ? 0.5096 0.5491 0.3876 0.0288  -0.0523 0.0150  127 ALA A O   
1012 C CB  . ALA A 127 ? 0.4814 0.4794 0.3468 0.0085  -0.0552 0.0046  127 ALA A CB  
1013 N N   . ALA A 128 ? 0.5804 0.6196 0.4560 0.0159  -0.0621 0.0094  128 ALA A N   
1014 C CA  . ALA A 128 ? 0.5650 0.6133 0.4360 0.0210  -0.0591 0.0114  128 ALA A CA  
1015 C C   . ALA A 128 ? 0.5396 0.5760 0.3939 0.0281  -0.0532 0.0079  128 ALA A C   
1016 O O   . ALA A 128 ? 0.5734 0.6198 0.4233 0.0333  -0.0488 0.0093  128 ALA A O   
1017 C CB  . ALA A 128 ? 0.5784 0.6327 0.4488 0.0157  -0.0644 0.0126  128 ALA A CB  
1018 N N   . SER A 129 ? 0.4754 0.4891 0.3191 0.0277  -0.0516 0.0029  129 SER A N   
1019 C CA  . SER A 129 ? 0.4798 0.4733 0.3022 0.0339  -0.0453 -0.0027 129 SER A CA  
1020 C C   . SER A 129 ? 0.5821 0.5627 0.3980 0.0487  -0.0352 -0.0002 129 SER A C   
1021 O O   . SER A 129 ? 0.6465 0.6049 0.4422 0.0572  -0.0278 -0.0050 129 SER A O   
1022 C CB  . SER A 129 ? 0.5757 0.5465 0.3843 0.0218  -0.0492 -0.0120 129 SER A CB  
1023 O OG  . SER A 129 ? 0.5693 0.5307 0.3852 0.0137  -0.0506 -0.0119 129 SER A OG  
1024 N N   . LEU A 130 ? 0.6266 0.6201 0.4572 0.0533  -0.0347 0.0073  130 LEU A N   
1025 C CA  . LEU A 130 ? 0.5600 0.5466 0.3849 0.0708  -0.0259 0.0126  130 LEU A CA  
1026 C C   . LEU A 130 ? 0.5596 0.5652 0.3817 0.0870  -0.0197 0.0144  130 LEU A C   
1027 O O   . LEU A 130 ? 0.5721 0.6084 0.4056 0.0826  -0.0226 0.0151  130 LEU A O   
1028 C CB  . LEU A 130 ? 0.5965 0.6017 0.4378 0.0722  -0.0282 0.0209  130 LEU A CB  
1029 C CG  . LEU A 130 ? 0.6107 0.6050 0.4579 0.0571  -0.0332 0.0203  130 LEU A CG  
1030 C CD1 . LEU A 130 ? 0.6790 0.6912 0.5376 0.0618  -0.0334 0.0285  130 LEU A CD1 
1031 C CD2 . LEU A 130 ? 0.4948 0.4472 0.3231 0.0528  -0.0284 0.0160  130 LEU A CD2 
1032 N N   . ASP A 131 ? 0.5460 0.5322 0.3519 0.1061  -0.0097 0.0156  131 ASP A N   
1033 C CA  . ASP A 131 ? 0.5968 0.6038 0.4001 0.1257  -0.0018 0.0178  131 ASP A CA  
1034 C C   . ASP A 131 ? 0.6488 0.7113 0.4772 0.1280  -0.0050 0.0252  131 ASP A C   
1035 O O   . ASP A 131 ? 0.7685 0.8612 0.6026 0.1297  -0.0025 0.0245  131 ASP A O   
1036 C CB  . ASP A 131 ? 0.6124 0.5902 0.3958 0.1508  0.0098  0.0209  131 ASP A CB  
1037 C CG  . ASP A 131 ? 0.8145 0.7384 0.5671 0.1505  0.0169  0.0104  131 ASP A CG  
1038 O OD1 . ASP A 131 ? 0.8892 0.8030 0.6382 0.1288  0.0106  0.0009  131 ASP A OD1 
1039 O OD2 . ASP A 131 ? 0.9547 0.8460 0.6849 0.1722  0.0288  0.0113  131 ASP A OD2 
1040 N N   . VAL A 132 ? 0.5367 0.6126 0.3786 0.1255  -0.0101 0.0315  132 VAL A N   
1041 C CA  . VAL A 132 ? 0.4850 0.6130 0.3481 0.1277  -0.0129 0.0378  132 VAL A CA  
1042 C C   . VAL A 132 ? 0.5057 0.6576 0.3840 0.1041  -0.0200 0.0339  132 VAL A C   
1043 O O   . VAL A 132 ? 0.4949 0.6895 0.3894 0.0995  -0.0220 0.0364  132 VAL A O   
1044 C CB  . VAL A 132 ? 0.5108 0.6420 0.3783 0.1338  -0.0157 0.0454  132 VAL A CB  
1045 C CG1 . VAL A 132 ? 0.3616 0.4757 0.2338 0.1119  -0.0235 0.0426  132 VAL A CG1 
1046 C CG2 . VAL A 132 ? 0.6120 0.7997 0.4966 0.1417  -0.0175 0.0516  132 VAL A CG2 
1047 N N   . TYR A 133 ? 0.4380 0.5615 0.3089 0.0891  -0.0234 0.0278  133 TYR A N   
1048 C CA  . TYR A 133 ? 0.4942 0.6305 0.3737 0.0698  -0.0286 0.0255  133 TYR A CA  
1049 C C   . TYR A 133 ? 0.5963 0.7322 0.4658 0.0682  -0.0244 0.0224  133 TYR A C   
1050 O O   . TYR A 133 ? 0.5199 0.6537 0.3890 0.0536  -0.0280 0.0211  133 TYR A O   
1051 C CB  . TYR A 133 ? 0.5107 0.6218 0.3902 0.0556  -0.0364 0.0230  133 TYR A CB  
1052 C CG  . TYR A 133 ? 0.5365 0.6469 0.4245 0.0549  -0.0398 0.0256  133 TYR A CG  
1053 C CD1 . TYR A 133 ? 0.4968 0.6357 0.3947 0.0608  -0.0388 0.0302  133 TYR A CD1 
1054 C CD2 . TYR A 133 ? 0.4593 0.5450 0.3451 0.0479  -0.0438 0.0236  133 TYR A CD2 
1055 C CE1 . TYR A 133 ? 0.3865 0.5250 0.2888 0.0606  -0.0415 0.0328  133 TYR A CE1 
1056 C CE2 . TYR A 133 ? 0.4724 0.5583 0.3645 0.0471  -0.0454 0.0263  133 TYR A CE2 
1057 C CZ  . TYR A 133 ? 0.5228 0.6332 0.4218 0.0538  -0.0441 0.0310  133 TYR A CZ  
1058 O OH  . TYR A 133 ? 0.4130 0.5241 0.3154 0.0533  -0.0454 0.0340  133 TYR A OH  
1059 N N   . ASP A 134 ? 0.6237 0.7600 0.4829 0.0850  -0.0160 0.0217  134 ASP A N   
1060 C CA  . ASP A 134 ? 0.5690 0.7047 0.4152 0.0861  -0.0101 0.0182  134 ASP A CA  
1061 C C   . ASP A 134 ? 0.5312 0.7059 0.3890 0.0758  -0.0079 0.0213  134 ASP A C   
1062 O O   . ASP A 134 ? 0.5323 0.7463 0.4029 0.0829  -0.0025 0.0249  134 ASP A O   
1063 C CB  . ASP A 134 ? 0.4715 0.6014 0.3042 0.1100  0.0006  0.0168  134 ASP A CB  
1064 C CG  . ASP A 134 ? 0.6890 0.8039 0.5006 0.1122  0.0069  0.0103  134 ASP A CG  
1065 O OD1 . ASP A 134 ? 0.7295 0.8595 0.5418 0.0990  0.0060  0.0103  134 ASP A OD1 
1066 O OD2 . ASP A 134 ? 0.7935 0.8783 0.5845 0.1276  0.0138  0.0052  134 ASP A OD2 
1067 N N   . GLY A 135 ? 0.5452 0.7099 0.3976 0.0589  -0.0115 0.0205  135 GLY A N   
1068 C CA  . GLY A 135 ? 0.4683 0.6613 0.3282 0.0453  -0.0083 0.0241  135 GLY A CA  
1069 C C   . GLY A 135 ? 0.4895 0.7023 0.3411 0.0506  0.0027  0.0243  135 GLY A C   
1070 O O   . GLY A 135 ? 0.3986 0.6313 0.2529 0.0365  0.0068  0.0276  135 GLY A O   
1071 N N   . ARG A 136 ? 0.4763 0.6823 0.3162 0.0705  0.0089  0.0207  136 ARG A N   
1072 C CA  . ARG A 136 ? 0.5154 0.7367 0.3436 0.0769  0.0203  0.0197  136 ARG A CA  
1073 C C   . ARG A 136 ? 0.6056 0.8839 0.4541 0.0795  0.0291  0.0243  136 ARG A C   
1074 O O   . ARG A 136 ? 0.6408 0.9439 0.4867 0.0742  0.0384  0.0258  136 ARG A O   
1075 C CB  . ARG A 136 ? 0.5005 0.6940 0.3064 0.0982  0.0260  0.0127  136 ARG A CB  
1076 C CG  . ARG A 136 ? 0.5799 0.7886 0.3929 0.1236  0.0334  0.0133  136 ARG A CG  
1077 C CD  . ARG A 136 ? 0.5912 0.7608 0.3763 0.1440  0.0408  0.0055  136 ARG A CD  
1078 N NE  . ARG A 136 ? 0.6430 0.7594 0.4123 0.1354  0.0316  -0.0005 136 ARG A NE  
1079 C CZ  . ARG A 136 ? 0.7555 0.8279 0.4952 0.1417  0.0352  -0.0104 136 ARG A CZ  
1080 N NH1 . ARG A 136 ? 0.7426 0.8137 0.4631 0.1591  0.0486  -0.0155 136 ARG A NH1 
1081 N NH2 . ARG A 136 ? 0.7708 0.8020 0.4995 0.1295  0.0260  -0.0161 136 ARG A NH2 
1082 N N   . PHE A 137 ? 0.5867 0.8895 0.4555 0.0868  0.0263  0.0268  137 PHE A N   
1083 C CA  . PHE A 137 ? 0.4696 0.8354 0.3602 0.0907  0.0332  0.0307  137 PHE A CA  
1084 C C   . PHE A 137 ? 0.4363 0.8307 0.3417 0.0599  0.0311  0.0331  137 PHE A C   
1085 O O   . PHE A 137 ? 0.4865 0.9268 0.4014 0.0523  0.0402  0.0350  137 PHE A O   
1086 C CB  . PHE A 137 ? 0.4552 0.8402 0.3598 0.1107  0.0301  0.0333  137 PHE A CB  
1087 C CG  . PHE A 137 ? 0.5577 0.9065 0.4440 0.1407  0.0340  0.0317  137 PHE A CG  
1088 C CD1 . PHE A 137 ? 0.5309 0.8955 0.4096 0.1666  0.0470  0.0314  137 PHE A CD1 
1089 C CD2 . PHE A 137 ? 0.5174 0.8145 0.3924 0.1427  0.0260  0.0301  137 PHE A CD2 
1090 C CE1 . PHE A 137 ? 0.5158 0.8383 0.3728 0.1944  0.0525  0.0290  137 PHE A CE1 
1091 C CE2 . PHE A 137 ? 0.5004 0.7577 0.3550 0.1671  0.0311  0.0280  137 PHE A CE2 
1092 C CZ  . PHE A 137 ? 0.5295 0.7961 0.3734 0.1932  0.0446  0.0273  137 PHE A CZ  
1093 N N   . LEU A 138 ? 0.3830 0.7488 0.2889 0.0417  0.0206  0.0327  138 LEU A N   
1094 C CA  . LEU A 138 ? 0.4734 0.8521 0.3869 0.0115  0.0197  0.0340  138 LEU A CA  
1095 C C   . LEU A 138 ? 0.5020 0.8669 0.3987 -0.0022 0.0276  0.0359  138 LEU A C   
1096 O O   . LEU A 138 ? 0.5748 0.9687 0.4775 -0.0228 0.0347  0.0381  138 LEU A O   
1097 C CB  . LEU A 138 ? 0.4548 0.7972 0.3674 -0.0010 0.0082  0.0326  138 LEU A CB  
1098 C CG  . LEU A 138 ? 0.4662 0.8327 0.3971 0.0028  0.0013  0.0315  138 LEU A CG  
1099 C CD1 . LEU A 138 ? 0.4874 0.8110 0.4132 -0.0033 -0.0088 0.0296  138 LEU A CD1 
1100 C CD2 . LEU A 138 ? 0.4135 0.8350 0.3628 -0.0166 0.0042  0.0309  138 LEU A CD2 
1101 N N   . ALA A 139 ? 0.4779 0.7995 0.3521 0.0083  0.0266  0.0351  139 ALA A N   
1102 C CA  . ALA A 139 ? 0.5382 0.8420 0.3914 -0.0021 0.0327  0.0379  139 ALA A CA  
1103 C C   . ALA A 139 ? 0.6008 0.9470 0.4547 0.0025  0.0474  0.0390  139 ALA A C   
1104 O O   . ALA A 139 ? 0.5928 0.9539 0.4434 -0.0169 0.0559  0.0434  139 ALA A O   
1105 C CB  . ALA A 139 ? 0.5553 0.8092 0.3844 0.0091  0.0263  0.0356  139 ALA A CB  
1106 N N   . GLN A 140 ? 0.6307 0.9950 0.4876 0.0285  0.0517  0.0353  140 GLN A N   
1107 C CA  . GLN A 140 ? 0.6970 1.1039 0.5546 0.0380  0.0669  0.0359  140 GLN A CA  
1108 C C   . GLN A 140 ? 0.7299 1.2034 0.6164 0.0247  0.0731  0.0393  140 GLN A C   
1109 O O   . GLN A 140 ? 0.7489 1.2540 0.6361 0.0097  0.0848  0.0424  140 GLN A O   
1110 C CB  . GLN A 140 ? 0.7238 1.1300 0.5760 0.0728  0.0710  0.0309  140 GLN A CB  
1111 C CG  . GLN A 140 ? 0.7178 1.1441 0.5561 0.0867  0.0874  0.0293  140 GLN A CG  
1112 C CD  . GLN A 140 ? 0.6960 1.1995 0.5600 0.0878  0.1000  0.0334  140 GLN A CD  
1113 O OE1 . GLN A 140 ? 0.5453 1.0909 0.4370 0.0936  0.0970  0.0354  140 GLN A OE1 
1114 N NE2 . GLN A 140 ? 0.6588 1.1854 0.5134 0.0818  0.1144  0.0348  140 GLN A NE2 
1115 N N   . VAL A 141 ? 0.6060 1.1037 0.5158 0.0290  0.0654  0.0386  141 VAL A N   
1116 C CA  . VAL A 141 ? 0.5775 1.1493 0.5166 0.0203  0.0701  0.0404  141 VAL A CA  
1117 C C   . VAL A 141 ? 0.4995 1.0799 0.4461 -0.0206 0.0686  0.0415  141 VAL A C   
1118 O O   . VAL A 141 ? 0.4267 1.0610 0.3870 -0.0394 0.0786  0.0430  141 VAL A O   
1119 C CB  . VAL A 141 ? 0.5874 1.1897 0.5468 0.0436  0.0631  0.0400  141 VAL A CB  
1120 C CG1 . VAL A 141 ? 0.4654 1.1547 0.4563 0.0346  0.0669  0.0416  141 VAL A CG1 
1121 C CG2 . VAL A 141 ? 0.6224 1.2117 0.5700 0.0844  0.0683  0.0394  141 VAL A CG2 
1122 N N   . GLU A 142 ? 0.3902 0.9166 0.3265 -0.0352 0.0575  0.0405  142 GLU A N   
1123 C CA  . GLU A 142 ? 0.4688 0.9928 0.4073 -0.0729 0.0573  0.0407  142 GLU A CA  
1124 C C   . GLU A 142 ? 0.5695 1.0396 0.4798 -0.0914 0.0625  0.0449  142 GLU A C   
1125 O O   . GLU A 142 ? 0.5207 0.9822 0.4272 -0.1231 0.0659  0.0462  142 GLU A O   
1126 C CB  . GLU A 142 ? 0.4309 0.9389 0.3778 -0.0796 0.0436  0.0368  142 GLU A CB  
1127 C CG  . GLU A 142 ? 0.4556 1.0290 0.4311 -0.0713 0.0393  0.0339  142 GLU A CG  
1128 C CD  . GLU A 142 ? 0.6524 1.2983 0.6480 -0.0955 0.0480  0.0330  142 GLU A CD  
1129 O OE1 . GLU A 142 ? 0.7211 1.3557 0.7075 -0.1277 0.0559  0.0333  142 GLU A OE1 
1130 O OE2 . GLU A 142 ? 0.7470 1.4626 0.7669 -0.0826 0.0474  0.0325  142 GLU A OE2 
1131 N N   . GLY A 143 ? 0.5442 0.9768 0.4325 -0.0717 0.0632  0.0471  143 GLY A N   
1132 C CA  . GLY A 143 ? 0.5655 0.9491 0.4247 -0.0843 0.0669  0.0526  143 GLY A CA  
1133 C C   . GLY A 143 ? 0.6084 0.9325 0.4555 -0.0901 0.0547  0.0532  143 GLY A C   
1134 O O   . GLY A 143 ? 0.6897 0.9716 0.5134 -0.1024 0.0566  0.0593  143 GLY A O   
1135 N N   . ALA A 144 ? 0.5635 0.8846 0.4252 -0.0791 0.0428  0.0478  144 ALA A N   
1136 C CA  . ALA A 144 ? 0.5929 0.8659 0.4476 -0.0845 0.0321  0.0475  144 ALA A CA  
1137 C C   . ALA A 144 ? 0.5887 0.8126 0.4212 -0.0682 0.0252  0.0500  144 ALA A C   
1138 O O   . ALA A 144 ? 0.5595 0.7864 0.3862 -0.0487 0.0249  0.0484  144 ALA A O   
1139 C CB  . ALA A 144 ? 0.5046 0.7941 0.3814 -0.0779 0.0225  0.0412  144 ALA A CB  
1140 N N   . VAL A 145 ? 0.5248 0.7046 0.3440 -0.0760 0.0199  0.0534  145 VAL A N   
1141 C CA  . VAL A 145 ? 0.4662 0.6081 0.2708 -0.0598 0.0100  0.0546  145 VAL A CA  
1142 C C   . VAL A 145 ? 0.5855 0.7201 0.4062 -0.0526 -0.0013 0.0489  145 VAL A C   
1143 O O   . VAL A 145 ? 0.6344 0.7603 0.4612 -0.0646 -0.0025 0.0482  145 VAL A O   
1144 C CB  . VAL A 145 ? 0.5919 0.6918 0.3699 -0.0669 0.0111  0.0641  145 VAL A CB  
1145 C CG1 . VAL A 145 ? 0.6180 0.6897 0.3853 -0.0493 -0.0012 0.0648  145 VAL A CG1 
1146 C CG2 . VAL A 145 ? 0.5416 0.6476 0.3003 -0.0741 0.0232  0.0711  145 VAL A CG2 
1147 N N   . LEU A 146 ? 0.6216 0.7582 0.4466 -0.0341 -0.0083 0.0443  146 LEU A N   
1148 C CA  . LEU A 146 ? 0.6251 0.7598 0.4655 -0.0266 -0.0171 0.0392  146 LEU A CA  
1149 C C   . LEU A 146 ? 0.6852 0.7892 0.5160 -0.0168 -0.0269 0.0390  146 LEU A C   
1150 O O   . LEU A 146 ? 0.7050 0.8024 0.5228 -0.0080 -0.0283 0.0382  146 LEU A O   
1151 C CB  . LEU A 146 ? 0.5893 0.7538 0.4430 -0.0140 -0.0153 0.0344  146 LEU A CB  
1152 C CG  . LEU A 146 ? 0.5856 0.7619 0.4573 -0.0074 -0.0203 0.0307  146 LEU A CG  
1153 C CD1 . LEU A 146 ? 0.5016 0.6478 0.3719 -0.0025 -0.0299 0.0290  146 LEU A CD1 
1154 C CD2 . LEU A 146 ? 0.6847 0.8870 0.5713 -0.0219 -0.0184 0.0305  146 LEU A CD2 
1155 N N   . VAL A 147 ? 0.5699 0.6580 0.4067 -0.0190 -0.0333 0.0389  147 VAL A N   
1156 C CA  . VAL A 147 ? 0.4919 0.5594 0.3241 -0.0105 -0.0427 0.0389  147 VAL A CA  
1157 C C   . VAL A 147 ? 0.6230 0.6947 0.4725 -0.0063 -0.0481 0.0338  147 VAL A C   
1158 O O   . VAL A 147 ? 0.5930 0.6684 0.4530 -0.0123 -0.0467 0.0329  147 VAL A O   
1159 C CB  . VAL A 147 ? 0.5875 0.6301 0.4086 -0.0141 -0.0443 0.0457  147 VAL A CB  
1160 C CG1 . VAL A 147 ? 0.5072 0.5387 0.3272 -0.0033 -0.0548 0.0461  147 VAL A CG1 
1161 C CG2 . VAL A 147 ? 0.6150 0.6483 0.4153 -0.0195 -0.0376 0.0533  147 VAL A CG2 
1162 N N   . SER A 148 ? 0.5692 0.6391 0.4198 0.0023  -0.0536 0.0299  148 SER A N   
1163 C CA  . SER A 148 ? 0.4091 0.4800 0.2736 0.0051  -0.0578 0.0263  148 SER A CA  
1164 C C   . SER A 148 ? 0.5257 0.5858 0.3879 0.0082  -0.0661 0.0254  148 SER A C   
1165 O O   . SER A 148 ? 0.5296 0.5856 0.3794 0.0101  -0.0691 0.0245  148 SER A O   
1166 C CB  . SER A 148 ? 0.4728 0.5536 0.3419 0.0111  -0.0547 0.0224  148 SER A CB  
1167 O OG  . SER A 148 ? 0.4510 0.5224 0.3077 0.0162  -0.0554 0.0190  148 SER A OG  
1168 N N   . MET A 149 ? 0.4223 0.4816 0.2961 0.0083  -0.0697 0.0252  149 MET A N   
1169 C CA  . MET A 149 ? 0.4689 0.5267 0.3445 0.0109  -0.0775 0.0247  149 MET A CA  
1170 C C   . MET A 149 ? 0.5156 0.5787 0.4041 0.0101  -0.0791 0.0200  149 MET A C   
1171 O O   . MET A 149 ? 0.4903 0.5558 0.3870 0.0095  -0.0747 0.0193  149 MET A O   
1172 C CB  . MET A 149 ? 0.4579 0.5100 0.3335 0.0141  -0.0796 0.0302  149 MET A CB  
1173 C CG  . MET A 149 ? 0.4731 0.5265 0.3627 0.0151  -0.0785 0.0292  149 MET A CG  
1174 S SD  . MET A 149 ? 0.5890 0.6407 0.4820 0.0080  -0.0700 0.0270  149 MET A SD  
1175 C CE  . MET A 149 ? 0.3316 0.3628 0.2101 0.0050  -0.0652 0.0320  149 MET A CE  
1176 N N   . ASN A 150 ? 0.4315 0.4982 0.3204 0.0089  -0.0853 0.0170  150 ASN A N   
1177 C CA  . ASN A 150 ? 0.4796 0.5527 0.3814 0.0056  -0.0868 0.0138  150 ASN A CA  
1178 C C   . ASN A 150 ? 0.5381 0.6218 0.4523 0.0096  -0.0897 0.0173  150 ASN A C   
1179 O O   . ASN A 150 ? 0.4930 0.5788 0.4032 0.0153  -0.0937 0.0215  150 ASN A O   
1180 C CB  . ASN A 150 ? 0.4117 0.4872 0.3092 -0.0013 -0.0918 0.0078  150 ASN A CB  
1181 C CG  . ASN A 150 ? 0.4765 0.5345 0.3607 -0.0048 -0.0864 0.0025  150 ASN A CG  
1182 O OD1 . ASN A 150 ? 0.4224 0.4716 0.3024 0.0008  -0.0794 0.0046  150 ASN A OD1 
1183 N ND2 . ASN A 150 ? 0.4680 0.5215 0.3447 -0.0138 -0.0893 -0.0048 150 ASN A ND2 
1184 N N   . TYR A 151 ? 0.5547 0.6435 0.4816 0.0084  -0.0866 0.0164  151 TYR A N   
1185 C CA  . TYR A 151 ? 0.5046 0.6054 0.4435 0.0135  -0.0882 0.0184  151 TYR A CA  
1186 C C   . TYR A 151 ? 0.4694 0.5837 0.4215 0.0073  -0.0873 0.0152  151 TYR A C   
1187 O O   . TYR A 151 ? 0.4567 0.5630 0.4062 0.0002  -0.0832 0.0129  151 TYR A O   
1188 C CB  . TYR A 151 ? 0.4667 0.5572 0.4044 0.0188  -0.0825 0.0207  151 TYR A CB  
1189 C CG  . TYR A 151 ? 0.5588 0.6455 0.4977 0.0141  -0.0762 0.0185  151 TYR A CG  
1190 C CD1 . TYR A 151 ? 0.5004 0.5800 0.4306 0.0109  -0.0735 0.0185  151 TYR A CD1 
1191 C CD2 . TYR A 151 ? 0.5755 0.6701 0.5241 0.0141  -0.0730 0.0171  151 TYR A CD2 
1192 C CE1 . TYR A 151 ? 0.4362 0.5185 0.3678 0.0090  -0.0689 0.0176  151 TYR A CE1 
1193 C CE2 . TYR A 151 ? 0.3709 0.4646 0.3183 0.0111  -0.0681 0.0162  151 TYR A CE2 
1194 C CZ  . TYR A 151 ? 0.4370 0.5255 0.3761 0.0091  -0.0667 0.0167  151 TYR A CZ  
1195 O OH  . TYR A 151 ? 0.4133 0.5067 0.3516 0.0085  -0.0629 0.0169  151 TYR A OH  
1196 N N   . ARG A 152 ? 0.4483 0.5834 0.4136 0.0106  -0.0903 0.0158  152 ARG A N   
1197 C CA  . ARG A 152 ? 0.4534 0.6060 0.4324 0.0022  -0.0887 0.0129  152 ARG A CA  
1198 C C   . ARG A 152 ? 0.4829 0.6275 0.4642 0.0015  -0.0797 0.0134  152 ARG A C   
1199 O O   . ARG A 152 ? 0.3936 0.5324 0.3736 0.0104  -0.0761 0.0151  152 ARG A O   
1200 C CB  . ARG A 152 ? 0.4438 0.6292 0.4391 0.0074  -0.0935 0.0138  152 ARG A CB  
1201 C CG  . ARG A 152 ? 0.5113 0.7172 0.5080 0.0008  -0.1034 0.0114  152 ARG A CG  
1202 C CD  . ARG A 152 ? 0.4456 0.6916 0.4596 0.0110  -0.1094 0.0142  152 ARG A CD  
1203 N NE  . ARG A 152 ? 0.3683 0.6041 0.3759 0.0328  -0.1095 0.0213  152 ARG A NE  
1204 C CZ  . ARG A 152 ? 0.3750 0.6359 0.3929 0.0503  -0.1122 0.0263  152 ARG A CZ  
1205 N NH1 . ARG A 152 ? 0.3443 0.6515 0.3839 0.0484  -0.1160 0.0247  152 ARG A NH1 
1206 N NH2 . ARG A 152 ? 0.4017 0.6409 0.4074 0.0699  -0.1102 0.0331  152 ARG A NH2 
1207 N N   . VAL A 153 ? 0.4539 0.5953 0.4351 -0.0098 -0.0757 0.0118  153 VAL A N   
1208 C CA  . VAL A 153 ? 0.5128 0.6486 0.4939 -0.0104 -0.0674 0.0137  153 VAL A CA  
1209 C C   . VAL A 153 ? 0.5842 0.7391 0.5780 -0.0192 -0.0635 0.0133  153 VAL A C   
1210 O O   . VAL A 153 ? 0.6501 0.8226 0.6530 -0.0280 -0.0674 0.0106  153 VAL A O   
1211 C CB  . VAL A 153 ? 0.4301 0.5412 0.3958 -0.0135 -0.0633 0.0150  153 VAL A CB  
1212 C CG1 . VAL A 153 ? 0.3871 0.4869 0.3430 -0.0051 -0.0655 0.0157  153 VAL A CG1 
1213 C CG2 . VAL A 153 ? 0.2817 0.3818 0.2410 -0.0256 -0.0635 0.0123  153 VAL A CG2 
1214 N N   . GLY A 154 ? 0.4945 0.6491 0.4886 -0.0180 -0.0557 0.0158  154 GLY A N   
1215 C CA  . GLY A 154 ? 0.4551 0.6265 0.4591 -0.0275 -0.0494 0.0165  154 GLY A CA  
1216 C C   . GLY A 154 ? 0.4170 0.6245 0.4415 -0.0235 -0.0509 0.0147  154 GLY A C   
1217 O O   . GLY A 154 ? 0.4569 0.6707 0.4847 -0.0082 -0.0530 0.0143  154 GLY A O   
1218 N N   . THR A 155 ? 0.2977 0.5287 0.3351 -0.0373 -0.0487 0.0137  155 THR A N   
1219 C CA  . THR A 155 ? 0.4191 0.6939 0.4792 -0.0331 -0.0500 0.0124  155 THR A CA  
1220 C C   . THR A 155 ? 0.5100 0.7970 0.5752 -0.0210 -0.0616 0.0110  155 THR A C   
1221 O O   . THR A 155 ? 0.5293 0.8332 0.6029 -0.0023 -0.0624 0.0123  155 THR A O   
1222 C CB  . THR A 155 ? 0.3880 0.6909 0.4621 -0.0551 -0.0467 0.0108  155 THR A CB  
1223 O OG1 . THR A 155 ? 0.4784 0.7652 0.5433 -0.0725 -0.0525 0.0072  155 THR A OG1 
1224 C CG2 . THR A 155 ? 0.3890 0.6814 0.4572 -0.0649 -0.0334 0.0143  155 THR A CG2 
1225 N N   . PHE A 156 ? 0.4789 0.7536 0.5355 -0.0303 -0.0696 0.0087  156 PHE A N   
1226 C CA  . PHE A 156 ? 0.3997 0.6868 0.4579 -0.0208 -0.0812 0.0083  156 PHE A CA  
1227 C C   . PHE A 156 ? 0.3777 0.6426 0.4251 0.0012  -0.0818 0.0121  156 PHE A C   
1228 O O   . PHE A 156 ? 0.3997 0.6792 0.4512 0.0167  -0.0876 0.0146  156 PHE A O   
1229 C CB  . PHE A 156 ? 0.3166 0.5869 0.3613 -0.0360 -0.0878 0.0041  156 PHE A CB  
1230 C CG  . PHE A 156 ? 0.3678 0.6388 0.4132 -0.0617 -0.0836 -0.0007 156 PHE A CG  
1231 C CD1 . PHE A 156 ? 0.2861 0.5983 0.3479 -0.0773 -0.0883 -0.0054 156 PHE A CD1 
1232 C CD2 . PHE A 156 ? 0.3594 0.5901 0.3881 -0.0704 -0.0742 -0.0001 156 PHE A CD2 
1233 C CE1 . PHE A 156 ? 0.4450 0.7534 0.5049 -0.1049 -0.0830 -0.0105 156 PHE A CE1 
1234 C CE2 . PHE A 156 ? 0.3202 0.5429 0.3450 -0.0939 -0.0684 -0.0036 156 PHE A CE2 
1235 C CZ  . PHE A 156 ? 0.3837 0.6431 0.4235 -0.1131 -0.0723 -0.0094 156 PHE A CZ  
1236 N N   . GLY A 157 ? 0.3877 0.6177 0.4203 0.0023  -0.0754 0.0128  157 GLY A N   
1237 C CA  . GLY A 157 ? 0.3999 0.6074 0.4210 0.0180  -0.0746 0.0149  157 GLY A CA  
1238 C C   . GLY A 157 ? 0.4371 0.6476 0.4621 0.0304  -0.0669 0.0152  157 GLY A C   
1239 O O   . GLY A 157 ? 0.4221 0.6203 0.4402 0.0451  -0.0666 0.0164  157 GLY A O   
1240 N N   . PHE A 158 ? 0.4261 0.6494 0.4589 0.0243  -0.0594 0.0139  158 PHE A N   
1241 C CA  . PHE A 158 ? 0.2771 0.4968 0.3076 0.0347  -0.0507 0.0126  158 PHE A CA  
1242 C C   . PHE A 158 ? 0.4502 0.7029 0.4972 0.0373  -0.0433 0.0120  158 PHE A C   
1243 O O   . PHE A 158 ? 0.4889 0.7386 0.5321 0.0477  -0.0351 0.0098  158 PHE A O   
1244 C CB  . PHE A 158 ? 0.2752 0.4665 0.2882 0.0284  -0.0464 0.0114  158 PHE A CB  
1245 C CG  . PHE A 158 ? 0.3637 0.5277 0.3618 0.0284  -0.0517 0.0115  158 PHE A CG  
1246 C CD1 . PHE A 158 ? 0.3793 0.5250 0.3671 0.0384  -0.0510 0.0097  158 PHE A CD1 
1247 C CD2 . PHE A 158 ? 0.3721 0.5272 0.3651 0.0182  -0.0560 0.0132  158 PHE A CD2 
1248 C CE1 . PHE A 158 ? 0.3897 0.5129 0.3643 0.0358  -0.0546 0.0101  158 PHE A CE1 
1249 C CE2 . PHE A 158 ? 0.4517 0.5867 0.4324 0.0186  -0.0597 0.0135  158 PHE A CE2 
1250 C CZ  . PHE A 158 ? 0.5014 0.6227 0.4739 0.0262  -0.0591 0.0122  158 PHE A CZ  
1251 N N   . LEU A 159 ? 0.4811 0.7666 0.5458 0.0270  -0.0453 0.0131  159 LEU A N   
1252 C CA  . LEU A 159 ? 0.4246 0.7497 0.5083 0.0295  -0.0379 0.0128  159 LEU A CA  
1253 C C   . LEU A 159 ? 0.3869 0.7268 0.4775 0.0553  -0.0375 0.0129  159 LEU A C   
1254 O O   . LEU A 159 ? 0.5549 0.8959 0.6462 0.0661  -0.0463 0.0149  159 LEU A O   
1255 C CB  . LEU A 159 ? 0.2496 0.6122 0.3526 0.0109  -0.0409 0.0131  159 LEU A CB  
1256 C CG  . LEU A 159 ? 0.4538 0.8661 0.5800 0.0087  -0.0324 0.0131  159 LEU A CG  
1257 C CD1 . LEU A 159 ? 0.3910 0.8195 0.5252 -0.0214 -0.0301 0.0128  159 LEU A CD1 
1258 C CD2 . LEU A 159 ? 0.4598 0.9191 0.6081 0.0274  -0.0373 0.0136  159 LEU A CD2 
1259 N N   . ALA A 160 ? 0.4280 0.7768 0.5206 0.0667  -0.0264 0.0111  160 ALA A N   
1260 C CA  . ALA A 160 ? 0.4217 0.7748 0.5153 0.0946  -0.0232 0.0108  160 ALA A CA  
1261 C C   . ALA A 160 ? 0.4018 0.7953 0.5122 0.1048  -0.0116 0.0094  160 ALA A C   
1262 O O   . ALA A 160 ? 0.5071 0.9006 0.6138 0.0955  -0.0014 0.0067  160 ALA A O   
1263 C CB  . ALA A 160 ? 0.4708 0.7692 0.5358 0.1043  -0.0198 0.0074  160 ALA A CB  
1264 N N   . LEU A 161 ? 0.3697 0.8008 0.4982 0.1254  -0.0131 0.0122  161 LEU A N   
1265 C CA  . LEU A 161 ? 0.3650 0.8297 0.5062 0.1455  -0.0008 0.0109  161 LEU A CA  
1266 C C   . LEU A 161 ? 0.4408 0.8693 0.5629 0.1780  0.0022  0.0105  161 LEU A C   
1267 O O   . LEU A 161 ? 0.4690 0.9174 0.6006 0.2010  -0.0030 0.0160  161 LEU A O   
1268 C CB  . LEU A 161 ? 0.3773 0.9169 0.5543 0.1467  -0.0044 0.0149  161 LEU A CB  
1269 C CG  . LEU A 161 ? 0.4815 1.0494 0.6733 0.1100  -0.0051 0.0142  161 LEU A CG  
1270 C CD1 . LEU A 161 ? 0.6145 1.2624 0.8431 0.1067  -0.0073 0.0164  161 LEU A CD1 
1271 C CD2 . LEU A 161 ? 0.4803 1.0317 0.6610 0.0997  0.0100  0.0108  161 LEU A CD2 
1272 N N   . PRO A 162 ? 0.4495 0.8223 0.5421 0.1791  0.0104  0.0043  162 PRO A N   
1273 C CA  . PRO A 162 ? 0.4675 0.7880 0.5332 0.2028  0.0142  0.0022  162 PRO A CA  
1274 C C   . PRO A 162 ? 0.5114 0.8546 0.5857 0.2401  0.0215  0.0051  162 PRO A C   
1275 O O   . PRO A 162 ? 0.5611 0.9468 0.6523 0.2501  0.0319  0.0030  162 PRO A O   
1276 C CB  . PRO A 162 ? 0.5088 0.7881 0.5485 0.1935  0.0253  -0.0080 162 PRO A CB  
1277 C CG  . PRO A 162 ? 0.4618 0.7559 0.5088 0.1609  0.0206  -0.0079 162 PRO A CG  
1278 C CD  . PRO A 162 ? 0.4447 0.8029 0.5264 0.1566  0.0174  -0.0015 162 PRO A CD  
1279 N N   . GLY A 163 ? 0.5023 0.8184 0.5644 0.2619  0.0167  0.0109  163 GLY A N   
1280 C CA  . GLY A 163 ? 0.4893 0.8229 0.5565 0.3025  0.0228  0.0162  163 GLY A CA  
1281 C C   . GLY A 163 ? 0.5751 0.9770 0.6751 0.3124  0.0100  0.0274  163 GLY A C   
1282 O O   . GLY A 163 ? 0.6815 1.0944 0.7828 0.3484  0.0104  0.0355  163 GLY A O   
1283 N N   . SER A 164 ? 0.5362 0.9842 0.6612 0.2811  -0.0011 0.0280  164 SER A N   
1284 C CA  . SER A 164 ? 0.5240 1.0392 0.6789 0.2843  -0.0150 0.0365  164 SER A CA  
1285 C C   . SER A 164 ? 0.6000 1.0820 0.7375 0.2850  -0.0298 0.0438  164 SER A C   
1286 O O   . SER A 164 ? 0.6622 1.0748 0.7692 0.2738  -0.0296 0.0414  164 SER A O   
1287 C CB  . SER A 164 ? 0.3892 0.9603 0.5732 0.2472  -0.0202 0.0329  164 SER A CB  
1288 O OG  . SER A 164 ? 0.4525 0.9839 0.6217 0.2130  -0.0285 0.0299  164 SER A OG  
1289 N N   . ARG A 165 ? 0.6205 1.1364 0.7682 0.2868  -0.0404 0.0507  165 ARG A N   
1290 C CA  . ARG A 165 ? 0.7033 1.1922 0.8341 0.2845  -0.0539 0.0574  165 ARG A CA  
1291 C C   . ARG A 165 ? 0.6186 1.1334 0.7624 0.2465  -0.0679 0.0540  165 ARG A C   
1292 O O   . ARG A 165 ? 0.5783 1.0618 0.7047 0.2376  -0.0777 0.0567  165 ARG A O   
1293 C CB  . ARG A 165 ? 0.8280 1.3278 0.9542 0.3109  -0.0566 0.0671  165 ARG A CB  
1294 C CG  . ARG A 165 ? 0.9372 1.5121 1.0935 0.3095  -0.0585 0.0671  165 ARG A CG  
1295 C CD  . ARG A 165 ? 1.0695 1.6622 1.2219 0.3254  -0.0681 0.0769  165 ARG A CD  
1296 N NE  . ARG A 165 ? 1.0554 1.6435 1.2024 0.3017  -0.0833 0.0776  165 ARG A NE  
1297 C CZ  . ARG A 165 ? 1.0287 1.6693 1.1963 0.2752  -0.0943 0.0736  165 ARG A CZ  
1298 N NH1 . ARG A 165 ? 1.0308 1.7346 1.2268 0.2680  -0.0921 0.0695  165 ARG A NH1 
1299 N NH2 . ARG A 165 ? 0.9788 1.6072 1.1367 0.2552  -0.1067 0.0732  165 ARG A NH2 
1300 N N   . GLU A 166 ? 0.4955 1.0626 0.6665 0.2233  -0.0672 0.0479  166 GLU A N   
1301 C CA  . GLU A 166 ? 0.4799 1.0685 0.6609 0.1864  -0.0786 0.0436  166 GLU A CA  
1302 C C   . GLU A 166 ? 0.4482 1.0053 0.6208 0.1619  -0.0786 0.0380  166 GLU A C   
1303 O O   . GLU A 166 ? 0.4603 1.0165 0.6315 0.1337  -0.0878 0.0347  166 GLU A O   
1304 C CB  . GLU A 166 ? 0.6226 1.2767 0.8328 0.1691  -0.0775 0.0397  166 GLU A CB  
1305 C CG  . GLU A 166 ? 0.6726 1.3675 0.8931 0.1926  -0.0784 0.0453  166 GLU A CG  
1306 C CD  . GLU A 166 ? 0.7962 1.5055 1.0247 0.2190  -0.0634 0.0466  166 GLU A CD  
1307 O OE1 . GLU A 166 ? 0.7326 1.4024 0.9490 0.2304  -0.0527 0.0449  166 GLU A OE1 
1308 O OE2 . GLU A 166 ? 0.8569 1.6183 1.1030 0.2283  -0.0622 0.0486  166 GLU A OE2 
1309 N N   . ALA A 167 ? 0.4743 0.9889 0.6329 0.1685  -0.0651 0.0352  167 ALA A N   
1310 C CA  . ALA A 167 ? 0.4380 0.8987 0.5767 0.1430  -0.0606 0.0292  167 ALA A CA  
1311 C C   . ALA A 167 ? 0.5187 0.9246 0.6335 0.1593  -0.0483 0.0273  167 ALA A C   
1312 O O   . ALA A 167 ? 0.5134 0.9177 0.6293 0.1561  -0.0363 0.0222  167 ALA A O   
1313 C CB  . ALA A 167 ? 0.3459 0.8349 0.5014 0.1143  -0.0555 0.0237  167 ALA A CB  
1314 N N   . PRO A 168 ? 0.5865 0.9467 0.6775 0.1754  -0.0507 0.0311  168 PRO A N   
1315 C CA  . PRO A 168 ? 0.5959 0.9007 0.6609 0.1903  -0.0388 0.0284  168 PRO A CA  
1316 C C   . PRO A 168 ? 0.5442 0.8054 0.5908 0.1651  -0.0350 0.0210  168 PRO A C   
1317 O O   . PRO A 168 ? 0.5787 0.7996 0.6049 0.1705  -0.0247 0.0157  168 PRO A O   
1318 C CB  . PRO A 168 ? 0.6191 0.8906 0.6642 0.2097  -0.0442 0.0363  168 PRO A CB  
1319 C CG  . PRO A 168 ? 0.5874 0.8768 0.6389 0.1912  -0.0595 0.0401  168 PRO A CG  
1320 C CD  . PRO A 168 ? 0.5620 0.9193 0.6467 0.1789  -0.0642 0.0381  168 PRO A CD  
1321 N N   . GLY A 169 ? 0.4217 0.6916 0.4742 0.1386  -0.0430 0.0204  169 GLY A N   
1322 C CA  . GLY A 169 ? 0.4371 0.6714 0.4733 0.1171  -0.0411 0.0155  169 GLY A CA  
1323 C C   . GLY A 169 ? 0.4638 0.6511 0.4761 0.1145  -0.0451 0.0166  169 GLY A C   
1324 O O   . GLY A 169 ? 0.6251 0.7960 0.6277 0.1308  -0.0472 0.0214  169 GLY A O   
1325 N N   . ASN A 170 ? 0.4621 0.6293 0.4644 0.0944  -0.0454 0.0131  170 ASN A N   
1326 C CA  . ASN A 170 ? 0.5169 0.6463 0.4990 0.0878  -0.0483 0.0135  170 ASN A CA  
1327 C C   . ASN A 170 ? 0.4730 0.6047 0.4549 0.0878  -0.0586 0.0200  170 ASN A C   
1328 O O   . ASN A 170 ? 0.5135 0.6154 0.4782 0.0844  -0.0599 0.0216  170 ASN A O   
1329 C CB  . ASN A 170 ? 0.5250 0.6146 0.4854 0.0986  -0.0402 0.0105  170 ASN A CB  
1330 C CG  . ASN A 170 ? 0.6049 0.6876 0.5593 0.0962  -0.0300 0.0017  170 ASN A CG  
1331 O OD1 . ASN A 170 ? 0.5611 0.6559 0.5194 0.0810  -0.0298 -0.0018 170 ASN A OD1 
1332 N ND2 . ASN A 170 ? 0.5187 0.5788 0.4603 0.1124  -0.0210 -0.0017 170 ASN A ND2 
1333 N N   . VAL A 171 ? 0.4096 0.5783 0.4096 0.0897  -0.0656 0.0233  171 VAL A N   
1334 C CA  . VAL A 171 ? 0.3789 0.5529 0.3765 0.0905  -0.0760 0.0287  171 VAL A CA  
1335 C C   . VAL A 171 ? 0.4945 0.6495 0.4810 0.0719  -0.0792 0.0269  171 VAL A C   
1336 O O   . VAL A 171 ? 0.4846 0.6280 0.4594 0.0729  -0.0848 0.0309  171 VAL A O   
1337 C CB  . VAL A 171 ? 0.3596 0.5829 0.3789 0.0914  -0.0840 0.0304  171 VAL A CB  
1338 C CG1 . VAL A 171 ? 0.3124 0.5642 0.3469 0.1111  -0.0798 0.0321  171 VAL A CG1 
1339 C CG2 . VAL A 171 ? 0.3813 0.6226 0.4119 0.0673  -0.0855 0.0248  171 VAL A CG2 
1340 N N   . GLY A 172 ? 0.4120 0.5635 0.4004 0.0571  -0.0749 0.0219  172 GLY A N   
1341 C CA  . GLY A 172 ? 0.4058 0.5384 0.3827 0.0437  -0.0759 0.0205  172 GLY A CA  
1342 C C   . GLY A 172 ? 0.4347 0.5357 0.3932 0.0464  -0.0729 0.0217  172 GLY A C   
1343 O O   . GLY A 172 ? 0.3681 0.4577 0.3162 0.0415  -0.0758 0.0235  172 GLY A O   
1344 N N   . LEU A 173 ? 0.4331 0.5196 0.3862 0.0531  -0.0659 0.0199  173 LEU A N   
1345 C CA  . LEU A 173 ? 0.4911 0.5446 0.4249 0.0527  -0.0616 0.0199  173 LEU A CA  
1346 C C   . LEU A 173 ? 0.5349 0.5732 0.4574 0.0637  -0.0643 0.0273  173 LEU A C   
1347 O O   . LEU A 173 ? 0.5647 0.5785 0.4706 0.0585  -0.0625 0.0295  173 LEU A O   
1348 C CB  . LEU A 173 ? 0.4290 0.4665 0.3561 0.0558  -0.0527 0.0143  173 LEU A CB  
1349 C CG  . LEU A 173 ? 0.4808 0.5284 0.4117 0.0438  -0.0495 0.0074  173 LEU A CG  
1350 C CD1 . LEU A 173 ? 0.3646 0.3972 0.2864 0.0477  -0.0409 0.0006  173 LEU A CD1 
1351 C CD2 . LEU A 173 ? 0.4951 0.5371 0.4185 0.0288  -0.0510 0.0063  173 LEU A CD2 
1352 N N   . LEU A 174 ? 0.4904 0.5463 0.4219 0.0793  -0.0682 0.0318  174 LEU A N   
1353 C CA  . LEU A 174 ? 0.5228 0.5691 0.4432 0.0939  -0.0717 0.0408  174 LEU A CA  
1354 C C   . LEU A 174 ? 0.6198 0.6770 0.5377 0.0854  -0.0806 0.0443  174 LEU A C   
1355 O O   . LEU A 174 ? 0.6331 0.6720 0.5336 0.0909  -0.0819 0.0517  174 LEU A O   
1356 C CB  . LEU A 174 ? 0.3938 0.4654 0.3270 0.1154  -0.0740 0.0448  174 LEU A CB  
1357 C CG  . LEU A 174 ? 0.5491 0.6002 0.4768 0.1302  -0.0631 0.0428  174 LEU A CG  
1358 C CD1 . LEU A 174 ? 0.4028 0.4879 0.3470 0.1537  -0.0646 0.0467  174 LEU A CD1 
1359 C CD2 . LEU A 174 ? 0.4864 0.4831 0.3838 0.1368  -0.0557 0.0471  174 LEU A CD2 
1360 N N   . ASP A 175 ? 0.5806 0.6640 0.5130 0.0721  -0.0854 0.0389  175 ASP A N   
1361 C CA  . ASP A 175 ? 0.5129 0.6012 0.4399 0.0618  -0.0917 0.0391  175 ASP A CA  
1362 C C   . ASP A 175 ? 0.6018 0.6598 0.5106 0.0536  -0.0860 0.0398  175 ASP A C   
1363 O O   . ASP A 175 ? 0.6631 0.7110 0.5567 0.0542  -0.0880 0.0449  175 ASP A O   
1364 C CB  . ASP A 175 ? 0.4049 0.5153 0.3463 0.0479  -0.0943 0.0320  175 ASP A CB  
1365 C CG  . ASP A 175 ? 0.5159 0.6618 0.4754 0.0506  -0.1004 0.0308  175 ASP A CG  
1366 O OD1 . ASP A 175 ? 0.5405 0.7003 0.5022 0.0652  -0.1049 0.0363  175 ASP A OD1 
1367 O OD2 . ASP A 175 ? 0.4223 0.5832 0.3934 0.0381  -0.1004 0.0251  175 ASP A OD2 
1368 N N   . GLN A 176 ? 0.5257 0.5726 0.4357 0.0455  -0.0786 0.0348  176 GLN A N   
1369 C CA  . GLN A 176 ? 0.4989 0.5251 0.3952 0.0354  -0.0728 0.0343  176 GLN A CA  
1370 C C   . GLN A 176 ? 0.6262 0.6222 0.5027 0.0405  -0.0684 0.0407  176 GLN A C   
1371 O O   . GLN A 176 ? 0.6900 0.6740 0.5525 0.0338  -0.0665 0.0443  176 GLN A O   
1372 C CB  . GLN A 176 ? 0.4250 0.4514 0.3270 0.0262  -0.0670 0.0273  176 GLN A CB  
1373 C CG  . GLN A 176 ? 0.3724 0.4222 0.2891 0.0214  -0.0694 0.0230  176 GLN A CG  
1374 C CD  . GLN A 176 ? 0.4760 0.5280 0.3960 0.0154  -0.0641 0.0178  176 GLN A CD  
1375 O OE1 . GLN A 176 ? 0.3919 0.4290 0.3035 0.0124  -0.0591 0.0153  176 GLN A OE1 
1376 N NE2 . GLN A 176 ? 0.3477 0.4163 0.2772 0.0129  -0.0649 0.0159  176 GLN A NE2 
1377 N N   . ARG A 177 ? 0.5410 0.5226 0.4143 0.0527  -0.0654 0.0426  177 ARG A N   
1378 C CA  . ARG A 177 ? 0.5587 0.5022 0.4086 0.0590  -0.0591 0.0495  177 ARG A CA  
1379 C C   . ARG A 177 ? 0.6938 0.6366 0.5320 0.0690  -0.0648 0.0607  177 ARG A C   
1380 O O   . ARG A 177 ? 0.7308 0.6434 0.5461 0.0666  -0.0596 0.0676  177 ARG A O   
1381 C CB  . ARG A 177 ? 0.5307 0.4563 0.3775 0.0745  -0.0538 0.0492  177 ARG A CB  
1382 C CG  . ARG A 177 ? 0.6578 0.5337 0.4754 0.0828  -0.0451 0.0567  177 ARG A CG  
1383 C CD  . ARG A 177 ? 0.6133 0.4694 0.4259 0.1034  -0.0389 0.0566  177 ARG A CD  
1384 N NE  . ARG A 177 ? 0.7431 0.5821 0.5535 0.0908  -0.0298 0.0437  177 ARG A NE  
1385 C CZ  . ARG A 177 ? 0.6864 0.5201 0.4989 0.1042  -0.0243 0.0382  177 ARG A CZ  
1386 N NH1 . ARG A 177 ? 0.6130 0.4605 0.4331 0.1321  -0.0266 0.0451  177 ARG A NH1 
1387 N NH2 . ARG A 177 ? 0.6478 0.4659 0.4547 0.0900  -0.0165 0.0255  177 ARG A NH2 
1388 N N   . LEU A 178 ? 0.6482 0.6255 0.5007 0.0784  -0.0754 0.0624  178 LEU A N   
1389 C CA  . LEU A 178 ? 0.6262 0.6108 0.4678 0.0881  -0.0829 0.0720  178 LEU A CA  
1390 C C   . LEU A 178 ? 0.6532 0.6348 0.4836 0.0725  -0.0828 0.0717  178 LEU A C   
1391 O O   . LEU A 178 ? 0.7332 0.6992 0.5420 0.0765  -0.0824 0.0811  178 LEU A O   
1392 C CB  . LEU A 178 ? 0.5579 0.5870 0.4192 0.0966  -0.0950 0.0708  178 LEU A CB  
1393 C CG  . LEU A 178 ? 0.6285 0.6747 0.4796 0.1051  -0.1054 0.0788  178 LEU A CG  
1394 C CD1 . LEU A 178 ? 0.6390 0.6576 0.4658 0.1254  -0.1028 0.0937  178 LEU A CD1 
1395 C CD2 . LEU A 178 ? 0.5831 0.6784 0.4565 0.1095  -0.1171 0.0751  178 LEU A CD2 
1396 N N   . ALA A 179 ? 0.5395 0.5361 0.3831 0.0565  -0.0823 0.0617  179 ALA A N   
1397 C CA  . ALA A 179 ? 0.4608 0.4554 0.2948 0.0434  -0.0798 0.0606  179 ALA A CA  
1398 C C   . ALA A 179 ? 0.5729 0.5358 0.3891 0.0356  -0.0686 0.0648  179 ALA A C   
1399 O O   . ALA A 179 ? 0.7744 0.7300 0.5745 0.0299  -0.0656 0.0695  179 ALA A O   
1400 C CB  . ALA A 179 ? 0.3733 0.3884 0.2242 0.0319  -0.0801 0.0500  179 ALA A CB  
1401 N N   . LEU A 180 ? 0.5175 0.4612 0.3348 0.0336  -0.0618 0.0624  180 LEU A N   
1402 C CA  . LEU A 180 ? 0.6426 0.5539 0.4414 0.0216  -0.0505 0.0647  180 LEU A CA  
1403 C C   . LEU A 180 ? 0.6808 0.5595 0.4523 0.0316  -0.0474 0.0782  180 LEU A C   
1404 O O   . LEU A 180 ? 0.6667 0.5244 0.4189 0.0200  -0.0393 0.0832  180 LEU A O   
1405 C CB  . LEU A 180 ? 0.6257 0.5203 0.4277 0.0150  -0.0435 0.0570  180 LEU A CB  
1406 C CG  . LEU A 180 ? 0.7029 0.6263 0.5277 0.0055  -0.0452 0.0449  180 LEU A CG  
1407 C CD1 . LEU A 180 ? 0.6991 0.6020 0.5194 -0.0037 -0.0373 0.0372  180 LEU A CD1 
1408 C CD2 . LEU A 180 ? 0.6467 0.5969 0.4795 -0.0080 -0.0458 0.0419  180 LEU A CD2 
1409 N N   . GLN A 181 ? 0.6176 0.4944 0.3873 0.0538  -0.0535 0.0849  181 GLN A N   
1410 C CA  . GLN A 181 ? 0.8186 0.6659 0.5609 0.0687  -0.0517 0.1000  181 GLN A CA  
1411 C C   . GLN A 181 ? 0.7976 0.6635 0.5308 0.0681  -0.0579 0.1067  181 GLN A C   
1412 O O   . GLN A 181 ? 0.7023 0.5410 0.4073 0.0698  -0.0526 0.1188  181 GLN A O   
1413 C CB  . GLN A 181 ? 0.8973 0.7478 0.6432 0.0962  -0.0578 0.1057  181 GLN A CB  
1414 C CG  . GLN A 181 ? 0.9496 0.7773 0.6994 0.1012  -0.0500 0.1000  181 GLN A CG  
1415 C CD  . GLN A 181 ? 0.9231 0.7760 0.6891 0.1271  -0.0577 0.1016  181 GLN A CD  
1416 O OE1 . GLN A 181 ? 0.8651 0.7647 0.6495 0.1334  -0.0704 0.1019  181 GLN A OE1 
1417 N NE2 . GLN A 181 ? 0.9257 0.7487 0.6843 0.1414  -0.0492 0.1019  181 GLN A NE2 
1418 N N   . TRP A 182 ? 0.7721 0.6814 0.5265 0.0652  -0.0682 0.0984  182 TRP A N   
1419 C CA  . TRP A 182 ? 0.6478 0.5767 0.3939 0.0628  -0.0740 0.1007  182 TRP A CA  
1420 C C   . TRP A 182 ? 0.6683 0.5813 0.3998 0.0445  -0.0627 0.1013  182 TRP A C   
1421 O O   . TRP A 182 ? 0.7393 0.6424 0.4467 0.0452  -0.0604 0.1109  182 TRP A O   
1422 C CB  . TRP A 182 ? 0.5569 0.5271 0.3270 0.0587  -0.0841 0.0883  182 TRP A CB  
1423 C CG  . TRP A 182 ? 0.5567 0.5439 0.3145 0.0570  -0.0900 0.0887  182 TRP A CG  
1424 C CD1 . TRP A 182 ? 0.5080 0.5142 0.2580 0.0687  -0.1018 0.0930  182 TRP A CD1 
1425 C CD2 . TRP A 182 ? 0.5584 0.5473 0.3085 0.0432  -0.0840 0.0841  182 TRP A CD2 
1426 N NE1 . TRP A 182 ? 0.6185 0.6343 0.3540 0.0617  -0.1035 0.0902  182 TRP A NE1 
1427 C CE2 . TRP A 182 ? 0.6571 0.6614 0.3924 0.0472  -0.0919 0.0850  182 TRP A CE2 
1428 C CE3 . TRP A 182 ? 0.5876 0.5706 0.3422 0.0287  -0.0728 0.0790  182 TRP A CE3 
1429 C CZ2 . TRP A 182 ? 0.6675 0.6766 0.3905 0.0383  -0.0875 0.0806  182 TRP A CZ2 
1430 C CZ3 . TRP A 182 ? 0.6274 0.6200 0.3729 0.0211  -0.0687 0.0758  182 TRP A CZ3 
1431 C CH2 . TRP A 182 ? 0.6956 0.6986 0.4246 0.0264  -0.0753 0.0764  182 TRP A CH2 
1432 N N   . VAL A 183 ? 0.5898 0.5042 0.3359 0.0283  -0.0556 0.0913  183 VAL A N   
1433 C CA  . VAL A 183 ? 0.5517 0.4589 0.2887 0.0094  -0.0443 0.0910  183 VAL A CA  
1434 C C   . VAL A 183 ? 0.7333 0.5966 0.4404 0.0063  -0.0333 0.1036  183 VAL A C   
1435 O O   . VAL A 183 ? 0.5864 0.4429 0.2744 -0.0024 -0.0262 0.1105  183 VAL A O   
1436 C CB  . VAL A 183 ? 0.5932 0.5149 0.3526 -0.0062 -0.0397 0.0784  183 VAL A CB  
1437 C CG1 . VAL A 183 ? 0.5900 0.5027 0.3396 -0.0272 -0.0266 0.0791  183 VAL A CG1 
1438 C CG2 . VAL A 183 ? 0.4471 0.4079 0.2286 -0.0047 -0.0471 0.0685  183 VAL A CG2 
1439 N N   . GLN A 184 ? 0.6680 0.4987 0.3685 0.0139  -0.0306 0.1070  184 GLN A N   
1440 C CA  . GLN A 184 ? 0.7712 0.5499 0.4387 0.0119  -0.0186 0.1194  184 GLN A CA  
1441 C C   . GLN A 184 ? 0.8213 0.5895 0.4613 0.0263  -0.0206 0.1362  184 GLN A C   
1442 O O   . GLN A 184 ? 0.8665 0.6048 0.4784 0.0160  -0.0091 0.1464  184 GLN A O   
1443 C CB  . GLN A 184 ? 0.7666 0.5079 0.4282 0.0237  -0.0153 0.1202  184 GLN A CB  
1444 C CG  . GLN A 184 ? 0.8625 0.5977 0.5376 0.0044  -0.0084 0.1053  184 GLN A CG  
1445 C CD  . GLN A 184 ? 0.9297 0.6418 0.5891 -0.0262 0.0062  0.1036  184 GLN A CD  
1446 O OE1 . GLN A 184 ? 1.0451 0.7032 0.6721 -0.0311 0.0186  0.1125  184 GLN A OE1 
1447 N NE2 . GLN A 184 ? 0.7264 0.4800 0.4080 -0.0469 0.0055  0.0924  184 GLN A NE2 
1448 N N   . GLU A 185 ? 0.7755 0.5702 0.4223 0.0488  -0.0351 0.1392  185 GLU A N   
1449 C CA  . GLU A 185 ? 0.8763 0.6650 0.4956 0.0643  -0.0388 0.1553  185 GLU A CA  
1450 C C   . GLU A 185 ? 0.8559 0.6718 0.4699 0.0523  -0.0398 0.1540  185 GLU A C   
1451 O O   . GLU A 185 ? 0.8955 0.6937 0.4782 0.0542  -0.0348 0.1679  185 GLU A O   
1452 C CB  . GLU A 185 ? 0.9019 0.7128 0.5278 0.0930  -0.0546 0.1599  185 GLU A CB  
1453 C CG  . GLU A 185 ? 1.0377 0.8368 0.6295 0.1124  -0.0578 0.1798  185 GLU A CG  
1454 C CD  . GLU A 185 ? 1.1248 0.9548 0.7300 0.1392  -0.0729 0.1834  185 GLU A CD  
1455 O OE1 . GLU A 185 ? 1.0942 0.9555 0.7285 0.1441  -0.0823 0.1722  185 GLU A OE1 
1456 O OE2 . GLU A 185 ? 1.2070 1.0348 0.7992 0.1521  -0.0746 0.1956  185 GLU A OE2 
1457 N N   . ASN A 186 ? 0.7991 0.6549 0.4412 0.0411  -0.0447 0.1378  186 ASN A N   
1458 C CA  . ASN A 186 ? 0.7444 0.6312 0.3833 0.0373  -0.0489 0.1341  186 ASN A CA  
1459 C C   . ASN A 186 ? 0.7496 0.6476 0.3934 0.0157  -0.0377 0.1263  186 ASN A C   
1460 O O   . ASN A 186 ? 0.8816 0.7957 0.5131 0.0135  -0.0368 0.1264  186 ASN A O   
1461 C CB  . ASN A 186 ? 0.6301 0.5559 0.2919 0.0464  -0.0650 0.1224  186 ASN A CB  
1462 C CG  . ASN A 186 ? 0.6943 0.6243 0.3509 0.0682  -0.0779 0.1307  186 ASN A CG  
1463 O OD1 . ASN A 186 ? 0.7971 0.7269 0.4281 0.0790  -0.0824 0.1421  186 ASN A OD1 
1464 N ND2 . ASN A 186 ? 0.6103 0.5482 0.2909 0.0758  -0.0839 0.1254  186 ASN A ND2 
1465 N N   . ILE A 187 ? 0.6631 0.5565 0.3243 0.0006  -0.0292 0.1190  187 ILE A N   
1466 C CA  . ILE A 187 ? 0.6370 0.5552 0.3113 -0.0168 -0.0211 0.1095  187 ILE A CA  
1467 C C   . ILE A 187 ? 0.7100 0.6204 0.3597 -0.0293 -0.0075 0.1186  187 ILE A C   
1468 O O   . ILE A 187 ? 0.7104 0.6496 0.3658 -0.0372 -0.0022 0.1129  187 ILE A O   
1469 C CB  . ILE A 187 ? 0.5841 0.5066 0.2834 -0.0304 -0.0165 0.0995  187 ILE A CB  
1470 C CG1 . ILE A 187 ? 0.6017 0.5654 0.3235 -0.0384 -0.0147 0.0875  187 ILE A CG1 
1471 C CG2 . ILE A 187 ? 0.6034 0.4923 0.2873 -0.0477 -0.0027 0.1061  187 ILE A CG2 
1472 C CD1 . ILE A 187 ? 0.4871 0.4754 0.2200 -0.0234 -0.0261 0.0798  187 ILE A CD1 
1473 N N   . ALA A 188 ? 0.6582 0.5286 0.2791 -0.0299 -0.0007 0.1336  188 ALA A N   
1474 C CA  . ALA A 188 ? 0.7298 0.5877 0.3240 -0.0437 0.0140  0.1442  188 ALA A CA  
1475 C C   . ALA A 188 ? 0.7397 0.6210 0.3190 -0.0339 0.0104  0.1470  188 ALA A C   
1476 O O   . ALA A 188 ? 0.7471 0.6371 0.3133 -0.0464 0.0227  0.1505  188 ALA A O   
1477 C CB  . ALA A 188 ? 0.7502 0.5511 0.3112 -0.0443 0.0226  0.1614  188 ALA A CB  
1478 N N   . ALA A 189 ? 0.7304 0.6245 0.3117 -0.0132 -0.0059 0.1443  189 ALA A N   
1479 C CA  . ALA A 189 ? 0.7635 0.6807 0.3295 -0.0047 -0.0110 0.1435  189 ALA A CA  
1480 C C   . ALA A 189 ? 0.7739 0.7284 0.3592 -0.0127 -0.0071 0.1275  189 ALA A C   
1481 O O   . ALA A 189 ? 0.9282 0.8994 0.4981 -0.0090 -0.0067 0.1250  189 ALA A O   
1482 C CB  . ALA A 189 ? 0.7214 0.6460 0.2858 0.0163  -0.0303 0.1426  189 ALA A CB  
1483 N N   . PHE A 190 ? 0.6947 0.6617 0.3116 -0.0220 -0.0041 0.1167  190 PHE A N   
1484 C CA  . PHE A 190 ? 0.6917 0.6935 0.3283 -0.0260 0.0002  0.1029  190 PHE A CA  
1485 C C   . PHE A 190 ? 0.7460 0.7582 0.3885 -0.0451 0.0175  0.1052  190 PHE A C   
1486 O O   . PHE A 190 ? 0.7656 0.8111 0.4254 -0.0482 0.0235  0.0958  190 PHE A O   
1487 C CB  . PHE A 190 ? 0.7074 0.7219 0.3765 -0.0207 -0.0099 0.0896  190 PHE A CB  
1488 C CG  . PHE A 190 ? 0.6558 0.6668 0.3240 -0.0057 -0.0263 0.0853  190 PHE A CG  
1489 C CD1 . PHE A 190 ? 0.7050 0.6966 0.3727 0.0006  -0.0358 0.0918  190 PHE A CD1 
1490 C CD2 . PHE A 190 ? 0.6358 0.6636 0.3032 0.0016  -0.0314 0.0740  190 PHE A CD2 
1491 C CE1 . PHE A 190 ? 0.6762 0.6733 0.3461 0.0126  -0.0509 0.0875  190 PHE A CE1 
1492 C CE2 . PHE A 190 ? 0.6302 0.6575 0.2969 0.0107  -0.0461 0.0687  190 PHE A CE2 
1493 C CZ  . PHE A 190 ? 0.6533 0.6693 0.3232 0.0156  -0.0564 0.0756  190 PHE A CZ  
1494 N N   . GLY A 191 ? 0.5971 0.7171 0.2012 -0.0109 0.0376  0.0863  191 GLY A N   
1495 C CA  . GLY A 191 ? 0.5939 0.7241 0.2107 -0.0169 0.0495  0.0975  191 GLY A CA  
1496 C C   . GLY A 191 ? 0.6207 0.7545 0.2652 -0.0220 0.0475  0.1008  191 GLY A C   
1497 O O   . GLY A 191 ? 0.7218 0.8712 0.3807 -0.0303 0.0566  0.1081  191 GLY A O   
1498 N N   . GLY A 192 ? 0.6075 0.7303 0.2599 -0.0189 0.0356  0.0951  192 GLY A N   
1499 C CA  . GLY A 192 ? 0.6071 0.7284 0.2811 -0.0247 0.0326  0.0990  192 GLY A CA  
1500 C C   . GLY A 192 ? 0.6908 0.7904 0.3568 -0.0334 0.0306  0.1145  192 GLY A C   
1501 O O   . GLY A 192 ? 0.7538 0.8355 0.3973 -0.0295 0.0282  0.1222  192 GLY A O   
1502 N N   . ASP A 193 ? 0.6888 0.7875 0.3701 -0.0450 0.0329  0.1190  193 ASP A N   
1503 C CA  . ASP A 193 ? 0.7110 0.7804 0.3809 -0.0566 0.0350  0.1324  193 ASP A CA  
1504 C C   . ASP A 193 ? 0.7389 0.7841 0.4115 -0.0511 0.0245  0.1314  193 ASP A C   
1505 O O   . ASP A 193 ? 0.7211 0.7754 0.4140 -0.0561 0.0214  0.1245  193 ASP A O   
1506 C CB  . ASP A 193 ? 0.7570 0.8437 0.4415 -0.0786 0.0449  0.1352  193 ASP A CB  
1507 C CG  . ASP A 193 ? 0.8069 0.8577 0.4737 -0.0967 0.0515  0.1472  193 ASP A CG  
1508 O OD1 . ASP A 193 ? 0.8431 0.8511 0.4874 -0.0877 0.0492  0.1549  193 ASP A OD1 
1509 O OD2 . ASP A 193 ? 0.7245 0.7913 0.4000 -0.1196 0.0599  0.1487  193 ASP A OD2 
1510 N N   . PRO A 194 ? 0.6917 0.7080 0.3435 -0.0386 0.0195  0.1391  194 PRO A N   
1511 C CA  . PRO A 194 ? 0.6106 0.6076 0.2664 -0.0302 0.0104  0.1389  194 PRO A CA  
1512 C C   . PRO A 194 ? 0.8242 0.7895 0.4777 -0.0445 0.0170  0.1460  194 PRO A C   
1513 O O   . PRO A 194 ? 0.8652 0.8151 0.5253 -0.0410 0.0110  0.1435  194 PRO A O   
1514 C CB  . PRO A 194 ? 0.6974 0.6772 0.3302 -0.0114 0.0047  0.1473  194 PRO A CB  
1515 C CG  . PRO A 194 ? 0.6436 0.6141 0.2509 -0.0145 0.0153  0.1579  194 PRO A CG  
1516 C CD  . PRO A 194 ? 0.6110 0.6138 0.2347 -0.0296 0.0223  0.1492  194 PRO A CD  
1517 N N   . MET A 195 ? 0.8578 0.8118 0.5013 -0.0629 0.0296  0.1529  195 MET A N   
1518 C CA  . MET A 195 ? 0.8545 0.7745 0.4931 -0.0825 0.0368  0.1555  195 MET A CA  
1519 C C   . MET A 195 ? 0.8692 0.8199 0.5331 -0.1055 0.0363  0.1438  195 MET A C   
1520 O O   . MET A 195 ? 0.8944 0.8243 0.5555 -0.1274 0.0413  0.1422  195 MET A O   
1521 C CB  . MET A 195 ? 0.8692 0.7572 0.4820 -0.0935 0.0512  0.1681  195 MET A CB  
1522 C CG  . MET A 195 ? 0.8600 0.7175 0.4493 -0.0682 0.0522  0.1833  195 MET A CG  
1523 S SD  . MET A 195 ? 1.3953 1.1972 0.9525 -0.0816 0.0700  0.1980  195 MET A SD  
1524 C CE  . MET A 195 ? 0.8984 0.7335 0.4537 -0.0990 0.0793  0.1998  195 MET A CE  
1525 N N   . SER A 196 ? 0.7548 0.7559 0.4425 -0.0989 0.0307  0.1352  196 SER A N   
1526 C CA  . SER A 196 ? 0.6737 0.7145 0.3890 -0.1119 0.0297  0.1261  196 SER A CA  
1527 C C   . SER A 196 ? 0.7020 0.7668 0.4362 -0.0908 0.0201  0.1164  196 SER A C   
1528 O O   . SER A 196 ? 0.6919 0.7901 0.4363 -0.0785 0.0215  0.1115  196 SER A O   
1529 C CB  . SER A 196 ? 0.7549 0.8401 0.4816 -0.1244 0.0385  0.1271  196 SER A CB  
1530 O OG  . SER A 196 ? 0.6601 0.7885 0.4136 -0.1369 0.0382  0.1213  196 SER A OG  
1531 N N   . VAL A 197 ? 0.7448 0.7868 0.4827 -0.0855 0.0122  0.1119  197 VAL A N   
1532 C CA  . VAL A 197 ? 0.6606 0.7152 0.4187 -0.0649 0.0037  0.0997  197 VAL A CA  
1533 C C   . VAL A 197 ? 0.6750 0.7352 0.4546 -0.0696 0.0007  0.0919  197 VAL A C   
1534 O O   . VAL A 197 ? 0.7652 0.7957 0.5390 -0.0801 -0.0006 0.0935  197 VAL A O   
1535 C CB  . VAL A 197 ? 0.6032 0.6299 0.3502 -0.0474 -0.0044 0.0998  197 VAL A CB  
1536 C CG1 . VAL A 197 ? 0.5213 0.5587 0.2882 -0.0331 -0.0120 0.0859  197 VAL A CG1 
1537 C CG2 . VAL A 197 ? 0.5620 0.5933 0.2879 -0.0403 -0.0031 0.1069  197 VAL A CG2 
1538 N N   . THR A 198 ? 0.6340 0.7293 0.4342 -0.0603 0.0013  0.0841  198 THR A N   
1539 C CA  . THR A 198 ? 0.4916 0.6010 0.3122 -0.0618 -0.0007 0.0784  198 THR A CA  
1540 C C   . THR A 198 ? 0.6071 0.7093 0.4374 -0.0400 -0.0050 0.0677  198 THR A C   
1541 O O   . THR A 198 ? 0.6693 0.7840 0.4990 -0.0256 -0.0008 0.0632  198 THR A O   
1542 C CB  . THR A 198 ? 0.4598 0.6225 0.2949 -0.0673 0.0064  0.0817  198 THR A CB  
1543 O OG1 . THR A 198 ? 0.4684 0.6414 0.2944 -0.0939 0.0110  0.0907  198 THR A OG1 
1544 C CG2 . THR A 198 ? 0.5199 0.7038 0.3753 -0.0648 0.0036  0.0774  198 THR A CG2 
1545 N N   . LEU A 199 ? 0.5069 0.5847 0.3421 -0.0390 -0.0115 0.0631  199 LEU A N   
1546 C CA  . LEU A 199 ? 0.4882 0.5592 0.3327 -0.0226 -0.0142 0.0529  199 LEU A CA  
1547 C C   . LEU A 199 ? 0.5079 0.6050 0.3680 -0.0172 -0.0098 0.0507  199 LEU A C   
1548 O O   . LEU A 199 ? 0.5760 0.6922 0.4435 -0.0292 -0.0100 0.0556  199 LEU A O   
1549 C CB  . LEU A 199 ? 0.4702 0.5092 0.3144 -0.0224 -0.0214 0.0503  199 LEU A CB  
1550 C CG  . LEU A 199 ? 0.6027 0.6160 0.4305 -0.0247 -0.0249 0.0571  199 LEU A CG  
1551 C CD1 . LEU A 199 ? 0.5319 0.5196 0.3619 -0.0187 -0.0299 0.0548  199 LEU A CD1 
1552 C CD2 . LEU A 199 ? 0.7427 0.7647 0.5609 -0.0164 -0.0257 0.0572  199 LEU A CD2 
1553 N N   . PHE A 200 ? 0.4868 0.5852 0.3485 0.0002  -0.0049 0.0437  200 PHE A N   
1554 C CA  . PHE A 200 ? 0.4682 0.5839 0.3412 0.0120  0.0005  0.0430  200 PHE A CA  
1555 C C   . PHE A 200 ? 0.5430 0.6311 0.4102 0.0275  0.0046  0.0327  200 PHE A C   
1556 O O   . PHE A 200 ? 0.5694 0.6395 0.4223 0.0307  0.0077  0.0257  200 PHE A O   
1557 C CB  . PHE A 200 ? 0.4189 0.5796 0.2967 0.0190  0.0101  0.0514  200 PHE A CB  
1558 C CG  . PHE A 200 ? 0.4591 0.6187 0.3234 0.0362  0.0224  0.0489  200 PHE A CG  
1559 C CD1 . PHE A 200 ? 0.6183 0.7571 0.4660 0.0307  0.0217  0.0444  200 PHE A CD1 
1560 C CD2 . PHE A 200 ? 0.4256 0.6060 0.2903 0.0594  0.0360  0.0523  200 PHE A CD2 
1561 C CE1 . PHE A 200 ? 0.5846 0.7199 0.4148 0.0443  0.0341  0.0405  200 PHE A CE1 
1562 C CE2 . PHE A 200 ? 0.5302 0.7022 0.3763 0.0764  0.0507  0.0495  200 PHE A CE2 
1563 C CZ  . PHE A 200 ? 0.4683 0.6162 0.2962 0.0669  0.0496  0.0423  200 PHE A CZ  
1564 N N   . GLY A 201 ? 0.5357 0.6200 0.4112 0.0344  0.0048  0.0314  201 GLY A N   
1565 C CA  . GLY A 201 ? 0.5046 0.5570 0.3728 0.0452  0.0097  0.0217  201 GLY A CA  
1566 C C   . GLY A 201 ? 0.5512 0.6100 0.4269 0.0574  0.0139  0.0253  201 GLY A C   
1567 O O   . GLY A 201 ? 0.4964 0.5842 0.3853 0.0527  0.0083  0.0334  201 GLY A O   
1568 N N   . GLU A 202 ? 0.5803 0.6108 0.4439 0.0720  0.0248  0.0191  202 GLU A N   
1569 C CA  . GLU A 202 ? 0.4967 0.5293 0.3624 0.0883  0.0313  0.0242  202 GLU A CA  
1570 C C   . GLU A 202 ? 0.5425 0.5368 0.4052 0.0836  0.0294  0.0152  202 GLU A C   
1571 O O   . GLU A 202 ? 0.5552 0.5187 0.4084 0.0734  0.0295  0.0038  202 GLU A O   
1572 C CB  . GLU A 202 ? 0.5164 0.5454 0.3648 0.1149  0.0510  0.0282  202 GLU A CB  
1573 C CG  . GLU A 202 ? 0.7012 0.7431 0.5506 0.1389  0.0596  0.0389  202 GLU A CG  
1574 C CD  . GLU A 202 ? 0.7820 0.7681 0.6112 0.1479  0.0709  0.0315  202 GLU A CD  
1575 O OE1 . GLU A 202 ? 0.7402 0.6812 0.5536 0.1346  0.0740  0.0169  202 GLU A OE1 
1576 O OE2 . GLU A 202 ? 0.7824 0.7726 0.6105 0.1669  0.0769  0.0406  202 GLU A OE2 
1577 N N   . SER A 203 ? 0.5631 0.5650 0.4338 0.0893  0.0275  0.0207  203 SER A N   
1578 C CA  . SER A 203 ? 0.5504 0.5185 0.4179 0.0868  0.0279  0.0138  203 SER A CA  
1579 C C   . SER A 203 ? 0.5138 0.4694 0.3890 0.0646  0.0154  0.0050  203 SER A C   
1580 O O   . SER A 203 ? 0.4532 0.4281 0.3407 0.0527  0.0030  0.0086  203 SER A O   
1581 C CB  . SER A 203 ? 0.6122 0.5384 0.4555 0.1013  0.0468  0.0083  203 SER A CB  
1582 O OG  . SER A 203 ? 0.8263 0.7234 0.6653 0.1003  0.0499  0.0043  203 SER A OG  
1583 N N   . ALA A 204 ? 0.5048 0.4292 0.3706 0.0589  0.0198  -0.0060 204 ALA A N   
1584 C CA  . ALA A 204 ? 0.5747 0.4980 0.4491 0.0420  0.0086  -0.0121 204 ALA A CA  
1585 C C   . ALA A 204 ? 0.6101 0.5539 0.4879 0.0344  -0.0002 -0.0093 204 ALA A C   
1586 O O   . ALA A 204 ? 0.6014 0.5524 0.4881 0.0261  -0.0109 -0.0072 204 ALA A O   
1587 C CB  . ALA A 204 ? 0.6233 0.5216 0.4871 0.0340  0.0151  -0.0243 204 ALA A CB  
1588 N N   . GLY A 205 ? 0.5966 0.5468 0.4642 0.0397  0.0062  -0.0082 205 GLY A N   
1589 C CA  . GLY A 205 ? 0.4984 0.4680 0.3665 0.0335  -0.0001 -0.0043 205 GLY A CA  
1590 C C   . GLY A 205 ? 0.5777 0.5685 0.4585 0.0295  -0.0086 0.0065  205 GLY A C   
1591 O O   . GLY A 205 ? 0.5029 0.4973 0.3854 0.0199  -0.0170 0.0098  205 GLY A O   
1592 N N   . ALA A 206 ? 0.5452 0.5494 0.4314 0.0364  -0.0053 0.0124  206 ALA A N   
1593 C CA  . ALA A 206 ? 0.5300 0.5542 0.4249 0.0269  -0.0127 0.0203  206 ALA A CA  
1594 C C   . ALA A 206 ? 0.5590 0.5616 0.4556 0.0164  -0.0208 0.0178  206 ALA A C   
1595 O O   . ALA A 206 ? 0.5474 0.5487 0.4413 0.0039  -0.0262 0.0217  206 ALA A O   
1596 C CB  . ALA A 206 ? 0.5382 0.5877 0.4384 0.0359  -0.0088 0.0264  206 ALA A CB  
1597 N N   . ALA A 207 ? 0.5186 0.5009 0.4166 0.0222  -0.0194 0.0118  207 ALA A N   
1598 C CA  . ALA A 207 ? 0.4869 0.4496 0.3862 0.0164  -0.0248 0.0099  207 ALA A CA  
1599 C C   . ALA A 207 ? 0.5566 0.5130 0.4526 0.0122  -0.0292 0.0109  207 ALA A C   
1600 O O   . ALA A 207 ? 0.5681 0.5130 0.4593 0.0070  -0.0327 0.0154  207 ALA A O   
1601 C CB  . ALA A 207 ? 0.3333 0.2800 0.2354 0.0233  -0.0209 0.0033  207 ALA A CB  
1602 N N   . SER A 208 ? 0.5622 0.5242 0.4569 0.0150  -0.0279 0.0071  208 SER A N   
1603 C CA  . SER A 208 ? 0.5613 0.5267 0.4518 0.0128  -0.0327 0.0095  208 SER A CA  
1604 C C   . SER A 208 ? 0.5257 0.4923 0.4084 0.0074  -0.0348 0.0192  208 SER A C   
1605 O O   . SER A 208 ? 0.4678 0.4233 0.3442 0.0077  -0.0379 0.0255  208 SER A O   
1606 C CB  . SER A 208 ? 0.4545 0.4296 0.3398 0.0128  -0.0302 0.0027  208 SER A CB  
1607 O OG  . SER A 208 ? 0.5204 0.4904 0.4081 0.0121  -0.0282 -0.0070 208 SER A OG  
1608 N N   . VAL A 209 ? 0.4184 0.3984 0.2999 0.0033  -0.0316 0.0216  209 VAL A N   
1609 C CA  . VAL A 209 ? 0.4735 0.4568 0.3466 -0.0070 -0.0319 0.0302  209 VAL A CA  
1610 C C   . VAL A 209 ? 0.6297 0.5893 0.4962 -0.0150 -0.0332 0.0333  209 VAL A C   
1611 O O   . VAL A 209 ? 0.5581 0.4974 0.4098 -0.0202 -0.0327 0.0399  209 VAL A O   
1612 C CB  . VAL A 209 ? 0.5062 0.5183 0.3831 -0.0111 -0.0276 0.0326  209 VAL A CB  
1613 C CG1 . VAL A 209 ? 0.4766 0.4943 0.3446 -0.0279 -0.0273 0.0408  209 VAL A CG1 
1614 C CG2 . VAL A 209 ? 0.4640 0.4916 0.3408 -0.0007 -0.0227 0.0297  209 VAL A CG2 
1615 N N   . GLY A 210 ? 0.5594 0.5170 0.4328 -0.0149 -0.0331 0.0288  210 GLY A N   
1616 C CA  . GLY A 210 ? 0.5111 0.4428 0.3744 -0.0233 -0.0329 0.0292  210 GLY A CA  
1617 C C   . GLY A 210 ? 0.5635 0.4627 0.4175 -0.0144 -0.0323 0.0314  210 GLY A C   
1618 O O   . GLY A 210 ? 0.6554 0.5233 0.4892 -0.0210 -0.0288 0.0361  210 GLY A O   
1619 N N   . MET A 211 ? 0.4602 0.3670 0.3264 0.0004  -0.0343 0.0284  211 MET A N   
1620 C CA  . MET A 211 ? 0.5143 0.4052 0.3757 0.0127  -0.0342 0.0329  211 MET A CA  
1621 C C   . MET A 211 ? 0.6053 0.4863 0.4497 0.0140  -0.0333 0.0435  211 MET A C   
1622 O O   . MET A 211 ? 0.5792 0.4320 0.4077 0.0229  -0.0291 0.0515  211 MET A O   
1623 C CB  . MET A 211 ? 0.5988 0.5140 0.4775 0.0230  -0.0376 0.0278  211 MET A CB  
1624 C CG  . MET A 211 ? 0.6491 0.5739 0.5414 0.0206  -0.0364 0.0174  211 MET A CG  
1625 S SD  . MET A 211 ? 0.8270 0.7386 0.7258 0.0276  -0.0336 0.0140  211 MET A SD  
1626 C CE  . MET A 211 ? 0.5810 0.4967 0.4873 0.0231  -0.0301 0.0047  211 MET A CE  
1627 N N   . HIS A 212 ? 0.5031 0.4044 0.3478 0.0074  -0.0352 0.0447  212 HIS A N   
1628 C CA  . HIS A 212 ? 0.5772 0.4699 0.4039 0.0089  -0.0337 0.0557  212 HIS A CA  
1629 C C   . HIS A 212 ? 0.6144 0.4692 0.4160 -0.0044 -0.0261 0.0621  212 HIS A C   
1630 O O   . HIS A 212 ? 0.6633 0.4879 0.4412 0.0012  -0.0206 0.0730  212 HIS A O   
1631 C CB  . HIS A 212 ? 0.5396 0.4636 0.3708 0.0054  -0.0366 0.0550  212 HIS A CB  
1632 C CG  . HIS A 212 ? 0.5018 0.4543 0.3465 0.0152  -0.0423 0.0488  212 HIS A CG  
1633 N ND1 . HIS A 212 ? 0.4361 0.3976 0.2779 0.0278  -0.0464 0.0547  212 HIS A ND1 
1634 C CD2 . HIS A 212 ? 0.4930 0.4664 0.3507 0.0127  -0.0433 0.0372  212 HIS A CD2 
1635 C CE1 . HIS A 212 ? 0.4868 0.4776 0.3405 0.0278  -0.0511 0.0452  212 HIS A CE1 
1636 N NE2 . HIS A 212 ? 0.4771 0.4690 0.3381 0.0184  -0.0481 0.0338  212 HIS A NE2 
1637 N N   . ILE A 213 ? 0.5910 0.4474 0.3948 -0.0229 -0.0247 0.0555  213 ILE A N   
1638 C CA  . ILE A 213 ? 0.6668 0.4876 0.4444 -0.0428 -0.0172 0.0581  213 ILE A CA  
1639 C C   . ILE A 213 ? 0.7874 0.5572 0.5442 -0.0340 -0.0107 0.0597  213 ILE A C   
1640 O O   . ILE A 213 ? 0.8145 0.5350 0.5368 -0.0411 -0.0004 0.0660  213 ILE A O   
1641 C CB  . ILE A 213 ? 0.6944 0.5411 0.4824 -0.0645 -0.0192 0.0498  213 ILE A CB  
1642 C CG1 . ILE A 213 ? 0.6637 0.5607 0.4693 -0.0691 -0.0225 0.0507  213 ILE A CG1 
1643 C CG2 . ILE A 213 ? 0.6946 0.5057 0.4525 -0.0920 -0.0118 0.0492  213 ILE A CG2 
1644 C CD1 . ILE A 213 ? 0.5959 0.5312 0.4136 -0.0856 -0.0242 0.0463  213 ILE A CD1 
1645 N N   . LEU A 214 ? 0.7614 0.5397 0.5361 -0.0176 -0.0144 0.0544  214 LEU A N   
1646 C CA  . LEU A 214 ? 0.7762 0.5102 0.5328 -0.0069 -0.0069 0.0556  214 LEU A CA  
1647 C C   . LEU A 214 ? 0.8145 0.5371 0.5654 0.0226  -0.0036 0.0673  214 LEU A C   
1648 O O   . LEU A 214 ? 0.8727 0.5584 0.6065 0.0376  0.0052  0.0712  214 LEU A O   
1649 C CB  . LEU A 214 ? 0.7276 0.4764 0.5040 -0.0051 -0.0107 0.0448  214 LEU A CB  
1650 C CG  . LEU A 214 ? 0.7144 0.4770 0.4934 -0.0307 -0.0135 0.0356  214 LEU A CG  
1651 C CD1 . LEU A 214 ? 0.6103 0.3935 0.4104 -0.0247 -0.0177 0.0270  214 LEU A CD1 
1652 C CD2 . LEU A 214 ? 0.7137 0.4282 0.4544 -0.0536 -0.0042 0.0347  214 LEU A CD2 
1653 N N   . SER A 215 ? 0.7608 0.5180 0.5245 0.0323  -0.0100 0.0737  215 SER A N   
1654 C CA  . SER A 215 ? 0.7416 0.5030 0.5023 0.0611  -0.0089 0.0865  215 SER A CA  
1655 C C   . SER A 215 ? 0.8440 0.5837 0.5781 0.0652  -0.0024 0.1005  215 SER A C   
1656 O O   . SER A 215 ? 0.8126 0.5742 0.5476 0.0564  -0.0080 0.1029  215 SER A O   
1657 C CB  . SER A 215 ? 0.6856 0.5103 0.4815 0.0697  -0.0216 0.0822  215 SER A CB  
1658 O OG  . SER A 215 ? 0.6684 0.5079 0.4674 0.0970  -0.0213 0.0925  215 SER A OG  
1659 N N   . LEU A 216 ? 0.9270 0.6321 0.6449 0.0773  0.0107  0.1057  216 LEU A N   
1660 C CA  . LEU A 216 ? 1.0199 0.7002 0.7138 0.0800  0.0201  0.1162  216 LEU A CA  
1661 C C   . LEU A 216 ? 1.0090 0.7297 0.7107 0.0883  0.0114  0.1269  216 LEU A C   
1662 O O   . LEU A 216 ? 0.9353 0.6436 0.6206 0.0734  0.0141  0.1307  216 LEU A O   
1663 C CB  . LEU A 216 ? 1.0951 0.7411 0.7713 0.1021  0.0350  0.1216  216 LEU A CB  
1664 C CG  . LEU A 216 ? 1.2021 0.7811 0.8384 0.0858  0.0521  0.1181  216 LEU A CG  
1665 C CD1 . LEU A 216 ? 1.1440 0.7116 0.7622 0.0731  0.0546  0.1257  216 LEU A CD1 
1666 C CD2 . LEU A 216 ? 1.1963 0.7555 0.8287 0.0559  0.0520  0.1015  216 LEU A CD2 
1667 N N   . PRO A 217 ? 0.9201 0.6928 0.6465 0.1094  0.0011  0.1307  217 PRO A N   
1668 C CA  . PRO A 217 ? 0.7753 0.5860 0.5049 0.1144  -0.0068 0.1391  217 PRO A CA  
1669 C C   . PRO A 217 ? 0.7638 0.5945 0.4959 0.0915  -0.0157 0.1326  217 PRO A C   
1670 O O   . PRO A 217 ? 0.9164 0.7598 0.6403 0.0893  -0.0173 0.1391  217 PRO A O   
1671 C CB  . PRO A 217 ? 0.6251 0.4940 0.3820 0.1354  -0.0167 0.1403  217 PRO A CB  
1672 C CG  . PRO A 217 ? 0.7277 0.5765 0.4875 0.1501  -0.0077 0.1395  217 PRO A CG  
1673 C CD  . PRO A 217 ? 0.7357 0.5360 0.4844 0.1288  -0.0020 0.1285  217 PRO A CD  
1674 N N   . SER A 218 ? 0.7061 0.5386 0.4468 0.0758  -0.0204 0.1199  218 SER A N   
1675 C CA  . SER A 218 ? 0.6953 0.5557 0.4485 0.0533  -0.0266 0.1090  218 SER A CA  
1676 C C   . SER A 218 ? 0.8418 0.6683 0.5712 0.0326  -0.0173 0.1125  218 SER A C   
1677 O O   . SER A 218 ? 0.7877 0.6383 0.5213 0.0189  -0.0196 0.1095  218 SER A O   
1678 C CB  . SER A 218 ? 0.5881 0.4705 0.3709 0.0411  -0.0321 0.0905  218 SER A CB  
1679 O OG  . SER A 218 ? 0.6092 0.5318 0.4144 0.0523  -0.0409 0.0848  218 SER A OG  
1680 N N   . ARG A 219 ? 0.9435 0.7134 0.6453 0.0291  -0.0054 0.1184  219 ARG A N   
1681 C CA  . ARG A 219 ? 0.9339 0.6719 0.6147 0.0000  0.0042  0.1170  219 ARG A CA  
1682 C C   . ARG A 219 ? 0.9271 0.6671 0.5935 -0.0066 0.0092  0.1264  219 ARG A C   
1683 O O   . ARG A 219 ? 0.9657 0.7077 0.6258 -0.0341 0.0128  0.1233  219 ARG A O   
1684 C CB  . ARG A 219 ? 0.9852 0.6689 0.6479 -0.0047 0.0171  0.1143  219 ARG A CB  
1685 C CG  . ARG A 219 ? 1.0537 0.7345 0.7271 -0.0120 0.0136  0.1020  219 ARG A CG  
1686 C CD  . ARG A 219 ? 1.1276 0.8487 0.8218 -0.0390 0.0054  0.0907  219 ARG A CD  
1687 N NE  . ARG A 219 ? 1.2691 0.9621 0.9416 -0.0726 0.0134  0.0853  219 ARG A NE  
1688 C CZ  . ARG A 219 ? 1.3537 1.0544 1.0155 -0.0999 0.0174  0.0870  219 ARG A CZ  
1689 N NH1 . ARG A 219 ? 1.3677 1.0992 1.0377 -0.0945 0.0147  0.0944  219 ARG A NH1 
1690 N NH2 . ARG A 219 ? 1.3300 1.0155 0.9772 -0.1325 0.0235  0.0787  219 ARG A NH2 
1691 N N   . SER A 220 ? 0.8440 0.5896 0.5070 0.0176  0.0094  0.1381  220 SER A N   
1692 C CA  . SER A 220 ? 0.9769 0.7249 0.6252 0.0137  0.0141  0.1482  220 SER A CA  
1693 C C   . SER A 220 ? 0.8759 0.6788 0.5387 0.0124  0.0024  0.1462  220 SER A C   
1694 O O   . SER A 220 ? 0.9914 0.8046 0.6443 0.0107  0.0049  0.1541  220 SER A O   
1695 C CB  . SER A 220 ? 1.0962 0.8283 0.7322 0.0399  0.0190  0.1623  220 SER A CB  
1696 O OG  . SER A 220 ? 1.1019 0.8804 0.7590 0.0642  0.0058  0.1642  220 SER A OG  
1697 N N   . LEU A 221 ? 0.7528 0.5897 0.4383 0.0132  -0.0092 0.1341  221 LEU A N   
1698 C CA  . LEU A 221 ? 0.6510 0.5427 0.3576 0.0126  -0.0188 0.1259  221 LEU A CA  
1699 C C   . LEU A 221 ? 0.6734 0.5854 0.3948 -0.0107 -0.0170 0.1143  221 LEU A C   
1700 O O   . LEU A 221 ? 0.7407 0.6897 0.4726 -0.0114 -0.0207 0.1082  221 LEU A O   
1701 C CB  . LEU A 221 ? 0.6273 0.5539 0.3598 0.0275  -0.0307 0.1160  221 LEU A CB  
1702 C CG  . LEU A 221 ? 0.7092 0.6346 0.4334 0.0531  -0.0339 0.1285  221 LEU A CG  
1703 C CD1 . LEU A 221 ? 0.6659 0.6341 0.4171 0.0615  -0.0456 0.1173  221 LEU A CD1 
1704 C CD2 . LEU A 221 ? 0.6382 0.5722 0.3491 0.0585  -0.0332 0.1399  221 LEU A CD2 
1705 N N   . PHE A 222 ? 0.5801 0.4705 0.3006 -0.0291 -0.0107 0.1113  222 PHE A N   
1706 C CA  . PHE A 222 ? 0.5474 0.4675 0.2834 -0.0495 -0.0087 0.1031  222 PHE A CA  
1707 C C   . PHE A 222 ? 0.6837 0.5775 0.4033 -0.0763 0.0008  0.1063  222 PHE A C   
1708 O O   . PHE A 222 ? 0.7866 0.6286 0.4793 -0.0790 0.0073  0.1130  222 PHE A O   
1709 C CB  . PHE A 222 ? 0.5423 0.4932 0.3099 -0.0438 -0.0160 0.0885  222 PHE A CB  
1710 C CG  . PHE A 222 ? 0.5796 0.5073 0.3530 -0.0435 -0.0179 0.0833  222 PHE A CG  
1711 C CD1 . PHE A 222 ? 0.5758 0.4824 0.3467 -0.0253 -0.0216 0.0846  222 PHE A CD1 
1712 C CD2 . PHE A 222 ? 0.5744 0.5067 0.3554 -0.0612 -0.0157 0.0778  222 PHE A CD2 
1713 C CE1 . PHE A 222 ? 0.6359 0.5204 0.4106 -0.0240 -0.0217 0.0800  222 PHE A CE1 
1714 C CE2 . PHE A 222 ? 0.6142 0.5240 0.3971 -0.0615 -0.0171 0.0726  222 PHE A CE2 
1715 C CZ  . PHE A 222 ? 0.6004 0.4835 0.3797 -0.0425 -0.0194 0.0734  222 PHE A CZ  
1716 N N   . HIS A 223 ? 0.6694 0.5993 0.4022 -0.0964 0.0031  0.1020  223 HIS A N   
1717 C CA  . HIS A 223 ? 0.7433 0.6584 0.4591 -0.1291 0.0121  0.1045  223 HIS A CA  
1718 C C   . HIS A 223 ? 0.7663 0.7191 0.5056 -0.1464 0.0089  0.0945  223 HIS A C   
1719 O O   . HIS A 223 ? 0.8766 0.8139 0.6014 -0.1754 0.0139  0.0930  223 HIS A O   
1720 C CB  . HIS A 223 ? 0.7048 0.6333 0.4072 -0.1433 0.0206  0.1136  223 HIS A CB  
1721 C CG  . HIS A 223 ? 0.8409 0.7440 0.5251 -0.1215 0.0225  0.1233  223 HIS A CG  
1722 N ND1 . HIS A 223 ? 0.8278 0.7611 0.5230 -0.0979 0.0150  0.1236  223 HIS A ND1 
1723 C CD2 . HIS A 223 ? 0.7962 0.6483 0.4521 -0.1176 0.0310  0.1326  223 HIS A CD2 
1724 C CE1 . HIS A 223 ? 0.6824 0.5901 0.3566 -0.0824 0.0172  0.1335  223 HIS A CE1 
1725 N NE2 . HIS A 223 ? 0.7676 0.6269 0.4191 -0.0915 0.0275  0.1405  223 HIS A NE2 
1726 N N   . ARG A 224 ? 0.6288 0.6294 0.4005 -0.1285 0.0014  0.0879  224 ARG A N   
1727 C CA  . ARG A 224 ? 0.5020 0.5497 0.2975 -0.1376 -0.0014 0.0817  224 ARG A CA  
1728 C C   . ARG A 224 ? 0.5383 0.6005 0.3575 -0.1083 -0.0085 0.0742  224 ARG A C   
1729 O O   . ARG A 224 ? 0.5984 0.6507 0.4184 -0.0862 -0.0103 0.0734  224 ARG A O   
1730 C CB  . ARG A 224 ? 0.5406 0.6481 0.3472 -0.1496 0.0037  0.0868  224 ARG A CB  
1731 C CG  . ARG A 224 ? 0.6507 0.7592 0.4391 -0.1893 0.0109  0.0915  224 ARG A CG  
1732 C CD  . ARG A 224 ? 0.7038 0.8732 0.5067 -0.1972 0.0163  0.0968  224 ARG A CD  
1733 N NE  . ARG A 224 ? 0.8545 1.0052 0.6457 -0.1832 0.0216  0.1028  224 ARG A NE  
1734 C CZ  . ARG A 224 ? 0.9186 1.0231 0.6830 -0.1969 0.0279  0.1071  224 ARG A CZ  
1735 N NH1 . ARG A 224 ? 0.9822 1.0477 0.7266 -0.2248 0.0312  0.1045  224 ARG A NH1 
1736 N NH2 . ARG A 224 ? 0.9633 1.0577 0.7178 -0.1813 0.0320  0.1134  224 ARG A NH2 
1737 N N   . ALA A 225 ? 0.5856 0.6712 0.4211 -0.1100 -0.0120 0.0688  225 ALA A N   
1738 C CA  . ALA A 225 ? 0.5662 0.6551 0.4186 -0.0841 -0.0165 0.0621  225 ALA A CA  
1739 C C   . ALA A 225 ? 0.5238 0.6650 0.3969 -0.0804 -0.0165 0.0615  225 ALA A C   
1740 O O   . ALA A 225 ? 0.4130 0.5829 0.2881 -0.1019 -0.0170 0.0638  225 ALA A O   
1741 C CB  . ALA A 225 ? 0.6018 0.6433 0.4462 -0.0819 -0.0208 0.0569  225 ALA A CB  
1742 N N   . VAL A 226 ? 0.4848 0.6381 0.3700 -0.0534 -0.0148 0.0588  226 VAL A N   
1743 C CA  . VAL A 226 ? 0.4172 0.6125 0.3185 -0.0399 -0.0128 0.0602  226 VAL A CA  
1744 C C   . VAL A 226 ? 0.5402 0.7046 0.4435 -0.0200 -0.0142 0.0528  226 VAL A C   
1745 O O   . VAL A 226 ? 0.5605 0.6920 0.4574 -0.0070 -0.0124 0.0472  226 VAL A O   
1746 C CB  . VAL A 226 ? 0.4772 0.7111 0.3846 -0.0212 -0.0034 0.0657  226 VAL A CB  
1747 C CG1 . VAL A 226 ? 0.4357 0.7084 0.3564 0.0005  0.0010  0.0697  226 VAL A CG1 
1748 C CG2 . VAL A 226 ? 0.4625 0.7335 0.3696 -0.0406 -0.0003 0.0738  226 VAL A CG2 
1749 N N   . LEU A 227 ? 0.4579 0.6346 0.3681 -0.0202 -0.0174 0.0526  227 LEU A N   
1750 C CA  . LEU A 227 ? 0.4421 0.5904 0.3530 -0.0028 -0.0174 0.0466  227 LEU A CA  
1751 C C   . LEU A 227 ? 0.4622 0.6469 0.3816 0.0189  -0.0114 0.0523  227 LEU A C   
1752 O O   . LEU A 227 ? 0.4743 0.7000 0.4011 0.0126  -0.0150 0.0581  227 LEU A O   
1753 C CB  . LEU A 227 ? 0.4852 0.6046 0.3913 -0.0182 -0.0249 0.0416  227 LEU A CB  
1754 C CG  . LEU A 227 ? 0.5563 0.6296 0.4500 -0.0315 -0.0283 0.0375  227 LEU A CG  
1755 C CD1 . LEU A 227 ? 0.5391 0.6193 0.4229 -0.0564 -0.0290 0.0421  227 LEU A CD1 
1756 C CD2 . LEU A 227 ? 0.4877 0.5246 0.3759 -0.0335 -0.0316 0.0318  227 LEU A CD2 
1757 N N   . GLN A 228 ? 0.4657 0.6349 0.3804 0.0443  -0.0012 0.0510  228 GLN A N   
1758 C CA  . GLN A 228 ? 0.4843 0.6790 0.4006 0.0719  0.0089  0.0587  228 GLN A CA  
1759 C C   . GLN A 228 ? 0.5128 0.6685 0.4222 0.0849  0.0116  0.0537  228 GLN A C   
1760 O O   . GLN A 228 ? 0.4833 0.5884 0.3808 0.0893  0.0169  0.0441  228 GLN A O   
1761 C CB  . GLN A 228 ? 0.4678 0.6638 0.3752 0.0936  0.0236  0.0614  228 GLN A CB  
1762 C CG  . GLN A 228 ? 0.5212 0.7554 0.4345 0.0812  0.0224  0.0666  228 GLN A CG  
1763 C CD  . GLN A 228 ? 0.5296 0.7535 0.4291 0.1000  0.0373  0.0663  228 GLN A CD  
1764 O OE1 . GLN A 228 ? 0.4546 0.6872 0.3526 0.0871  0.0363  0.0660  228 GLN A OE1 
1765 N NE2 . GLN A 228 ? 0.5262 0.7273 0.4110 0.1303  0.0530  0.0664  228 GLN A NE2 
1766 N N   . SER A 229 ? 0.3784 0.5604 0.2941 0.0879  0.0076  0.0599  229 SER A N   
1767 C CA  . SER A 229 ? 0.3349 0.4840 0.2429 0.1013  0.0114  0.0575  229 SER A CA  
1768 C C   . SER A 229 ? 0.4035 0.4938 0.3056 0.0869  0.0075  0.0435  229 SER A C   
1769 O O   . SER A 229 ? 0.4130 0.4617 0.3034 0.0993  0.0171  0.0383  229 SER A O   
1770 C CB  . SER A 229 ? 0.3523 0.4867 0.2462 0.1364  0.0301  0.0632  229 SER A CB  
1771 O OG  . SER A 229 ? 0.4089 0.5967 0.3073 0.1550  0.0369  0.0769  229 SER A OG  
1772 N N   . GLY A 230 ? 0.3267 0.4135 0.2344 0.0611  -0.0047 0.0382  230 GLY A N   
1773 C CA  . GLY A 230 ? 0.3265 0.3681 0.2307 0.0508  -0.0084 0.0279  230 GLY A CA  
1774 C C   . GLY A 230 ? 0.4705 0.5113 0.3766 0.0269  -0.0194 0.0260  230 GLY A C   
1775 O O   . GLY A 230 ? 0.4501 0.5157 0.3577 0.0144  -0.0230 0.0303  230 GLY A O   
1776 N N   . THR A 231 ? 0.4359 0.4451 0.3389 0.0208  -0.0226 0.0201  231 THR A N   
1777 C CA  . THR A 231 ? 0.4749 0.4711 0.3722 0.0017  -0.0292 0.0186  231 THR A CA  
1778 C C   . THR A 231 ? 0.4994 0.4572 0.3943 0.0044  -0.0288 0.0128  231 THR A C   
1779 O O   . THR A 231 ? 0.5177 0.4645 0.4167 0.0161  -0.0248 0.0090  231 THR A O   
1780 C CB  . THR A 231 ? 0.5735 0.5810 0.4652 -0.0094 -0.0327 0.0194  231 THR A CB  
1781 O OG1 . THR A 231 ? 0.5617 0.5596 0.4543 0.0042  -0.0299 0.0174  231 THR A OG1 
1782 C CG2 . THR A 231 ? 0.4359 0.4959 0.3317 -0.0160 -0.0349 0.0265  231 THR A CG2 
1783 N N   . PRO A 232 ? 0.6042 0.5421 0.4907 -0.0057 -0.0313 0.0132  232 PRO A N   
1784 C CA  . PRO A 232 ? 0.6118 0.5212 0.4970 0.0012  -0.0302 0.0105  232 PRO A CA  
1785 C C   . PRO A 232 ? 0.6570 0.5486 0.5375 0.0020  -0.0283 0.0071  232 PRO A C   
1786 O O   . PRO A 232 ? 0.6235 0.5049 0.5100 0.0121  -0.0256 0.0040  232 PRO A O   
1787 C CB  . PRO A 232 ? 0.5668 0.4589 0.4390 -0.0058 -0.0310 0.0152  232 PRO A CB  
1788 C CG  . PRO A 232 ? 0.4708 0.3706 0.3321 -0.0242 -0.0318 0.0176  232 PRO A CG  
1789 C CD  . PRO A 232 ? 0.5503 0.4907 0.4262 -0.0220 -0.0332 0.0176  232 PRO A CD  
1790 N N   . ASN A 233 ? 0.6919 0.5834 0.5608 -0.0108 -0.0294 0.0072  233 ASN A N   
1791 C CA  . ASN A 233 ? 0.6275 0.5075 0.4896 -0.0112 -0.0278 0.0034  233 ASN A CA  
1792 C C   . ASN A 233 ? 0.6195 0.5222 0.4943 0.0010  -0.0267 0.0033  233 ASN A C   
1793 O O   . ASN A 233 ? 0.6151 0.5390 0.5009 0.0091  -0.0260 0.0059  233 ASN A O   
1794 C CB  . ASN A 233 ? 0.5737 0.4511 0.4157 -0.0329 -0.0297 0.0023  233 ASN A CB  
1795 C CG  . ASN A 233 ? 0.6191 0.5404 0.4664 -0.0452 -0.0346 0.0063  233 ASN A CG  
1796 O OD1 . ASN A 233 ? 0.7837 0.7171 0.6379 -0.0454 -0.0352 0.0102  233 ASN A OD1 
1797 N ND2 . ASN A 233 ? 0.5658 0.5162 0.4099 -0.0546 -0.0380 0.0061  233 ASN A ND2 
1798 N N   . GLY A 234 ? 0.6549 0.5483 0.5241 0.0037  -0.0245 0.0008  234 GLY A N   
1799 C CA  . GLY A 234 ? 0.5913 0.4996 0.4669 0.0170  -0.0212 0.0026  234 GLY A CA  
1800 C C   . GLY A 234 ? 0.6052 0.4901 0.4851 0.0283  -0.0141 -0.0010 234 GLY A C   
1801 O O   . GLY A 234 ? 0.7314 0.5967 0.6129 0.0273  -0.0129 -0.0044 234 GLY A O   
1802 N N   . PRO A 235 ? 0.6045 0.4925 0.4848 0.0400  -0.0081 0.0008  235 PRO A N   
1803 C CA  . PRO A 235 ? 0.6007 0.4663 0.4812 0.0467  0.0004  -0.0028 235 PRO A CA  
1804 C C   . PRO A 235 ? 0.6673 0.5242 0.5566 0.0485  0.0063  -0.0068 235 PRO A C   
1805 O O   . PRO A 235 ? 0.6825 0.5256 0.5742 0.0482  0.0126  -0.0109 235 PRO A O   
1806 C CB  . PRO A 235 ? 0.5627 0.4327 0.4336 0.0577  0.0059  0.0026  235 PRO A CB  
1807 C CG  . PRO A 235 ? 0.5980 0.4958 0.4696 0.0634  0.0033  0.0096  235 PRO A CG  
1808 C CD  . PRO A 235 ? 0.6241 0.5382 0.5016 0.0485  -0.0075 0.0081  235 PRO A CD  
1809 N N   . TRP A 236 ? 0.6410 0.5085 0.5339 0.0480  0.0048  -0.0063 236 TRP A N   
1810 C CA  . TRP A 236 ? 0.5889 0.4481 0.4842 0.0464  0.0111  -0.0118 236 TRP A CA  
1811 C C   . TRP A 236 ? 0.6477 0.5189 0.5522 0.0381  0.0039  -0.0146 236 TRP A C   
1812 O O   . TRP A 236 ? 0.6649 0.5349 0.5722 0.0322  0.0070  -0.0207 236 TRP A O   
1813 C CB  . TRP A 236 ? 0.4539 0.3067 0.3373 0.0558  0.0207  -0.0097 236 TRP A CB  
1814 C CG  . TRP A 236 ? 0.5522 0.4282 0.4362 0.0606  0.0153  -0.0032 236 TRP A CG  
1815 C CD1 . TRP A 236 ? 0.5330 0.4297 0.4147 0.0694  0.0128  0.0058  236 TRP A CD1 
1816 C CD2 . TRP A 236 ? 0.6378 0.5247 0.5250 0.0558  0.0117  -0.0049 236 TRP A CD2 
1817 N NE1 . TRP A 236 ? 0.5279 0.4497 0.4131 0.0697  0.0087  0.0100  236 TRP A NE1 
1818 C CE2 . TRP A 236 ? 0.6208 0.5336 0.5084 0.0621  0.0084  0.0036  236 TRP A CE2 
1819 C CE3 . TRP A 236 ? 0.5977 0.4797 0.4870 0.0462  0.0108  -0.0123 236 TRP A CE3 
1820 C CZ2 . TRP A 236 ? 0.5684 0.4979 0.4581 0.0597  0.0057  0.0049  236 TRP A CZ2 
1821 C CZ3 . TRP A 236 ? 0.6719 0.5685 0.5612 0.0445  0.0073  -0.0111 236 TRP A CZ3 
1822 C CH2 . TRP A 236 ? 0.5969 0.5145 0.4861 0.0515  0.0055  -0.0026 236 TRP A CH2 
1823 N N   . ALA A 237 ? 0.6086 0.4921 0.5152 0.0360  -0.0051 -0.0101 237 ALA A N   
1824 C CA  . ALA A 237 ? 0.5641 0.4585 0.4751 0.0311  -0.0108 -0.0103 237 ALA A CA  
1825 C C   . ALA A 237 ? 0.5671 0.4633 0.4855 0.0295  -0.0140 -0.0112 237 ALA A C   
1826 O O   . ALA A 237 ? 0.6460 0.5555 0.5684 0.0270  -0.0172 -0.0119 237 ALA A O   
1827 C CB  . ALA A 237 ? 0.3590 0.2642 0.2664 0.0283  -0.0170 -0.0042 237 ALA A CB  
1828 N N   . THR A 238 ? 0.5361 0.4220 0.4550 0.0328  -0.0124 -0.0102 238 THR A N   
1829 C CA  . THR A 238 ? 0.5590 0.4504 0.4851 0.0369  -0.0130 -0.0087 238 THR A CA  
1830 C C   . THR A 238 ? 0.7082 0.5965 0.6397 0.0395  -0.0060 -0.0119 238 THR A C   
1831 O O   . THR A 238 ? 0.7997 0.6730 0.7251 0.0390  -0.0010 -0.0142 238 THR A O   
1832 C CB  . THR A 238 ? 0.5966 0.4736 0.5126 0.0422  -0.0153 -0.0015 238 THR A CB  
1833 O OG1 . THR A 238 ? 0.7938 0.6473 0.6972 0.0409  -0.0120 -0.0023 238 THR A OG1 
1834 C CG2 . THR A 238 ? 0.6165 0.4955 0.5255 0.0377  -0.0208 0.0026  238 THR A CG2 
1835 N N   . VAL A 239 ? 0.6768 0.5839 0.6198 0.0432  -0.0053 -0.0108 239 VAL A N   
1836 C CA  . VAL A 239 ? 0.5427 0.4514 0.4919 0.0473  0.0022  -0.0118 239 VAL A CA  
1837 C C   . VAL A 239 ? 0.6093 0.5264 0.5614 0.0626  0.0024  -0.0034 239 VAL A C   
1838 O O   . VAL A 239 ? 0.6883 0.6179 0.6410 0.0684  -0.0032 0.0028  239 VAL A O   
1839 C CB  . VAL A 239 ? 0.5275 0.4598 0.4891 0.0354  0.0065  -0.0190 239 VAL A CB  
1840 C CG1 . VAL A 239 ? 0.4044 0.3137 0.3546 0.0247  0.0119  -0.0262 239 VAL A CG1 
1841 C CG2 . VAL A 239 ? 0.4863 0.4570 0.4592 0.0299  -0.0003 -0.0190 239 VAL A CG2 
1842 N N   . SER A 240 ? 0.5850 0.4926 0.5357 0.0717  0.0104  -0.0019 240 SER A N   
1843 C CA  . SER A 240 ? 0.5769 0.4874 0.5262 0.0916  0.0147  0.0074  240 SER A CA  
1844 C C   . SER A 240 ? 0.4695 0.4360 0.4430 0.0967  0.0130  0.0119  240 SER A C   
1845 O O   . SER A 240 ? 0.5159 0.5139 0.5052 0.0797  0.0103  0.0047  240 SER A O   
1846 C CB  . SER A 240 ? 0.5430 0.4303 0.4833 0.0999  0.0259  0.0067  240 SER A CB  
1847 O OG  . SER A 240 ? 0.5848 0.4933 0.5406 0.0897  0.0299  0.0003  240 SER A OG  
1848 N N   . ALA A 241 ? 0.4640 0.6394 0.3534 0.2054  -0.0107 -0.0111 241 ALA A N   
1849 C CA  . ALA A 241 ? 0.6154 0.8233 0.5223 0.2088  -0.0090 -0.0062 241 ALA A CA  
1850 C C   . ALA A 241 ? 0.5986 0.8478 0.5123 0.2168  0.0117  -0.0140 241 ALA A C   
1851 O O   . ALA A 241 ? 0.5074 0.7895 0.4309 0.2038  0.0215  -0.0065 241 ALA A O   
1852 C CB  . ALA A 241 ? 0.6502 0.8393 0.5628 0.2298  -0.0338 -0.0081 241 ALA A CB  
1853 N N   . GLY A 242 ? 0.6245 0.8734 0.5302 0.2346  0.0168  -0.0277 242 GLY A N   
1854 C CA  . GLY A 242 ? 0.5577 0.8527 0.4641 0.2358  0.0351  -0.0331 242 GLY A CA  
1855 C C   . GLY A 242 ? 0.5180 0.8185 0.4151 0.2059  0.0461  -0.0210 242 GLY A C   
1856 O O   . GLY A 242 ? 0.4974 0.8373 0.4005 0.1930  0.0543  -0.0135 242 GLY A O   
1857 N N   . GLU A 243 ? 0.3571 0.6176 0.2395 0.1950  0.0421  -0.0205 243 GLU A N   
1858 C CA  . GLU A 243 ? 0.4757 0.7320 0.3473 0.1725  0.0437  -0.0150 243 GLU A CA  
1859 C C   . GLU A 243 ? 0.5775 0.8480 0.4621 0.1573  0.0399  -0.0057 243 GLU A C   
1860 O O   . GLU A 243 ? 0.6007 0.8816 0.4811 0.1408  0.0388  0.0011  243 GLU A O   
1861 C CB  . GLU A 243 ? 0.5067 0.7206 0.3621 0.1704  0.0366  -0.0235 243 GLU A CB  
1862 C CG  . GLU A 243 ? 0.6233 0.8238 0.4678 0.1524  0.0283  -0.0236 243 GLU A CG  
1863 C CD  . GLU A 243 ? 0.6520 0.8561 0.4778 0.1396  0.0287  -0.0160 243 GLU A CD  
1864 O OE1 . GLU A 243 ? 0.6012 0.8286 0.4222 0.1445  0.0403  -0.0134 243 GLU A OE1 
1865 O OE2 . GLU A 243 ? 0.6776 0.8632 0.4917 0.1232  0.0138  -0.0135 243 GLU A OE2 
1866 N N   . ALA A 244 ? 0.5947 0.8638 0.4924 0.1604  0.0345  -0.0040 244 ALA A N   
1867 C CA  . ALA A 244 ? 0.4871 0.7730 0.3962 0.1461  0.0308  0.0033  244 ALA A CA  
1868 C C   . ALA A 244 ? 0.4609 0.7822 0.3829 0.1448  0.0366  0.0128  244 ALA A C   
1869 O O   . ALA A 244 ? 0.5153 0.8507 0.4406 0.1298  0.0347  0.0193  244 ALA A O   
1870 C CB  . ALA A 244 ? 0.4503 0.7315 0.3657 0.1439  0.0227  0.0058  244 ALA A CB  
1871 N N   . ARG A 245 ? 0.4290 0.7674 0.3588 0.1619  0.0409  0.0108  245 ARG A N   
1872 C CA  . ARG A 245 ? 0.4549 0.8403 0.3997 0.1625  0.0472  0.0157  245 ARG A CA  
1873 C C   . ARG A 245 ? 0.5324 0.9384 0.4653 0.1425  0.0546  0.0221  245 ARG A C   
1874 O O   . ARG A 245 ? 0.5631 0.9935 0.5020 0.1250  0.0542  0.0334  245 ARG A O   
1875 C CB  . ARG A 245 ? 0.3592 0.7677 0.3153 0.1906  0.0475  0.0036  245 ARG A CB  
1876 C CG  . ARG A 245 ? 0.3433 0.8162 0.3191 0.1935  0.0543  0.0035  245 ARG A CG  
1877 C CD  . ARG A 245 ? 0.3442 0.8379 0.3365 0.2281  0.0459  -0.0156 245 ARG A CD  
1878 N NE  . ARG A 245 ? 0.5828 1.0413 0.5853 0.2400  0.0255  -0.0134 245 ARG A NE  
1879 C CZ  . ARG A 245 ? 0.6159 1.0951 0.6369 0.2381  0.0191  -0.0070 245 ARG A CZ  
1880 N NH1 . ARG A 245 ? 0.4916 1.0319 0.5260 0.2274  0.0335  -0.0036 245 ARG A NH1 
1881 N NH2 . ARG A 245 ? 0.7528 1.1912 0.7762 0.2435  -0.0039 -0.0019 245 ARG A NH2 
1882 N N   . ARG A 246 ? 0.4664 0.8585 0.3793 0.1421  0.0578  0.0167  246 ARG A N   
1883 C CA  . ARG A 246 ? 0.4628 0.8671 0.3564 0.1173  0.0591  0.0263  246 ARG A CA  
1884 C C   . ARG A 246 ? 0.5341 0.9076 0.4188 0.0932  0.0436  0.0370  246 ARG A C   
1885 O O   . ARG A 246 ? 0.5444 0.9350 0.4209 0.0678  0.0381  0.0516  246 ARG A O   
1886 C CB  . ARG A 246 ? 0.5500 0.9321 0.4196 0.1201  0.0608  0.0188  246 ARG A CB  
1887 C CG  . ARG A 246 ? 0.6322 1.0279 0.4757 0.0894  0.0587  0.0322  246 ARG A CG  
1888 C CD  . ARG A 246 ? 0.5532 0.9118 0.3687 0.0891  0.0551  0.0264  246 ARG A CD  
1889 N NE  . ARG A 246 ? 0.5655 0.8535 0.3708 0.0894  0.0367  0.0218  246 ARG A NE  
1890 C CZ  . ARG A 246 ? 0.5574 0.8101 0.3470 0.0665  0.0145  0.0306  246 ARG A CZ  
1891 N NH1 . ARG A 246 ? 0.5138 0.7874 0.2930 0.0362  0.0067  0.0504  246 ARG A NH1 
1892 N NH2 . ARG A 246 ? 0.5176 0.7156 0.3017 0.0742  -0.0037 0.0179  246 ARG A NH2 
1893 N N   . ARG A 247 ? 0.5088 0.8406 0.3944 0.1006  0.0335  0.0281  247 ARG A N   
1894 C CA  . ARG A 247 ? 0.5178 0.8227 0.3968 0.0859  0.0142  0.0290  247 ARG A CA  
1895 C C   . ARG A 247 ? 0.5588 0.8895 0.4568 0.0790  0.0115  0.0371  247 ARG A C   
1896 O O   . ARG A 247 ? 0.5725 0.8954 0.4634 0.0610  -0.0048 0.0445  247 ARG A O   
1897 C CB  . ARG A 247 ? 0.4259 0.6954 0.3019 0.0978  0.0048  0.0106  247 ARG A CB  
1898 C CG  . ARG A 247 ? 0.4633 0.7010 0.3192 0.1035  0.0033  0.0018  247 ARG A CG  
1899 C CD  . ARG A 247 ? 0.4952 0.7111 0.3532 0.1153  -0.0053 -0.0186 247 ARG A CD  
1900 N NE  . ARG A 247 ? 0.5010 0.6850 0.3419 0.1224  -0.0083 -0.0291 247 ARG A NE  
1901 C CZ  . ARG A 247 ? 0.6311 0.7990 0.4715 0.1311  -0.0180 -0.0492 247 ARG A CZ  
1902 N NH1 . ARG A 247 ? 0.6483 0.8376 0.5044 0.1327  -0.0245 -0.0619 247 ARG A NH1 
1903 N NH2 . ARG A 247 ? 0.4489 0.5868 0.2737 0.1376  -0.0215 -0.0582 247 ARG A NH2 
1904 N N   . ALA A 248 ? 0.5480 0.9037 0.4676 0.0924  0.0230  0.0364  248 ALA A N   
1905 C CA  . ALA A 248 ? 0.5274 0.9090 0.4650 0.0863  0.0210  0.0448  248 ALA A CA  
1906 C C   . ALA A 248 ? 0.5437 0.9599 0.4833 0.0712  0.0246  0.0599  248 ALA A C   
1907 O O   . ALA A 248 ? 0.5415 0.9638 0.4827 0.0540  0.0139  0.0698  248 ALA A O   
1908 C CB  . ALA A 248 ? 0.4427 0.8390 0.3985 0.1019  0.0282  0.0432  248 ALA A CB  
1909 N N   . THR A 249 ? 0.5098 0.9538 0.4486 0.0768  0.0384  0.0602  249 THR A N   
1910 C CA  . THR A 249 ? 0.4522 0.9499 0.3938 0.0610  0.0455  0.0720  249 THR A CA  
1911 C C   . THR A 249 ? 0.4260 0.9077 0.3410 0.0258  0.0307  0.0879  249 THR A C   
1912 O O   . THR A 249 ? 0.5195 1.0306 0.4359 0.0012  0.0252  0.1043  249 THR A O   
1913 C CB  . THR A 249 ? 0.5134 1.0512 0.4575 0.0778  0.0621  0.0615  249 THR A CB  
1914 O OG1 . THR A 249 ? 0.5964 1.1430 0.5648 0.1109  0.0663  0.0470  249 THR A OG1 
1915 C CG2 . THR A 249 ? 0.4042 1.0086 0.3510 0.0567  0.0686  0.0702  249 THR A CG2 
1916 N N   . LEU A 250 ? 0.4784 0.9086 0.3677 0.0221  0.0194  0.0838  250 LEU A N   
1917 C CA  . LEU A 250 ? 0.5309 0.9298 0.3888 -0.0116 -0.0043 0.0988  250 LEU A CA  
1918 C C   . LEU A 250 ? 0.6260 0.9866 0.4838 -0.0209 -0.0322 0.1018  250 LEU A C   
1919 O O   . LEU A 250 ? 0.6300 0.9853 0.4719 -0.0532 -0.0534 0.1212  250 LEU A O   
1920 C CB  . LEU A 250 ? 0.4415 0.7905 0.2716 -0.0092 -0.0133 0.0906  250 LEU A CB  
1921 C CG  . LEU A 250 ? 0.5736 0.8707 0.3661 -0.0428 -0.0489 0.1050  250 LEU A CG  
1922 C CD1 . LEU A 250 ? 0.5475 0.8861 0.3232 -0.0867 -0.0529 0.1350  250 LEU A CD1 
1923 C CD2 . LEU A 250 ? 0.5012 0.7535 0.2667 -0.0391 -0.0565 0.0965  250 LEU A CD2 
1924 N N   . LEU A 251 ? 0.6312 0.9689 0.5053 0.0054  -0.0343 0.0821  251 LEU A N   
1925 C CA  . LEU A 251 ? 0.5451 0.8562 0.4222 0.0033  -0.0602 0.0771  251 LEU A CA  
1926 C C   . LEU A 251 ? 0.5037 0.8541 0.3974 -0.0105 -0.0574 0.0937  251 LEU A C   
1927 O O   . LEU A 251 ? 0.5825 0.9115 0.4666 -0.0290 -0.0856 0.1020  251 LEU A O   
1928 C CB  . LEU A 251 ? 0.5336 0.8355 0.4264 0.0319  -0.0578 0.0513  251 LEU A CB  
1929 C CG  . LEU A 251 ? 0.5570 0.8488 0.4562 0.0328  -0.0826 0.0413  251 LEU A CG  
1930 C CD1 . LEU A 251 ? 0.5416 0.7794 0.4206 0.0368  -0.1208 0.0207  251 LEU A CD1 
1931 C CD2 . LEU A 251 ? 0.5558 0.8817 0.4796 0.0508  -0.0656 0.0286  251 LEU A CD2 
1932 N N   . ALA A 252 ? 0.4934 0.8979 0.4114 -0.0001 -0.0280 0.0972  252 ALA A N   
1933 C CA  . ALA A 252 ? 0.4674 0.9189 0.4030 -0.0130 -0.0229 0.1129  252 ALA A CA  
1934 C C   . ALA A 252 ? 0.5278 0.9910 0.4431 -0.0518 -0.0363 0.1366  252 ALA A C   
1935 O O   . ALA A 252 ? 0.5183 0.9777 0.4326 -0.0721 -0.0559 0.1496  252 ALA A O   
1936 C CB  . ALA A 252 ? 0.3366 0.8442 0.2986 0.0068  0.0062  0.1092  252 ALA A CB  
1937 N N   . ARG A 253 ? 0.4762 0.9548 0.3730 -0.0652 -0.0278 0.1434  253 ARG A N   
1938 C CA  . ARG A 253 ? 0.5458 1.0405 0.4162 -0.1115 -0.0423 0.1702  253 ARG A CA  
1939 C C   . ARG A 253 ? 0.5997 1.0161 0.4400 -0.1363 -0.0886 0.1809  253 ARG A C   
1940 O O   . ARG A 253 ? 0.6304 1.0509 0.4617 -0.1704 -0.1103 0.2033  253 ARG A O   
1941 C CB  . ARG A 253 ? 0.5267 1.0444 0.3747 -0.1234 -0.0294 0.1737  253 ARG A CB  
1942 C CG  . ARG A 253 ? 0.6628 1.2687 0.5387 -0.1038 0.0092  0.1618  253 ARG A CG  
1943 C CD  . ARG A 253 ? 0.9028 1.5301 0.7647 -0.1231 0.0146  0.1623  253 ARG A CD  
1944 N NE  . ARG A 253 ? 0.9648 1.6562 0.8574 -0.0917 0.0417  0.1379  253 ARG A NE  
1945 C CZ  . ARG A 253 ? 0.9379 1.6099 0.8307 -0.0567 0.0537  0.1165  253 ARG A CZ  
1946 N NH1 . ARG A 253 ? 0.7960 1.3945 0.6612 -0.0489 0.0454  0.1162  253 ARG A NH1 
1947 N NH2 . ARG A 253 ? 0.9192 1.6433 0.8373 -0.0282 0.0691  0.0936  253 ARG A NH2 
1948 N N   . LEU A 254 ? 0.5960 0.9410 0.4215 -0.1175 -0.1074 0.1626  254 LEU A N   
1949 C CA  . LEU A 254 ? 0.5995 0.8627 0.3951 -0.1330 -0.1593 0.1645  254 LEU A CA  
1950 C C   . LEU A 254 ? 0.7140 0.9629 0.5237 -0.1304 -0.1829 0.1620  254 LEU A C   
1951 O O   . LEU A 254 ? 0.8112 0.9973 0.6006 -0.1490 -0.2266 0.1666  254 LEU A O   
1952 C CB  . LEU A 254 ? 0.5906 0.7930 0.3769 -0.1028 -0.1725 0.1357  254 LEU A CB  
1953 C CG  . LEU A 254 ? 0.6342 0.8323 0.3990 -0.1076 -0.1597 0.1382  254 LEU A CG  
1954 C CD1 . LEU A 254 ? 0.6066 0.7416 0.3630 -0.0781 -0.1785 0.1083  254 LEU A CD1 
1955 C CD2 . LEU A 254 ? 0.6989 0.8850 0.4226 -0.1608 -0.1843 0.1727  254 LEU A CD2 
1956 N N   . VAL A 255 ? 0.6298 0.9280 0.4776 -0.1045 -0.1524 0.1505  255 VAL A N   
1957 C CA  . VAL A 255 ? 0.7254 1.0204 0.5882 -0.1020 -0.1703 0.1483  255 VAL A CA  
1958 C C   . VAL A 255 ? 0.7701 1.1323 0.6518 -0.1229 -0.1499 0.1726  255 VAL A C   
1959 O O   . VAL A 255 ? 0.7147 1.0894 0.6163 -0.1162 -0.1535 0.1704  255 VAL A O   
1960 C CB  . VAL A 255 ? 0.5758 0.8717 0.4646 -0.0590 -0.1600 0.1147  255 VAL A CB  
1961 C CG1 . VAL A 255 ? 0.5814 0.8222 0.4544 -0.0385 -0.1832 0.0864  255 VAL A CG1 
1962 C CG2 . VAL A 255 ? 0.4438 0.7994 0.3614 -0.0387 -0.1114 0.1110  255 VAL A CG2 
1963 N N   . GLY A 256 ? 0.8364 1.2487 0.7127 -0.1472 -0.1285 0.1932  256 GLY A N   
1964 C CA  . GLY A 256 ? 0.7439 1.2305 0.6366 -0.1709 -0.1129 0.2148  256 GLY A CA  
1965 C C   . GLY A 256 ? 0.6008 1.1588 0.5362 -0.1393 -0.0717 0.2015  256 GLY A C   
1966 O O   . GLY A 256 ? 0.6470 1.2444 0.6036 -0.1449 -0.0689 0.2094  256 GLY A O   
1967 N N   . CYS A 257 ? 0.6343 1.2044 0.5807 -0.1065 -0.0444 0.1816  257 CYS A N   
1968 C CA  . CYS A 257 ? 0.5464 1.1716 0.5293 -0.0743 -0.0140 0.1675  257 CYS A CA  
1969 C C   . CYS A 257 ? 0.5243 1.2021 0.5105 -0.0644 0.0121  0.1598  257 CYS A C   
1970 O O   . CYS A 257 ? 0.6198 1.3758 0.6187 -0.0761 0.0254  0.1651  257 CYS A O   
1971 C CB  . CYS A 257 ? 0.5907 1.1716 0.5853 -0.0383 -0.0136 0.1465  257 CYS A CB  
1972 S SG  . CYS A 257 ? 0.8245 1.3663 0.8230 -0.0398 -0.0394 0.1459  257 CYS A SG  
1973 N N   . ASN A 265 ? 0.8323 1.6408 0.9462 0.1990  0.0390  -0.0155 265 ASN A N   
1974 C CA  . ASN A 265 ? 0.7600 1.5231 0.8873 0.2124  0.0243  -0.0100 265 ASN A CA  
1975 C C   . ASN A 265 ? 0.6409 1.3558 0.7567 0.1900  0.0272  0.0176  265 ASN A C   
1976 O O   . ASN A 265 ? 0.6780 1.4040 0.7869 0.1581  0.0367  0.0378  265 ASN A O   
1977 C CB  . ASN A 265 ? 0.7693 1.5685 0.9168 0.2107  0.0193  -0.0108 265 ASN A CB  
1978 C CG  . ASN A 265 ? 0.7472 1.5004 0.9087 0.2238  -0.0008 -0.0049 265 ASN A CG  
1979 O OD1 . ASN A 265 ? 0.6279 1.3433 0.7824 0.2061  -0.0018 0.0188  265 ASN A OD1 
1980 N ND2 . ASN A 265 ? 0.7498 1.5077 0.9298 0.2534  -0.0204 -0.0269 265 ASN A ND2 
1981 N N   . ASP A 266 ? 0.4950 1.1575 0.6079 0.2065  0.0148  0.0173  266 ASP A N   
1982 C CA  . ASP A 266 ? 0.4623 1.0876 0.5637 0.1876  0.0162  0.0384  266 ASP A CA  
1983 C C   . ASP A 266 ? 0.4692 1.0899 0.5777 0.1688  0.0097  0.0571  266 ASP A C   
1984 O O   . ASP A 266 ? 0.3793 0.9761 0.4718 0.1427  0.0144  0.0710  266 ASP A O   
1985 C CB  . ASP A 266 ? 0.5354 1.1003 0.6233 0.2033  0.0008  0.0341  266 ASP A CB  
1986 C CG  . ASP A 266 ? 0.6517 1.2122 0.7270 0.2150  0.0097  0.0204  266 ASP A CG  
1987 O OD1 . ASP A 2