data_4BWM
# 
_entry.id   4BWM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BWM         
PDBE  EBI-57573    
WWPDB D_1290057573 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4BWJ 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'KLENTAQ MUTANT IN COMPLEX WITH DNA AND DDCTP' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BWM 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blatter, N.'    1 
'Bergen, K.'     2 
'Welte, W.'      3 
'Diederichs, K.' 4 
'Marx, A.'       5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure and Function of an RNA-Reading Thermostable DNA Polymerase.'  Angew.Chem.Int.Ed.Engl. 52  11935 ? 2013 ? GE 
1433-7851 9999 ? 24106012 10.1002/ANIE.201306655 
1       'Struktur Und Funktion Einer RNA-Lesenden Thermostabilen DNA-Polymerase' Angew.Chem.             125 12154 ? 2013 ? GE 
1433-7851 9999 ? ?        10.1002/ANGE.201306655 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Blatter, N.'    1  ? 
primary 'Bergen, K.'     2  ? 
primary 'Nolte, O.'      3  ? 
primary 'Welte, W.'      4  ? 
primary 'Diederichs, K.' 5  ? 
primary 'Mayer, J.'      6  ? 
primary 'Wieland, M.'    7  ? 
primary 'Marx, A.'       8  ? 
1       'Blatter, N.'    9  ? 
1       'Bergen, K.'     10 ? 
1       'Nolte, O.'      11 ? 
1       'Welte, W.'      12 ? 
1       'Diederichs, K.' 13 ? 
1       'Mayer, J.'      14 ? 
1       'Wieland, M.'    15 ? 
1       'Marx, A.'       16 ? 
# 
_cell.entry_id           4BWM 
_cell.length_a           143.192 
_cell.length_b           86.282 
_cell.length_c           63.094 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BWM 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE I, THERMOSTABLE'                           61057.113 1   2.7.7.7 YES 
'KLENOW FRAGMENT, RESIDUES 293-832' ? 
2 polymer     syn "5'-D(*GP*AP*CP*CP*AP*CP*GP*GP*CP*GP*CP*DOCP)-3'"          3617.371  1   ?       ?   ? ? 
3 polymer     syn "5'-R(*AP*AP*AP*GP*GP*GP*CP*GP*CP*CP*GP*UP*GP*GP*UP*C)-3'" 5192.160  1   ?       ?   ? ? 
4 non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   1   ?       ?   ?                                   ? 
5 non-polymer syn 'CHLORIDE ION'                                             35.453    2   ?       ?   ? ? 
6 non-polymer syn 'MAGNESIUM ION'                                            24.305    3   ?       ?   ? ? 
7 non-polymer syn 'FORMIC ACID'                                              46.025    4   ?       ?   ? ? 
8 water       nat water                                                      18.015    631 ?       ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'TAQ POLYMERASE 1' 
2 PRIMER             
3 TEMPLATE           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;ALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDD
PMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLD
VAYLRAMSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTRAAVLEALREAHPIVEKI
LQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYS
QIELRVLAHLSGDENLIRVFQEGRDFHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAF
IERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERKAFNMPVQGTAADLMKLAMVKLFPRL
EEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKE
;
;ALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDD
PMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLD
VAYLRAMSLEVAEEIARLEAEVFRLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTRAAVLEALREAHPIVEKI
LQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYS
QIELRVLAHLSGDENLIRVFQEGRDFHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAF
IERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERKAFNMPVQGTAADLMKLAMVKLFPRL
EEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKE
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DA)(DC)(DC)(DA)(DC)(DG)(DG)(DC)(DG)(DC)(DOC)' GACCACGGCGCC B ? 
3 polyribonucleotide      no no  AAAGGGCGCCGUGGUC AAAGGGCGCCGUGGUC G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   LEU n 
1 3   GLU n 
1 4   GLU n 
1 5   ALA n 
1 6   PRO n 
1 7   TRP n 
1 8   PRO n 
1 9   PRO n 
1 10  PRO n 
1 11  GLU n 
1 12  GLY n 
1 13  ALA n 
1 14  PHE n 
1 15  VAL n 
1 16  GLY n 
1 17  PHE n 
1 18  VAL n 
1 19  LEU n 
1 20  SER n 
1 21  ARG n 
1 22  LYS n 
1 23  GLU n 
1 24  PRO n 
1 25  MET n 
1 26  TRP n 
1 27  ALA n 
1 28  ASP n 
1 29  LEU n 
1 30  LEU n 
1 31  ALA n 
1 32  LEU n 
1 33  ALA n 
1 34  ALA n 
1 35  ALA n 
1 36  ARG n 
1 37  GLY n 
1 38  GLY n 
1 39  ARG n 
1 40  VAL n 
1 41  HIS n 
1 42  ARG n 
1 43  ALA n 
1 44  PRO n 
1 45  GLU n 
1 46  PRO n 
1 47  TYR n 
1 48  LYS n 
1 49  ALA n 
1 50  LEU n 
1 51  ARG n 
1 52  ASP n 
1 53  LEU n 
1 54  LYS n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  GLY n 
1 59  LEU n 
1 60  LEU n 
1 61  ALA n 
1 62  LYS n 
1 63  ASP n 
1 64  LEU n 
1 65  SER n 
1 66  VAL n 
1 67  LEU n 
1 68  ALA n 
1 69  LEU n 
1 70  ARG n 
1 71  GLU n 
1 72  GLY n 
1 73  LEU n 
1 74  GLY n 
1 75  LEU n 
1 76  PRO n 
1 77  PRO n 
1 78  GLY n 
1 79  ASP n 
1 80  ASP n 
1 81  PRO n 
1 82  MET n 
1 83  LEU n 
1 84  LEU n 
1 85  ALA n 
1 86  TYR n 
1 87  LEU n 
1 88  LEU n 
1 89  ASP n 
1 90  PRO n 
1 91  SER n 
1 92  ASN n 
1 93  THR n 
1 94  THR n 
1 95  PRO n 
1 96  GLU n 
1 97  GLY n 
1 98  VAL n 
1 99  ALA n 
1 100 ARG n 
1 101 ARG n 
1 102 TYR n 
1 103 GLY n 
1 104 GLY n 
1 105 GLU n 
1 106 TRP n 
1 107 THR n 
1 108 GLU n 
1 109 GLU n 
1 110 ALA n 
1 111 GLY n 
1 112 GLU n 
1 113 ARG n 
1 114 ALA n 
1 115 ALA n 
1 116 LEU n 
1 117 SER n 
1 118 GLU n 
1 119 ARG n 
1 120 LEU n 
1 121 PHE n 
1 122 ALA n 
1 123 ASN n 
1 124 LEU n 
1 125 TRP n 
1 126 GLY n 
1 127 ARG n 
1 128 LEU n 
1 129 GLU n 
1 130 GLY n 
1 131 GLU n 
1 132 GLU n 
1 133 ARG n 
1 134 LEU n 
1 135 LEU n 
1 136 TRP n 
1 137 LEU n 
1 138 TYR n 
1 139 ARG n 
1 140 GLU n 
1 141 VAL n 
1 142 GLU n 
1 143 ARG n 
1 144 PRO n 
1 145 LEU n 
1 146 SER n 
1 147 ALA n 
1 148 VAL n 
1 149 LEU n 
1 150 ALA n 
1 151 HIS n 
1 152 MET n 
1 153 GLU n 
1 154 ALA n 
1 155 THR n 
1 156 GLY n 
1 157 VAL n 
1 158 ARG n 
1 159 LEU n 
1 160 ASP n 
1 161 VAL n 
1 162 ALA n 
1 163 TYR n 
1 164 LEU n 
1 165 ARG n 
1 166 ALA n 
1 167 MET n 
1 168 SER n 
1 169 LEU n 
1 170 GLU n 
1 171 VAL n 
1 172 ALA n 
1 173 GLU n 
1 174 GLU n 
1 175 ILE n 
1 176 ALA n 
1 177 ARG n 
1 178 LEU n 
1 179 GLU n 
1 180 ALA n 
1 181 GLU n 
1 182 VAL n 
1 183 PHE n 
1 184 ARG n 
1 185 LEU n 
1 186 ALA n 
1 187 GLY n 
1 188 HIS n 
1 189 PRO n 
1 190 PHE n 
1 191 ASN n 
1 192 LEU n 
1 193 ASN n 
1 194 SER n 
1 195 ARG n 
1 196 ASP n 
1 197 GLN n 
1 198 LEU n 
1 199 GLU n 
1 200 ARG n 
1 201 VAL n 
1 202 LEU n 
1 203 PHE n 
1 204 ASP n 
1 205 GLU n 
1 206 LEU n 
1 207 GLY n 
1 208 LEU n 
1 209 PRO n 
1 210 ALA n 
1 211 ILE n 
1 212 GLY n 
1 213 LYS n 
1 214 THR n 
1 215 GLU n 
1 216 LYS n 
1 217 THR n 
1 218 GLY n 
1 219 LYS n 
1 220 ARG n 
1 221 SER n 
1 222 THR n 
1 223 ARG n 
1 224 ALA n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLU n 
1 229 ALA n 
1 230 LEU n 
1 231 ARG n 
1 232 GLU n 
1 233 ALA n 
1 234 HIS n 
1 235 PRO n 
1 236 ILE n 
1 237 VAL n 
1 238 GLU n 
1 239 LYS n 
1 240 ILE n 
1 241 LEU n 
1 242 GLN n 
1 243 TYR n 
1 244 ARG n 
1 245 GLU n 
1 246 LEU n 
1 247 THR n 
1 248 LYS n 
1 249 LEU n 
1 250 LYS n 
1 251 SER n 
1 252 THR n 
1 253 TYR n 
1 254 ILE n 
1 255 ASP n 
1 256 PRO n 
1 257 LEU n 
1 258 PRO n 
1 259 ASP n 
1 260 LEU n 
1 261 ILE n 
1 262 HIS n 
1 263 PRO n 
1 264 ARG n 
1 265 THR n 
1 266 GLY n 
1 267 ARG n 
1 268 LEU n 
1 269 HIS n 
1 270 THR n 
1 271 ARG n 
1 272 PHE n 
1 273 ASN n 
1 274 GLN n 
1 275 THR n 
1 276 ALA n 
1 277 THR n 
1 278 ALA n 
1 279 THR n 
1 280 GLY n 
1 281 ARG n 
1 282 LEU n 
1 283 SER n 
1 284 SER n 
1 285 SER n 
1 286 ASP n 
1 287 PRO n 
1 288 ASN n 
1 289 LEU n 
1 290 GLN n 
1 291 ASN n 
1 292 ILE n 
1 293 PRO n 
1 294 VAL n 
1 295 ARG n 
1 296 THR n 
1 297 PRO n 
1 298 LEU n 
1 299 GLY n 
1 300 GLN n 
1 301 ARG n 
1 302 ILE n 
1 303 ARG n 
1 304 ARG n 
1 305 ALA n 
1 306 PHE n 
1 307 ILE n 
1 308 ALA n 
1 309 GLU n 
1 310 GLU n 
1 311 GLY n 
1 312 TRP n 
1 313 LEU n 
1 314 LEU n 
1 315 VAL n 
1 316 ALA n 
1 317 LEU n 
1 318 ASP n 
1 319 TYR n 
1 320 SER n 
1 321 GLN n 
1 322 ILE n 
1 323 GLU n 
1 324 LEU n 
1 325 ARG n 
1 326 VAL n 
1 327 LEU n 
1 328 ALA n 
1 329 HIS n 
1 330 LEU n 
1 331 SER n 
1 332 GLY n 
1 333 ASP n 
1 334 GLU n 
1 335 ASN n 
1 336 LEU n 
1 337 ILE n 
1 338 ARG n 
1 339 VAL n 
1 340 PHE n 
1 341 GLN n 
1 342 GLU n 
1 343 GLY n 
1 344 ARG n 
1 345 ASP n 
1 346 PHE n 
1 347 HIS n 
1 348 THR n 
1 349 GLU n 
1 350 THR n 
1 351 ALA n 
1 352 SER n 
1 353 TRP n 
1 354 MET n 
1 355 PHE n 
1 356 GLY n 
1 357 VAL n 
1 358 PRO n 
1 359 ARG n 
1 360 GLU n 
1 361 ALA n 
1 362 VAL n 
1 363 ASP n 
1 364 PRO n 
1 365 LEU n 
1 366 MET n 
1 367 ARG n 
1 368 ARG n 
1 369 ALA n 
1 370 ALA n 
1 371 LYS n 
1 372 THR n 
1 373 ILE n 
1 374 ASN n 
1 375 PHE n 
1 376 GLY n 
1 377 VAL n 
1 378 LEU n 
1 379 TYR n 
1 380 GLY n 
1 381 MET n 
1 382 SER n 
1 383 ALA n 
1 384 HIS n 
1 385 ARG n 
1 386 LEU n 
1 387 SER n 
1 388 GLN n 
1 389 GLU n 
1 390 LEU n 
1 391 ALA n 
1 392 ILE n 
1 393 PRO n 
1 394 TYR n 
1 395 GLU n 
1 396 GLU n 
1 397 ALA n 
1 398 GLN n 
1 399 ALA n 
1 400 PHE n 
1 401 ILE n 
1 402 GLU n 
1 403 ARG n 
1 404 TYR n 
1 405 PHE n 
1 406 GLN n 
1 407 SER n 
1 408 PHE n 
1 409 PRO n 
1 410 LYS n 
1 411 VAL n 
1 412 ARG n 
1 413 ALA n 
1 414 TRP n 
1 415 ILE n 
1 416 GLU n 
1 417 LYS n 
1 418 THR n 
1 419 LEU n 
1 420 GLU n 
1 421 GLU n 
1 422 GLY n 
1 423 ARG n 
1 424 ARG n 
1 425 ARG n 
1 426 GLY n 
1 427 TYR n 
1 428 VAL n 
1 429 GLU n 
1 430 THR n 
1 431 LEU n 
1 432 PHE n 
1 433 GLY n 
1 434 ARG n 
1 435 ARG n 
1 436 ARG n 
1 437 TYR n 
1 438 VAL n 
1 439 PRO n 
1 440 ASP n 
1 441 LEU n 
1 442 GLU n 
1 443 ALA n 
1 444 ARG n 
1 445 VAL n 
1 446 LYS n 
1 447 SER n 
1 448 VAL n 
1 449 ARG n 
1 450 GLU n 
1 451 ALA n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 LYS n 
1 456 ALA n 
1 457 PHE n 
1 458 ASN n 
1 459 MET n 
1 460 PRO n 
1 461 VAL n 
1 462 GLN n 
1 463 GLY n 
1 464 THR n 
1 465 ALA n 
1 466 ALA n 
1 467 ASP n 
1 468 LEU n 
1 469 MET n 
1 470 LYS n 
1 471 LEU n 
1 472 ALA n 
1 473 MET n 
1 474 VAL n 
1 475 LYS n 
1 476 LEU n 
1 477 PHE n 
1 478 PRO n 
1 479 ARG n 
1 480 LEU n 
1 481 GLU n 
1 482 GLU n 
1 483 MET n 
1 484 GLY n 
1 485 ALA n 
1 486 ARG n 
1 487 MET n 
1 488 LEU n 
1 489 LEU n 
1 490 GLN n 
1 491 VAL n 
1 492 HIS n 
1 493 ASP n 
1 494 GLU n 
1 495 LEU n 
1 496 VAL n 
1 497 LEU n 
1 498 GLU n 
1 499 ALA n 
1 500 PRO n 
1 501 LYS n 
1 502 GLU n 
1 503 ARG n 
1 504 ALA n 
1 505 GLU n 
1 506 ALA n 
1 507 VAL n 
1 508 ALA n 
1 509 ARG n 
1 510 LEU n 
1 511 ALA n 
1 512 LYS n 
1 513 GLU n 
1 514 VAL n 
1 515 MET n 
1 516 GLU n 
1 517 GLY n 
1 518 VAL n 
1 519 TYR n 
1 520 PRO n 
1 521 LEU n 
1 522 ALA n 
1 523 VAL n 
1 524 PRO n 
1 525 LEU n 
1 526 GLU n 
1 527 VAL n 
1 528 GLU n 
1 529 VAL n 
1 530 GLY n 
1 531 ILE n 
1 532 GLY n 
1 533 GLU n 
1 534 ASP n 
1 535 TRP n 
1 536 LEU n 
1 537 SER n 
1 538 ALA n 
1 539 LYS n 
1 540 GLU n 
2 1   DG  n 
2 2   DA  n 
2 3   DC  n 
2 4   DC  n 
2 5   DA  n 
2 6   DC  n 
2 7   DG  n 
2 8   DG  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DOC n 
3 1   A   n 
3 2   A   n 
3 3   A   n 
3 4   G   n 
3 5   G   n 
3 6   G   n 
3 7   C   n 
3 8   G   n 
3 9   C   n 
3 10  C   n 
3 11  G   n 
3 12  U   n 
3 13  G   n 
3 14  G   n 
3 15  U   n 
3 16  C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'THERMUS AQUATICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     271 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGDR11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
3 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DPO1_THEAQ 1 ? ? P19821 ? 
2 PDB 4BWM       2 ? ? 4BWM   ? 
3 PDB 4BWM       3 ? ? 4BWM   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4BWM A 1 ? 540 ? P19821 293 ? 832 ? 293 832 
2 2 4BWM B 1 ? 12  ? 4BWM   101 ? 112 ? 101 112 
3 3 4BWM G 1 ? 16  ? 4BWM   1   ? 16  ? 1   16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BWM MET A 167 ? UNP P19821 LEU 459 'engineered mutation' 459 1 
1 4BWM ARG A 223 ? UNP P19821 SER 515 'engineered mutation' 515 2 
1 4BWM PHE A 346 ? UNP P19821 ILE 638 'engineered mutation' 638 3 
1 4BWM LYS A 455 ? UNP P19821 MET 747 'engineered mutation' 747 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"             ? 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"              ? 'C9 H14 N3 O8 P'   323.197 
CL  non-polymer         . 'CHLORIDE ION'                           ? 'Cl -1'            35.453  
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'       n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
? 'C9 H16 N3 O12 P3' 451.158 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'   291.198 
FMT non-polymer         . 'FORMIC ACID'                            ? 'C H2 O2'          46.025  
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"             ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                          ? 'Mg 2'             24.305  
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"               ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          4BWM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.21 
_exptl_crystal.density_percent_sol   61.7 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'HANGING DROP. 100MM TRIS PH8.5, 200MM MG-FORMATE, 20% PEG 8K MICROSEEDED' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2012-04-27 
_diffrn_detector.details                'DYNAMICALLY BENDABLE MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'LN2 COOLED FIXED-EXIT SI(111) MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000040 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.000040 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BWM 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.34 
_reflns.d_resolution_high            1.75 
_reflns.number_obs                   79729 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.73 
_reflns.B_iso_Wilson_estimate        26.55 
_reflns.pdbx_redundancy              6.59 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.85 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           1.12 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.70 
_reflns_shell.pdbx_redundancy        6.62 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BWM 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     79632 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.985 
_refine.ls_d_res_high                            1.749 
_refine.ls_percent_reflns_obs                    99.89 
_refine.ls_R_factor_obs                          0.1700 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1680 
_refine.ls_R_factor_R_free                       0.2076 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3989 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'RESIDUES 15 AND 16 OF THE TEMPLATE AND 1 AND 2 OF THE PRIMER ARE DISORDERED' 
_refine.pdbx_starting_model                      'PDB ENTRY 3RTV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.18 
_refine.pdbx_overall_phase_error                 19.98 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4288 
_refine_hist.pdbx_number_atoms_nucleic_acid   504 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             631 
_refine_hist.number_atoms_total               5467 
_refine_hist.d_res_high                       1.749 
_refine_hist.d_res_low                        47.985 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 5043 'X-RAY DIFFRACTION' ? 
f_angle_d          1.089  ? ? 6942 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.698 ? ? 1992 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.070  ? ? 767  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 819  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7488 1.7701  2580 0.2574 97.00  0.2844 . . 126 . . 
'X-RAY DIFFRACTION' . 1.7701 1.7925  2701 0.2481 100.00 0.2563 . . 124 . . 
'X-RAY DIFFRACTION' . 1.7925 1.8161  2673 0.2429 100.00 0.2715 . . 149 . . 
'X-RAY DIFFRACTION' . 1.8161 1.8410  2682 0.2316 100.00 0.2517 . . 137 . . 
'X-RAY DIFFRACTION' . 1.8410 1.8673  2645 0.2255 100.00 0.2323 . . 147 . . 
'X-RAY DIFFRACTION' . 1.8673 1.8952  2659 0.2153 100.00 0.2217 . . 141 . . 
'X-RAY DIFFRACTION' . 1.8952 1.9248  2693 0.2093 100.00 0.2472 . . 144 . . 
'X-RAY DIFFRACTION' . 1.9248 1.9564  2674 0.1963 100.00 0.2465 . . 142 . . 
'X-RAY DIFFRACTION' . 1.9564 1.9901  2673 0.1944 100.00 0.2190 . . 134 . . 
'X-RAY DIFFRACTION' . 1.9901 2.0263  2658 0.1944 100.00 0.2317 . . 162 . . 
'X-RAY DIFFRACTION' . 2.0263 2.0653  2684 0.1799 100.00 0.2120 . . 144 . . 
'X-RAY DIFFRACTION' . 2.0653 2.1074  2687 0.1777 100.00 0.1928 . . 135 . . 
'X-RAY DIFFRACTION' . 2.1074 2.1532  2676 0.1671 100.00 0.2065 . . 137 . . 
'X-RAY DIFFRACTION' . 2.1532 2.2033  2687 0.1629 100.00 0.1953 . . 145 . . 
'X-RAY DIFFRACTION' . 2.2033 2.2584  2702 0.1617 100.00 0.1902 . . 139 . . 
'X-RAY DIFFRACTION' . 2.2584 2.3195  2697 0.1717 100.00 0.2331 . . 131 . . 
'X-RAY DIFFRACTION' . 2.3195 2.3877  2691 0.1716 100.00 0.1990 . . 147 . . 
'X-RAY DIFFRACTION' . 2.3877 2.4648  2683 0.1697 100.00 0.2382 . . 149 . . 
'X-RAY DIFFRACTION' . 2.4648 2.5529  2717 0.1743 100.00 0.2214 . . 132 . . 
'X-RAY DIFFRACTION' . 2.5529 2.6551  2675 0.1806 100.00 0.2253 . . 152 . . 
'X-RAY DIFFRACTION' . 2.6551 2.7759  2704 0.1827 100.00 0.2191 . . 162 . . 
'X-RAY DIFFRACTION' . 2.7759 2.9223  2724 0.1794 100.00 0.2458 . . 116 . . 
'X-RAY DIFFRACTION' . 2.9223 3.1053  2724 0.1793 100.00 0.2338 . . 140 . . 
'X-RAY DIFFRACTION' . 3.1053 3.3450  2764 0.1722 100.00 0.2255 . . 136 . . 
'X-RAY DIFFRACTION' . 3.3450 3.6815  2710 0.1495 100.00 0.1922 . . 167 . . 
'X-RAY DIFFRACTION' . 3.6815 4.2140  2758 0.1336 100.00 0.1700 . . 153 . . 
'X-RAY DIFFRACTION' . 4.2140 5.3081  2791 0.1368 100.00 0.1616 . . 146 . . 
'X-RAY DIFFRACTION' . 5.3081 48.0030 2931 0.1625 100.00 0.2148 . . 152 . . 
# 
_struct.entry_id                  4BWM 
_struct.title                     'KlenTaq mutant in complex with a RNA/DNA hybrid' 
_struct.pdbx_descriptor           'DNA POLYMERASE I, THERMOSTABLE (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BWM 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA/RNA 
_struct_keywords.text            'TRANSFERASE-DNA-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 23  ? ALA A 27  ? GLU A 315 ALA A 319 5 ? 5  
HELX_P HELX_P2  2  GLU A 45  ? ARG A 51  ? GLU A 337 ARG A 343 1 ? 7  
HELX_P HELX_P3  3  LEU A 60  ? GLU A 71  ? LEU A 352 GLU A 363 1 ? 12 
HELX_P HELX_P4  4  ASP A 80  ? ASP A 89  ? ASP A 372 ASP A 381 1 ? 10 
HELX_P HELX_P5  5  THR A 94  ? GLY A 103 ? THR A 386 GLY A 395 1 ? 10 
HELX_P HELX_P6  6  GLU A 109 ? LEU A 128 ? GLU A 401 LEU A 420 1 ? 20 
HELX_P HELX_P7  7  GLU A 131 ? VAL A 141 ? GLU A 423 VAL A 433 1 ? 11 
HELX_P HELX_P8  8  VAL A 141 ? GLY A 156 ? VAL A 433 GLY A 448 1 ? 16 
HELX_P HELX_P9  9  ASP A 160 ? GLY A 187 ? ASP A 452 GLY A 479 1 ? 28 
HELX_P HELX_P10 10 SER A 194 ? ASP A 204 ? SER A 486 ASP A 496 1 ? 11 
HELX_P HELX_P11 11 ARG A 223 ? LEU A 230 ? ARG A 515 LEU A 522 1 ? 8  
HELX_P HELX_P12 12 PRO A 235 ? TYR A 253 ? PRO A 527 TYR A 545 1 ? 19 
HELX_P HELX_P13 13 ASP A 255 ? LEU A 260 ? ASP A 547 LEU A 552 1 ? 6  
HELX_P HELX_P14 14 ASN A 288 ? ILE A 292 ? ASN A 580 ILE A 584 5 ? 5  
HELX_P HELX_P15 15 THR A 296 ? ALA A 305 ? THR A 588 ALA A 597 1 ? 10 
HELX_P HELX_P16 16 GLN A 321 ? GLY A 332 ? GLN A 613 GLY A 624 1 ? 12 
HELX_P HELX_P17 17 ASP A 333 ? GLU A 342 ? ASP A 625 GLU A 634 1 ? 10 
HELX_P HELX_P18 18 ASP A 345 ? GLY A 356 ? ASP A 637 GLY A 648 1 ? 12 
HELX_P HELX_P19 19 PRO A 358 ? VAL A 362 ? PRO A 650 VAL A 654 5 ? 5  
HELX_P HELX_P20 20 ASP A 363 ? TYR A 379 ? ASP A 655 TYR A 671 1 ? 17 
HELX_P HELX_P21 21 SER A 382 ? LEU A 390 ? SER A 674 LEU A 682 1 ? 9  
HELX_P HELX_P22 22 PRO A 393 ? PHE A 408 ? PRO A 685 PHE A 700 1 ? 16 
HELX_P HELX_P23 23 PHE A 408 ? GLY A 426 ? PHE A 700 GLY A 718 1 ? 19 
HELX_P HELX_P24 24 PRO A 439 ? ALA A 443 ? PRO A 731 ALA A 735 5 ? 5  
HELX_P HELX_P25 25 VAL A 445 ? MET A 483 ? VAL A 737 MET A 775 1 ? 39 
HELX_P HELX_P26 26 ARG A 503 ? GLY A 517 ? ARG A 795 GLY A 809 1 ? 15 
HELX_P HELX_P27 27 ASP A 534 ? GLU A 540 ? ASP A 826 GLU A 832 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? D DCT .  O2A ? ? ? 1_555 G MG  .  MG    ? ? A DCT 1833 A MG  1836 1_555 ? ? ? ? ? ? ?            1.976 ? 
metalc2  metalc ?    ? D DCT .  O1B ? ? ? 1_555 G MG  .  MG    ? ? A DCT 1833 A MG  1836 1_555 ? ? ? ? ? ? ?            2.087 ? 
metalc3  metalc ?    ? D DCT .  O1G ? ? ? 1_555 G MG  .  MG    ? ? A DCT 1833 A MG  1836 1_555 ? ? ? ? ? ? ?            1.925 ? 
metalc4  metalc ?    ? G MG  .  MG  ? ? ? 1_555 N HOH .  O     ? ? A MG  1836 A HOH 2425 1_555 ? ? ? ? ? ? ?            2.065 ? 
metalc5  metalc ?    ? G MG  .  MG  ? ? ? 1_555 N HOH .  O     ? ? A MG  1836 A HOH 2423 1_555 ? ? ? ? ? ? ?            2.109 ? 
metalc6  metalc ?    ? G MG  .  MG  ? ? ? 1_555 N HOH .  O     ? ? A MG  1836 A HOH 2426 1_555 ? ? ? ? ? ? ?            1.942 ? 
covale1  covale both ? B DOC 12 P   ? ? ? 1_555 B DC  11 "O3'" ? ? B DOC 112  B DC  111  1_555 ? ? ? ? ? ? ?            1.581 ? 
metalc7  metalc ?    ? K MG  .  MG  ? ? ? 1_555 B DC  11 OP2   ? ? B MG  1112 B DC  111  1_555 ? ? ? ? ? ? ?            2.224 ? 
metalc8  metalc ?    ? K MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1112 B HOH 2025 1_555 ? ? ? ? ? ? ?            2.927 ? 
metalc9  metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2006 1_555 ? ? ? ? ? ? ?            2.174 ? 
metalc10 metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2027 1_555 ? ? ? ? ? ? ?            2.161 ? 
metalc11 metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2028 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc12 metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2029 1_555 ? ? ? ? ? ? ?            2.158 ? 
metalc13 metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2001 1_555 ? ? ? ? ? ? ?            2.097 ? 
metalc14 metalc ?    ? L MG  .  MG  ? ? ? 1_555 O HOH .  O     ? ? B MG  1113 B HOH 2002 1_555 ? ? ? ? ? ? ?            2.260 ? 
hydrog1  hydrog ?    ? B DC  3  N4  ? ? ? 1_555 C G   14 O6    ? ? B DC  103  G G   14   1_555 ? ? ? ? ? ? 'DC-G PAIR'  ?     ? 
hydrog2  hydrog ?    ? B DC  4  N3  ? ? ? 1_555 C G   13 N1    ? ? B DC  104  G G   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DC  4  N4  ? ? ? 1_555 C G   13 O6    ? ? B DC  104  G G   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DC  4  O2  ? ? ? 1_555 C G   13 N2    ? ? B DC  104  G G   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DA  5  N1  ? ? ? 1_555 C U   12 N3    ? ? B DA  105  G U   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DA  5  N6  ? ? ? 1_555 C U   12 O4    ? ? B DA  105  G U   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DC  6  N3  ? ? ? 1_555 C G   11 N1    ? ? B DC  106  G G   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DC  6  N4  ? ? ? 1_555 C G   11 O6    ? ? B DC  106  G G   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DC  6  O2  ? ? ? 1_555 C G   11 N2    ? ? B DC  106  G G   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DG  7  N1  ? ? ? 1_555 C C   10 N3    ? ? B DG  107  G C   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DG  7  N2  ? ? ? 1_555 C C   10 O2    ? ? B DG  107  G C   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DG  7  O6  ? ? ? 1_555 C C   10 N4    ? ? B DG  107  G C   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DG  8  N1  ? ? ? 1_555 C C   9  N3    ? ? B DG  108  G C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DG  8  N2  ? ? ? 1_555 C C   9  O2    ? ? B DG  108  G C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DG  8  O6  ? ? ? 1_555 C C   9  N4    ? ? B DG  108  G C   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  9  N3  ? ? ? 1_555 C G   8  N1    ? ? B DC  109  G G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DC  9  N4  ? ? ? 1_555 C G   8  O6    ? ? B DC  109  G G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DC  9  O2  ? ? ? 1_555 C G   8  N2    ? ? B DC  109  G G   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DG  10 N1  ? ? ? 1_555 C C   7  N3    ? ? B DG  110  G C   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  10 N2  ? ? ? 1_555 C C   7  O2    ? ? B DG  110  G C   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  10 O6  ? ? ? 1_555 C C   7  N4    ? ? B DG  110  G C   7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DC  11 N3  ? ? ? 1_555 C G   6  N1    ? ? B DC  111  G G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DC  11 N4  ? ? ? 1_555 C G   6  O6    ? ? B DC  111  G G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DC  11 O2  ? ? ? 1_555 C G   6  N2    ? ? B DC  111  G G   6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DOC 12 N3  ? ? ? 1_555 C G   5  N1    ? ? B DOC 112  G G   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DOC 12 N4  ? ? ? 1_555 C G   5  O6    ? ? B DOC 112  G G   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DOC 12 O2  ? ? ? 1_555 C G   5  N2    ? ? B DOC 112  G G   5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 7   A . ? TRP 299 A PRO 8   A ? PRO 300 A 1 1.10 
2 ASP 286 A . ? ASP 578 A PRO 287 A ? PRO 579 A 1 5.10 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 4   ? ALA A 5   ? GLU A 296 ALA A 297 
AA 2 ARG A 39  ? ARG A 42  ? ARG A 331 ARG A 334 
AA 3 LEU A 29  ? ARG A 36  ? LEU A 321 ARG A 328 
AA 4 PHE A 14  ? LEU A 19  ? PHE A 306 LEU A 311 
AB 1 ARG A 158 ? LEU A 159 ? ARG A 450 LEU A 451 
AB 2 PHE A 306 ? ILE A 307 ? PHE A 598 ILE A 599 
AC 1 ILE A 261 ? HIS A 262 ? ILE A 553 HIS A 554 
AC 2 ARG A 267 ? LEU A 268 ? ARG A 559 LEU A 560 
AD 1 ARG A 271 ? ASN A 273 ? ARG A 563 ASN A 565 
AD 2 SER A 283 ? SER A 285 ? SER A 575 SER A 577 
AE 1 ARG A 486 ? VAL A 491 ? ARG A 778 VAL A 783 
AE 2 GLU A 494 ? PRO A 500 ? GLU A 786 PRO A 792 
AE 3 TRP A 312 ? TYR A 319 ? TRP A 604 TYR A 611 
AE 4 VAL A 527 ? GLY A 532 ? VAL A 819 GLY A 824 
AF 1 TYR A 427 ? GLU A 429 ? TYR A 719 GLU A 721 
AF 2 ARG A 435 ? TYR A 437 ? ARG A 727 TYR A 729 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 5   ? N ALA A 297 O VAL A 40  ? O VAL A 332 
AA 2 3 N HIS A 41  ? N HIS A 333 O ALA A 34  ? O ALA A 326 
AA 3 4 N ALA A 35  ? N ALA A 327 O PHE A 14  ? O PHE A 306 
AB 1 2 N ARG A 158 ? N ARG A 450 O ILE A 307 ? O ILE A 599 
AC 1 2 N HIS A 262 ? N HIS A 554 O ARG A 267 ? O ARG A 559 
AD 1 2 N ASN A 273 ? N ASN A 565 O SER A 283 ? O SER A 575 
AE 1 2 N VAL A 491 ? N VAL A 783 O GLU A 494 ? O GLU A 786 
AE 2 3 N ALA A 499 ? N ALA A 791 O LEU A 313 ? O LEU A 605 
AE 3 4 N ASP A 318 ? N ASP A 610 O GLU A 528 ? O GLU A 820 
AF 1 2 N VAL A 428 ? N VAL A 720 O ARG A 436 ? O ARG A 728 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE DCT A 1833' 
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 1834'  
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL A 1835'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 1836'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT A 1837' 
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT A 1838' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT A 1839' 
AC8 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG B 1112'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG B 1113'  
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT G 1015' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 GLN A 321 ? GLN A 613  . ? 1_555 ? 
2  AC1 20 HIS A 347 ? HIS A 639  . ? 1_555 ? 
3  AC1 20 ARG A 367 ? ARG A 659  . ? 1_555 ? 
4  AC1 20 LYS A 371 ? LYS A 663  . ? 1_555 ? 
5  AC1 20 PHE A 375 ? PHE A 667  . ? 1_555 ? 
6  AC1 20 ASP A 493 ? ASP A 785  . ? 1_555 ? 
7  AC1 20 MG  G .   ? MG  A 1836 . ? 1_555 ? 
8  AC1 20 HOH N .   ? HOH A 2381 . ? 1_555 ? 
9  AC1 20 HOH N .   ? HOH A 2423 . ? 1_555 ? 
10 AC1 20 HOH N .   ? HOH A 2425 . ? 1_555 ? 
11 AC1 20 HOH N .   ? HOH A 2426 . ? 1_555 ? 
12 AC1 20 HOH N .   ? HOH A 2429 . ? 1_555 ? 
13 AC1 20 HOH N .   ? HOH A 2430 . ? 1_555 ? 
14 AC1 20 HOH N .   ? HOH A 2433 . ? 1_555 ? 
15 AC1 20 HOH N .   ? HOH A 2546 . ? 1_555 ? 
16 AC1 20 HOH N .   ? HOH A 2581 . ? 1_555 ? 
17 AC1 20 HOH N .   ? HOH A 2582 . ? 1_555 ? 
18 AC1 20 DOC B 12  ? DOC B 112  . ? 1_555 ? 
19 AC1 20 G   C 4   ? G   G 4    . ? 1_555 ? 
20 AC1 20 G   C 5   ? G   G 5    . ? 1_555 ? 
21 AC2 1  ARG A 267 ? ARG A 559  . ? 1_555 ? 
22 AC3 3  VAL A 438 ? VAL A 730  . ? 1_555 ? 
23 AC3 3  PRO A 439 ? PRO A 731  . ? 1_555 ? 
24 AC3 3  ASP A 440 ? ASP A 732  . ? 1_555 ? 
25 AC4 4  DCT D .   ? DCT A 1833 . ? 1_555 ? 
26 AC4 4  HOH N .   ? HOH A 2423 . ? 1_555 ? 
27 AC4 4  HOH N .   ? HOH A 2425 . ? 1_555 ? 
28 AC4 4  HOH N .   ? HOH A 2426 . ? 1_555 ? 
29 AC5 5  GLU A 132 ? GLU A 424  . ? 1_555 ? 
30 AC5 5  LEU A 135 ? LEU A 427  . ? 1_555 ? 
31 AC5 5  ARG A 139 ? ARG A 431  . ? 1_555 ? 
32 AC5 5  HOH N .   ? HOH A 2452 . ? 3_455 ? 
33 AC5 5  HOH N .   ? HOH A 2453 . ? 3_455 ? 
34 AC6 3  ASP A 79  ? ASP A 371  . ? 1_555 ? 
35 AC6 3  ARG A 143 ? ARG A 435  . ? 1_555 ? 
36 AC6 3  HOH N .   ? HOH A 2161 . ? 1_555 ? 
37 AC7 4  TYR A 253 ? TYR A 545  . ? 1_555 ? 
38 AC7 4  ASN A 291 ? ASN A 583  . ? 1_555 ? 
39 AC7 4  HOH N .   ? HOH A 2396 . ? 1_555 ? 
40 AC7 4  HOH N .   ? HOH A 2398 . ? 1_555 ? 
41 AC8 3  DG  B 10  ? DG  B 110  . ? 1_555 ? 
42 AC8 3  DC  B 11  ? DC  B 111  . ? 1_555 ? 
43 AC8 3  HOH O .   ? HOH B 2025 . ? 1_555 ? 
44 AC9 6  HOH O .   ? HOH B 2001 . ? 1_555 ? 
45 AC9 6  HOH O .   ? HOH B 2002 . ? 1_555 ? 
46 AC9 6  HOH O .   ? HOH B 2006 . ? 1_555 ? 
47 AC9 6  HOH O .   ? HOH B 2027 . ? 1_555 ? 
48 AC9 6  HOH O .   ? HOH B 2028 . ? 1_555 ? 
49 AC9 6  HOH O .   ? HOH B 2029 . ? 1_555 ? 
50 BC1 5  GLN A 290 ? GLN A 582  . ? 1_555 ? 
51 BC1 5  HOH N .   ? HOH A 2380 . ? 1_555 ? 
52 BC1 5  HOH N .   ? HOH A 2386 . ? 1_555 ? 
53 BC1 5  G   C 6   ? G   G 6    . ? 1_555 ? 
54 BC1 5  C   C 7   ? C   G 7    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BWM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BWM 
_atom_sites.fract_transf_matrix[1][1]   0.006984 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011590 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015849 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 3   ? 7.510   31.838  3.927   1.00 104.24 ? 295  GLU A N     1 
ATOM   2    C  CA    . GLU A 1 3   ? 6.184   31.285  3.685   1.00 101.95 ? 295  GLU A CA    1 
ATOM   3    C  C     . GLU A 1 3   ? 5.936   30.065  4.568   1.00 94.37  ? 295  GLU A C     1 
ATOM   4    O  O     . GLU A 1 3   ? 4.797   29.758  4.916   1.00 95.77  ? 295  GLU A O     1 
ATOM   5    C  CB    . GLU A 1 3   ? 6.024   30.905  2.214   1.00 105.54 ? 295  GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 3   ? 4.595   30.606  1.813   1.00 111.11 ? 295  GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 3   ? 4.510   29.626  0.667   1.00 114.84 ? 295  GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 3   ? 5.570   29.265  0.114   1.00 115.46 ? 295  GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 3   ? 3.384   29.210  0.323   1.00 116.24 ? 295  GLU A OE2   1 
ATOM   10   N  N     . GLU A 1 4   ? 7.012   29.371  4.922   1.00 83.49  ? 296  GLU A N     1 
ATOM   11   C  CA    . GLU A 1 4   ? 6.924   28.217  5.807   1.00 70.40  ? 296  GLU A CA    1 
ATOM   12   C  C     . GLU A 1 4   ? 6.839   28.656  7.263   1.00 53.71  ? 296  GLU A C     1 
ATOM   13   O  O     . GLU A 1 4   ? 7.266   29.755  7.618   1.00 44.21  ? 296  GLU A O     1 
ATOM   14   C  CB    . GLU A 1 4   ? 8.123   27.289  5.605   1.00 78.40  ? 296  GLU A CB    1 
ATOM   15   C  CG    . GLU A 1 4   ? 8.100   26.526  4.292   1.00 88.42  ? 296  GLU A CG    1 
ATOM   16   C  CD    . GLU A 1 4   ? 9.359   25.711  4.069   1.00 98.46  ? 296  GLU A CD    1 
ATOM   17   O  OE1   . GLU A 1 4   ? 10.430  26.120  4.564   1.00 103.03 ? 296  GLU A OE1   1 
ATOM   18   O  OE2   . GLU A 1 4   ? 9.278   24.659  3.400   1.00 100.77 ? 296  GLU A OE2   1 
ATOM   19   N  N     . ALA A 1 5   ? 6.276   27.792  8.100   1.00 38.46  ? 297  ALA A N     1 
ATOM   20   C  CA    . ALA A 1 5   ? 6.122   28.063  9.524   1.00 41.68  ? 297  ALA A CA    1 
ATOM   21   C  C     . ALA A 1 5   ? 6.073   26.739  10.281  1.00 43.52  ? 297  ALA A C     1 
ATOM   22   O  O     . ALA A 1 5   ? 5.652   25.727  9.723   1.00 39.98  ? 297  ALA A O     1 
ATOM   23   C  CB    . ALA A 1 5   ? 4.858   28.872  9.776   1.00 44.33  ? 297  ALA A CB    1 
ATOM   24   N  N     . PRO A 1 6   ? 6.505   26.742  11.552  1.00 50.55  ? 298  PRO A N     1 
ATOM   25   C  CA    . PRO A 1 6   ? 6.574   25.521  12.364  1.00 50.04  ? 298  PRO A CA    1 
ATOM   26   C  C     . PRO A 1 6   ? 5.221   24.860  12.608  1.00 38.81  ? 298  PRO A C     1 
ATOM   27   O  O     . PRO A 1 6   ? 4.228   25.557  12.830  1.00 36.00  ? 298  PRO A O     1 
ATOM   28   C  CB    . PRO A 1 6   ? 7.124   26.027  13.703  1.00 55.05  ? 298  PRO A CB    1 
ATOM   29   C  CG    . PRO A 1 6   ? 7.850   27.272  13.371  1.00 58.41  ? 298  PRO A CG    1 
ATOM   30   C  CD    . PRO A 1 6   ? 7.082   27.901  12.256  1.00 55.86  ? 298  PRO A CD    1 
ATOM   31   N  N     . TRP A 1 7   ? 5.195   23.528  12.571  1.00 34.90  ? 299  TRP A N     1 
ATOM   32   C  CA    . TRP A 1 7   ? 4.068   22.767  13.095  1.00 32.12  ? 299  TRP A CA    1 
ATOM   33   C  C     . TRP A 1 7   ? 4.022   23.023  14.604  1.00 36.56  ? 299  TRP A C     1 
ATOM   34   O  O     . TRP A 1 7   ? 5.070   23.179  15.228  1.00 38.80  ? 299  TRP A O     1 
ATOM   35   C  CB    . TRP A 1 7   ? 4.264   21.269  12.802  1.00 32.05  ? 299  TRP A CB    1 
ATOM   36   C  CG    . TRP A 1 7   ? 3.019   20.473  13.036  1.00 35.97  ? 299  TRP A CG    1 
ATOM   37   C  CD1   . TRP A 1 7   ? 2.677   19.797  14.165  1.00 32.24  ? 299  TRP A CD1   1 
ATOM   38   C  CD2   . TRP A 1 7   ? 1.928   20.315  12.126  1.00 29.31  ? 299  TRP A CD2   1 
ATOM   39   N  NE1   . TRP A 1 7   ? 1.438   19.219  14.015  1.00 29.53  ? 299  TRP A NE1   1 
ATOM   40   C  CE2   . TRP A 1 7   ? 0.955   19.527  12.772  1.00 26.99  ? 299  TRP A CE2   1 
ATOM   41   C  CE3   . TRP A 1 7   ? 1.679   20.764  10.825  1.00 30.20  ? 299  TRP A CE3   1 
ATOM   42   C  CZ2   . TRP A 1 7   ? -0.248  19.163  12.153  1.00 26.70  ? 299  TRP A CZ2   1 
ATOM   43   C  CZ3   . TRP A 1 7   ? 0.483   20.404  10.211  1.00 30.24  ? 299  TRP A CZ3   1 
ATOM   44   C  CH2   . TRP A 1 7   ? -0.464  19.617  10.877  1.00 29.46  ? 299  TRP A CH2   1 
ATOM   45   N  N     . PRO A 1 8   ? 2.822   23.079  15.212  1.00 39.42  ? 300  PRO A N     1 
ATOM   46   C  CA    . PRO A 1 8   ? 1.457   22.914  14.691  1.00 35.42  ? 300  PRO A CA    1 
ATOM   47   C  C     . PRO A 1 8   ? 0.851   24.210  14.157  1.00 36.14  ? 300  PRO A C     1 
ATOM   48   O  O     . PRO A 1 8   ? 1.300   25.305  14.518  1.00 34.20  ? 300  PRO A O     1 
ATOM   49   C  CB    . PRO A 1 8   ? 0.681   22.434  15.921  1.00 33.60  ? 300  PRO A CB    1 
ATOM   50   C  CG    . PRO A 1 8   ? 1.371   23.089  17.062  1.00 35.06  ? 300  PRO A CG    1 
ATOM   51   C  CD    . PRO A 1 8   ? 2.827   23.228  16.678  1.00 41.72  ? 300  PRO A CD    1 
ATOM   52   N  N     . PRO A 1 9   ? -0.162  24.086  13.290  1.00 31.35  ? 301  PRO A N     1 
ATOM   53   C  CA    . PRO A 1 9   ? -0.818  25.250  12.689  1.00 34.03  ? 301  PRO A CA    1 
ATOM   54   C  C     . PRO A 1 9   ? -1.842  25.847  13.645  1.00 36.02  ? 301  PRO A C     1 
ATOM   55   O  O     . PRO A 1 9   ? -2.203  25.208  14.635  1.00 35.65  ? 301  PRO A O     1 
ATOM   56   C  CB    . PRO A 1 9   ? -1.525  24.644  11.478  1.00 31.97  ? 301  PRO A CB    1 
ATOM   57   C  CG    . PRO A 1 9   ? -1.899  23.272  11.952  1.00 29.23  ? 301  PRO A CG    1 
ATOM   58   C  CD    . PRO A 1 9   ? -0.734  22.815  12.795  1.00 28.02  ? 301  PRO A CD    1 
ATOM   59   N  N     . PRO A 1 10  ? -2.302  27.073  13.358  1.00 40.40  ? 302  PRO A N     1 
ATOM   60   C  CA    . PRO A 1 10  ? -3.369  27.674  14.167  1.00 45.24  ? 302  PRO A CA    1 
ATOM   61   C  C     . PRO A 1 10  ? -4.708  26.976  13.928  1.00 48.21  ? 302  PRO A C     1 
ATOM   62   O  O     . PRO A 1 10  ? -4.894  26.349  12.885  1.00 41.81  ? 302  PRO A O     1 
ATOM   63   C  CB    . PRO A 1 10  ? -3.422  29.118  13.661  1.00 44.57  ? 302  PRO A CB    1 
ATOM   64   C  CG    . PRO A 1 10  ? -2.828  29.071  12.294  1.00 49.89  ? 302  PRO A CG    1 
ATOM   65   C  CD    . PRO A 1 10  ? -1.781  27.998  12.338  1.00 39.88  ? 302  PRO A CD    1 
ATOM   66   N  N     . GLU A 1 11  ? -5.622  27.077  14.886  1.00 53.99  ? 303  GLU A N     1 
ATOM   67   C  CA    . GLU A 1 11  ? -6.941  26.468  14.747  1.00 62.28  ? 303  GLU A CA    1 
ATOM   68   C  C     . GLU A 1 11  ? -7.663  27.039  13.526  1.00 47.96  ? 303  GLU A C     1 
ATOM   69   O  O     . GLU A 1 11  ? -7.600  28.239  13.271  1.00 41.36  ? 303  GLU A O     1 
ATOM   70   C  CB    . GLU A 1 11  ? -7.764  26.694  16.016  1.00 78.31  ? 303  GLU A CB    1 
ATOM   71   C  CG    . GLU A 1 11  ? -9.097  25.968  16.035  1.00 94.93  ? 303  GLU A CG    1 
ATOM   72   C  CD    . GLU A 1 11  ? -9.740  25.969  17.409  1.00 105.00 ? 303  GLU A CD    1 
ATOM   73   O  OE1   . GLU A 1 11  ? -9.124  25.427  18.353  1.00 108.09 ? 303  GLU A OE1   1 
ATOM   74   O  OE2   . GLU A 1 11  ? -10.856 26.514  17.546  1.00 105.55 ? 303  GLU A OE2   1 
ATOM   75   N  N     . GLY A 1 12  ? -8.317  26.172  12.754  1.00 41.80  ? 304  GLY A N     1 
ATOM   76   C  CA    . GLY A 1 12  ? -9.033  26.602  11.565  1.00 37.27  ? 304  GLY A CA    1 
ATOM   77   C  C     . GLY A 1 12  ? -8.270  26.525  10.250  1.00 39.27  ? 304  GLY A C     1 
ATOM   78   O  O     . GLY A 1 12  ? -8.848  26.752  9.187   1.00 39.75  ? 304  GLY A O     1 
ATOM   79   N  N     . ALA A 1 13  ? -6.978  26.205  10.304  1.00 31.77  ? 305  ALA A N     1 
ATOM   80   C  CA    . ALA A 1 13  ? -6.173  26.111  9.088   1.00 27.03  ? 305  ALA A CA    1 
ATOM   81   C  C     . ALA A 1 13  ? -6.716  24.982  8.217   1.00 33.02  ? 305  ALA A C     1 
ATOM   82   O  O     . ALA A 1 13  ? -7.428  24.106  8.701   1.00 35.40  ? 305  ALA A O     1 
ATOM   83   C  CB    . ALA A 1 13  ? -4.703  25.836  9.430   1.00 30.60  ? 305  ALA A CB    1 
ATOM   84   N  N     . PHE A 1 14  ? -6.370  25.009  6.941   1.00 27.22  ? 306  PHE A N     1 
ATOM   85   C  CA    . PHE A 1 14  ? -6.784  23.957  6.024   1.00 27.62  ? 306  PHE A CA    1 
ATOM   86   C  C     . PHE A 1 14  ? -5.699  22.901  5.891   1.00 26.69  ? 306  PHE A C     1 
ATOM   87   O  O     . PHE A 1 14  ? -4.525  23.219  5.706   1.00 26.74  ? 306  PHE A O     1 
ATOM   88   C  CB    . PHE A 1 14  ? -7.101  24.541  4.663   1.00 28.20  ? 306  PHE A CB    1 
ATOM   89   C  CG    . PHE A 1 14  ? -8.331  25.388  4.654   1.00 29.46  ? 306  PHE A CG    1 
ATOM   90   C  CD1   . PHE A 1 14  ? -8.269  26.730  5.001   1.00 36.72  ? 306  PHE A CD1   1 
ATOM   91   C  CD2   . PHE A 1 14  ? -9.553  24.840  4.313   1.00 27.84  ? 306  PHE A CD2   1 
ATOM   92   C  CE1   . PHE A 1 14  ? -9.411  27.510  4.998   1.00 35.44  ? 306  PHE A CE1   1 
ATOM   93   C  CE2   . PHE A 1 14  ? -10.699 25.616  4.305   1.00 33.89  ? 306  PHE A CE2   1 
ATOM   94   C  CZ    . PHE A 1 14  ? -10.625 26.950  4.646   1.00 32.83  ? 306  PHE A CZ    1 
ATOM   95   N  N     . VAL A 1 15  ? -6.106  21.641  5.964   1.00 24.84  ? 307  VAL A N     1 
ATOM   96   C  CA    . VAL A 1 15  ? -5.161  20.538  5.921   1.00 26.34  ? 307  VAL A CA    1 
ATOM   97   C  C     . VAL A 1 15  ? -4.914  20.067  4.481   1.00 28.67  ? 307  VAL A C     1 
ATOM   98   O  O     . VAL A 1 15  ? -5.779  20.211  3.607   1.00 24.45  ? 307  VAL A O     1 
ATOM   99   C  CB    . VAL A 1 15  ? -5.667  19.370  6.799   1.00 27.98  ? 307  VAL A CB    1 
ATOM   100  C  CG1   . VAL A 1 15  ? -6.916  18.731  6.194   1.00 30.98  ? 307  VAL A CG1   1 
ATOM   101  C  CG2   . VAL A 1 15  ? -4.597  18.347  6.993   1.00 33.34  ? 307  VAL A CG2   1 
ATOM   102  N  N     . GLY A 1 16  ? -3.708  19.549  4.236   1.00 21.80  ? 308  GLY A N     1 
ATOM   103  C  CA    . GLY A 1 16  ? -3.373  18.848  3.003   1.00 21.30  ? 308  GLY A CA    1 
ATOM   104  C  C     . GLY A 1 16  ? -2.654  17.565  3.400   1.00 22.20  ? 308  GLY A C     1 
ATOM   105  O  O     . GLY A 1 16  ? -1.971  17.527  4.412   1.00 21.53  ? 308  GLY A O     1 
ATOM   106  N  N     . PHE A 1 17  ? -2.838  16.497  2.635   1.00 21.02  ? 309  PHE A N     1 
ATOM   107  C  CA    . PHE A 1 17  ? -2.247  15.217  3.026   1.00 19.19  ? 309  PHE A CA    1 
ATOM   108  C  C     . PHE A 1 17  ? -2.031  14.375  1.789   1.00 20.65  ? 309  PHE A C     1 
ATOM   109  O  O     . PHE A 1 17  ? -2.695  14.562  0.765   1.00 21.29  ? 309  PHE A O     1 
ATOM   110  C  CB    . PHE A 1 17  ? -3.123  14.491  4.067   1.00 23.25  ? 309  PHE A CB    1 
ATOM   111  C  CG    . PHE A 1 17  ? -4.500  14.110  3.560   1.00 20.60  ? 309  PHE A CG    1 
ATOM   112  C  CD1   . PHE A 1 17  ? -5.530  15.050  3.528   1.00 20.87  ? 309  PHE A CD1   1 
ATOM   113  C  CD2   . PHE A 1 17  ? -4.766  12.809  3.138   1.00 22.29  ? 309  PHE A CD2   1 
ATOM   114  C  CE1   . PHE A 1 17  ? -6.805  14.699  3.073   1.00 21.85  ? 309  PHE A CE1   1 
ATOM   115  C  CE2   . PHE A 1 17  ? -6.018  12.446  2.681   1.00 23.03  ? 309  PHE A CE2   1 
ATOM   116  C  CZ    . PHE A 1 17  ? -7.055  13.396  2.648   1.00 21.15  ? 309  PHE A CZ    1 
ATOM   117  N  N     . VAL A 1 18  ? -1.053  13.484  1.871   1.00 20.23  ? 310  VAL A N     1 
ATOM   118  C  CA    . VAL A 1 18  ? -0.761  12.579  0.777   1.00 23.25  ? 310  VAL A CA    1 
ATOM   119  C  C     . VAL A 1 18  ? -0.803  11.151  1.316   1.00 21.24  ? 310  VAL A C     1 
ATOM   120  O  O     . VAL A 1 18  ? -0.187  10.843  2.344   1.00 21.82  ? 310  VAL A O     1 
ATOM   121  C  CB    . VAL A 1 18  ? 0.620   12.875  0.149   1.00 21.50  ? 310  VAL A CB    1 
ATOM   122  C  CG1   . VAL A 1 18  ? 0.910   11.899  -0.969  1.00 20.92  ? 310  VAL A CG1   1 
ATOM   123  C  CG2   . VAL A 1 18  ? 0.685   14.334  -0.359  1.00 22.66  ? 310  VAL A CG2   1 
ATOM   124  N  N     . LEU A 1 19  ? -1.570  10.301  0.637   1.00 19.16  ? 311  LEU A N     1 
ATOM   125  C  CA    . LEU A 1 19  ? -1.671  8.890   1.007   1.00 20.38  ? 311  LEU A CA    1 
ATOM   126  C  C     . LEU A 1 19  ? -0.832  8.026   0.075   1.00 22.85  ? 311  LEU A C     1 
ATOM   127  O  O     . LEU A 1 19  ? -0.653  8.351   -1.103  1.00 23.26  ? 311  LEU A O     1 
ATOM   128  C  CB    . LEU A 1 19  ? -3.133  8.434   0.923   1.00 22.54  ? 311  LEU A CB    1 
ATOM   129  C  CG    . LEU A 1 19  ? -4.175  9.204   1.724   1.00 24.84  ? 311  LEU A CG    1 
ATOM   130  C  CD1   . LEU A 1 19  ? -5.554  8.555   1.508   1.00 22.65  ? 311  LEU A CD1   1 
ATOM   131  C  CD2   . LEU A 1 19  ? -3.805  9.227   3.199   1.00 22.70  ? 311  LEU A CD2   1 
ATOM   132  N  N     . SER A 1 20  ? -0.342  6.908   0.602   1.00 21.36  ? 312  SER A N     1 
ATOM   133  C  CA    . SER A 1 20  ? 0.453   5.955   -0.183  1.00 25.69  ? 312  SER A CA    1 
ATOM   134  C  C     . SER A 1 20  ? -0.362  5.225   -1.260  1.00 29.41  ? 312  SER A C     1 
ATOM   135  O  O     . SER A 1 20  ? 0.191   4.761   -2.268  1.00 27.64  ? 312  SER A O     1 
ATOM   136  C  CB    . SER A 1 20  ? 1.119   4.939   0.750   1.00 24.18  ? 312  SER A CB    1 
ATOM   137  O  OG    . SER A 1 20  ? 0.162   4.098   1.381   1.00 21.20  ? 312  SER A OG    1 
ATOM   138  N  N     . ARG A 1 21  ? -1.666  5.105   -1.024  1.00 22.14  ? 313  ARG A N     1 
ATOM   139  C  CA    . ARG A 1 21  ? -2.609  4.567   -2.010  1.00 23.77  ? 313  ARG A CA    1 
ATOM   140  C  C     . ARG A 1 21  ? -3.954  5.241   -1.770  1.00 27.98  ? 313  ARG A C     1 
ATOM   141  O  O     . ARG A 1 21  ? -4.154  5.871   -0.731  1.00 23.17  ? 313  ARG A O     1 
ATOM   142  C  CB    . ARG A 1 21  ? -2.718  3.039   -1.911  1.00 23.30  ? 313  ARG A CB    1 
ATOM   143  C  CG    . ARG A 1 21  ? -3.045  2.512   -0.511  1.00 19.80  ? 313  ARG A CG    1 
ATOM   144  C  CD    . ARG A 1 21  ? -2.925  0.980   -0.446  1.00 25.14  ? 313  ARG A CD    1 
ATOM   145  N  NE    . ARG A 1 21  ? -4.048  0.333   -1.128  1.00 26.39  ? 313  ARG A NE    1 
ATOM   146  C  CZ    . ARG A 1 21  ? -4.281  -0.981  -1.138  1.00 26.66  ? 313  ARG A CZ    1 
ATOM   147  N  NH1   . ARG A 1 21  ? -3.473  -1.825  -0.502  1.00 26.34  ? 313  ARG A NH1   1 
ATOM   148  N  NH2   . ARG A 1 21  ? -5.340  -1.451  -1.778  1.00 26.39  ? 313  ARG A NH2   1 
ATOM   149  N  N     . LYS A 1 22  ? -4.874  5.110   -2.719  1.00 25.34  ? 314  LYS A N     1 
ATOM   150  C  CA    . LYS A 1 22  ? -6.071  5.949   -2.715  1.00 30.04  ? 314  LYS A CA    1 
ATOM   151  C  C     . LYS A 1 22  ? -7.053  5.596   -1.598  1.00 25.40  ? 314  LYS A C     1 
ATOM   152  O  O     . LYS A 1 22  ? -7.827  6.448   -1.177  1.00 26.57  ? 314  LYS A O     1 
ATOM   153  C  CB    . LYS A 1 22  ? -6.782  5.891   -4.074  1.00 36.35  ? 314  LYS A CB    1 
ATOM   154  C  CG    . LYS A 1 22  ? -7.320  4.511   -4.427  1.00 39.98  ? 314  LYS A CG    1 
ATOM   155  C  CD    . LYS A 1 22  ? -7.924  4.479   -5.828  1.00 45.63  ? 314  LYS A CD    1 
ATOM   156  C  CE    . LYS A 1 22  ? -8.421  3.089   -6.180  1.00 53.81  ? 314  LYS A CE    1 
ATOM   157  N  NZ    . LYS A 1 22  ? -8.968  3.020   -7.569  1.00 57.18  ? 314  LYS A NZ    1 
ATOM   158  N  N     . GLU A 1 23  ? -7.015  4.348   -1.126  1.00 23.72  ? 315  GLU A N     1 
ATOM   159  C  CA    . GLU A 1 23  ? -7.934  3.877   -0.088  1.00 21.33  ? 315  GLU A CA    1 
ATOM   160  C  C     . GLU A 1 23  ? -7.381  4.194   1.302   1.00 20.32  ? 315  GLU A C     1 
ATOM   161  O  O     . GLU A 1 23  ? -6.400  3.599   1.719   1.00 19.90  ? 315  GLU A O     1 
ATOM   162  C  CB    . GLU A 1 23  ? -8.161  2.366   -0.215  1.00 26.78  ? 315  GLU A CB    1 
ATOM   163  C  CG    . GLU A 1 23  ? -8.486  1.880   -1.628  1.00 25.09  ? 315  GLU A CG    1 
ATOM   164  C  CD    . GLU A 1 23  ? -7.263  1.317   -2.345  1.00 32.60  ? 315  GLU A CD    1 
ATOM   165  O  OE1   . GLU A 1 23  ? -6.157  1.867   -2.180  1.00 25.33  ? 315  GLU A OE1   1 
ATOM   166  O  OE2   . GLU A 1 23  ? -7.406  0.310   -3.068  1.00 38.12  ? 315  GLU A OE2   1 
ATOM   167  N  N     . PRO A 1 24  ? -8.019  5.127   2.033   1.00 20.14  ? 316  PRO A N     1 
ATOM   168  C  CA    . PRO A 1 24  ? -7.457  5.551   3.323   1.00 20.33  ? 316  PRO A CA    1 
ATOM   169  C  C     . PRO A 1 24  ? -7.295  4.438   4.370   1.00 20.14  ? 316  PRO A C     1 
ATOM   170  O  O     . PRO A 1 24  ? -6.333  4.496   5.131   1.00 21.41  ? 316  PRO A O     1 
ATOM   171  C  CB    . PRO A 1 24  ? -8.439  6.648   3.812   1.00 22.70  ? 316  PRO A CB    1 
ATOM   172  C  CG    . PRO A 1 24  ? -9.680  6.464   2.998   1.00 25.31  ? 316  PRO A CG    1 
ATOM   173  C  CD    . PRO A 1 24  ? -9.250  5.858   1.680   1.00 21.11  ? 316  PRO A CD    1 
ATOM   174  N  N     . MET A 1 25  ? -8.189  3.449   4.417   1.00 17.69  ? 317  MET A N     1 
ATOM   175  C  CA    . MET A 1 25  ? -8.054  2.358   5.377   1.00 18.44  ? 317  MET A CA    1 
ATOM   176  C  C     . MET A 1 25  ? -6.818  1.508   5.115   1.00 18.94  ? 317  MET A C     1 
ATOM   177  O  O     . MET A 1 25  ? -6.330  0.832   6.013   1.00 21.65  ? 317  MET A O     1 
ATOM   178  C  CB    . MET A 1 25  ? -9.311  1.457   5.388   1.00 19.32  ? 317  MET A CB    1 
ATOM   179  C  CG    . MET A 1 25  ? -10.495 2.072   6.127   1.00 24.16  ? 317  MET A CG    1 
ATOM   180  S  SD    . MET A 1 25  ? -10.098 2.467   7.841   1.00 23.35  ? 317  MET A SD    1 
ATOM   181  C  CE    . MET A 1 25  ? -9.758  0.816   8.456   1.00 19.53  ? 317  MET A CE    1 
ATOM   182  N  N     . TRP A 1 26  ? -6.320  1.553   3.884   1.00 18.66  ? 318  TRP A N     1 
ATOM   183  C  CA    . TRP A 1 26  ? -5.174  0.741   3.478   1.00 16.61  ? 318  TRP A CA    1 
ATOM   184  C  C     . TRP A 1 26  ? -3.882  1.537   3.307   1.00 21.20  ? 318  TRP A C     1 
ATOM   185  O  O     . TRP A 1 26  ? -2.839  0.964   3.000   1.00 24.36  ? 318  TRP A O     1 
ATOM   186  C  CB    . TRP A 1 26  ? -5.500  0.062   2.151   1.00 18.04  ? 318  TRP A CB    1 
ATOM   187  C  CG    . TRP A 1 26  ? -6.582  -0.978  2.297   1.00 18.67  ? 318  TRP A CG    1 
ATOM   188  C  CD1   . TRP A 1 26  ? -7.934  -0.777  2.278   1.00 20.29  ? 318  TRP A CD1   1 
ATOM   189  C  CD2   . TRP A 1 26  ? -6.386  -2.373  2.497   1.00 18.84  ? 318  TRP A CD2   1 
ATOM   190  N  NE1   . TRP A 1 26  ? -8.595  -1.978  2.450   1.00 19.20  ? 318  TRP A NE1   1 
ATOM   191  C  CE2   . TRP A 1 26  ? -7.661  -2.971  2.593   1.00 17.10  ? 318  TRP A CE2   1 
ATOM   192  C  CE3   . TRP A 1 26  ? -5.249  -3.176  2.631   1.00 17.66  ? 318  TRP A CE3   1 
ATOM   193  C  CZ2   . TRP A 1 26  ? -7.826  -4.341  2.791   1.00 16.23  ? 318  TRP A CZ2   1 
ATOM   194  C  CZ3   . TRP A 1 26  ? -5.413  -4.521  2.827   1.00 21.72  ? 318  TRP A CZ3   1 
ATOM   195  C  CH2   . TRP A 1 26  ? -6.685  -5.095  2.904   1.00 20.14  ? 318  TRP A CH2   1 
ATOM   196  N  N     . ALA A 1 27  ? -3.950  2.847   3.516   1.00 20.04  ? 319  ALA A N     1 
ATOM   197  C  CA    . ALA A 1 27  ? -2.840  3.730   3.154   1.00 18.54  ? 319  ALA A CA    1 
ATOM   198  C  C     . ALA A 1 27  ? -1.957  4.104   4.322   1.00 21.75  ? 319  ALA A C     1 
ATOM   199  O  O     . ALA A 1 27  ? -2.406  4.161   5.457   1.00 21.90  ? 319  ALA A O     1 
ATOM   200  C  CB    . ALA A 1 27  ? -3.388  5.017   2.509   1.00 22.40  ? 319  ALA A CB    1 
ATOM   201  N  N     . ASP A 1 28  ? -0.696  4.395   4.034   1.00 20.11  ? 320  ASP A N     1 
ATOM   202  C  CA    . ASP A 1 28  ? 0.085   5.182   4.983   1.00 20.06  ? 320  ASP A CA    1 
ATOM   203  C  C     . ASP A 1 28  ? -0.046  6.663   4.698   1.00 19.34  ? 320  ASP A C     1 
ATOM   204  O  O     . ASP A 1 28  ? -0.171  7.078   3.546   1.00 21.97  ? 320  ASP A O     1 
ATOM   205  C  CB    . ASP A 1 28  ? 1.552   4.781   4.975   1.00 22.90  ? 320  ASP A CB    1 
ATOM   206  C  CG    . ASP A 1 28  ? 1.833   3.640   5.930   1.00 34.18  ? 320  ASP A CG    1 
ATOM   207  O  OD1   . ASP A 1 28  ? 1.736   3.832   7.171   1.00 30.61  ? 320  ASP A OD1   1 
ATOM   208  O  OD2   . ASP A 1 28  ? 2.148   2.552   5.433   1.00 32.14  ? 320  ASP A OD2   1 
ATOM   209  N  N     . LEU A 1 29  ? -0.029  7.446   5.765   1.00 18.72  ? 321  LEU A N     1 
ATOM   210  C  CA    . LEU A 1 29  ? -0.074  8.905   5.671   1.00 20.49  ? 321  LEU A CA    1 
ATOM   211  C  C     . LEU A 1 29  ? 1.349   9.399   5.396   1.00 21.05  ? 321  LEU A C     1 
ATOM   212  O  O     . LEU A 1 29  ? 2.115   9.607   6.328   1.00 20.15  ? 321  LEU A O     1 
ATOM   213  C  CB    . LEU A 1 29  ? -0.621  9.470   6.986   1.00 19.55  ? 321  LEU A CB    1 
ATOM   214  C  CG    . LEU A 1 29  ? -0.804  10.987  7.065   1.00 20.33  ? 321  LEU A CG    1 
ATOM   215  C  CD1   . LEU A 1 29  ? -1.772  11.451  5.971   1.00 23.89  ? 321  LEU A CD1   1 
ATOM   216  C  CD2   . LEU A 1 29  ? -1.308  11.350  8.453   1.00 19.47  ? 321  LEU A CD2   1 
ATOM   217  N  N     . LEU A 1 30  ? 1.718   9.537   4.120   1.00 20.12  ? 322  LEU A N     1 
ATOM   218  C  CA    . LEU A 1 30  ? 3.087   9.950   3.763   1.00 22.22  ? 322  LEU A CA    1 
ATOM   219  C  C     . LEU A 1 30  ? 3.459   11.332  4.315   1.00 20.42  ? 322  LEU A C     1 
ATOM   220  O  O     . LEU A 1 30  ? 4.578   11.554  4.803   1.00 23.24  ? 322  LEU A O     1 
ATOM   221  C  CB    . LEU A 1 30  ? 3.264   9.981   2.244   1.00 22.09  ? 322  LEU A CB    1 
ATOM   222  C  CG    . LEU A 1 30  ? 3.018   8.688   1.471   1.00 19.65  ? 322  LEU A CG    1 
ATOM   223  C  CD1   . LEU A 1 30  ? 3.485   8.817   0.017   1.00 26.41  ? 322  LEU A CD1   1 
ATOM   224  C  CD2   . LEU A 1 30  ? 3.719   7.504   2.147   1.00 24.02  ? 322  LEU A CD2   1 
ATOM   225  N  N     . ALA A 1 31  ? 2.512   12.256  4.243   1.00 22.42  ? 323  ALA A N     1 
ATOM   226  C  CA    . ALA A 1 31  ? 2.801   13.634  4.632   1.00 21.35  ? 323  ALA A CA    1 
ATOM   227  C  C     . ALA A 1 31  ? 1.520   14.339  5.033   1.00 22.14  ? 323  ALA A C     1 
ATOM   228  O  O     . ALA A 1 31  ? 0.441   14.020  4.535   1.00 21.62  ? 323  ALA A O     1 
ATOM   229  C  CB    . ALA A 1 31  ? 3.462   14.361  3.483   1.00 20.58  ? 323  ALA A CB    1 
ATOM   230  N  N     . LEU A 1 32  ? 1.657   15.306  5.935   1.00 22.95  ? 324  LEU A N     1 
ATOM   231  C  CA    . LEU A 1 32  ? 0.527   16.054  6.457   1.00 22.74  ? 324  LEU A CA    1 
ATOM   232  C  C     . LEU A 1 32  ? 0.979   17.500  6.590   1.00 20.51  ? 324  LEU A C     1 
ATOM   233  O  O     . LEU A 1 32  ? 2.091   17.761  7.049   1.00 23.33  ? 324  LEU A O     1 
ATOM   234  C  CB    . LEU A 1 32  ? 0.139   15.517  7.837   1.00 21.71  ? 324  LEU A CB    1 
ATOM   235  C  CG    . LEU A 1 32  ? -1.020  16.229  8.550   1.00 24.27  ? 324  LEU A CG    1 
ATOM   236  C  CD1   . LEU A 1 32  ? -2.337  15.931  7.832   1.00 24.08  ? 324  LEU A CD1   1 
ATOM   237  C  CD2   . LEU A 1 32  ? -1.118  15.788  9.984   1.00 26.05  ? 324  LEU A CD2   1 
ATOM   238  N  N     . ALA A 1 33  ? 0.121   18.433  6.195   1.00 24.17  ? 325  ALA A N     1 
ATOM   239  C  CA    . ALA A 1 33  ? 0.477   19.846  6.273   1.00 25.34  ? 325  ALA A CA    1 
ATOM   240  C  C     . ALA A 1 33  ? -0.778  20.682  6.469   1.00 23.31  ? 325  ALA A C     1 
ATOM   241  O  O     . ALA A 1 33  ? -1.897  20.193  6.298   1.00 23.40  ? 325  ALA A O     1 
ATOM   242  C  CB    . ALA A 1 33  ? 1.207   20.264  5.021   1.00 25.32  ? 325  ALA A CB    1 
ATOM   243  N  N     . ALA A 1 34  ? -0.597  21.947  6.830   1.00 22.40  ? 326  ALA A N     1 
ATOM   244  C  CA    . ALA A 1 34  ? -1.747  22.809  7.054   1.00 26.94  ? 326  ALA A CA    1 
ATOM   245  C  C     . ALA A 1 34  ? -1.413  24.212  6.588   1.00 32.17  ? 326  ALA A C     1 
ATOM   246  O  O     . ALA A 1 34  ? -0.257  24.632  6.675   1.00 31.70  ? 326  ALA A O     1 
ATOM   247  C  CB    . ALA A 1 34  ? -2.123  22.801  8.512   1.00 28.21  ? 326  ALA A CB    1 
ATOM   248  N  N     . ALA A 1 35  ? -2.409  24.928  6.069   1.00 28.74  ? 327  ALA A N     1 
ATOM   249  C  CA    . ALA A 1 35  ? -2.171  26.279  5.567   1.00 33.05  ? 327  ALA A CA    1 
ATOM   250  C  C     . ALA A 1 35  ? -3.169  27.278  6.140   1.00 29.89  ? 327  ALA A C     1 
ATOM   251  O  O     . ALA A 1 35  ? -4.353  27.000  6.260   1.00 29.15  ? 327  ALA A O     1 
ATOM   252  C  CB    . ALA A 1 35  ? -2.194  26.310  4.033   1.00 31.14  ? 327  ALA A CB    1 
ATOM   253  N  N     . ARG A 1 36  ? -2.677  28.460  6.493   1.00 35.80  ? 328  ARG A N     1 
ATOM   254  C  CA    . ARG A 1 36  ? -3.550  29.505  6.996   1.00 34.24  ? 328  ARG A CA    1 
ATOM   255  C  C     . ARG A 1 36  ? -2.902  30.835  6.666   1.00 39.82  ? 328  ARG A C     1 
ATOM   256  O  O     . ARG A 1 36  ? -1.756  31.073  7.038   1.00 37.33  ? 328  ARG A O     1 
ATOM   257  C  CB    . ARG A 1 36  ? -3.753  29.360  8.500   1.00 45.77  ? 328  ARG A CB    1 
ATOM   258  C  CG    . ARG A 1 36  ? -4.272  30.617  9.171   1.00 63.53  ? 328  ARG A CG    1 
ATOM   259  C  CD    . ARG A 1 36  ? -5.723  30.883  8.823   1.00 77.64  ? 328  ARG A CD    1 
ATOM   260  N  NE    . ARG A 1 36  ? -6.632  30.143  9.693   1.00 87.14  ? 328  ARG A NE    1 
ATOM   261  C  CZ    . ARG A 1 36  ? -7.020  30.562  10.894  1.00 89.15  ? 328  ARG A CZ    1 
ATOM   262  N  NH1   . ARG A 1 36  ? -6.577  31.717  11.371  1.00 90.79  ? 328  ARG A NH1   1 
ATOM   263  N  NH2   . ARG A 1 36  ? -7.850  29.825  11.618  1.00 88.33  ? 328  ARG A NH2   1 
ATOM   264  N  N     . GLY A 1 37  ? -3.625  31.680  5.938   1.00 48.66  ? 329  GLY A N     1 
ATOM   265  C  CA    . GLY A 1 37  ? -3.070  32.928  5.448   1.00 56.12  ? 329  GLY A CA    1 
ATOM   266  C  C     . GLY A 1 37  ? -1.979  32.683  4.424   1.00 65.35  ? 329  GLY A C     1 
ATOM   267  O  O     . GLY A 1 37  ? -1.083  33.507  4.246   1.00 60.75  ? 329  GLY A O     1 
ATOM   268  N  N     . GLY A 1 38  ? -2.042  31.537  3.753   1.00 72.85  ? 330  GLY A N     1 
ATOM   269  C  CA    . GLY A 1 38  ? -1.043  31.187  2.759   1.00 74.08  ? 330  GLY A CA    1 
ATOM   270  C  C     . GLY A 1 38  ? 0.253   30.675  3.363   1.00 71.07  ? 330  GLY A C     1 
ATOM   271  O  O     . GLY A 1 38  ? 1.109   30.142  2.655   1.00 75.72  ? 330  GLY A O     1 
ATOM   272  N  N     . ARG A 1 39  ? 0.405   30.851  4.673   1.00 58.89  ? 331  ARG A N     1 
ATOM   273  C  CA    . ARG A 1 39  ? 1.533   30.292  5.403   1.00 45.09  ? 331  ARG A CA    1 
ATOM   274  C  C     . ARG A 1 39  ? 1.277   28.798  5.533   1.00 32.88  ? 331  ARG A C     1 
ATOM   275  O  O     . ARG A 1 39  ? 0.160   28.399  5.847   1.00 33.09  ? 331  ARG A O     1 
ATOM   276  C  CB    . ARG A 1 39  ? 1.619   30.921  6.790   1.00 51.61  ? 331  ARG A CB    1 
ATOM   277  C  CG    . ARG A 1 39  ? 3.012   30.940  7.382   1.00 68.03  ? 331  ARG A CG    1 
ATOM   278  C  CD    . ARG A 1 39  ? 3.214   32.170  8.255   1.00 80.40  ? 331  ARG A CD    1 
ATOM   279  N  NE    . ARG A 1 39  ? 4.573   32.246  8.784   1.00 94.70  ? 331  ARG A NE    1 
ATOM   280  C  CZ    . ARG A 1 39  ? 5.609   32.755  8.124   1.00 98.60  ? 331  ARG A CZ    1 
ATOM   281  N  NH1   . ARG A 1 39  ? 5.449   33.236  6.898   1.00 98.14  ? 331  ARG A NH1   1 
ATOM   282  N  NH2   . ARG A 1 39  ? 6.809   32.779  8.688   1.00 99.49  ? 331  ARG A NH2   1 
ATOM   283  N  N     . VAL A 1 40  ? 2.303   27.989  5.286   1.00 36.17  ? 332  VAL A N     1 
ATOM   284  C  CA    . VAL A 1 40  ? 2.167   26.531  5.309   1.00 33.38  ? 332  VAL A CA    1 
ATOM   285  C  C     . VAL A 1 40  ? 2.995   25.919  6.440   1.00 37.78  ? 332  VAL A C     1 
ATOM   286  O  O     . VAL A 1 40  ? 4.144   26.305  6.664   1.00 38.46  ? 332  VAL A O     1 
ATOM   287  C  CB    . VAL A 1 40  ? 2.555   25.909  3.946   1.00 35.76  ? 332  VAL A CB    1 
ATOM   288  C  CG1   . VAL A 1 40  ? 3.901   26.433  3.481   1.00 47.27  ? 332  VAL A CG1   1 
ATOM   289  C  CG2   . VAL A 1 40  ? 2.566   24.386  4.021   1.00 38.71  ? 332  VAL A CG2   1 
ATOM   290  N  N     . HIS A 1 41  ? 2.392   24.977  7.160   1.00 36.07  ? 333  HIS A N     1 
ATOM   291  C  CA    . HIS A 1 41  ? 3.042   24.296  8.263   1.00 29.09  ? 333  HIS A CA    1 
ATOM   292  C  C     . HIS A 1 41  ? 3.145   22.813  7.911   1.00 30.44  ? 333  HIS A C     1 
ATOM   293  O  O     . HIS A 1 41  ? 2.119   22.167  7.731   1.00 27.57  ? 333  HIS A O     1 
ATOM   294  C  CB    . HIS A 1 41  ? 2.194   24.423  9.532   1.00 26.59  ? 333  HIS A CB    1 
ATOM   295  C  CG    . HIS A 1 41  ? 1.754   25.824  9.842   1.00 32.70  ? 333  HIS A CG    1 
ATOM   296  N  ND1   . HIS A 1 41  ? 2.128   26.483  10.994  1.00 34.33  ? 333  HIS A ND1   1 
ATOM   297  C  CD2   . HIS A 1 41  ? 0.953   26.680  9.163   1.00 34.35  ? 333  HIS A CD2   1 
ATOM   298  C  CE1   . HIS A 1 41  ? 1.580   27.686  11.010  1.00 34.00  ? 333  HIS A CE1   1 
ATOM   299  N  NE2   . HIS A 1 41  ? 0.871   27.835  9.905   1.00 34.82  ? 333  HIS A NE2   1 
ATOM   300  N  N     . ARG A 1 42  ? 4.357   22.272  7.828   1.00 28.00  ? 334  ARG A N     1 
ATOM   301  C  CA    . ARG A 1 42  ? 4.510   20.848  7.503   1.00 27.37  ? 334  ARG A CA    1 
ATOM   302  C  C     . ARG A 1 42  ? 4.785   19.988  8.728   1.00 32.37  ? 334  ARG A C     1 
ATOM   303  O  O     . ARG A 1 42  ? 5.603   20.334  9.577   1.00 33.88  ? 334  ARG A O     1 
ATOM   304  C  CB    . ARG A 1 42  ? 5.597   20.642  6.444   1.00 34.83  ? 334  ARG A CB    1 
ATOM   305  C  CG    . ARG A 1 42  ? 5.258   21.271  5.110   1.00 38.46  ? 334  ARG A CG    1 
ATOM   306  C  CD    . ARG A 1 42  ? 6.329   21.014  4.074   1.00 39.64  ? 334  ARG A CD    1 
ATOM   307  N  NE    . ARG A 1 42  ? 5.878   21.397  2.740   1.00 47.21  ? 334  ARG A NE    1 
ATOM   308  C  CZ    . ARG A 1 42  ? 5.850   22.648  2.294   1.00 50.18  ? 334  ARG A CZ    1 
ATOM   309  N  NH1   . ARG A 1 42  ? 6.243   23.640  3.082   1.00 49.41  ? 334  ARG A NH1   1 
ATOM   310  N  NH2   . ARG A 1 42  ? 5.420   22.910  1.067   1.00 53.56  ? 334  ARG A NH2   1 
ATOM   311  N  N     . ALA A 1 43  ? 4.100   18.851  8.817   1.00 28.19  ? 335  ALA A N     1 
ATOM   312  C  CA    . ALA A 1 43  ? 4.231   17.991  9.983   1.00 29.11  ? 335  ALA A CA    1 
ATOM   313  C  C     . ALA A 1 43  ? 5.522   17.176  9.926   1.00 24.06  ? 335  ALA A C     1 
ATOM   314  O  O     . ALA A 1 43  ? 5.775   16.492  8.936   1.00 28.22  ? 335  ALA A O     1 
ATOM   315  C  CB    . ALA A 1 43  ? 3.035   17.060  10.071  1.00 28.42  ? 335  ALA A CB    1 
ATOM   316  N  N     . PRO A 1 44  ? 6.338   17.231  10.995  1.00 29.01  ? 336  PRO A N     1 
ATOM   317  C  CA    . PRO A 1 44  ? 7.535   16.376  11.050  1.00 29.50  ? 336  PRO A CA    1 
ATOM   318  C  C     . PRO A 1 44  ? 7.229   14.868  11.098  1.00 28.85  ? 336  PRO A C     1 
ATOM   319  O  O     . PRO A 1 44  ? 7.913   14.095  10.430  1.00 34.11  ? 336  PRO A O     1 
ATOM   320  C  CB    . PRO A 1 44  ? 8.242   16.818  12.344  1.00 31.13  ? 336  PRO A CB    1 
ATOM   321  C  CG    . PRO A 1 44  ? 7.281   17.731  13.052  1.00 35.74  ? 336  PRO A CG    1 
ATOM   322  C  CD    . PRO A 1 44  ? 6.355   18.283  12.025  1.00 33.41  ? 336  PRO A CD    1 
ATOM   323  N  N     . GLU A 1 45  ? 6.241   14.466  11.894  1.00 27.53  ? 337  GLU A N     1 
ATOM   324  C  CA    . GLU A 1 45  ? 5.843   13.061  12.008  1.00 27.97  ? 337  GLU A CA    1 
ATOM   325  C  C     . GLU A 1 45  ? 4.334   12.959  11.840  1.00 28.26  ? 337  GLU A C     1 
ATOM   326  O  O     . GLU A 1 45  ? 3.593   13.236  12.779  1.00 29.95  ? 337  GLU A O     1 
ATOM   327  C  CB    . GLU A 1 45  ? 6.201   12.524  13.391  1.00 30.84  ? 337  GLU A CB    1 
ATOM   328  C  CG    . GLU A 1 45  ? 7.685   12.548  13.724  1.00 34.26  ? 337  GLU A CG    1 
ATOM   329  C  CD    . GLU A 1 45  ? 7.949   12.061  15.136  1.00 47.57  ? 337  GLU A CD    1 
ATOM   330  O  OE1   . GLU A 1 45  ? 8.058   10.832  15.337  1.00 57.43  ? 337  GLU A OE1   1 
ATOM   331  O  OE2   . GLU A 1 45  ? 8.036   12.908  16.046  1.00 46.71  ? 337  GLU A OE2   1 
ATOM   332  N  N     . PRO A 1 46  ? 3.874   12.560  10.645  1.00 28.12  ? 338  PRO A N     1 
ATOM   333  C  CA    . PRO A 1 46  ? 2.457   12.685  10.284  1.00 27.04  ? 338  PRO A CA    1 
ATOM   334  C  C     . PRO A 1 46  ? 1.452   12.080  11.256  1.00 22.40  ? 338  PRO A C     1 
ATOM   335  O  O     . PRO A 1 46  ? 0.454   12.738  11.531  1.00 24.07  ? 338  PRO A O     1 
ATOM   336  C  CB    . PRO A 1 46  ? 2.388   11.966  8.935   1.00 27.67  ? 338  PRO A CB    1 
ATOM   337  C  CG    . PRO A 1 46  ? 3.713   12.280  8.332   1.00 23.37  ? 338  PRO A CG    1 
ATOM   338  C  CD    . PRO A 1 46  ? 4.684   12.137  9.490   1.00 30.00  ? 338  PRO A CD    1 
ATOM   339  N  N     . TYR A 1 47  ? 1.677   10.858  11.732  1.00 22.71  ? 339  TYR A N     1 
ATOM   340  C  CA    . TYR A 1 47  ? 0.711   10.235  12.635  1.00 25.21  ? 339  TYR A CA    1 
ATOM   341  C  C     . TYR A 1 47  ? 0.628   10.962  13.969  1.00 29.86  ? 339  TYR A C     1 
ATOM   342  O  O     . TYR A 1 47  ? -0.458  11.117  14.526  1.00 29.26  ? 339  TYR A O     1 
ATOM   343  C  CB    . TYR A 1 47  ? 1.003   8.743   12.836  1.00 24.20  ? 339  TYR A CB    1 
ATOM   344  C  CG    . TYR A 1 47  ? 0.745   7.923   11.584  1.00 21.14  ? 339  TYR A CG    1 
ATOM   345  C  CD1   . TYR A 1 47  ? -0.542  7.774   11.086  1.00 21.19  ? 339  TYR A CD1   1 
ATOM   346  C  CD2   . TYR A 1 47  ? 1.788   7.295   10.907  1.00 23.95  ? 339  TYR A CD2   1 
ATOM   347  C  CE1   . TYR A 1 47  ? -0.790  7.035   9.947   1.00 23.94  ? 339  TYR A CE1   1 
ATOM   348  C  CE2   . TYR A 1 47  ? 1.550   6.550   9.760   1.00 25.44  ? 339  TYR A CE2   1 
ATOM   349  C  CZ    . TYR A 1 47  ? 0.263   6.419   9.292   1.00 23.89  ? 339  TYR A CZ    1 
ATOM   350  O  OH    . TYR A 1 47  ? 0.025   5.683   8.153   1.00 23.89  ? 339  TYR A OH    1 
ATOM   351  N  N     . LYS A 1 48  ? 1.770   11.406  14.480  1.00 25.97  ? 340  LYS A N     1 
ATOM   352  C  CA    . LYS A 1 48  ? 1.789   12.167  15.729  1.00 31.53  ? 340  LYS A CA    1 
ATOM   353  C  C     . LYS A 1 48  ? 1.096   13.511  15.538  1.00 35.17  ? 340  LYS A C     1 
ATOM   354  O  O     . LYS A 1 48  ? 0.337   13.966  16.396  1.00 31.43  ? 340  LYS A O     1 
ATOM   355  C  CB    . LYS A 1 48  ? 3.228   12.384  16.197  1.00 29.33  ? 340  LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 48  ? 3.350   13.231  17.452  1.00 46.59  ? 340  LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 48  ? 4.806   13.555  17.774  1.00 62.80  ? 340  LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 48  ? 4.901   14.595  18.885  1.00 74.51  ? 340  LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 48  ? 6.310   14.943  19.222  1.00 82.75  ? 340  LYS A NZ    1 
ATOM   360  N  N     . ALA A 1 49  ? 1.361   14.142  14.401  1.00 26.19  ? 341  ALA A N     1 
ATOM   361  C  CA    . ALA A 1 49  ? 0.785   15.444  14.098  1.00 26.51  ? 341  ALA A CA    1 
ATOM   362  C  C     . ALA A 1 49  ? -0.738  15.429  13.949  1.00 30.01  ? 341  ALA A C     1 
ATOM   363  O  O     . ALA A 1 49  ? -1.382  16.464  14.127  1.00 27.30  ? 341  ALA A O     1 
ATOM   364  C  CB    . ALA A 1 49  ? 1.418   16.020  12.864  1.00 27.28  ? 341  ALA A CB    1 
ATOM   365  N  N     . LEU A 1 50  ? -1.314  14.275  13.610  1.00 27.37  ? 342  LEU A N     1 
ATOM   366  C  CA    . LEU A 1 50  ? -2.767  14.176  13.470  1.00 28.94  ? 342  LEU A CA    1 
ATOM   367  C  C     . LEU A 1 50  ? -3.448  14.564  14.776  1.00 25.74  ? 342  LEU A C     1 
ATOM   368  O  O     . LEU A 1 50  ? -4.534  15.127  14.771  1.00 28.61  ? 342  LEU A O     1 
ATOM   369  C  CB    . LEU A 1 50  ? -3.209  12.755  13.111  1.00 28.77  ? 342  LEU A CB    1 
ATOM   370  C  CG    . LEU A 1 50  ? -3.220  12.284  11.667  1.00 29.43  ? 342  LEU A CG    1 
ATOM   371  C  CD1   . LEU A 1 50  ? -3.710  10.845  11.649  1.00 27.23  ? 342  LEU A CD1   1 
ATOM   372  C  CD2   . LEU A 1 50  ? -4.085  13.165  10.782  1.00 27.70  ? 342  LEU A CD2   1 
ATOM   373  N  N     . ARG A 1 51  ? -2.791  14.248  15.885  1.00 31.53  ? 343  ARG A N     1 
ATOM   374  C  CA    . ARG A 1 51  ? -3.315  14.525  17.217  1.00 33.97  ? 343  ARG A CA    1 
ATOM   375  C  C     . ARG A 1 51  ? -3.423  16.011  17.527  1.00 38.51  ? 343  ARG A C     1 
ATOM   376  O  O     . ARG A 1 51  ? -4.125  16.403  18.463  1.00 38.43  ? 343  ARG A O     1 
ATOM   377  C  CB    . ARG A 1 51  ? -2.444  13.851  18.279  1.00 34.25  ? 343  ARG A CB    1 
ATOM   378  C  CG    . ARG A 1 51  ? -2.852  12.435  18.608  1.00 43.93  ? 343  ARG A CG    1 
ATOM   379  C  CD    . ARG A 1 51  ? -2.618  11.495  17.442  1.00 54.92  ? 343  ARG A CD    1 
ATOM   380  N  NE    . ARG A 1 51  ? -3.151  10.163  17.714  1.00 62.33  ? 343  ARG A NE    1 
ATOM   381  C  CZ    . ARG A 1 51  ? -2.978  9.110   16.922  1.00 57.53  ? 343  ARG A CZ    1 
ATOM   382  N  NH1   . ARG A 1 51  ? -2.272  9.224   15.799  1.00 51.71  ? 343  ARG A NH1   1 
ATOM   383  N  NH2   . ARG A 1 51  ? -3.507  7.939   17.261  1.00 48.29  ? 343  ARG A NH2   1 
ATOM   384  N  N     . ASP A 1 52  ? -2.730  16.836  16.753  1.00 33.26  ? 344  ASP A N     1 
ATOM   385  C  CA    . ASP A 1 52  ? -2.747  18.276  16.981  1.00 32.84  ? 344  ASP A CA    1 
ATOM   386  C  C     . ASP A 1 52  ? -3.971  18.941  16.368  1.00 36.33  ? 344  ASP A C     1 
ATOM   387  O  O     . ASP A 1 52  ? -4.345  20.051  16.753  1.00 38.23  ? 344  ASP A O     1 
ATOM   388  C  CB    . ASP A 1 52  ? -1.469  18.913  16.435  1.00 32.72  ? 344  ASP A CB    1 
ATOM   389  C  CG    . ASP A 1 52  ? -0.222  18.379  17.114  1.00 37.56  ? 344  ASP A CG    1 
ATOM   390  O  OD1   . ASP A 1 52  ? -0.285  18.094  18.329  1.00 46.47  ? 344  ASP A OD1   1 
ATOM   391  O  OD2   . ASP A 1 52  ? 0.812   18.228  16.433  1.00 33.65  ? 344  ASP A OD2   1 
ATOM   392  N  N     . LEU A 1 53  ? -4.598  18.262  15.411  1.00 31.57  ? 345  LEU A N     1 
ATOM   393  C  CA    . LEU A 1 53  ? -5.728  18.840  14.685  1.00 30.44  ? 345  LEU A CA    1 
ATOM   394  C  C     . LEU A 1 53  ? -7.054  18.594  15.409  1.00 30.09  ? 345  LEU A C     1 
ATOM   395  O  O     . LEU A 1 53  ? -7.260  17.537  16.000  1.00 33.19  ? 345  LEU A O     1 
ATOM   396  C  CB    . LEU A 1 53  ? -5.786  18.261  13.263  1.00 26.18  ? 345  LEU A CB    1 
ATOM   397  C  CG    . LEU A 1 53  ? -4.543  18.447  12.389  1.00 33.31  ? 345  LEU A CG    1 
ATOM   398  C  CD1   . LEU A 1 53  ? -4.743  17.758  11.043  1.00 34.78  ? 345  LEU A CD1   1 
ATOM   399  C  CD2   . LEU A 1 53  ? -4.244  19.915  12.192  1.00 35.81  ? 345  LEU A CD2   1 
ATOM   400  N  N     . LYS A 1 54  ? -7.957  19.568  15.354  1.00 30.09  ? 346  LYS A N     1 
ATOM   401  C  CA    . LYS A 1 54  ? -9.270  19.409  15.982  1.00 31.42  ? 346  LYS A CA    1 
ATOM   402  C  C     . LYS A 1 54  ? -10.305 18.916  14.975  1.00 33.73  ? 346  LYS A C     1 
ATOM   403  O  O     . LYS A 1 54  ? -11.300 18.294  15.342  1.00 32.65  ? 346  LYS A O     1 
ATOM   404  C  CB    . LYS A 1 54  ? -9.732  20.725  16.602  1.00 40.22  ? 346  LYS A CB    1 
ATOM   405  C  CG    . LYS A 1 54  ? -8.820  21.224  17.707  1.00 50.19  ? 346  LYS A CG    1 
ATOM   406  C  CD    . LYS A 1 54  ? -8.815  20.275  18.899  1.00 62.81  ? 346  LYS A CD    1 
ATOM   407  C  CE    . LYS A 1 54  ? -10.055 20.455  19.779  1.00 73.42  ? 346  LYS A CE    1 
ATOM   408  N  NZ    . LYS A 1 54  ? -11.259 19.718  19.278  1.00 78.82  ? 346  LYS A NZ    1 
ATOM   409  N  N     . GLU A 1 55  ? -10.066 19.201  13.703  1.00 32.07  ? 347  GLU A N     1 
ATOM   410  C  CA    . GLU A 1 55  ? -10.901 18.653  12.638  1.00 32.13  ? 347  GLU A CA    1 
ATOM   411  C  C     . GLU A 1 55  ? -10.081 18.541  11.370  1.00 29.78  ? 347  GLU A C     1 
ATOM   412  O  O     . GLU A 1 55  ? -8.972  19.071  11.290  1.00 29.53  ? 347  GLU A O     1 
ATOM   413  C  CB    . GLU A 1 55  ? -12.149 19.517  12.399  1.00 39.99  ? 347  GLU A CB    1 
ATOM   414  C  CG    . GLU A 1 55  ? -11.876 20.901  11.838  1.00 46.12  ? 347  GLU A CG    1 
ATOM   415  C  CD    . GLU A 1 55  ? -13.156 21.644  11.463  1.00 49.62  ? 347  GLU A CD    1 
ATOM   416  O  OE1   . GLU A 1 55  ? -14.265 21.144  11.766  1.00 45.85  ? 347  GLU A OE1   1 
ATOM   417  O  OE2   . GLU A 1 55  ? -13.051 22.732  10.861  1.00 57.22  ? 347  GLU A OE2   1 
ATOM   418  N  N     . ALA A 1 56  ? -10.616 17.833  10.381  1.00 25.80  ? 348  ALA A N     1 
ATOM   419  C  CA    . ALA A 1 56  ? -9.985  17.784  9.076   1.00 24.37  ? 348  ALA A CA    1 
ATOM   420  C  C     . ALA A 1 56  ? -10.718 18.731  8.130   1.00 24.28  ? 348  ALA A C     1 
ATOM   421  O  O     . ALA A 1 56  ? -11.849 18.471  7.731   1.00 24.77  ? 348  ALA A O     1 
ATOM   422  C  CB    . ALA A 1 56  ? -9.995  16.367  8.524   1.00 21.77  ? 348  ALA A CB    1 
ATOM   423  N  N     . ARG A 1 57  ? -10.073 19.837  7.788   1.00 24.32  ? 349  ARG A N     1 
ATOM   424  C  CA    . ARG A 1 57  ? -10.717 20.875  7.003   1.00 25.89  ? 349  ARG A CA    1 
ATOM   425  C  C     . ARG A 1 57  ? -9.946  21.064  5.708   1.00 27.59  ? 349  ARG A C     1 
ATOM   426  O  O     . ARG A 1 57  ? -8.831  21.577  5.712   1.00 26.71  ? 349  ARG A O     1 
ATOM   427  C  CB    . ARG A 1 57  ? -10.718 22.172  7.817   1.00 32.57  ? 349  ARG A CB    1 
ATOM   428  C  CG    . ARG A 1 57  ? -11.490 23.300  7.207   1.00 30.81  ? 349  ARG A CG    1 
ATOM   429  C  CD    . ARG A 1 57  ? -11.531 24.475  8.186   1.00 32.56  ? 349  ARG A CD    1 
ATOM   430  N  NE    . ARG A 1 57  ? -12.540 25.425  7.765   1.00 31.66  ? 349  ARG A NE    1 
ATOM   431  C  CZ    . ARG A 1 57  ? -12.325 26.717  7.549   1.00 39.03  ? 349  ARG A CZ    1 
ATOM   432  N  NH1   . ARG A 1 57  ? -11.123 27.244  7.747   1.00 41.29  ? 349  ARG A NH1   1 
ATOM   433  N  NH2   . ARG A 1 57  ? -13.330 27.486  7.157   1.00 37.88  ? 349  ARG A NH2   1 
ATOM   434  N  N     . GLY A 1 58  ? -10.513 20.624  4.593   1.00 24.66  ? 350  GLY A N     1 
ATOM   435  C  CA    . GLY A 1 58  ? -9.811  20.737  3.330   1.00 25.08  ? 350  GLY A CA    1 
ATOM   436  C  C     . GLY A 1 58  ? -10.273 19.715  2.325   1.00 20.82  ? 350  GLY A C     1 
ATOM   437  O  O     . GLY A 1 58  ? -11.215 18.970  2.610   1.00 21.16  ? 350  GLY A O     1 
ATOM   438  N  N     . LEU A 1 59  ? -9.618  19.675  1.166   1.00 21.94  ? 351  LEU A N     1 
ATOM   439  C  CA    . LEU A 1 59  ? -9.967  18.715  0.117   1.00 20.06  ? 351  LEU A CA    1 
ATOM   440  C  C     . LEU A 1 59  ? -9.878  17.286  0.634   1.00 20.82  ? 351  LEU A C     1 
ATOM   441  O  O     . LEU A 1 59  ? -8.904  16.928  1.306   1.00 20.72  ? 351  LEU A O     1 
ATOM   442  C  CB    . LEU A 1 59  ? -9.058  18.883  -1.098  1.00 23.27  ? 351  LEU A CB    1 
ATOM   443  C  CG    . LEU A 1 59  ? -9.308  20.152  -1.936  1.00 24.94  ? 351  LEU A CG    1 
ATOM   444  C  CD1   . LEU A 1 59  ? -8.084  20.495  -2.784  1.00 28.84  ? 351  LEU A CD1   1 
ATOM   445  C  CD2   . LEU A 1 59  ? -10.521 19.948  -2.838  1.00 22.95  ? 351  LEU A CD2   1 
ATOM   446  N  N     . LEU A 1 60  ? -10.906 16.496  0.314   1.00 20.05  ? 352  LEU A N     1 
ATOM   447  C  CA    . LEU A 1 60  ? -10.979 15.077  0.699   1.00 20.19  ? 352  LEU A CA    1 
ATOM   448  C  C     . LEU A 1 60  ? -10.898 14.883  2.211   1.00 22.88  ? 352  LEU A C     1 
ATOM   449  O  O     . LEU A 1 60  ? -10.308 13.907  2.689   1.00 19.97  ? 352  LEU A O     1 
ATOM   450  C  CB    . LEU A 1 60  ? -9.877  14.278  0.001   1.00 22.00  ? 352  LEU A CB    1 
ATOM   451  C  CG    . LEU A 1 60  ? -9.872  14.364  -1.528  1.00 26.19  ? 352  LEU A CG    1 
ATOM   452  C  CD1   . LEU A 1 60  ? -8.792  13.457  -2.085  1.00 32.70  ? 352  LEU A CD1   1 
ATOM   453  C  CD2   . LEU A 1 60  ? -11.254 14.043  -2.120  1.00 28.51  ? 352  LEU A CD2   1 
ATOM   454  N  N     . ALA A 1 61  ? -11.513 15.794  2.960   1.00 23.25  ? 353  ALA A N     1 
ATOM   455  C  CA    . ALA A 1 61  ? -11.476 15.732  4.421   1.00 20.85  ? 353  ALA A CA    1 
ATOM   456  C  C     . ALA A 1 61  ? -11.948 14.387  4.986   1.00 20.09  ? 353  ALA A C     1 
ATOM   457  O  O     . ALA A 1 61  ? -11.364 13.873  5.939   1.00 21.84  ? 353  ALA A O     1 
ATOM   458  C  CB    . ALA A 1 61  ? -12.310 16.854  5.021   1.00 21.74  ? 353  ALA A CB    1 
ATOM   459  N  N     . LYS A 1 62  ? -13.008 13.830  4.404   1.00 18.04  ? 354  LYS A N     1 
ATOM   460  C  CA    A LYS A 1 62  ? -13.535 12.545  4.867   0.48 18.71  ? 354  LYS A CA    1 
ATOM   461  C  CA    B LYS A 1 62  ? -13.537 12.541  4.849   0.52 18.80  ? 354  LYS A CA    1 
ATOM   462  C  C     . LYS A 1 62  ? -12.460 11.458  4.859   1.00 19.01  ? 354  LYS A C     1 
ATOM   463  O  O     . LYS A 1 62  ? -12.382 10.656  5.789   1.00 20.08  ? 354  LYS A O     1 
ATOM   464  C  CB    A LYS A 1 62  ? -14.736 12.109  4.021   0.48 20.82  ? 354  LYS A CB    1 
ATOM   465  C  CB    B LYS A 1 62  ? -14.686 12.104  3.942   0.52 19.50  ? 354  LYS A CB    1 
ATOM   466  C  CG    A LYS A 1 62  ? -15.344 10.752  4.420   0.48 25.34  ? 354  LYS A CG    1 
ATOM   467  C  CG    B LYS A 1 62  ? -15.205 10.689  4.208   0.52 24.90  ? 354  LYS A CG    1 
ATOM   468  C  CD    A LYS A 1 62  ? -14.800 9.605   3.573   0.48 24.10  ? 354  LYS A CD    1 
ATOM   469  C  CD    B LYS A 1 62  ? -16.357 10.356  3.280   0.52 25.86  ? 354  LYS A CD    1 
ATOM   470  C  CE    A LYS A 1 62  ? -15.414 9.581   2.180   0.48 29.65  ? 354  LYS A CE    1 
ATOM   471  C  CE    B LYS A 1 62  ? -15.885 10.006  1.883   0.52 31.20  ? 354  LYS A CE    1 
ATOM   472  N  NZ    A LYS A 1 62  ? -14.844 8.472   1.356   0.48 25.60  ? 354  LYS A NZ    1 
ATOM   473  N  NZ    B LYS A 1 62  ? -15.127 8.728   1.851   0.52 28.62  ? 354  LYS A NZ    1 
ATOM   474  N  N     . ASP A 1 63  ? -11.640 11.428  3.810   1.00 19.67  ? 355  ASP A N     1 
ATOM   475  C  CA    . ASP A 1 63  ? -10.599 10.402  3.695   1.00 17.89  ? 355  ASP A CA    1 
ATOM   476  C  C     . ASP A 1 63  ? -9.551  10.504  4.807   1.00 19.37  ? 355  ASP A C     1 
ATOM   477  O  O     . ASP A 1 63  ? -9.108  9.490   5.349   1.00 20.38  ? 355  ASP A O     1 
ATOM   478  C  CB    . ASP A 1 63  ? -9.942  10.431  2.312   1.00 18.23  ? 355  ASP A CB    1 
ATOM   479  C  CG    . ASP A 1 63  ? -10.869 9.922   1.202   1.00 29.58  ? 355  ASP A CG    1 
ATOM   480  O  OD1   . ASP A 1 63  ? -11.860 9.216   1.504   1.00 27.15  ? 355  ASP A OD1   1 
ATOM   481  O  OD2   . ASP A 1 63  ? -10.594 10.222  0.017   1.00 33.33  ? 355  ASP A OD2   1 
ATOM   482  N  N     . LEU A 1 64  ? -9.158  11.725  5.166   1.00 20.09  ? 356  LEU A N     1 
ATOM   483  C  CA    . LEU A 1 64  ? -8.263  11.877  6.305   1.00 18.02  ? 356  LEU A CA    1 
ATOM   484  C  C     . LEU A 1 64  ? -8.933  11.429  7.603   1.00 19.03  ? 356  LEU A C     1 
ATOM   485  O  O     . LEU A 1 64  ? -8.295  10.797  8.458   1.00 24.24  ? 356  LEU A O     1 
ATOM   486  C  CB    . LEU A 1 64  ? -7.729  13.317  6.400   1.00 17.79  ? 356  LEU A CB    1 
ATOM   487  C  CG    . LEU A 1 64  ? -6.667  13.485  7.492   1.00 22.36  ? 356  LEU A CG    1 
ATOM   488  C  CD1   . LEU A 1 64  ? -5.457  12.570  7.242   1.00 23.24  ? 356  LEU A CD1   1 
ATOM   489  C  CD2   . LEU A 1 64  ? -6.243  14.952  7.579   1.00 21.38  ? 356  LEU A CD2   1 
ATOM   490  N  N     . SER A 1 65  ? -10.221 11.725  7.743   1.00 17.45  ? 357  SER A N     1 
ATOM   491  C  CA    A SER A 1 65  ? -11.003 11.291  8.909   0.61 18.61  ? 357  SER A CA    1 
ATOM   492  C  CA    B SER A 1 65  ? -10.980 11.291  8.919   0.39 18.36  ? 357  SER A CA    1 
ATOM   493  C  C     . SER A 1 65  ? -11.047 9.771   9.022   1.00 17.91  ? 357  SER A C     1 
ATOM   494  O  O     . SER A 1 65  ? -10.954 9.218   10.118  1.00 19.52  ? 357  SER A O     1 
ATOM   495  C  CB    A SER A 1 65  ? -12.427 11.839  8.824   0.61 24.05  ? 357  SER A CB    1 
ATOM   496  C  CB    B SER A 1 65  ? -12.388 11.884  8.909   0.39 23.07  ? 357  SER A CB    1 
ATOM   497  O  OG    A SER A 1 65  ? -13.127 11.636  10.035  0.61 23.68  ? 357  SER A OG    1 
ATOM   498  O  OG    B SER A 1 65  ? -12.335 13.290  9.083   0.39 18.94  ? 357  SER A OG    1 
ATOM   499  N  N     . VAL A 1 66  ? -11.211 9.103   7.881   1.00 17.06  ? 358  VAL A N     1 
ATOM   500  C  CA    . VAL A 1 66  ? -11.206 7.634   7.848   1.00 18.37  ? 358  VAL A CA    1 
ATOM   501  C  C     . VAL A 1 66  ? -9.873  7.088   8.368   1.00 21.17  ? 358  VAL A C     1 
ATOM   502  O  O     . VAL A 1 66  ? -9.837  6.208   9.238   1.00 19.04  ? 358  VAL A O     1 
ATOM   503  C  CB    . VAL A 1 66  ? -11.464 7.113   6.416   1.00 17.24  ? 358  VAL A CB    1 
ATOM   504  C  CG1   . VAL A 1 66  ? -11.190 5.602   6.320   1.00 15.30  ? 358  VAL A CG1   1 
ATOM   505  C  CG2   . VAL A 1 66  ? -12.903 7.416   5.994   1.00 18.65  ? 358  VAL A CG2   1 
ATOM   506  N  N     . LEU A 1 67  ? -8.778  7.610   7.828   1.00 18.91  ? 359  LEU A N     1 
ATOM   507  C  CA    . LEU A 1 67  ? -7.458  7.184   8.287   1.00 18.69  ? 359  LEU A CA    1 
ATOM   508  C  C     . LEU A 1 67  ? -7.276  7.500   9.773   1.00 18.74  ? 359  LEU A C     1 
ATOM   509  O  O     . LEU A 1 67  ? -6.723  6.699   10.508  1.00 19.93  ? 359  LEU A O     1 
ATOM   510  C  CB    . LEU A 1 67  ? -6.350  7.791   7.417   1.00 18.70  ? 359  LEU A CB    1 
ATOM   511  C  CG    . LEU A 1 67  ? -4.910  7.394   7.788   1.00 19.45  ? 359  LEU A CG    1 
ATOM   512  C  CD1   . LEU A 1 67  ? -4.056  7.324   6.538   1.00 21.55  ? 359  LEU A CD1   1 
ATOM   513  C  CD2   . LEU A 1 67  ? -4.323  8.423   8.752   1.00 21.94  ? 359  LEU A CD2   1 
ATOM   514  N  N     . ALA A 1 68  ? -7.746  8.663   10.228  1.00 18.41  ? 360  ALA A N     1 
ATOM   515  C  CA    . ALA A 1 68  ? -7.651  8.988   11.654  1.00 19.39  ? 360  ALA A CA    1 
ATOM   516  C  C     . ALA A 1 68  ? -8.403  7.974   12.514  1.00 22.05  ? 360  ALA A C     1 
ATOM   517  O  O     . ALA A 1 68  ? -7.891  7.533   13.545  1.00 22.48  ? 360  ALA A O     1 
ATOM   518  C  CB    . ALA A 1 68  ? -8.192  10.384  11.927  1.00 20.65  ? 360  ALA A CB    1 
ATOM   519  N  N     . LEU A 1 69  ? -9.615  7.607   12.093  1.00 21.70  ? 361  LEU A N     1 
ATOM   520  C  CA    . LEU A 1 69  ? -10.388 6.604   12.831  1.00 22.72  ? 361  LEU A CA    1 
ATOM   521  C  C     . LEU A 1 69  ? -9.635  5.280   12.924  1.00 26.24  ? 361  LEU A C     1 
ATOM   522  O  O     . LEU A 1 69  ? -9.664  4.601   13.964  1.00 26.27  ? 361  LEU A O     1 
ATOM   523  C  CB    . LEU A 1 69  ? -11.768 6.374   12.190  1.00 17.12  ? 361  LEU A CB    1 
ATOM   524  C  CG    . LEU A 1 69  ? -12.767 7.523   12.325  1.00 22.90  ? 361  LEU A CG    1 
ATOM   525  C  CD1   . LEU A 1 69  ? -14.048 7.276   11.492  1.00 25.21  ? 361  LEU A CD1   1 
ATOM   526  C  CD2   . LEU A 1 69  ? -13.120 7.732   13.803  1.00 26.73  ? 361  LEU A CD2   1 
ATOM   527  N  N     . ARG A 1 70  ? -8.967  4.896   11.839  1.00 19.44  ? 362  ARG A N     1 
ATOM   528  C  CA    . ARG A 1 70  ? -8.188  3.657   11.857  1.00 21.56  ? 362  ARG A CA    1 
ATOM   529  C  C     . ARG A 1 70  ? -7.118  3.727   12.929  1.00 23.47  ? 362  ARG A C     1 
ATOM   530  O  O     . ARG A 1 70  ? -6.807  2.723   13.581  1.00 24.59  ? 362  ARG A O     1 
ATOM   531  C  CB    . ARG A 1 70  ? -7.522  3.421   10.511  1.00 20.85  ? 362  ARG A CB    1 
ATOM   532  C  CG    . ARG A 1 70  ? -6.761  2.108   10.444  1.00 22.51  ? 362  ARG A CG    1 
ATOM   533  C  CD    . ARG A 1 70  ? -5.899  2.072   9.212   1.00 24.28  ? 362  ARG A CD    1 
ATOM   534  N  NE    . ARG A 1 70  ? -4.748  2.963   9.319   1.00 22.42  ? 362  ARG A NE    1 
ATOM   535  C  CZ    . ARG A 1 70  ? -4.029  3.368   8.279   1.00 26.37  ? 362  ARG A CZ    1 
ATOM   536  N  NH1   . ARG A 1 70  ? -4.344  2.957   7.055   1.00 23.67  ? 362  ARG A NH1   1 
ATOM   537  N  NH2   . ARG A 1 70  ? -2.984  4.169   8.460   1.00 22.77  ? 362  ARG A NH2   1 
ATOM   538  N  N     . GLU A 1 71  ? -6.570  4.926   13.106  1.00 22.23  ? 363  GLU A N     1 
ATOM   539  C  CA    . GLU A 1 71  ? -5.484  5.187   14.046  1.00 24.99  ? 363  GLU A CA    1 
ATOM   540  C  C     . GLU A 1 71  ? -6.027  5.432   15.455  1.00 30.05  ? 363  GLU A C     1 
ATOM   541  O  O     . GLU A 1 71  ? -5.269  5.769   16.372  1.00 32.09  ? 363  GLU A O     1 
ATOM   542  C  CB    . GLU A 1 71  ? -4.656  6.396   13.586  1.00 25.09  ? 363  GLU A CB    1 
ATOM   543  C  CG    . GLU A 1 71  ? -3.955  6.191   12.222  1.00 24.11  ? 363  GLU A CG    1 
ATOM   544  C  CD    . GLU A 1 71  ? -2.983  5.031   12.239  1.00 31.58  ? 363  GLU A CD    1 
ATOM   545  O  OE1   . GLU A 1 71  ? -2.193  4.945   13.199  1.00 26.75  ? 363  GLU A OE1   1 
ATOM   546  O  OE2   . GLU A 1 71  ? -3.005  4.196   11.308  1.00 31.76  ? 363  GLU A OE2   1 
ATOM   547  N  N     . GLY A 1 72  ? -7.340  5.283   15.615  1.00 27.11  ? 364  GLY A N     1 
ATOM   548  C  CA    . GLY A 1 72  ? -7.982  5.415   16.912  1.00 28.86  ? 364  GLY A CA    1 
ATOM   549  C  C     . GLY A 1 72  ? -8.215  6.845   17.338  1.00 32.98  ? 364  GLY A C     1 
ATOM   550  O  O     . GLY A 1 72  ? -8.351  7.142   18.525  1.00 30.11  ? 364  GLY A O     1 
ATOM   551  N  N     . LEU A 1 73  ? -8.281  7.740   16.362  1.00 24.50  ? 365  LEU A N     1 
ATOM   552  C  CA    . LEU A 1 73  ? -8.468  9.150   16.643  1.00 27.38  ? 365  LEU A CA    1 
ATOM   553  C  C     . LEU A 1 73  ? -9.792  9.630   16.056  1.00 34.01  ? 365  LEU A C     1 
ATOM   554  O  O     . LEU A 1 73  ? -10.088 9.376   14.893  1.00 28.14  ? 365  LEU A O     1 
ATOM   555  C  CB    . LEU A 1 73  ? -7.310  9.945   16.042  1.00 32.04  ? 365  LEU A CB    1 
ATOM   556  C  CG    . LEU A 1 73  ? -7.302  11.449  16.271  1.00 36.95  ? 365  LEU A CG    1 
ATOM   557  C  CD1   . LEU A 1 73  ? -7.289  11.762  17.762  1.00 39.30  ? 365  LEU A CD1   1 
ATOM   558  C  CD2   . LEU A 1 73  ? -6.095  12.060  15.582  1.00 46.95  ? 365  LEU A CD2   1 
ATOM   559  N  N     . GLY A 1 74  ? -10.593 10.308  16.867  1.00 32.35  ? 366  GLY A N     1 
ATOM   560  C  CA    . GLY A 1 74  ? -11.805 10.930  16.370  1.00 38.84  ? 366  GLY A CA    1 
ATOM   561  C  C     . GLY A 1 74  ? -11.493 12.311  15.823  1.00 40.60  ? 366  GLY A C     1 
ATOM   562  O  O     . GLY A 1 74  ? -11.459 13.286  16.569  1.00 39.89  ? 366  GLY A O     1 
ATOM   563  N  N     . LEU A 1 75  ? -11.244 12.393  14.520  1.00 25.49  ? 367  LEU A N     1 
ATOM   564  C  CA    . LEU A 1 75  ? -10.947 13.662  13.874  1.00 23.22  ? 367  LEU A CA    1 
ATOM   565  C  C     . LEU A 1 75  ? -12.039 13.917  12.847  1.00 28.62  ? 367  LEU A C     1 
ATOM   566  O  O     . LEU A 1 75  ? -11.980 13.395  11.743  1.00 30.78  ? 367  LEU A O     1 
ATOM   567  C  CB    . LEU A 1 75  ? -9.587  13.591  13.180  1.00 26.00  ? 367  LEU A CB    1 
ATOM   568  C  CG    . LEU A 1 75  ? -9.106  14.828  12.435  1.00 27.64  ? 367  LEU A CG    1 
ATOM   569  C  CD1   . LEU A 1 75  ? -8.722  15.919  13.432  1.00 34.71  ? 367  LEU A CD1   1 
ATOM   570  C  CD2   . LEU A 1 75  ? -7.912  14.471  11.561  1.00 28.88  ? 367  LEU A CD2   1 
ATOM   571  N  N     . PRO A 1 76  ? -13.061 14.701  13.218  1.00 30.77  ? 368  PRO A N     1 
ATOM   572  C  CA    . PRO A 1 76  ? -14.206 14.848  12.305  1.00 29.35  ? 368  PRO A CA    1 
ATOM   573  C  C     . PRO A 1 76  ? -13.861 15.646  11.056  1.00 30.57  ? 368  PRO A C     1 
ATOM   574  O  O     . PRO A 1 76  ? -13.054 16.578  11.128  1.00 29.62  ? 368  PRO A O     1 
ATOM   575  C  CB    . PRO A 1 76  ? -15.227 15.614  13.150  1.00 31.74  ? 368  PRO A CB    1 
ATOM   576  C  CG    . PRO A 1 76  ? -14.407 16.348  14.158  1.00 33.97  ? 368  PRO A CG    1 
ATOM   577  C  CD    . PRO A 1 76  ? -13.230 15.470  14.463  1.00 30.30  ? 368  PRO A CD    1 
ATOM   578  N  N     . PRO A 1 77  ? -14.461 15.291  9.913   1.00 24.37  ? 369  PRO A N     1 
ATOM   579  C  CA    . PRO A 1 77  ? -14.246 16.112  8.724   1.00 20.80  ? 369  PRO A CA    1 
ATOM   580  C  C     . PRO A 1 77  ? -15.052 17.393  8.853   1.00 26.12  ? 369  PRO A C     1 
ATOM   581  O  O     . PRO A 1 77  ? -16.158 17.374  9.388   1.00 27.58  ? 369  PRO A O     1 
ATOM   582  C  CB    . PRO A 1 77  ? -14.782 15.232  7.574   1.00 20.11  ? 369  PRO A CB    1 
ATOM   583  C  CG    . PRO A 1 77  ? -15.771 14.336  8.218   1.00 25.56  ? 369  PRO A CG    1 
ATOM   584  C  CD    . PRO A 1 77  ? -15.352 14.140  9.656   1.00 23.93  ? 369  PRO A CD    1 
ATOM   585  N  N     . GLY A 1 78  ? -14.478 18.504  8.414   1.00 25.59  ? 370  GLY A N     1 
ATOM   586  C  CA    . GLY A 1 78  ? -15.192 19.770  8.430   1.00 29.47  ? 370  GLY A CA    1 
ATOM   587  C  C     . GLY A 1 78  ? -15.389 20.259  7.009   1.00 27.35  ? 370  GLY A C     1 
ATOM   588  O  O     . GLY A 1 78  ? -15.779 19.488  6.124   1.00 24.62  ? 370  GLY A O     1 
ATOM   589  N  N     . ASP A 1 79  ? -15.115 21.537  6.771   1.00 25.88  ? 371  ASP A N     1 
ATOM   590  C  CA    . ASP A 1 79  ? -15.254 22.079  5.422   1.00 23.10  ? 371  ASP A CA    1 
ATOM   591  C  C     . ASP A 1 79  ? -14.417 21.320  4.399   1.00 25.17  ? 371  ASP A C     1 
ATOM   592  O  O     . ASP A 1 79  ? -13.300 20.906  4.682   1.00 25.51  ? 371  ASP A O     1 
ATOM   593  C  CB    . ASP A 1 79  ? -14.891 23.568  5.388   1.00 23.66  ? 371  ASP A CB    1 
ATOM   594  C  CG    . ASP A 1 79  ? -15.911 24.430  6.113   1.00 31.00  ? 371  ASP A CG    1 
ATOM   595  O  OD1   . ASP A 1 79  ? -17.119 24.260  5.855   1.00 30.41  ? 371  ASP A OD1   1 
ATOM   596  O  OD2   . ASP A 1 79  ? -15.511 25.262  6.958   1.00 31.07  ? 371  ASP A OD2   1 
ATOM   597  N  N     . ASP A 1 80  ? -14.976 21.145  3.208   1.00 22.12  ? 372  ASP A N     1 
ATOM   598  C  CA    . ASP A 1 80  ? -14.292 20.468  2.115   1.00 18.40  ? 372  ASP A CA    1 
ATOM   599  C  C     . ASP A 1 80  ? -14.768 21.163  0.855   1.00 17.73  ? 372  ASP A C     1 
ATOM   600  O  O     . ASP A 1 80  ? -15.959 21.123  0.522   1.00 21.57  ? 372  ASP A O     1 
ATOM   601  C  CB    . ASP A 1 80  ? -14.656 18.963  2.088   1.00 22.19  ? 372  ASP A CB    1 
ATOM   602  C  CG    . ASP A 1 80  ? -13.904 18.176  0.998   1.00 26.59  ? 372  ASP A CG    1 
ATOM   603  O  OD1   . ASP A 1 80  ? -13.290 18.806  0.104   1.00 23.66  ? 372  ASP A OD1   1 
ATOM   604  O  OD2   . ASP A 1 80  ? -13.935 16.907  1.017   1.00 22.10  ? 372  ASP A OD2   1 
ATOM   605  N  N     . PRO A 1 81  ? -13.840 21.804  0.138   1.00 25.14  ? 373  PRO A N     1 
ATOM   606  C  CA    . PRO A 1 81  ? -14.168 22.486  -1.117  1.00 27.22  ? 373  PRO A CA    1 
ATOM   607  C  C     . PRO A 1 81  ? -14.752 21.539  -2.157  1.00 21.59  ? 373  PRO A C     1 
ATOM   608  O  O     . PRO A 1 81  ? -15.489 22.006  -3.019  1.00 22.03  ? 373  PRO A O     1 
ATOM   609  C  CB    . PRO A 1 81  ? -12.807 23.008  -1.600  1.00 24.90  ? 373  PRO A CB    1 
ATOM   610  C  CG    . PRO A 1 81  ? -11.981 23.122  -0.371  1.00 31.15  ? 373  PRO A CG    1 
ATOM   611  C  CD    . PRO A 1 81  ? -12.425 21.984  0.517   1.00 24.72  ? 373  PRO A CD    1 
ATOM   612  N  N     . MET A 1 82  ? -14.413 20.247  -2.107  1.00 19.63  ? 374  MET A N     1 
ATOM   613  C  CA    . MET A 1 82  ? -15.055 19.301  -3.017  1.00 19.81  ? 374  MET A CA    1 
ATOM   614  C  C     . MET A 1 82  ? -16.575 19.325  -2.869  1.00 20.53  ? 374  MET A C     1 
ATOM   615  O  O     . MET A 1 82  ? -17.280 19.223  -3.860  1.00 20.93  ? 374  MET A O     1 
ATOM   616  C  CB    . MET A 1 82  ? -14.565 17.852  -2.790  1.00 19.91  ? 374  MET A CB    1 
ATOM   617  C  CG    . MET A 1 82  ? -13.159 17.580  -3.235  1.00 29.66  ? 374  MET A CG    1 
ATOM   618  S  SD    . MET A 1 82  ? -12.914 17.936  -4.985  1.00 37.29  ? 374  MET A SD    1 
ATOM   619  C  CE    . MET A 1 82  ? -14.350 17.191  -5.708  1.00 22.56  ? 374  MET A CE    1 
ATOM   620  N  N     . LEU A 1 83  ? -17.072 19.420  -1.634  1.00 18.66  ? 375  LEU A N     1 
ATOM   621  C  CA    . LEU A 1 83  ? -18.512 19.413  -1.385  1.00 17.69  ? 375  LEU A CA    1 
ATOM   622  C  C     . LEU A 1 83  ? -19.137 20.703  -1.910  1.00 22.78  ? 375  LEU A C     1 
ATOM   623  O  O     . LEU A 1 83  ? -20.235 20.692  -2.477  1.00 21.49  ? 375  LEU A O     1 
ATOM   624  C  CB    . LEU A 1 83  ? -18.823 19.272  0.098   1.00 19.61  ? 375  LEU A CB    1 
ATOM   625  C  CG    . LEU A 1 83  ? -18.365 17.950  0.738   1.00 23.40  ? 375  LEU A CG    1 
ATOM   626  C  CD1   . LEU A 1 83  ? -18.763 17.907  2.205   1.00 23.16  ? 375  LEU A CD1   1 
ATOM   627  C  CD2   . LEU A 1 83  ? -18.903 16.747  -0.020  1.00 26.22  ? 375  LEU A CD2   1 
ATOM   628  N  N     . LEU A 1 84  ? -18.438 21.815  -1.698  1.00 19.00  ? 376  LEU A N     1 
ATOM   629  C  CA    . LEU A 1 84  ? -18.882 23.087  -2.270  1.00 19.63  ? 376  LEU A CA    1 
ATOM   630  C  C     . LEU A 1 84  ? -18.974 23.029  -3.793  1.00 22.64  ? 376  LEU A C     1 
ATOM   631  O  O     . LEU A 1 84  ? -19.971 23.465  -4.399  1.00 20.58  ? 376  LEU A O     1 
ATOM   632  C  CB    . LEU A 1 84  ? -17.931 24.222  -1.862  1.00 21.25  ? 376  LEU A CB    1 
ATOM   633  C  CG    . LEU A 1 84  ? -17.814 24.516  -0.375  1.00 27.52  ? 376  LEU A CG    1 
ATOM   634  C  CD1   . LEU A 1 84  ? -16.902 25.728  -0.181  1.00 26.76  ? 376  LEU A CD1   1 
ATOM   635  C  CD2   . LEU A 1 84  ? -19.182 24.768  0.234   1.00 29.11  ? 376  LEU A CD2   1 
ATOM   636  N  N     . ALA A 1 85  ? -17.927 22.503  -4.417  1.00 21.18  ? 377  ALA A N     1 
ATOM   637  C  CA    . ALA A 1 85  ? -17.883 22.411  -5.876  1.00 23.43  ? 377  ALA A CA    1 
ATOM   638  C  C     . ALA A 1 85  ? -18.992 21.515  -6.425  1.00 22.78  ? 377  ALA A C     1 
ATOM   639  O  O     . ALA A 1 85  ? -19.600 21.808  -7.459  1.00 21.77  ? 377  ALA A O     1 
ATOM   640  C  CB    . ALA A 1 85  ? -16.534 21.902  -6.322  1.00 20.93  ? 377  ALA A CB    1 
ATOM   641  N  N     . TYR A 1 86  ? -19.247 20.409  -5.734  1.00 18.89  ? 378  TYR A N     1 
ATOM   642  C  CA    . TYR A 1 86  ? -20.256 19.463  -6.192  1.00 19.54  ? 378  TYR A CA    1 
ATOM   643  C  C     . TYR A 1 86  ? -21.659 20.070  -6.117  1.00 18.08  ? 378  TYR A C     1 
ATOM   644  O  O     . TYR A 1 86  ? -22.510 19.767  -6.952  1.00 21.31  ? 378  TYR A O     1 
ATOM   645  C  CB    . TYR A 1 86  ? -20.175 18.202  -5.340  1.00 20.29  ? 378  TYR A CB    1 
ATOM   646  C  CG    . TYR A 1 86  ? -21.087 17.065  -5.764  1.00 19.17  ? 378  TYR A CG    1 
ATOM   647  C  CD1   . TYR A 1 86  ? -20.886 16.398  -6.959  1.00 17.13  ? 378  TYR A CD1   1 
ATOM   648  C  CD2   . TYR A 1 86  ? -22.125 16.646  -4.936  1.00 18.64  ? 378  TYR A CD2   1 
ATOM   649  C  CE1   . TYR A 1 86  ? -21.711 15.341  -7.338  1.00 19.47  ? 378  TYR A CE1   1 
ATOM   650  C  CE2   . TYR A 1 86  ? -22.961 15.593  -5.302  1.00 22.95  ? 378  TYR A CE2   1 
ATOM   651  C  CZ    . TYR A 1 86  ? -22.747 14.946  -6.505  1.00 24.48  ? 378  TYR A CZ    1 
ATOM   652  O  OH    . TYR A 1 86  ? -23.568 13.895  -6.859  1.00 21.66  ? 378  TYR A OH    1 
ATOM   653  N  N     . LEU A 1 87  ? -21.895 20.916  -5.112  1.00 21.01  ? 379  LEU A N     1 
ATOM   654  C  CA    . LEU A 1 87  ? -23.176 21.613  -4.980  1.00 16.97  ? 379  LEU A CA    1 
ATOM   655  C  C     . LEU A 1 87  ? -23.340 22.660  -6.067  1.00 19.10  ? 379  LEU A C     1 
ATOM   656  O  O     . LEU A 1 87  ? -24.416 22.810  -6.633  1.00 23.25  ? 379  LEU A O     1 
ATOM   657  C  CB    . LEU A 1 87  ? -23.327 22.247  -3.594  1.00 18.89  ? 379  LEU A CB    1 
ATOM   658  C  CG    . LEU A 1 87  ? -23.659 21.225  -2.497  1.00 20.73  ? 379  LEU A CG    1 
ATOM   659  C  CD1   . LEU A 1 87  ? -23.537 21.861  -1.127  1.00 24.30  ? 379  LEU A CD1   1 
ATOM   660  C  CD2   . LEU A 1 87  ? -25.070 20.639  -2.692  1.00 25.33  ? 379  LEU A CD2   1 
ATOM   661  N  N     . LEU A 1 88  ? -22.258 23.360  -6.374  1.00 21.14  ? 380  LEU A N     1 
ATOM   662  C  CA    . LEU A 1 88  ? -22.291 24.352  -7.456  1.00 23.33  ? 380  LEU A CA    1 
ATOM   663  C  C     . LEU A 1 88  ? -22.630 23.702  -8.789  1.00 31.95  ? 380  LEU A C     1 
ATOM   664  O  O     . LEU A 1 88  ? -23.371 24.273  -9.606  1.00 26.83  ? 380  LEU A O     1 
ATOM   665  C  CB    . LEU A 1 88  ? -20.964 25.091  -7.564  1.00 25.16  ? 380  LEU A CB    1 
ATOM   666  C  CG    . LEU A 1 88  ? -20.764 26.259  -6.601  1.00 30.99  ? 380  LEU A CG    1 
ATOM   667  C  CD1   . LEU A 1 88  ? -19.291 26.610  -6.521  1.00 30.57  ? 380  LEU A CD1   1 
ATOM   668  C  CD2   . LEU A 1 88  ? -21.588 27.480  -7.050  1.00 29.70  ? 380  LEU A CD2   1 
ATOM   669  N  N     . ASP A 1 89  ? -22.097 22.501  -9.002  1.00 25.36  ? 381  ASP A N     1 
ATOM   670  C  CA    . ASP A 1 89  ? -22.311 21.770  -10.243 1.00 22.59  ? 381  ASP A CA    1 
ATOM   671  C  C     . ASP A 1 89  ? -21.855 20.329  -10.032 1.00 23.78  ? 381  ASP A C     1 
ATOM   672  O  O     . ASP A 1 89  ? -20.679 20.092  -9.789  1.00 24.24  ? 381  ASP A O     1 
ATOM   673  C  CB    . ASP A 1 89  ? -21.491 22.419  -11.363 1.00 24.01  ? 381  ASP A CB    1 
ATOM   674  C  CG    . ASP A 1 89  ? -21.732 21.792  -12.727 1.00 29.37  ? 381  ASP A CG    1 
ATOM   675  O  OD1   . ASP A 1 89  ? -22.266 20.652  -12.814 1.00 25.14  ? 381  ASP A OD1   1 
ATOM   676  O  OD2   . ASP A 1 89  ? -21.357 22.450  -13.732 1.00 30.54  ? 381  ASP A OD2   1 
ATOM   677  N  N     . PRO A 1 90  ? -22.783 19.364  -10.115 1.00 20.82  ? 382  PRO A N     1 
ATOM   678  C  CA    . PRO A 1 90  ? -22.400 17.977  -9.813  1.00 19.90  ? 382  PRO A CA    1 
ATOM   679  C  C     . PRO A 1 90  ? -21.491 17.325  -10.857 1.00 26.71  ? 382  PRO A C     1 
ATOM   680  O  O     . PRO A 1 90  ? -21.081 16.182  -10.678 1.00 23.50  ? 382  PRO A O     1 
ATOM   681  C  CB    . PRO A 1 90  ? -23.742 17.250  -9.714  1.00 22.81  ? 382  PRO A CB    1 
ATOM   682  C  CG    . PRO A 1 90  ? -24.694 18.101  -10.542 1.00 28.68  ? 382  PRO A CG    1 
ATOM   683  C  CD    . PRO A 1 90  ? -24.242 19.512  -10.258 1.00 21.75  ? 382  PRO A CD    1 
ATOM   684  N  N     . SER A 1 91  ? -21.157 18.042  -11.922 1.00 23.56  ? 383  SER A N     1 
ATOM   685  C  CA    . SER A 1 91  ? -20.101 17.568  -12.804 1.00 26.22  ? 383  SER A CA    1 
ATOM   686  C  C     . SER A 1 91  ? -18.715 17.756  -12.162 1.00 28.57  ? 383  SER A C     1 
ATOM   687  O  O     . SER A 1 91  ? -17.719 17.249  -12.670 1.00 28.15  ? 383  SER A O     1 
ATOM   688  C  CB    . SER A 1 91  ? -20.175 18.262  -14.171 1.00 29.28  ? 383  SER A CB    1 
ATOM   689  O  OG    . SER A 1 91  ? -19.875 19.639  -14.059 1.00 38.84  ? 383  SER A OG    1 
ATOM   690  N  N     . ASN A 1 92  ? -18.653 18.493  -11.052 1.00 23.55  ? 384  ASN A N     1 
ATOM   691  C  CA    . ASN A 1 92  ? -17.417 18.627  -10.273 1.00 19.97  ? 384  ASN A CA    1 
ATOM   692  C  C     . ASN A 1 92  ? -17.240 17.429  -9.336  1.00 24.90  ? 384  ASN A C     1 
ATOM   693  O  O     . ASN A 1 92  ? -17.920 17.355  -8.309  1.00 25.82  ? 384  ASN A O     1 
ATOM   694  C  CB    . ASN A 1 92  ? -17.467 19.909  -9.429  1.00 21.98  ? 384  ASN A CB    1 
ATOM   695  C  CG    . ASN A 1 92  ? -17.364 21.179  -10.281 1.00 25.99  ? 384  ASN A CG    1 
ATOM   696  O  OD1   . ASN A 1 92  ? -16.658 21.191  -11.278 1.00 29.28  ? 384  ASN A OD1   1 
ATOM   697  N  ND2   . ASN A 1 92  ? -18.071 22.246  -9.884  1.00 23.80  ? 384  ASN A ND2   1 
ATOM   698  N  N     . THR A 1 93  ? -16.339 16.503  -9.675  1.00 23.61  ? 385  THR A N     1 
ATOM   699  C  CA    . THR A 1 93  ? -16.273 15.229  -8.942  1.00 22.26  ? 385  THR A CA    1 
ATOM   700  C  C     . THR A 1 93  ? -14.898 14.856  -8.396  1.00 26.81  ? 385  THR A C     1 
ATOM   701  O  O     . THR A 1 93  ? -14.794 13.971  -7.542  1.00 26.88  ? 385  THR A O     1 
ATOM   702  C  CB    . THR A 1 93  ? -16.811 14.068  -9.797  1.00 30.25  ? 385  THR A CB    1 
ATOM   703  O  OG1   . THR A 1 93  ? -16.021 13.931  -10.988 1.00 27.12  ? 385  THR A OG1   1 
ATOM   704  C  CG2   . THR A 1 93  ? -18.275 14.323  -10.176 1.00 27.57  ? 385  THR A CG2   1 
ATOM   705  N  N     . THR A 1 94  ? -13.843 15.504  -8.888  1.00 23.45  ? 386  THR A N     1 
ATOM   706  C  CA    . THR A 1 94  ? -12.485 15.184  -8.450  1.00 25.12  ? 386  THR A CA    1 
ATOM   707  C  C     . THR A 1 94  ? -11.710 16.458  -8.115  1.00 26.82  ? 386  THR A C     1 
ATOM   708  O  O     . THR A 1 94  ? -11.957 17.501  -8.709  1.00 28.41  ? 386  THR A O     1 
ATOM   709  C  CB    . THR A 1 94  ? -11.696 14.436  -9.542  1.00 32.04  ? 386  THR A CB    1 
ATOM   710  O  OG1   . THR A 1 94  ? -11.518 15.295  -10.680 1.00 29.62  ? 386  THR A OG1   1 
ATOM   711  C  CG2   . THR A 1 94  ? -12.422 13.153  -9.970  1.00 34.03  ? 386  THR A CG2   1 
ATOM   712  N  N     . PRO A 1 95  ? -10.759 16.373  -7.172  1.00 30.12  ? 387  PRO A N     1 
ATOM   713  C  CA    . PRO A 1 95  ? -9.934  17.552  -6.867  1.00 29.45  ? 387  PRO A CA    1 
ATOM   714  C  C     . PRO A 1 95  ? -9.175  18.039  -8.101  1.00 26.41  ? 387  PRO A C     1 
ATOM   715  O  O     . PRO A 1 95  ? -9.051  19.249  -8.294  1.00 25.88  ? 387  PRO A O     1 
ATOM   716  C  CB    . PRO A 1 95  ? -8.966  17.036  -5.797  1.00 34.05  ? 387  PRO A CB    1 
ATOM   717  C  CG    . PRO A 1 95  ? -9.709  15.896  -5.145  1.00 34.73  ? 387  PRO A CG    1 
ATOM   718  C  CD    . PRO A 1 95  ? -10.469 15.242  -6.270  1.00 32.83  ? 387  PRO A CD    1 
ATOM   719  N  N     . GLU A 1 96  ? -8.718  17.106  -8.931  1.00 29.77  ? 388  GLU A N     1 
ATOM   720  C  CA    . GLU A 1 96  ? -8.038  17.429  -10.182 1.00 38.01  ? 388  GLU A CA    1 
ATOM   721  C  C     . GLU A 1 96  ? -8.917  18.311  -11.057 1.00 30.66  ? 388  GLU A C     1 
ATOM   722  O  O     . GLU A 1 96  ? -8.485  19.371  -11.525 1.00 34.53  ? 388  GLU A O     1 
ATOM   723  C  CB    . GLU A 1 96  ? -7.688  16.151  -10.953 1.00 46.73  ? 388  GLU A CB    1 
ATOM   724  C  CG    . GLU A 1 96  ? -6.614  15.285  -10.311 1.00 58.98  ? 388  GLU A CG    1 
ATOM   725  C  CD    . GLU A 1 96  ? -7.169  14.169  -9.427  1.00 61.77  ? 388  GLU A CD    1 
ATOM   726  O  OE1   . GLU A 1 96  ? -8.259  14.334  -8.830  1.00 45.67  ? 388  GLU A OE1   1 
ATOM   727  O  OE2   . GLU A 1 96  ? -6.499  13.118  -9.328  1.00 64.76  ? 388  GLU A OE2   1 
ATOM   728  N  N     . GLY A 1 97  ? -10.147 17.858  -11.278 1.00 30.38  ? 389  GLY A N     1 
ATOM   729  C  CA    . GLY A 1 97  ? -11.094 18.564  -12.125 1.00 32.36  ? 389  GLY A CA    1 
ATOM   730  C  C     . GLY A 1 97  ? -11.514 19.903  -11.549 1.00 31.10  ? 389  GLY A C     1 
ATOM   731  O  O     . GLY A 1 97  ? -11.656 20.882  -12.283 1.00 33.70  ? 389  GLY A O     1 
ATOM   732  N  N     . VAL A 1 98  ? -11.709 19.949  -10.233 1.00 23.37  ? 390  VAL A N     1 
ATOM   733  C  CA    . VAL A 1 98  ? -12.096 21.182  -9.558  1.00 28.79  ? 390  VAL A CA    1 
ATOM   734  C  C     . VAL A 1 98  ? -10.977 22.228  -9.622  1.00 34.45  ? 390  VAL A C     1 
ATOM   735  O  O     . VAL A 1 98  ? -11.235 23.408  -9.889  1.00 28.06  ? 390  VAL A O     1 
ATOM   736  C  CB    . VAL A 1 98  ? -12.522 20.908  -8.094  1.00 22.39  ? 390  VAL A CB    1 
ATOM   737  C  CG1   . VAL A 1 98  ? -12.706 22.197  -7.317  1.00 23.42  ? 390  VAL A CG1   1 
ATOM   738  C  CG2   . VAL A 1 98  ? -13.829 20.095  -8.085  1.00 25.11  ? 390  VAL A CG2   1 
ATOM   739  N  N     . ALA A 1 99  ? -9.739  21.799  -9.381  1.00 29.16  ? 391  ALA A N     1 
ATOM   740  C  CA    . ALA A 1 99  ? -8.597  22.713  -9.505  1.00 30.62  ? 391  ALA A CA    1 
ATOM   741  C  C     . ALA A 1 99  ? -8.458  23.225  -10.933 1.00 34.52  ? 391  ALA A C     1 
ATOM   742  O  O     . ALA A 1 99  ? -8.224  24.417  -11.162 1.00 35.06  ? 391  ALA A O     1 
ATOM   743  C  CB    . ALA A 1 99  ? -7.312  22.032  -9.062  1.00 33.59  ? 391  ALA A CB    1 
ATOM   744  N  N     . ARG A 1 100 ? -8.609  22.324  -11.895 1.00 33.70  ? 392  ARG A N     1 
ATOM   745  C  CA    . ARG A 1 100 ? -8.500  22.691  -13.301 1.00 34.89  ? 392  ARG A CA    1 
ATOM   746  C  C     . ARG A 1 100 ? -9.552  23.727  -13.685 1.00 36.44  ? 392  ARG A C     1 
ATOM   747  O  O     . ARG A 1 100 ? -9.252  24.697  -14.379 1.00 40.37  ? 392  ARG A O     1 
ATOM   748  C  CB    . ARG A 1 100 ? -8.618  21.448  -14.177 1.00 46.68  ? 392  ARG A CB    1 
ATOM   749  C  CG    . ARG A 1 100 ? -8.378  21.689  -15.650 1.00 61.77  ? 392  ARG A CG    1 
ATOM   750  C  CD    . ARG A 1 100 ? -7.593  20.535  -16.261 1.00 70.40  ? 392  ARG A CD    1 
ATOM   751  N  NE    . ARG A 1 100 ? -7.987  19.244  -15.702 1.00 75.05  ? 392  ARG A NE    1 
ATOM   752  C  CZ    . ARG A 1 100 ? -7.136  18.361  -15.188 1.00 76.27  ? 392  ARG A CZ    1 
ATOM   753  N  NH1   . ARG A 1 100 ? -5.835  18.624  -15.164 1.00 71.69  ? 392  ARG A NH1   1 
ATOM   754  N  NH2   . ARG A 1 100 ? -7.584  17.211  -14.702 1.00 80.06  ? 392  ARG A NH2   1 
ATOM   755  N  N     . ARG A 1 101 ? -10.776 23.532  -13.206 1.00 36.67  ? 393  ARG A N     1 
ATOM   756  C  CA    . ARG A 1 101 ? -11.883 24.436  -13.509 1.00 33.43  ? 393  ARG A CA    1 
ATOM   757  C  C     . ARG A 1 101 ? -11.832 25.797  -12.800 1.00 38.89  ? 393  ARG A C     1 
ATOM   758  O  O     . ARG A 1 101 ? -12.143 26.834  -13.399 1.00 38.10  ? 393  ARG A O     1 
ATOM   759  C  CB    . ARG A 1 101 ? -13.226 23.744  -13.219 1.00 29.38  ? 393  ARG A CB    1 
ATOM   760  C  CG    . ARG A 1 101 ? -14.434 24.657  -13.394 1.00 31.28  ? 393  ARG A CG    1 
ATOM   761  C  CD    . ARG A 1 101 ? -15.740 23.867  -13.499 1.00 33.45  ? 393  ARG A CD    1 
ATOM   762  N  NE    . ARG A 1 101 ? -16.864 24.761  -13.753 1.00 40.34  ? 393  ARG A NE    1 
ATOM   763  C  CZ    . ARG A 1 101 ? -18.143 24.391  -13.769 1.00 42.06  ? 393  ARG A CZ    1 
ATOM   764  N  NH1   . ARG A 1 101 ? -18.488 23.129  -13.534 1.00 39.38  ? 393  ARG A NH1   1 
ATOM   765  N  NH2   . ARG A 1 101 ? -19.080 25.296  -14.009 1.00 41.78  ? 393  ARG A NH2   1 
ATOM   766  N  N     . TYR A 1 102 ? -11.457 25.804  -11.526 1.00 32.51  ? 394  TYR A N     1 
ATOM   767  C  CA    . TYR A 1 102 ? -11.610 27.006  -10.717 1.00 30.81  ? 394  TYR A CA    1 
ATOM   768  C  C     . TYR A 1 102 ? -10.305 27.713  -10.382 1.00 35.73  ? 394  TYR A C     1 
ATOM   769  O  O     . TYR A 1 102 ? -10.317 28.842  -9.902  1.00 39.78  ? 394  TYR A O     1 
ATOM   770  C  CB    . TYR A 1 102 ? -12.380 26.697  -9.433  1.00 26.24  ? 394  TYR A CB    1 
ATOM   771  C  CG    . TYR A 1 102 ? -13.810 26.271  -9.680  1.00 30.05  ? 394  TYR A CG    1 
ATOM   772  C  CD1   . TYR A 1 102 ? -14.801 27.210  -9.942  1.00 25.32  ? 394  TYR A CD1   1 
ATOM   773  C  CD2   . TYR A 1 102 ? -14.169 24.925  -9.655  1.00 26.52  ? 394  TYR A CD2   1 
ATOM   774  C  CE1   . TYR A 1 102 ? -16.112 26.829  -10.170 1.00 30.41  ? 394  TYR A CE1   1 
ATOM   775  C  CE2   . TYR A 1 102 ? -15.477 24.531  -9.878  1.00 26.29  ? 394  TYR A CE2   1 
ATOM   776  C  CZ    . TYR A 1 102 ? -16.449 25.485  -10.132 1.00 26.34  ? 394  TYR A CZ    1 
ATOM   777  O  OH    . TYR A 1 102 ? -17.756 25.098  -10.358 1.00 26.35  ? 394  TYR A OH    1 
ATOM   778  N  N     . GLY A 1 103 ? -9.182  27.053  -10.636 1.00 34.15  ? 395  GLY A N     1 
ATOM   779  C  CA    . GLY A 1 103 ? -7.895  27.654  -10.353 1.00 35.31  ? 395  GLY A CA    1 
ATOM   780  C  C     . GLY A 1 103 ? -7.017  26.813  -9.451  1.00 37.96  ? 395  GLY A C     1 
ATOM   781  O  O     . GLY A 1 103 ? -7.488  26.188  -8.498  1.00 44.08  ? 395  GLY A O     1 
ATOM   782  N  N     . GLY A 1 104 ? -5.726  26.799  -9.758  1.00 39.97  ? 396  GLY A N     1 
ATOM   783  C  CA    . GLY A 1 104 ? -4.768  26.047  -8.974  1.00 34.03  ? 396  GLY A CA    1 
ATOM   784  C  C     . GLY A 1 104 ? -4.434  24.730  -9.631  1.00 35.37  ? 396  GLY A C     1 
ATOM   785  O  O     . GLY A 1 104 ? -4.856  24.443  -10.755 1.00 37.76  ? 396  GLY A O     1 
ATOM   786  N  N     . GLU A 1 105 ? -3.657  23.921  -8.922  1.00 35.35  ? 397  GLU A N     1 
ATOM   787  C  CA    . GLU A 1 105 ? -3.233  22.645  -9.448  1.00 37.44  ? 397  GLU A CA    1 
ATOM   788  C  C     . GLU A 1 105 ? -3.182  21.628  -8.319  1.00 32.46  ? 397  GLU A C     1 
ATOM   789  O  O     . GLU A 1 105 ? -2.637  21.898  -7.245  1.00 32.92  ? 397  GLU A O     1 
ATOM   790  C  CB    . GLU A 1 105 ? -1.861  22.758  -10.116 1.00 37.29  ? 397  GLU A CB    1 
ATOM   791  C  CG    . GLU A 1 105 ? -1.485  21.530  -10.932 1.00 39.24  ? 397  GLU A CG    1 
ATOM   792  C  CD    . GLU A 1 105 ? -0.022  21.519  -11.339 1.00 51.58  ? 397  GLU A CD    1 
ATOM   793  O  OE1   . GLU A 1 105 ? 0.695   22.495  -11.032 1.00 53.80  ? 397  GLU A OE1   1 
ATOM   794  O  OE2   . GLU A 1 105 ? 0.410   20.528  -11.965 1.00 64.55  ? 397  GLU A OE2   1 
ATOM   795  N  N     . TRP A 1 106 ? -3.785  20.474  -8.569  1.00 33.32  ? 398  TRP A N     1 
ATOM   796  C  CA    . TRP A 1 106 ? -3.746  19.350  -7.641  1.00 34.28  ? 398  TRP A CA    1 
ATOM   797  C  C     . TRP A 1 106 ? -2.431  18.608  -7.856  1.00 32.58  ? 398  TRP A C     1 
ATOM   798  O  O     . TRP A 1 106 ? -2.239  17.943  -8.867  1.00 35.94  ? 398  TRP A O     1 
ATOM   799  C  CB    . TRP A 1 106 ? -4.951  18.438  -7.896  1.00 30.68  ? 398  TRP A CB    1 
ATOM   800  C  CG    . TRP A 1 106 ? -5.032  17.199  -7.047  1.00 30.03  ? 398  TRP A CG    1 
ATOM   801  C  CD1   . TRP A 1 106 ? -4.858  15.914  -7.466  1.00 32.03  ? 398  TRP A CD1   1 
ATOM   802  C  CD2   . TRP A 1 106 ? -5.324  17.128  -5.641  1.00 29.53  ? 398  TRP A CD2   1 
ATOM   803  N  NE1   . TRP A 1 106 ? -5.026  15.042  -6.410  1.00 32.73  ? 398  TRP A NE1   1 
ATOM   804  C  CE2   . TRP A 1 106 ? -5.312  15.761  -5.281  1.00 31.58  ? 398  TRP A CE2   1 
ATOM   805  C  CE3   . TRP A 1 106 ? -5.603  18.082  -4.658  1.00 28.62  ? 398  TRP A CE3   1 
ATOM   806  C  CZ2   . TRP A 1 106 ? -5.555  15.329  -3.975  1.00 27.31  ? 398  TRP A CZ2   1 
ATOM   807  C  CZ3   . TRP A 1 106 ? -5.841  17.654  -3.361  1.00 28.93  ? 398  TRP A CZ3   1 
ATOM   808  C  CH2   . TRP A 1 106 ? -5.817  16.284  -3.032  1.00 26.32  ? 398  TRP A CH2   1 
ATOM   809  N  N     . THR A 1 107 ? -1.515  18.750  -6.907  1.00 30.67  ? 399  THR A N     1 
ATOM   810  C  CA    . THR A 1 107 ? -0.203  18.129  -7.011  1.00 31.03  ? 399  THR A CA    1 
ATOM   811  C  C     . THR A 1 107 ? -0.076  16.969  -6.023  1.00 34.84  ? 399  THR A C     1 
ATOM   812  O  O     . THR A 1 107 ? -1.064  16.565  -5.412  1.00 33.42  ? 399  THR A O     1 
ATOM   813  C  CB    . THR A 1 107 ? 0.904   19.150  -6.722  1.00 32.08  ? 399  THR A CB    1 
ATOM   814  O  OG1   . THR A 1 107 ? 0.816   19.565  -5.354  1.00 33.99  ? 399  THR A OG1   1 
ATOM   815  C  CG2   . THR A 1 107 ? 0.751   20.380  -7.625  1.00 30.93  ? 399  THR A CG2   1 
ATOM   816  N  N     . GLU A 1 108 ? 1.138   16.438  -5.872  1.00 30.02  ? 400  GLU A N     1 
ATOM   817  C  CA    . GLU A 1 108 ? 1.379   15.327  -4.947  1.00 29.44  ? 400  GLU A CA    1 
ATOM   818  C  C     . GLU A 1 108 ? 2.130   15.750  -3.684  1.00 28.73  ? 400  GLU A C     1 
ATOM   819  O  O     . GLU A 1 108 ? 2.768   14.920  -3.038  1.00 35.39  ? 400  GLU A O     1 
ATOM   820  C  CB    . GLU A 1 108 ? 2.144   14.195  -5.645  1.00 33.81  ? 400  GLU A CB    1 
ATOM   821  C  CG    . GLU A 1 108 ? 1.500   13.694  -6.923  1.00 43.87  ? 400  GLU A CG    1 
ATOM   822  C  CD    . GLU A 1 108 ? 0.225   12.917  -6.664  1.00 50.06  ? 400  GLU A CD    1 
ATOM   823  O  OE1   . GLU A 1 108 ? 0.321   11.796  -6.119  1.00 49.35  ? 400  GLU A OE1   1 
ATOM   824  O  OE2   . GLU A 1 108 ? -0.871  13.426  -7.002  1.00 51.65  ? 400  GLU A OE2   1 
ATOM   825  N  N     . GLU A 1 109 ? 2.063   17.034  -3.337  1.00 26.46  ? 401  GLU A N     1 
ATOM   826  C  CA    . GLU A 1 109 ? 2.734   17.543  -2.142  1.00 27.31  ? 401  GLU A CA    1 
ATOM   827  C  C     . GLU A 1 109 ? 1.711   18.048  -1.137  1.00 31.23  ? 401  GLU A C     1 
ATOM   828  O  O     . GLU A 1 109 ? 0.806   18.805  -1.497  1.00 29.13  ? 401  GLU A O     1 
ATOM   829  C  CB    . GLU A 1 109 ? 3.721   18.664  -2.507  1.00 31.28  ? 401  GLU A CB    1 
ATOM   830  C  CG    . GLU A 1 109 ? 4.833   18.888  -1.476  1.00 43.48  ? 401  GLU A CG    1 
ATOM   831  C  CD    . GLU A 1 109 ? 4.444   19.854  -0.360  1.00 46.47  ? 401  GLU A CD    1 
ATOM   832  O  OE1   . GLU A 1 109 ? 4.001   20.981  -0.674  1.00 42.38  ? 401  GLU A OE1   1 
ATOM   833  O  OE2   . GLU A 1 109 ? 4.592   19.492  0.834   1.00 44.62  ? 401  GLU A OE2   1 
ATOM   834  N  N     . ALA A 1 110 ? 1.860   17.633  0.122   1.00 23.69  ? 402  ALA A N     1 
ATOM   835  C  CA    . ALA A 1 110 ? 0.887   17.957  1.152   1.00 22.42  ? 402  ALA A CA    1 
ATOM   836  C  C     . ALA A 1 110 ? 0.749   19.465  1.377   1.00 22.35  ? 402  ALA A C     1 
ATOM   837  O  O     . ALA A 1 110 ? -0.356  19.964  1.565   1.00 22.64  ? 402  ALA A O     1 
ATOM   838  C  CB    . ALA A 1 110 ? 1.229   17.245  2.457   1.00 24.92  ? 402  ALA A CB    1 
ATOM   839  N  N     . GLY A 1 111 ? 1.867   20.188  1.363   1.00 24.93  ? 403  GLY A N     1 
ATOM   840  C  CA    . GLY A 1 111 ? 1.821   21.620  1.615   1.00 26.72  ? 403  GLY A CA    1 
ATOM   841  C  C     . GLY A 1 111 ? 1.043   22.333  0.526   1.00 29.62  ? 403  GLY A C     1 
ATOM   842  O  O     . GLY A 1 111 ? 0.213   23.200  0.810   1.00 29.64  ? 403  GLY A O     1 
ATOM   843  N  N     . GLU A 1 112 ? 1.310   21.964  -0.721  1.00 26.24  ? 404  GLU A N     1 
ATOM   844  C  CA    . GLU A 1 112 ? 0.601   22.523  -1.875  1.00 25.06  ? 404  GLU A CA    1 
ATOM   845  C  C     . GLU A 1 112 ? -0.898  22.176  -1.878  1.00 32.03  ? 404  GLU A C     1 
ATOM   846  O  O     . GLU A 1 112 ? -1.742  22.997  -2.256  1.00 28.10  ? 404  GLU A O     1 
ATOM   847  C  CB    . GLU A 1 112 ? 1.266   22.082  -3.181  1.00 33.33  ? 404  GLU A CB    1 
ATOM   848  C  CG    . GLU A 1 112 ? 2.610   22.761  -3.427  1.00 37.27  ? 404  GLU A CG    1 
ATOM   849  C  CD    . GLU A 1 112 ? 3.366   22.198  -4.620  1.00 43.14  ? 404  GLU A CD    1 
ATOM   850  O  OE1   . GLU A 1 112 ? 2.948   21.161  -5.174  1.00 35.93  ? 404  GLU A OE1   1 
ATOM   851  O  OE2   . GLU A 1 112 ? 4.398   22.794  -5.001  1.00 50.32  ? 404  GLU A OE2   1 
ATOM   852  N  N     . ARG A 1 113 ? -1.230  20.958  -1.458  1.00 25.18  ? 405  ARG A N     1 
ATOM   853  C  CA    . ARG A 1 113 ? -2.634  20.592  -1.283  1.00 22.06  ? 405  ARG A CA    1 
ATOM   854  C  C     . ARG A 1 113 ? -3.326  21.388  -0.178  1.00 24.50  ? 405  ARG A C     1 
ATOM   855  O  O     . ARG A 1 113 ? -4.500  21.724  -0.309  1.00 25.52  ? 405  ARG A O     1 
ATOM   856  C  CB    . ARG A 1 113 ? -2.798  19.081  -1.037  1.00 22.22  ? 405  ARG A CB    1 
ATOM   857  C  CG    . ARG A 1 113 ? -2.432  18.235  -2.240  1.00 23.78  ? 405  ARG A CG    1 
ATOM   858  C  CD    . ARG A 1 113 ? -2.481  16.740  -1.894  1.00 20.97  ? 405  ARG A CD    1 
ATOM   859  N  NE    . ARG A 1 113 ? -2.273  15.928  -3.087  1.00 23.52  ? 405  ARG A NE    1 
ATOM   860  C  CZ    . ARG A 1 113 ? -2.398  14.606  -3.122  1.00 25.04  ? 405  ARG A CZ    1 
ATOM   861  N  NH1   . ARG A 1 113 ? -2.731  13.927  -2.019  1.00 21.55  ? 405  ARG A NH1   1 
ATOM   862  N  NH2   . ARG A 1 113 ? -2.204  13.964  -4.266  1.00 24.50  ? 405  ARG A NH2   1 
ATOM   863  N  N     . ALA A 1 114 ? -2.615  21.695  0.906   1.00 23.81  ? 406  ALA A N     1 
ATOM   864  C  CA    . ALA A 1 114 ? -3.214  22.476  1.987   1.00 20.04  ? 406  ALA A CA    1 
ATOM   865  C  C     . ALA A 1 114 ? -3.520  23.894  1.505   1.00 25.73  ? 406  ALA A C     1 
ATOM   866  O  O     . ALA A 1 114 ? -4.599  24.436  1.780   1.00 25.62  ? 406  ALA A O     1 
ATOM   867  C  CB    . ALA A 1 114 ? -2.302  22.525  3.211   1.00 23.28  ? 406  ALA A CB    1 
ATOM   868  N  N     . ALA A 1 115 ? -2.556  24.472  0.790   1.00 27.49  ? 407  ALA A N     1 
ATOM   869  C  CA    . ALA A 1 115 ? -2.688  25.822  0.226   1.00 30.51  ? 407  ALA A CA    1 
ATOM   870  C  C     . ALA A 1 115 ? -3.832  25.899  -0.786  1.00 31.14  ? 407  ALA A C     1 
ATOM   871  O  O     . ALA A 1 115 ? -4.621  26.857  -0.784  1.00 27.52  ? 407  ALA A O     1 
ATOM   872  C  CB    . ALA A 1 115 ? -1.372  26.246  -0.425  1.00 29.42  ? 407  ALA A CB    1 
ATOM   873  N  N     . LEU A 1 116 ? -3.908  24.894  -1.654  1.00 26.31  ? 408  LEU A N     1 
ATOM   874  C  CA    . LEU A 1 116 ? -4.988  24.777  -2.636  1.00 28.08  ? 408  LEU A CA    1 
ATOM   875  C  C     . LEU A 1 116 ? -6.367  24.668  -1.976  1.00 31.82  ? 408  LEU A C     1 
ATOM   876  O  O     . LEU A 1 116 ? -7.324  25.304  -2.421  1.00 26.61  ? 408  LEU A O     1 
ATOM   877  C  CB    . LEU A 1 116 ? -4.748  23.574  -3.553  1.00 27.89  ? 408  LEU A CB    1 
ATOM   878  C  CG    . LEU A 1 116 ? -5.813  23.279  -4.607  1.00 28.44  ? 408  LEU A CG    1 
ATOM   879  C  CD1   . LEU A 1 116 ? -5.882  24.435  -5.611  1.00 29.36  ? 408  LEU A CD1   1 
ATOM   880  C  CD2   . LEU A 1 116 ? -5.535  21.962  -5.313  1.00 29.90  ? 408  LEU A CD2   1 
ATOM   881  N  N     . SER A 1 117 ? -6.469  23.854  -0.928  1.00 29.55  ? 409  SER A N     1 
ATOM   882  C  CA    . SER A 1 117 ? -7.708  23.746  -0.156  1.00 27.16  ? 409  SER A CA    1 
ATOM   883  C  C     . SER A 1 117 ? -8.185  25.096  0.338   1.00 26.93  ? 409  SER A C     1 
ATOM   884  O  O     . SER A 1 117 ? -9.354  25.442  0.180   1.00 25.97  ? 409  SER A O     1 
ATOM   885  C  CB    . SER A 1 117 ? -7.532  22.815  1.041   1.00 22.17  ? 409  SER A CB    1 
ATOM   886  O  OG    . SER A 1 117 ? -7.316  21.480  0.589   1.00 23.38  ? 409  SER A OG    1 
ATOM   887  N  N     . GLU A 1 118 ? -7.273  25.850  0.944   1.00 29.41  ? 410  GLU A N     1 
ATOM   888  C  CA    . GLU A 1 118 ? -7.604  27.185  1.451   1.00 28.80  ? 410  GLU A CA    1 
ATOM   889  C  C     . GLU A 1 118 ? -8.091  28.092  0.320   1.00 32.51  ? 410  GLU A C     1 
ATOM   890  O  O     . GLU A 1 118 ? -9.104  28.780  0.452   1.00 28.91  ? 410  GLU A O     1 
ATOM   891  C  CB    . GLU A 1 118 ? -6.387  27.811  2.143   1.00 29.06  ? 410  GLU A CB    1 
ATOM   892  C  CG    . GLU A 1 118 ? -6.638  29.236  2.642   1.00 32.54  ? 410  GLU A CG    1 
ATOM   893  C  CD    . GLU A 1 118 ? -5.475  29.792  3.458   1.00 41.07  ? 410  GLU A CD    1 
ATOM   894  O  OE1   . GLU A 1 118 ? -4.307  29.527  3.097   1.00 37.07  ? 410  GLU A OE1   1 
ATOM   895  O  OE2   . GLU A 1 118 ? -5.735  30.490  4.462   1.00 45.46  ? 410  GLU A OE2   1 
ATOM   896  N  N     . ARG A 1 119 ? -7.379  28.062  -0.796  1.00 26.50  ? 411  ARG A N     1 
ATOM   897  C  CA    . ARG A 1 119 ? -7.671  28.926  -1.934  1.00 32.69  ? 411  ARG A CA    1 
ATOM   898  C  C     . ARG A 1 119 ? -9.002  28.559  -2.590  1.00 37.85  ? 411  ARG A C     1 
ATOM   899  O  O     . ARG A 1 119 ? -9.801  29.432  -2.947  1.00 30.77  ? 411  ARG A O     1 
ATOM   900  C  CB    . ARG A 1 119 ? -6.536  28.841  -2.955  1.00 33.49  ? 411  ARG A CB    1 
ATOM   901  C  CG    . ARG A 1 119 ? -6.820  29.520  -4.280  1.00 56.24  ? 411  ARG A CG    1 
ATOM   902  C  CD    . ARG A 1 119 ? -5.564  30.181  -4.825  1.00 79.80  ? 411  ARG A CD    1 
ATOM   903  N  NE    . ARG A 1 119 ? -5.150  31.314  -3.998  1.00 98.40  ? 411  ARG A NE    1 
ATOM   904  C  CZ    . ARG A 1 119 ? -5.501  32.576  -4.230  1.00 109.21 ? 411  ARG A CZ    1 
ATOM   905  N  NH1   . ARG A 1 119 ? -6.269  32.875  -5.270  1.00 112.62 ? 411  ARG A NH1   1 
ATOM   906  N  NH2   . ARG A 1 119 ? -5.082  33.542  -3.424  1.00 111.12 ? 411  ARG A NH2   1 
ATOM   907  N  N     . LEU A 1 120 ? -9.239  27.259  -2.740  1.00 31.92  ? 412  LEU A N     1 
ATOM   908  C  CA    . LEU A 1 120 ? -10.489 26.786  -3.318  1.00 27.50  ? 412  LEU A CA    1 
ATOM   909  C  C     . LEU A 1 120 ? -11.677 27.030  -2.408  1.00 23.76  ? 412  LEU A C     1 
ATOM   910  O  O     . LEU A 1 120 ? -12.759 27.325  -2.892  1.00 26.77  ? 412  LEU A O     1 
ATOM   911  C  CB    . LEU A 1 120 ? -10.400 25.296  -3.681  1.00 31.03  ? 412  LEU A CB    1 
ATOM   912  C  CG    . LEU A 1 120 ? -9.612  24.969  -4.950  1.00 30.71  ? 412  LEU A CG    1 
ATOM   913  C  CD1   . LEU A 1 120 ? -9.435  23.463  -5.101  1.00 30.09  ? 412  LEU A CD1   1 
ATOM   914  C  CD2   . LEU A 1 120 ? -10.293 25.555  -6.188  1.00 35.06  ? 412  LEU A CD2   1 
ATOM   915  N  N     . PHE A 1 121 ? -11.500 26.900  -1.095  1.00 23.29  ? 413  PHE A N     1 
ATOM   916  C  CA    . PHE A 1 121 ? -12.608 27.160  -0.191  1.00 23.43  ? 413  PHE A CA    1 
ATOM   917  C  C     . PHE A 1 121 ? -13.062 28.612  -0.364  1.00 28.60  ? 413  PHE A C     1 
ATOM   918  O  O     . PHE A 1 121 ? -14.252 28.886  -0.490  1.00 27.45  ? 413  PHE A O     1 
ATOM   919  C  CB    . PHE A 1 121 ? -12.252 26.887  1.271   1.00 26.92  ? 413  PHE A CB    1 
ATOM   920  C  CG    . PHE A 1 121 ? -13.400 27.132  2.228   1.00 29.18  ? 413  PHE A CG    1 
ATOM   921  C  CD1   . PHE A 1 121 ? -14.338 26.140  2.477   1.00 31.09  ? 413  PHE A CD1   1 
ATOM   922  C  CD2   . PHE A 1 121 ? -13.558 28.365  2.856   1.00 37.28  ? 413  PHE A CD2   1 
ATOM   923  C  CE1   . PHE A 1 121 ? -15.405 26.355  3.345   1.00 34.13  ? 413  PHE A CE1   1 
ATOM   924  C  CE2   . PHE A 1 121 ? -14.623 28.587  3.724   1.00 40.78  ? 413  PHE A CE2   1 
ATOM   925  C  CZ    . PHE A 1 121 ? -15.554 27.579  3.963   1.00 30.16  ? 413  PHE A CZ    1 
ATOM   926  N  N     . ALA A 1 122 ? -12.107 29.530  -0.386  1.00 30.29  ? 414  ALA A N     1 
ATOM   927  C  CA    . ALA A 1 122 ? -12.452 30.945  -0.494  1.00 29.59  ? 414  ALA A CA    1 
ATOM   928  C  C     . ALA A 1 122 ? -13.165 31.224  -1.811  1.00 32.01  ? 414  ALA A C     1 
ATOM   929  O  O     . ALA A 1 122 ? -14.184 31.918  -1.834  1.00 32.01  ? 414  ALA A O     1 
ATOM   930  C  CB    . ALA A 1 122 ? -11.202 31.822  -0.342  1.00 28.16  ? 414  ALA A CB    1 
ATOM   931  N  N     . ASN A 1 123 ? -12.628 30.675  -2.900  1.00 25.00  ? 415  ASN A N     1 
ATOM   932  C  CA    . ASN A 1 123 ? -13.195 30.851  -4.231  1.00 29.69  ? 415  ASN A CA    1 
ATOM   933  C  C     . ASN A 1 123 ? -14.636 30.330  -4.286  1.00 31.25  ? 415  ASN A C     1 
ATOM   934  O  O     . ASN A 1 123 ? -15.576 31.057  -4.635  1.00 27.56  ? 415  ASN A O     1 
ATOM   935  C  CB    . ASN A 1 123 ? -12.302 30.133  -5.254  1.00 31.33  ? 415  ASN A CB    1 
ATOM   936  C  CG    . ASN A 1 123 ? -12.738 30.350  -6.693  1.00 37.78  ? 415  ASN A CG    1 
ATOM   937  O  OD1   . ASN A 1 123 ? -13.899 30.630  -6.977  1.00 42.79  ? 415  ASN A OD1   1 
ATOM   938  N  ND2   . ASN A 1 123 ? -11.799 30.191  -7.617  1.00 46.76  ? 415  ASN A ND2   1 
ATOM   939  N  N     . LEU A 1 124 ? -14.810 29.060  -3.928  1.00 24.87  ? 416  LEU A N     1 
ATOM   940  C  CA    . LEU A 1 124 ? -16.118 28.421  -4.034  1.00 25.67  ? 416  LEU A CA    1 
ATOM   941  C  C     . LEU A 1 124 ? -17.131 28.968  -3.032  1.00 25.24  ? 416  LEU A C     1 
ATOM   942  O  O     . LEU A 1 124 ? -18.320 29.104  -3.351  1.00 24.51  ? 416  LEU A O     1 
ATOM   943  C  CB    . LEU A 1 124 ? -15.966 26.897  -3.891  1.00 19.02  ? 416  LEU A CB    1 
ATOM   944  C  CG    . LEU A 1 124 ? -15.089 26.291  -4.988  1.00 29.96  ? 416  LEU A CG    1 
ATOM   945  C  CD1   . LEU A 1 124 ? -14.842 24.804  -4.742  1.00 28.90  ? 416  LEU A CD1   1 
ATOM   946  C  CD2   . LEU A 1 124 ? -15.735 26.495  -6.356  1.00 33.34  ? 416  LEU A CD2   1 
ATOM   947  N  N     . TRP A 1 125 ? -16.681 29.286  -1.824  1.00 26.62  ? 417  TRP A N     1 
ATOM   948  C  CA    . TRP A 1 125 ? -17.581 29.869  -0.833  1.00 26.68  ? 417  TRP A CA    1 
ATOM   949  C  C     . TRP A 1 125 ? -18.148 31.184  -1.380  1.00 29.02  ? 417  TRP A C     1 
ATOM   950  O  O     . TRP A 1 125 ? -19.342 31.469  -1.232  1.00 30.74  ? 417  TRP A O     1 
ATOM   951  C  CB    . TRP A 1 125 ? -16.861 30.129  0.494   1.00 29.87  ? 417  TRP A CB    1 
ATOM   952  C  CG    . TRP A 1 125 ? -17.791 30.500  1.603   1.00 29.48  ? 417  TRP A CG    1 
ATOM   953  C  CD1   . TRP A 1 125 ? -17.976 31.747  2.147   1.00 30.35  ? 417  TRP A CD1   1 
ATOM   954  C  CD2   . TRP A 1 125 ? -18.685 29.625  2.294   1.00 31.77  ? 417  TRP A CD2   1 
ATOM   955  N  NE1   . TRP A 1 125 ? -18.926 31.692  3.137   1.00 32.53  ? 417  TRP A NE1   1 
ATOM   956  C  CE2   . TRP A 1 125 ? -19.377 30.400  3.248   1.00 33.41  ? 417  TRP A CE2   1 
ATOM   957  C  CE3   . TRP A 1 125 ? -18.967 28.254  2.202   1.00 28.85  ? 417  TRP A CE3   1 
ATOM   958  C  CZ2   . TRP A 1 125 ? -20.330 29.853  4.104   1.00 28.28  ? 417  TRP A CZ2   1 
ATOM   959  C  CZ3   . TRP A 1 125 ? -19.913 27.712  3.053   1.00 27.61  ? 417  TRP A CZ3   1 
ATOM   960  C  CH2   . TRP A 1 125 ? -20.583 28.508  3.994   1.00 30.51  ? 417  TRP A CH2   1 
ATOM   961  N  N     . GLY A 1 126 ? -17.280 31.956  -2.023  1.00 30.27  ? 418  GLY A N     1 
ATOM   962  C  CA    . GLY A 1 126 ? -17.683 33.204  -2.658  1.00 32.89  ? 418  GLY A CA    1 
ATOM   963  C  C     . GLY A 1 126 ? -18.698 32.988  -3.766  1.00 32.41  ? 418  GLY A C     1 
ATOM   964  O  O     . GLY A 1 126 ? -19.670 33.739  -3.887  1.00 30.13  ? 418  GLY A O     1 
ATOM   965  N  N     . ARG A 1 127 ? -18.490 31.947  -4.570  1.00 28.99  ? 419  ARG A N     1 
ATOM   966  C  CA    . ARG A 1 127 ? -19.404 31.647  -5.667  1.00 27.90  ? 419  ARG A CA    1 
ATOM   967  C  C     . ARG A 1 127 ? -20.783 31.229  -5.154  1.00 35.14  ? 419  ARG A C     1 
ATOM   968  O  O     . ARG A 1 127 ? -21.782 31.361  -5.863  1.00 31.23  ? 419  ARG A O     1 
ATOM   969  C  CB    . ARG A 1 127 ? -18.825 30.580  -6.597  1.00 30.30  ? 419  ARG A CB    1 
ATOM   970  C  CG    . ARG A 1 127 ? -17.683 31.076  -7.458  1.00 27.75  ? 419  ARG A CG    1 
ATOM   971  C  CD    . ARG A 1 127 ? -17.017 29.940  -8.213  1.00 28.11  ? 419  ARG A CD    1 
ATOM   972  N  NE    . ARG A 1 127 ? -15.878 30.397  -8.999  1.00 35.42  ? 419  ARG A NE    1 
ATOM   973  C  CZ    . ARG A 1 127 ? -15.951 30.761  -10.274 1.00 40.13  ? 419  ARG A CZ    1 
ATOM   974  N  NH1   . ARG A 1 127 ? -17.117 30.729  -10.905 1.00 39.90  ? 419  ARG A NH1   1 
ATOM   975  N  NH2   . ARG A 1 127 ? -14.860 31.158  -10.918 1.00 38.69  ? 419  ARG A NH2   1 
ATOM   976  N  N     . LEU A 1 128 ? -20.838 30.746  -3.914  1.00 27.58  ? 420  LEU A N     1 
ATOM   977  C  CA    . LEU A 1 128 ? -22.098 30.297  -3.328  1.00 28.97  ? 420  LEU A CA    1 
ATOM   978  C  C     . LEU A 1 128 ? -22.852 31.380  -2.555  1.00 29.81  ? 420  LEU A C     1 
ATOM   979  O  O     . LEU A 1 128 ? -23.945 31.131  -2.064  1.00 29.17  ? 420  LEU A O     1 
ATOM   980  C  CB    . LEU A 1 128 ? -21.867 29.078  -2.421  1.00 30.53  ? 420  LEU A CB    1 
ATOM   981  C  CG    . LEU A 1 128 ? -21.686 27.742  -3.136  1.00 28.88  ? 420  LEU A CG    1 
ATOM   982  C  CD1   . LEU A 1 128 ? -21.090 26.734  -2.168  1.00 27.42  ? 420  LEU A CD1   1 
ATOM   983  C  CD2   . LEU A 1 128 ? -23.016 27.249  -3.639  1.00 24.27  ? 420  LEU A CD2   1 
ATOM   984  N  N     . GLU A 1 129 ? -22.276 32.576  -2.448  1.00 31.46  ? 421  GLU A N     1 
ATOM   985  C  CA    . GLU A 1 129 ? -22.937 33.663  -1.724  1.00 34.66  ? 421  GLU A CA    1 
ATOM   986  C  C     . GLU A 1 129 ? -24.360 33.895  -2.219  1.00 33.33  ? 421  GLU A C     1 
ATOM   987  O  O     . GLU A 1 129 ? -24.595 34.015  -3.415  1.00 31.18  ? 421  GLU A O     1 
ATOM   988  C  CB    . GLU A 1 129 ? -22.127 34.962  -1.825  1.00 42.09  ? 421  GLU A CB    1 
ATOM   989  C  CG    . GLU A 1 129 ? -20.857 34.959  -0.982  1.00 64.64  ? 421  GLU A CG    1 
ATOM   990  C  CD    . GLU A 1 129 ? -20.130 36.292  -1.011  1.00 77.75  ? 421  GLU A CD    1 
ATOM   991  O  OE1   . GLU A 1 129 ? -20.700 37.273  -1.537  1.00 79.87  ? 421  GLU A OE1   1 
ATOM   992  O  OE2   . GLU A 1 129 ? -18.987 36.354  -0.508  1.00 80.84  ? 421  GLU A OE2   1 
ATOM   993  N  N     . GLY A 1 130 ? -25.309 33.920  -1.291  1.00 34.16  ? 422  GLY A N     1 
ATOM   994  C  CA    . GLY A 1 130 ? -26.696 34.153  -1.639  1.00 33.01  ? 422  GLY A CA    1 
ATOM   995  C  C     . GLY A 1 130 ? -27.446 32.913  -2.089  1.00 35.29  ? 422  GLY A C     1 
ATOM   996  O  O     . GLY A 1 130 ? -28.652 32.954  -2.294  1.00 30.65  ? 422  GLY A O     1 
ATOM   997  N  N     . GLU A 1 131 ? -26.743 31.794  -2.249  1.00 28.66  ? 423  GLU A N     1 
ATOM   998  C  CA    . GLU A 1 131 ? -27.416 30.573  -2.676  1.00 29.93  ? 423  GLU A CA    1 
ATOM   999  C  C     . GLU A 1 131 ? -27.881 29.829  -1.447  1.00 33.89  ? 423  GLU A C     1 
ATOM   1000 O  O     . GLU A 1 131 ? -27.304 28.809  -1.081  1.00 26.92  ? 423  GLU A O     1 
ATOM   1001 C  CB    . GLU A 1 131 ? -26.465 29.691  -3.490  1.00 31.62  ? 423  GLU A CB    1 
ATOM   1002 C  CG    . GLU A 1 131 ? -26.018 30.292  -4.820  1.00 31.88  ? 423  GLU A CG    1 
ATOM   1003 C  CD    . GLU A 1 131 ? -27.085 30.190  -5.897  1.00 35.56  ? 423  GLU A CD    1 
ATOM   1004 O  OE1   . GLU A 1 131 ? -28.205 29.718  -5.595  1.00 37.92  ? 423  GLU A OE1   1 
ATOM   1005 O  OE2   . GLU A 1 131 ? -26.802 30.578  -7.050  1.00 49.59  ? 423  GLU A OE2   1 
ATOM   1006 N  N     . GLU A 1 132 ? -28.923 30.327  -0.795  1.00 29.59  ? 424  GLU A N     1 
ATOM   1007 C  CA    . GLU A 1 132 ? -29.281 29.784  0.514   1.00 28.78  ? 424  GLU A CA    1 
ATOM   1008 C  C     . GLU A 1 132 ? -29.720 28.308  0.528   1.00 25.19  ? 424  GLU A C     1 
ATOM   1009 O  O     . GLU A 1 132 ? -29.483 27.603  1.512   1.00 25.97  ? 424  GLU A O     1 
ATOM   1010 C  CB    . GLU A 1 132 ? -30.292 30.687  1.228   1.00 36.20  ? 424  GLU A CB    1 
ATOM   1011 C  CG    . GLU A 1 132 ? -29.725 32.087  1.534   1.00 39.45  ? 424  GLU A CG    1 
ATOM   1012 C  CD    . GLU A 1 132 ? -28.415 32.059  2.349   1.00 51.07  ? 424  GLU A CD    1 
ATOM   1013 O  OE1   . GLU A 1 132 ? -28.231 31.143  3.191   1.00 47.27  ? 424  GLU A OE1   1 
ATOM   1014 O  OE2   . GLU A 1 132 ? -27.563 32.960  2.147   1.00 45.88  ? 424  GLU A OE2   1 
ATOM   1015 N  N     . ARG A 1 133 ? -30.339 27.841  -0.551  1.00 22.09  ? 425  ARG A N     1 
ATOM   1016 C  CA    . ARG A 1 133 ? -30.779 26.447  -0.598  1.00 20.42  ? 425  ARG A CA    1 
ATOM   1017 C  C     . ARG A 1 133 ? -29.600 25.493  -0.770  1.00 20.98  ? 425  ARG A C     1 
ATOM   1018 O  O     . ARG A 1 133 ? -29.572 24.450  -0.137  1.00 23.53  ? 425  ARG A O     1 
ATOM   1019 C  CB    . ARG A 1 133 ? -31.830 26.226  -1.684  1.00 23.68  ? 425  ARG A CB    1 
ATOM   1020 C  CG    . ARG A 1 133 ? -33.187 26.817  -1.285  1.00 36.49  ? 425  ARG A CG    1 
ATOM   1021 C  CD    . ARG A 1 133 ? -34.047 27.210  -2.478  1.00 41.37  ? 425  ARG A CD    1 
ATOM   1022 N  NE    . ARG A 1 133 ? -34.442 26.105  -3.352  1.00 49.44  ? 425  ARG A NE    1 
ATOM   1023 C  CZ    . ARG A 1 133 ? -35.324 25.161  -3.030  1.00 49.28  ? 425  ARG A CZ    1 
ATOM   1024 N  NH1   . ARG A 1 133 ? -35.888 25.148  -1.830  1.00 65.61  ? 425  ARG A NH1   1 
ATOM   1025 N  NH2   . ARG A 1 133 ? -35.634 24.218  -3.907  1.00 45.27  ? 425  ARG A NH2   1 
ATOM   1026 N  N     . LEU A 1 134 ? -28.635 25.856  -1.611  1.00 22.84  ? 426  LEU A N     1 
ATOM   1027 C  CA    . LEU A 1 134 ? -27.404 25.064  -1.723  1.00 21.77  ? 426  LEU A CA    1 
ATOM   1028 C  C     . LEU A 1 134 ? -26.598 25.119  -0.424  1.00 24.33  ? 426  LEU A C     1 
ATOM   1029 O  O     . LEU A 1 134 ? -25.957 24.145  -0.042  1.00 22.08  ? 426  LEU A O     1 
ATOM   1030 C  CB    . LEU A 1 134 ? -26.544 25.538  -2.895  1.00 20.08  ? 426  LEU A CB    1 
ATOM   1031 C  CG    . LEU A 1 134 ? -27.133 25.370  -4.303  1.00 24.57  ? 426  LEU A CG    1 
ATOM   1032 C  CD1   . LEU A 1 134 ? -26.227 26.010  -5.378  1.00 23.72  ? 426  LEU A CD1   1 
ATOM   1033 C  CD2   . LEU A 1 134 ? -27.370 23.879  -4.581  1.00 24.13  ? 426  LEU A CD2   1 
ATOM   1034 N  N     . LEU A 1 135 ? -26.606 26.267  0.254   1.00 19.44  ? 427  LEU A N     1 
ATOM   1035 C  CA    . LEU A 1 135 ? -25.895 26.364  1.533   1.00 22.51  ? 427  LEU A CA    1 
ATOM   1036 C  C     . LEU A 1 135 ? -26.570 25.549  2.627   1.00 23.16  ? 427  LEU A C     1 
ATOM   1037 O  O     . LEU A 1 135 ? -25.905 25.036  3.531   1.00 22.83  ? 427  LEU A O     1 
ATOM   1038 C  CB    . LEU A 1 135 ? -25.713 27.835  1.974   1.00 21.88  ? 427  LEU A CB    1 
ATOM   1039 C  CG    . LEU A 1 135 ? -24.730 28.633  1.123   1.00 23.30  ? 427  LEU A CG    1 
ATOM   1040 C  CD1   . LEU A 1 135 ? -24.807 30.110  1.465   1.00 26.34  ? 427  LEU A CD1   1 
ATOM   1041 C  CD2   . LEU A 1 135 ? -23.296 28.143  1.285   1.00 26.32  ? 427  LEU A CD2   1 
ATOM   1042 N  N     . TRP A 1 136 ? -27.890 25.432  2.550   1.00 22.52  ? 428  TRP A N     1 
ATOM   1043 C  CA    . TRP A 1 136 ? -28.629 24.590  3.475   1.00 24.08  ? 428  TRP A CA    1 
ATOM   1044 C  C     . TRP A 1 136 ? -28.222 23.140  3.251   1.00 21.95  ? 428  TRP A C     1 
ATOM   1045 O  O     . TRP A 1 136 ? -27.997 22.405  4.197   1.00 23.78  ? 428  TRP A O     1 
ATOM   1046 C  CB    . TRP A 1 136 ? -30.135 24.712  3.249   1.00 22.07  ? 428  TRP A CB    1 
ATOM   1047 C  CG    . TRP A 1 136 ? -30.921 23.944  4.244   1.00 25.20  ? 428  TRP A CG    1 
ATOM   1048 C  CD1   . TRP A 1 136 ? -31.349 24.372  5.465   1.00 31.17  ? 428  TRP A CD1   1 
ATOM   1049 C  CD2   . TRP A 1 136 ? -31.351 22.580  4.121   1.00 24.61  ? 428  TRP A CD2   1 
ATOM   1050 N  NE1   . TRP A 1 136 ? -32.040 23.365  6.103   1.00 32.91  ? 428  TRP A NE1   1 
ATOM   1051 C  CE2   . TRP A 1 136 ? -32.054 22.256  5.298   1.00 33.96  ? 428  TRP A CE2   1 
ATOM   1052 C  CE3   . TRP A 1 136 ? -31.225 21.612  3.118   1.00 25.12  ? 428  TRP A CE3   1 
ATOM   1053 C  CZ2   . TRP A 1 136 ? -32.620 21.002  5.507   1.00 33.31  ? 428  TRP A CZ2   1 
ATOM   1054 C  CZ3   . TRP A 1 136 ? -31.794 20.367  3.324   1.00 28.86  ? 428  TRP A CZ3   1 
ATOM   1055 C  CH2   . TRP A 1 136 ? -32.471 20.071  4.514   1.00 25.63  ? 428  TRP A CH2   1 
ATOM   1056 N  N     . LEU A 1 137 ? -28.181 22.729  1.990   1.00 20.82  ? 429  LEU A N     1 
ATOM   1057 C  CA    . LEU A 1 137 ? -27.726 21.372  1.666   1.00 22.45  ? 429  LEU A CA    1 
ATOM   1058 C  C     . LEU A 1 137 ? -26.311 21.136  2.192   1.00 22.04  ? 429  LEU A C     1 
ATOM   1059 O  O     . LEU A 1 137 ? -26.002 20.068  2.742   1.00 21.80  ? 429  LEU A O     1 
ATOM   1060 C  CB    . LEU A 1 137 ? -27.769 21.142  0.157   1.00 22.75  ? 429  LEU A CB    1 
ATOM   1061 C  CG    . LEU A 1 137 ? -29.139 20.767  -0.398  1.00 20.77  ? 429  LEU A CG    1 
ATOM   1062 C  CD1   . LEU A 1 137 ? -29.107 20.758  -1.920  1.00 24.41  ? 429  LEU A CD1   1 
ATOM   1063 C  CD2   . LEU A 1 137 ? -29.592 19.383  0.139   1.00 21.09  ? 429  LEU A CD2   1 
ATOM   1064 N  N     . TYR A 1 138 ? -25.444 22.129  2.022   1.00 17.70  ? 430  TYR A N     1 
ATOM   1065 C  CA    . TYR A 1 138 ? -24.086 22.027  2.545   1.00 21.11  ? 430  TYR A CA    1 
ATOM   1066 C  C     . TYR A 1 138 ? -24.019 21.828  4.056   1.00 28.32  ? 430  TYR A C     1 
ATOM   1067 O  O     . TYR A 1 138 ? -23.351 20.908  4.531   1.00 21.93  ? 430  TYR A O     1 
ATOM   1068 C  CB    . TYR A 1 138 ? -23.236 23.225  2.133   1.00 20.62  ? 430  TYR A CB    1 
ATOM   1069 C  CG    . TYR A 1 138 ? -21.783 23.144  2.587   1.00 20.42  ? 430  TYR A CG    1 
ATOM   1070 C  CD1   . TYR A 1 138 ? -20.912 22.200  2.043   1.00 22.89  ? 430  TYR A CD1   1 
ATOM   1071 C  CD2   . TYR A 1 138 ? -21.282 24.031  3.541   1.00 21.91  ? 430  TYR A CD2   1 
ATOM   1072 C  CE1   . TYR A 1 138 ? -19.583 22.131  2.444   1.00 22.11  ? 430  TYR A CE1   1 
ATOM   1073 C  CE2   . TYR A 1 138 ? -19.954 23.978  3.948   1.00 21.78  ? 430  TYR A CE2   1 
ATOM   1074 C  CZ    . TYR A 1 138 ? -19.107 23.022  3.390   1.00 22.03  ? 430  TYR A CZ    1 
ATOM   1075 O  OH    . TYR A 1 138 ? -17.781 22.952  3.775   1.00 22.55  ? 430  TYR A OH    1 
ATOM   1076 N  N     . ARG A 1 139 ? -24.697 22.687  4.815   1.00 22.13  ? 431  ARG A N     1 
ATOM   1077 C  CA    . ARG A 1 139 ? -24.570 22.657  6.264   1.00 25.64  ? 431  ARG A CA    1 
ATOM   1078 C  C     . ARG A 1 139 ? -25.399 21.551  6.883   1.00 23.17  ? 431  ARG A C     1 
ATOM   1079 O  O     . ARG A 1 139 ? -25.026 21.001  7.916   1.00 24.09  ? 431  ARG A O     1 
ATOM   1080 C  CB    . ARG A 1 139 ? -24.955 24.016  6.895   1.00 24.12  ? 431  ARG A CB    1 
ATOM   1081 C  CG    . ARG A 1 139 ? -23.977 25.145  6.586   1.00 26.62  ? 431  ARG A CG    1 
ATOM   1082 C  CD    . ARG A 1 139 ? -24.252 26.341  7.499   1.00 29.03  ? 431  ARG A CD    1 
ATOM   1083 N  NE    . ARG A 1 139 ? -23.311 27.438  7.287   1.00 33.87  ? 431  ARG A NE    1 
ATOM   1084 C  CZ    . ARG A 1 139 ? -23.553 28.481  6.499   1.00 35.83  ? 431  ARG A CZ    1 
ATOM   1085 N  NH1   . ARG A 1 139 ? -24.705 28.562  5.844   1.00 32.14  ? 431  ARG A NH1   1 
ATOM   1086 N  NH2   . ARG A 1 139 ? -22.646 29.445  6.366   1.00 36.26  ? 431  ARG A NH2   1 
ATOM   1087 N  N     . GLU A 1 140 ? -26.516 21.197  6.249   1.00 19.50  ? 432  GLU A N     1 
ATOM   1088 C  CA    . GLU A 1 140 ? -27.459 20.285  6.884   1.00 26.12  ? 432  GLU A CA    1 
ATOM   1089 C  C     . GLU A 1 140 ? -27.393 18.868  6.338   1.00 25.30  ? 432  GLU A C     1 
ATOM   1090 O  O     . GLU A 1 140 ? -27.864 17.941  6.983   1.00 23.75  ? 432  GLU A O     1 
ATOM   1091 C  CB    . GLU A 1 140 ? -28.889 20.813  6.767   1.00 27.35  ? 432  GLU A CB    1 
ATOM   1092 C  CG    . GLU A 1 140 ? -29.084 22.156  7.448   1.00 29.17  ? 432  GLU A CG    1 
ATOM   1093 C  CD    . GLU A 1 140 ? -28.772 22.110  8.935   1.00 48.08  ? 432  GLU A CD    1 
ATOM   1094 O  OE1   . GLU A 1 140 ? -29.143 21.115  9.593   1.00 45.20  ? 432  GLU A OE1   1 
ATOM   1095 O  OE2   . GLU A 1 140 ? -28.143 23.068  9.440   1.00 49.49  ? 432  GLU A OE2   1 
ATOM   1096 N  N     . VAL A 1 141 ? -26.830 18.708  5.148   1.00 22.65  ? 433  VAL A N     1 
ATOM   1097 C  CA    . VAL A 1 141 ? -26.746 17.378  4.547   1.00 22.75  ? 433  VAL A CA    1 
ATOM   1098 C  C     . VAL A 1 141 ? -25.306 16.996  4.231   1.00 26.29  ? 433  VAL A C     1 
ATOM   1099 O  O     . VAL A 1 141 ? -24.765 16.109  4.860   1.00 21.81  ? 433  VAL A O     1 
ATOM   1100 C  CB    . VAL A 1 141 ? -27.635 17.252  3.294   1.00 18.39  ? 433  VAL A CB    1 
ATOM   1101 C  CG1   . VAL A 1 141 ? -27.435 15.872  2.615   1.00 21.93  ? 433  VAL A CG1   1 
ATOM   1102 C  CG2   . VAL A 1 141 ? -29.106 17.475  3.652   1.00 23.06  ? 433  VAL A CG2   1 
ATOM   1103 N  N     . GLU A 1 142 ? -24.669 17.680  3.291   1.00 20.20  ? 434  GLU A N     1 
ATOM   1104 C  CA    . GLU A 1 142 ? -23.362 17.217  2.800   1.00 22.86  ? 434  GLU A CA    1 
ATOM   1105 C  C     . GLU A 1 142 ? -22.237 17.190  3.854   1.00 21.85  ? 434  GLU A C     1 
ATOM   1106 O  O     . GLU A 1 142 ? -21.523 16.180  3.998   1.00 20.52  ? 434  GLU A O     1 
ATOM   1107 C  CB    . GLU A 1 142 ? -22.930 18.018  1.566   1.00 29.32  ? 434  GLU A CB    1 
ATOM   1108 C  CG    . GLU A 1 142 ? -23.908 17.948  0.383   1.00 31.88  ? 434  GLU A CG    1 
ATOM   1109 C  CD    . GLU A 1 142 ? -24.081 16.545  -0.223  1.00 47.30  ? 434  GLU A CD    1 
ATOM   1110 O  OE1   . GLU A 1 142 ? -23.449 15.549  0.229   1.00 40.93  ? 434  GLU A OE1   1 
ATOM   1111 O  OE2   . GLU A 1 142 ? -24.870 16.438  -1.179  1.00 52.65  ? 434  GLU A OE2   1 
ATOM   1112 N  N     . ARG A 1 143 ? -22.060 18.289  4.584   1.00 20.10  ? 435  ARG A N     1 
ATOM   1113 C  CA    . ARG A 1 143 ? -20.987 18.320  5.574   1.00 19.23  ? 435  ARG A CA    1 
ATOM   1114 C  C     . ARG A 1 143 ? -21.189 17.311  6.721   1.00 18.33  ? 435  ARG A C     1 
ATOM   1115 O  O     . ARG A 1 143 ? -20.255 16.552  7.052   1.00 22.77  ? 435  ARG A O     1 
ATOM   1116 C  CB    . ARG A 1 143 ? -20.726 19.752  6.107   1.00 21.29  ? 435  ARG A CB    1 
ATOM   1117 C  CG    . ARG A 1 143 ? -19.292 19.968  6.549   1.00 25.59  ? 435  ARG A CG    1 
ATOM   1118 C  CD    . ARG A 1 143 ? -19.033 21.428  6.962   1.00 27.42  ? 435  ARG A CD    1 
ATOM   1119 N  NE    . ARG A 1 143 ? -20.091 21.952  7.818   1.00 31.63  ? 435  ARG A NE    1 
ATOM   1120 C  CZ    . ARG A 1 143 ? -20.221 23.244  8.114   1.00 31.61  ? 435  ARG A CZ    1 
ATOM   1121 N  NH1   . ARG A 1 143 ? -19.346 24.113  7.626   1.00 25.42  ? 435  ARG A NH1   1 
ATOM   1122 N  NH2   . ARG A 1 143 ? -21.215 23.662  8.891   1.00 32.80  ? 435  ARG A NH2   1 
ATOM   1123 N  N     . PRO A 1 144 ? -22.382 17.283  7.345   1.00 22.85  ? 436  PRO A N     1 
ATOM   1124 C  CA    . PRO A 1 144 ? -22.521 16.229  8.358   1.00 22.09  ? 436  PRO A CA    1 
ATOM   1125 C  C     . PRO A 1 144 ? -22.491 14.820  7.768   1.00 18.71  ? 436  PRO A C     1 
ATOM   1126 O  O     . PRO A 1 144 ? -22.024 13.918  8.451   1.00 18.63  ? 436  PRO A O     1 
ATOM   1127 C  CB    . PRO A 1 144 ? -23.887 16.502  9.002   1.00 25.02  ? 436  PRO A CB    1 
ATOM   1128 C  CG    . PRO A 1 144 ? -24.549 17.526  8.146   1.00 27.62  ? 436  PRO A CG    1 
ATOM   1129 C  CD    . PRO A 1 144 ? -23.496 18.255  7.396   1.00 24.99  ? 436  PRO A CD    1 
ATOM   1130 N  N     . LEU A 1 145 ? -22.959 14.641  6.536   1.00 17.37  ? 437  LEU A N     1 
ATOM   1131 C  CA    . LEU A 1 145 ? -22.923 13.301  5.938   1.00 17.52  ? 437  LEU A CA    1 
ATOM   1132 C  C     . LEU A 1 145 ? -21.494 12.810  5.790   1.00 19.32  ? 437  LEU A C     1 
ATOM   1133 O  O     . LEU A 1 145 ? -21.239 11.605  5.878   1.00 18.22  ? 437  LEU A O     1 
ATOM   1134 C  CB    . LEU A 1 145 ? -23.582 13.311  4.569   1.00 14.82  ? 437  LEU A CB    1 
ATOM   1135 C  CG    . LEU A 1 145 ? -23.669 11.964  3.848   1.00 16.51  ? 437  LEU A CG    1 
ATOM   1136 C  CD1   . LEU A 1 145 ? -24.540 10.972  4.600   1.00 18.88  ? 437  LEU A CD1   1 
ATOM   1137 C  CD2   . LEU A 1 145 ? -24.149 12.184  2.405   1.00 18.11  ? 437  LEU A CD2   1 
ATOM   1138 N  N     . SER A 1 146 ? -20.565 13.727  5.529   1.00 19.32  ? 438  SER A N     1 
ATOM   1139 C  CA    . SER A 1 146 ? -19.162 13.322  5.379   1.00 18.76  ? 438  SER A CA    1 
ATOM   1140 C  C     . SER A 1 146 ? -18.659 12.588  6.629   1.00 19.79  ? 438  SER A C     1 
ATOM   1141 O  O     . SER A 1 146 ? -17.881 11.647  6.519   1.00 16.90  ? 438  SER A O     1 
ATOM   1142 C  CB    . SER A 1 146 ? -18.260 14.512  5.011   1.00 21.29  ? 438  SER A CB    1 
ATOM   1143 O  OG    . SER A 1 146 ? -18.161 15.433  6.083   1.00 22.44  ? 438  SER A OG    1 
ATOM   1144 N  N     . ALA A 1 147 ? -19.122 12.988  7.813   1.00 16.91  ? 439  ALA A N     1 
ATOM   1145 C  CA    . ALA A 1 147 ? -18.712 12.306  9.049   1.00 18.61  ? 439  ALA A CA    1 
ATOM   1146 C  C     . ALA A 1 147 ? -19.356 10.924  9.187   1.00 19.98  ? 439  ALA A C     1 
ATOM   1147 O  O     . ALA A 1 147 ? -18.744 9.968   9.701   1.00 18.94  ? 439  ALA A O     1 
ATOM   1148 C  CB    . ALA A 1 147 ? -19.025 13.175  10.271  1.00 19.65  ? 439  ALA A CB    1 
ATOM   1149 N  N     . VAL A 1 148 ? -20.589 10.820  8.695   1.00 18.31  ? 440  VAL A N     1 
ATOM   1150 C  CA    . VAL A 1 148 ? -21.301 9.557   8.685   1.00 17.08  ? 440  VAL A CA    1 
ATOM   1151 C  C     . VAL A 1 148 ? -20.574 8.576   7.756   1.00 17.29  ? 440  VAL A C     1 
ATOM   1152 O  O     . VAL A 1 148 ? -20.314 7.439   8.131   1.00 17.19  ? 440  VAL A O     1 
ATOM   1153 C  CB    . VAL A 1 148 ? -22.747 9.729   8.222   1.00 21.18  ? 440  VAL A CB    1 
ATOM   1154 C  CG1   . VAL A 1 148 ? -23.441 8.352   8.137   1.00 18.81  ? 440  VAL A CG1   1 
ATOM   1155 C  CG2   . VAL A 1 148 ? -23.491 10.664  9.181   1.00 19.57  ? 440  VAL A CG2   1 
ATOM   1156 N  N     . LEU A 1 149 ? -20.233 9.040   6.561   1.00 16.62  ? 441  LEU A N     1 
ATOM   1157 C  CA    . LEU A 1 149 ? -19.532 8.197   5.598   1.00 15.71  ? 441  LEU A CA    1 
ATOM   1158 C  C     . LEU A 1 149 ? -18.144 7.772   6.097   1.00 20.03  ? 441  LEU A C     1 
ATOM   1159 O  O     . LEU A 1 149 ? -17.690 6.653   5.811   1.00 18.53  ? 441  LEU A O     1 
ATOM   1160 C  CB    . LEU A 1 149 ? -19.426 8.916   4.244   1.00 17.15  ? 441  LEU A CB    1 
ATOM   1161 C  CG    . LEU A 1 149 ? -20.759 9.299   3.583   1.00 19.67  ? 441  LEU A CG    1 
ATOM   1162 C  CD1   . LEU A 1 149 ? -20.533 9.960   2.218   1.00 18.92  ? 441  LEU A CD1   1 
ATOM   1163 C  CD2   . LEU A 1 149 ? -21.628 8.063   3.420   1.00 20.06  ? 441  LEU A CD2   1 
ATOM   1164 N  N     . ALA A 1 150 ? -17.477 8.655   6.839   1.00 14.84  ? 442  ALA A N     1 
ATOM   1165 C  CA    . ALA A 1 150 ? -16.172 8.312   7.420   1.00 16.86  ? 442  ALA A CA    1 
ATOM   1166 C  C     . ALA A 1 150 ? -16.324 7.157   8.402   1.00 19.53  ? 442  ALA A C     1 
ATOM   1167 O  O     . ALA A 1 150 ? -15.527 6.207   8.387   1.00 17.31  ? 442  ALA A O     1 
ATOM   1168 C  CB    . ALA A 1 150 ? -15.560 9.517   8.113   1.00 17.45  ? 442  ALA A CB    1 
ATOM   1169 N  N     . HIS A 1 151 ? -17.349 7.240   9.242   1.00 15.60  ? 443  HIS A N     1 
ATOM   1170 C  CA    . HIS A 1 151 ? -17.670 6.170   10.201  1.00 15.24  ? 443  HIS A CA    1 
ATOM   1171 C  C     . HIS A 1 151 ? -17.951 4.867   9.471   1.00 15.92  ? 443  HIS A C     1 
ATOM   1172 O  O     . HIS A 1 151 ? -17.434 3.822   9.848   1.00 19.86  ? 443  HIS A O     1 
ATOM   1173 C  CB    . HIS A 1 151 ? -18.898 6.546   11.050  1.00 19.79  ? 443  HIS A CB    1 
ATOM   1174 C  CG    . HIS A 1 151 ? -19.603 5.369   11.680  1.00 25.64  ? 443  HIS A CG    1 
ATOM   1175 N  ND1   . HIS A 1 151 ? -19.291 4.897   12.940  1.00 27.48  ? 443  HIS A ND1   1 
ATOM   1176 C  CD2   . HIS A 1 151 ? -20.619 4.583   11.231  1.00 27.58  ? 443  HIS A CD2   1 
ATOM   1177 C  CE1   . HIS A 1 151 ? -20.071 3.868   13.233  1.00 26.23  ? 443  HIS A CE1   1 
ATOM   1178 N  NE2   . HIS A 1 151 ? -20.892 3.661   12.217  1.00 23.56  ? 443  HIS A NE2   1 
ATOM   1179 N  N     . MET A 1 152 ? -18.780 4.925   8.434   1.00 15.60  ? 444  MET A N     1 
ATOM   1180 C  CA    . MET A 1 152 ? -19.144 3.717   7.688   1.00 18.57  ? 444  MET A CA    1 
ATOM   1181 C  C     . MET A 1 152 ? -17.918 3.057   7.077   1.00 16.40  ? 444  MET A C     1 
ATOM   1182 O  O     . MET A 1 152 ? -17.706 1.853   7.209   1.00 18.43  ? 444  MET A O     1 
ATOM   1183 C  CB    . MET A 1 152 ? -20.153 4.064   6.577   1.00 17.71  ? 444  MET A CB    1 
ATOM   1184 C  CG    . MET A 1 152 ? -21.512 4.467   7.126   1.00 18.34  ? 444  MET A CG    1 
ATOM   1185 S  SD    . MET A 1 152 ? -22.546 5.251   5.868   1.00 19.48  ? 444  MET A SD    1 
ATOM   1186 C  CE    . MET A 1 152 ? -22.929 3.856   4.803   1.00 22.13  ? 444  MET A CE    1 
ATOM   1187 N  N     . GLU A 1 153 ? -17.104 3.858   6.402   1.00 16.81  ? 445  GLU A N     1 
ATOM   1188 C  CA    . GLU A 1 153 ? -15.925 3.323   5.726   1.00 17.13  ? 445  GLU A CA    1 
ATOM   1189 C  C     . GLU A 1 153 ? -14.897 2.748   6.721   1.00 20.03  ? 445  GLU A C     1 
ATOM   1190 O  O     . GLU A 1 153 ? -14.359 1.663   6.506   1.00 20.72  ? 445  GLU A O     1 
ATOM   1191 C  CB    . GLU A 1 153 ? -15.321 4.429   4.820   1.00 19.78  ? 445  GLU A CB    1 
ATOM   1192 C  CG    . GLU A 1 153 ? -14.138 3.979   3.934   1.00 24.48  ? 445  GLU A CG    1 
ATOM   1193 C  CD    . GLU A 1 153 ? -13.809 4.986   2.821   1.00 22.77  ? 445  GLU A CD    1 
ATOM   1194 O  OE1   . GLU A 1 153 ? -14.715 5.729   2.403   1.00 27.19  ? 445  GLU A OE1   1 
ATOM   1195 O  OE2   . GLU A 1 153 ? -12.643 5.022   2.361   1.00 26.42  ? 445  GLU A OE2   1 
ATOM   1196 N  N     . ALA A 1 154 ? -14.641 3.460   7.820   1.00 17.03  ? 446  ALA A N     1 
ATOM   1197 C  CA    . ALA A 1 154 ? -13.649 3.003   8.799   1.00 16.84  ? 446  ALA A CA    1 
ATOM   1198 C  C     . ALA A 1 154 ? -14.140 1.807   9.623   1.00 18.28  ? 446  ALA A C     1 
ATOM   1199 O  O     . ALA A 1 154 ? -13.341 0.955   10.015  1.00 20.34  ? 446  ALA A O     1 
ATOM   1200 C  CB    . ALA A 1 154 ? -13.218 4.143   9.725   1.00 18.76  ? 446  ALA A CB    1 
ATOM   1201 N  N     . THR A 1 155 ? -15.442 1.748   9.881   1.00 16.75  ? 447  THR A N     1 
ATOM   1202 C  CA    . THR A 1 155 ? -16.029 0.634   10.638  1.00 18.24  ? 447  THR A CA    1 
ATOM   1203 C  C     . THR A 1 155 ? -16.011 -0.657  9.834   1.00 19.41  ? 447  THR A C     1 
ATOM   1204 O  O     . THR A 1 155 ? -15.659 -1.715  10.342  1.00 20.54  ? 447  THR A O     1 
ATOM   1205 C  CB    . THR A 1 155 ? -17.472 0.958   11.084  1.00 19.33  ? 447  THR A CB    1 
ATOM   1206 O  OG1   . THR A 1 155 ? -17.440 2.112   11.940  1.00 19.62  ? 447  THR A OG1   1 
ATOM   1207 C  CG2   . THR A 1 155 ? -18.112 -0.211  11.841  1.00 19.97  ? 447  THR A CG2   1 
ATOM   1208 N  N     . GLY A 1 156 ? -16.394 -0.557  8.575   1.00 18.03  ? 448  GLY A N     1 
ATOM   1209 C  CA    . GLY A 1 156 ? -16.370 -1.705  7.686   1.00 15.99  ? 448  GLY A CA    1 
ATOM   1210 C  C     . GLY A 1 156 ? -17.444 -2.727  8.011   1.00 16.20  ? 448  GLY A C     1 
ATOM   1211 O  O     . GLY A 1 156 ? -18.303 -2.509  8.860   1.00 19.88  ? 448  GLY A O     1 
ATOM   1212 N  N     . VAL A 1 157 ? -17.396 -3.865  7.329   1.00 14.69  ? 449  VAL A N     1 
ATOM   1213 C  CA    . VAL A 1 157 ? -18.367 -4.927  7.585   1.00 15.63  ? 449  VAL A CA    1 
ATOM   1214 C  C     . VAL A 1 157 ? -17.654 -6.267  7.577   1.00 14.07  ? 449  VAL A C     1 
ATOM   1215 O  O     . VAL A 1 157 ? -16.722 -6.486  6.795   1.00 15.84  ? 449  VAL A O     1 
ATOM   1216 C  CB    . VAL A 1 157 ? -19.532 -4.913  6.541   1.00 19.07  ? 449  VAL A CB    1 
ATOM   1217 C  CG1   . VAL A 1 157 ? -19.006 -5.130  5.130   1.00 17.84  ? 449  VAL A CG1   1 
ATOM   1218 C  CG2   . VAL A 1 157 ? -20.598 -5.957  6.881   1.00 20.38  ? 449  VAL A CG2   1 
ATOM   1219 N  N     . ARG A 1 158 ? -18.072 -7.157  8.472   1.00 16.37  ? 450  ARG A N     1 
ATOM   1220 C  CA    . ARG A 1 158 ? -17.507 -8.509  8.528   1.00 13.68  ? 450  ARG A CA    1 
ATOM   1221 C  C     . ARG A 1 158 ? -18.007 -9.375  7.362   1.00 16.25  ? 450  ARG A C     1 
ATOM   1222 O  O     . ARG A 1 158 ? -19.185 -9.296  7.002   1.00 17.42  ? 450  ARG A O     1 
ATOM   1223 C  CB    . ARG A 1 158 ? -17.885 -9.144  9.864   1.00 18.08  ? 450  ARG A CB    1 
ATOM   1224 C  CG    . ARG A 1 158 ? -17.253 -10.498 10.124  1.00 24.35  ? 450  ARG A CG    1 
ATOM   1225 C  CD    . ARG A 1 158 ? -17.778 -11.067 11.449  1.00 23.15  ? 450  ARG A CD    1 
ATOM   1226 N  NE    . ARG A 1 158 ? -17.194 -12.375 11.754  1.00 25.37  ? 450  ARG A NE    1 
ATOM   1227 C  CZ    . ARG A 1 158 ? -17.758 -13.274 12.556  1.00 33.13  ? 450  ARG A CZ    1 
ATOM   1228 N  NH1   . ARG A 1 158 ? -18.937 -13.018 13.120  1.00 20.71  ? 450  ARG A NH1   1 
ATOM   1229 N  NH2   . ARG A 1 158 ? -17.154 -14.439 12.784  1.00 29.74  ? 450  ARG A NH2   1 
ATOM   1230 N  N     . LEU A 1 159 ? -17.118 -10.165 6.757   1.00 17.89  ? 451  LEU A N     1 
ATOM   1231 C  CA    . LEU A 1 159 ? -17.517 -11.172 5.758   1.00 14.71  ? 451  LEU A CA    1 
ATOM   1232 C  C     . LEU A 1 159 ? -17.320 -12.604 6.232   1.00 17.53  ? 451  LEU A C     1 
ATOM   1233 O  O     . LEU A 1 159 ? -16.418 -12.905 7.024   1.00 21.32  ? 451  LEU A O     1 
ATOM   1234 C  CB    . LEU A 1 159 ? -16.755 -11.022 4.442   1.00 16.43  ? 451  LEU A CB    1 
ATOM   1235 C  CG    . LEU A 1 159 ? -16.817 -9.675  3.738   1.00 19.31  ? 451  LEU A CG    1 
ATOM   1236 C  CD1   . LEU A 1 159 ? -16.047 -9.781  2.431   1.00 19.00  ? 451  LEU A CD1   1 
ATOM   1237 C  CD2   . LEU A 1 159 ? -18.261 -9.250  3.507   1.00 19.53  ? 451  LEU A CD2   1 
ATOM   1238 N  N     . ASP A 1 160 ? -18.173 -13.484 5.725   1.00 15.71  ? 452  ASP A N     1 
ATOM   1239 C  CA    . ASP A 1 160 ? -18.024 -14.914 5.974   1.00 16.41  ? 452  ASP A CA    1 
ATOM   1240 C  C     . ASP A 1 160 ? -17.093 -15.450 4.886   1.00 19.81  ? 452  ASP A C     1 
ATOM   1241 O  O     . ASP A 1 160 ? -17.538 -15.904 3.813   1.00 18.95  ? 452  ASP A O     1 
ATOM   1242 C  CB    . ASP A 1 160 ? -19.397 -15.576 5.908   1.00 16.18  ? 452  ASP A CB    1 
ATOM   1243 C  CG    . ASP A 1 160 ? -19.381 -17.033 6.366   1.00 24.58  ? 452  ASP A CG    1 
ATOM   1244 O  OD1   . ASP A 1 160 ? -18.314 -17.680 6.331   1.00 23.75  ? 452  ASP A OD1   1 
ATOM   1245 O  OD2   . ASP A 1 160 ? -20.457 -17.523 6.744   1.00 23.64  ? 452  ASP A OD2   1 
ATOM   1246 N  N     . VAL A 1 161 ? -15.794 -15.399 5.152   1.00 22.32  ? 453  VAL A N     1 
ATOM   1247 C  CA    A VAL A 1 161 ? -14.808 -15.735 4.131   0.42 20.09  ? 453  VAL A CA    1 
ATOM   1248 C  CA    B VAL A 1 161 ? -14.809 -15.733 4.133   0.58 19.85  ? 453  VAL A CA    1 
ATOM   1249 C  C     . VAL A 1 161 ? -14.819 -17.232 3.804   1.00 21.11  ? 453  VAL A C     1 
ATOM   1250 O  O     . VAL A 1 161 ? -14.618 -17.621 2.654   1.00 19.89  ? 453  VAL A O     1 
ATOM   1251 C  CB    A VAL A 1 161 ? -13.384 -15.245 4.507   0.42 22.43  ? 453  VAL A CB    1 
ATOM   1252 C  CB    B VAL A 1 161 ? -13.401 -15.228 4.523   0.58 21.11  ? 453  VAL A CB    1 
ATOM   1253 C  CG1   A VAL A 1 161 ? -12.853 -15.982 5.721   0.42 21.15  ? 453  VAL A CG1   1 
ATOM   1254 C  CG1   B VAL A 1 161 ? -12.321 -15.878 3.664   0.58 26.92  ? 453  VAL A CG1   1 
ATOM   1255 C  CG2   A VAL A 1 161 ? -12.434 -15.393 3.328   0.42 25.13  ? 453  VAL A CG2   1 
ATOM   1256 C  CG2   B VAL A 1 161 ? -13.351 -13.696 4.408   0.58 17.70  ? 453  VAL A CG2   1 
ATOM   1257 N  N     . ALA A 1 162 ? -15.090 -18.073 4.803   1.00 19.47  ? 454  ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 162 ? -15.185 -19.512 4.527   1.00 24.14  ? 454  ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 162 ? -16.319 -19.801 3.530   1.00 24.72  ? 454  ALA A C     1 
ATOM   1260 O  O     . ALA A 1 162 ? -16.190 -20.652 2.644   1.00 21.31  ? 454  ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 162 ? -15.407 -20.300 5.823   1.00 25.70  ? 454  ALA A CB    1 
ATOM   1262 N  N     . TYR A 1 163 ? -17.426 -19.087 3.688   1.00 20.57  ? 455  TYR A N     1 
ATOM   1263 C  CA    . TYR A 1 163 ? -18.592 -19.264 2.831   1.00 19.75  ? 455  TYR A CA    1 
ATOM   1264 C  C     . TYR A 1 163 ? -18.225 -18.818 1.420   1.00 20.68  ? 455  TYR A C     1 
ATOM   1265 O  O     . TYR A 1 163 ? -18.529 -19.504 0.445   1.00 22.11  ? 455  TYR A O     1 
ATOM   1266 C  CB    . TYR A 1 163 ? -19.776 -18.452 3.376   1.00 20.31  ? 455  TYR A CB    1 
ATOM   1267 C  CG    . TYR A 1 163 ? -21.062 -18.626 2.608   1.00 24.96  ? 455  TYR A CG    1 
ATOM   1268 C  CD1   . TYR A 1 163 ? -21.730 -19.833 2.636   1.00 30.89  ? 455  TYR A CD1   1 
ATOM   1269 C  CD2   . TYR A 1 163 ? -21.618 -17.584 1.876   1.00 32.78  ? 455  TYR A CD2   1 
ATOM   1270 C  CE1   . TYR A 1 163 ? -22.903 -20.018 1.947   1.00 44.73  ? 455  TYR A CE1   1 
ATOM   1271 C  CE2   . TYR A 1 163 ? -22.811 -17.762 1.180   1.00 37.73  ? 455  TYR A CE2   1 
ATOM   1272 C  CZ    . TYR A 1 163 ? -23.438 -18.988 1.220   1.00 45.43  ? 455  TYR A CZ    1 
ATOM   1273 O  OH    . TYR A 1 163 ? -24.615 -19.206 0.542   1.00 59.13  ? 455  TYR A OH    1 
ATOM   1274 N  N     . LEU A 1 164 ? -17.571 -17.659 1.311   1.00 18.43  ? 456  LEU A N     1 
ATOM   1275 C  CA    . LEU A 1 164 ? -17.090 -17.189 0.000   1.00 19.01  ? 456  LEU A CA    1 
ATOM   1276 C  C     . LEU A 1 164 ? -16.102 -18.145 -0.683  1.00 17.46  ? 456  LEU A C     1 
ATOM   1277 O  O     . LEU A 1 164 ? -16.156 -18.327 -1.909  1.00 22.11  ? 456  LEU A O     1 
ATOM   1278 C  CB    . LEU A 1 164 ? -16.464 -15.793 0.103   1.00 23.44  ? 456  LEU A CB    1 
ATOM   1279 C  CG    . LEU A 1 164 ? -17.480 -14.677 0.372   1.00 21.66  ? 456  LEU A CG    1 
ATOM   1280 C  CD1   . LEU A 1 164 ? -16.790 -13.434 0.897   1.00 22.25  ? 456  LEU A CD1   1 
ATOM   1281 C  CD2   . LEU A 1 164 ? -18.280 -14.362 -0.887  1.00 28.65  ? 456  LEU A CD2   1 
ATOM   1282 N  N     . ARG A 1 165 ? -15.195 -18.738 0.091   1.00 20.30  ? 457  ARG A N     1 
ATOM   1283 C  CA    . ARG A 1 165 ? -14.242 -19.700 -0.478  1.00 21.04  ? 457  ARG A CA    1 
ATOM   1284 C  C     . ARG A 1 165 ? -14.993 -20.913 -1.033  1.00 21.20  ? 457  ARG A C     1 
ATOM   1285 O  O     . ARG A 1 165 ? -14.672 -21.414 -2.114  1.00 23.02  ? 457  ARG A O     1 
ATOM   1286 C  CB    . ARG A 1 165 ? -13.226 -20.171 0.568   1.00 25.74  ? 457  ARG A CB    1 
ATOM   1287 C  CG    . ARG A 1 165 ? -12.306 -19.090 1.141   1.00 29.32  ? 457  ARG A CG    1 
ATOM   1288 C  CD    . ARG A 1 165 ? -11.412 -18.458 0.091   1.00 39.66  ? 457  ARG A CD    1 
ATOM   1289 N  NE    . ARG A 1 165 ? -10.426 -17.551 0.690   1.00 40.08  ? 457  ARG A NE    1 
ATOM   1290 C  CZ    . ARG A 1 165 ? -9.707  -16.668 0.000   1.00 47.66  ? 457  ARG A CZ    1 
ATOM   1291 N  NH1   . ARG A 1 165 ? -9.868  -16.559 -1.315  1.00 43.30  ? 457  ARG A NH1   1 
ATOM   1292 N  NH2   . ARG A 1 165 ? -8.836  -15.884 0.626   1.00 44.97  ? 457  ARG A NH2   1 
ATOM   1293 N  N     . ALA A 1 166 ? -16.002 -21.373 -0.299  1.00 21.57  ? 458  ALA A N     1 
ATOM   1294 C  CA    . ALA A 1 166 ? -16.763 -22.554 -0.726  1.00 17.60  ? 458  ALA A CA    1 
ATOM   1295 C  C     . ALA A 1 166 ? -17.573 -22.206 -1.973  1.00 24.52  ? 458  ALA A C     1 
ATOM   1296 O  O     . ALA A 1 166 ? -17.737 -23.020 -2.905  1.00 24.49  ? 458  ALA A O     1 
ATOM   1297 C  CB    . ALA A 1 166 ? -17.694 -23.001 0.386   1.00 22.40  ? 458  ALA A CB    1 
ATOM   1298 N  N     . MET A 1 167 ? -18.109 -20.996 -1.968  1.00 22.48  ? 459  MET A N     1 
ATOM   1299 C  CA    . MET A 1 167 ? -18.938 -20.547 -3.073  1.00 18.71  ? 459  MET A CA    1 
ATOM   1300 C  C     . MET A 1 167 ? -18.101 -20.454 -4.327  1.00 20.39  ? 459  MET A C     1 
ATOM   1301 O  O     . MET A 1 167 ? -18.573 -20.780 -5.422  1.00 25.00  ? 459  MET A O     1 
ATOM   1302 C  CB    . MET A 1 167 ? -19.558 -19.183 -2.752  1.00 21.57  ? 459  MET A CB    1 
ATOM   1303 C  CG    . MET A 1 167 ? -20.684 -18.806 -3.680  1.00 30.11  ? 459  MET A CG    1 
ATOM   1304 S  SD    . MET A 1 167 ? -21.187 -17.086 -3.425  1.00 33.49  ? 459  MET A SD    1 
ATOM   1305 C  CE    . MET A 1 167 ? -21.328 -17.013 -1.657  1.00 32.45  ? 459  MET A CE    1 
ATOM   1306 N  N     . SER A 1 168 ? -16.858 -20.002 -4.178  1.00 19.72  ? 460  SER A N     1 
ATOM   1307 C  CA    . SER A 1 168 ? -15.991 -19.863 -5.339  1.00 22.60  ? 460  SER A CA    1 
ATOM   1308 C  C     . SER A 1 168 ? -15.776 -21.231 -6.000  1.00 25.97  ? 460  SER A C     1 
ATOM   1309 O  O     . SER A 1 168 ? -15.848 -21.367 -7.230  1.00 23.70  ? 460  SER A O     1 
ATOM   1310 C  CB    . SER A 1 168 ? -14.657 -19.228 -4.944  1.00 27.39  ? 460  SER A CB    1 
ATOM   1311 O  OG    . SER A 1 168 ? -13.803 -19.118 -6.065  1.00 29.66  ? 460  SER A OG    1 
ATOM   1312 N  N     . LEU A 1 169 ? -15.555 -22.252 -5.176  1.00 26.39  ? 461  LEU A N     1 
ATOM   1313 C  CA    . LEU A 1 169 ? -15.331 -23.595 -5.709  1.00 25.16  ? 461  LEU A CA    1 
ATOM   1314 C  C     . LEU A 1 169 ? -16.587 -24.114 -6.398  1.00 22.87  ? 461  LEU A C     1 
ATOM   1315 O  O     . LEU A 1 169 ? -16.511 -24.723 -7.472  1.00 28.11  ? 461  LEU A O     1 
ATOM   1316 C  CB    . LEU A 1 169 ? -14.915 -24.545 -4.580  1.00 22.98  ? 461  LEU A CB    1 
ATOM   1317 C  CG    . LEU A 1 169 ? -13.549 -24.248 -3.966  1.00 28.28  ? 461  LEU A CG    1 
ATOM   1318 C  CD1   . LEU A 1 169 ? -13.297 -25.129 -2.750  1.00 33.90  ? 461  LEU A CD1   1 
ATOM   1319 C  CD2   . LEU A 1 169 ? -12.467 -24.439 -5.010  1.00 38.19  ? 461  LEU A CD2   1 
ATOM   1320 N  N     . GLU A 1 170 ? -17.736 -23.895 -5.769  1.00 25.35  ? 462  GLU A N     1 
ATOM   1321 C  CA    . GLU A 1 170 ? -19.003 -24.397 -6.286  1.00 28.53  ? 462  GLU A CA    1 
ATOM   1322 C  C     . GLU A 1 170 ? -19.350 -23.730 -7.609  1.00 31.99  ? 462  GLU A C     1 
ATOM   1323 O  O     . GLU A 1 170 ? -19.777 -24.395 -8.559  1.00 25.83  ? 462  GLU A O     1 
ATOM   1324 C  CB    . GLU A 1 170 ? -20.124 -24.164 -5.271  1.00 28.18  ? 462  GLU A CB    1 
ATOM   1325 C  CG    . GLU A 1 170 ? -21.497 -24.621 -5.741  1.00 51.96  ? 462  GLU A CG    1 
ATOM   1326 C  CD    . GLU A 1 170 ? -22.578 -24.393 -4.693  1.00 67.49  ? 462  GLU A CD    1 
ATOM   1327 O  OE1   . GLU A 1 170 ? -22.253 -23.857 -3.611  1.00 57.47  ? 462  GLU A OE1   1 
ATOM   1328 O  OE2   . GLU A 1 170 ? -23.751 -24.751 -4.952  1.00 72.61  ? 462  GLU A OE2   1 
ATOM   1329 N  N     . VAL A 1 171 ? -19.154 -22.412 -7.666  1.00 22.80  ? 463  VAL A N     1 
ATOM   1330 C  CA    . VAL A 1 171 ? -19.471 -21.639 -8.865  1.00 22.57  ? 463  VAL A CA    1 
ATOM   1331 C  C     . VAL A 1 171 ? -18.536 -21.965 -10.027 1.00 27.54  ? 463  VAL A C     1 
ATOM   1332 O  O     . VAL A 1 171 ? -18.985 -22.058 -11.170 1.00 27.99  ? 463  VAL A O     1 
ATOM   1333 C  CB    . VAL A 1 171 ? -19.472 -20.113 -8.561  1.00 21.69  ? 463  VAL A CB    1 
ATOM   1334 C  CG1   . VAL A 1 171 ? -19.539 -19.303 -9.840  1.00 23.74  ? 463  VAL A CG1   1 
ATOM   1335 C  CG2   . VAL A 1 171 ? -20.634 -19.760 -7.644  1.00 26.60  ? 463  VAL A CG2   1 
ATOM   1336 N  N     . ALA A 1 172 ? -17.248 -22.152 -9.741  1.00 25.35  ? 464  ALA A N     1 
ATOM   1337 C  CA    . ALA A 1 172 ? -16.283 -22.515 -10.773 1.00 30.63  ? 464  ALA A CA    1 
ATOM   1338 C  C     . ALA A 1 172 ? -16.641 -23.859 -11.403 1.00 31.64  ? 464  ALA A C     1 
ATOM   1339 O  O     . ALA A 1 172 ? -16.574 -24.025 -12.626 1.00 31.49  ? 464  ALA A O     1 
ATOM   1340 C  CB    . ALA A 1 172 ? -14.872 -22.557 -10.205 1.00 30.93  ? 464  ALA A CB    1 
ATOM   1341 N  N     . GLU A 1 173 ? -17.017 -24.816 -10.560 1.00 31.79  ? 465  GLU A N     1 
ATOM   1342 C  CA    . GLU A 1 173 ? -17.447 -26.127 -11.043 1.00 32.44  ? 465  GLU A CA    1 
ATOM   1343 C  C     . GLU A 1 173 ? -18.685 -26.011 -11.947 1.00 37.01  ? 465  GLU A C     1 
ATOM   1344 O  O     . GLU A 1 173 ? -18.748 -26.624 -13.016 1.00 36.57  ? 465  GLU A O     1 
ATOM   1345 C  CB    . GLU A 1 173 ? -17.714 -27.061 -9.854  1.00 34.79  ? 465  GLU A CB    1 
ATOM   1346 C  CG    . GLU A 1 173 ? -18.274 -28.417 -10.236 1.00 49.06  ? 465  GLU A CG    1 
ATOM   1347 C  CD    . GLU A 1 173 ? -18.481 -29.309 -9.028  1.00 56.74  ? 465  GLU A CD    1 
ATOM   1348 O  OE1   . GLU A 1 173 ? -17.583 -29.342 -8.159  1.00 54.19  ? 465  GLU A OE1   1 
ATOM   1349 O  OE2   . GLU A 1 173 ? -19.541 -29.966 -8.944  1.00 60.63  ? 465  GLU A OE2   1 
ATOM   1350 N  N     . GLU A 1 174 ? -19.656 -25.205 -11.533 1.00 28.68  ? 466  GLU A N     1 
ATOM   1351 C  CA    . GLU A 1 174 ? -20.871 -25.027 -12.318 1.00 31.07  ? 466  GLU A CA    1 
ATOM   1352 C  C     . GLU A 1 174 ? -20.621 -24.274 -13.628 1.00 33.24  ? 466  GLU A C     1 
ATOM   1353 O  O     . GLU A 1 174 ? -21.212 -24.608 -14.655 1.00 32.87  ? 466  GLU A O     1 
ATOM   1354 C  CB    . GLU A 1 174 ? -21.971 -24.352 -11.500 1.00 35.12  ? 466  GLU A CB    1 
ATOM   1355 C  CG    . GLU A 1 174 ? -23.268 -24.104 -12.273 1.00 37.85  ? 466  GLU A CG    1 
ATOM   1356 C  CD    . GLU A 1 174 ? -24.100 -25.366 -12.485 1.00 51.79  ? 466  GLU A CD    1 
ATOM   1357 O  OE1   . GLU A 1 174 ? -23.696 -26.438 -11.998 1.00 50.97  ? 466  GLU A OE1   1 
ATOM   1358 O  OE2   . GLU A 1 174 ? -25.171 -25.283 -13.130 1.00 47.60  ? 466  GLU A OE2   1 
ATOM   1359 N  N     . ILE A 1 175 ? -19.753 -23.265 -13.596 1.00 28.45  ? 467  ILE A N     1 
ATOM   1360 C  CA    . ILE A 1 175 ? -19.353 -22.580 -14.826 1.00 30.17  ? 467  ILE A CA    1 
ATOM   1361 C  C     . ILE A 1 175 ? -18.727 -23.549 -15.828 1.00 37.87  ? 467  ILE A C     1 
ATOM   1362 O  O     . ILE A 1 175 ? -19.027 -23.500 -17.025 1.00 32.28  ? 467  ILE A O     1 
ATOM   1363 C  CB    . ILE A 1 175 ? -18.379 -21.420 -14.542 1.00 30.57  ? 467  ILE A CB    1 
ATOM   1364 C  CG1   . ILE A 1 175 ? -19.125 -20.293 -13.827 1.00 32.54  ? 467  ILE A CG1   1 
ATOM   1365 C  CG2   . ILE A 1 175 ? -17.738 -20.905 -15.837 1.00 26.31  ? 467  ILE A CG2   1 
ATOM   1366 C  CD1   . ILE A 1 175 ? -18.229 -19.167 -13.355 1.00 29.64  ? 467  ILE A CD1   1 
ATOM   1367 N  N     . ALA A 1 176 ? -17.865 -24.431 -15.331 1.00 30.90  ? 468  ALA A N     1 
ATOM   1368 C  CA    . ALA A 1 176 ? -17.205 -25.416 -16.184 1.00 32.69  ? 468  ALA A CA    1 
ATOM   1369 C  C     . ALA A 1 176 ? -18.222 -26.346 -16.830 1.00 34.02  ? 468  ALA A C     1 
ATOM   1370 O  O     . ALA A 1 176 ? -18.124 -26.634 -18.020 1.00 37.56  ? 468  ALA A O     1 
ATOM   1371 C  CB    . ALA A 1 176 ? -16.182 -26.208 -15.394 1.00 31.70  ? 468  ALA A CB    1 
ATOM   1372 N  N     . ARG A 1 177 ? -19.198 -26.803 -16.046 1.00 34.74  ? 469  ARG A N     1 
ATOM   1373 C  CA    . ARG A 1 177 ? -20.243 -27.690 -16.552 1.00 37.56  ? 469  ARG A CA    1 
ATOM   1374 C  C     . ARG A 1 177 ? -21.064 -26.990 -17.624 1.00 40.02  ? 469  ARG A C     1 
ATOM   1375 O  O     . ARG A 1 177 ? -21.346 -27.562 -18.684 1.00 34.00  ? 469  ARG A O     1 
ATOM   1376 C  CB    . ARG A 1 177 ? -21.171 -28.129 -15.424 1.00 41.94  ? 469  ARG A CB    1 
ATOM   1377 C  CG    . ARG A 1 177 ? -21.011 -29.568 -15.002 1.00 52.75  ? 469  ARG A CG    1 
ATOM   1378 C  CD    . ARG A 1 177 ? -21.939 -29.868 -13.848 1.00 58.22  ? 469  ARG A CD    1 
ATOM   1379 N  NE    . ARG A 1 177 ? -21.679 -28.964 -12.732 1.00 63.00  ? 469  ARG A NE    1 
ATOM   1380 C  CZ    . ARG A 1 177 ? -22.360 -28.960 -11.592 1.00 61.70  ? 469  ARG A CZ    1 
ATOM   1381 N  NH1   . ARG A 1 177 ? -23.363 -29.809 -11.409 1.00 75.52  ? 469  ARG A NH1   1 
ATOM   1382 N  NH2   . ARG A 1 177 ? -22.043 -28.093 -10.637 1.00 39.98  ? 469  ARG A NH2   1 
ATOM   1383 N  N     . LEU A 1 178 ? -21.443 -25.746 -17.338 1.00 31.47  ? 470  LEU A N     1 
ATOM   1384 C  CA    . LEU A 1 178 ? -22.257 -24.962 -18.262 1.00 28.90  ? 470  LEU A CA    1 
ATOM   1385 C  C     . LEU A 1 178 ? -21.548 -24.708 -19.582 1.00 31.74  ? 470  LEU A C     1 
ATOM   1386 O  O     . LEU A 1 178 ? -22.146 -24.858 -20.650 1.00 35.49  ? 470  LEU A O     1 
ATOM   1387 C  CB    . LEU A 1 178 ? -22.685 -23.639 -17.618 1.00 29.89  ? 470  LEU A CB    1 
ATOM   1388 C  CG    . LEU A 1 178 ? -23.743 -23.748 -16.517 1.00 30.96  ? 470  LEU A CG    1 
ATOM   1389 C  CD1   . LEU A 1 178 ? -23.874 -22.421 -15.772 1.00 31.15  ? 470  LEU A CD1   1 
ATOM   1390 C  CD2   . LEU A 1 178 ? -25.081 -24.138 -17.087 1.00 34.20  ? 470  LEU A CD2   1 
ATOM   1391 N  N     . GLU A 1 179 ? -20.281 -24.324 -19.514 1.00 28.71  ? 471  GLU A N     1 
ATOM   1392 C  CA    . GLU A 1 179 ? -19.518 -24.033 -20.723 1.00 32.79  ? 471  GLU A CA    1 
ATOM   1393 C  C     . GLU A 1 179 ? -19.434 -25.281 -21.604 1.00 38.25  ? 471  GLU A C     1 
ATOM   1394 O  O     . GLU A 1 179 ? -19.658 -25.218 -22.812 1.00 36.64  ? 471  GLU A O     1 
ATOM   1395 C  CB    . GLU A 1 179 ? -18.112 -23.544 -20.381 1.00 39.15  ? 471  GLU A CB    1 
ATOM   1396 C  CG    . GLU A 1 179 ? -17.248 -23.278 -21.601 1.00 49.91  ? 471  GLU A CG    1 
ATOM   1397 C  CD    . GLU A 1 179 ? -15.890 -22.709 -21.247 1.00 60.05  ? 471  GLU A CD    1 
ATOM   1398 O  OE1   . GLU A 1 179 ? -15.841 -21.637 -20.611 1.00 60.89  ? 471  GLU A OE1   1 
ATOM   1399 O  OE2   . GLU A 1 179 ? -14.869 -23.333 -21.603 1.00 68.00  ? 471  GLU A OE2   1 
ATOM   1400 N  N     . ALA A 1 180 ? -19.121 -26.412 -20.978 1.00 39.51  ? 472  ALA A N     1 
ATOM   1401 C  CA    . ALA A 1 180 ? -18.988 -27.684 -21.679 1.00 42.65  ? 472  ALA A CA    1 
ATOM   1402 C  C     . ALA A 1 180 ? -20.293 -28.095 -22.351 1.00 40.61  ? 472  ALA A C     1 
ATOM   1403 O  O     . ALA A 1 180 ? -20.292 -28.582 -23.481 1.00 42.44  ? 472  ALA A O     1 
ATOM   1404 C  CB    . ALA A 1 180 ? -18.529 -28.766 -20.715 1.00 42.59  ? 472  ALA A CB    1 
ATOM   1405 N  N     . GLU A 1 181 ? -21.403 -27.900 -21.650 1.00 38.91  ? 473  GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 181 ? -22.710 -28.233 -22.193 1.00 34.70  ? 473  GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 181 ? -23.106 -27.279 -23.317 1.00 40.91  ? 473  GLU A C     1 
ATOM   1408 O  O     . GLU A 1 181 ? -23.715 -27.692 -24.308 1.00 38.40  ? 473  GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 181 ? -23.772 -28.248 -21.092 1.00 40.60  ? 473  GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 181 ? -25.191 -28.535 -21.576 1.00 49.51  ? 473  GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 181 ? -25.402 -29.981 -22.026 1.00 62.58  ? 473  GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 181 ? -24.436 -30.779 -22.007 1.00 63.21  ? 473  GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 181 ? -26.546 -30.320 -22.401 1.00 61.67  ? 473  GLU A OE2   1 
ATOM   1414 N  N     . VAL A 1 182 ? -22.759 -26.005 -23.166 1.00 31.14  ? 474  VAL A N     1 
ATOM   1415 C  CA    . VAL A 1 182 ? -23.030 -25.034 -24.227 1.00 31.26  ? 474  VAL A CA    1 
ATOM   1416 C  C     . VAL A 1 182 ? -22.277 -25.399 -25.510 1.00 36.98  ? 474  VAL A C     1 
ATOM   1417 O  O     . VAL A 1 182 ? -22.854 -25.408 -26.600 1.00 40.22  ? 474  VAL A O     1 
ATOM   1418 C  CB    . VAL A 1 182 ? -22.665 -23.599 -23.793 1.00 30.01  ? 474  VAL A CB    1 
ATOM   1419 C  CG1   . VAL A 1 182 ? -22.620 -22.670 -24.998 1.00 30.98  ? 474  VAL A CG1   1 
ATOM   1420 C  CG2   . VAL A 1 182 ? -23.664 -23.094 -22.767 1.00 31.59  ? 474  VAL A CG2   1 
ATOM   1421 N  N     . PHE A 1 183 ? -20.996 -25.716 -25.374 1.00 36.22  ? 475  PHE A N     1 
ATOM   1422 C  CA    . PHE A 1 183 ? -20.172 -26.082 -26.527 1.00 41.03  ? 475  PHE A CA    1 
ATOM   1423 C  C     . PHE A 1 183 ? -20.655 -27.375 -27.191 1.00 39.39  ? 475  PHE A C     1 
ATOM   1424 O  O     . PHE A 1 183 ? -20.529 -27.543 -28.406 1.00 39.87  ? 475  PHE A O     1 
ATOM   1425 C  CB    . PHE A 1 183 ? -18.701 -26.222 -26.130 1.00 39.27  ? 475  PHE A CB    1 
ATOM   1426 C  CG    . PHE A 1 183 ? -18.032 -24.922 -25.797 1.00 38.03  ? 475  PHE A CG    1 
ATOM   1427 C  CD1   . PHE A 1 183 ? -18.692 -23.716 -25.972 1.00 40.83  ? 475  PHE A CD1   1 
ATOM   1428 C  CD2   . PHE A 1 183 ? -16.735 -24.905 -25.318 1.00 39.18  ? 475  PHE A CD2   1 
ATOM   1429 C  CE1   . PHE A 1 183 ? -18.073 -22.522 -25.666 1.00 42.92  ? 475  PHE A CE1   1 
ATOM   1430 C  CE2   . PHE A 1 183 ? -16.111 -23.713 -25.013 1.00 39.11  ? 475  PHE A CE2   1 
ATOM   1431 C  CZ    . PHE A 1 183 ? -16.781 -22.521 -25.187 1.00 38.92  ? 475  PHE A CZ    1 
ATOM   1432 N  N     . ARG A 1 184 ? -21.208 -28.280 -26.392 1.00 38.73  ? 476  ARG A N     1 
ATOM   1433 C  CA    . ARG A 1 184 ? -21.765 -29.524 -26.915 1.00 45.85  ? 476  ARG A CA    1 
ATOM   1434 C  C     . ARG A 1 184 ? -23.050 -29.264 -27.702 1.00 46.95  ? 476  ARG A C     1 
ATOM   1435 O  O     . ARG A 1 184 ? -23.242 -29.800 -28.796 1.00 42.98  ? 476  ARG A O     1 
ATOM   1436 C  CB    . ARG A 1 184 ? -22.044 -30.502 -25.774 1.00 48.27  ? 476  ARG A CB    1 
ATOM   1437 C  CG    . ARG A 1 184 ? -22.471 -31.878 -26.239 1.00 55.46  ? 476  ARG A CG    1 
ATOM   1438 C  CD    . ARG A 1 184 ? -22.941 -32.738 -25.080 1.00 60.38  ? 476  ARG A CD    1 
ATOM   1439 N  NE    . ARG A 1 184 ? -24.216 -32.284 -24.535 1.00 63.98  ? 476  ARG A NE    1 
ATOM   1440 C  CZ    . ARG A 1 184 ? -25.404 -32.627 -25.025 1.00 67.28  ? 476  ARG A CZ    1 
ATOM   1441 N  NH1   . ARG A 1 184 ? -25.486 -33.425 -26.081 1.00 68.28  ? 476  ARG A NH1   1 
ATOM   1442 N  NH2   . ARG A 1 184 ? -26.511 -32.171 -24.460 1.00 68.46  ? 476  ARG A NH2   1 
ATOM   1443 N  N     . LEU A 1 185 ? -23.925 -28.439 -27.133 1.00 40.46  ? 477  LEU A N     1 
ATOM   1444 C  CA    . LEU A 1 185 ? -25.191 -28.083 -27.761 1.00 39.82  ? 477  LEU A CA    1 
ATOM   1445 C  C     . LEU A 1 185 ? -24.970 -27.294 -29.045 1.00 44.25  ? 477  LEU A C     1 
ATOM   1446 O  O     . LEU A 1 185 ? -25.766 -27.379 -29.983 1.00 44.02  ? 477  LEU A O     1 
ATOM   1447 C  CB    . LEU A 1 185 ? -26.046 -27.268 -26.792 1.00 47.77  ? 477  LEU A CB    1 
ATOM   1448 C  CG    . LEU A 1 185 ? -27.288 -27.919 -26.180 1.00 51.85  ? 477  LEU A CG    1 
ATOM   1449 C  CD1   . LEU A 1 185 ? -27.166 -29.421 -26.149 1.00 43.98  ? 477  LEU A CD1   1 
ATOM   1450 C  CD2   . LEU A 1 185 ? -27.521 -27.379 -24.778 1.00 44.35  ? 477  LEU A CD2   1 
ATOM   1451 N  N     . ALA A 1 186 ? -23.883 -26.528 -29.078 1.00 37.37  ? 478  ALA A N     1 
ATOM   1452 C  CA    . ALA A 1 186 ? -23.550 -25.699 -30.229 1.00 37.58  ? 478  ALA A CA    1 
ATOM   1453 C  C     . ALA A 1 186 ? -22.817 -26.495 -31.307 1.00 41.41  ? 478  ALA A C     1 
ATOM   1454 O  O     . ALA A 1 186 ? -22.754 -26.075 -32.460 1.00 43.57  ? 478  ALA A O     1 
ATOM   1455 C  CB    . ALA A 1 186 ? -22.705 -24.513 -29.791 1.00 36.04  ? 478  ALA A CB    1 
ATOM   1456 N  N     . GLY A 1 187 ? -22.251 -27.632 -30.920 1.00 43.47  ? 479  GLY A N     1 
ATOM   1457 C  CA    . GLY A 1 187 ? -21.510 -28.472 -31.844 1.00 52.65  ? 479  GLY A CA    1 
ATOM   1458 C  C     . GLY A 1 187 ? -20.040 -28.113 -31.975 1.00 50.23  ? 479  GLY A C     1 
ATOM   1459 O  O     . GLY A 1 187 ? -19.289 -28.821 -32.643 1.00 48.09  ? 479  GLY A O     1 
ATOM   1460 N  N     . HIS A 1 188 ? -19.625 -27.021 -31.334 1.00 40.70  ? 480  HIS A N     1 
ATOM   1461 C  CA    . HIS A 1 188 ? -18.239 -26.562 -31.401 1.00 40.09  ? 480  HIS A CA    1 
ATOM   1462 C  C     . HIS A 1 188 ? -17.966 -25.524 -30.316 1.00 48.00  ? 480  HIS A C     1 
ATOM   1463 O  O     . HIS A 1 188 ? -18.893 -24.877 -29.836 1.00 51.15  ? 480  HIS A O     1 
ATOM   1464 C  CB    . HIS A 1 188 ? -17.953 -25.945 -32.772 1.00 48.58  ? 480  HIS A CB    1 
ATOM   1465 C  CG    . HIS A 1 188 ? -18.871 -24.816 -33.127 1.00 56.41  ? 480  HIS A CG    1 
ATOM   1466 N  ND1   . HIS A 1 188 ? -18.708 -23.540 -32.633 1.00 62.23  ? 480  HIS A ND1   1 
ATOM   1467 C  CD2   . HIS A 1 188 ? -19.970 -24.776 -33.918 1.00 59.35  ? 480  HIS A CD2   1 
ATOM   1468 C  CE1   . HIS A 1 188 ? -19.663 -22.760 -33.110 1.00 60.70  ? 480  HIS A CE1   1 
ATOM   1469 N  NE2   . HIS A 1 188 ? -20.442 -23.486 -33.891 1.00 59.66  ? 480  HIS A NE2   1 
ATOM   1470 N  N     . PRO A 1 189 ? -16.691 -25.354 -29.932 1.00 52.46  ? 481  PRO A N     1 
ATOM   1471 C  CA    . PRO A 1 189 ? -16.370 -24.295 -28.972 1.00 48.26  ? 481  PRO A CA    1 
ATOM   1472 C  C     . PRO A 1 189 ? -16.358 -22.927 -29.640 1.00 49.35  ? 481  PRO A C     1 
ATOM   1473 O  O     . PRO A 1 189 ? -16.066 -22.814 -30.830 1.00 50.51  ? 481  PRO A O     1 
ATOM   1474 C  CB    . PRO A 1 189 ? -14.958 -24.660 -28.515 1.00 49.02  ? 481  PRO A CB    1 
ATOM   1475 C  CG    . PRO A 1 189 ? -14.371 -25.362 -29.683 1.00 52.32  ? 481  PRO A CG    1 
ATOM   1476 C  CD    . PRO A 1 189 ? -15.502 -26.146 -30.292 1.00 51.07  ? 481  PRO A CD    1 
ATOM   1477 N  N     . PHE A 1 190 ? -16.684 -21.896 -28.872 1.00 43.07  ? 482  PHE A N     1 
ATOM   1478 C  CA    . PHE A 1 190 ? -16.611 -20.529 -29.360 1.00 40.20  ? 482  PHE A CA    1 
ATOM   1479 C  C     . PHE A 1 190 ? -16.384 -19.592 -28.183 1.00 41.28  ? 482  PHE A C     1 
ATOM   1480 O  O     . PHE A 1 190 ? -16.380 -20.029 -27.033 1.00 41.79  ? 482  PHE A O     1 
ATOM   1481 C  CB    . PHE A 1 190 ? -17.877 -20.151 -30.136 1.00 40.67  ? 482  PHE A CB    1 
ATOM   1482 C  CG    . PHE A 1 190 ? -19.142 -20.208 -29.325 1.00 36.28  ? 482  PHE A CG    1 
ATOM   1483 C  CD1   . PHE A 1 190 ? -19.779 -21.417 -29.080 1.00 35.27  ? 482  PHE A CD1   1 
ATOM   1484 C  CD2   . PHE A 1 190 ? -19.714 -19.044 -28.831 1.00 33.71  ? 482  PHE A CD2   1 
ATOM   1485 C  CE1   . PHE A 1 190 ? -20.951 -21.468 -28.344 1.00 32.21  ? 482  PHE A CE1   1 
ATOM   1486 C  CE2   . PHE A 1 190 ? -20.885 -19.084 -28.098 1.00 32.34  ? 482  PHE A CE2   1 
ATOM   1487 C  CZ    . PHE A 1 190 ? -21.509 -20.297 -27.852 1.00 32.59  ? 482  PHE A CZ    1 
ATOM   1488 N  N     . ASN A 1 191 ? -16.178 -18.313 -28.471 1.00 44.79  ? 483  ASN A N     1 
ATOM   1489 C  CA    . ASN A 1 191 ? -16.012 -17.321 -27.419 1.00 41.40  ? 483  ASN A CA    1 
ATOM   1490 C  C     . ASN A 1 191 ? -17.353 -17.015 -26.753 1.00 39.03  ? 483  ASN A C     1 
ATOM   1491 O  O     . ASN A 1 191 ? -18.120 -16.175 -27.234 1.00 40.04  ? 483  ASN A O     1 
ATOM   1492 C  CB    . ASN A 1 191 ? -15.393 -16.045 -27.986 1.00 42.28  ? 483  ASN A CB    1 
ATOM   1493 C  CG    . ASN A 1 191 ? -14.979 -15.064 -26.903 1.00 43.31  ? 483  ASN A CG    1 
ATOM   1494 O  OD1   . ASN A 1 191 ? -15.306 -15.240 -25.727 1.00 45.25  ? 483  ASN A OD1   1 
ATOM   1495 N  ND2   . ASN A 1 191 ? -14.264 -14.016 -27.300 1.00 42.66  ? 483  ASN A ND2   1 
ATOM   1496 N  N     . LEU A 1 192 ? -17.622 -17.692 -25.637 1.00 37.05  ? 484  LEU A N     1 
ATOM   1497 C  CA    . LEU A 1 192 ? -18.909 -17.594 -24.954 1.00 33.59  ? 484  LEU A CA    1 
ATOM   1498 C  C     . LEU A 1 192 ? -19.105 -16.200 -24.342 1.00 39.81  ? 484  LEU A C     1 
ATOM   1499 O  O     . LEU A 1 192 ? -20.210 -15.814 -23.975 1.00 41.87  ? 484  LEU A O     1 
ATOM   1500 C  CB    . LEU A 1 192 ? -18.998 -18.681 -23.879 1.00 38.69  ? 484  LEU A CB    1 
ATOM   1501 C  CG    . LEU A 1 192 ? -20.388 -19.086 -23.393 1.00 43.67  ? 484  LEU A CG    1 
ATOM   1502 C  CD1   . LEU A 1 192 ? -21.392 -18.975 -24.509 1.00 51.65  ? 484  LEU A CD1   1 
ATOM   1503 C  CD2   . LEU A 1 192 ? -20.336 -20.514 -22.861 1.00 44.25  ? 484  LEU A CD2   1 
ATOM   1504 N  N     . ASN A 1 193 ? -18.019 -15.439 -24.259 1.00 38.93  ? 485  ASN A N     1 
ATOM   1505 C  CA    . ASN A 1 193 ? -18.080 -14.068 -23.762 1.00 40.69  ? 485  ASN A CA    1 
ATOM   1506 C  C     . ASN A 1 193 ? -18.234 -13.004 -24.864 1.00 38.32  ? 485  ASN A C     1 
ATOM   1507 O  O     . ASN A 1 193 ? -18.319 -11.806 -24.569 1.00 38.54  ? 485  ASN A O     1 
ATOM   1508 C  CB    . ASN A 1 193 ? -16.859 -13.771 -22.890 1.00 42.52  ? 485  ASN A CB    1 
ATOM   1509 C  CG    . ASN A 1 193 ? -16.793 -14.662 -21.670 1.00 42.60  ? 485  ASN A CG    1 
ATOM   1510 O  OD1   . ASN A 1 193 ? -17.759 -14.767 -20.907 1.00 42.87  ? 485  ASN A OD1   1 
ATOM   1511 N  ND2   . ASN A 1 193 ? -15.664 -15.336 -21.495 1.00 44.85  ? 485  ASN A ND2   1 
ATOM   1512 N  N     . SER A 1 194 ? -18.275 -13.441 -26.126 1.00 38.12  ? 486  SER A N     1 
ATOM   1513 C  CA    . SER A 1 194 ? -18.480 -12.529 -27.263 1.00 38.67  ? 486  SER A CA    1 
ATOM   1514 C  C     . SER A 1 194 ? -19.942 -12.508 -27.709 1.00 34.53  ? 486  SER A C     1 
ATOM   1515 O  O     . SER A 1 194 ? -20.473 -13.528 -28.183 1.00 30.56  ? 486  SER A O     1 
ATOM   1516 C  CB    . SER A 1 194 ? -17.631 -12.974 -28.470 1.00 43.71  ? 486  SER A CB    1 
ATOM   1517 O  OG    . SER A 1 194 ? -18.011 -12.217 -29.627 1.00 44.59  ? 486  SER A OG    1 
ATOM   1518 N  N     . ARG A 1 195 ? -20.598 -11.360 -27.573 1.00 36.23  ? 487  ARG A N     1 
ATOM   1519 C  CA    . ARG A 1 195 ? -21.990 -11.264 -28.003 1.00 32.73  ? 487  ARG A CA    1 
ATOM   1520 C  C     . ARG A 1 195 ? -22.151 -11.446 -29.520 1.00 33.64  ? 487  ARG A C     1 
ATOM   1521 O  O     . ARG A 1 195 ? -23.176 -11.948 -29.979 1.00 32.65  ? 487  ARG A O     1 
ATOM   1522 C  CB    . ARG A 1 195 ? -22.666 -9.973  -27.509 1.00 31.65  ? 487  ARG A CB    1 
ATOM   1523 C  CG    . ARG A 1 195 ? -22.025 -8.670  -27.974 1.00 31.21  ? 487  ARG A CG    1 
ATOM   1524 C  CD    . ARG A 1 195 ? -22.582 -8.133  -29.324 1.00 31.35  ? 487  ARG A CD    1 
ATOM   1525 N  NE    . ARG A 1 195 ? -24.037 -8.216  -29.420 1.00 37.21  ? 487  ARG A NE    1 
ATOM   1526 C  CZ    . ARG A 1 195 ? -24.703 -8.554  -30.525 1.00 36.11  ? 487  ARG A CZ    1 
ATOM   1527 N  NH1   . ARG A 1 195 ? -24.046 -8.829  -31.648 1.00 32.78  ? 487  ARG A NH1   1 
ATOM   1528 N  NH2   . ARG A 1 195 ? -26.028 -8.620  -30.508 1.00 33.35  ? 487  ARG A NH2   1 
ATOM   1529 N  N     . ASP A 1 196 ? -21.137 -11.052 -30.290 1.00 31.03  ? 488  ASP A N     1 
ATOM   1530 C  CA    . ASP A 1 196 ? -21.180 -11.227 -31.742 1.00 33.45  ? 488  ASP A CA    1 
ATOM   1531 C  C     . ASP A 1 196 ? -21.153 -12.717 -32.087 1.00 31.61  ? 488  ASP A C     1 
ATOM   1532 O  O     . ASP A 1 196 ? -21.918 -13.188 -32.930 1.00 34.66  ? 488  ASP A O     1 
ATOM   1533 C  CB    . ASP A 1 196 ? -20.015 -10.499 -32.421 1.00 37.79  ? 488  ASP A CB    1 
ATOM   1534 C  CG    . ASP A 1 196 ? -20.223 -8.994  -32.485 1.00 46.80  ? 488  ASP A CG    1 
ATOM   1535 O  OD1   . ASP A 1 196 ? -21.383 -8.543  -32.363 1.00 46.24  ? 488  ASP A OD1   1 
ATOM   1536 O  OD2   . ASP A 1 196 ? -19.227 -8.263  -32.672 1.00 60.67  ? 488  ASP A OD2   1 
ATOM   1537 N  N     . GLN A 1 197 ? -20.282 -13.459 -31.411 1.00 32.68  ? 489  GLN A N     1 
ATOM   1538 C  CA    . GLN A 1 197 ? -20.237 -14.906 -31.599 1.00 36.43  ? 489  GLN A CA    1 
ATOM   1539 C  C     . GLN A 1 197 ? -21.499 -15.595 -31.091 1.00 34.76  ? 489  GLN A C     1 
ATOM   1540 O  O     . GLN A 1 197 ? -21.983 -16.531 -31.719 1.00 32.87  ? 489  GLN A O     1 
ATOM   1541 C  CB    . GLN A 1 197 ? -18.986 -15.513 -30.968 1.00 38.18  ? 489  GLN A CB    1 
ATOM   1542 C  CG    . GLN A 1 197 ? -17.707 -15.022 -31.624 1.00 46.74  ? 489  GLN A CG    1 
ATOM   1543 C  CD    . GLN A 1 197 ? -16.500 -15.856 -31.266 1.00 49.94  ? 489  GLN A CD    1 
ATOM   1544 O  OE1   . GLN A 1 197 ? -16.611 -17.057 -31.017 1.00 51.47  ? 489  GLN A OE1   1 
ATOM   1545 N  NE2   . GLN A 1 197 ? -15.332 -15.224 -31.246 1.00 51.95  ? 489  GLN A NE2   1 
ATOM   1546 N  N     . LEU A 1 198 ? -22.035 -15.133 -29.963 1.00 34.91  ? 490  LEU A N     1 
ATOM   1547 C  CA    . LEU A 1 198 ? -23.300 -15.668 -29.457 1.00 30.18  ? 490  LEU A CA    1 
ATOM   1548 C  C     . LEU A 1 198 ? -24.428 -15.442 -30.451 1.00 26.61  ? 490  LEU A C     1 
ATOM   1549 O  O     . LEU A 1 198 ? -25.234 -16.342 -30.693 1.00 28.68  ? 490  LEU A O     1 
ATOM   1550 C  CB    . LEU A 1 198 ? -23.687 -15.006 -28.130 1.00 29.50  ? 490  LEU A CB    1 
ATOM   1551 C  CG    . LEU A 1 198 ? -23.557 -15.841 -26.858 1.00 47.96  ? 490  LEU A CG    1 
ATOM   1552 C  CD1   . LEU A 1 198 ? -24.183 -17.228 -27.030 1.00 45.13  ? 490  LEU A CD1   1 
ATOM   1553 C  CD2   . LEU A 1 198 ? -22.098 -15.946 -26.463 1.00 58.78  ? 490  LEU A CD2   1 
ATOM   1554 N  N     . GLU A 1 199 ? -24.501 -14.226 -30.996 1.00 24.83  ? 491  GLU A N     1 
ATOM   1555 C  CA    . GLU A 1 199 ? -25.550 -13.888 -31.954 1.00 27.21  ? 491  GLU A CA    1 
ATOM   1556 C  C     . GLU A 1 199 ? -25.535 -14.891 -33.111 1.00 30.06  ? 491  GLU A C     1 
ATOM   1557 O  O     . GLU A 1 199 ? -26.576 -15.391 -33.530 1.00 29.90  ? 491  GLU A O     1 
ATOM   1558 C  CB    . GLU A 1 199 ? -25.379 -12.459 -32.497 1.00 29.50  ? 491  GLU A CB    1 
ATOM   1559 C  CG    . GLU A 1 199 ? -26.470 -12.067 -33.498 1.00 33.49  ? 491  GLU A CG    1 
ATOM   1560 C  CD    . GLU A 1 199 ? -26.265 -10.695 -34.137 1.00 39.56  ? 491  GLU A CD    1 
ATOM   1561 O  OE1   . GLU A 1 199 ? -25.275 -10.010 -33.810 1.00 32.21  ? 491  GLU A OE1   1 
ATOM   1562 O  OE2   . GLU A 1 199 ? -27.106 -10.304 -34.977 1.00 39.39  ? 491  GLU A OE2   1 
ATOM   1563 N  N     . ARG A 1 200 ? -24.342 -15.189 -33.602 1.00 29.17  ? 492  ARG A N     1 
ATOM   1564 C  CA    . ARG A 1 200 ? -24.177 -16.129 -34.713 1.00 33.31  ? 492  ARG A CA    1 
ATOM   1565 C  C     . ARG A 1 200 ? -24.686 -17.516 -34.330 1.00 36.38  ? 492  ARG A C     1 
ATOM   1566 O  O     . ARG A 1 200 ? -25.507 -18.116 -35.039 1.00 33.66  ? 492  ARG A O     1 
ATOM   1567 C  CB    . ARG A 1 200 ? -22.701 -16.209 -35.098 1.00 42.85  ? 492  ARG A CB    1 
ATOM   1568 C  CG    . ARG A 1 200 ? -22.388 -17.174 -36.227 1.00 55.71  ? 492  ARG A CG    1 
ATOM   1569 C  CD    . ARG A 1 200 ? -20.886 -17.399 -36.345 1.00 67.52  ? 492  ARG A CD    1 
ATOM   1570 N  NE    . ARG A 1 200 ? -20.353 -18.141 -35.204 1.00 78.20  ? 492  ARG A NE    1 
ATOM   1571 C  CZ    . ARG A 1 200 ? -19.232 -17.827 -34.559 1.00 82.49  ? 492  ARG A CZ    1 
ATOM   1572 N  NH1   . ARG A 1 200 ? -18.515 -16.778 -34.939 1.00 81.39  ? 492  ARG A NH1   1 
ATOM   1573 N  NH2   . ARG A 1 200 ? -18.829 -18.565 -33.533 1.00 84.10  ? 492  ARG A NH2   1 
ATOM   1574 N  N     . VAL A 1 201 ? -24.203 -18.018 -33.196 1.00 33.01  ? 493  VAL A N     1 
ATOM   1575 C  CA    . VAL A 1 201 ? -24.581 -19.354 -32.729 1.00 29.05  ? 493  VAL A CA    1 
ATOM   1576 C  C     . VAL A 1 201 ? -26.091 -19.490 -32.530 1.00 34.09  ? 493  VAL A C     1 
ATOM   1577 O  O     . VAL A 1 201 ? -26.712 -20.414 -33.058 1.00 31.23  ? 493  VAL A O     1 
ATOM   1578 C  CB    . VAL A 1 201 ? -23.855 -19.718 -31.424 1.00 31.60  ? 493  VAL A CB    1 
ATOM   1579 C  CG1   . VAL A 1 201 ? -24.454 -20.995 -30.820 1.00 30.98  ? 493  VAL A CG1   1 
ATOM   1580 C  CG2   . VAL A 1 201 ? -22.365 -19.858 -31.673 1.00 36.94  ? 493  VAL A CG2   1 
ATOM   1581 N  N     . LEU A 1 202 ? -26.680 -18.559 -31.782 1.00 30.27  ? 494  LEU A N     1 
ATOM   1582 C  CA    . LEU A 1 202 ? -28.109 -18.603 -31.485 1.00 24.71  ? 494  LEU A CA    1 
ATOM   1583 C  C     . LEU A 1 202 ? -28.994 -18.425 -32.713 1.00 27.48  ? 494  LEU A C     1 
ATOM   1584 O  O     . LEU A 1 202 ? -29.965 -19.148 -32.895 1.00 32.22  ? 494  LEU A O     1 
ATOM   1585 C  CB    . LEU A 1 202 ? -28.487 -17.537 -30.444 1.00 23.56  ? 494  LEU A CB    1 
ATOM   1586 C  CG    . LEU A 1 202 ? -27.918 -17.741 -29.038 1.00 23.58  ? 494  LEU A CG    1 
ATOM   1587 C  CD1   . LEU A 1 202 ? -28.348 -16.587 -28.110 1.00 27.37  ? 494  LEU A CD1   1 
ATOM   1588 C  CD2   . LEU A 1 202 ? -28.351 -19.088 -28.471 1.00 33.83  ? 494  LEU A CD2   1 
ATOM   1589 N  N     . PHE A 1 203 ? -28.673 -17.442 -33.547 1.00 25.53  ? 495  PHE A N     1 
ATOM   1590 C  CA    . PHE A 1 203 ? -29.642 -17.025 -34.559 1.00 25.67  ? 495  PHE A CA    1 
ATOM   1591 C  C     . PHE A 1 203 ? -29.331 -17.542 -35.969 1.00 36.23  ? 495  PHE A C     1 
ATOM   1592 O  O     . PHE A 1 203 ? -30.239 -17.723 -36.772 1.00 39.59  ? 495  PHE A O     1 
ATOM   1593 C  CB    . PHE A 1 203 ? -29.807 -15.504 -34.555 1.00 24.36  ? 495  PHE A CB    1 
ATOM   1594 C  CG    . PHE A 1 203 ? -30.238 -14.944 -33.207 1.00 26.17  ? 495  PHE A CG    1 
ATOM   1595 C  CD1   . PHE A 1 203 ? -31.413 -15.371 -32.609 1.00 30.64  ? 495  PHE A CD1   1 
ATOM   1596 C  CD2   . PHE A 1 203 ? -29.463 -13.997 -32.552 1.00 28.89  ? 495  PHE A CD2   1 
ATOM   1597 C  CE1   . PHE A 1 203 ? -31.806 -14.870 -31.364 1.00 31.58  ? 495  PHE A CE1   1 
ATOM   1598 C  CE2   . PHE A 1 203 ? -29.852 -13.487 -31.313 1.00 26.91  ? 495  PHE A CE2   1 
ATOM   1599 C  CZ    . PHE A 1 203 ? -31.022 -13.921 -30.727 1.00 30.05  ? 495  PHE A CZ    1 
ATOM   1600 N  N     . ASP A 1 204 ? -28.056 -17.753 -36.269 1.00 37.76  ? 496  ASP A N     1 
ATOM   1601 C  CA    . ASP A 1 204 ? -27.671 -18.325 -37.557 1.00 38.08  ? 496  ASP A CA    1 
ATOM   1602 C  C     . ASP A 1 204 ? -27.551 -19.842 -37.455 1.00 43.44  ? 496  ASP A C     1 
ATOM   1603 O  O     . ASP A 1 204 ? -28.298 -20.575 -38.106 1.00 44.74  ? 496  ASP A O     1 
ATOM   1604 C  CB    . ASP A 1 204 ? -26.357 -17.723 -38.055 1.00 38.15  ? 496  ASP A CB    1 
ATOM   1605 C  CG    . ASP A 1 204 ? -26.495 -16.258 -38.444 1.00 37.73  ? 496  ASP A CG    1 
ATOM   1606 O  OD1   . ASP A 1 204 ? -27.609 -15.855 -38.835 1.00 43.09  ? 496  ASP A OD1   1 
ATOM   1607 O  OD2   . ASP A 1 204 ? -25.491 -15.521 -38.359 1.00 45.89  ? 496  ASP A OD2   1 
ATOM   1608 N  N     . GLU A 1 205 ? -26.621 -20.312 -36.627 1.00 33.22  ? 497  GLU A N     1 
ATOM   1609 C  CA    . GLU A 1 205 ? -26.345 -21.744 -36.537 1.00 30.86  ? 497  GLU A CA    1 
ATOM   1610 C  C     . GLU A 1 205 ? -27.519 -22.554 -35.992 1.00 36.93  ? 497  GLU A C     1 
ATOM   1611 O  O     . GLU A 1 205 ? -27.940 -23.536 -36.605 1.00 35.97  ? 497  GLU A O     1 
ATOM   1612 C  CB    . GLU A 1 205 ? -25.067 -22.007 -35.737 1.00 37.05  ? 497  GLU A CB    1 
ATOM   1613 C  CG    . GLU A 1 205 ? -23.812 -21.478 -36.425 1.00 49.34  ? 497  GLU A CG    1 
ATOM   1614 C  CD    . GLU A 1 205 ? -22.567 -21.618 -35.572 1.00 55.16  ? 497  GLU A CD    1 
ATOM   1615 O  OE1   . GLU A 1 205 ? -22.639 -22.292 -34.524 1.00 54.29  ? 497  GLU A OE1   1 
ATOM   1616 O  OE2   . GLU A 1 205 ? -21.517 -21.049 -35.945 1.00 62.63  ? 497  GLU A OE2   1 
ATOM   1617 N  N     . LEU A 1 206 ? -28.063 -22.142 -34.852 1.00 29.98  ? 498  LEU A N     1 
ATOM   1618 C  CA    . LEU A 1 206 ? -29.192 -22.858 -34.263 1.00 30.56  ? 498  LEU A CA    1 
ATOM   1619 C  C     . LEU A 1 206 ? -30.544 -22.344 -34.755 1.00 33.96  ? 498  LEU A C     1 
ATOM   1620 O  O     . LEU A 1 206 ? -31.577 -22.921 -34.433 1.00 36.57  ? 498  LEU A O     1 
ATOM   1621 C  CB    . LEU A 1 206 ? -29.141 -22.801 -32.733 1.00 31.25  ? 498  LEU A CB    1 
ATOM   1622 C  CG    . LEU A 1 206 ? -27.884 -23.354 -32.062 1.00 30.70  ? 498  LEU A CG    1 
ATOM   1623 C  CD1   . LEU A 1 206 ? -27.943 -23.112 -30.553 1.00 32.63  ? 498  LEU A CD1   1 
ATOM   1624 C  CD2   . LEU A 1 206 ? -27.714 -24.842 -32.361 1.00 28.95  ? 498  LEU A CD2   1 
ATOM   1625 N  N     . GLY A 1 207 ? -30.534 -21.249 -35.510 1.00 30.35  ? 499  GLY A N     1 
ATOM   1626 C  CA    . GLY A 1 207 ? -31.741 -20.727 -36.138 1.00 32.66  ? 499  GLY A CA    1 
ATOM   1627 C  C     . GLY A 1 207 ? -32.880 -20.287 -35.235 1.00 36.33  ? 499  GLY A C     1 
ATOM   1628 O  O     . GLY A 1 207 ? -34.046 -20.288 -35.644 1.00 30.40  ? 499  GLY A O     1 
ATOM   1629 N  N     . LEU A 1 208 ? -32.563 -19.884 -34.006 1.00 28.08  ? 500  LEU A N     1 
ATOM   1630 C  CA    . LEU A 1 208 ? -33.602 -19.433 -33.101 1.00 28.96  ? 500  LEU A CA    1 
ATOM   1631 C  C     . LEU A 1 208 ? -34.150 -18.102 -33.604 1.00 31.41  ? 500  LEU A C     1 
ATOM   1632 O  O     . LEU A 1 208 ? -33.427 -17.336 -34.237 1.00 30.53  ? 500  LEU A O     1 
ATOM   1633 C  CB    . LEU A 1 208 ? -33.057 -19.300 -31.674 1.00 27.47  ? 500  LEU A CB    1 
ATOM   1634 C  CG    . LEU A 1 208 ? -32.368 -20.554 -31.120 1.00 33.52  ? 500  LEU A CG    1 
ATOM   1635 C  CD1   . LEU A 1 208 ? -31.947 -20.345 -29.664 1.00 33.49  ? 500  LEU A CD1   1 
ATOM   1636 C  CD2   . LEU A 1 208 ? -33.257 -21.777 -31.243 1.00 36.89  ? 500  LEU A CD2   1 
ATOM   1637 N  N     . PRO A 1 209 ? -35.439 -17.842 -33.360 1.00 29.49  ? 501  PRO A N     1 
ATOM   1638 C  CA    . PRO A 1 209 ? -36.007 -16.571 -33.829 1.00 32.08  ? 501  PRO A CA    1 
ATOM   1639 C  C     . PRO A 1 209 ? -35.481 -15.386 -33.020 1.00 37.00  ? 501  PRO A C     1 
ATOM   1640 O  O     . PRO A 1 209 ? -35.402 -15.470 -31.792 1.00 34.71  ? 501  PRO A O     1 
ATOM   1641 C  CB    . PRO A 1 209 ? -37.511 -16.754 -33.610 1.00 36.65  ? 501  PRO A CB    1 
ATOM   1642 C  CG    . PRO A 1 209 ? -37.637 -17.842 -32.595 1.00 35.02  ? 501  PRO A CG    1 
ATOM   1643 C  CD    . PRO A 1 209 ? -36.460 -18.747 -32.805 1.00 33.85  ? 501  PRO A CD    1 
ATOM   1644 N  N     . ALA A 1 210 ? -35.108 -14.307 -33.699 1.00 36.67  ? 502  ALA A N     1 
ATOM   1645 C  CA    . ALA A 1 210 ? -34.647 -13.110 -33.007 1.00 42.45  ? 502  ALA A CA    1 
ATOM   1646 C  C     . ALA A 1 210 ? -35.853 -12.323 -32.507 1.00 50.79  ? 502  ALA A C     1 
ATOM   1647 O  O     . ALA A 1 210 ? -36.901 -12.302 -33.149 1.00 54.37  ? 502  ALA A O     1 
ATOM   1648 C  CB    . ALA A 1 210 ? -33.793 -12.260 -33.922 1.00 48.84  ? 502  ALA A CB    1 
ATOM   1649 N  N     . ILE A 1 211 ? -35.713 -11.688 -31.353 1.00 58.62  ? 503  ILE A N     1 
ATOM   1650 C  CA    . ILE A 1 211 ? -36.827 -10.957 -30.771 1.00 67.83  ? 503  ILE A CA    1 
ATOM   1651 C  C     . ILE A 1 211 ? -36.575 -9.460  -30.838 1.00 64.49  ? 503  ILE A C     1 
ATOM   1652 O  O     . ILE A 1 211 ? -37.403 -8.700  -31.334 1.00 76.20  ? 503  ILE A O     1 
ATOM   1653 C  CB    . ILE A 1 211 ? -37.069 -11.374 -29.310 1.00 74.12  ? 503  ILE A CB    1 
ATOM   1654 C  CG1   . ILE A 1 211 ? -37.113 -12.898 -29.198 1.00 74.95  ? 503  ILE A CG1   1 
ATOM   1655 C  CG2   . ILE A 1 211 ? -38.353 -10.753 -28.776 1.00 73.88  ? 503  ILE A CG2   1 
ATOM   1656 C  CD1   . ILE A 1 211 ? -37.456 -13.386 -27.826 1.00 72.21  ? 503  ILE A CD1   1 
ATOM   1657 N  N     . GLY A 1 212 ? -35.417 -9.044  -30.346 1.00 55.62  ? 504  GLY A N     1 
ATOM   1658 C  CA    . GLY A 1 212 ? -35.095 -7.636  -30.274 1.00 53.50  ? 504  GLY A CA    1 
ATOM   1659 C  C     . GLY A 1 212 ? -33.899 -7.241  -31.114 1.00 43.75  ? 504  GLY A C     1 
ATOM   1660 O  O     . GLY A 1 212 ? -33.063 -8.065  -31.487 1.00 38.30  ? 504  GLY A O     1 
ATOM   1661 N  N     . LYS A 1 213 ? -33.826 -5.955  -31.412 1.00 41.31  ? 505  LYS A N     1 
ATOM   1662 C  CA    . LYS A 1 213 ? -32.703 -5.401  -32.137 1.00 40.18  ? 505  LYS A CA    1 
ATOM   1663 C  C     . LYS A 1 213 ? -31.867 -4.570  -31.176 1.00 40.37  ? 505  LYS A C     1 
ATOM   1664 O  O     . LYS A 1 213 ? -32.391 -4.020  -30.206 1.00 43.24  ? 505  LYS A O     1 
ATOM   1665 C  CB    . LYS A 1 213 ? -33.217 -4.542  -33.291 1.00 44.94  ? 505  LYS A CB    1 
ATOM   1666 C  CG    . LYS A 1 213 ? -34.159 -5.294  -34.220 1.00 59.50  ? 505  LYS A CG    1 
ATOM   1667 C  CD    . LYS A 1 213 ? -33.475 -5.658  -35.526 1.00 69.77  ? 505  LYS A CD    1 
ATOM   1668 C  CE    . LYS A 1 213 ? -33.637 -4.546  -36.550 1.00 71.72  ? 505  LYS A CE    1 
ATOM   1669 N  NZ    . LYS A 1 213 ? -32.518 -4.527  -37.532 1.00 67.62  ? 505  LYS A NZ    1 
ATOM   1670 N  N     . THR A 1 214 ? -30.567 -4.490  -31.424 1.00 32.42  ? 506  THR A N     1 
ATOM   1671 C  CA    . THR A 1 214 ? -29.710 -3.654  -30.592 1.00 31.80  ? 506  THR A CA    1 
ATOM   1672 C  C     . THR A 1 214 ? -30.031 -2.199  -30.932 1.00 37.63  ? 506  THR A C     1 
ATOM   1673 O  O     . THR A 1 214 ? -30.590 -1.915  -31.995 1.00 39.38  ? 506  THR A O     1 
ATOM   1674 C  CB    . THR A 1 214 ? -28.209 -3.952  -30.801 1.00 34.82  ? 506  THR A CB    1 
ATOM   1675 O  OG1   . THR A 1 214 ? -27.837 -3.643  -32.146 1.00 31.60  ? 506  THR A OG1   1 
ATOM   1676 C  CG2   . THR A 1 214 ? -27.888 -5.429  -30.529 1.00 31.05  ? 506  THR A CG2   1 
ATOM   1677 N  N     . GLU A 1 215 ? -29.690 -1.284  -30.030 1.00 41.37  ? 507  GLU A N     1 
ATOM   1678 C  CA    . GLU A 1 215 ? -30.106 0.112   -30.163 1.00 43.95  ? 507  GLU A CA    1 
ATOM   1679 C  C     . GLU A 1 215 ? -29.497 0.854   -31.353 1.00 47.00  ? 507  GLU A C     1 
ATOM   1680 O  O     . GLU A 1 215 ? -30.219 1.339   -32.222 1.00 49.27  ? 507  GLU A O     1 
ATOM   1681 C  CB    . GLU A 1 215 ? -29.841 0.873   -28.859 1.00 47.25  ? 507  GLU A CB    1 
ATOM   1682 C  CG    . GLU A 1 215 ? -30.802 0.491   -27.740 1.00 63.93  ? 507  GLU A CG    1 
ATOM   1683 C  CD    . GLU A 1 215 ? -30.107 0.269   -26.410 1.00 83.09  ? 507  GLU A CD    1 
ATOM   1684 O  OE1   . GLU A 1 215 ? -28.878 0.483   -26.333 1.00 91.89  ? 507  GLU A OE1   1 
ATOM   1685 O  OE2   . GLU A 1 215 ? -30.793 -0.126  -25.441 1.00 85.42  ? 507  GLU A OE2   1 
ATOM   1686 N  N     . LYS A 1 216 ? -28.173 0.935   -31.392 1.00 39.48  ? 508  LYS A N     1 
ATOM   1687 C  CA    . LYS A 1 216 ? -27.493 1.756   -32.387 1.00 48.26  ? 508  LYS A CA    1 
ATOM   1688 C  C     . LYS A 1 216 ? -27.329 1.056   -33.732 1.00 48.01  ? 508  LYS A C     1 
ATOM   1689 O  O     . LYS A 1 216 ? -27.506 1.670   -34.783 1.00 55.99  ? 508  LYS A O     1 
ATOM   1690 C  CB    . LYS A 1 216 ? -26.115 2.178   -31.871 1.00 60.92  ? 508  LYS A CB    1 
ATOM   1691 C  CG    . LYS A 1 216 ? -26.108 2.751   -30.459 1.00 69.52  ? 508  LYS A CG    1 
ATOM   1692 C  CD    . LYS A 1 216 ? -26.434 4.226   -30.435 1.00 79.35  ? 508  LYS A CD    1 
ATOM   1693 C  CE    . LYS A 1 216 ? -26.332 4.775   -29.021 1.00 88.04  ? 508  LYS A CE    1 
ATOM   1694 N  NZ    . LYS A 1 216 ? -27.299 4.106   -28.102 1.00 94.23  ? 508  LYS A NZ    1 
ATOM   1695 N  N     . THR A 1 217 ? -26.978 -0.225  -33.699 1.00 40.96  ? 509  THR A N     1 
ATOM   1696 C  CA    . THR A 1 217 ? -26.565 -0.923  -34.913 1.00 40.89  ? 509  THR A CA    1 
ATOM   1697 C  C     . THR A 1 217 ? -27.636 -1.868  -35.454 1.00 35.81  ? 509  THR A C     1 
ATOM   1698 O  O     . THR A 1 217 ? -27.508 -2.405  -36.556 1.00 40.33  ? 509  THR A O     1 
ATOM   1699 C  CB    . THR A 1 217 ? -25.231 -1.667  -34.698 1.00 46.47  ? 509  THR A CB    1 
ATOM   1700 O  OG1   . THR A 1 217 ? -25.378 -2.634  -33.648 1.00 46.20  ? 509  THR A OG1   1 
ATOM   1701 C  CG2   . THR A 1 217 ? -24.143 -0.678  -34.313 1.00 45.86  ? 509  THR A CG2   1 
ATOM   1702 N  N     . GLY A 1 218 ? -28.700 -2.053  -34.683 1.00 35.38  ? 510  GLY A N     1 
ATOM   1703 C  CA    . GLY A 1 218 ? -29.839 -2.836  -35.128 1.00 34.20  ? 510  GLY A CA    1 
ATOM   1704 C  C     . GLY A 1 218 ? -29.543 -4.312  -35.313 1.00 36.96  ? 510  GLY A C     1 
ATOM   1705 O  O     . GLY A 1 218 ? -30.277 -5.009  -36.018 1.00 32.76  ? 510  GLY A O     1 
ATOM   1706 N  N     . LYS A 1 219 ? -28.470 -4.789  -34.686 1.00 33.12  ? 511  LYS A N     1 
ATOM   1707 C  CA    . LYS A 1 219 ? -28.118 -6.213  -34.727 1.00 32.16  ? 511  LYS A CA    1 
ATOM   1708 C  C     . LYS A 1 219 ? -29.124 -7.027  -33.921 1.00 33.24  ? 511  LYS A C     1 
ATOM   1709 O  O     . LYS A 1 219 ? -29.925 -6.468  -33.175 1.00 32.31  ? 511  LYS A O     1 
ATOM   1710 C  CB    . LYS A 1 219 ? -26.718 -6.430  -34.169 1.00 33.50  ? 511  LYS A CB    1 
ATOM   1711 C  CG    . LYS A 1 219 ? -25.621 -5.777  -34.977 1.00 44.13  ? 511  LYS A CG    1 
ATOM   1712 C  CD    . LYS A 1 219 ? -24.257 -6.126  -34.431 1.00 49.41  ? 511  LYS A CD    1 
ATOM   1713 C  CE    . LYS A 1 219 ? -23.173 -5.400  -35.200 1.00 59.94  ? 511  LYS A CE    1 
ATOM   1714 N  NZ    . LYS A 1 219 ? -23.290 -5.653  -36.663 1.00 68.88  ? 511  LYS A NZ    1 
ATOM   1715 N  N     . ARG A 1 220 ? -29.097 -8.348  -34.066 1.00 24.68  ? 512  ARG A N     1 
ATOM   1716 C  CA    . ARG A 1 220 ? -29.998 -9.178  -33.281 1.00 26.22  ? 512  ARG A CA    1 
ATOM   1717 C  C     . ARG A 1 220 ? -29.481 -9.215  -31.839 1.00 27.84  ? 512  ARG A C     1 
ATOM   1718 O  O     . ARG A 1 220 ? -28.373 -9.683  -31.580 1.00 28.46  ? 512  ARG A O     1 
ATOM   1719 C  CB    . ARG A 1 220 ? -30.093 -10.586 -33.873 1.00 29.75  ? 512  ARG A CB    1 
ATOM   1720 C  CG    . ARG A 1 220 ? -30.779 -10.597 -35.249 1.00 32.06  ? 512  ARG A CG    1 
ATOM   1721 C  CD    . ARG A 1 220 ? -30.486 -11.878 -36.022 1.00 29.53  ? 512  ARG A CD    1 
ATOM   1722 N  NE    . ARG A 1 220 ? -29.059 -12.074 -36.274 1.00 30.17  ? 512  ARG A NE    1 
ATOM   1723 C  CZ    . ARG A 1 220 ? -28.567 -13.058 -37.025 1.00 32.49  ? 512  ARG A CZ    1 
ATOM   1724 N  NH1   . ARG A 1 220 ? -29.387 -13.922 -37.610 1.00 31.67  ? 512  ARG A NH1   1 
ATOM   1725 N  NH2   . ARG A 1 220 ? -27.264 -13.179 -37.193 1.00 33.20  ? 512  ARG A NH2   1 
ATOM   1726 N  N     . SER A 1 221 ? -30.273 -8.686  -30.918 1.00 27.60  ? 513  SER A N     1 
ATOM   1727 C  CA    . SER A 1 221 ? -29.838 -8.602  -29.521 1.00 26.40  ? 513  SER A CA    1 
ATOM   1728 C  C     . SER A 1 221 ? -29.780 -9.975  -28.865 1.00 26.57  ? 513  SER A C     1 
ATOM   1729 O  O     . SER A 1 221 ? -30.579 -10.871 -29.182 1.00 28.20  ? 513  SER A O     1 
ATOM   1730 C  CB    . SER A 1 221 ? -30.765 -7.684  -28.716 1.00 29.50  ? 513  SER A CB    1 
ATOM   1731 O  OG    . SER A 1 221 ? -30.388 -7.664  -27.344 1.00 30.74  ? 513  SER A OG    1 
ATOM   1732 N  N     . THR A 1 222 ? -28.816 -10.131 -27.961 1.00 25.45  ? 514  THR A N     1 
ATOM   1733 C  CA    . THR A 1 222 ? -28.696 -11.325 -27.127 1.00 25.81  ? 514  THR A CA    1 
ATOM   1734 C  C     . THR A 1 222 ? -28.858 -10.963 -25.651 1.00 27.14  ? 514  THR A C     1 
ATOM   1735 O  O     . THR A 1 222 ? -28.446 -11.727 -24.773 1.00 28.06  ? 514  THR A O     1 
ATOM   1736 C  CB    . THR A 1 222 ? -27.316 -11.993 -27.277 1.00 27.85  ? 514  THR A CB    1 
ATOM   1737 O  OG1   . THR A 1 222 ? -26.285 -11.134 -26.751 1.00 27.84  ? 514  THR A OG1   1 
ATOM   1738 C  CG2   . THR A 1 222 ? -27.015 -12.299 -28.745 1.00 28.87  ? 514  THR A CG2   1 
ATOM   1739 N  N     . ARG A 1 223 ? -29.435 -9.802  -25.376 1.00 25.51  ? 515  ARG A N     1 
ATOM   1740 C  CA    A ARG A 1 223 ? -29.590 -9.331  -23.998 0.59 26.53  ? 515  ARG A CA    1 
ATOM   1741 C  CA    B ARG A 1 223 ? -29.554 -9.357  -23.992 0.41 26.57  ? 515  ARG A CA    1 
ATOM   1742 C  C     . ARG A 1 223 ? -30.456 -10.300 -23.196 1.00 31.92  ? 515  ARG A C     1 
ATOM   1743 O  O     . ARG A 1 223 ? -31.257 -11.045 -23.767 1.00 27.99  ? 515  ARG A O     1 
ATOM   1744 C  CB    A ARG A 1 223 ? -30.188 -7.922  -23.970 0.59 28.44  ? 515  ARG A CB    1 
ATOM   1745 C  CB    B ARG A 1 223 ? -30.045 -7.912  -23.917 0.41 27.36  ? 515  ARG A CB    1 
ATOM   1746 C  CG    A ARG A 1 223 ? -31.673 -7.856  -24.296 0.59 26.62  ? 515  ARG A CG    1 
ATOM   1747 C  CG    B ARG A 1 223 ? -31.517 -7.725  -24.207 0.41 28.18  ? 515  ARG A CG    1 
ATOM   1748 C  CD    A ARG A 1 223 ? -32.207 -6.430  -24.221 0.59 33.24  ? 515  ARG A CD    1 
ATOM   1749 C  CD    B ARG A 1 223 ? -31.883 -6.253  -24.174 0.41 33.89  ? 515  ARG A CD    1 
ATOM   1750 N  NE    A ARG A 1 223 ? -31.567 -5.545  -25.191 0.59 35.45  ? 515  ARG A NE    1 
ATOM   1751 N  NE    B ARG A 1 223 ? -32.124 -5.727  -25.509 0.41 38.22  ? 515  ARG A NE    1 
ATOM   1752 C  CZ    A ARG A 1 223 ? -32.074 -5.260  -26.388 0.59 36.42  ? 515  ARG A CZ    1 
ATOM   1753 C  CZ    B ARG A 1 223 ? -33.297 -5.782  -26.130 0.41 37.64  ? 515  ARG A CZ    1 
ATOM   1754 N  NH1   A ARG A 1 223 ? -33.232 -5.791  -26.761 0.59 35.30  ? 515  ARG A NH1   1 
ATOM   1755 N  NH1   B ARG A 1 223 ? -34.341 -6.340  -25.533 0.41 34.20  ? 515  ARG A NH1   1 
ATOM   1756 N  NH2   A ARG A 1 223 ? -31.427 -4.445  -27.209 0.59 27.61  ? 515  ARG A NH2   1 
ATOM   1757 N  NH2   B ARG A 1 223 ? -33.426 -5.278  -27.348 0.41 39.27  ? 515  ARG A NH2   1 
ATOM   1758 N  N     . ALA A 1 224 ? -30.300 -10.284 -21.875 1.00 27.63  ? 516  ALA A N     1 
ATOM   1759 C  CA    . ALA A 1 224 ? -31.013 -11.214 -21.000 1.00 31.12  ? 516  ALA A CA    1 
ATOM   1760 C  C     . ALA A 1 224 ? -32.518 -11.314 -21.259 1.00 30.04  ? 516  ALA A C     1 
ATOM   1761 O  O     . ALA A 1 224 ? -33.076 -12.412 -21.241 1.00 36.03  ? 516  ALA A O     1 
ATOM   1762 C  CB    . ALA A 1 224 ? -30.730 -10.882 -19.523 1.00 32.50  ? 516  ALA A CB    1 
ATOM   1763 N  N     . ALA A 1 225 ? -33.175 -10.180 -21.507 1.00 32.37  ? 517  ALA A N     1 
ATOM   1764 C  CA    . ALA A 1 225 ? -34.617 -10.169 -21.753 1.00 33.38  ? 517  ALA A CA    1 
ATOM   1765 C  C     . ALA A 1 225 ? -35.017 -10.991 -22.989 1.00 37.72  ? 517  ALA A C     1 
ATOM   1766 O  O     . ALA A 1 225 ? -36.051 -11.645 -22.997 1.00 34.04  ? 517  ALA A O     1 
ATOM   1767 C  CB    . ALA A 1 225 ? -35.134 -8.741  -21.867 1.00 38.15  ? 517  ALA A CB    1 
ATOM   1768 N  N     . VAL A 1 226 ? -34.195 -10.943 -24.030 1.00 30.68  ? 518  VAL A N     1 
ATOM   1769 C  CA    . VAL A 1 226 ? -34.436 -11.735 -25.232 1.00 28.15  ? 518  VAL A CA    1 
ATOM   1770 C  C     . VAL A 1 226 ? -34.233 -13.217 -24.926 1.00 34.87  ? 518  VAL A C     1 
ATOM   1771 O  O     . VAL A 1 226 ? -35.061 -14.051 -25.282 1.00 33.29  ? 518  VAL A O     1 
ATOM   1772 C  CB    . VAL A 1 226 ? -33.500 -11.291 -26.390 1.00 32.85  ? 518  VAL A CB    1 
ATOM   1773 C  CG1   . VAL A 1 226 ? -33.572 -12.270 -27.568 1.00 29.41  ? 518  VAL A CG1   1 
ATOM   1774 C  CG2   . VAL A 1 226 ? -33.835 -9.866  -26.826 1.00 35.71  ? 518  VAL A CG2   1 
ATOM   1775 N  N     . LEU A 1 227 ? -33.135 -13.535 -24.247 1.00 30.45  ? 519  LEU A N     1 
ATOM   1776 C  CA    . LEU A 1 227 ? -32.837 -14.918 -23.888 1.00 28.14  ? 519  LEU A CA    1 
ATOM   1777 C  C     . LEU A 1 227 ? -33.913 -15.497 -22.961 1.00 33.66  ? 519  LEU A C     1 
ATOM   1778 O  O     . LEU A 1 227 ? -34.320 -16.648 -23.116 1.00 32.13  ? 519  LEU A O     1 
ATOM   1779 C  CB    . LEU A 1 227 ? -31.455 -15.007 -23.245 1.00 31.91  ? 519  LEU A CB    1 
ATOM   1780 C  CG    . LEU A 1 227 ? -30.258 -15.433 -24.101 1.00 43.97  ? 519  LEU A CG    1 
ATOM   1781 C  CD1   . LEU A 1 227 ? -30.321 -14.873 -25.511 1.00 38.81  ? 519  LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A 1 227 ? -28.949 -15.044 -23.426 1.00 40.78  ? 519  LEU A CD2   1 
ATOM   1783 N  N     . GLU A 1 228 ? -34.383 -14.696 -22.006 1.00 33.19  ? 520  GLU A N     1 
ATOM   1784 C  CA    . GLU A 1 228 ? -35.450 -15.145 -21.111 1.00 36.05  ? 520  GLU A CA    1 
ATOM   1785 C  C     . GLU A 1 228 ? -36.690 -15.561 -21.896 1.00 38.72  ? 520  GLU A C     1 
ATOM   1786 O  O     . GLU A 1 228 ? -37.334 -16.564 -21.582 1.00 39.49  ? 520  GLU A O     1 
ATOM   1787 C  CB    . GLU A 1 228 ? -35.811 -14.058 -20.098 1.00 42.21  ? 520  GLU A CB    1 
ATOM   1788 C  CG    . GLU A 1 228 ? -34.784 -13.871 -18.992 1.00 52.57  ? 520  GLU A CG    1 
ATOM   1789 C  CD    . GLU A 1 228 ? -34.813 -14.993 -17.972 1.00 70.15  ? 520  GLU A CD    1 
ATOM   1790 O  OE1   . GLU A 1 228 ? -35.738 -15.832 -18.029 1.00 77.11  ? 520  GLU A OE1   1 
ATOM   1791 O  OE2   . GLU A 1 228 ? -33.913 -15.035 -17.107 1.00 78.75  ? 520  GLU A OE2   1 
ATOM   1792 N  N     . ALA A 1 229 ? -37.010 -14.795 -22.933 1.00 32.19  ? 521  ALA A N     1 
ATOM   1793 C  CA    . ALA A 1 229 ? -38.173 -15.084 -23.755 1.00 34.98  ? 521  ALA A CA    1 
ATOM   1794 C  C     . ALA A 1 229 ? -37.941 -16.284 -24.680 1.00 41.55  ? 521  ALA A C     1 
ATOM   1795 O  O     . ALA A 1 229 ? -38.893 -16.863 -25.196 1.00 40.18  ? 521  ALA A O     1 
ATOM   1796 C  CB    . ALA A 1 229 ? -38.565 -13.863 -24.555 1.00 36.51  ? 521  ALA A CB    1 
ATOM   1797 N  N     . LEU A 1 230 ? -36.678 -16.648 -24.890 1.00 34.81  ? 522  LEU A N     1 
ATOM   1798 C  CA    . LEU A 1 230 ? -36.339 -17.813 -25.713 1.00 33.76  ? 522  LEU A CA    1 
ATOM   1799 C  C     . LEU A 1 230 ? -35.974 -19.043 -24.880 1.00 33.78  ? 522  LEU A C     1 
ATOM   1800 O  O     . LEU A 1 230 ? -35.416 -20.009 -25.406 1.00 35.10  ? 522  LEU A O     1 
ATOM   1801 C  CB    . LEU A 1 230 ? -35.182 -17.484 -26.656 1.00 30.99  ? 522  LEU A CB    1 
ATOM   1802 C  CG    . LEU A 1 230 ? -35.527 -16.502 -27.773 1.00 35.00  ? 522  LEU A CG    1 
ATOM   1803 C  CD1   . LEU A 1 230 ? -34.268 -16.044 -28.483 1.00 34.15  ? 522  LEU A CD1   1 
ATOM   1804 C  CD2   . LEU A 1 230 ? -36.506 -17.151 -28.753 1.00 36.80  ? 522  LEU A CD2   1 
ATOM   1805 N  N     . ARG A 1 231 ? -36.291 -19.001 -23.585 1.00 31.66  ? 523  ARG A N     1 
ATOM   1806 C  CA    . ARG A 1 231 ? -35.911 -20.058 -22.650 1.00 34.01  ? 523  ARG A CA    1 
ATOM   1807 C  C     . ARG A 1 231 ? -36.398 -21.430 -23.108 1.00 33.48  ? 523  ARG A C     1 
ATOM   1808 O  O     . ARG A 1 231 ? -35.668 -22.417 -23.032 1.00 36.94  ? 523  ARG A O     1 
ATOM   1809 C  CB    . ARG A 1 231 ? -36.509 -19.783 -21.268 1.00 49.15  ? 523  ARG A CB    1 
ATOM   1810 C  CG    . ARG A 1 231 ? -35.599 -19.090 -20.278 1.00 69.02  ? 523  ARG A CG    1 
ATOM   1811 C  CD    . ARG A 1 231 ? -36.311 -18.944 -18.934 1.00 74.55  ? 523  ARG A CD    1 
ATOM   1812 N  NE    . ARG A 1 231 ? -35.507 -18.231 -17.947 1.00 78.15  ? 523  ARG A NE    1 
ATOM   1813 C  CZ    . ARG A 1 231 ? -34.623 -18.813 -17.145 1.00 85.59  ? 523  ARG A CZ    1 
ATOM   1814 N  NH1   . ARG A 1 231 ? -34.423 -20.122 -17.217 1.00 88.75  ? 523  ARG A NH1   1 
ATOM   1815 N  NH2   . ARG A 1 231 ? -33.936 -18.087 -16.274 1.00 88.91  ? 523  ARG A NH2   1 
ATOM   1816 N  N     . GLU A 1 232 ? -37.642 -21.478 -23.571 1.00 41.04  ? 524  GLU A N     1 
ATOM   1817 C  CA    . GLU A 1 232 ? -38.262 -22.737 -23.974 1.00 47.94  ? 524  GLU A CA    1 
ATOM   1818 C  C     . GLU A 1 232 ? -38.021 -23.082 -25.445 1.00 45.89  ? 524  GLU A C     1 
ATOM   1819 O  O     . GLU A 1 232 ? -38.525 -24.090 -25.937 1.00 45.25  ? 524  GLU A O     1 
ATOM   1820 C  CB    . GLU A 1 232 ? -39.764 -22.706 -23.669 1.00 58.84  ? 524  GLU A CB    1 
ATOM   1821 C  CG    . GLU A 1 232 ? -40.485 -21.462 -24.184 1.00 80.04  ? 524  GLU A CG    1 
ATOM   1822 C  CD    . GLU A 1 232 ? -40.913 -21.582 -25.638 1.00 93.96  ? 524  GLU A CD    1 
ATOM   1823 O  OE1   . GLU A 1 232 ? -41.182 -22.717 -26.088 1.00 100.49 ? 524  GLU A OE1   1 
ATOM   1824 O  OE2   . GLU A 1 232 ? -40.981 -20.543 -26.329 1.00 94.26  ? 524  GLU A OE2   1 
ATOM   1825 N  N     . ALA A 1 233 ? -37.241 -22.259 -26.138 1.00 40.38  ? 525  ALA A N     1 
ATOM   1826 C  CA    . ALA A 1 233 ? -36.993 -22.458 -27.572 1.00 30.95  ? 525  ALA A CA    1 
ATOM   1827 C  C     . ALA A 1 233 ? -35.849 -23.420 -27.865 1.00 38.65  ? 525  ALA A C     1 
ATOM   1828 O  O     . ALA A 1 233 ? -35.802 -24.029 -28.932 1.00 38.20  ? 525  ALA A O     1 
ATOM   1829 C  CB    . ALA A 1 233 ? -36.743 -21.119 -28.262 1.00 31.79  ? 525  ALA A CB    1 
ATOM   1830 N  N     . HIS A 1 234 ? -34.917 -23.547 -26.924 1.00 30.83  ? 526  HIS A N     1 
ATOM   1831 C  CA    . HIS A 1 234 ? -33.774 -24.426 -27.098 1.00 29.87  ? 526  HIS A CA    1 
ATOM   1832 C  C     . HIS A 1 234 ? -33.112 -24.611 -25.745 1.00 30.85  ? 526  HIS A C     1 
ATOM   1833 O  O     . HIS A 1 234 ? -33.070 -23.671 -24.949 1.00 33.61  ? 526  HIS A O     1 
ATOM   1834 C  CB    . HIS A 1 234 ? -32.778 -23.826 -28.093 1.00 28.75  ? 526  HIS A CB    1 
ATOM   1835 C  CG    . HIS A 1 234 ? -31.774 -24.804 -28.609 1.00 32.96  ? 526  HIS A CG    1 
ATOM   1836 N  ND1   . HIS A 1 234 ? -30.685 -25.215 -27.870 1.00 29.81  ? 526  HIS A ND1   1 
ATOM   1837 C  CD2   . HIS A 1 234 ? -31.689 -25.451 -29.797 1.00 32.27  ? 526  HIS A CD2   1 
ATOM   1838 C  CE1   . HIS A 1 234 ? -29.972 -26.071 -28.580 1.00 34.32  ? 526  HIS A CE1   1 
ATOM   1839 N  NE2   . HIS A 1 234 ? -30.558 -26.230 -29.754 1.00 34.23  ? 526  HIS A NE2   1 
ATOM   1840 N  N     . PRO A 1 235 ? -32.600 -25.821 -25.471 1.00 31.16  ? 527  PRO A N     1 
ATOM   1841 C  CA    . PRO A 1 235 ? -31.979 -26.048 -24.157 1.00 32.85  ? 527  PRO A CA    1 
ATOM   1842 C  C     . PRO A 1 235 ? -30.728 -25.203 -23.901 1.00 37.35  ? 527  PRO A C     1 
ATOM   1843 O  O     . PRO A 1 235 ? -30.399 -24.970 -22.744 1.00 32.70  ? 527  PRO A O     1 
ATOM   1844 C  CB    . PRO A 1 235 ? -31.635 -27.547 -24.174 1.00 35.00  ? 527  PRO A CB    1 
ATOM   1845 C  CG    . PRO A 1 235 ? -31.788 -27.988 -25.620 1.00 39.27  ? 527  PRO A CG    1 
ATOM   1846 C  CD    . PRO A 1 235 ? -32.807 -27.082 -26.212 1.00 34.31  ? 527  PRO A CD    1 
ATOM   1847 N  N     . ILE A 1 236 ? -30.061 -24.742 -24.955 1.00 33.74  ? 528  ILE A N     1 
ATOM   1848 C  CA    . ILE A 1 236 ? -28.823 -23.992 -24.806 1.00 31.21  ? 528  ILE A CA    1 
ATOM   1849 C  C     . ILE A 1 236 ? -29.051 -22.640 -24.138 1.00 33.48  ? 528  ILE A C     1 
ATOM   1850 O  O     . ILE A 1 236 ? -28.136 -22.082 -23.535 1.00 31.21  ? 528  ILE A O     1 
ATOM   1851 C  CB    . ILE A 1 236 ? -28.126 -23.751 -26.167 1.00 28.74  ? 528  ILE A CB    1 
ATOM   1852 C  CG1   . ILE A 1 236 ? -26.637 -23.476 -25.968 1.00 33.25  ? 528  ILE A CG1   1 
ATOM   1853 C  CG2   . ILE A 1 236 ? -28.808 -22.604 -26.947 1.00 28.53  ? 528  ILE A CG2   1 
ATOM   1854 C  CD1   . ILE A 1 236 ? -25.875 -23.284 -27.270 1.00 32.71  ? 528  ILE A CD1   1 
ATOM   1855 N  N     . VAL A 1 237 ? -30.272 -22.127 -24.233 1.00 23.88  ? 529  VAL A N     1 
ATOM   1856 C  CA    . VAL A 1 237 ? -30.522 -20.732 -23.883 1.00 26.26  ? 529  VAL A CA    1 
ATOM   1857 C  C     . VAL A 1 237 ? -30.360 -20.493 -22.382 1.00 28.56  ? 529  VAL A C     1 
ATOM   1858 O  O     . VAL A 1 237 ? -29.676 -19.552 -21.958 1.00 31.44  ? 529  VAL A O     1 
ATOM   1859 C  CB    . VAL A 1 237 ? -31.912 -20.271 -24.346 1.00 30.94  ? 529  VAL A CB    1 
ATOM   1860 C  CG1   . VAL A 1 237 ? -32.198 -18.863 -23.844 1.00 29.13  ? 529  VAL A CG1   1 
ATOM   1861 C  CG2   . VAL A 1 237 ? -31.997 -20.311 -25.883 1.00 31.08  ? 529  VAL A CG2   1 
ATOM   1862 N  N     . GLU A 1 238 ? -30.991 -21.349 -21.585 1.00 31.59  ? 530  GLU A N     1 
ATOM   1863 C  CA    . GLU A 1 238 ? -30.926 -21.227 -20.128 1.00 33.41  ? 530  GLU A CA    1 
ATOM   1864 C  C     . GLU A 1 238 ? -29.490 -21.387 -19.637 1.00 31.18  ? 530  GLU A C     1 
ATOM   1865 O  O     . GLU A 1 238 ? -29.085 -20.753 -18.656 1.00 30.53  ? 530  GLU A O     1 
ATOM   1866 C  CB    . GLU A 1 238 ? -31.831 -22.268 -19.476 1.00 39.74  ? 530  GLU A CB    1 
ATOM   1867 C  CG    . GLU A 1 238 ? -31.875 -22.202 -17.959 1.00 65.75  ? 530  GLU A CG    1 
ATOM   1868 C  CD    . GLU A 1 238 ? -32.533 -23.425 -17.351 1.00 85.38  ? 530  GLU A CD    1 
ATOM   1869 O  OE1   . GLU A 1 238 ? -32.481 -24.502 -17.985 1.00 89.58  ? 530  GLU A OE1   1 
ATOM   1870 O  OE2   . GLU A 1 238 ? -33.105 -23.308 -16.245 1.00 93.06  ? 530  GLU A OE2   1 
ATOM   1871 N  N     . LYS A 1 239 ? -28.718 -22.222 -20.326 1.00 28.60  ? 531  LYS A N     1 
ATOM   1872 C  CA    . LYS A 1 239 ? -27.317 -22.442 -19.978 1.00 30.86  ? 531  LYS A CA    1 
ATOM   1873 C  C     . LYS A 1 239 ? -26.491 -21.173 -20.186 1.00 32.82  ? 531  LYS A C     1 
ATOM   1874 O  O     . LYS A 1 239 ? -25.626 -20.839 -19.370 1.00 31.75  ? 531  LYS A O     1 
ATOM   1875 C  CB    . LYS A 1 239 ? -26.720 -23.580 -20.805 1.00 35.50  ? 531  LYS A CB    1 
ATOM   1876 C  CG    . LYS A 1 239 ? -27.479 -24.910 -20.720 1.00 42.24  ? 531  LYS A CG    1 
ATOM   1877 C  CD    . LYS A 1 239 ? -27.640 -25.379 -19.289 1.00 52.13  ? 531  LYS A CD    1 
ATOM   1878 C  CE    . LYS A 1 239 ? -27.741 -26.897 -19.216 1.00 59.87  ? 531  LYS A CE    1 
ATOM   1879 N  NZ    . LYS A 1 239 ? -28.707 -27.419 -20.216 1.00 58.37  ? 531  LYS A NZ    1 
ATOM   1880 N  N     . ILE A 1 240 ? -26.757 -20.473 -21.286 1.00 26.59  ? 532  ILE A N     1 
ATOM   1881 C  CA    . ILE A 1 240 ? -26.060 -19.218 -21.579 1.00 24.75  ? 532  ILE A CA    1 
ATOM   1882 C  C     . ILE A 1 240 ? -26.359 -18.176 -20.511 1.00 29.30  ? 532  ILE A C     1 
ATOM   1883 O  O     . ILE A 1 240 ? -25.457 -17.472 -20.045 1.00 28.04  ? 532  ILE A O     1 
ATOM   1884 C  CB    . ILE A 1 240 ? -26.514 -18.631 -22.940 1.00 31.06  ? 532  ILE A CB    1 
ATOM   1885 C  CG1   . ILE A 1 240 ? -26.190 -19.593 -24.078 1.00 38.92  ? 532  ILE A CG1   1 
ATOM   1886 C  CG2   . ILE A 1 240 ? -25.876 -17.265 -23.178 1.00 32.43  ? 532  ILE A CG2   1 
ATOM   1887 C  CD1   . ILE A 1 240 ? -24.753 -19.935 -24.165 1.00 44.76  ? 532  ILE A CD1   1 
ATOM   1888 N  N     . LEU A 1 241 ? -27.631 -18.065 -20.149 1.00 28.52  ? 533  LEU A N     1 
ATOM   1889 C  CA    . LEU A 1 241 ? -28.063 -17.091 -19.152 1.00 27.41  ? 533  LEU A CA    1 
ATOM   1890 C  C     . LEU A 1 241 ? -27.332 -17.325 -17.836 1.00 32.86  ? 533  LEU A C     1 
ATOM   1891 O  O     . LEU A 1 241 ? -26.819 -16.397 -17.217 1.00 28.35  ? 533  LEU A O     1 
ATOM   1892 C  CB    . LEU A 1 241 ? -29.566 -17.193 -18.921 1.00 30.34  ? 533  LEU A CB    1 
ATOM   1893 C  CG    . LEU A 1 241 ? -30.455 -16.467 -19.925 1.00 36.45  ? 533  LEU A CG    1 
ATOM   1894 C  CD1   . LEU A 1 241 ? -31.898 -16.952 -19.806 1.00 35.79  ? 533  LEU A CD1   1 
ATOM   1895 C  CD2   . LEU A 1 241 ? -30.364 -14.961 -19.710 1.00 35.72  ? 533  LEU A CD2   1 
ATOM   1896 N  N     . GLN A 1 242 ? -27.295 -18.580 -17.421 1.00 27.87  ? 534  GLN A N     1 
ATOM   1897 C  CA    . GLN A 1 242 ? -26.647 -18.957 -16.169 1.00 27.96  ? 534  GLN A CA    1 
ATOM   1898 C  C     . GLN A 1 242 ? -25.138 -18.761 -16.246 1.00 31.44  ? 534  GLN A C     1 
ATOM   1899 O  O     . GLN A 1 242 ? -24.521 -18.267 -15.301 1.00 29.57  ? 534  GLN A O     1 
ATOM   1900 C  CB    . GLN A 1 242 ? -27.002 -20.405 -15.823 1.00 26.19  ? 534  GLN A CB    1 
ATOM   1901 C  CG    . GLN A 1 242 ? -28.478 -20.567 -15.479 1.00 36.15  ? 534  GLN A CG    1 
ATOM   1902 C  CD    . GLN A 1 242 ? -28.947 -22.020 -15.478 1.00 57.21  ? 534  GLN A CD    1 
ATOM   1903 O  OE1   . GLN A 1 242 ? -28.193 -22.933 -15.821 1.00 62.12  ? 534  GLN A OE1   1 
ATOM   1904 N  NE2   . GLN A 1 242 ? -30.205 -22.235 -15.098 1.00 57.68  ? 534  GLN A NE2   1 
ATOM   1905 N  N     . TYR A 1 243 ? -24.541 -19.141 -17.370 1.00 25.70  ? 535  TYR A N     1 
ATOM   1906 C  CA    . TYR A 1 243 ? -23.110 -18.955 -17.549 1.00 27.02  ? 535  TYR A CA    1 
ATOM   1907 C  C     . TYR A 1 243 ? -22.736 -17.485 -17.402 1.00 26.42  ? 535  TYR A C     1 
ATOM   1908 O  O     . TYR A 1 243 ? -21.739 -17.157 -16.762 1.00 31.85  ? 535  TYR A O     1 
ATOM   1909 C  CB    . TYR A 1 243 ? -22.640 -19.458 -18.922 1.00 29.14  ? 535  TYR A CB    1 
ATOM   1910 C  CG    . TYR A 1 243 ? -21.237 -18.995 -19.276 1.00 28.89  ? 535  TYR A CG    1 
ATOM   1911 C  CD1   . TYR A 1 243 ? -21.031 -17.776 -19.919 1.00 29.94  ? 535  TYR A CD1   1 
ATOM   1912 C  CD2   . TYR A 1 243 ? -20.123 -19.768 -18.970 1.00 31.42  ? 535  TYR A CD2   1 
ATOM   1913 C  CE1   . TYR A 1 243 ? -19.769 -17.332 -20.236 1.00 32.01  ? 535  TYR A CE1   1 
ATOM   1914 C  CE2   . TYR A 1 243 ? -18.840 -19.331 -19.300 1.00 34.75  ? 535  TYR A CE2   1 
ATOM   1915 C  CZ    . TYR A 1 243 ? -18.679 -18.107 -19.930 1.00 34.39  ? 535  TYR A CZ    1 
ATOM   1916 O  OH    . TYR A 1 243 ? -17.430 -17.638 -20.264 1.00 37.11  ? 535  TYR A OH    1 
ATOM   1917 N  N     . ARG A 1 244 ? -23.531 -16.606 -18.012 1.00 24.27  ? 536  ARG A N     1 
ATOM   1918 C  CA    . ARG A 1 244 ? -23.172 -15.190 -18.033 1.00 26.49  ? 536  ARG A CA    1 
ATOM   1919 C  C     . ARG A 1 244 ? -23.174 -14.625 -16.615 1.00 33.66  ? 536  ARG A C     1 
ATOM   1920 O  O     . ARG A 1 244 ? -22.226 -13.957 -16.199 1.00 30.44  ? 536  ARG A O     1 
ATOM   1921 C  CB    . ARG A 1 244 ? -24.140 -14.401 -18.906 1.00 31.30  ? 536  ARG A CB    1 
ATOM   1922 C  CG    . ARG A 1 244 ? -23.752 -14.376 -20.377 1.00 36.47  ? 536  ARG A CG    1 
ATOM   1923 C  CD    . ARG A 1 244 ? -24.867 -13.756 -21.188 1.00 37.77  ? 536  ARG A CD    1 
ATOM   1924 N  NE    . ARG A 1 244 ? -24.435 -13.334 -22.514 1.00 36.44  ? 536  ARG A NE    1 
ATOM   1925 C  CZ    . ARG A 1 244 ? -25.226 -12.700 -23.373 1.00 37.00  ? 536  ARG A CZ    1 
ATOM   1926 N  NH1   . ARG A 1 244 ? -26.473 -12.428 -23.027 1.00 30.53  ? 536  ARG A NH1   1 
ATOM   1927 N  NH2   . ARG A 1 244 ? -24.767 -12.330 -24.564 1.00 33.07  ? 536  ARG A NH2   1 
ATOM   1928 N  N     . GLU A 1 245 ? -24.243 -14.906 -15.883 1.00 26.03  ? 537  GLU A N     1 
ATOM   1929 C  CA    . GLU A 1 245 ? -24.386 -14.390 -14.523 1.00 31.99  ? 537  GLU A CA    1 
ATOM   1930 C  C     . GLU A 1 245 ? -23.324 -14.929 -13.575 1.00 29.20  ? 537  GLU A C     1 
ATOM   1931 O  O     . GLU A 1 245 ? -22.759 -14.175 -12.789 1.00 28.57  ? 537  GLU A O     1 
ATOM   1932 C  CB    . GLU A 1 245 ? -25.773 -14.680 -13.953 1.00 32.95  ? 537  GLU A CB    1 
ATOM   1933 C  CG    . GLU A 1 245 ? -25.852 -14.344 -12.466 1.00 52.39  ? 537  GLU A CG    1 
ATOM   1934 C  CD    . GLU A 1 245 ? -27.256 -14.069 -11.974 1.00 63.52  ? 537  GLU A CD    1 
ATOM   1935 O  OE1   . GLU A 1 245 ? -28.209 -14.690 -12.496 1.00 76.58  ? 537  GLU A OE1   1 
ATOM   1936 O  OE2   . GLU A 1 245 ? -27.398 -13.223 -11.059 1.00 47.02  ? 537  GLU A OE2   1 
ATOM   1937 N  N     . LEU A 1 246 ? -23.066 -16.232 -13.632 1.00 25.30  ? 538  LEU A N     1 
ATOM   1938 C  CA    . LEU A 1 246 ? -22.086 -16.840 -12.733 1.00 27.50  ? 538  LEU A CA    1 
ATOM   1939 C  C     . LEU A 1 246 ? -20.691 -16.295 -13.022 1.00 32.44  ? 538  LEU A C     1 
ATOM   1940 O  O     . LEU A 1 246 ? -19.929 -15.982 -12.109 1.00 27.93  ? 538  LEU A O     1 
ATOM   1941 C  CB    . LEU A 1 246 ? -22.089 -18.369 -12.855 1.00 26.29  ? 538  LEU A CB    1 
ATOM   1942 C  CG    . LEU A 1 246 ? -23.061 -19.146 -11.966 1.00 32.79  ? 538  LEU A CG    1 
ATOM   1943 C  CD1   . LEU A 1 246 ? -24.459 -18.583 -12.030 1.00 33.77  ? 538  LEU A CD1   1 
ATOM   1944 C  CD2   . LEU A 1 246 ? -23.063 -20.615 -12.371 1.00 26.06  ? 538  LEU A CD2   1 
ATOM   1945 N  N     . THR A 1 247 ? -20.355 -16.188 -14.300 1.00 27.48  ? 539  THR A N     1 
ATOM   1946 C  CA    . THR A 1 247 ? -19.061 -15.665 -14.701 1.00 28.36  ? 539  THR A CA    1 
ATOM   1947 C  C     . THR A 1 247 ? -18.862 -14.235 -14.179 1.00 26.43  ? 539  THR A C     1 
ATOM   1948 O  O     . THR A 1 247 ? -17.795 -13.890 -13.668 1.00 33.90  ? 539  THR A O     1 
ATOM   1949 C  CB    . THR A 1 247 ? -18.913 -15.707 -16.230 1.00 32.74  ? 539  THR A CB    1 
ATOM   1950 O  OG1   . THR A 1 247 ? -18.904 -17.077 -16.649 1.00 31.55  ? 539  THR A OG1   1 
ATOM   1951 C  CG2   . THR A 1 247 ? -17.613 -15.040 -16.676 1.00 30.48  ? 539  THR A CG2   1 
ATOM   1952 N  N     . LYS A 1 248 ? -19.910 -13.429 -14.291 1.00 25.27  ? 540  LYS A N     1 
ATOM   1953 C  CA    . LYS A 1 248 ? -19.858 -12.028 -13.888 1.00 29.88  ? 540  LYS A CA    1 
ATOM   1954 C  C     . LYS A 1 248 ? -19.675 -11.899 -12.378 1.00 33.33  ? 540  LYS A C     1 
ATOM   1955 O  O     . LYS A 1 248 ? -18.772 -11.203 -11.911 1.00 27.14  ? 540  LYS A O     1 
ATOM   1956 C  CB    . LYS A 1 248 ? -21.135 -11.310 -14.323 1.00 31.86  ? 540  LYS A CB    1 
ATOM   1957 C  CG    . LYS A 1 248 ? -21.197 -9.844  -13.920 1.00 43.70  ? 540  LYS A CG    1 
ATOM   1958 C  CD    . LYS A 1 248 ? -20.061 -9.040  -14.527 1.00 52.96  ? 540  LYS A CD    1 
ATOM   1959 C  CE    . LYS A 1 248 ? -20.193 -7.562  -14.172 1.00 58.95  ? 540  LYS A CE    1 
ATOM   1960 N  NZ    . LYS A 1 248 ? -19.099 -6.735  -14.752 1.00 65.92  ? 540  LYS A NZ    1 
ATOM   1961 N  N     . LEU A 1 249 ? -20.529 -12.576 -11.616 1.00 23.56  ? 541  LEU A N     1 
ATOM   1962 C  CA    . LEU A 1 249 ? -20.481 -12.464 -10.159 1.00 25.61  ? 541  LEU A CA    1 
ATOM   1963 C  C     . LEU A 1 249 ? -19.249 -13.105 -9.533  1.00 28.42  ? 541  LEU A C     1 
ATOM   1964 O  O     . LEU A 1 249 ? -18.766 -12.641 -8.489  1.00 25.01  ? 541  LEU A O     1 
ATOM   1965 C  CB    . LEU A 1 249 ? -21.754 -13.016 -9.533  1.00 25.47  ? 541  LEU A CB    1 
ATOM   1966 C  CG    . LEU A 1 249 ? -22.994 -12.281 -10.043 1.00 28.10  ? 541  LEU A CG    1 
ATOM   1967 C  CD1   . LEU A 1 249 ? -24.262 -12.910 -9.490  1.00 29.88  ? 541  LEU A CD1   1 
ATOM   1968 C  CD2   . LEU A 1 249 ? -22.939 -10.754 -9.738  1.00 30.18  ? 541  LEU A CD2   1 
ATOM   1969 N  N     . LYS A 1 250 ? -18.732 -14.158 -10.157 1.00 22.07  ? 542  LYS A N     1 
ATOM   1970 C  CA    . LYS A 1 250 ? -17.508 -14.775 -9.662  1.00 22.93  ? 542  LYS A CA    1 
ATOM   1971 C  C     . LYS A 1 250 ? -16.362 -13.777 -9.784  1.00 25.19  ? 542  LYS A C     1 
ATOM   1972 O  O     . LYS A 1 250 ? -15.602 -13.565 -8.848  1.00 26.19  ? 542  LYS A O     1 
ATOM   1973 C  CB    . LYS A 1 250 ? -17.169 -16.063 -10.435 1.00 22.81  ? 542  LYS A CB    1 
ATOM   1974 C  CG    . LYS A 1 250 ? -15.997 -16.840 -9.819  1.00 33.06  ? 542  LYS A CG    1 
ATOM   1975 C  CD    . LYS A 1 250 ? -15.812 -18.208 -10.464 1.00 33.00  ? 542  LYS A CD    1 
ATOM   1976 C  CE    . LYS A 1 250 ? -14.642 -18.955 -9.837  1.00 39.71  ? 542  LYS A CE    1 
ATOM   1977 N  NZ    . LYS A 1 250 ? -13.354 -18.286 -10.141 1.00 45.84  ? 542  LYS A NZ    1 
ATOM   1978 N  N     . SER A 1 251 ? -16.260 -13.149 -10.948 1.00 26.58  ? 543  SER A N     1 
ATOM   1979 C  CA    . SER A 1 251 ? -15.119 -12.289 -11.234 1.00 29.63  ? 543  SER A CA    1 
ATOM   1980 C  C     . SER A 1 251 ? -15.186 -10.961 -10.489 1.00 30.06  ? 543  SER A C     1 
ATOM   1981 O  O     . SER A 1 251 ? -14.156 -10.418 -10.116 1.00 25.67  ? 543  SER A O     1 
ATOM   1982 C  CB    . SER A 1 251 ? -15.005 -12.034 -12.735 1.00 38.23  ? 543  SER A CB    1 
ATOM   1983 O  OG    . SER A 1 251 ? -16.185 -11.411 -13.210 1.00 44.42  ? 543  SER A OG    1 
ATOM   1984 N  N     . THR A 1 252 ? -16.389 -10.455 -10.249 1.00 25.91  ? 544  THR A N     1 
ATOM   1985 C  CA    . THR A 1 252 ? -16.532 -9.132  -9.641  1.00 30.17  ? 544  THR A CA    1 
ATOM   1986 C  C     . THR A 1 252 ? -16.763 -9.139  -8.122  1.00 27.41  ? 544  THR A C     1 
ATOM   1987 O  O     . THR A 1 252 ? -16.392 -8.187  -7.431  1.00 24.92  ? 544  THR A O     1 
ATOM   1988 C  CB    . THR A 1 252 ? -17.660 -8.317  -10.318 1.00 38.33  ? 544  THR A CB    1 
ATOM   1989 O  OG1   . THR A 1 252 ? -18.926 -8.909  -10.026 1.00 48.22  ? 544  THR A OG1   1 
ATOM   1990 C  CG2   . THR A 1 252 ? -17.473 -8.298  -11.815 1.00 31.53  ? 544  THR A CG2   1 
ATOM   1991 N  N     . TYR A 1 253 ? -17.371 -10.193 -7.594  1.00 19.84  ? 545  TYR A N     1 
ATOM   1992 C  CA    . TYR A 1 253 ? -17.636 -10.235 -6.146  1.00 18.13  ? 545  TYR A CA    1 
ATOM   1993 C  C     . TYR A 1 253 ? -17.029 -11.453 -5.445  1.00 23.45  ? 545  TYR A C     1 
ATOM   1994 O  O     . TYR A 1 253 ? -16.274 -11.315 -4.495  1.00 23.11  ? 545  TYR A O     1 
ATOM   1995 C  CB    . TYR A 1 253 ? -19.137 -10.168 -5.861  1.00 21.31  ? 545  TYR A CB    1 
ATOM   1996 C  CG    . TYR A 1 253 ? -19.745 -8.872  -6.351  1.00 19.40  ? 545  TYR A CG    1 
ATOM   1997 C  CD1   . TYR A 1 253 ? -19.483 -7.682  -5.694  1.00 22.46  ? 545  TYR A CD1   1 
ATOM   1998 C  CD2   . TYR A 1 253 ? -20.537 -8.843  -7.487  1.00 26.69  ? 545  TYR A CD2   1 
ATOM   1999 C  CE1   . TYR A 1 253 ? -20.009 -6.483  -6.147  1.00 23.93  ? 545  TYR A CE1   1 
ATOM   2000 C  CE2   . TYR A 1 253 ? -21.077 -7.644  -7.956  1.00 27.94  ? 545  TYR A CE2   1 
ATOM   2001 C  CZ    . TYR A 1 253 ? -20.808 -6.472  -7.274  1.00 28.51  ? 545  TYR A CZ    1 
ATOM   2002 O  OH    . TYR A 1 253 ? -21.333 -5.281  -7.723  1.00 26.12  ? 545  TYR A OH    1 
ATOM   2003 N  N     . ILE A 1 254 ? -17.367 -12.648 -5.903  1.00 22.11  ? 546  ILE A N     1 
ATOM   2004 C  CA    . ILE A 1 254 ? -16.992 -13.842 -5.140  1.00 17.47  ? 546  ILE A CA    1 
ATOM   2005 C  C     . ILE A 1 254 ? -15.485 -13.980 -4.955  1.00 24.57  ? 546  ILE A C     1 
ATOM   2006 O  O     . ILE A 1 254 ? -14.997 -14.219 -3.843  1.00 22.75  ? 546  ILE A O     1 
ATOM   2007 C  CB    . ILE A 1 254 ? -17.552 -15.130 -5.796  1.00 21.55  ? 546  ILE A CB    1 
ATOM   2008 C  CG1   . ILE A 1 254 ? -19.086 -15.074 -5.818  1.00 28.60  ? 546  ILE A CG1   1 
ATOM   2009 C  CG2   . ILE A 1 254 ? -17.036 -16.361 -5.051  1.00 23.59  ? 546  ILE A CG2   1 
ATOM   2010 C  CD1   . ILE A 1 254 ? -19.735 -16.175 -6.650  1.00 30.68  ? 546  ILE A CD1   1 
ATOM   2011 N  N     . ASP A 1 255 ? -14.736 -13.831 -6.038  1.00 22.05  ? 547  ASP A N     1 
ATOM   2012 C  CA    . ASP A 1 255 ? -13.281 -13.913 -5.931  1.00 33.41  ? 547  ASP A CA    1 
ATOM   2013 C  C     . ASP A 1 255 ? -12.584 -12.692 -5.286  1.00 25.56  ? 547  ASP A C     1 
ATOM   2014 O  O     . ASP A 1 255 ? -11.709 -12.877 -4.444  1.00 28.34  ? 547  ASP A O     1 
ATOM   2015 C  CB    . ASP A 1 255 ? -12.652 -14.298 -7.274  1.00 34.06  ? 547  ASP A CB    1 
ATOM   2016 C  CG    . ASP A 1 255 ? -12.856 -15.772 -7.604  1.00 39.44  ? 547  ASP A CG    1 
ATOM   2017 O  OD1   . ASP A 1 255 ? -13.099 -16.568 -6.673  1.00 43.75  ? 547  ASP A OD1   1 
ATOM   2018 O  OD2   . ASP A 1 255 ? -12.763 -16.136 -8.789  1.00 41.22  ? 547  ASP A OD2   1 
ATOM   2019 N  N     . PRO A 1 256 ? -12.981 -11.453 -5.650  1.00 23.42  ? 548  PRO A N     1 
ATOM   2020 C  CA    . PRO A 1 256 ? -12.276 -10.288 -5.079  1.00 19.94  ? 548  PRO A CA    1 
ATOM   2021 C  C     . PRO A 1 256 ? -12.564 -9.991  -3.601  1.00 24.87  ? 548  PRO A C     1 
ATOM   2022 O  O     . PRO A 1 256 ? -11.685 -9.446  -2.930  1.00 23.39  ? 548  PRO A O     1 
ATOM   2023 C  CB    . PRO A 1 256 ? -12.799 -9.111  -5.917  1.00 28.41  ? 548  PRO A CB    1 
ATOM   2024 C  CG    . PRO A 1 256 ? -13.338 -9.707  -7.139  1.00 30.59  ? 548  PRO A CG    1 
ATOM   2025 C  CD    . PRO A 1 256 ? -13.864 -11.049 -6.760  1.00 22.36  ? 548  PRO A CD    1 
ATOM   2026 N  N     . LEU A 1 257 ? -13.767 -10.291 -3.111  1.00 21.38  ? 549  LEU A N     1 
ATOM   2027 C  CA    . LEU A 1 257 ? -14.135 -9.886  -1.747  1.00 21.02  ? 549  LEU A CA    1 
ATOM   2028 C  C     . LEU A 1 257 ? -13.192 -10.371 -0.637  1.00 20.04  ? 549  LEU A C     1 
ATOM   2029 O  O     . LEU A 1 257 ? -12.804 -9.584  0.240   1.00 18.01  ? 549  LEU A O     1 
ATOM   2030 C  CB    . LEU A 1 257 ? -15.588 -10.239 -1.417  1.00 20.22  ? 549  LEU A CB    1 
ATOM   2031 C  CG    . LEU A 1 257 ? -16.630 -9.321  -2.073  1.00 20.38  ? 549  LEU A CG    1 
ATOM   2032 C  CD1   . LEU A 1 257 ? -18.023 -9.857  -1.866  1.00 24.17  ? 549  LEU A CD1   1 
ATOM   2033 C  CD2   . LEU A 1 257 ? -16.522 -7.901  -1.513  1.00 26.46  ? 549  LEU A CD2   1 
ATOM   2034 N  N     . PRO A 1 258 ? -12.803 -11.651 -0.660  1.00 19.44  ? 550  PRO A N     1 
ATOM   2035 C  CA    . PRO A 1 258 ? -11.922 -12.066 0.443   1.00 17.32  ? 550  PRO A CA    1 
ATOM   2036 C  C     . PRO A 1 258 ? -10.587 -11.319 0.519   1.00 19.85  ? 550  PRO A C     1 
ATOM   2037 O  O     . PRO A 1 258 ? -10.064 -11.134 1.622   1.00 22.75  ? 550  PRO A O     1 
ATOM   2038 C  CB    . PRO A 1 258 ? -11.660 -13.553 0.139   1.00 22.85  ? 550  PRO A CB    1 
ATOM   2039 C  CG    . PRO A 1 258 ? -12.857 -13.992 -0.651  1.00 26.15  ? 550  PRO A CG    1 
ATOM   2040 C  CD    . PRO A 1 258 ? -13.217 -12.802 -1.497  1.00 22.58  ? 550  PRO A CD    1 
ATOM   2041 N  N     . ASP A 1 259 ? -10.046 -10.907 -0.627  1.00 18.31  ? 551  ASP A N     1 
ATOM   2042 C  CA    . ASP A 1 259 ? -8.796  -10.151 -0.665  1.00 24.97  ? 551  ASP A CA    1 
ATOM   2043 C  C     . ASP A 1 259 ? -8.941  -8.738  -0.098  1.00 22.34  ? 551  ASP A C     1 
ATOM   2044 O  O     . ASP A 1 259 ? -7.939  -8.087  0.216   1.00 22.80  ? 551  ASP A O     1 
ATOM   2045 C  CB    . ASP A 1 259 ? -8.281  -10.033 -2.100  1.00 29.44  ? 551  ASP A CB    1 
ATOM   2046 C  CG    . ASP A 1 259 ? -8.000  -11.378 -2.742  1.00 46.95  ? 551  ASP A CG    1 
ATOM   2047 O  OD1   . ASP A 1 259 ? -7.461  -12.269 -2.053  1.00 44.58  ? 551  ASP A OD1   1 
ATOM   2048 O  OD2   . ASP A 1 259 ? -8.313  -11.533 -3.942  1.00 53.47  ? 551  ASP A OD2   1 
ATOM   2049 N  N     . LEU A 1 260 ? -10.180 -8.255  -0.001  1.00 18.99  ? 552  LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 260 ? -10.454 -6.911  0.525   1.00 15.85  ? 552  LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 260 ? -10.615 -6.892  2.043   1.00 18.48  ? 552  LEU A C     1 
ATOM   2052 O  O     . LEU A 1 260 ? -10.877 -5.846  2.622   1.00 19.76  ? 552  LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 260 ? -11.713 -6.322  -0.146  1.00 14.75  ? 552  LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 260 ? -11.506 -6.105  -1.655  1.00 20.96  ? 552  LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 260 ? -12.807 -5.693  -2.329  1.00 21.53  ? 552  LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 260 ? -10.417 -5.047  -1.882  1.00 24.40  ? 552  LEU A CD2   1 
ATOM   2057 N  N     . ILE A 1 261 ? -10.483 -8.049  2.685   1.00 18.23  ? 553  ILE A N     1 
ATOM   2058 C  CA    . ILE A 1 261 ? -10.521 -8.063  4.140   1.00 16.78  ? 553  ILE A CA    1 
ATOM   2059 C  C     . ILE A 1 261 ? -9.203  -7.484  4.681   1.00 18.67  ? 553  ILE A C     1 
ATOM   2060 O  O     . ILE A 1 261 ? -8.117  -7.997  4.391   1.00 20.42  ? 553  ILE A O     1 
ATOM   2061 C  CB    . ILE A 1 261 ? -10.714 -9.473  4.706   1.00 17.95  ? 553  ILE A CB    1 
ATOM   2062 C  CG1   . ILE A 1 261 ? -12.098 -10.033 4.318   1.00 20.39  ? 553  ILE A CG1   1 
ATOM   2063 C  CG2   . ILE A 1 261 ? -10.509 -9.453  6.232   1.00 20.25  ? 553  ILE A CG2   1 
ATOM   2064 C  CD1   . ILE A 1 261 ? -13.271 -9.172  4.776   1.00 25.42  ? 553  ILE A CD1   1 
ATOM   2065 N  N     . HIS A 1 262 ? -9.313  -6.429  5.478   1.00 16.58  ? 554  HIS A N     1 
ATOM   2066 C  CA    . HIS A 1 262 ? -8.135  -5.759  6.021   1.00 17.98  ? 554  HIS A CA    1 
ATOM   2067 C  C     . HIS A 1 262 ? -7.596  -6.556  7.194   1.00 19.04  ? 554  HIS A C     1 
ATOM   2068 O  O     . HIS A 1 262 ? -8.343  -6.876  8.110   1.00 19.41  ? 554  HIS A O     1 
ATOM   2069 C  CB    . HIS A 1 262 ? -8.509  -4.351  6.479   1.00 18.24  ? 554  HIS A CB    1 
ATOM   2070 C  CG    . HIS A 1 262 ? -7.328  -3.459  6.696   1.00 22.17  ? 554  HIS A CG    1 
ATOM   2071 N  ND1   . HIS A 1 262 ? -6.373  -3.716  7.654   1.00 25.30  ? 554  HIS A ND1   1 
ATOM   2072 C  CD2   . HIS A 1 262 ? -6.955  -2.307  6.086   1.00 21.07  ? 554  HIS A CD2   1 
ATOM   2073 C  CE1   . HIS A 1 262 ? -5.451  -2.765  7.618   1.00 25.60  ? 554  HIS A CE1   1 
ATOM   2074 N  NE2   . HIS A 1 262 ? -5.788  -1.892  6.684   1.00 24.81  ? 554  HIS A NE2   1 
ATOM   2075 N  N     . PRO A 1 263 ? -6.298  -6.891  7.171   1.00 18.67  ? 555  PRO A N     1 
ATOM   2076 C  CA    . PRO A 1 263 ? -5.809  -7.774  8.240   1.00 22.11  ? 555  PRO A CA    1 
ATOM   2077 C  C     . PRO A 1 263 ? -5.795  -7.157  9.648   1.00 21.93  ? 555  PRO A C     1 
ATOM   2078 O  O     . PRO A 1 263 ? -5.758  -7.900  10.631  1.00 24.22  ? 555  PRO A O     1 
ATOM   2079 C  CB    . PRO A 1 263 ? -4.385  -8.148  7.781   1.00 23.95  ? 555  PRO A CB    1 
ATOM   2080 C  CG    . PRO A 1 263 ? -3.975  -7.019  6.853   1.00 23.98  ? 555  PRO A CG    1 
ATOM   2081 C  CD    . PRO A 1 263 ? -5.255  -6.578  6.173   1.00 20.58  ? 555  PRO A CD    1 
ATOM   2082 N  N     . ARG A 1 264 ? -5.826  -5.840  9.757   1.00 23.16  ? 556  ARG A N     1 
ATOM   2083 C  CA    . ARG A 1 264 ? -5.810  -5.210  11.075  1.00 22.72  ? 556  ARG A CA    1 
ATOM   2084 C  C     . ARG A 1 264 ? -7.186  -5.234  11.703  1.00 28.80  ? 556  ARG A C     1 
ATOM   2085 O  O     . ARG A 1 264 ? -7.323  -5.394  12.913  1.00 30.70  ? 556  ARG A O     1 
ATOM   2086 C  CB    . ARG A 1 264 ? -5.344  -3.759  10.989  1.00 36.14  ? 556  ARG A CB    1 
ATOM   2087 C  CG    . ARG A 1 264 ? -3.928  -3.607  10.531  1.00 41.31  ? 556  ARG A CG    1 
ATOM   2088 C  CD    . ARG A 1 264 ? -3.055  -3.021  11.609  1.00 35.69  ? 556  ARG A CD    1 
ATOM   2089 N  NE    . ARG A 1 264 ? -1.722  -2.797  11.076  1.00 31.79  ? 556  ARG A NE    1 
ATOM   2090 C  CZ    . ARG A 1 264 ? -0.623  -3.384  11.537  1.00 30.26  ? 556  ARG A CZ    1 
ATOM   2091 N  NH1   . ARG A 1 264 ? -0.687  -4.211  12.573  1.00 27.87  ? 556  ARG A NH1   1 
ATOM   2092 N  NH2   . ARG A 1 264 ? 0.547   -3.119  10.969  1.00 32.21  ? 556  ARG A NH2   1 
ATOM   2093 N  N     . THR A 1 265 ? -8.208  -5.066  10.872  1.00 18.25  ? 557  THR A N     1 
ATOM   2094 C  CA    . THR A 1 265 ? -9.565  -4.944  11.374  1.00 19.85  ? 557  THR A CA    1 
ATOM   2095 C  C     . THR A 1 265 ? -10.375 -6.232  11.232  1.00 22.03  ? 557  THR A C     1 
ATOM   2096 O  O     . THR A 1 265 ? -11.370 -6.427  11.939  1.00 23.48  ? 557  THR A O     1 
ATOM   2097 C  CB    . THR A 1 265 ? -10.305 -3.857  10.586  1.00 20.32  ? 557  THR A CB    1 
ATOM   2098 O  OG1   . THR A 1 265 ? -10.458 -4.309  9.233   1.00 19.32  ? 557  THR A OG1   1 
ATOM   2099 C  CG2   . THR A 1 265 ? -9.509  -2.548  10.605  1.00 22.58  ? 557  THR A CG2   1 
ATOM   2100 N  N     . GLY A 1 266 ? -9.982  -7.099  10.300  1.00 19.40  ? 558  GLY A N     1 
ATOM   2101 C  CA    . GLY A 1 266 ? -10.769 -8.287  9.985   1.00 20.92  ? 558  GLY A CA    1 
ATOM   2102 C  C     . GLY A 1 266 ? -12.087 -7.968  9.286   1.00 21.01  ? 558  GLY A C     1 
ATOM   2103 O  O     . GLY A 1 266 ? -13.025 -8.770  9.270   1.00 19.50  ? 558  GLY A O     1 
ATOM   2104 N  N     . ARG A 1 267 ? -12.155 -6.780  8.701   1.00 16.69  ? 559  ARG A N     1 
ATOM   2105 C  CA    . ARG A 1 267 ? -13.368 -6.348  8.022   1.00 17.20  ? 559  ARG A CA    1 
ATOM   2106 C  C     . ARG A 1 267 ? -13.106 -5.800  6.617   1.00 17.15  ? 559  ARG A C     1 
ATOM   2107 O  O     . ARG A 1 267 ? -11.963 -5.494  6.241   1.00 18.51  ? 559  ARG A O     1 
ATOM   2108 C  CB    . ARG A 1 267 ? -14.136 -5.358  8.900   1.00 19.78  ? 559  ARG A CB    1 
ATOM   2109 C  CG    . ARG A 1 267 ? -14.814 -6.106  10.099  1.00 20.30  ? 559  ARG A CG    1 
ATOM   2110 C  CD    . ARG A 1 267 ? -15.231 -5.188  11.202  1.00 26.45  ? 559  ARG A CD    1 
ATOM   2111 N  NE    . ARG A 1 267 ? -16.462 -4.447  10.953  1.00 24.99  ? 559  ARG A NE    1 
ATOM   2112 C  CZ    . ARG A 1 267 ? -17.648 -4.732  11.491  1.00 26.50  ? 559  ARG A CZ    1 
ATOM   2113 N  NH1   . ARG A 1 267 ? -17.797 -5.790  12.290  1.00 24.39  ? 559  ARG A NH1   1 
ATOM   2114 N  NH2   . ARG A 1 267 ? -18.692 -3.951  11.227  1.00 17.60  ? 559  ARG A NH2   1 
ATOM   2115 N  N     . LEU A 1 268 ? -14.179 -5.731  5.841   1.00 16.79  ? 560  LEU A N     1 
ATOM   2116 C  CA    . LEU A 1 268 ? -14.158 -5.151  4.504   1.00 15.54  ? 560  LEU A CA    1 
ATOM   2117 C  C     . LEU A 1 268 ? -14.506 -3.673  4.628   1.00 17.41  ? 560  LEU A C     1 
ATOM   2118 O  O     . LEU A 1 268 ? -15.494 -3.338  5.272   1.00 17.49  ? 560  LEU A O     1 
ATOM   2119 C  CB    . LEU A 1 268 ? -15.233 -5.848  3.660   1.00 16.32  ? 560  LEU A CB    1 
ATOM   2120 C  CG    . LEU A 1 268 ? -15.674 -5.079  2.417   1.00 22.79  ? 560  LEU A CG    1 
ATOM   2121 C  CD1   . LEU A 1 268 ? -14.617 -5.218  1.345   1.00 23.36  ? 560  LEU A CD1   1 
ATOM   2122 C  CD2   . LEU A 1 268 ? -17.019 -5.625  1.932   1.00 21.35  ? 560  LEU A CD2   1 
ATOM   2123 N  N     . HIS A 1 269 ? -13.729 -2.792  3.988   1.00 17.16  ? 561  HIS A N     1 
ATOM   2124 C  CA    . HIS A 1 269 ? -13.947 -1.337  4.109   1.00 15.08  ? 561  HIS A CA    1 
ATOM   2125 C  C     . HIS A 1 269 ? -14.359 -0.721  2.782   1.00 16.57  ? 561  HIS A C     1 
ATOM   2126 O  O     . HIS A 1 269 ? -13.525 -0.227  2.026   1.00 20.06  ? 561  HIS A O     1 
ATOM   2127 C  CB    . HIS A 1 269 ? -12.699 -0.671  4.690   1.00 15.81  ? 561  HIS A CB    1 
ATOM   2128 C  CG    . HIS A 1 269 ? -12.375 -1.190  6.051   1.00 15.69  ? 561  HIS A CG    1 
ATOM   2129 N  ND1   . HIS A 1 269 ? -12.944 -0.667  7.197   1.00 16.58  ? 561  HIS A ND1   1 
ATOM   2130 C  CD2   . HIS A 1 269 ? -11.658 -2.268  6.449   1.00 20.03  ? 561  HIS A CD2   1 
ATOM   2131 C  CE1   . HIS A 1 269 ? -12.545 -1.370  8.243   1.00 17.11  ? 561  HIS A CE1   1 
ATOM   2132 N  NE2   . HIS A 1 269 ? -11.758 -2.343  7.817   1.00 18.85  ? 561  HIS A NE2   1 
ATOM   2133 N  N     . THR A 1 270 ? -15.655 -0.803  2.505   1.00 16.36  ? 562  THR A N     1 
ATOM   2134 C  CA    . THR A 1 270 ? -16.222 -0.261  1.273   1.00 16.05  ? 562  THR A CA    1 
ATOM   2135 C  C     . THR A 1 270 ? -16.008 1.232   1.272   1.00 21.22  ? 562  THR A C     1 
ATOM   2136 O  O     . THR A 1 270 ? -16.107 1.886   2.316   1.00 20.75  ? 562  THR A O     1 
ATOM   2137 C  CB    . THR A 1 270 ? -17.722 -0.552  1.210   1.00 19.46  ? 562  THR A CB    1 
ATOM   2138 O  OG1   . THR A 1 270 ? -17.952 -1.951  1.419   1.00 20.75  ? 562  THR A OG1   1 
ATOM   2139 C  CG2   . THR A 1 270 ? -18.324 -0.114  -0.136  1.00 19.04  ? 562  THR A CG2   1 
ATOM   2140 N  N     . ARG A 1 271 ? -15.697 1.783   0.102   1.00 18.20  ? 563  ARG A N     1 
ATOM   2141 C  CA    . ARG A 1 271 ? -15.444 3.204   0.004   1.00 18.96  ? 563  ARG A CA    1 
ATOM   2142 C  C     . ARG A 1 271 ? -16.708 3.900   -0.460  1.00 19.07  ? 563  ARG A C     1 
ATOM   2143 O  O     . ARG A 1 271 ? -17.293 3.496   -1.455  1.00 21.73  ? 563  ARG A O     1 
ATOM   2144 C  CB    . ARG A 1 271 ? -14.300 3.466   -0.977  1.00 19.17  ? 563  ARG A CB    1 
ATOM   2145 C  CG    . ARG A 1 271 ? -12.998 2.740   -0.585  1.00 25.51  ? 563  ARG A CG    1 
ATOM   2146 C  CD    . ARG A 1 271 ? -11.847 3.242   -1.431  1.00 31.09  ? 563  ARG A CD    1 
ATOM   2147 N  NE    . ARG A 1 271 ? -11.610 4.664   -1.209  1.00 47.22  ? 563  ARG A NE    1 
ATOM   2148 C  CZ    . ARG A 1 271 ? -11.152 5.491   -2.141  1.00 47.51  ? 563  ARG A CZ    1 
ATOM   2149 N  NH1   . ARG A 1 271 ? -10.889 5.034   -3.362  1.00 48.56  ? 563  ARG A NH1   1 
ATOM   2150 N  NH2   . ARG A 1 271 ? -10.963 6.771   -1.854  1.00 40.26  ? 563  ARG A NH2   1 
ATOM   2151 N  N     . PHE A 1 272 ? -17.149 4.917   0.275   1.00 17.52  ? 564  PHE A N     1 
ATOM   2152 C  CA    . PHE A 1 272 ? -18.332 5.664   -0.128  1.00 16.69  ? 564  PHE A CA    1 
ATOM   2153 C  C     . PHE A 1 272 ? -17.946 7.053   -0.608  1.00 20.81  ? 564  PHE A C     1 
ATOM   2154 O  O     . PHE A 1 272 ? -17.137 7.733   0.023   1.00 23.33  ? 564  PHE A O     1 
ATOM   2155 C  CB    . PHE A 1 272 ? -19.365 5.724   1.006   1.00 21.01  ? 564  PHE A CB    1 
ATOM   2156 C  CG    . PHE A 1 272 ? -19.898 4.365   1.386   1.00 20.76  ? 564  PHE A CG    1 
ATOM   2157 C  CD1   . PHE A 1 272 ? -20.930 3.786   0.659   1.00 20.00  ? 564  PHE A CD1   1 
ATOM   2158 C  CD2   . PHE A 1 272 ? -19.335 3.652   2.439   1.00 20.56  ? 564  PHE A CD2   1 
ATOM   2159 C  CE1   . PHE A 1 272 ? -21.404 2.507   0.986   1.00 19.83  ? 564  PHE A CE1   1 
ATOM   2160 C  CE2   . PHE A 1 272 ? -19.805 2.381   2.774   1.00 20.53  ? 564  PHE A CE2   1 
ATOM   2161 C  CZ    . PHE A 1 272 ? -20.849 1.816   2.038   1.00 18.92  ? 564  PHE A CZ    1 
ATOM   2162 N  N     . ASN A 1 273 ? -18.517 7.460   -1.735  1.00 21.68  ? 565  ASN A N     1 
ATOM   2163 C  CA    . ASN A 1 273 ? -18.193 8.767   -2.310  1.00 19.78  ? 565  ASN A CA    1 
ATOM   2164 C  C     . ASN A 1 273 ? -19.454 9.591   -2.512  1.00 19.07  ? 565  ASN A C     1 
ATOM   2165 O  O     . ASN A 1 273 ? -20.435 9.113   -3.082  1.00 20.22  ? 565  ASN A O     1 
ATOM   2166 C  CB    . ASN A 1 273 ? -17.443 8.610   -3.630  1.00 25.41  ? 565  ASN A CB    1 
ATOM   2167 C  CG    . ASN A 1 273 ? -16.694 9.881   -4.031  1.00 38.65  ? 565  ASN A CG    1 
ATOM   2168 O  OD1   . ASN A 1 273 ? -17.290 10.834  -4.523  1.00 30.12  ? 565  ASN A OD1   1 
ATOM   2169 N  ND2   . ASN A 1 273 ? -15.384 9.896   -3.808  1.00 48.92  ? 565  ASN A ND2   1 
ATOM   2170 N  N     . GLN A 1 274 ? -19.433 10.836  -2.036  1.00 20.38  ? 566  GLN A N     1 
ATOM   2171 C  CA    . GLN A 1 274 ? -20.643 11.637  -2.040  1.00 22.75  ? 566  GLN A CA    1 
ATOM   2172 C  C     . GLN A 1 274 ? -20.564 12.744  -3.084  1.00 23.99  ? 566  GLN A C     1 
ATOM   2173 O  O     . GLN A 1 274 ? -21.468 13.563  -3.172  1.00 23.78  ? 566  GLN A O     1 
ATOM   2174 C  CB    . GLN A 1 274 ? -20.941 12.223  -0.643  1.00 26.10  ? 566  GLN A CB    1 
ATOM   2175 C  CG    . GLN A 1 274 ? -20.045 13.379  -0.239  1.00 26.82  ? 566  GLN A CG    1 
ATOM   2176 C  CD    . GLN A 1 274 ? -20.209 13.794  1.221   1.00 23.65  ? 566  GLN A CD    1 
ATOM   2177 O  OE1   . GLN A 1 274 ? -19.341 13.525  2.037   1.00 22.15  ? 566  GLN A OE1   1 
ATOM   2178 N  NE2   . GLN A 1 274 ? -21.315 14.459  1.545   1.00 21.16  ? 566  GLN A NE2   1 
ATOM   2179 N  N     . THR A 1 275 ? -19.491 12.761  -3.874  1.00 20.35  ? 567  THR A N     1 
ATOM   2180 C  CA    . THR A 1 275 ? -19.416 13.697  -5.001  1.00 20.14  ? 567  THR A CA    1 
ATOM   2181 C  C     . THR A 1 275 ? -19.106 12.983  -6.299  1.00 23.44  ? 567  THR A C     1 
ATOM   2182 O  O     . THR A 1 275 ? -18.187 13.364  -7.015  1.00 26.37  ? 567  THR A O     1 
ATOM   2183 C  CB    . THR A 1 275 ? -18.385 14.838  -4.762  1.00 23.88  ? 567  THR A CB    1 
ATOM   2184 O  OG1   . THR A 1 275 ? -17.041 14.326  -4.816  1.00 22.98  ? 567  THR A OG1   1 
ATOM   2185 C  CG2   . THR A 1 275 ? -18.630 15.494  -3.420  1.00 21.41  ? 567  THR A CG2   1 
ATOM   2186 N  N     . ALA A 1 276 ? -19.890 11.953  -6.614  1.00 20.08  ? 568  ALA A N     1 
ATOM   2187 C  CA    . ALA A 1 276 ? -19.529 11.069  -7.717  1.00 21.54  ? 568  ALA A CA    1 
ATOM   2188 C  C     . ALA A 1 276 ? -20.557 10.996  -8.845  1.00 28.76  ? 568  ALA A C     1 
ATOM   2189 O  O     . ALA A 1 276 ? -20.211 10.635  -9.966  1.00 29.90  ? 568  ALA A O     1 
ATOM   2190 C  CB    . ALA A 1 276 ? -19.233 9.659   -7.192  1.00 27.90  ? 568  ALA A CB    1 
ATOM   2191 N  N     . THR A 1 277 ? -21.812 11.319  -8.556  1.00 24.64  ? 569  THR A N     1 
ATOM   2192 C  CA    . THR A 1 277 ? -22.867 11.091  -9.541  1.00 18.09  ? 569  THR A CA    1 
ATOM   2193 C  C     . THR A 1 277 ? -23.556 12.394  -9.973  1.00 19.72  ? 569  THR A C     1 
ATOM   2194 O  O     . THR A 1 277 ? -23.509 13.407  -9.270  1.00 22.05  ? 569  THR A O     1 
ATOM   2195 C  CB    . THR A 1 277 ? -23.937 10.150  -8.985  1.00 21.83  ? 569  THR A CB    1 
ATOM   2196 O  OG1   . THR A 1 277 ? -24.639 10.826  -7.938  1.00 22.67  ? 569  THR A OG1   1 
ATOM   2197 C  CG2   . THR A 1 277 ? -23.291 8.895   -8.411  1.00 23.68  ? 569  THR A CG2   1 
ATOM   2198 N  N     . ALA A 1 278 ? -24.229 12.323  -11.114 1.00 20.64  ? 570  ALA A N     1 
ATOM   2199 C  CA    . ALA A 1 278 ? -24.844 13.494  -11.721 1.00 22.38  ? 570  ALA A CA    1 
ATOM   2200 C  C     . ALA A 1 278 ? -26.097 13.950  -10.986 1.00 29.98  ? 570  ALA A C     1 
ATOM   2201 O  O     . ALA A 1 278 ? -26.509 15.108  -11.121 1.00 29.83  ? 570  ALA A O     1 
ATOM   2202 C  CB    . ALA A 1 278 ? -25.151 13.219  -13.189 1.00 26.72  ? 570  ALA A CB    1 
ATOM   2203 N  N     . THR A 1 279 ? -26.695 13.057  -10.204 1.00 24.26  ? 571  THR A N     1 
ATOM   2204 C  CA    . THR A 1 279 ? -27.981 13.345  -9.570  1.00 30.72  ? 571  THR A CA    1 
ATOM   2205 C  C     . THR A 1 279 ? -27.925 13.447  -8.047  1.00 29.96  ? 571  THR A C     1 
ATOM   2206 O  O     . THR A 1 279 ? -28.913 13.802  -7.404  1.00 27.92  ? 571  THR A O     1 
ATOM   2207 C  CB    . THR A 1 279 ? -29.021 12.269  -9.919  1.00 33.75  ? 571  THR A CB    1 
ATOM   2208 O  OG1   . THR A 1 279 ? -28.582 11.015  -9.391  1.00 37.36  ? 571  THR A OG1   1 
ATOM   2209 C  CG2   . THR A 1 279 ? -29.200 12.159  -11.431 1.00 30.99  ? 571  THR A CG2   1 
ATOM   2210 N  N     . GLY A 1 280 ? -26.784 13.119  -7.458  1.00 22.93  ? 572  GLY A N     1 
ATOM   2211 C  CA    . GLY A 1 280 ? -26.668 13.214  -6.019  1.00 23.25  ? 572  GLY A CA    1 
ATOM   2212 C  C     . GLY A 1 280 ? -26.697 11.886  -5.281  1.00 24.63  ? 572  GLY A C     1 
ATOM   2213 O  O     . GLY A 1 280 ? -26.493 11.860  -4.075  1.00 28.22  ? 572  GLY A O     1 
ATOM   2214 N  N     A ARG A 1 281 ? -26.948 10.793  -5.999  0.50 21.30  ? 573  ARG A N     1 
ATOM   2215 N  N     B ARG A 1 281 ? -26.954 10.793  -5.999  0.50 21.16  ? 573  ARG A N     1 
ATOM   2216 C  CA    A ARG A 1 281 ? -26.842 9.456   -5.407  0.50 21.35  ? 573  ARG A CA    1 
ATOM   2217 C  CA    B ARG A 1 281 ? -26.856 9.448   -5.416  0.50 22.41  ? 573  ARG A CA    1 
ATOM   2218 C  C     A ARG A 1 281 ? -25.428 9.194   -4.879  0.50 24.21  ? 573  ARG A C     1 
ATOM   2219 C  C     B ARG A 1 281 ? -25.437 9.175   -4.893  0.50 24.05  ? 573  ARG A C     1 
ATOM   2220 O  O     A ARG A 1 281 ? -24.444 9.623   -5.485  0.50 24.34  ? 573  ARG A O     1 
ATOM   2221 O  O     B ARG A 1 281 ? -24.454 9.583   -5.514  0.50 24.16  ? 573  ARG A O     1 
ATOM   2222 C  CB    A ARG A 1 281 ? -27.183 8.374   -6.436  0.50 26.21  ? 573  ARG A CB    1 
ATOM   2223 C  CB    B ARG A 1 281 ? -27.216 8.378   -6.457  0.50 29.20  ? 573  ARG A CB    1 
ATOM   2224 C  CG    A ARG A 1 281 ? -28.664 8.181   -6.719  0.50 31.68  ? 573  ARG A CG    1 
ATOM   2225 C  CG    B ARG A 1 281 ? -28.704 8.239   -6.799  0.50 33.68  ? 573  ARG A CG    1 
ATOM   2226 C  CD    A ARG A 1 281 ? -28.903 6.824   -7.390  0.50 37.59  ? 573  ARG A CD    1 
ATOM   2227 C  CD    B ARG A 1 281 ? -28.912 7.160   -7.883  0.50 33.58  ? 573  ARG A CD    1 
ATOM   2228 N  NE    A ARG A 1 281 ? -28.394 5.745   -6.550  0.50 33.41  ? 573  ARG A NE    1 
ATOM   2229 N  NE    B ARG A 1 281 ? -30.314 6.770   -8.085  0.50 25.59  ? 573  ARG A NE    1 
ATOM   2230 C  CZ    A ARG A 1 281 ? -29.147 4.963   -5.781  0.50 25.57  ? 573  ARG A CZ    1 
ATOM   2231 C  CZ    B ARG A 1 281 ? -30.690 5.731   -8.830  0.50 31.58  ? 573  ARG A CZ    1 
ATOM   2232 N  NH1   A ARG A 1 281 ? -30.466 5.101   -5.751  0.50 28.70  ? 573  ARG A NH1   1 
ATOM   2233 N  NH1   B ARG A 1 281 ? -29.768 4.993   -9.443  0.50 18.78  ? 573  ARG A NH1   1 
ATOM   2234 N  NH2   A ARG A 1 281 ? -28.572 4.036   -5.042  0.50 29.18  ? 573  ARG A NH2   1 
ATOM   2235 N  NH2   B ARG A 1 281 ? -31.981 5.421   -8.967  0.50 28.33  ? 573  ARG A NH2   1 
ATOM   2236 N  N     . LEU A 1 282 ? -25.336 8.495   -3.751  1.00 21.38  ? 574  LEU A N     1 
ATOM   2237 C  CA    . LEU A 1 282 ? -24.045 8.050   -3.217  1.00 15.24  ? 574  LEU A CA    1 
ATOM   2238 C  C     . LEU A 1 282 ? -23.516 6.922   -4.068  1.00 23.51  ? 574  LEU A C     1 
ATOM   2239 O  O     . LEU A 1 282 ? -24.286 6.145   -4.633  1.00 29.57  ? 574  LEU A O     1 
ATOM   2240 C  CB    . LEU A 1 282 ? -24.206 7.510   -1.791  1.00 20.70  ? 574  LEU A CB    1 
ATOM   2241 C  CG    . LEU A 1 282 ? -24.529 8.542   -0.714  1.00 28.26  ? 574  LEU A CG    1 
ATOM   2242 C  CD1   . LEU A 1 282 ? -24.808 7.843   0.599   1.00 25.49  ? 574  LEU A CD1   1 
ATOM   2243 C  CD2   . LEU A 1 282 ? -23.359 9.518   -0.548  1.00 26.89  ? 574  LEU A CD2   1 
ATOM   2244 N  N     . SER A 1 283 ? -22.205 6.805   -4.143  1.00 19.35  ? 575  SER A N     1 
ATOM   2245 C  CA    . SER A 1 283 ? -21.618 5.658   -4.837  1.00 17.85  ? 575  SER A CA    1 
ATOM   2246 C  C     . SER A 1 283 ? -20.721 4.863   -3.894  1.00 19.79  ? 575  SER A C     1 
ATOM   2247 O  O     . SER A 1 283 ? -20.226 5.385   -2.894  1.00 20.10  ? 575  SER A O     1 
ATOM   2248 C  CB    . SER A 1 283 ? -20.846 6.105   -6.082  1.00 25.23  ? 575  SER A CB    1 
ATOM   2249 O  OG    . SER A 1 283 ? -19.582 6.616   -5.735  1.00 40.70  ? 575  SER A OG    1 
ATOM   2250 N  N     . SER A 1 284 ? -20.514 3.586   -4.208  1.00 17.97  ? 576  SER A N     1 
ATOM   2251 C  CA    . SER A 1 284 ? -19.598 2.770   -3.431  1.00 15.71  ? 576  SER A CA    1 
ATOM   2252 C  C     . SER A 1 284 ? -18.592 2.147   -4.381  1.00 17.55  ? 576  SER A C     1 
ATOM   2253 O  O     . SER A 1 284 ? -18.883 1.964   -5.567  1.00 18.34  ? 576  SER A O     1 
ATOM   2254 C  CB    . SER A 1 284 ? -20.339 1.656   -2.667  1.00 16.87  ? 576  SER A CB    1 
ATOM   2255 O  OG    . SER A 1 284 ? -21.168 0.860   -3.519  1.00 18.28  ? 576  SER A OG    1 
ATOM   2256 N  N     . SER A 1 285 ? -17.409 1.831   -3.865  1.00 19.13  ? 577  SER A N     1 
ATOM   2257 C  CA    A SER A 1 285 ? -16.372 1.142   -4.632  0.45 21.34  ? 577  SER A CA    1 
ATOM   2258 C  CA    B SER A 1 285 ? -16.433 1.081   -4.643  0.55 18.88  ? 577  SER A CA    1 
ATOM   2259 C  C     . SER A 1 285 ? -15.650 0.122   -3.754  1.00 23.51  ? 577  SER A C     1 
ATOM   2260 O  O     . SER A 1 285 ? -15.571 0.302   -2.537  1.00 23.20  ? 577  SER A O     1 
ATOM   2261 C  CB    A SER A 1 285 ? -15.350 2.143   -5.182  0.45 25.23  ? 577  SER A CB    1 
ATOM   2262 C  CB    B SER A 1 285 ? -15.492 2.015   -5.423  0.55 22.84  ? 577  SER A CB    1 
ATOM   2263 O  OG    A SER A 1 285 ? -15.965 3.141   -5.975  0.45 20.74  ? 577  SER A OG    1 
ATOM   2264 O  OG    B SER A 1 285 ? -14.724 2.830   -4.556  0.55 24.68  ? 577  SER A OG    1 
ATOM   2265 N  N     . ASP A 1 286 ? -15.116 -0.929  -4.374  1.00 25.15  ? 578  ASP A N     1 
ATOM   2266 C  CA    . ASP A 1 286 ? -14.356 -1.963  -3.652  1.00 26.84  ? 578  ASP A CA    1 
ATOM   2267 C  C     . ASP A 1 286 ? -15.093 -2.585  -2.452  1.00 21.80  ? 578  ASP A C     1 
ATOM   2268 O  O     . ASP A 1 286 ? -14.555 -2.587  -1.351  1.00 27.17  ? 578  ASP A O     1 
ATOM   2269 C  CB    . ASP A 1 286 ? -13.034 -1.390  -3.110  1.00 31.49  ? 578  ASP A CB    1 
ATOM   2270 C  CG    . ASP A 1 286 ? -12.285 -0.514  -4.113  1.00 47.80  ? 578  ASP A CG    1 
ATOM   2271 O  OD1   . ASP A 1 286 ? -12.072 -0.943  -5.267  1.00 37.68  ? 578  ASP A OD1   1 
ATOM   2272 O  OD2   . ASP A 1 286 ? -11.879 0.608   -3.726  1.00 50.05  ? 578  ASP A OD2   1 
ATOM   2273 N  N     . PRO A 1 287 ? -16.289 -3.157  -2.642  1.00 24.48  ? 579  PRO A N     1 
ATOM   2274 C  CA    . PRO A 1 287 ? -17.045 -3.405  -3.863  1.00 32.81  ? 579  PRO A CA    1 
ATOM   2275 C  C     . PRO A 1 287 ? -17.930 -2.223  -4.216  1.00 26.74  ? 579  PRO A C     1 
ATOM   2276 O  O     . PRO A 1 287 ? -18.301 -1.414  -3.368  1.00 22.99  ? 579  PRO A O     1 
ATOM   2277 C  CB    . PRO A 1 287 ? -17.941 -4.578  -3.462  1.00 33.17  ? 579  PRO A CB    1 
ATOM   2278 C  CG    . PRO A 1 287 ? -18.256 -4.283  -2.024  1.00 28.48  ? 579  PRO A CG    1 
ATOM   2279 C  CD    . PRO A 1 287 ? -16.958 -3.748  -1.470  1.00 25.16  ? 579  PRO A CD    1 
ATOM   2280 N  N     . ASN A 1 288 ? -18.269 -2.137  -5.490  1.00 22.89  ? 580  ASN A N     1 
ATOM   2281 C  CA    . ASN A 1 288 ? -19.426 -1.377  -5.900  1.00 27.31  ? 580  ASN A CA    1 
ATOM   2282 C  C     . ASN A 1 288 ? -20.660 -2.220  -5.575  1.00 21.61  ? 580  ASN A C     1 
ATOM   2283 O  O     . ASN A 1 288 ? -20.967 -3.176  -6.284  1.00 22.57  ? 580  ASN A O     1 
ATOM   2284 C  CB    . ASN A 1 288 ? -19.341 -1.089  -7.397  1.00 27.78  ? 580  ASN A CB    1 
ATOM   2285 C  CG    . ASN A 1 288 ? -20.542 -0.323  -7.917  1.00 30.63  ? 580  ASN A CG    1 
ATOM   2286 O  OD1   . ASN A 1 288 ? -21.489 -0.040  -7.182  1.00 24.24  ? 580  ASN A OD1   1 
ATOM   2287 N  ND2   . ASN A 1 288 ? -20.501 0.031   -9.195  1.00 28.73  ? 580  ASN A ND2   1 
ATOM   2288 N  N     . LEU A 1 289 ? -21.385 -1.855  -4.518  1.00 19.48  ? 581  LEU A N     1 
ATOM   2289 C  CA    . LEU A 1 289 ? -22.519 -2.662  -4.066  1.00 19.64  ? 581  LEU A CA    1 
ATOM   2290 C  C     . LEU A 1 289 ? -23.684 -2.616  -5.055  1.00 22.63  ? 581  LEU A C     1 
ATOM   2291 O  O     . LEU A 1 289 ? -24.594 -3.438  -4.992  1.00 20.29  ? 581  LEU A O     1 
ATOM   2292 C  CB    . LEU A 1 289 ? -23.002 -2.181  -2.687  1.00 17.06  ? 581  LEU A CB    1 
ATOM   2293 C  CG    . LEU A 1 289 ? -21.972 -2.235  -1.557  1.00 21.69  ? 581  LEU A CG    1 
ATOM   2294 C  CD1   . LEU A 1 289 ? -22.417 -1.358  -0.386  1.00 24.20  ? 581  LEU A CD1   1 
ATOM   2295 C  CD2   . LEU A 1 289 ? -21.764 -3.668  -1.108  1.00 22.51  ? 581  LEU A CD2   1 
ATOM   2296 N  N     . GLN A 1 290 ? -23.658 -1.645  -5.969  1.00 22.87  ? 582  GLN A N     1 
ATOM   2297 C  CA    . GLN A 1 290 ? -24.789 -1.422  -6.863  1.00 22.57  ? 582  GLN A CA    1 
ATOM   2298 C  C     . GLN A 1 290 ? -25.124 -2.627  -7.730  1.00 25.98  ? 582  GLN A C     1 
ATOM   2299 O  O     . GLN A 1 290 ? -26.296 -2.882  -8.021  1.00 20.70  ? 582  GLN A O     1 
ATOM   2300 C  CB    . GLN A 1 290 ? -24.536 -0.198  -7.757  1.00 23.28  ? 582  GLN A CB    1 
ATOM   2301 C  CG    . GLN A 1 290 ? -25.409 -0.177  -9.013  1.00 33.70  ? 582  GLN A CG    1 
ATOM   2302 C  CD    . GLN A 1 290 ? -26.870 0.085   -8.705  1.00 44.63  ? 582  GLN A CD    1 
ATOM   2303 O  OE1   . GLN A 1 290 ? -27.199 0.749   -7.718  1.00 48.29  ? 582  GLN A OE1   1 
ATOM   2304 N  NE2   . GLN A 1 290 ? -27.757 -0.435  -9.549  1.00 34.75  ? 582  GLN A NE2   1 
ATOM   2305 N  N     . ASN A 1 291 ? -24.098 -3.381  -8.116  1.00 20.89  ? 583  ASN A N     1 
ATOM   2306 C  CA    . ASN A 1 291 ? -24.266 -4.384  -9.160  1.00 22.81  ? 583  ASN A CA    1 
ATOM   2307 C  C     . ASN A 1 291 ? -24.485 -5.787  -8.655  1.00 22.97  ? 583  ASN A C     1 
ATOM   2308 O  O     . ASN A 1 291 ? -24.448 -6.736  -9.439  1.00 24.46  ? 583  ASN A O     1 
ATOM   2309 C  CB    . ASN A 1 291 ? -23.094 -4.335  -10.140 1.00 28.17  ? 583  ASN A CB    1 
ATOM   2310 C  CG    . ASN A 1 291 ? -23.033 -3.025  -10.894 1.00 29.55  ? 583  ASN A CG    1 
ATOM   2311 O  OD1   . ASN A 1 291 ? -24.069 -2.474  -11.291 1.00 25.64  ? 583  ASN A OD1   1 
ATOM   2312 N  ND2   . ASN A 1 291 ? -21.824 -2.510  -11.087 1.00 34.01  ? 583  ASN A ND2   1 
ATOM   2313 N  N     . ILE A 1 292 ? -24.736 -5.922  -7.350  1.00 23.37  ? 584  ILE A N     1 
ATOM   2314 C  CA    . ILE A 1 292 ? -25.113 -7.220  -6.809  1.00 24.47  ? 584  ILE A CA    1 
ATOM   2315 C  C     . ILE A 1 292 ? -26.606 -7.397  -7.026  1.00 24.54  ? 584  ILE A C     1 
ATOM   2316 O  O     . ILE A 1 292 ? -27.411 -6.647  -6.466  1.00 25.91  ? 584  ILE A O     1 
ATOM   2317 C  CB    . ILE A 1 292 ? -24.825 -7.340  -5.279  1.00 23.56  ? 584  ILE A CB    1 
ATOM   2318 C  CG1   . ILE A 1 292 ? -23.368 -7.002  -4.969  1.00 20.96  ? 584  ILE A CG1   1 
ATOM   2319 C  CG2   . ILE A 1 292 ? -25.167 -8.749  -4.805  1.00 22.43  ? 584  ILE A CG2   1 
ATOM   2320 C  CD1   . ILE A 1 292 ? -23.084 -6.772  -3.468  1.00 25.21  ? 584  ILE A CD1   1 
ATOM   2321 N  N     . PRO A 1 293 ? -26.990 -8.410  -7.824  1.00 25.23  ? 585  PRO A N     1 
ATOM   2322 C  CA    . PRO A 1 293 ? -28.399 -8.601  -8.159  1.00 29.90  ? 585  PRO A CA    1 
ATOM   2323 C  C     . PRO A 1 293 ? -29.182 -8.934  -6.900  1.00 33.84  ? 585  PRO A C     1 
ATOM   2324 O  O     . PRO A 1 293 ? -28.677 -9.609  -5.998  1.00 30.83  ? 585  PRO A O     1 
ATOM   2325 C  CB    . PRO A 1 293 ? -28.381 -9.801  -9.119  1.00 29.85  ? 585  PRO A CB    1 
ATOM   2326 C  CG    . PRO A 1 293 ? -26.977 -9.890  -9.605  1.00 35.84  ? 585  PRO A CG    1 
ATOM   2327 C  CD    . PRO A 1 293 ? -26.134 -9.424  -8.457  1.00 27.09  ? 585  PRO A CD    1 
ATOM   2328 N  N     . VAL A 1 294 ? -30.409 -8.446  -6.844  1.00 27.96  ? 586  VAL A N     1 
ATOM   2329 C  CA    . VAL A 1 294 ? -31.243 -8.587  -5.660  1.00 34.22  ? 586  VAL A CA    1 
ATOM   2330 C  C     . VAL A 1 294 ? -32.031 -9.894  -5.682  1.00 35.11  ? 586  VAL A C     1 
ATOM   2331 O  O     . VAL A 1 294 ? -32.253 -10.514 -4.640  1.00 39.00  ? 586  VAL A O     1 
ATOM   2332 C  CB    . VAL A 1 294 ? -32.209 -7.391  -5.558  1.00 42.33  ? 586  VAL A CB    1 
ATOM   2333 C  CG1   . VAL A 1 294 ? -33.261 -7.609  -4.474  1.00 43.35  ? 586  VAL A CG1   1 
ATOM   2334 C  CG2   . VAL A 1 294 ? -31.423 -6.100  -5.332  1.00 32.74  ? 586  VAL A CG2   1 
ATOM   2335 N  N     . ARG A 1 295 ? -32.417 -10.328 -6.878  1.00 34.31  ? 587  ARG A N     1 
ATOM   2336 C  CA    . ARG A 1 295 ? -33.400 -11.404 -7.010  1.00 46.61  ? 587  ARG A CA    1 
ATOM   2337 C  C     . ARG A 1 295 ? -32.814 -12.795 -7.252  1.00 45.62  ? 587  ARG A C     1 
ATOM   2338 O  O     . ARG A 1 295 ? -33.359 -13.797 -6.788  1.00 54.92  ? 587  ARG A O     1 
ATOM   2339 C  CB    . ARG A 1 295 ? -34.397 -11.060 -8.119  1.00 62.48  ? 587  ARG A CB    1 
ATOM   2340 C  CG    . ARG A 1 295 ? -35.519 -12.068 -8.287  1.00 75.65  ? 587  ARG A CG    1 
ATOM   2341 C  CD    . ARG A 1 295 ? -36.274 -11.844 -9.585  1.00 85.87  ? 587  ARG A CD    1 
ATOM   2342 N  NE    . ARG A 1 295 ? -35.452 -12.114 -10.765 1.00 89.05  ? 587  ARG A NE    1 
ATOM   2343 C  CZ    . ARG A 1 295 ? -34.819 -11.182 -11.472 1.00 91.01  ? 587  ARG A CZ    1 
ATOM   2344 N  NH1   . ARG A 1 295 ? -34.913 -9.904  -11.130 1.00 88.84  ? 587  ARG A NH1   1 
ATOM   2345 N  NH2   . ARG A 1 295 ? -34.097 -11.527 -12.531 1.00 93.77  ? 587  ARG A NH2   1 
ATOM   2346 N  N     . THR A 1 296 ? -31.705 -12.856 -7.975  1.00 34.17  ? 588  THR A N     1 
ATOM   2347 C  CA    . THR A 1 296 ? -31.152 -14.134 -8.390  1.00 37.04  ? 588  THR A CA    1 
ATOM   2348 C  C     . THR A 1 296 ? -30.594 -14.909 -7.199  1.00 32.87  ? 588  THR A C     1 
ATOM   2349 O  O     . THR A 1 296 ? -30.230 -14.310 -6.180  1.00 37.66  ? 588  THR A O     1 
ATOM   2350 C  CB    . THR A 1 296 ? -30.050 -13.930 -9.435  1.00 46.95  ? 588  THR A CB    1 
ATOM   2351 O  OG1   . THR A 1 296 ? -28.889 -13.390 -8.797  1.00 32.77  ? 588  THR A OG1   1 
ATOM   2352 C  CG2   . THR A 1 296 ? -30.528 -12.974 -10.528 1.00 46.19  ? 588  THR A CG2   1 
ATOM   2353 N  N     . PRO A 1 297 ? -30.535 -16.249 -7.316  1.00 32.71  ? 589  PRO A N     1 
ATOM   2354 C  CA    . PRO A 1 297 ? -29.991 -17.061 -6.223  1.00 35.26  ? 589  PRO A CA    1 
ATOM   2355 C  C     . PRO A 1 297 ? -28.564 -16.672 -5.846  1.00 33.31  ? 589  PRO A C     1 
ATOM   2356 O  O     . PRO A 1 297 ? -28.248 -16.634 -4.661  1.00 30.87  ? 589  PRO A O     1 
ATOM   2357 C  CB    . PRO A 1 297 ? -30.023 -18.480 -6.796  1.00 37.30  ? 589  PRO A CB    1 
ATOM   2358 C  CG    . PRO A 1 297 ? -31.157 -18.455 -7.766  1.00 38.93  ? 589  PRO A CG    1 
ATOM   2359 C  CD    . PRO A 1 297 ? -31.103 -17.088 -8.392  1.00 37.40  ? 589  PRO A CD    1 
ATOM   2360 N  N     . LEU A 1 298 ? -27.716 -16.375 -6.826  1.00 34.89  ? 590  LEU A N     1 
ATOM   2361 C  CA    . LEU A 1 298 ? -26.318 -16.113 -6.517  1.00 33.53  ? 590  LEU A CA    1 
ATOM   2362 C  C     . LEU A 1 298 ? -26.130 -14.708 -5.931  1.00 27.26  ? 590  LEU A C     1 
ATOM   2363 O  O     . LEU A 1 298 ? -25.276 -14.496 -5.075  1.00 32.55  ? 590  LEU A O     1 
ATOM   2364 C  CB    . LEU A 1 298 ? -25.436 -16.328 -7.748  1.00 35.33  ? 590  LEU A CB    1 
ATOM   2365 C  CG    . LEU A 1 298 ? -23.922 -16.279 -7.503  1.00 39.04  ? 590  LEU A CG    1 
ATOM   2366 C  CD1   . LEU A 1 298 ? -23.517 -17.278 -6.417  1.00 38.54  ? 590  LEU A CD1   1 
ATOM   2367 C  CD2   . LEU A 1 298 ? -23.155 -16.537 -8.794  1.00 38.59  ? 590  LEU A CD2   1 
ATOM   2368 N  N     . GLY A 1 299 ? -26.919 -13.750 -6.409  1.00 28.87  ? 591  GLY A N     1 
ATOM   2369 C  CA    . GLY A 1 299 ? -26.915 -12.417 -5.831  1.00 26.97  ? 591  GLY A CA    1 
ATOM   2370 C  C     . GLY A 1 299 ? -27.322 -12.491 -4.365  1.00 27.73  ? 591  GLY A C     1 
ATOM   2371 O  O     . GLY A 1 299 ? -26.745 -11.822 -3.496  1.00 26.48  ? 591  GLY A O     1 
ATOM   2372 N  N     . GLN A 1 300 ? -28.327 -13.318 -4.079  1.00 28.59  ? 592  GLN A N     1 
ATOM   2373 C  CA    . GLN A 1 300 ? -28.749 -13.540 -2.694  1.00 28.18  ? 592  GLN A CA    1 
ATOM   2374 C  C     . GLN A 1 300 ? -27.658 -14.227 -1.868  1.00 26.95  ? 592  GLN A C     1 
ATOM   2375 O  O     . GLN A 1 300 ? -27.418 -13.858 -0.716  1.00 28.02  ? 592  GLN A O     1 
ATOM   2376 C  CB    . GLN A 1 300 ? -30.049 -14.353 -2.652  1.00 32.70  ? 592  GLN A CB    1 
ATOM   2377 C  CG    . GLN A 1 300 ? -31.256 -13.593 -3.183  1.00 38.91  ? 592  GLN A CG    1 
ATOM   2378 C  CD    . GLN A 1 300 ? -32.498 -14.463 -3.287  1.00 54.78  ? 592  GLN A CD    1 
ATOM   2379 O  OE1   . GLN A 1 300 ? -32.417 -15.692 -3.251  1.00 51.08  ? 592  GLN A OE1   1 
ATOM   2380 N  NE2   . GLN A 1 300 ? -33.658 -13.825 -3.417  1.00 63.02  ? 592  GLN A NE2   1 
ATOM   2381 N  N     . ARG A 1 301 ? -27.001 -15.228 -2.449  1.00 26.36  ? 593  ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 301 ? -25.904 -15.905 -1.760  1.00 28.64  ? 593  ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 301 ? -24.758 -14.943 -1.450  1.00 25.84  ? 593  ARG A C     1 
ATOM   2384 O  O     . ARG A 1 301 ? -24.062 -15.080 -0.436  1.00 29.57  ? 593  ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 301 ? -25.379 -17.081 -2.588  1.00 35.26  ? 593  ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 301 ? -26.325 -18.277 -2.669  1.00 38.58  ? 593  ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 301 ? -25.598 -19.502 -3.226  1.00 48.72  ? 593  ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 301 ? -24.574 -19.991 -2.301  1.00 56.62  ? 593  ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 301 ? -23.664 -20.914 -2.601  1.00 58.56  ? 593  ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 301 ? -23.632 -21.453 -3.813  1.00 53.61  ? 593  ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 301 ? -22.776 -21.291 -1.691  1.00 56.22  ? 593  ARG A NH2   1 
ATOM   2392 N  N     . ILE A 1 302 ? -24.550 -13.968 -2.328  1.00 25.74  ? 594  ILE A N     1 
ATOM   2393 C  CA    . ILE A 1 302 ? -23.535 -12.963 -2.050  1.00 23.64  ? 594  ILE A CA    1 
ATOM   2394 C  C     . ILE A 1 302 ? -23.895 -12.152 -0.801  1.00 22.45  ? 594  ILE A C     1 
ATOM   2395 O  O     . ILE A 1 302 ? -23.028 -11.877 0.020   1.00 20.83  ? 594  ILE A O     1 
ATOM   2396 C  CB    . ILE A 1 302 ? -23.272 -12.062 -3.266  1.00 23.79  ? 594  ILE A CB    1 
ATOM   2397 C  CG1   . ILE A 1 302 ? -22.550 -12.878 -4.341  1.00 28.38  ? 594  ILE A CG1   1 
ATOM   2398 C  CG2   . ILE A 1 302 ? -22.403 -10.873 -2.876  1.00 22.51  ? 594  ILE A CG2   1 
ATOM   2399 C  CD1   . ILE A 1 302 ? -22.549 -12.226 -5.716  1.00 32.42  ? 594  ILE A CD1   1 
ATOM   2400 N  N     . ARG A 1 303 ? -25.163 -11.783 -0.635  1.00 24.46  ? 595  ARG A N     1 
ATOM   2401 C  CA    . ARG A 1 303 ? -25.541 -11.031 0.567   1.00 21.44  ? 595  ARG A CA    1 
ATOM   2402 C  C     . ARG A 1 303 ? -25.430 -11.876 1.825   1.00 23.31  ? 595  ARG A C     1 
ATOM   2403 O  O     . ARG A 1 303 ? -25.196 -11.357 2.923   1.00 21.30  ? 595  ARG A O     1 
ATOM   2404 C  CB    . ARG A 1 303 ? -26.943 -10.446 0.441   1.00 19.78  ? 595  ARG A CB    1 
ATOM   2405 C  CG    . ARG A 1 303 ? -26.970 -9.258  -0.497  1.00 25.48  ? 595  ARG A CG    1 
ATOM   2406 C  CD    . ARG A 1 303 ? -28.312 -8.584  -0.527  1.00 28.65  ? 595  ARG A CD    1 
ATOM   2407 N  NE    . ARG A 1 303 ? -28.254 -7.546  -1.547  1.00 34.79  ? 595  ARG A NE    1 
ATOM   2408 C  CZ    . ARG A 1 303 ? -28.354 -7.793  -2.850  1.00 33.83  ? 595  ARG A CZ    1 
ATOM   2409 N  NH1   . ARG A 1 303 ? -28.547 -9.039  -3.286  1.00 31.50  ? 595  ARG A NH1   1 
ATOM   2410 N  NH2   . ARG A 1 303 ? -28.258 -6.799  -3.716  1.00 32.19  ? 595  ARG A NH2   1 
ATOM   2411 N  N     . ARG A 1 304 ? -25.567 -13.184 1.660   1.00 18.39  ? 596  ARG A N     1 
ATOM   2412 C  CA    . ARG A 1 304 ? -25.396 -14.092 2.792   1.00 19.18  ? 596  ARG A CA    1 
ATOM   2413 C  C     . ARG A 1 304 ? -23.962 -14.047 3.339   1.00 20.69  ? 596  ARG A C     1 
ATOM   2414 O  O     . ARG A 1 304 ? -23.725 -14.410 4.491   1.00 21.25  ? 596  ARG A O     1 
ATOM   2415 C  CB    . ARG A 1 304 ? -25.782 -15.526 2.404   1.00 21.50  ? 596  ARG A CB    1 
ATOM   2416 C  CG    . ARG A 1 304 ? -25.766 -16.508 3.580   1.00 27.03  ? 596  ARG A CG    1 
ATOM   2417 C  CD    . ARG A 1 304 ? -26.245 -17.895 3.152   1.00 40.59  ? 596  ARG A CD    1 
ATOM   2418 N  NE    . ARG A 1 304 ? -27.678 -17.929 2.868   1.00 41.24  ? 596  ARG A NE    1 
ATOM   2419 C  CZ    . ARG A 1 304 ? -28.212 -18.466 1.774   1.00 46.49  ? 596  ARG A CZ    1 
ATOM   2420 N  NH1   . ARG A 1 304 ? -27.429 -19.023 0.855   1.00 47.92  ? 596  ARG A NH1   1 
ATOM   2421 N  NH2   . ARG A 1 304 ? -29.529 -18.455 1.599   1.00 43.62  ? 596  ARG A NH2   1 
ATOM   2422 N  N     . ALA A 1 305 ? -23.015 -13.589 2.516   1.00 22.72  ? 597  ALA A N     1 
ATOM   2423 C  CA    . ALA A 1 305 ? -21.613 -13.493 2.923   1.00 21.27  ? 597  ALA A CA    1 
ATOM   2424 C  C     . ALA A 1 305 ? -21.328 -12.292 3.810   1.00 18.12  ? 597  ALA A C     1 
ATOM   2425 O  O     . ALA A 1 305 ? -20.274 -12.228 4.414   1.00 18.71  ? 597  ALA A O     1 
ATOM   2426 C  CB    . ALA A 1 305 ? -20.690 -13.463 1.704   1.00 22.89  ? 597  ALA A CB    1 
ATOM   2427 N  N     . PHE A 1 306 ? -22.256 -11.343 3.869   1.00 15.86  ? 598  PHE A N     1 
ATOM   2428 C  CA    . PHE A 1 306 ? -22.100 -10.164 4.719   1.00 15.76  ? 598  PHE A CA    1 
ATOM   2429 C  C     . PHE A 1 306 ? -22.746 -10.458 6.072   1.00 18.73  ? 598  PHE A C     1 
ATOM   2430 O  O     . PHE A 1 306 ? -23.951 -10.655 6.150   1.00 19.85  ? 598  PHE A O     1 
ATOM   2431 C  CB    . PHE A 1 306 ? -22.760 -8.934  4.069   1.00 17.41  ? 598  PHE A CB    1 
ATOM   2432 C  CG    . PHE A 1 306 ? -22.029 -8.418  2.850   1.00 16.27  ? 598  PHE A CG    1 
ATOM   2433 C  CD1   . PHE A 1 306 ? -22.068 -9.109  1.656   1.00 19.22  ? 598  PHE A CD1   1 
ATOM   2434 C  CD2   . PHE A 1 306 ? -21.332 -7.210  2.906   1.00 19.68  ? 598  PHE A CD2   1 
ATOM   2435 C  CE1   . PHE A 1 306 ? -21.401 -8.637  0.534   1.00 21.17  ? 598  PHE A CE1   1 
ATOM   2436 C  CE2   . PHE A 1 306 ? -20.672 -6.719  1.788   1.00 17.43  ? 598  PHE A CE2   1 
ATOM   2437 C  CZ    . PHE A 1 306 ? -20.708 -7.446  0.599   1.00 16.21  ? 598  PHE A CZ    1 
ATOM   2438 N  N     . ILE A 1 307 ? -21.939 -10.478 7.135   1.00 16.13  ? 599  ILE A N     1 
ATOM   2439 C  CA    . ILE A 1 307 ? -22.406 -10.957 8.438   1.00 15.57  ? 599  ILE A CA    1 
ATOM   2440 C  C     . ILE A 1 307 ? -22.115 -9.967  9.557   1.00 17.77  ? 599  ILE A C     1 
ATOM   2441 O  O     . ILE A 1 307 ? -21.254 -9.116  9.429   1.00 20.70  ? 599  ILE A O     1 
ATOM   2442 C  CB    . ILE A 1 307 ? -21.766 -12.314 8.792   1.00 17.30  ? 599  ILE A CB    1 
ATOM   2443 C  CG1   . ILE A 1 307 ? -20.243 -12.182 8.885   1.00 20.69  ? 599  ILE A CG1   1 
ATOM   2444 C  CG2   . ILE A 1 307 ? -22.176 -13.365 7.745   1.00 21.84  ? 599  ILE A CG2   1 
ATOM   2445 C  CD1   . ILE A 1 307 ? -19.512 -13.476 9.269   1.00 22.03  ? 599  ILE A CD1   1 
ATOM   2446 N  N     . ALA A 1 308 ? -22.856 -10.093 10.652  1.00 20.24  ? 600  ALA A N     1 
ATOM   2447 C  CA    . ALA A 1 308 ? -22.611 -9.302  11.845  1.00 20.38  ? 600  ALA A CA    1 
ATOM   2448 C  C     . ALA A 1 308 ? -21.406 -9.809  12.662  1.00 21.72  ? 600  ALA A C     1 
ATOM   2449 O  O     . ALA A 1 308 ? -21.087 -11.003 12.658  1.00 23.24  ? 600  ALA A O     1 
ATOM   2450 C  CB    . ALA A 1 308 ? -23.877 -9.299  12.718  1.00 20.17  ? 600  ALA A CB    1 
ATOM   2451 N  N     . GLU A 1 309 ? -20.761 -8.889  13.377  1.00 20.07  ? 601  GLU A N     1 
ATOM   2452 C  CA    . GLU A 1 309 ? -19.768 -9.227  14.398  1.00 18.76  ? 601  GLU A CA    1 
ATOM   2453 C  C     . GLU A 1 309 ? -20.399 -10.184 15.409  1.00 22.17  ? 601  GLU A C     1 
ATOM   2454 O  O     . GLU A 1 309 ? -21.599 -10.146 15.631  1.00 20.33  ? 601  GLU A O     1 
ATOM   2455 C  CB    . GLU A 1 309 ? -19.303 -7.940  15.090  1.00 19.91  ? 601  GLU A CB    1 
ATOM   2456 C  CG    . GLU A 1 309 ? -18.372 -8.150  16.302  1.00 20.71  ? 601  GLU A CG    1 
ATOM   2457 C  CD    . GLU A 1 309 ? -17.681 -6.874  16.780  1.00 34.72  ? 601  GLU A CD    1 
ATOM   2458 O  OE1   . GLU A 1 309 ? -17.639 -5.871  16.025  1.00 29.20  ? 601  GLU A OE1   1 
ATOM   2459 O  OE2   . GLU A 1 309 ? -17.174 -6.874  17.927  1.00 35.58  ? 601  GLU A OE2   1 
ATOM   2460 N  N     . GLU A 1 310 ? -19.598 -11.072 15.991  1.00 23.86  ? 602  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 310 ? -20.099 -11.946 17.046  1.00 26.10  ? 602  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 310 ? -20.739 -11.129 18.160  1.00 21.72  ? 602  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 310 ? -20.130 -10.198 18.665  1.00 23.51  ? 602  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 310 ? -18.958 -12.806 17.597  1.00 27.71  ? 602  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 310 ? -18.519 -13.876 16.614  1.00 36.28  ? 602  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 310 ? -19.676 -14.771 16.193  1.00 51.28  ? 602  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 310 ? -20.422 -15.230 17.091  1.00 50.39  ? 602  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 310 ? -19.852 -14.997 14.970  1.00 48.70  ? 602  GLU A OE2   1 
ATOM   2469 N  N     . GLY A 1 311 ? -21.972 -11.476 18.525  1.00 26.24  ? 603  GLY A N     1 
ATOM   2470 C  CA    . GLY A 1 311 ? -22.716 -10.746 19.540  1.00 25.78  ? 603  GLY A CA    1 
ATOM   2471 C  C     . GLY A 1 311 ? -23.554 -9.598  18.999  1.00 30.74  ? 603  GLY A C     1 
ATOM   2472 O  O     . GLY A 1 311 ? -24.204 -8.872  19.759  1.00 25.77  ? 603  GLY A O     1 
ATOM   2473 N  N     . TRP A 1 312 ? -23.515 -9.417  17.682  1.00 20.82  ? 604  TRP A N     1 
ATOM   2474 C  CA    . TRP A 1 312 ? -24.243 -8.331  17.028  1.00 21.37  ? 604  TRP A CA    1 
ATOM   2475 C  C     . TRP A 1 312 ? -25.206 -8.919  15.999  1.00 22.42  ? 604  TRP A C     1 
ATOM   2476 O  O     . TRP A 1 312 ? -25.147 -10.109 15.697  1.00 22.91  ? 604  TRP A O     1 
ATOM   2477 C  CB    . TRP A 1 312 ? -23.262 -7.379  16.322  1.00 21.68  ? 604  TRP A CB    1 
ATOM   2478 C  CG    . TRP A 1 312 ? -22.320 -6.628  17.250  1.00 20.11  ? 604  TRP A CG    1 
ATOM   2479 C  CD1   . TRP A 1 312 ? -21.380 -7.184  18.084  1.00 22.07  ? 604  TRP A CD1   1 
ATOM   2480 C  CD2   . TRP A 1 312 ? -22.203 -5.205  17.410  1.00 21.67  ? 604  TRP A CD2   1 
ATOM   2481 N  NE1   . TRP A 1 312 ? -20.700 -6.192  18.761  1.00 24.36  ? 604  TRP A NE1   1 
ATOM   2482 C  CE2   . TRP A 1 312 ? -21.186 -4.972  18.366  1.00 27.09  ? 604  TRP A CE2   1 
ATOM   2483 C  CE3   . TRP A 1 312 ? -22.862 -4.106  16.845  1.00 18.95  ? 604  TRP A CE3   1 
ATOM   2484 C  CZ2   . TRP A 1 312 ? -20.814 -3.692  18.766  1.00 26.73  ? 604  TRP A CZ2   1 
ATOM   2485 C  CZ3   . TRP A 1 312 ? -22.490 -2.834  17.238  1.00 21.52  ? 604  TRP A CZ3   1 
ATOM   2486 C  CH2   . TRP A 1 312 ? -21.473 -2.633  18.196  1.00 22.88  ? 604  TRP A CH2   1 
ATOM   2487 N  N     . LEU A 1 313 ? -26.091 -8.073  15.465  1.00 17.67  ? 605  LEU A N     1 
ATOM   2488 C  CA    . LEU A 1 313 ? -26.988 -8.458  14.374  1.00 16.64  ? 605  LEU A CA    1 
ATOM   2489 C  C     . LEU A 1 313 ? -27.000 -7.337  13.347  1.00 17.19  ? 605  LEU A C     1 
ATOM   2490 O  O     . LEU A 1 313 ? -26.779 -6.182  13.690  1.00 20.04  ? 605  LEU A O     1 
ATOM   2491 C  CB    . LEU A 1 313 ? -28.415 -8.641  14.895  1.00 21.61  ? 605  LEU A CB    1 
ATOM   2492 C  CG    . LEU A 1 313 ? -28.615 -9.899  15.757  1.00 23.16  ? 605  LEU A CG    1 
ATOM   2493 C  CD1   . LEU A 1 313 ? -29.950 -9.858  16.487  1.00 23.26  ? 605  LEU A CD1   1 
ATOM   2494 C  CD2   . LEU A 1 313 ? -28.485 -11.170 14.915  1.00 22.94  ? 605  LEU A CD2   1 
ATOM   2495 N  N     . LEU A 1 314 ? -27.270 -7.680  12.094  1.00 17.99  ? 606  LEU A N     1 
ATOM   2496 C  CA    . LEU A 1 314 ? -27.471 -6.643  11.081  1.00 18.79  ? 606  LEU A CA    1 
ATOM   2497 C  C     . LEU A 1 314 ? -28.935 -6.225  11.045  1.00 24.58  ? 606  LEU A C     1 
ATOM   2498 O  O     . LEU A 1 314 ? -29.830 -7.038  11.257  1.00 20.07  ? 606  LEU A O     1 
ATOM   2499 C  CB    . LEU A 1 314 ? -27.032 -7.146  9.705   1.00 16.49  ? 606  LEU A CB    1 
ATOM   2500 C  CG    . LEU A 1 314 ? -25.555 -7.540  9.573   1.00 19.86  ? 606  LEU A CG    1 
ATOM   2501 C  CD1   . LEU A 1 314 ? -25.273 -8.008  8.129   1.00 19.11  ? 606  LEU A CD1   1 
ATOM   2502 C  CD2   . LEU A 1 314 ? -24.608 -6.411  9.990   1.00 17.92  ? 606  LEU A CD2   1 
ATOM   2503 N  N     . VAL A 1 315 ? -29.173 -4.945  10.781  1.00 18.75  ? 607  VAL A N     1 
ATOM   2504 C  CA    . VAL A 1 315 ? -30.520 -4.426  10.626  1.00 18.23  ? 607  VAL A CA    1 
ATOM   2505 C  C     . VAL A 1 315 ? -30.570 -3.785  9.245   1.00 21.73  ? 607  VAL A C     1 
ATOM   2506 O  O     . VAL A 1 315 ? -29.836 -2.836  8.972   1.00 21.71  ? 607  VAL A O     1 
ATOM   2507 C  CB    . VAL A 1 315 ? -30.842 -3.368  11.695  1.00 17.01  ? 607  VAL A CB    1 
ATOM   2508 C  CG1   . VAL A 1 315 ? -32.268 -2.802  11.490  1.00 18.87  ? 607  VAL A CG1   1 
ATOM   2509 C  CG2   . VAL A 1 315 ? -30.703 -3.950  13.109  1.00 22.81  ? 607  VAL A CG2   1 
ATOM   2510 N  N     . ALA A 1 316 ? -31.427 -4.308  8.380   1.00 16.22  ? 608  ALA A N     1 
ATOM   2511 C  CA    . ALA A 1 316 ? -31.527 -3.811  7.013   1.00 22.22  ? 608  ALA A CA    1 
ATOM   2512 C  C     . ALA A 1 316 ? -32.833 -3.071  6.811   1.00 23.24  ? 608  ALA A C     1 
ATOM   2513 O  O     . ALA A 1 316 ? -33.905 -3.611  7.098   1.00 21.87  ? 608  ALA A O     1 
ATOM   2514 C  CB    . ALA A 1 316 ? -31.425 -4.966  6.034   1.00 21.55  ? 608  ALA A CB    1 
ATOM   2515 N  N     . LEU A 1 317 ? -32.738 -1.839  6.310   1.00 16.10  ? 609  LEU A N     1 
ATOM   2516 C  CA    . LEU A 1 317 ? -33.910 -1.005  6.088   1.00 18.45  ? 609  LEU A CA    1 
ATOM   2517 C  C     . LEU A 1 317 ? -33.982 -0.625  4.614   1.00 25.62  ? 609  LEU A C     1 
ATOM   2518 O  O     . LEU A 1 317 ? -32.976 -0.252  4.046   1.00 26.61  ? 609  LEU A O     1 
ATOM   2519 C  CB    . LEU A 1 317 ? -33.795 0.259   6.945   1.00 20.18  ? 609  LEU A CB    1 
ATOM   2520 C  CG    . LEU A 1 317 ? -33.710 -0.038  8.444   1.00 18.85  ? 609  LEU A CG    1 
ATOM   2521 C  CD1   . LEU A 1 317 ? -32.338 0.320   9.017   1.00 20.99  ? 609  LEU A CD1   1 
ATOM   2522 C  CD2   . LEU A 1 317 ? -34.850 0.619   9.230   1.00 20.89  ? 609  LEU A CD2   1 
ATOM   2523 N  N     . ASP A 1 318 ? -35.163 -0.706  4.000   1.00 19.76  ? 610  ASP A N     1 
ATOM   2524 C  CA    . ASP A 1 318 ? -35.297 -0.373  2.569   1.00 19.34  ? 610  ASP A CA    1 
ATOM   2525 C  C     . ASP A 1 318 ? -36.466 0.579   2.365   1.00 22.26  ? 610  ASP A C     1 
ATOM   2526 O  O     . ASP A 1 318 ? -37.581 0.273   2.778   1.00 22.46  ? 610  ASP A O     1 
ATOM   2527 C  CB    . ASP A 1 318 ? -35.541 -1.658  1.764   1.00 23.84  ? 610  ASP A CB    1 
ATOM   2528 C  CG    . ASP A 1 318 ? -35.345 -1.474  0.257   1.00 32.37  ? 610  ASP A CG    1 
ATOM   2529 O  OD1   . ASP A 1 318 ? -34.576 -0.584  -0.153  1.00 41.14  ? 610  ASP A OD1   1 
ATOM   2530 O  OD2   . ASP A 1 318 ? -35.939 -2.248  -0.517  1.00 37.08  ? 610  ASP A OD2   1 
ATOM   2531 N  N     . TYR A 1 319 ? -36.237 1.720   1.714   1.00 19.94  ? 611  TYR A N     1 
ATOM   2532 C  CA    . TYR A 1 319 ? -37.364 2.585   1.378   1.00 18.97  ? 611  TYR A CA    1 
ATOM   2533 C  C     . TYR A 1 319 ? -38.188 1.920   0.279   1.00 32.31  ? 611  TYR A C     1 
ATOM   2534 O  O     . TYR A 1 319 ? -37.666 1.600   -0.787  1.00 33.59  ? 611  TYR A O     1 
ATOM   2535 C  CB    . TYR A 1 319 ? -36.893 3.958   0.892   1.00 23.34  ? 611  TYR A CB    1 
ATOM   2536 C  CG    . TYR A 1 319 ? -36.618 5.000   1.957   1.00 21.73  ? 611  TYR A CG    1 
ATOM   2537 C  CD1   . TYR A 1 319 ? -37.652 5.569   2.704   1.00 22.63  ? 611  TYR A CD1   1 
ATOM   2538 C  CD2   . TYR A 1 319 ? -35.330 5.462   2.170   1.00 20.92  ? 611  TYR A CD2   1 
ATOM   2539 C  CE1   . TYR A 1 319 ? -37.386 6.555   3.665   1.00 20.01  ? 611  TYR A CE1   1 
ATOM   2540 C  CE2   . TYR A 1 319 ? -35.059 6.429   3.118   1.00 23.65  ? 611  TYR A CE2   1 
ATOM   2541 C  CZ    . TYR A 1 319 ? -36.085 6.977   3.851   1.00 20.30  ? 611  TYR A CZ    1 
ATOM   2542 O  OH    . TYR A 1 319 ? -35.788 7.944   4.785   1.00 24.07  ? 611  TYR A OH    1 
ATOM   2543 N  N     . SER A 1 320 ? -39.472 1.700   0.535   1.00 22.70  ? 612  SER A N     1 
ATOM   2544 C  CA    . SER A 1 320 ? -40.331 1.066   -0.458  1.00 20.59  ? 612  SER A CA    1 
ATOM   2545 C  C     . SER A 1 320 ? -40.755 2.071   -1.533  1.00 22.41  ? 612  SER A C     1 
ATOM   2546 O  O     . SER A 1 320 ? -41.421 3.060   -1.224  1.00 23.59  ? 612  SER A O     1 
ATOM   2547 C  CB    . SER A 1 320 ? -41.579 0.498   0.207   1.00 32.49  ? 612  SER A CB    1 
ATOM   2548 O  OG    . SER A 1 320 ? -41.219 -0.332  1.296   1.00 36.07  ? 612  SER A OG    1 
ATOM   2549 N  N     . GLN A 1 321 ? -40.363 1.808   -2.779  1.00 21.36  ? 613  GLN A N     1 
ATOM   2550 C  CA    . GLN A 1 321 ? -40.783 2.617   -3.926  1.00 17.94  ? 613  GLN A CA    1 
ATOM   2551 C  C     . GLN A 1 321 ? -40.636 4.126   -3.707  1.00 22.29  ? 613  GLN A C     1 
ATOM   2552 O  O     . GLN A 1 321 ? -41.515 4.916   -4.092  1.00 19.75  ? 613  GLN A O     1 
ATOM   2553 C  CB    . GLN A 1 321 ? -42.217 2.254   -4.343  1.00 22.47  ? 613  GLN A CB    1 
ATOM   2554 C  CG    . GLN A 1 321 ? -42.274 0.848   -4.893  1.00 21.98  ? 613  GLN A CG    1 
ATOM   2555 C  CD    . GLN A 1 321 ? -43.661 0.227   -4.964  1.00 35.23  ? 613  GLN A CD    1 
ATOM   2556 O  OE1   . GLN A 1 321 ? -44.689 0.906   -4.882  1.00 34.55  ? 613  GLN A OE1   1 
ATOM   2557 N  NE2   . GLN A 1 321 ? -43.687 -1.095  -5.123  1.00 35.26  ? 613  GLN A NE2   1 
ATOM   2558 N  N     . ILE A 1 322 ? -39.512 4.528   -3.120  1.00 21.61  ? 614  ILE A N     1 
ATOM   2559 C  CA    . ILE A 1 322 ? -39.332 5.940   -2.767  1.00 19.55  ? 614  ILE A CA    1 
ATOM   2560 C  C     . ILE A 1 322 ? -39.370 6.882   -3.981  1.00 20.60  ? 614  ILE A C     1 
ATOM   2561 O  O     . ILE A 1 322 ? -39.990 7.952   -3.913  1.00 19.80  ? 614  ILE A O     1 
ATOM   2562 C  CB    . ILE A 1 322 ? -38.092 6.185   -1.846  1.00 20.05  ? 614  ILE A CB    1 
ATOM   2563 C  CG1   . ILE A 1 322 ? -38.055 7.655   -1.396  1.00 20.16  ? 614  ILE A CG1   1 
ATOM   2564 C  CG2   . ILE A 1 322 ? -36.813 5.730   -2.528  1.00 20.35  ? 614  ILE A CG2   1 
ATOM   2565 C  CD1   . ILE A 1 322 ? -37.118 7.988   -0.214  1.00 22.66  ? 614  ILE A CD1   1 
ATOM   2566 N  N     . GLU A 1 323 ? -38.768 6.485   -5.100  1.00 17.31  ? 615  GLU A N     1 
ATOM   2567 C  CA    . GLU A 1 323 ? -38.790 7.364   -6.271  1.00 17.99  ? 615  GLU A CA    1 
ATOM   2568 C  C     . GLU A 1 323 ? -40.204 7.616   -6.801  1.00 22.03  ? 615  GLU A C     1 
ATOM   2569 O  O     . GLU A 1 323 ? -40.521 8.744   -7.203  1.00 20.74  ? 615  GLU A O     1 
ATOM   2570 C  CB    . GLU A 1 323 ? -37.893 6.856   -7.391  1.00 26.07  ? 615  GLU A CB    1 
ATOM   2571 C  CG    . GLU A 1 323 ? -36.425 7.050   -7.115  1.00 38.44  ? 615  GLU A CG    1 
ATOM   2572 C  CD    . GLU A 1 323 ? -35.592 6.937   -8.376  1.00 48.13  ? 615  GLU A CD    1 
ATOM   2573 O  OE1   . GLU A 1 323 ? -36.108 7.293   -9.462  1.00 53.38  ? 615  GLU A OE1   1 
ATOM   2574 O  OE2   . GLU A 1 323 ? -34.429 6.490   -8.279  1.00 49.73  ? 615  GLU A OE2   1 
ATOM   2575 N  N     . LEU A 1 324 ? -41.049 6.589   -6.790  1.00 21.45  ? 616  LEU A N     1 
ATOM   2576 C  CA    . LEU A 1 324 ? -42.448 6.762   -7.198  1.00 18.01  ? 616  LEU A CA    1 
ATOM   2577 C  C     . LEU A 1 324 ? -43.225 7.643   -6.216  1.00 19.36  ? 616  LEU A C     1 
ATOM   2578 O  O     . LEU A 1 324 ? -44.082 8.427   -6.620  1.00 21.42  ? 616  LEU A O     1 
ATOM   2579 C  CB    . LEU A 1 324 ? -43.142 5.411   -7.378  1.00 19.17  ? 616  LEU A CB    1 
ATOM   2580 C  CG    . LEU A 1 324 ? -42.635 4.590   -8.568  1.00 22.27  ? 616  LEU A CG    1 
ATOM   2581 C  CD1   . LEU A 1 324 ? -42.982 3.124   -8.402  1.00 21.86  ? 616  LEU A CD1   1 
ATOM   2582 C  CD2   . LEU A 1 324 ? -43.206 5.149   -9.881  1.00 27.47  ? 616  LEU A CD2   1 
ATOM   2583 N  N     . ARG A 1 325 ? -42.916 7.529   -4.929  1.00 24.07  ? 617  ARG A N     1 
ATOM   2584 C  CA    . ARG A 1 325 ? -43.541 8.378   -3.913  1.00 21.03  ? 617  ARG A CA    1 
ATOM   2585 C  C     . ARG A 1 325 ? -43.140 9.836   -4.084  1.00 25.35  ? 617  ARG A C     1 
ATOM   2586 O  O     . ARG A 1 325 ? -43.963 10.757  -3.923  1.00 24.03  ? 617  ARG A O     1 
ATOM   2587 C  CB    . ARG A 1 325 ? -43.185 7.879   -2.509  1.00 18.74  ? 617  ARG A CB    1 
ATOM   2588 C  CG    . ARG A 1 325 ? -43.759 6.476   -2.233  1.00 20.92  ? 617  ARG A CG    1 
ATOM   2589 C  CD    . ARG A 1 325 ? -43.427 5.970   -0.846  1.00 22.80  ? 617  ARG A CD    1 
ATOM   2590 N  NE    . ARG A 1 325 ? -43.796 4.560   -0.756  1.00 22.66  ? 617  ARG A NE    1 
ATOM   2591 C  CZ    . ARG A 1 325 ? -44.904 4.098   -0.184  1.00 29.32  ? 617  ARG A CZ    1 
ATOM   2592 N  NH1   . ARG A 1 325 ? -45.760 4.926   0.399   1.00 25.70  ? 617  ARG A NH1   1 
ATOM   2593 N  NH2   . ARG A 1 325 ? -45.146 2.794   -0.185  1.00 27.79  ? 617  ARG A NH2   1 
ATOM   2594 N  N     . VAL A 1 326 ? -41.869 10.044  -4.409  1.00 21.37  ? 618  VAL A N     1 
ATOM   2595 C  CA    . VAL A 1 326 ? -41.364 11.374  -4.719  1.00 21.21  ? 618  VAL A CA    1 
ATOM   2596 C  C     . VAL A 1 326 ? -42.086 11.935  -5.953  1.00 19.55  ? 618  VAL A C     1 
ATOM   2597 O  O     . VAL A 1 326 ? -42.481 13.114  -5.967  1.00 22.16  ? 618  VAL A O     1 
ATOM   2598 C  CB    . VAL A 1 326 ? -39.831 11.358  -4.942  1.00 17.42  ? 618  VAL A CB    1 
ATOM   2599 C  CG1   . VAL A 1 326 ? -39.356 12.636  -5.612  1.00 19.71  ? 618  VAL A CG1   1 
ATOM   2600 C  CG2   . VAL A 1 326 ? -39.103 11.126  -3.612  1.00 21.02  ? 618  VAL A CG2   1 
ATOM   2601 N  N     . LEU A 1 327 ? -42.247 11.103  -6.976  1.00 19.74  ? 619  LEU A N     1 
ATOM   2602 C  CA    . LEU A 1 327 ? -42.953 11.525  -8.200  1.00 19.49  ? 619  LEU A CA    1 
ATOM   2603 C  C     . LEU A 1 327 ? -44.398 11.919  -7.885  1.00 23.42  ? 619  LEU A C     1 
ATOM   2604 O  O     . LEU A 1 327 ? -44.916 12.926  -8.401  1.00 23.79  ? 619  LEU A O     1 
ATOM   2605 C  CB    . LEU A 1 327 ? -42.921 10.421  -9.263  1.00 22.78  ? 619  LEU A CB    1 
ATOM   2606 C  CG    . LEU A 1 327 ? -43.637 10.744  -10.588 1.00 23.16  ? 619  LEU A CG    1 
ATOM   2607 C  CD1   . LEU A 1 327 ? -43.052 12.009  -11.217 1.00 23.65  ? 619  LEU A CD1   1 
ATOM   2608 C  CD2   . LEU A 1 327 ? -43.552 9.565   -11.572 1.00 25.46  ? 619  LEU A CD2   1 
ATOM   2609 N  N     . ALA A 1 328 ? -45.052 11.126  -7.042  1.00 24.00  ? 620  ALA A N     1 
ATOM   2610 C  CA    . ALA A 1 328 ? -46.391 11.479  -6.555  1.00 27.91  ? 620  ALA A CA    1 
ATOM   2611 C  C     . ALA A 1 328 ? -46.382 12.842  -5.899  1.00 26.84  ? 620  ALA A C     1 
ATOM   2612 O  O     . ALA A 1 328 ? -47.238 13.683  -6.178  1.00 27.33  ? 620  ALA A O     1 
ATOM   2613 C  CB    . ALA A 1 328 ? -46.915 10.428  -5.573  1.00 24.83  ? 620  ALA A CB    1 
ATOM   2614 N  N     . HIS A 1 329 ? -45.401 13.070  -5.031  1.00 24.18  ? 621  HIS A N     1 
ATOM   2615 C  CA    . HIS A 1 329 ? -45.289 14.352  -4.346  1.00 24.52  ? 621  HIS A CA    1 
ATOM   2616 C  C     . HIS A 1 329 ? -45.016 15.524  -5.301  1.00 27.86  ? 621  HIS A C     1 
ATOM   2617 O  O     . HIS A 1 329 ? -45.680 16.561  -5.216  1.00 26.49  ? 621  HIS A O     1 
ATOM   2618 C  CB    . HIS A 1 329 ? -44.201 14.314  -3.272  1.00 22.31  ? 621  HIS A CB    1 
ATOM   2619 C  CG    . HIS A 1 329 ? -44.058 15.609  -2.531  1.00 26.87  ? 621  HIS A CG    1 
ATOM   2620 N  ND1   . HIS A 1 329 ? -44.844 15.936  -1.447  1.00 28.76  ? 621  HIS A ND1   1 
ATOM   2621 C  CD2   . HIS A 1 329 ? -43.237 16.666  -2.733  1.00 30.60  ? 621  HIS A CD2   1 
ATOM   2622 C  CE1   . HIS A 1 329 ? -44.512 17.138  -1.011  1.00 32.28  ? 621  HIS A CE1   1 
ATOM   2623 N  NE2   . HIS A 1 329 ? -43.540 17.605  -1.776  1.00 29.72  ? 621  HIS A NE2   1 
ATOM   2624 N  N     . LEU A 1 330 ? -44.045 15.367  -6.200  1.00 22.49  ? 622  LEU A N     1 
ATOM   2625 C  CA    . LEU A 1 330 ? -43.656 16.471  -7.085  1.00 25.31  ? 622  LEU A CA    1 
ATOM   2626 C  C     . LEU A 1 330 ? -44.753 16.806  -8.099  1.00 26.36  ? 622  LEU A C     1 
ATOM   2627 O  O     . LEU A 1 330 ? -44.980 17.978  -8.418  1.00 24.51  ? 622  LEU A O     1 
ATOM   2628 C  CB    . LEU A 1 330 ? -42.335 16.169  -7.814  1.00 22.06  ? 622  LEU A CB    1 
ATOM   2629 C  CG    . LEU A 1 330 ? -41.084 16.042  -6.923  1.00 24.34  ? 622  LEU A CG    1 
ATOM   2630 C  CD1   . LEU A 1 330 ? -39.861 15.675  -7.764  1.00 30.77  ? 622  LEU A CD1   1 
ATOM   2631 C  CD2   . LEU A 1 330 ? -40.809 17.295  -6.116  1.00 27.37  ? 622  LEU A CD2   1 
ATOM   2632 N  N     . SER A 1 331 ? -45.416 15.778  -8.609  1.00 22.85  ? 623  SER A N     1 
ATOM   2633 C  CA    . SER A 1 331 ? -46.405 15.958  -9.666  1.00 25.02  ? 623  SER A CA    1 
ATOM   2634 C  C     . SER A 1 331 ? -47.763 16.361  -9.111  1.00 30.11  ? 623  SER A C     1 
ATOM   2635 O  O     . SER A 1 331 ? -48.512 17.099  -9.753  1.00 28.33  ? 623  SER A O     1 
ATOM   2636 C  CB    . SER A 1 331 ? -46.539 14.679  -10.501 1.00 25.98  ? 623  SER A CB    1 
ATOM   2637 O  OG    . SER A 1 331 ? -47.164 13.632  -9.764  1.00 26.02  ? 623  SER A OG    1 
ATOM   2638 N  N     . GLY A 1 332 ? -48.075 15.868  -7.915  1.00 29.31  ? 624  GLY A N     1 
ATOM   2639 C  CA    . GLY A 1 332 ? -49.403 16.008  -7.356  1.00 34.10  ? 624  GLY A CA    1 
ATOM   2640 C  C     . GLY A 1 332 ? -50.455 15.152  -8.044  1.00 32.57  ? 624  GLY A C     1 
ATOM   2641 O  O     . GLY A 1 332 ? -51.642 15.400  -7.874  1.00 40.34  ? 624  GLY A O     1 
ATOM   2642 N  N     . ASP A 1 333 ? -50.041 14.148  -8.817  1.00 29.28  ? 625  ASP A N     1 
ATOM   2643 C  CA    . ASP A 1 333 ? -51.016 13.312  -9.512  1.00 30.26  ? 625  ASP A CA    1 
ATOM   2644 C  C     . ASP A 1 333 ? -51.910 12.544  -8.546  1.00 33.73  ? 625  ASP A C     1 
ATOM   2645 O  O     . ASP A 1 333 ? -51.422 11.808  -7.684  1.00 28.77  ? 625  ASP A O     1 
ATOM   2646 C  CB    . ASP A 1 333 ? -50.358 12.332  -10.472 1.00 29.51  ? 625  ASP A CB    1 
ATOM   2647 C  CG    . ASP A 1 333 ? -51.378 11.592  -11.310 1.00 35.15  ? 625  ASP A CG    1 
ATOM   2648 O  OD1   . ASP A 1 333 ? -51.837 12.170  -12.318 1.00 38.99  ? 625  ASP A OD1   1 
ATOM   2649 O  OD2   . ASP A 1 333 ? -51.740 10.449  -10.952 1.00 33.02  ? 625  ASP A OD2   1 
ATOM   2650 N  N     . GLU A 1 334 ? -53.223 12.712  -8.701  1.00 33.20  ? 626  GLU A N     1 
ATOM   2651 C  CA    . GLU A 1 334 ? -54.173 12.159  -7.740  1.00 32.90  ? 626  GLU A CA    1 
ATOM   2652 C  C     . GLU A 1 334 ? -54.232 10.638  -7.755  1.00 31.08  ? 626  GLU A C     1 
ATOM   2653 O  O     . GLU A 1 334 ? -54.369 10.012  -6.700  1.00 34.30  ? 626  GLU A O     1 
ATOM   2654 C  CB    . GLU A 1 334 ? -55.575 12.751  -7.954  1.00 38.25  ? 626  GLU A CB    1 
ATOM   2655 C  CG    . GLU A 1 334 ? -55.708 14.208  -7.559  1.00 43.69  ? 626  GLU A CG    1 
ATOM   2656 C  CD    . GLU A 1 334 ? -55.316 15.163  -8.675  1.00 59.15  ? 626  GLU A CD    1 
ATOM   2657 O  OE1   . GLU A 1 334 ? -55.051 14.691  -9.805  1.00 58.35  ? 626  GLU A OE1   1 
ATOM   2658 O  OE2   . GLU A 1 334 ? -55.281 16.387  -8.419  1.00 67.80  ? 626  GLU A OE2   1 
ATOM   2659 N  N     . ASN A 1 335 ? -54.144 10.043  -8.942  1.00 33.78  ? 627  ASN A N     1 
ATOM   2660 C  CA    . ASN A 1 335 ? -54.171 8.593   -9.056  1.00 34.99  ? 627  ASN A CA    1 
ATOM   2661 C  C     . ASN A 1 335 ? -52.908 7.982   -8.455  1.00 36.76  ? 627  ASN A C     1 
ATOM   2662 O  O     . ASN A 1 335 ? -52.960 6.963   -7.775  1.00 32.50  ? 627  ASN A O     1 
ATOM   2663 C  CB    . ASN A 1 335 ? -54.341 8.162   -10.510 1.00 37.69  ? 627  ASN A CB    1 
ATOM   2664 C  CG    . ASN A 1 335 ? -55.651 8.642   -11.109 1.00 51.78  ? 627  ASN A CG    1 
ATOM   2665 O  OD1   . ASN A 1 335 ? -56.586 8.995   -10.387 1.00 52.07  ? 627  ASN A OD1   1 
ATOM   2666 N  ND2   . ASN A 1 335 ? -55.724 8.661   -12.434 1.00 55.67  ? 627  ASN A ND2   1 
ATOM   2667 N  N     . LEU A 1 336 ? -51.772 8.622   -8.705  1.00 30.07  ? 628  LEU A N     1 
ATOM   2668 C  CA    . LEU A 1 336 ? -50.512 8.178   -8.119  1.00 28.83  ? 628  LEU A CA    1 
ATOM   2669 C  C     . LEU A 1 336 ? -50.521 8.324   -6.596  1.00 28.25  ? 628  LEU A C     1 
ATOM   2670 O  O     . LEU A 1 336 ? -50.164 7.389   -5.878  1.00 30.51  ? 628  LEU A O     1 
ATOM   2671 C  CB    . LEU A 1 336 ? -49.348 8.961   -8.730  1.00 28.01  ? 628  LEU A CB    1 
ATOM   2672 C  CG    . LEU A 1 336 ? -47.939 8.464   -8.433  1.00 38.65  ? 628  LEU A CG    1 
ATOM   2673 C  CD1   . LEU A 1 336 ? -47.848 6.971   -8.681  1.00 42.88  ? 628  LEU A CD1   1 
ATOM   2674 C  CD2   . LEU A 1 336 ? -46.936 9.218   -9.305  1.00 33.39  ? 628  LEU A CD2   1 
ATOM   2675 N  N     . ILE A 1 337 ? -50.925 9.493   -6.106  1.00 30.76  ? 629  ILE A N     1 
ATOM   2676 C  CA    . ILE A 1 337 ? -51.039 9.722   -4.665  1.00 30.23  ? 629  ILE A CA    1 
ATOM   2677 C  C     . ILE A 1 337 ? -51.955 8.679   -4.015  1.00 33.89  ? 629  ILE A C     1 
ATOM   2678 O  O     . ILE A 1 337 ? -51.663 8.173   -2.924  1.00 31.63  ? 629  ILE A O     1 
ATOM   2679 C  CB    . ILE A 1 337 ? -51.519 11.157  -4.353  1.00 33.65  ? 629  ILE A CB    1 
ATOM   2680 C  CG1   . ILE A 1 337 ? -50.366 12.152  -4.529  1.00 27.01  ? 629  ILE A CG1   1 
ATOM   2681 C  CG2   . ILE A 1 337 ? -52.039 11.261  -2.941  1.00 32.16  ? 629  ILE A CG2   1 
ATOM   2682 C  CD1   . ILE A 1 337 ? -50.784 13.615  -4.605  1.00 34.26  ? 629  ILE A CD1   1 
ATOM   2683 N  N     . ARG A 1 338 ? -53.037 8.335   -4.713  1.00 33.27  ? 630  ARG A N     1 
ATOM   2684 C  CA    . ARG A 1 338 ? -54.020 7.374   -4.210  1.00 33.54  ? 630  ARG A CA    1 
ATOM   2685 C  C     . ARG A 1 338 ? -53.445 5.973   -4.029  1.00 31.28  ? 630  ARG A C     1 
ATOM   2686 O  O     . ARG A 1 338 ? -53.778 5.279   -3.064  1.00 36.78  ? 630  ARG A O     1 
ATOM   2687 C  CB    . ARG A 1 338 ? -55.243 7.327   -5.131  1.00 39.25  ? 630  ARG A CB    1 
ATOM   2688 C  CG    . ARG A 1 338 ? -56.389 6.476   -4.598  1.00 55.11  ? 630  ARG A CG    1 
ATOM   2689 C  CD    . ARG A 1 338 ? -57.633 6.568   -5.482  1.00 67.12  ? 630  ARG A CD    1 
ATOM   2690 N  NE    . ARG A 1 338 ? -58.081 7.948   -5.657  1.00 75.84  ? 630  ARG A NE    1 
ATOM   2691 C  CZ    . ARG A 1 338 ? -58.032 8.613   -6.808  1.00 82.24  ? 630  ARG A CZ    1 
ATOM   2692 N  NH1   . ARG A 1 338 ? -57.564 8.022   -7.899  1.00 85.73  ? 630  ARG A NH1   1 
ATOM   2693 N  NH2   . ARG A 1 338 ? -58.458 9.868   -6.872  1.00 80.74  ? 630  ARG A NH2   1 
ATOM   2694 N  N     . VAL A 1 339 ? -52.592 5.554   -4.961  1.00 32.68  ? 631  VAL A N     1 
ATOM   2695 C  CA    . VAL A 1 339 ? -51.924 4.264   -4.858  1.00 32.54  ? 631  VAL A CA    1 
ATOM   2696 C  C     . VAL A 1 339 ? -51.218 4.133   -3.506  1.00 30.51  ? 631  VAL A C     1 
ATOM   2697 O  O     . VAL A 1 339 ? -51.330 3.104   -2.834  1.00 34.46  ? 631  VAL A O     1 
ATOM   2698 C  CB    . VAL A 1 339 ? -50.899 4.058   -6.001  1.00 35.75  ? 631  VAL A CB    1 
ATOM   2699 C  CG1   . VAL A 1 339 ? -50.082 2.796   -5.777  1.00 36.48  ? 631  VAL A CG1   1 
ATOM   2700 C  CG2   . VAL A 1 339 ? -51.606 4.006   -7.354  1.00 40.61  ? 631  VAL A CG2   1 
ATOM   2701 N  N     . PHE A 1 340 ? -50.519 5.185   -3.098  1.00 29.96  ? 632  PHE A N     1 
ATOM   2702 C  CA    . PHE A 1 340 ? -49.704 5.112   -1.887  1.00 27.48  ? 632  PHE A CA    1 
ATOM   2703 C  C     . PHE A 1 340 ? -50.504 5.458   -0.644  1.00 31.94  ? 632  PHE A C     1 
ATOM   2704 O  O     . PHE A 1 340 ? -50.266 4.889   0.422   1.00 29.96  ? 632  PHE A O     1 
ATOM   2705 C  CB    . PHE A 1 340 ? -48.445 5.981   -2.007  1.00 27.96  ? 632  PHE A CB    1 
ATOM   2706 C  CG    . PHE A 1 340 ? -47.538 5.553   -3.118  1.00 26.07  ? 632  PHE A CG    1 
ATOM   2707 C  CD1   . PHE A 1 340 ? -46.921 4.306   -3.085  1.00 26.25  ? 632  PHE A CD1   1 
ATOM   2708 C  CD2   . PHE A 1 340 ? -47.298 6.390   -4.193  1.00 28.97  ? 632  PHE A CD2   1 
ATOM   2709 C  CE1   . PHE A 1 340 ? -46.094 3.897   -4.122  1.00 29.21  ? 632  PHE A CE1   1 
ATOM   2710 C  CE2   . PHE A 1 340 ? -46.462 5.992   -5.230  1.00 32.16  ? 632  PHE A CE2   1 
ATOM   2711 C  CZ    . PHE A 1 340 ? -45.861 4.748   -5.192  1.00 27.64  ? 632  PHE A CZ    1 
ATOM   2712 N  N     . GLN A 1 341 ? -51.461 6.375   -0.772  1.00 31.83  ? 633  GLN A N     1 
ATOM   2713 C  CA    . GLN A 1 341 ? -52.331 6.675   0.369   1.00 34.00  ? 633  GLN A CA    1 
ATOM   2714 C  C     . GLN A 1 341 ? -53.135 5.444   0.783   1.00 36.60  ? 633  GLN A C     1 
ATOM   2715 O  O     . GLN A 1 341 ? -53.428 5.267   1.965   1.00 37.33  ? 633  GLN A O     1 
ATOM   2716 C  CB    . GLN A 1 341 ? -53.269 7.852   0.085   1.00 32.95  ? 633  GLN A CB    1 
ATOM   2717 C  CG    . GLN A 1 341 ? -52.597 9.228   0.097   1.00 36.64  ? 633  GLN A CG    1 
ATOM   2718 C  CD    . GLN A 1 341 ? -52.163 9.689   1.481   1.00 46.29  ? 633  GLN A CD    1 
ATOM   2719 O  OE1   . GLN A 1 341 ? -52.501 9.074   2.494   1.00 49.63  ? 633  GLN A OE1   1 
ATOM   2720 N  NE2   . GLN A 1 341 ? -51.409 10.785  1.529   1.00 44.74  ? 633  GLN A NE2   1 
ATOM   2721 N  N     . GLU A 1 342 ? -53.477 4.595   -0.186  1.00 33.96  ? 634  GLU A N     1 
ATOM   2722 C  CA    . GLU A 1 342 ? -54.260 3.386   0.076   1.00 39.84  ? 634  GLU A CA    1 
ATOM   2723 C  C     . GLU A 1 342 ? -53.396 2.167   0.387   1.00 41.90  ? 634  GLU A C     1 
ATOM   2724 O  O     . GLU A 1 342 ? -53.895 1.044   0.445   1.00 44.94  ? 634  GLU A O     1 
ATOM   2725 C  CB    . GLU A 1 342 ? -55.187 3.065   -1.106  1.00 45.71  ? 634  GLU A CB    1 
ATOM   2726 C  CG    . GLU A 1 342 ? -56.308 4.076   -1.314  1.00 52.65  ? 634  GLU A CG    1 
ATOM   2727 C  CD    . GLU A 1 342 ? -57.184 3.739   -2.509  1.00 56.58  ? 634  GLU A CD    1 
ATOM   2728 O  OE1   . GLU A 1 342 ? -56.950 2.694   -3.155  1.00 62.02  ? 634  GLU A OE1   1 
ATOM   2729 O  OE2   . GLU A 1 342 ? -58.110 4.525   -2.803  1.00 57.66  ? 634  GLU A OE2   1 
ATOM   2730 N  N     . GLY A 1 343 ? -52.099 2.388   0.572   1.00 38.77  ? 635  GLY A N     1 
ATOM   2731 C  CA    . GLY A 1 343 ? -51.192 1.317   0.941   1.00 35.75  ? 635  GLY A CA    1 
ATOM   2732 C  C     . GLY A 1 343 ? -51.003 0.255   -0.123  1.00 39.90  ? 635  GLY A C     1 
ATOM   2733 O  O     . GLY A 1 343 ? -50.726 -0.901  0.194   1.00 42.92  ? 635  GLY A O     1 
ATOM   2734 N  N     . ARG A 1 344 ? -51.137 0.638   -1.389  1.00 34.04  ? 636  ARG A N     1 
ATOM   2735 C  CA    . ARG A 1 344 ? -50.987 -0.326  -2.477  1.00 34.22  ? 636  ARG A CA    1 
ATOM   2736 C  C     . ARG A 1 344 ? -49.567 -0.391  -3.050  1.00 42.00  ? 636  ARG A C     1 
ATOM   2737 O  O     . ARG A 1 344 ? -48.720 0.460   -2.766  1.00 39.60  ? 636  ARG A O     1 
ATOM   2738 C  CB    . ARG A 1 344 ? -52.001 -0.042  -3.591  1.00 40.34  ? 636  ARG A CB    1 
ATOM   2739 C  CG    . ARG A 1 344 ? -53.430 0.057   -3.092  1.00 55.77  ? 636  ARG A CG    1 
ATOM   2740 C  CD    . ARG A 1 344 ? -54.427 0.057   -4.235  1.00 77.62  ? 636  ARG A CD    1 
ATOM   2741 N  NE    . ARG A 1 344 ? -55.804 0.037   -3.750  1.00 92.08  ? 636  ARG A NE    1 
ATOM   2742 C  CZ    . ARG A 1 344 ? -56.440 -1.061  -3.354  1.00 99.31  ? 636  ARG A CZ    1 
ATOM   2743 N  NH1   . ARG A 1 344 ? -55.821 -2.234  -3.377  1.00 98.87  ? 636  ARG A NH1   1 
ATOM   2744 N  NH2   . ARG A 1 344 ? -57.693 -0.987  -2.927  1.00 104.46 ? 636  ARG A NH2   1 
ATOM   2745 N  N     . ASP A 1 345 ? -49.319 -1.419  -3.850  1.00 38.86  ? 637  ASP A N     1 
ATOM   2746 C  CA    . ASP A 1 345 ? -48.038 -1.596  -4.515  1.00 36.42  ? 637  ASP A CA    1 
ATOM   2747 C  C     . ASP A 1 345 ? -48.170 -1.121  -5.959  1.00 43.57  ? 637  ASP A C     1 
ATOM   2748 O  O     . ASP A 1 345 ? -48.923 -1.703  -6.742  1.00 39.21  ? 637  ASP A O     1 
ATOM   2749 C  CB    . ASP A 1 345 ? -47.620 -3.067  -4.473  1.00 32.92  ? 637  ASP A CB    1 
ATOM   2750 C  CG    . ASP A 1 345 ? -46.258 -3.309  -5.096  1.00 38.97  ? 637  ASP A CG    1 
ATOM   2751 O  OD1   . ASP A 1 345 ? -46.064 -2.993  -6.294  1.00 40.61  ? 637  ASP A OD1   1 
ATOM   2752 O  OD2   . ASP A 1 345 ? -45.370 -3.819  -4.382  1.00 47.90  ? 637  ASP A OD2   1 
ATOM   2753 N  N     . PHE A 1 346 ? -47.425 -0.077  -6.312  1.00 34.02  ? 638  PHE A N     1 
ATOM   2754 C  CA    . PHE A 1 346 ? -47.550 0.530   -7.638  1.00 26.77  ? 638  PHE A CA    1 
ATOM   2755 C  C     . PHE A 1 346 ? -47.374 -0.460  -8.774  1.00 30.83  ? 638  PHE A C     1 
ATOM   2756 O  O     . PHE A 1 346 ? -48.145 -0.454  -9.732  1.00 28.46  ? 638  PHE A O     1 
ATOM   2757 C  CB    . PHE A 1 346 ? -46.541 1.663   -7.816  1.00 27.83  ? 638  PHE A CB    1 
ATOM   2758 C  CG    . PHE A 1 346 ? -46.647 2.361   -9.149  1.00 30.79  ? 638  PHE A CG    1 
ATOM   2759 C  CD1   . PHE A 1 346 ? -47.588 3.365   -9.348  1.00 29.01  ? 638  PHE A CD1   1 
ATOM   2760 C  CD2   . PHE A 1 346 ? -45.802 2.020   -10.194 1.00 26.60  ? 638  PHE A CD2   1 
ATOM   2761 C  CE1   . PHE A 1 346 ? -47.683 4.011   -10.582 1.00 26.70  ? 638  PHE A CE1   1 
ATOM   2762 C  CE2   . PHE A 1 346 ? -45.887 2.661   -11.422 1.00 29.48  ? 638  PHE A CE2   1 
ATOM   2763 C  CZ    . PHE A 1 346 ? -46.827 3.661   -11.614 1.00 29.55  ? 638  PHE A CZ    1 
ATOM   2764 N  N     . HIS A 1 347 ? -46.359 -1.306  -8.672  1.00 27.44  ? 639  HIS A N     1 
ATOM   2765 C  CA    . HIS A 1 347 ? -46.004 -2.178  -9.781  1.00 28.59  ? 639  HIS A CA    1 
ATOM   2766 C  C     . HIS A 1 347 ? -47.011 -3.309  -9.933  1.00 34.53  ? 639  HIS A C     1 
ATOM   2767 O  O     . HIS A 1 347 ? -47.242 -3.796  -11.032 1.00 32.88  ? 639  HIS A O     1 
ATOM   2768 C  CB    . HIS A 1 347 ? -44.592 -2.729  -9.608  1.00 24.30  ? 639  HIS A CB    1 
ATOM   2769 C  CG    . HIS A 1 347 ? -43.533 -1.673  -9.585  1.00 29.64  ? 639  HIS A CG    1 
ATOM   2770 N  ND1   . HIS A 1 347 ? -43.274 -0.849  -10.663 1.00 27.97  ? 639  HIS A ND1   1 
ATOM   2771 C  CD2   . HIS A 1 347 ? -42.662 -1.308  -8.616  1.00 26.93  ? 639  HIS A CD2   1 
ATOM   2772 C  CE1   . HIS A 1 347 ? -42.297 -0.016  -10.352 1.00 27.45  ? 639  HIS A CE1   1 
ATOM   2773 N  NE2   . HIS A 1 347 ? -41.905 -0.276  -9.115  1.00 25.38  ? 639  HIS A NE2   1 
ATOM   2774 N  N     . THR A 1 348 ? -47.608 -3.725  -8.823  1.00 32.07  ? 640  THR A N     1 
ATOM   2775 C  CA    . THR A 1 348 ? -48.669 -4.722  -8.882  1.00 34.21  ? 640  THR A CA    1 
ATOM   2776 C  C     . THR A 1 348 ? -49.958 -4.118  -9.444  1.00 36.99  ? 640  THR A C     1 
ATOM   2777 O  O     . THR A 1 348 ? -50.641 -4.745  -10.251 1.00 39.53  ? 640  THR A O     1 
ATOM   2778 C  CB    . THR A 1 348 ? -48.941 -5.321  -7.496  1.00 32.97  ? 640  THR A CB    1 
ATOM   2779 O  OG1   . THR A 1 348 ? -47.763 -6.002  -7.052  1.00 35.42  ? 640  THR A OG1   1 
ATOM   2780 C  CG2   . THR A 1 348 ? -50.105 -6.304  -7.560  1.00 32.33  ? 640  THR A CG2   1 
ATOM   2781 N  N     . GLU A 1 349 ? -50.287 -2.901  -9.019  1.00 33.93  ? 641  GLU A N     1 
ATOM   2782 C  CA    . GLU A 1 349 ? -51.492 -2.238  -9.508  1.00 37.68  ? 641  GLU A CA    1 
ATOM   2783 C  C     . GLU A 1 349 ? -51.419 -2.059  -11.024 1.00 38.23  ? 641  GLU A C     1 
ATOM   2784 O  O     . GLU A 1 349 ? -52.347 -2.430  -11.745 1.00 40.88  ? 641  GLU A O     1 
ATOM   2785 C  CB    . GLU A 1 349 ? -51.690 -0.877  -8.834  1.00 43.78  ? 641  GLU A CB    1 
ATOM   2786 C  CG    . GLU A 1 349 ? -52.009 -0.950  -7.347  1.00 42.70  ? 641  GLU A CG    1 
ATOM   2787 C  CD    . GLU A 1 349 ? -53.310 -1.684  -7.059  1.00 49.25  ? 641  GLU A CD    1 
ATOM   2788 O  OE1   . GLU A 1 349 ? -54.374 -1.201  -7.493  1.00 51.92  ? 641  GLU A OE1   1 
ATOM   2789 O  OE2   . GLU A 1 349 ? -53.263 -2.744  -6.396  1.00 52.70  ? 641  GLU A OE2   1 
ATOM   2790 N  N     . THR A 1 350 ? -50.308 -1.501  -11.497 1.00 32.88  ? 642  THR A N     1 
ATOM   2791 C  CA    . THR A 1 350 ? -50.111 -1.285  -12.928 1.00 31.15  ? 642  THR A CA    1 
ATOM   2792 C  C     . THR A 1 350 ? -49.973 -2.594  -13.710 1.00 34.03  ? 642  THR A C     1 
ATOM   2793 O  O     . THR A 1 350 ? -50.448 -2.687  -14.843 1.00 35.83  ? 642  THR A O     1 
ATOM   2794 C  CB    . THR A 1 350 ? -48.895 -0.378  -13.208 1.00 35.79  ? 642  THR A CB    1 
ATOM   2795 O  OG1   . THR A 1 350 ? -47.759 -0.875  -12.494 1.00 38.86  ? 642  THR A OG1   1 
ATOM   2796 C  CG2   . THR A 1 350 ? -49.188 1.064   -12.771 1.00 32.87  ? 642  THR A CG2   1 
ATOM   2797 N  N     . ALA A 1 351 ? -49.334 -3.603  -13.119 1.00 35.12  ? 643  ALA A N     1 
ATOM   2798 C  CA    . ALA A 1 351 ? -49.249 -4.924  -13.760 1.00 37.29  ? 643  ALA A CA    1 
ATOM   2799 C  C     . ALA A 1 351 ? -50.636 -5.515  -13.988 1.00 41.04  ? 643  ALA A C     1 
ATOM   2800 O  O     . ALA A 1 351 ? -50.917 -6.075  -15.047 1.00 43.94  ? 643  ALA A O     1 
ATOM   2801 C  CB    . ALA A 1 351 ? -48.408 -5.883  -12.932 1.00 39.39  ? 643  ALA A CB    1 
ATOM   2802 N  N     . SER A 1 352 ? -51.492 -5.393  -12.980 1.00 40.20  ? 644  SER A N     1 
ATOM   2803 C  CA    . SER A 1 352 ? -52.872 -5.858  -13.061 1.00 41.56  ? 644  SER A CA    1 
ATOM   2804 C  C     . SER A 1 352 ? -53.591 -5.137  -14.198 1.00 48.68  ? 644  SER A C     1 
ATOM   2805 O  O     . SER A 1 352 ? -54.304 -5.754  -14.990 1.00 47.37  ? 644  SER A O     1 
ATOM   2806 C  CB    . SER A 1 352 ? -53.584 -5.594  -11.734 1.00 41.06  ? 644  SER A CB    1 
ATOM   2807 O  OG    . SER A 1 352 ? -54.987 -5.735  -11.857 1.00 48.17  ? 644  SER A OG    1 
ATOM   2808 N  N     . TRP A 1 353 ? -53.383 -3.827  -14.280 1.00 39.58  ? 645  TRP A N     1 
ATOM   2809 C  CA    . TRP A 1 353 ? -53.966 -3.021  -15.353 1.00 43.74  ? 645  TRP A CA    1 
ATOM   2810 C  C     . TRP A 1 353 ? -53.454 -3.398  -16.748 1.00 47.12  ? 645  TRP A C     1 
ATOM   2811 O  O     . TRP A 1 353 ? -54.247 -3.602  -17.666 1.00 51.71  ? 645  TRP A O     1 
ATOM   2812 C  CB    . TRP A 1 353 ? -53.745 -1.531  -15.083 1.00 39.25  ? 645  TRP A CB    1 
ATOM   2813 C  CG    . TRP A 1 353 ? -54.060 -0.649  -16.256 1.00 56.43  ? 645  TRP A CG    1 
ATOM   2814 C  CD1   . TRP A 1 353 ? -55.297 -0.267  -16.687 1.00 63.61  ? 645  TRP A CD1   1 
ATOM   2815 C  CD2   . TRP A 1 353 ? -53.118 -0.028  -17.142 1.00 62.72  ? 645  TRP A CD2   1 
ATOM   2816 N  NE1   . TRP A 1 353 ? -55.185 0.547   -17.790 1.00 64.05  ? 645  TRP A NE1   1 
ATOM   2817 C  CE2   . TRP A 1 353 ? -53.857 0.708   -18.090 1.00 65.54  ? 645  TRP A CE2   1 
ATOM   2818 C  CE3   . TRP A 1 353 ? -51.721 -0.028  -17.227 1.00 62.67  ? 645  TRP A CE3   1 
ATOM   2819 C  CZ2   . TRP A 1 353 ? -53.247 1.438   -19.109 1.00 64.78  ? 645  TRP A CZ2   1 
ATOM   2820 C  CZ3   . TRP A 1 353 ? -51.117 0.698   -18.241 1.00 58.64  ? 645  TRP A CZ3   1 
ATOM   2821 C  CH2   . TRP A 1 353 ? -51.879 1.419   -19.168 1.00 61.78  ? 645  TRP A CH2   1 
ATOM   2822 N  N     . MET A 1 354 ? -52.138 -3.503  -16.910 1.00 44.03  ? 646  MET A N     1 
ATOM   2823 C  CA    . MET A 1 354 ? -51.564 -3.710  -18.242 1.00 49.64  ? 646  MET A CA    1 
ATOM   2824 C  C     . MET A 1 354 ? -51.608 -5.159  -18.746 1.00 50.96  ? 646  MET A C     1 
ATOM   2825 O  O     . MET A 1 354 ? -51.556 -5.398  -19.954 1.00 48.30  ? 646  MET A O     1 
ATOM   2826 C  CB    . MET A 1 354 ? -50.142 -3.134  -18.337 1.00 51.44  ? 646  MET A CB    1 
ATOM   2827 C  CG    . MET A 1 354 ? -49.060 -3.934  -17.629 1.00 50.60  ? 646  MET A CG    1 
ATOM   2828 S  SD    . MET A 1 354 ? -47.412 -3.199  -17.824 1.00 44.80  ? 646  MET A SD    1 
ATOM   2829 C  CE    . MET A 1 354 ? -47.592 -1.704  -16.845 1.00 45.68  ? 646  MET A CE    1 
ATOM   2830 N  N     . PHE A 1 355 ? -51.704 -6.118  -17.828 1.00 46.48  ? 647  PHE A N     1 
ATOM   2831 C  CA    . PHE A 1 355 ? -51.782 -7.532  -18.197 1.00 50.82  ? 647  PHE A CA    1 
ATOM   2832 C  C     . PHE A 1 355 ? -53.215 -8.059  -18.151 1.00 51.35  ? 647  PHE A C     1 
ATOM   2833 O  O     . PHE A 1 355 ? -53.483 -9.180  -18.581 1.00 48.99  ? 647  PHE A O     1 
ATOM   2834 C  CB    . PHE A 1 355 ? -50.887 -8.391  -17.296 1.00 52.97  ? 647  PHE A CB    1 
ATOM   2835 C  CG    . PHE A 1 355 ? -49.433 -8.353  -17.667 1.00 58.19  ? 647  PHE A CG    1 
ATOM   2836 C  CD1   . PHE A 1 355 ? -48.912 -9.266  -18.568 1.00 64.18  ? 647  PHE A CD1   1 
ATOM   2837 C  CD2   . PHE A 1 355 ? -48.585 -7.412  -17.109 1.00 64.06  ? 647  PHE A CD2   1 
ATOM   2838 C  CE1   . PHE A 1 355 ? -47.570 -9.239  -18.910 1.00 66.61  ? 647  PHE A CE1   1 
ATOM   2839 C  CE2   . PHE A 1 355 ? -47.242 -7.376  -17.448 1.00 62.11  ? 647  PHE A CE2   1 
ATOM   2840 C  CZ    . PHE A 1 355 ? -46.735 -8.290  -18.349 1.00 68.92  ? 647  PHE A CZ    1 
ATOM   2841 N  N     . GLY A 1 356 ? -54.124 -7.253  -17.613 1.00 43.41  ? 648  GLY A N     1 
ATOM   2842 C  CA    . GLY A 1 356 ? -55.537 -7.589  -17.570 1.00 44.05  ? 648  GLY A CA    1 
ATOM   2843 C  C     . GLY A 1 356 ? -55.892 -8.738  -16.644 1.00 55.77  ? 648  GLY A C     1 
ATOM   2844 O  O     . GLY A 1 356 ? -56.856 -9.465  -16.894 1.00 57.11  ? 648  GLY A O     1 
ATOM   2845 N  N     . VAL A 1 357 ? -55.120 -8.899  -15.571 1.00 50.24  ? 649  VAL A N     1 
ATOM   2846 C  CA    . VAL A 1 357 ? -55.349 -9.976  -14.608 1.00 51.74  ? 649  VAL A CA    1 
ATOM   2847 C  C     . VAL A 1 357 ? -55.559 -9.395  -13.207 1.00 48.28  ? 649  VAL A C     1 
ATOM   2848 O  O     . VAL A 1 357 ? -55.197 -8.239  -12.954 1.00 46.86  ? 649  VAL A O     1 
ATOM   2849 C  CB    . VAL A 1 357 ? -54.177 -10.989 -14.597 1.00 43.82  ? 649  VAL A CB    1 
ATOM   2850 C  CG1   . VAL A 1 357 ? -53.852 -11.461 -16.020 1.00 45.92  ? 649  VAL A CG1   1 
ATOM   2851 C  CG2   . VAL A 1 357 ? -52.943 -10.394 -13.932 1.00 41.39  ? 649  VAL A CG2   1 
ATOM   2852 N  N     . PRO A 1 358 ? -56.168 -10.175 -12.297 1.00 51.74  ? 650  PRO A N     1 
ATOM   2853 C  CA    . PRO A 1 358 ? -56.311 -9.682  -10.924 1.00 51.28  ? 650  PRO A CA    1 
ATOM   2854 C  C     . PRO A 1 358 ? -54.945 -9.523  -10.266 1.00 39.58  ? 650  PRO A C     1 
ATOM   2855 O  O     . PRO A 1 358 ? -53.997 -10.198 -10.670 1.00 41.90  ? 650  PRO A O     1 
ATOM   2856 C  CB    . PRO A 1 358 ? -57.099 -10.798 -10.226 1.00 46.62  ? 650  PRO A CB    1 
ATOM   2857 C  CG    . PRO A 1 358 ? -57.774 -11.544 -11.331 1.00 50.35  ? 650  PRO A CG    1 
ATOM   2858 C  CD    . PRO A 1 358 ? -56.823 -11.484 -12.482 1.00 46.93  ? 650  PRO A CD    1 
ATOM   2859 N  N     . ARG A 1 359 ? -54.858 -8.646  -9.269  1.00 41.94  ? 651  ARG A N     1 
ATOM   2860 C  CA    . ARG A 1 359 ? -53.590 -8.357  -8.600  1.00 39.26  ? 651  ARG A CA    1 
ATOM   2861 C  C     . ARG A 1 359 ? -52.967 -9.607  -7.967  1.00 34.99  ? 651  ARG A C     1 
ATOM   2862 O  O     . ARG A 1 359 ? -51.745 -9.744  -7.919  1.00 34.16  ? 651  ARG A O     1 
ATOM   2863 C  CB    . ARG A 1 359 ? -53.770 -7.243  -7.566  1.00 44.66  ? 651  ARG A CB    1 
ATOM   2864 C  CG    . ARG A 1 359 ? -54.941 -7.444  -6.629  1.00 58.16  ? 651  ARG A CG    1 
ATOM   2865 C  CD    . ARG A 1 359 ? -55.105 -6.264  -5.682  1.00 68.31  ? 651  ARG A CD    1 
ATOM   2866 N  NE    . ARG A 1 359 ? -55.355 -5.012  -6.391  1.00 74.59  ? 651  ARG A NE    1 
ATOM   2867 C  CZ    . ARG A 1 359 ? -56.278 -4.125  -6.033  1.00 82.15  ? 651  ARG A CZ    1 
ATOM   2868 N  NH1   . ARG A 1 359 ? -57.047 -4.353  -4.978  1.00 85.62  ? 651  ARG A NH1   1 
ATOM   2869 N  NH2   . ARG A 1 359 ? -56.435 -3.011  -6.734  1.00 83.74  ? 651  ARG A NH2   1 
ATOM   2870 N  N     . GLU A 1 360 ? -53.810 -10.535 -7.515  1.00 43.34  ? 652  GLU A N     1 
ATOM   2871 C  CA    . GLU A 1 360 ? -53.316 -11.777 -6.915  1.00 42.65  ? 652  GLU A CA    1 
ATOM   2872 C  C     . GLU A 1 360 ? -52.635 -12.680 -7.940  1.00 41.42  ? 652  GLU A C     1 
ATOM   2873 O  O     . GLU A 1 360 ? -51.810 -13.537 -7.585  1.00 42.65  ? 652  GLU A O     1 
ATOM   2874 C  CB    . GLU A 1 360 ? -54.442 -12.529 -6.199  1.00 53.43  ? 652  GLU A CB    1 
ATOM   2875 C  CG    . GLU A 1 360 ? -55.826 -12.273 -6.767  1.00 71.68  ? 652  GLU A CG    1 
ATOM   2876 C  CD    . GLU A 1 360 ? -56.451 -10.991 -6.244  1.00 78.25  ? 652  GLU A CD    1 
ATOM   2877 O  OE1   . GLU A 1 360 ? -56.117 -10.581 -5.112  1.00 81.66  ? 652  GLU A OE1   1 
ATOM   2878 O  OE2   . GLU A 1 360 ? -57.269 -10.387 -6.968  1.00 82.81  ? 652  GLU A OE2   1 
ATOM   2879 N  N     . ALA A 1 361 ? -52.969 -12.471 -9.212  1.00 42.30  ? 653  ALA A N     1 
ATOM   2880 C  CA    . ALA A 1 361 ? -52.399 -13.255 -10.305 1.00 44.74  ? 653  ALA A CA    1 
ATOM   2881 C  C     . ALA A 1 361 ? -51.084 -12.662 -10.805 1.00 45.54  ? 653  ALA A C     1 
ATOM   2882 O  O     . ALA A 1 361 ? -50.429 -13.221 -11.682 1.00 46.88  ? 653  ALA A O     1 
ATOM   2883 C  CB    . ALA A 1 361 ? -53.401 -13.382 -11.449 1.00 48.14  ? 653  ALA A CB    1 
ATOM   2884 N  N     . VAL A 1 362 ? -50.696 -11.526 -10.238 1.00 37.13  ? 654  VAL A N     1 
ATOM   2885 C  CA    . VAL A 1 362 ? -49.432 -10.900 -10.596 1.00 42.10  ? 654  VAL A CA    1 
ATOM   2886 C  C     . VAL A 1 362 ? -48.288 -11.545 -9.823  1.00 45.34  ? 654  VAL A C     1 
ATOM   2887 O  O     . VAL A 1 362 ? -48.005 -11.174 -8.685  1.00 40.62  ? 654  VAL A O     1 
ATOM   2888 C  CB    . VAL A 1 362 ? -49.468 -9.384  -10.324 1.00 37.53  ? 654  VAL A CB    1 
ATOM   2889 C  CG1   . VAL A 1 362 ? -48.126 -8.738  -10.701 1.00 35.84  ? 654  VAL A CG1   1 
ATOM   2890 C  CG2   . VAL A 1 362 ? -50.635 -8.749  -11.086 1.00 34.12  ? 654  VAL A CG2   1 
ATOM   2891 N  N     . ASP A 1 363 ? -47.639 -12.523 -10.443 1.00 43.32  ? 655  ASP A N     1 
ATOM   2892 C  CA    . ASP A 1 363 ? -46.516 -13.198 -9.809  1.00 43.02  ? 655  ASP A CA    1 
ATOM   2893 C  C     . ASP A 1 363 ? -45.241 -12.365 -9.980  1.00 43.19  ? 655  ASP A C     1 
ATOM   2894 O  O     . ASP A 1 363 ? -45.260 -11.361 -10.697 1.00 44.45  ? 655  ASP A O     1 
ATOM   2895 C  CB    . ASP A 1 363 ? -46.377 -14.631 -10.353 1.00 56.22  ? 655  ASP A CB    1 
ATOM   2896 C  CG    . ASP A 1 363 ? -46.379 -14.693 -11.868 1.00 66.24  ? 655  ASP A CG    1 
ATOM   2897 O  OD1   . ASP A 1 363 ? -45.958 -13.712 -12.516 1.00 63.47  ? 655  ASP A OD1   1 
ATOM   2898 O  OD2   . ASP A 1 363 ? -46.791 -15.738 -12.412 1.00 72.16  ? 655  ASP A OD2   1 
ATOM   2899 N  N     . PRO A 1 364 ? -44.141 -12.746 -9.302  1.00 40.33  ? 656  PRO A N     1 
ATOM   2900 C  CA    . PRO A 1 364 ? -42.927 -11.930 -9.428  1.00 46.23  ? 656  PRO A CA    1 
ATOM   2901 C  C     . PRO A 1 364 ? -42.393 -11.780 -10.849 1.00 49.65  ? 656  PRO A C     1 
ATOM   2902 O  O     . PRO A 1 364 ? -41.744 -10.777 -11.126 1.00 44.10  ? 656  PRO A O     1 
ATOM   2903 C  CB    . PRO A 1 364 ? -41.905 -12.661 -8.543  1.00 45.17  ? 656  PRO A CB    1 
ATOM   2904 C  CG    . PRO A 1 364 ? -42.541 -13.975 -8.182  1.00 47.46  ? 656  PRO A CG    1 
ATOM   2905 C  CD    . PRO A 1 364 ? -44.008 -13.733 -8.215  1.00 46.21  ? 656  PRO A CD    1 
ATOM   2906 N  N     . LEU A 1 365 ? -42.658 -12.744 -11.724 1.00 51.09  ? 657  LEU A N     1 
ATOM   2907 C  CA    . LEU A 1 365 ? -42.206 -12.653 -13.108 1.00 55.05  ? 657  LEU A CA    1 
ATOM   2908 C  C     . LEU A 1 365 ? -42.969 -11.552 -13.846 1.00 44.61  ? 657  LEU A C     1 
ATOM   2909 O  O     . LEU A 1 365 ? -42.371 -10.717 -14.526 1.00 41.59  ? 657  LEU A O     1 
ATOM   2910 C  CB    . LEU A 1 365 ? -42.397 -13.990 -13.825 1.00 72.51  ? 657  LEU A CB    1 
ATOM   2911 C  CG    . LEU A 1 365 ? -41.630 -14.169 -15.136 1.00 83.54  ? 657  LEU A CG    1 
ATOM   2912 C  CD1   . LEU A 1 365 ? -40.140 -14.288 -14.860 1.00 86.96  ? 657  LEU A CD1   1 
ATOM   2913 C  CD2   . LEU A 1 365 ? -42.137 -15.382 -15.903 1.00 88.46  ? 657  LEU A CD2   1 
ATOM   2914 N  N     . MET A 1 366 ? -44.294 -11.566 -13.708 1.00 38.43  ? 658  MET A N     1 
ATOM   2915 C  CA    . MET A 1 366 ? -45.139 -10.540 -14.300 1.00 36.38  ? 658  MET A CA    1 
ATOM   2916 C  C     . MET A 1 366 ? -44.824 -9.172  -13.694 1.00 38.45  ? 658  MET A C     1 
ATOM   2917 O  O     . MET A 1 366 ? -44.761 -8.169  -14.405 1.00 45.51  ? 658  MET A O     1 
ATOM   2918 C  CB    . MET A 1 366 ? -46.610 -10.880 -14.088 1.00 41.62  ? 658  MET A CB    1 
ATOM   2919 C  CG    . MET A 1 366 ? -47.571 -9.845  -14.646 1.00 41.08  ? 658  MET A CG    1 
ATOM   2920 S  SD    . MET A 1 366 ? -49.301 -10.331 -14.475 1.00 51.98  ? 658  MET A SD    1 
ATOM   2921 C  CE    . MET A 1 366 ? -49.326 -11.806 -15.499 1.00 52.32  ? 658  MET A CE    1 
ATOM   2922 N  N     . ARG A 1 367 ? -44.615 -9.141  -12.380 1.00 36.56  ? 659  ARG A N     1 
ATOM   2923 C  CA    . ARG A 1 367 ? -44.308 -7.886  -11.693 1.00 33.14  ? 659  ARG A CA    1 
ATOM   2924 C  C     . ARG A 1 367 ? -42.995 -7.278  -12.184 1.00 37.13  ? 659  ARG A C     1 
ATOM   2925 O  O     . ARG A 1 367 ? -42.892 -6.056  -12.352 1.00 31.31  ? 659  ARG A O     1 
ATOM   2926 C  CB    . ARG A 1 367 ? -44.273 -8.086  -10.176 1.00 32.49  ? 659  ARG A CB    1 
ATOM   2927 C  CG    . ARG A 1 367 ? -44.212 -6.776  -9.385  1.00 36.64  ? 659  ARG A CG    1 
ATOM   2928 C  CD    . ARG A 1 367 ? -44.295 -7.035  -7.884  1.00 40.88  ? 659  ARG A CD    1 
ATOM   2929 N  NE    . ARG A 1 367 ? -44.302 -5.799  -7.100  1.00 33.80  ? 659  ARG A NE    1 
ATOM   2930 C  CZ    . ARG A 1 367 ? -43.205 -5.127  -6.770  1.00 31.88  ? 659  ARG A CZ    1 
ATOM   2931 N  NH1   . ARG A 1 367 ? -42.025 -5.565  -7.168  1.00 37.95  ? 659  ARG A NH1   1 
ATOM   2932 N  NH2   . ARG A 1 367 ? -43.290 -4.010  -6.054  1.00 32.38  ? 659  ARG A NH2   1 
ATOM   2933 N  N     . ARG A 1 368 ? -42.000 -8.131  -12.419 1.00 35.04  ? 660  ARG A N     1 
ATOM   2934 C  CA    . ARG A 1 368 ? -40.721 -7.688  -12.963 1.00 39.20  ? 660  ARG A CA    1 
ATOM   2935 C  C     . ARG A 1 368 ? -40.892 -7.109  -14.359 1.00 30.79  ? 660  ARG A C     1 
ATOM   2936 O  O     . ARG A 1 368 ? -40.243 -6.125  -14.717 1.00 40.11  ? 660  ARG A O     1 
ATOM   2937 C  CB    . ARG A 1 368 ? -39.745 -8.852  -13.072 1.00 48.48  ? 660  ARG A CB    1 
ATOM   2938 C  CG    . ARG A 1 368 ? -39.133 -9.326  -11.781 1.00 72.76  ? 660  ARG A CG    1 
ATOM   2939 C  CD    . ARG A 1 368 ? -38.437 -10.660 -12.011 1.00 88.08  ? 660  ARG A CD    1 
ATOM   2940 N  NE    . ARG A 1 368 ? -37.329 -10.550 -12.958 1.00 99.72  ? 660  ARG A NE    1 
ATOM   2941 C  CZ    . ARG A 1 368 ? -37.383 -10.918 -14.236 1.00 105.76 ? 660  ARG A CZ    1 
ATOM   2942 N  NH1   . ARG A 1 368 ? -38.501 -11.425 -14.738 1.00 107.81 ? 660  ARG A NH1   1 
ATOM   2943 N  NH2   . ARG A 1 368 ? -36.317 -10.777 -15.012 1.00 106.68 ? 660  ARG A NH2   1 
ATOM   2944 N  N     . ALA A 1 369 ? -41.743 -7.747  -15.155 1.00 32.77  ? 661  ALA A N     1 
ATOM   2945 C  CA    . ALA A 1 369 ? -41.978 -7.296  -16.524 1.00 31.42  ? 661  ALA A CA    1 
ATOM   2946 C  C     . ALA A 1 369 ? -42.661 -5.928  -16.482 1.00 39.11  ? 661  ALA A C     1 
ATOM   2947 O  O     . ALA A 1 369 ? -42.286 -5.009  -17.215 1.00 38.88  ? 661  ALA A O     1 
ATOM   2948 C  CB    . ALA A 1 369 ? -42.819 -8.309  -17.286 1.00 38.42  ? 661  ALA A CB    1 
ATOM   2949 N  N     . ALA A 1 370 ? -43.646 -5.795  -15.600 1.00 33.84  ? 662  ALA A N     1 
ATOM   2950 C  CA    . ALA A 1 370 ? -44.351 -4.531  -15.415 1.00 34.35  ? 662  ALA A CA    1 
ATOM   2951 C  C     . ALA A 1 370 ? -43.437 -3.391  -14.940 1.00 32.08  ? 662  ALA A C     1 
ATOM   2952 O  O     . ALA A 1 370 ? -43.572 -2.247  -15.388 1.00 31.57  ? 662  ALA A O     1 
ATOM   2953 C  CB    . ALA A 1 370 ? -45.501 -4.716  -14.450 1.00 29.84  ? 662  ALA A CB    1 
ATOM   2954 N  N     . LYS A 1 371 ? -42.524 -3.695  -14.021 1.00 29.24  ? 663  LYS A N     1 
ATOM   2955 C  CA    A LYS A 1 371 ? -41.606 -2.680  -13.498 0.65 28.68  ? 663  LYS A CA    1 
ATOM   2956 C  CA    B LYS A 1 371 ? -41.604 -2.698  -13.490 0.35 28.80  ? 663  LYS A CA    1 
ATOM   2957 C  C     . LYS A 1 371 ? -40.757 -2.080  -14.602 1.00 32.31  ? 663  LYS A C     1 
ATOM   2958 O  O     . LYS A 1 371 ? -40.560 -0.861  -14.654 1.00 32.26  ? 663  LYS A O     1 
ATOM   2959 C  CB    A LYS A 1 371 ? -40.674 -3.265  -12.435 0.65 28.51  ? 663  LYS A CB    1 
ATOM   2960 C  CB    B LYS A 1 371 ? -40.693 -3.343  -12.442 0.35 29.17  ? 663  LYS A CB    1 
ATOM   2961 C  CG    A LYS A 1 371 ? -41.328 -3.546  -11.109 0.65 31.93  ? 663  LYS A CG    1 
ATOM   2962 C  CG    B LYS A 1 371 ? -40.290 -2.405  -11.336 0.35 28.04  ? 663  LYS A CG    1 
ATOM   2963 C  CD    A LYS A 1 371 ? -40.322 -4.125  -10.117 0.65 31.24  ? 663  LYS A CD    1 
ATOM   2964 C  CD    B LYS A 1 371 ? -39.144 -2.940  -10.489 0.35 29.31  ? 663  LYS A CD    1 
ATOM   2965 C  CE    A LYS A 1 371 ? -39.153 -3.169  -9.862  0.65 24.72  ? 663  LYS A CE    1 
ATOM   2966 C  CE    B LYS A 1 371 ? -39.602 -4.067  -9.593  0.35 30.95  ? 663  LYS A CE    1 
ATOM   2967 N  NZ    A LYS A 1 371 ? -38.164 -3.740  -8.884  0.65 25.20  ? 663  LYS A NZ    1 
ATOM   2968 N  NZ    B LYS A 1 371 ? -38.624 -4.310  -8.492  0.35 25.57  ? 663  LYS A NZ    1 
ATOM   2969 N  N     . THR A 1 372 ? -40.256 -2.941  -15.480 1.00 37.04  ? 664  THR A N     1 
ATOM   2970 C  CA    . THR A 1 372 ? -39.407 -2.525  -16.583 1.00 36.33  ? 664  THR A CA    1 
ATOM   2971 C  C     . THR A 1 372 ? -40.183 -1.619  -17.527 1.00 32.70  ? 664  THR A C     1 
ATOM   2972 O  O     . THR A 1 372 ? -39.656 -0.619  -18.012 1.00 39.76  ? 664  THR A O     1 
ATOM   2973 C  CB    . THR A 1 372 ? -38.852 -3.747  -17.354 1.00 43.15  ? 664  THR A CB    1 
ATOM   2974 O  OG1   . THR A 1 372 ? -39.928 -4.639  -17.667 1.00 59.96  ? 664  THR A OG1   1 
ATOM   2975 C  CG2   . THR A 1 372 ? -37.840 -4.493  -16.501 1.00 42.47  ? 664  THR A CG2   1 
ATOM   2976 N  N     . ILE A 1 373 ? -41.439 -1.972  -17.780 1.00 35.17  ? 665  ILE A N     1 
ATOM   2977 C  CA    . ILE A 1 373 ? -42.299 -1.126  -18.597 1.00 31.03  ? 665  ILE A CA    1 
ATOM   2978 C  C     . ILE A 1 373 ? -42.590 0.205   -17.904 1.00 33.92  ? 665  ILE A C     1 
ATOM   2979 O  O     . ILE A 1 373 ? -42.484 1.256   -18.535 1.00 31.58  ? 665  ILE A O     1 
ATOM   2980 C  CB    . ILE A 1 373 ? -43.606 -1.846  -18.989 1.00 34.13  ? 665  ILE A CB    1 
ATOM   2981 C  CG1   . ILE A 1 373 ? -43.295 -2.996  -19.951 1.00 40.94  ? 665  ILE A CG1   1 
ATOM   2982 C  CG2   . ILE A 1 373 ? -44.602 -0.868  -19.617 1.00 36.63  ? 665  ILE A CG2   1 
ATOM   2983 C  CD1   . ILE A 1 373 ? -44.494 -3.873  -20.271 1.00 48.26  ? 665  ILE A CD1   1 
ATOM   2984 N  N     . ASN A 1 374 ? -42.947 0.165   -16.618 1.00 27.89  ? 666  ASN A N     1 
ATOM   2985 C  CA    . ASN A 1 374 ? -43.252 1.389   -15.873 1.00 24.53  ? 666  ASN A CA    1 
ATOM   2986 C  C     . ASN A 1 374 ? -42.116 2.403   -15.895 1.00 23.53  ? 666  ASN A C     1 
ATOM   2987 O  O     . ASN A 1 374 ? -42.322 3.576   -16.197 1.00 25.18  ? 666  ASN A O     1 
ATOM   2988 C  CB    . ASN A 1 374 ? -43.579 1.076   -14.412 1.00 29.02  ? 666  ASN A CB    1 
ATOM   2989 C  CG    . ASN A 1 374 ? -44.908 0.381   -14.247 1.00 29.02  ? 666  ASN A CG    1 
ATOM   2990 O  OD1   . ASN A 1 374 ? -45.848 0.618   -15.010 1.00 30.69  ? 666  ASN A OD1   1 
ATOM   2991 N  ND2   . ASN A 1 374 ? -45.008 -0.466  -13.223 1.00 25.03  ? 666  ASN A ND2   1 
ATOM   2992 N  N     . PHE A 1 375 ? -40.917 1.955   -15.543 1.00 29.18  ? 667  PHE A N     1 
ATOM   2993 C  CA    . PHE A 1 375 ? -39.779 2.857   -15.487 1.00 24.10  ? 667  PHE A CA    1 
ATOM   2994 C  C     . PHE A 1 375 ? -39.445 3.395   -16.879 1.00 26.34  ? 667  PHE A C     1 
ATOM   2995 O  O     . PHE A 1 375 ? -39.185 4.587   -17.043 1.00 28.13  ? 667  PHE A O     1 
ATOM   2996 C  CB    . PHE A 1 375 ? -38.561 2.155   -14.889 1.00 27.48  ? 667  PHE A CB    1 
ATOM   2997 C  CG    . PHE A 1 375 ? -38.740 1.738   -13.451 1.00 38.22  ? 667  PHE A CG    1 
ATOM   2998 C  CD1   . PHE A 1 375 ? -39.440 2.523   -12.559 1.00 41.86  ? 667  PHE A CD1   1 
ATOM   2999 C  CD2   . PHE A 1 375 ? -38.207 0.544   -13.001 1.00 38.71  ? 667  PHE A CD2   1 
ATOM   3000 C  CE1   . PHE A 1 375 ? -39.593 2.127   -11.228 1.00 30.23  ? 667  PHE A CE1   1 
ATOM   3001 C  CE2   . PHE A 1 375 ? -38.349 0.160   -11.683 1.00 40.83  ? 667  PHE A CE2   1 
ATOM   3002 C  CZ    . PHE A 1 375 ? -39.056 0.950   -10.801 1.00 32.65  ? 667  PHE A CZ    1 
ATOM   3003 N  N     . GLY A 1 376 ? -39.462 2.517   -17.878 1.00 27.55  ? 668  GLY A N     1 
ATOM   3004 C  CA    . GLY A 1 376 ? -39.175 2.939   -19.238 1.00 24.99  ? 668  GLY A CA    1 
ATOM   3005 C  C     . GLY A 1 376 ? -40.162 3.991   -19.716 1.00 30.69  ? 668  GLY A C     1 
ATOM   3006 O  O     . GLY A 1 376 ? -39.766 5.046   -20.224 1.00 27.52  ? 668  GLY A O     1 
ATOM   3007 N  N     . VAL A 1 377 ? -41.447 3.716   -19.529 1.00 27.89  ? 669  VAL A N     1 
ATOM   3008 C  CA    . VAL A 1 377 ? -42.504 4.621   -19.989 1.00 25.60  ? 669  VAL A CA    1 
ATOM   3009 C  C     . VAL A 1 377 ? -42.555 5.943   -19.225 1.00 25.96  ? 669  VAL A C     1 
ATOM   3010 O  O     . VAL A 1 377 ? -42.566 7.022   -19.834 1.00 25.63  ? 669  VAL A O     1 
ATOM   3011 C  CB    . VAL A 1 377 ? -43.885 3.926   -19.954 1.00 34.29  ? 669  VAL A CB    1 
ATOM   3012 C  CG1   . VAL A 1 377 ? -45.010 4.930   -20.184 1.00 35.78  ? 669  VAL A CG1   1 
ATOM   3013 C  CG2   . VAL A 1 377 ? -43.924 2.809   -20.989 1.00 31.31  ? 669  VAL A CG2   1 
ATOM   3014 N  N     . LEU A 1 378 ? -42.593 5.863   -17.895 1.00 25.55  ? 670  LEU A N     1 
ATOM   3015 C  CA    . LEU A 1 378 ? -42.643 7.057   -17.058 1.00 25.29  ? 670  LEU A CA    1 
ATOM   3016 C  C     . LEU A 1 378 ? -41.466 7.980   -17.331 1.00 28.38  ? 670  LEU A C     1 
ATOM   3017 O  O     . LEU A 1 378 ? -41.613 9.207   -17.368 1.00 28.19  ? 670  LEU A O     1 
ATOM   3018 C  CB    . LEU A 1 378 ? -42.618 6.684   -15.573 1.00 28.69  ? 670  LEU A CB    1 
ATOM   3019 C  CG    . LEU A 1 378 ? -43.896 6.191   -14.891 1.00 28.17  ? 670  LEU A CG    1 
ATOM   3020 C  CD1   . LEU A 1 378 ? -43.546 5.674   -13.517 1.00 27.35  ? 670  LEU A CD1   1 
ATOM   3021 C  CD2   . LEU A 1 378 ? -44.937 7.301   -14.775 1.00 29.33  ? 670  LEU A CD2   1 
ATOM   3022 N  N     . TYR A 1 379 ? -40.290 7.392   -17.511 1.00 23.77  ? 671  TYR A N     1 
ATOM   3023 C  CA    . TYR A 1 379 ? -39.079 8.202   -17.575 1.00 27.86  ? 671  TYR A CA    1 
ATOM   3024 C  C     . TYR A 1 379 ? -38.530 8.432   -18.983 1.00 35.78  ? 671  TYR A C     1 
ATOM   3025 O  O     . TYR A 1 379 ? -37.394 8.869   -19.129 1.00 33.53  ? 671  TYR A O     1 
ATOM   3026 C  CB    . TYR A 1 379 ? -38.012 7.648   -16.616 1.00 29.40  ? 671  TYR A CB    1 
ATOM   3027 C  CG    . TYR A 1 379 ? -38.514 7.554   -15.179 1.00 39.17  ? 671  TYR A CG    1 
ATOM   3028 C  CD1   . TYR A 1 379 ? -39.111 8.648   -14.560 1.00 52.73  ? 671  TYR A CD1   1 
ATOM   3029 C  CD2   . TYR A 1 379 ? -38.423 6.365   -14.459 1.00 49.93  ? 671  TYR A CD2   1 
ATOM   3030 C  CE1   . TYR A 1 379 ? -39.585 8.572   -13.254 1.00 44.67  ? 671  TYR A CE1   1 
ATOM   3031 C  CE2   . TYR A 1 379 ? -38.896 6.277   -13.146 1.00 54.85  ? 671  TYR A CE2   1 
ATOM   3032 C  CZ    . TYR A 1 379 ? -39.480 7.387   -12.553 1.00 56.49  ? 671  TYR A CZ    1 
ATOM   3033 O  OH    . TYR A 1 379 ? -39.954 7.321   -11.256 1.00 55.31  ? 671  TYR A OH    1 
ATOM   3034 N  N     . GLY A 1 380 ? -39.333 8.140   -20.011 1.00 31.11  ? 672  GLY A N     1 
ATOM   3035 C  CA    . GLY A 1 380 ? -39.080 8.693   -21.336 1.00 32.08  ? 672  GLY A CA    1 
ATOM   3036 C  C     . GLY A 1 380 ? -38.841 7.824   -22.562 1.00 36.03  ? 672  GLY A C     1 
ATOM   3037 O  O     . GLY A 1 380 ? -38.448 8.343   -23.614 1.00 30.74  ? 672  GLY A O     1 
ATOM   3038 N  N     . MET A 1 381 ? -39.084 6.521   -22.461 1.00 26.51  ? 673  MET A N     1 
ATOM   3039 C  CA    . MET A 1 381 ? -38.848 5.625   -23.592 1.00 28.86  ? 673  MET A CA    1 
ATOM   3040 C  C     . MET A 1 381 ? -39.786 5.935   -24.762 1.00 36.12  ? 673  MET A C     1 
ATOM   3041 O  O     . MET A 1 381 ? -40.940 6.304   -24.559 1.00 32.29  ? 673  MET A O     1 
ATOM   3042 C  CB    . MET A 1 381 ? -39.001 4.166   -23.149 1.00 32.88  ? 673  MET A CB    1 
ATOM   3043 C  CG    . MET A 1 381 ? -38.769 3.123   -24.227 1.00 40.52  ? 673  MET A CG    1 
ATOM   3044 S  SD    . MET A 1 381 ? -39.022 1.463   -23.565 1.00 44.19  ? 673  MET A SD    1 
ATOM   3045 C  CE    . MET A 1 381 ? -40.340 1.806   -22.419 1.00 36.17  ? 673  MET A CE    1 
ATOM   3046 N  N     . SER A 1 382 ? -39.284 5.779   -25.984 1.00 42.71  ? 674  SER A N     1 
ATOM   3047 C  CA    . SER A 1 382 ? -40.070 6.082   -27.180 1.00 42.73  ? 674  SER A CA    1 
ATOM   3048 C  C     . SER A 1 382 ? -40.931 4.907   -27.616 1.00 36.96  ? 674  SER A C     1 
ATOM   3049 O  O     . SER A 1 382 ? -40.665 3.755   -27.260 1.00 33.21  ? 674  SER A O     1 
ATOM   3050 C  CB    . SER A 1 382 ? -39.155 6.492   -28.337 1.00 46.86  ? 674  SER A CB    1 
ATOM   3051 O  OG    . SER A 1 382 ? -38.379 5.388   -28.771 1.00 52.16  ? 674  SER A OG    1 
ATOM   3052 N  N     . ALA A 1 383 ? -41.962 5.203   -28.403 1.00 43.88  ? 675  ALA A N     1 
ATOM   3053 C  CA    . ALA A 1 383 ? -42.839 4.162   -28.927 1.00 43.58  ? 675  ALA A CA    1 
ATOM   3054 C  C     . ALA A 1 383 ? -42.038 3.130   -29.721 1.00 47.08  ? 675  ALA A C     1 
ATOM   3055 O  O     . ALA A 1 383 ? -42.309 1.930   -29.653 1.00 43.76  ? 675  ALA A O     1 
ATOM   3056 C  CB    . ALA A 1 383 ? -43.935 4.773   -29.784 1.00 45.88  ? 675  ALA A CB    1 
ATOM   3057 N  N     . HIS A 1 384 ? -41.038 3.608   -30.455 1.00 56.59  ? 676  HIS A N     1 
ATOM   3058 C  CA    . HIS A 1 384 ? -40.180 2.739   -31.250 1.00 63.76  ? 676  HIS A CA    1 
ATOM   3059 C  C     . HIS A 1 384 ? -39.529 1.645   -30.407 1.00 58.32  ? 676  HIS A C     1 
ATOM   3060 O  O     . HIS A 1 384 ? -39.702 0.457   -30.682 1.00 64.34  ? 676  HIS A O     1 
ATOM   3061 C  CB    . HIS A 1 384 ? -39.104 3.560   -31.962 1.00 77.90  ? 676  HIS A CB    1 
ATOM   3062 C  CG    . HIS A 1 384 ? -38.092 2.727   -32.683 1.00 93.76  ? 676  HIS A CG    1 
ATOM   3063 N  ND1   . HIS A 1 384 ? -38.437 1.823   -33.664 1.00 100.89 ? 676  HIS A ND1   1 
ATOM   3064 C  CD2   . HIS A 1 384 ? -36.746 2.656   -32.561 1.00 99.89  ? 676  HIS A CD2   1 
ATOM   3065 C  CE1   . HIS A 1 384 ? -37.346 1.233   -34.118 1.00 104.86 ? 676  HIS A CE1   1 
ATOM   3066 N  NE2   . HIS A 1 384 ? -36.306 1.720   -33.466 1.00 104.70 ? 676  HIS A NE2   1 
ATOM   3067 N  N     . ARG A 1 385 ? -38.789 2.051   -29.378 1.00 54.15  ? 677  ARG A N     1 
ATOM   3068 C  CA    . ARG A 1 385 ? -38.095 1.106   -28.500 1.00 52.17  ? 677  ARG A CA    1 
ATOM   3069 C  C     . ARG A 1 385 ? -39.065 0.169   -27.787 1.00 46.54  ? 677  ARG A C     1 
ATOM   3070 O  O     . ARG A 1 385 ? -38.817 -1.036  -27.692 1.00 49.02  ? 677  ARG A O     1 
ATOM   3071 C  CB    . ARG A 1 385 ? -37.238 1.852   -27.474 1.00 62.44  ? 677  ARG A CB    1 
ATOM   3072 C  CG    . ARG A 1 385 ? -36.662 0.970   -26.368 1.00 74.15  ? 677  ARG A CG    1 
ATOM   3073 C  CD    . ARG A 1 385 ? -35.186 0.655   -26.586 1.00 87.39  ? 677  ARG A CD    1 
ATOM   3074 N  NE    . ARG A 1 385 ? -34.529 0.249   -25.344 1.00 100.30 ? 677  ARG A NE    1 
ATOM   3075 C  CZ    . ARG A 1 385 ? -33.737 1.035   -24.617 1.00 107.43 ? 677  ARG A CZ    1 
ATOM   3076 N  NH1   . ARG A 1 385 ? -33.484 2.277   -25.007 1.00 107.87 ? 677  ARG A NH1   1 
ATOM   3077 N  NH2   . ARG A 1 385 ? -33.189 0.576   -23.500 1.00 111.00 ? 677  ARG A NH2   1 
ATOM   3078 N  N     . LEU A 1 386 ? -40.172 0.725   -27.300 1.00 43.17  ? 678  LEU A N     1 
ATOM   3079 C  CA    . LEU A 1 386 ? -41.176 -0.054  -26.585 1.00 43.75  ? 678  LEU A CA    1 
ATOM   3080 C  C     . LEU A 1 386 ? -41.780 -1.126  -27.485 1.00 48.95  ? 678  LEU A C     1 
ATOM   3081 O  O     . LEU A 1 386 ? -41.962 -2.270  -27.067 1.00 45.90  ? 678  LEU A O     1 
ATOM   3082 C  CB    . LEU A 1 386 ? -42.272 0.861   -26.034 1.00 39.05  ? 678  LEU A CB    1 
ATOM   3083 C  CG    . LEU A 1 386 ? -43.368 0.233   -25.164 1.00 40.27  ? 678  LEU A CG    1 
ATOM   3084 C  CD1   . LEU A 1 386 ? -42.808 -0.311  -23.857 1.00 37.62  ? 678  LEU A CD1   1 
ATOM   3085 C  CD2   . LEU A 1 386 ? -44.450 1.252   -24.885 1.00 34.48  ? 678  LEU A CD2   1 
ATOM   3086 N  N     . SER A 1 387 ? -42.077 -0.752  -28.726 1.00 62.07  ? 679  SER A N     1 
ATOM   3087 C  CA    . SER A 1 387 ? -42.650 -1.688  -29.688 1.00 73.90  ? 679  SER A CA    1 
ATOM   3088 C  C     . SER A 1 387 ? -41.701 -2.848  -29.974 1.00 77.05  ? 679  SER A C     1 
ATOM   3089 O  O     . SER A 1 387 ? -42.127 -4.000  -30.059 1.00 76.75  ? 679  SER A O     1 
ATOM   3090 C  CB    . SER A 1 387 ? -43.015 -0.970  -30.989 1.00 77.10  ? 679  SER A CB    1 
ATOM   3091 O  OG    . SER A 1 387 ? -41.882 -0.347  -31.564 1.00 79.74  ? 679  SER A OG    1 
ATOM   3092 N  N     . GLN A 1 388 ? -40.414 -2.540  -30.110 1.00 81.31  ? 680  GLN A N     1 
ATOM   3093 C  CA    . GLN A 1 388 ? -39.407 -3.562  -30.379 1.00 89.49  ? 680  GLN A CA    1 
ATOM   3094 C  C     . GLN A 1 388 ? -39.215 -4.514  -29.204 1.00 89.10  ? 680  GLN A C     1 
ATOM   3095 O  O     . GLN A 1 388 ? -39.179 -5.731  -29.381 1.00 90.54  ? 680  GLN A O     1 
ATOM   3096 C  CB    . GLN A 1 388 ? -38.069 -2.924  -30.755 1.00 96.29  ? 680  GLN A CB    1 
ATOM   3097 C  CG    . GLN A 1 388 ? -38.028 -2.354  -32.158 1.00 105.56 ? 680  GLN A CG    1 
ATOM   3098 C  CD    . GLN A 1 388 ? -36.618 -2.046  -32.614 1.00 112.59 ? 680  GLN A CD    1 
ATOM   3099 O  OE1   . GLN A 1 388 ? -35.688 -2.011  -31.808 1.00 115.25 ? 680  GLN A OE1   1 
ATOM   3100 N  NE2   . GLN A 1 388 ? -36.449 -1.830  -33.913 1.00 114.26 ? 680  GLN A NE2   1 
ATOM   3101 N  N     . GLU A 1 389 ? -39.088 -3.956  -28.005 1.00 86.27  ? 681  GLU A N     1 
ATOM   3102 C  CA    . GLU A 1 389 ? -38.858 -4.765  -26.814 1.00 83.63  ? 681  GLU A CA    1 
ATOM   3103 C  C     . GLU A 1 389 ? -40.076 -5.601  -26.434 1.00 81.19  ? 681  GLU A C     1 
ATOM   3104 O  O     . GLU A 1 389 ? -39.938 -6.704  -25.909 1.00 80.73  ? 681  GLU A O     1 
ATOM   3105 C  CB    . GLU A 1 389 ? -38.427 -3.889  -25.636 1.00 82.02  ? 681  GLU A CB    1 
ATOM   3106 C  CG    . GLU A 1 389 ? -37.072 -3.230  -25.825 1.00 79.98  ? 681  GLU A CG    1 
ATOM   3107 C  CD    . GLU A 1 389 ? -36.513 -2.673  -24.532 1.00 78.86  ? 681  GLU A CD    1 
ATOM   3108 O  OE1   . GLU A 1 389 ? -37.220 -2.744  -23.503 1.00 74.02  ? 681  GLU A OE1   1 
ATOM   3109 O  OE2   . GLU A 1 389 ? -35.367 -2.171  -24.545 1.00 80.57  ? 681  GLU A OE2   1 
ATOM   3110 N  N     . LEU A 1 390 ? -41.265 -5.073  -26.702 1.00 81.52  ? 682  LEU A N     1 
ATOM   3111 C  CA    . LEU A 1 390 ? -42.503 -5.765  -26.356 1.00 86.62  ? 682  LEU A CA    1 
ATOM   3112 C  C     . LEU A 1 390 ? -43.012 -6.637  -27.499 1.00 97.22  ? 682  LEU A C     1 
ATOM   3113 O  O     . LEU A 1 390 ? -44.050 -7.288  -27.372 1.00 96.17  ? 682  LEU A O     1 
ATOM   3114 C  CB    . LEU A 1 390 ? -43.580 -4.760  -25.941 1.00 79.57  ? 682  LEU A CB    1 
ATOM   3115 C  CG    . LEU A 1 390 ? -43.931 -4.712  -24.454 1.00 72.87  ? 682  LEU A CG    1 
ATOM   3116 C  CD1   . LEU A 1 390 ? -42.670 -4.736  -23.606 1.00 69.24  ? 682  LEU A CD1   1 
ATOM   3117 C  CD2   . LEU A 1 390 ? -44.768 -3.479  -24.145 1.00 69.11  ? 682  LEU A CD2   1 
ATOM   3118 N  N     . ALA A 1 391 ? -42.271 -6.643  -28.606 1.00 104.88 ? 683  ALA A N     1 
ATOM   3119 C  CA    . ALA A 1 391 ? -42.634 -7.409  -29.798 1.00 108.96 ? 683  ALA A CA    1 
ATOM   3120 C  C     . ALA A 1 391 ? -44.053 -7.097  -30.270 1.00 108.21 ? 683  ALA A C     1 
ATOM   3121 O  O     . ALA A 1 391 ? -44.843 -8.001  -30.541 1.00 108.71 ? 683  ALA A O     1 
ATOM   3122 C  CB    . ALA A 1 391 ? -42.459 -8.905  -29.553 1.00 110.46 ? 683  ALA A CB    1 
ATOM   3123 N  N     . ILE A 1 392 ? -44.367 -5.808  -30.352 1.00 105.46 ? 684  ILE A N     1 
ATOM   3124 C  CA    . ILE A 1 392 ? -45.684 -5.349  -30.781 1.00 102.45 ? 684  ILE A CA    1 
ATOM   3125 C  C     . ILE A 1 392 ? -45.532 -4.277  -31.860 1.00 96.20  ? 684  ILE A C     1 
ATOM   3126 O  O     . ILE A 1 392 ? -44.472 -3.661  -31.971 1.00 89.98  ? 684  ILE A O     1 
ATOM   3127 C  CB    . ILE A 1 392 ? -46.497 -4.783  -29.592 1.00 102.23 ? 684  ILE A CB    1 
ATOM   3128 C  CG1   . ILE A 1 392 ? -45.779 -3.585  -28.970 1.00 101.71 ? 684  ILE A CG1   1 
ATOM   3129 C  CG2   . ILE A 1 392 ? -46.751 -5.864  -28.552 1.00 101.60 ? 684  ILE A CG2   1 
ATOM   3130 C  CD1   . ILE A 1 392 ? -46.550 -2.931  -27.845 1.00 99.15  ? 684  ILE A CD1   1 
ATOM   3131 N  N     . PRO A 1 393 ? -46.583 -4.061  -32.672 1.00 95.40  ? 685  PRO A N     1 
ATOM   3132 C  CA    . PRO A 1 393 ? -46.532 -3.006  -33.691 1.00 90.88  ? 685  PRO A CA    1 
ATOM   3133 C  C     . PRO A 1 393 ? -46.338 -1.617  -33.091 1.00 81.16  ? 685  PRO A C     1 
ATOM   3134 O  O     . PRO A 1 393 ? -46.754 -1.367  -31.961 1.00 72.53  ? 685  PRO A O     1 
ATOM   3135 C  CB    . PRO A 1 393 ? -47.903 -3.106  -34.374 1.00 95.26  ? 685  PRO A CB    1 
ATOM   3136 C  CG    . PRO A 1 393 ? -48.759 -3.890  -33.434 1.00 98.20  ? 685  PRO A CG    1 
ATOM   3137 C  CD    . PRO A 1 393 ? -47.828 -4.843  -32.765 1.00 99.38  ? 685  PRO A CD    1 
ATOM   3138 N  N     . TYR A 1 394 ? -45.710 -0.732  -33.859 1.00 80.22  ? 686  TYR A N     1 
ATOM   3139 C  CA    . TYR A 1 394 ? -45.377 0.618   -33.412 1.00 77.46  ? 686  TYR A CA    1 
ATOM   3140 C  C     . TYR A 1 394 ? -46.589 1.402   -32.919 1.00 83.23  ? 686  TYR A C     1 
ATOM   3141 O  O     . TYR A 1 394 ? -46.527 2.082   -31.895 1.00 81.84  ? 686  TYR A O     1 
ATOM   3142 C  CB    . TYR A 1 394 ? -44.692 1.391   -34.546 1.00 70.38  ? 686  TYR A CB    1 
ATOM   3143 C  CG    . TYR A 1 394 ? -44.341 2.823   -34.201 1.00 65.93  ? 686  TYR A CG    1 
ATOM   3144 C  CD1   . TYR A 1 394 ? -45.250 3.857   -34.410 1.00 62.83  ? 686  TYR A CD1   1 
ATOM   3145 C  CD2   . TYR A 1 394 ? -43.099 3.142   -33.670 1.00 66.84  ? 686  TYR A CD2   1 
ATOM   3146 C  CE1   . TYR A 1 394 ? -44.931 5.165   -34.091 1.00 57.42  ? 686  TYR A CE1   1 
ATOM   3147 C  CE2   . TYR A 1 394 ? -42.772 4.447   -33.352 1.00 59.24  ? 686  TYR A CE2   1 
ATOM   3148 C  CZ    . TYR A 1 394 ? -43.691 5.452   -33.565 1.00 58.01  ? 686  TYR A CZ    1 
ATOM   3149 O  OH    . TYR A 1 394 ? -43.362 6.748   -33.249 1.00 60.07  ? 686  TYR A OH    1 
ATOM   3150 N  N     . GLU A 1 395 ? -47.684 1.317   -33.664 1.00 86.16  ? 687  GLU A N     1 
ATOM   3151 C  CA    . GLU A 1 395 ? -48.878 2.092   -33.358 1.00 84.28  ? 687  GLU A CA    1 
ATOM   3152 C  C     . GLU A 1 395 ? -49.518 1.618   -32.061 1.00 69.17  ? 687  GLU A C     1 
ATOM   3153 O  O     . GLU A 1 395 ? -50.168 2.392   -31.362 1.00 57.61  ? 687  GLU A O     1 
ATOM   3154 C  CB    . GLU A 1 395 ? -49.887 2.008   -34.507 1.00 95.81  ? 687  GLU A CB    1 
ATOM   3155 C  CG    . GLU A 1 395 ? -49.371 2.539   -35.839 1.00 106.16 ? 687  GLU A CG    1 
ATOM   3156 C  CD    . GLU A 1 395 ? -48.445 1.564   -36.544 1.00 113.50 ? 687  GLU A CD    1 
ATOM   3157 O  OE1   . GLU A 1 395 ? -48.564 0.345   -36.298 1.00 115.57 ? 687  GLU A OE1   1 
ATOM   3158 O  OE2   . GLU A 1 395 ? -47.594 2.019   -37.337 1.00 116.05 ? 687  GLU A OE2   1 
ATOM   3159 N  N     . GLU A 1 396 ? -49.334 0.341   -31.746 1.00 74.69  ? 688  GLU A N     1 
ATOM   3160 C  CA    . GLU A 1 396 ? -49.888 -0.222  -30.523 1.00 81.67  ? 688  GLU A CA    1 
ATOM   3161 C  C     . GLU A 1 396 ? -49.101 0.266   -29.309 1.00 67.70  ? 688  GLU A C     1 
ATOM   3162 O  O     . GLU A 1 396 ? -49.681 0.609   -28.280 1.00 52.72  ? 688  GLU A O     1 
ATOM   3163 C  CB    . GLU A 1 396 ? -49.897 -1.751  -30.582 1.00 100.30 ? 688  GLU A CB    1 
ATOM   3164 C  CG    . GLU A 1 396 ? -50.719 -2.400  -29.481 1.00 118.94 ? 688  GLU A CG    1 
ATOM   3165 C  CD    . GLU A 1 396 ? -50.832 -3.903  -29.645 1.00 133.48 ? 688  GLU A CD    1 
ATOM   3166 O  OE1   . GLU A 1 396 ? -50.204 -4.449  -30.575 1.00 138.26 ? 688  GLU A OE1   1 
ATOM   3167 O  OE2   . GLU A 1 396 ? -51.550 -4.536  -28.843 1.00 137.65 ? 688  GLU A OE2   1 
ATOM   3168 N  N     . ALA A 1 397 ? -47.779 0.303   -29.444 1.00 64.57  ? 689  ALA A N     1 
ATOM   3169 C  CA    . ALA A 1 397 ? -46.913 0.808   -28.385 1.00 56.27  ? 689  ALA A CA    1 
ATOM   3170 C  C     . ALA A 1 397 ? -47.178 2.289   -28.144 1.00 49.39  ? 689  ALA A C     1 
ATOM   3171 O  O     . ALA A 1 397 ? -47.295 2.736   -27.001 1.00 46.64  ? 689  ALA A O     1 
ATOM   3172 C  CB    . ALA A 1 397 ? -45.455 0.577   -28.738 1.00 54.80  ? 689  ALA A CB    1 
ATOM   3173 N  N     . GLN A 1 398 ? -47.283 3.048   -29.230 1.00 42.87  ? 690  GLN A N     1 
ATOM   3174 C  CA    . GLN A 1 398 ? -47.603 4.469   -29.138 1.00 41.78  ? 690  GLN A CA    1 
ATOM   3175 C  C     . GLN A 1 398 ? -48.936 4.679   -28.418 1.00 38.85  ? 690  GLN A C     1 
ATOM   3176 O  O     . GLN A 1 398 ? -49.079 5.598   -27.610 1.00 43.85  ? 690  GLN A O     1 
ATOM   3177 C  CB    . GLN A 1 398 ? -47.644 5.096   -30.534 1.00 50.53  ? 690  GLN A CB    1 
ATOM   3178 C  CG    . GLN A 1 398 ? -47.650 6.613   -30.540 1.00 62.84  ? 690  GLN A CG    1 
ATOM   3179 C  CD    . GLN A 1 398 ? -47.485 7.191   -31.936 1.00 76.00  ? 690  GLN A CD    1 
ATOM   3180 O  OE1   . GLN A 1 398 ? -47.658 6.492   -32.935 1.00 78.20  ? 690  GLN A OE1   1 
ATOM   3181 N  NE2   . GLN A 1 398 ? -47.143 8.473   -32.009 1.00 82.15  ? 690  GLN A NE2   1 
ATOM   3182 N  N     . ALA A 1 399 ? -49.903 3.809   -28.701 1.00 42.06  ? 691  ALA A N     1 
ATOM   3183 C  CA    . ALA A 1 399 ? -51.231 3.900   -28.095 1.00 44.62  ? 691  ALA A CA    1 
ATOM   3184 C  C     . ALA A 1 399 ? -51.199 3.525   -26.611 1.00 46.33  ? 691  ALA A C     1 
ATOM   3185 O  O     . ALA A 1 399 ? -51.913 4.111   -25.790 1.00 40.90  ? 691  ALA A O     1 
ATOM   3186 C  CB    . ALA A 1 399 ? -52.222 3.013   -28.852 1.00 46.61  ? 691  ALA A CB    1 
ATOM   3187 N  N     . PHE A 1 400 ? -50.371 2.537   -26.280 1.00 41.48  ? 692  PHE A N     1 
ATOM   3188 C  CA    . PHE A 1 400 ? -50.177 2.130   -24.894 1.00 41.07  ? 692  PHE A CA    1 
ATOM   3189 C  C     . PHE A 1 400 ? -49.626 3.293   -24.070 1.00 36.48  ? 692  PHE A C     1 
ATOM   3190 O  O     . PHE A 1 400 ? -50.115 3.577   -22.978 1.00 36.92  ? 692  PHE A O     1 
ATOM   3191 C  CB    . PHE A 1 400 ? -49.221 0.942   -24.811 1.00 39.32  ? 692  PHE A CB    1 
ATOM   3192 C  CG    . PHE A 1 400 ? -48.903 0.519   -23.401 1.00 41.78  ? 692  PHE A CG    1 
ATOM   3193 C  CD1   . PHE A 1 400 ? -49.814 -0.223  -22.664 1.00 47.75  ? 692  PHE A CD1   1 
ATOM   3194 C  CD2   . PHE A 1 400 ? -47.696 0.864   -22.815 1.00 40.36  ? 692  PHE A CD2   1 
ATOM   3195 C  CE1   . PHE A 1 400 ? -49.528 -0.609  -21.367 1.00 50.12  ? 692  PHE A CE1   1 
ATOM   3196 C  CE2   . PHE A 1 400 ? -47.405 0.478   -21.517 1.00 45.95  ? 692  PHE A CE2   1 
ATOM   3197 C  CZ    . PHE A 1 400 ? -48.322 -0.259  -20.794 1.00 48.46  ? 692  PHE A CZ    1 
ATOM   3198 N  N     . ILE A 1 401 ? -48.610 3.963   -24.607 1.00 37.60  ? 693  ILE A N     1 
ATOM   3199 C  CA    . ILE A 1 401 ? -47.981 5.081   -23.909 1.00 35.11  ? 693  ILE A CA    1 
ATOM   3200 C  C     . ILE A 1 401 ? -48.989 6.183   -23.598 1.00 38.73  ? 693  ILE A C     1 
ATOM   3201 O  O     . ILE A 1 401 ? -49.020 6.713   -22.494 1.00 36.75  ? 693  ILE A O     1 
ATOM   3202 C  CB    . ILE A 1 401 ? -46.775 5.636   -24.697 1.00 32.82  ? 693  ILE A CB    1 
ATOM   3203 C  CG1   . ILE A 1 401 ? -45.603 4.655   -24.611 1.00 38.44  ? 693  ILE A CG1   1 
ATOM   3204 C  CG2   . ILE A 1 401 ? -46.364 6.998   -24.168 1.00 35.44  ? 693  ILE A CG2   1 
ATOM   3205 C  CD1   . ILE A 1 401 ? -44.499 4.918   -25.611 1.00 38.59  ? 693  ILE A CD1   1 
ATOM   3206 N  N     . GLU A 1 402 ? -49.837 6.513   -24.566 1.00 40.92  ? 694  GLU A N     1 
ATOM   3207 C  CA    . GLU A 1 402 ? -50.866 7.517   -24.331 1.00 39.02  ? 694  GLU A CA    1 
ATOM   3208 C  C     . GLU A 1 402 ? -51.859 7.077   -23.257 1.00 34.96  ? 694  GLU A C     1 
ATOM   3209 O  O     . GLU A 1 402 ? -52.219 7.864   -22.384 1.00 41.04  ? 694  GLU A O     1 
ATOM   3210 C  CB    . GLU A 1 402 ? -51.589 7.881   -25.632 1.00 50.12  ? 694  GLU A CB    1 
ATOM   3211 C  CG    . GLU A 1 402 ? -50.724 8.678   -26.599 1.00 56.28  ? 694  GLU A CG    1 
ATOM   3212 C  CD    . GLU A 1 402 ? -50.168 9.952   -25.974 1.00 60.49  ? 694  GLU A CD    1 
ATOM   3213 O  OE1   . GLU A 1 402 ? -50.973 10.813  -25.554 1.00 56.87  ? 694  GLU A OE1   1 
ATOM   3214 O  OE2   . GLU A 1 402 ? -48.925 10.087  -25.898 1.00 55.94  ? 694  GLU A OE2   1 
ATOM   3215 N  N     . ARG A 1 403 ? -52.276 5.815   -23.304 1.00 36.48  ? 695  ARG A N     1 
ATOM   3216 C  CA    . ARG A 1 403 ? -53.228 5.292   -22.327 1.00 42.36  ? 695  ARG A CA    1 
ATOM   3217 C  C     . ARG A 1 403 ? -52.600 5.304   -20.937 1.00 45.43  ? 695  ARG A C     1 
ATOM   3218 O  O     . ARG A 1 403 ? -53.257 5.600   -19.935 1.00 40.98  ? 695  ARG A O     1 
ATOM   3219 C  CB    . ARG A 1 403 ? -53.631 3.866   -22.698 1.00 52.35  ? 695  ARG A CB    1 
ATOM   3220 C  CG    . ARG A 1 403 ? -54.978 3.423   -22.157 1.00 71.88  ? 695  ARG A CG    1 
ATOM   3221 C  CD    . ARG A 1 403 ? -55.117 1.908   -22.248 1.00 87.88  ? 695  ARG A CD    1 
ATOM   3222 N  NE    . ARG A 1 403 ? -54.500 1.375   -23.460 1.00 95.42  ? 695  ARG A NE    1 
ATOM   3223 C  CZ    . ARG A 1 403 ? -54.137 0.106   -23.619 1.00 100.93 ? 695  ARG A CZ    1 
ATOM   3224 N  NH1   . ARG A 1 403 ? -54.325 -0.769  -22.638 1.00 102.93 ? 695  ARG A NH1   1 
ATOM   3225 N  NH2   . ARG A 1 403 ? -53.580 -0.289  -24.757 1.00 99.15  ? 695  ARG A NH2   1 
ATOM   3226 N  N     . TYR A 1 404 ? -51.313 4.988   -20.895 1.00 36.86  ? 696  TYR A N     1 
ATOM   3227 C  CA    . TYR A 1 404 ? -50.568 4.969   -19.643 1.00 36.34  ? 696  TYR A CA    1 
ATOM   3228 C  C     . TYR A 1 404 ? -50.599 6.339   -18.951 1.00 37.49  ? 696  TYR A C     1 
ATOM   3229 O  O     . TYR A 1 404 ? -50.965 6.438   -17.778 1.00 42.35  ? 696  TYR A O     1 
ATOM   3230 C  CB    . TYR A 1 404 ? -49.132 4.505   -19.903 1.00 32.20  ? 696  TYR A CB    1 
ATOM   3231 C  CG    . TYR A 1 404 ? -48.343 4.194   -18.648 1.00 29.89  ? 696  TYR A CG    1 
ATOM   3232 C  CD1   . TYR A 1 404 ? -47.818 5.216   -17.862 1.00 35.79  ? 696  TYR A CD1   1 
ATOM   3233 C  CD2   . TYR A 1 404 ? -48.109 2.879   -18.260 1.00 29.88  ? 696  TYR A CD2   1 
ATOM   3234 C  CE1   . TYR A 1 404 ? -47.094 4.939   -16.714 1.00 36.94  ? 696  TYR A CE1   1 
ATOM   3235 C  CE2   . TYR A 1 404 ? -47.384 2.594   -17.111 1.00 28.05  ? 696  TYR A CE2   1 
ATOM   3236 C  CZ    . TYR A 1 404 ? -46.878 3.624   -16.347 1.00 32.47  ? 696  TYR A CZ    1 
ATOM   3237 O  OH    . TYR A 1 404 ? -46.151 3.335   -15.206 1.00 32.93  ? 696  TYR A OH    1 
ATOM   3238 N  N     . PHE A 1 405 ? -50.232 7.399   -19.672 1.00 37.45  ? 697  PHE A N     1 
ATOM   3239 C  CA    . PHE A 1 405 ? -50.231 8.735   -19.075 1.00 34.89  ? 697  PHE A CA    1 
ATOM   3240 C  C     . PHE A 1 405 ? -51.632 9.289   -18.840 1.00 46.51  ? 697  PHE A C     1 
ATOM   3241 O  O     . PHE A 1 405 ? -51.816 10.192  -18.030 1.00 45.68  ? 697  PHE A O     1 
ATOM   3242 C  CB    . PHE A 1 405 ? -49.371 9.714   -19.878 1.00 35.74  ? 697  PHE A CB    1 
ATOM   3243 C  CG    . PHE A 1 405 ? -47.895 9.510   -19.682 1.00 35.41  ? 697  PHE A CG    1 
ATOM   3244 C  CD1   . PHE A 1 405 ? -47.272 9.954   -18.525 1.00 38.26  ? 697  PHE A CD1   1 
ATOM   3245 C  CD2   . PHE A 1 405 ? -47.136 8.862   -20.644 1.00 32.75  ? 697  PHE A CD2   1 
ATOM   3246 C  CE1   . PHE A 1 405 ? -45.916 9.763   -18.335 1.00 36.89  ? 697  PHE A CE1   1 
ATOM   3247 C  CE2   . PHE A 1 405 ? -45.778 8.663   -20.457 1.00 37.70  ? 697  PHE A CE2   1 
ATOM   3248 C  CZ    . PHE A 1 405 ? -45.169 9.118   -19.298 1.00 38.55  ? 697  PHE A CZ    1 
ATOM   3249 N  N     . GLN A 1 406 ? -52.622 8.744   -19.537 1.00 45.00  ? 698  GLN A N     1 
ATOM   3250 C  CA    . GLN A 1 406 ? -54.002 9.115   -19.255 1.00 47.25  ? 698  GLN A CA    1 
ATOM   3251 C  C     . GLN A 1 406 ? -54.419 8.647   -17.858 1.00 44.91  ? 698  GLN A C     1 
ATOM   3252 O  O     . GLN A 1 406 ? -55.286 9.251   -17.234 1.00 43.90  ? 698  GLN A O     1 
ATOM   3253 C  CB    . GLN A 1 406 ? -54.948 8.566   -20.324 1.00 59.96  ? 698  GLN A CB    1 
ATOM   3254 C  CG    . GLN A 1 406 ? -54.879 9.314   -21.645 1.00 68.77  ? 698  GLN A CG    1 
ATOM   3255 C  CD    . GLN A 1 406 ? -55.675 8.634   -22.741 1.00 81.20  ? 698  GLN A CD    1 
ATOM   3256 O  OE1   . GLN A 1 406 ? -56.441 7.704   -22.484 1.00 87.11  ? 698  GLN A OE1   1 
ATOM   3257 N  NE2   . GLN A 1 406 ? -55.494 9.093   -23.974 1.00 83.43  ? 698  GLN A NE2   1 
ATOM   3258 N  N     . SER A 1 407 ? -53.792 7.575   -17.371 1.00 38.58  ? 699  SER A N     1 
ATOM   3259 C  CA    . SER A 1 407 ? -54.048 7.094   -16.018 1.00 42.78  ? 699  SER A CA    1 
ATOM   3260 C  C     . SER A 1 407 ? -53.392 8.000   -14.983 1.00 41.14  ? 699  SER A C     1 
ATOM   3261 O  O     . SER A 1 407 ? -53.857 8.099   -13.848 1.00 43.46  ? 699  SER A O     1 
ATOM   3262 C  CB    . SER A 1 407 ? -53.549 5.660   -15.849 1.00 52.25  ? 699  SER A CB    1 
ATOM   3263 O  OG    . SER A 1 407 ? -54.229 4.780   -16.725 1.00 57.89  ? 699  SER A OG    1 
ATOM   3264 N  N     . PHE A 1 408 ? -52.311 8.665   -15.382 1.00 38.36  ? 700  PHE A N     1 
ATOM   3265 C  CA    . PHE A 1 408 ? -51.620 9.602   -14.496 1.00 33.59  ? 700  PHE A CA    1 
ATOM   3266 C  C     . PHE A 1 408 ? -51.375 10.938  -15.194 1.00 37.69  ? 700  PHE A C     1 
ATOM   3267 O  O     . PHE A 1 408 ? -50.226 11.285  -15.487 1.00 33.01  ? 700  PHE A O     1 
ATOM   3268 C  CB    . PHE A 1 408 ? -50.289 9.003   -14.025 1.00 37.40  ? 700  PHE A CB    1 
ATOM   3269 C  CG    . PHE A 1 408 ? -50.413 7.614   -13.475 1.00 36.95  ? 700  PHE A CG    1 
ATOM   3270 C  CD1   . PHE A 1 408 ? -50.986 7.398   -12.236 1.00 35.84  ? 700  PHE A CD1   1 
ATOM   3271 C  CD2   . PHE A 1 408 ? -49.961 6.522   -14.202 1.00 39.85  ? 700  PHE A CD2   1 
ATOM   3272 C  CE1   . PHE A 1 408 ? -51.104 6.113   -11.727 1.00 31.89  ? 700  PHE A CE1   1 
ATOM   3273 C  CE2   . PHE A 1 408 ? -50.074 5.239   -13.701 1.00 39.25  ? 700  PHE A CE2   1 
ATOM   3274 C  CZ    . PHE A 1 408 ? -50.649 5.033   -12.466 1.00 38.12  ? 700  PHE A CZ    1 
ATOM   3275 N  N     . PRO A 1 409 ? -52.457 11.694  -15.457 1.00 35.32  ? 701  PRO A N     1 
ATOM   3276 C  CA    . PRO A 1 409 ? -52.434 12.943  -16.238 1.00 34.33  ? 701  PRO A CA    1 
ATOM   3277 C  C     . PRO A 1 409 ? -51.486 14.017  -15.717 1.00 36.14  ? 701  PRO A C     1 
ATOM   3278 O  O     . PRO A 1 409 ? -50.859 14.720  -16.513 1.00 37.61  ? 701  PRO A O     1 
ATOM   3279 C  CB    . PRO A 1 409 ? -53.877 13.458  -16.121 1.00 37.29  ? 701  PRO A CB    1 
ATOM   3280 C  CG    . PRO A 1 409 ? -54.686 12.268  -15.772 1.00 38.50  ? 701  PRO A CG    1 
ATOM   3281 C  CD    . PRO A 1 409 ? -53.800 11.413  -14.916 1.00 32.46  ? 701  PRO A CD    1 
ATOM   3282 N  N     . LYS A 1 410 ? -51.396 14.176  -14.404 1.00 31.02  ? 702  LYS A N     1 
ATOM   3283 C  CA    . LYS A 1 410 ? -50.561 15.242  -13.854 1.00 32.64  ? 702  LYS A CA    1 
ATOM   3284 C  C     . LYS A 1 410 ? -49.060 14.932  -13.902 1.00 33.66  ? 702  LYS A C     1 
ATOM   3285 O  O     . LYS A 1 410 ? -48.241 15.829  -13.726 1.00 30.04  ? 702  LYS A O     1 
ATOM   3286 C  CB    . LYS A 1 410 ? -50.978 15.595  -12.433 1.00 31.18  ? 702  LYS A CB    1 
ATOM   3287 C  CG    . LYS A 1 410 ? -52.177 16.523  -12.340 1.00 41.51  ? 702  LYS A CG    1 
ATOM   3288 C  CD    . LYS A 1 410 ? -52.411 16.946  -10.902 1.00 50.94  ? 702  LYS A CD    1 
ATOM   3289 C  CE    . LYS A 1 410 ? -53.496 18.007  -10.796 1.00 60.56  ? 702  LYS A CE    1 
ATOM   3290 N  NZ    . LYS A 1 410 ? -53.633 18.489  -9.395  1.00 66.70  ? 702  LYS A NZ    1 
ATOM   3291 N  N     . VAL A 1 411 ? -48.700 13.671  -14.131 1.00 31.72  ? 703  VAL A N     1 
ATOM   3292 C  CA    . VAL A 1 411 ? -47.294 13.332  -14.321 1.00 34.53  ? 703  VAL A CA    1 
ATOM   3293 C  C     . VAL A 1 411 ? -46.795 14.003  -15.596 1.00 32.48  ? 703  VAL A C     1 
ATOM   3294 O  O     . VAL A 1 411 ? -45.766 14.662  -15.590 1.00 27.66  ? 703  VAL A O     1 
ATOM   3295 C  CB    . VAL A 1 411 ? -47.042 11.801  -14.383 1.00 30.95  ? 703  VAL A CB    1 
ATOM   3296 C  CG1   . VAL A 1 411 ? -45.612 11.511  -14.820 1.00 30.19  ? 703  VAL A CG1   1 
ATOM   3297 C  CG2   . VAL A 1 411 ? -47.318 11.167  -13.032 1.00 31.27  ? 703  VAL A CG2   1 
ATOM   3298 N  N     . ARG A 1 412 ? -47.537 13.844  -16.689 1.00 28.87  ? 704  ARG A N     1 
ATOM   3299 C  CA    . ARG A 1 412 ? -47.177 14.506  -17.943 1.00 28.94  ? 704  ARG A CA    1 
ATOM   3300 C  C     . ARG A 1 412 ? -47.118 16.031  -17.810 1.00 35.68  ? 704  ARG A C     1 
ATOM   3301 O  O     . ARG A 1 412 ? -46.228 16.677  -18.374 1.00 27.96  ? 704  ARG A O     1 
ATOM   3302 C  CB    . ARG A 1 412 ? -48.152 14.089  -19.049 1.00 43.62  ? 704  ARG A CB    1 
ATOM   3303 C  CG    . ARG A 1 412 ? -47.902 14.727  -20.397 1.00 51.53  ? 704  ARG A CG    1 
ATOM   3304 C  CD    . ARG A 1 412 ? -48.665 13.989  -21.493 1.00 61.17  ? 704  ARG A CD    1 
ATOM   3305 N  NE    . ARG A 1 412 ? -47.918 12.846  -22.014 1.00 66.88  ? 704  ARG A NE    1 
ATOM   3306 C  CZ    . ARG A 1 412 ? -48.429 11.925  -22.829 1.00 66.27  ? 704  ARG A CZ    1 
ATOM   3307 N  NH1   . ARG A 1 412 ? -49.698 12.003  -23.209 1.00 60.82  ? 704  ARG A NH1   1 
ATOM   3308 N  NH2   . ARG A 1 412 ? -47.673 10.922  -23.258 1.00 65.56  ? 704  ARG A NH2   1 
ATOM   3309 N  N     . ALA A 1 413 ? -48.058 16.605  -17.060 1.00 30.89  ? 705  ALA A N     1 
ATOM   3310 C  CA    . ALA A 1 413 ? -48.078 18.046  -16.831 1.00 33.12  ? 705  ALA A CA    1 
ATOM   3311 C  C     . ALA A 1 413 ? -46.828 18.472  -16.076 1.00 32.02  ? 705  ALA A C     1 
ATOM   3312 O  O     . ALA A 1 413 ? -46.237 19.520  -16.365 1.00 29.87  ? 705  ALA A O     1 
ATOM   3313 C  CB    . ALA A 1 413 ? -49.329 18.451  -16.051 1.00 31.79  ? 705  ALA A CB    1 
ATOM   3314 N  N     . TRP A 1 414 ? -46.430 17.654  -15.101 1.00 27.79  ? 706  TRP A N     1 
ATOM   3315 C  CA    . TRP A 1 414 ? -45.210 17.921  -14.342 1.00 30.47  ? 706  TRP A CA    1 
ATOM   3316 C  C     . TRP A 1 414 ? -43.945 17.877  -15.211 1.00 28.80  ? 706  TRP A C     1 
ATOM   3317 O  O     . TRP A 1 414 ? -43.074 18.746  -15.087 1.00 27.22  ? 706  TRP A O     1 
ATOM   3318 C  CB    . TRP A 1 414 ? -45.075 16.953  -13.156 1.00 26.32  ? 706  TRP A CB    1 
ATOM   3319 C  CG    . TRP A 1 414 ? -43.797 17.184  -12.393 1.00 27.88  ? 706  TRP A CG    1 
ATOM   3320 C  CD1   . TRP A 1 414 ? -43.583 18.112  -11.427 1.00 26.53  ? 706  TRP A CD1   1 
ATOM   3321 C  CD2   . TRP A 1 414 ? -42.555 16.491  -12.568 1.00 26.65  ? 706  TRP A CD2   1 
ATOM   3322 N  NE1   . TRP A 1 414 ? -42.287 18.035  -10.973 1.00 26.93  ? 706  TRP A NE1   1 
ATOM   3323 C  CE2   . TRP A 1 414 ? -41.635 17.047  -11.657 1.00 25.59  ? 706  TRP A CE2   1 
ATOM   3324 C  CE3   . TRP A 1 414 ? -42.137 15.445  -13.395 1.00 30.42  ? 706  TRP A CE3   1 
ATOM   3325 C  CZ2   . TRP A 1 414 ? -40.315 16.604  -11.560 1.00 27.57  ? 706  TRP A CZ2   1 
ATOM   3326 C  CZ3   . TRP A 1 414 ? -40.827 14.998  -13.291 1.00 32.40  ? 706  TRP A CZ3   1 
ATOM   3327 C  CH2   . TRP A 1 414 ? -39.934 15.578  -12.385 1.00 26.76  ? 706  TRP A CH2   1 
ATOM   3328 N  N     . ILE A 1 415 ? -43.842 16.871  -16.081 1.00 23.38  ? 707  ILE A N     1 
ATOM   3329 C  CA    . ILE A 1 415 ? -42.699 16.755  -16.991 1.00 24.99  ? 707  ILE A CA    1 
ATOM   3330 C  C     . ILE A 1 415 ? -42.596 18.015  -17.846 1.00 24.15  ? 707  ILE A C     1 
ATOM   3331 O  O     . ILE A 1 415 ? -41.518 18.589  -18.024 1.00 25.28  ? 707  ILE A O     1 
ATOM   3332 C  CB    . ILE A 1 415 ? -42.825 15.515  -17.907 1.00 23.82  ? 707  ILE A CB    1 
ATOM   3333 C  CG1   . ILE A 1 415 ? -42.662 14.225  -17.080 1.00 25.08  ? 707  ILE A CG1   1 
ATOM   3334 C  CG2   . ILE A 1 415 ? -41.802 15.566  -19.051 1.00 26.92  ? 707  ILE A CG2   1 
ATOM   3335 C  CD1   . ILE A 1 415 ? -43.073 12.960  -17.818 1.00 29.75  ? 707  ILE A CD1   1 
ATOM   3336 N  N     . GLU A 1 416 ? -43.739 18.460  -18.348 1.00 25.25  ? 708  GLU A N     1 
ATOM   3337 C  CA    . GLU A 1 416 ? -43.756 19.615  -19.231 1.00 28.91  ? 708  GLU A CA    1 
ATOM   3338 C  C     . GLU A 1 416 ? -43.361 20.893  -18.508 1.00 26.98  ? 708  GLU A C     1 
ATOM   3339 O  O     . GLU A 1 416 ? -42.590 21.691  -19.038 1.00 28.06  ? 708  GLU A O     1 
ATOM   3340 C  CB    . GLU A 1 416 ? -45.122 19.746  -19.908 1.00 34.78  ? 708  GLU A CB    1 
ATOM   3341 C  CG    . GLU A 1 416 ? -45.407 18.596  -20.874 1.00 47.04  ? 708  GLU A CG    1 
ATOM   3342 C  CD    . GLU A 1 416 ? -44.201 18.247  -21.751 1.00 58.02  ? 708  GLU A CD    1 
ATOM   3343 O  OE1   . GLU A 1 416 ? -43.577 19.172  -22.321 1.00 56.51  ? 708  GLU A OE1   1 
ATOM   3344 O  OE2   . GLU A 1 416 ? -43.874 17.044  -21.869 1.00 60.84  ? 708  GLU A OE2   1 
ATOM   3345 N  N     . LYS A 1 417 ? -43.868 21.069  -17.290 1.00 28.15  ? 709  LYS A N     1 
ATOM   3346 C  CA    . LYS A 1 417 ? -43.550 22.253  -16.496 1.00 29.60  ? 709  LYS A CA    1 
ATOM   3347 C  C     . LYS A 1 417 ? -42.076 22.264  -16.126 1.00 22.75  ? 709  LYS A C     1 
ATOM   3348 O  O     . LYS A 1 417 ? -41.431 23.304  -16.085 1.00 24.43  ? 709  LYS A O     1 
ATOM   3349 C  CB    . LYS A 1 417 ? -44.386 22.284  -15.222 1.00 37.86  ? 709  LYS A CB    1 
ATOM   3350 C  CG    . LYS A 1 417 ? -44.076 23.481  -14.337 1.00 55.85  ? 709  LYS A CG    1 
ATOM   3351 C  CD    . LYS A 1 417 ? -44.690 23.354  -12.950 1.00 74.54  ? 709  LYS A CD    1 
ATOM   3352 C  CE    . LYS A 1 417 ? -44.317 24.557  -12.088 1.00 85.57  ? 709  LYS A CE    1 
ATOM   3353 N  NZ    . LYS A 1 417 ? -44.799 24.428  -10.685 1.00 89.24  ? 709  LYS A NZ    1 
ATOM   3354 N  N     . THR A 1 418 ? -41.560 21.083  -15.812 1.00 21.40  ? 710  THR A N     1 
ATOM   3355 C  CA    . THR A 1 418 ? -40.155 20.948  -15.460 1.00 19.24  ? 710  THR A CA    1 
ATOM   3356 C  C     . THR A 1 418 ? -39.271 21.308  -16.646 1.00 25.18  ? 710  THR A C     1 
ATOM   3357 O  O     . THR A 1 418 ? -38.271 21.997  -16.490 1.00 22.02  ? 710  THR A O     1 
ATOM   3358 C  CB    . THR A 1 418 ? -39.863 19.516  -14.948 1.00 23.97  ? 710  THR A CB    1 
ATOM   3359 O  OG1   . THR A 1 418 ? -40.629 19.306  -13.759 1.00 26.61  ? 710  THR A OG1   1 
ATOM   3360 C  CG2   . THR A 1 418 ? -38.363 19.338  -14.657 1.00 25.81  ? 710  THR A CG2   1 
ATOM   3361 N  N     . LEU A 1 419 ? -39.658 20.879  -17.840 1.00 24.22  ? 711  LEU A N     1 
ATOM   3362 C  CA    . LEU A 1 419 ? -38.858 21.206  -19.013 1.00 22.06  ? 711  LEU A CA    1 
ATOM   3363 C  C     . LEU A 1 419 ? -38.980 22.690  -19.342 1.00 24.23  ? 711  LEU A C     1 
ATOM   3364 O  O     . LEU A 1 419 ? -37.994 23.320  -19.707 1.00 21.97  ? 711  LEU A O     1 
ATOM   3365 C  CB    . LEU A 1 419 ? -39.251 20.354  -20.216 1.00 23.34  ? 711  LEU A CB    1 
ATOM   3366 C  CG    . LEU A 1 419 ? -38.986 18.854  -20.050 1.00 26.83  ? 711  LEU A CG    1 
ATOM   3367 C  CD1   . LEU A 1 419 ? -39.422 18.101  -21.303 1.00 28.14  ? 711  LEU A CD1   1 
ATOM   3368 C  CD2   . LEU A 1 419 ? -37.506 18.599  -19.730 1.00 27.34  ? 711  LEU A CD2   1 
ATOM   3369 N  N     . GLU A 1 420 ? -40.184 23.245  -19.203 1.00 23.97  ? 712  GLU A N     1 
ATOM   3370 C  CA    . GLU A 1 420 ? -40.381 24.663  -19.498 1.00 24.85  ? 712  GLU A CA    1 
ATOM   3371 C  C     . GLU A 1 420 ? -39.489 25.541  -18.613 1.00 25.08  ? 712  GLU A C     1 
ATOM   3372 O  O     . GLU A 1 420 ? -38.775 26.418  -19.099 1.00 23.90  ? 712  GLU A O     1 
ATOM   3373 C  CB    . GLU A 1 420 ? -41.860 25.045  -19.359 1.00 29.15  ? 712  GLU A CB    1 
ATOM   3374 C  CG    . GLU A 1 420 ? -42.149 26.515  -19.602 1.00 30.13  ? 712  GLU A CG    1 
ATOM   3375 C  CD    . GLU A 1 420 ? -43.636 26.826  -19.584 1.00 46.32  ? 712  GLU A CD    1 
ATOM   3376 O  OE1   . GLU A 1 420 ? -44.440 25.897  -19.353 1.00 59.44  ? 712  GLU A OE1   1 
ATOM   3377 O  OE2   . GLU A 1 420 ? -44.002 28.000  -19.807 1.00 51.36  ? 712  GLU A OE2   1 
ATOM   3378 N  N     . GLU A 1 421 ? -39.521 25.294  -17.311 1.00 24.77  ? 713  GLU A N     1 
ATOM   3379 C  CA    . GLU A 1 421 ? -38.695 26.048  -16.380 1.00 25.49  ? 713  GLU A CA    1 
ATOM   3380 C  C     . GLU A 1 421 ? -37.196 25.793  -16.579 1.00 22.21  ? 713  GLU A C     1 
ATOM   3381 O  O     . GLU A 1 421 ? -36.386 26.709  -16.453 1.00 26.29  ? 713  GLU A O     1 
ATOM   3382 C  CB    . GLU A 1 421 ? -39.115 25.752  -14.933 1.00 28.91  ? 713  GLU A CB    1 
ATOM   3383 C  CG    . GLU A 1 421 ? -38.360 26.565  -13.889 1.00 31.01  ? 713  GLU A CG    1 
ATOM   3384 C  CD    . GLU A 1 421 ? -38.901 26.352  -12.476 1.00 47.83  ? 713  GLU A CD    1 
ATOM   3385 O  OE1   . GLU A 1 421 ? -39.854 25.559  -12.314 1.00 53.73  ? 713  GLU A OE1   1 
ATOM   3386 O  OE2   . GLU A 1 421 ? -38.374 26.980  -11.530 1.00 38.44  ? 713  GLU A OE2   1 
ATOM   3387 N  N     . GLY A 1 422 ? -36.833 24.553  -16.904 1.00 21.63  ? 714  GLY A N     1 
ATOM   3388 C  CA    . GLY A 1 422 ? -35.446 24.220  -17.192 1.00 21.88  ? 714  GLY A CA    1 
ATOM   3389 C  C     . GLY A 1 422 ? -34.880 24.916  -18.422 1.00 20.98  ? 714  GLY A C     1 
ATOM   3390 O  O     . GLY A 1 422 ? -33.717 25.307  -18.442 1.00 21.84  ? 714  GLY A O     1 
ATOM   3391 N  N     . ARG A 1 423 ? -35.704 25.042  -19.464 1.00 20.90  ? 715  ARG A N     1 
ATOM   3392 C  CA    . ARG A 1 423 ? -35.315 25.797  -20.649 1.00 24.67  ? 715  ARG A CA    1 
ATOM   3393 C  C     . ARG A 1 423 ? -35.059 27.253  -20.260 1.00 26.33  ? 715  ARG A C     1 
ATOM   3394 O  O     . ARG A 1 423 ? -34.121 27.880  -20.754 1.00 25.38  ? 715  ARG A O     1 
ATOM   3395 C  CB    . ARG A 1 423 ? -36.402 25.712  -21.720 1.00 26.69  ? 715  ARG A CB    1 
ATOM   3396 C  CG    . ARG A 1 423 ? -36.548 24.335  -22.374 1.00 24.39  ? 715  ARG A CG    1 
ATOM   3397 C  CD    . ARG A 1 423 ? -37.834 24.244  -23.202 1.00 28.05  ? 715  ARG A CD    1 
ATOM   3398 N  NE    . ARG A 1 423 ? -38.094 22.870  -23.629 1.00 27.75  ? 715  ARG A NE    1 
ATOM   3399 C  CZ    . ARG A 1 423 ? -39.259 22.245  -23.507 1.00 25.72  ? 715  ARG A CZ    1 
ATOM   3400 N  NH1   . ARG A 1 423 ? -40.309 22.866  -22.980 1.00 28.77  ? 715  ARG A NH1   1 
ATOM   3401 N  NH2   . ARG A 1 423 ? -39.377 20.992  -23.924 1.00 34.21  ? 715  ARG A NH2   1 
ATOM   3402 N  N     . ARG A 1 424 ? -35.869 27.779  -19.343 1.00 26.67  ? 716  ARG A N     1 
ATOM   3403 C  CA    . ARG A 1 424 ? -35.701 29.174  -18.917 1.00 27.71  ? 716  ARG A CA    1 
ATOM   3404 C  C     . ARG A 1 424 ? -34.454 29.365  -18.060 1.00 29.49  ? 716  ARG A C     1 
ATOM   3405 O  O     . ARG A 1 424 ? -33.665 30.267  -18.310 1.00 27.33  ? 716  ARG A O     1 
ATOM   3406 C  CB    . ARG A 1 424 ? -36.948 29.713  -18.190 1.00 24.51  ? 716  ARG A CB    1 
ATOM   3407 C  CG    . ARG A 1 424 ? -36.687 31.057  -17.469 1.00 39.24  ? 716  ARG A CG    1 
ATOM   3408 C  CD    . ARG A 1 424 ? -37.954 31.716  -16.877 1.00 38.77  ? 716  ARG A CD    1 
ATOM   3409 N  NE    . ARG A 1 424 ? -38.786 30.838  -16.044 1.00 40.03  ? 716  ARG A NE    1 
ATOM   3410 C  CZ    . ARG A 1 424 ? -38.701 30.729  -14.719 1.00 39.67  ? 716  ARG A CZ    1 
ATOM   3411 N  NH1   . ARG A 1 424 ? -37.789 31.416  -14.048 1.00 36.98  ? 716  ARG A NH1   1 
ATOM   3412 N  NH2   . ARG A 1 424 ? -39.530 29.912  -14.064 1.00 37.13  ? 716  ARG A NH2   1 
ATOM   3413 N  N     . ARG A 1 425 ? -34.270 28.500  -17.061 1.00 22.86  ? 717  ARG A N     1 
ATOM   3414 C  CA    . ARG A 1 425 ? -33.191 28.662  -16.080 1.00 26.58  ? 717  ARG A CA    1 
ATOM   3415 C  C     . ARG A 1 425 ? -31.844 28.052  -16.487 1.00 26.63  ? 717  ARG A C     1 
ATOM   3416 O  O     . ARG A 1 425 ? -30.807 28.511  -16.027 1.00 27.32  ? 717  ARG A O     1 
ATOM   3417 C  CB    . ARG A 1 425 ? -33.610 28.085  -14.713 1.00 29.73  ? 717  ARG A CB    1 
ATOM   3418 C  CG    . ARG A 1 425 ? -34.809 28.782  -14.042 1.00 28.67  ? 717  ARG A CG    1 
ATOM   3419 C  CD    . ARG A 1 425 ? -34.989 28.267  -12.607 1.00 31.53  ? 717  ARG A CD    1 
ATOM   3420 N  NE    . ARG A 1 425 ? -36.305 28.554  -12.031 1.00 42.08  ? 717  ARG A NE    1 
ATOM   3421 C  CZ    . ARG A 1 425 ? -36.621 29.675  -11.379 1.00 45.22  ? 717  ARG A CZ    1 
ATOM   3422 N  NH1   . ARG A 1 425 ? -35.716 30.637  -11.228 1.00 35.14  ? 717  ARG A NH1   1 
ATOM   3423 N  NH2   . ARG A 1 425 ? -37.846 29.838  -10.880 1.00 28.37  ? 717  ARG A NH2   1 
ATOM   3424 N  N     . GLY A 1 426 ? -31.863 27.014  -17.326 1.00 24.41  ? 718  GLY A N     1 
ATOM   3425 C  CA    . GLY A 1 426 ? -30.643 26.320  -17.729 1.00 21.77  ? 718  GLY A CA    1 
ATOM   3426 C  C     . GLY A 1 426 ? -30.308 25.144  -16.818 1.00 25.44  ? 718  GLY A C     1 
ATOM   3427 O  O     . GLY A 1 426 ? -29.326 24.424  -17.024 1.00 23.21  ? 718  GLY A O     1 
ATOM   3428 N  N     . TYR A 1 427 ? -31.140 24.941  -15.799 1.00 21.76  ? 719  TYR A N     1 
ATOM   3429 C  CA    . TYR A 1 427 ? -30.916 23.841  -14.864 1.00 21.57  ? 719  TYR A CA    1 
ATOM   3430 C  C     . TYR A 1 427 ? -32.238 23.340  -14.307 1.00 20.52  ? 719  TYR A C     1 
ATOM   3431 O  O     . TYR A 1 427 ? -33.261 24.018  -14.412 1.00 21.21  ? 719  TYR A O     1 
ATOM   3432 C  CB    . TYR A 1 427 ? -29.972 24.271  -13.725 1.00 22.75  ? 719  TYR A CB    1 
ATOM   3433 C  CG    . TYR A 1 427 ? -30.522 25.366  -12.826 1.00 24.16  ? 719  TYR A CG    1 
ATOM   3434 C  CD1   . TYR A 1 427 ? -31.372 25.063  -11.770 1.00 24.60  ? 719  TYR A CD1   1 
ATOM   3435 C  CD2   . TYR A 1 427 ? -30.183 26.698  -13.028 1.00 32.43  ? 719  TYR A CD2   1 
ATOM   3436 C  CE1   . TYR A 1 427 ? -31.883 26.057  -10.946 1.00 33.01  ? 719  TYR A CE1   1 
ATOM   3437 C  CE2   . TYR A 1 427 ? -30.687 27.702  -12.197 1.00 32.35  ? 719  TYR A CE2   1 
ATOM   3438 C  CZ    . TYR A 1 427 ? -31.541 27.366  -11.162 1.00 39.18  ? 719  TYR A CZ    1 
ATOM   3439 O  OH    . TYR A 1 427 ? -32.061 28.334  -10.328 1.00 43.37  ? 719  TYR A OH    1 
ATOM   3440 N  N     . VAL A 1 428 ? -32.215 22.137  -13.736 1.00 20.51  ? 720  VAL A N     1 
ATOM   3441 C  CA    . VAL A 1 428 ? -33.346 21.642  -12.965 1.00 19.32  ? 720  VAL A CA    1 
ATOM   3442 C  C     . VAL A 1 428 ? -32.908 21.394  -11.525 1.00 18.24  ? 720  VAL A C     1 
ATOM   3443 O  O     . VAL A 1 428 ? -31.711 21.423  -11.221 1.00 20.52  ? 720  VAL A O     1 
ATOM   3444 C  CB    . VAL A 1 428 ? -33.957 20.385  -13.601 1.00 17.29  ? 720  VAL A CB    1 
ATOM   3445 C  CG1   . VAL A 1 428 ? -34.596 20.756  -14.948 1.00 22.23  ? 720  VAL A CG1   1 
ATOM   3446 C  CG2   . VAL A 1 428 ? -32.881 19.312  -13.806 1.00 19.95  ? 720  VAL A CG2   1 
ATOM   3447 N  N     . GLU A 1 429 ? -33.875 21.194  -10.637 1.00 20.19  ? 721  GLU A N     1 
ATOM   3448 C  CA    A GLU A 1 429 ? -33.609 21.112  -9.195  0.58 21.49  ? 721  GLU A CA    1 
ATOM   3449 C  CA    B GLU A 1 429 ? -33.560 21.056  -9.221  0.42 21.31  ? 721  GLU A CA    1 
ATOM   3450 C  C     . GLU A 1 429 ? -34.407 20.006  -8.524  1.00 22.09  ? 721  GLU A C     1 
ATOM   3451 O  O     . GLU A 1 429 ? -35.518 19.695  -8.952  1.00 24.21  ? 721  GLU A O     1 
ATOM   3452 C  CB    A GLU A 1 429 ? -33.960 22.434  -8.497  0.58 21.74  ? 721  GLU A CB    1 
ATOM   3453 C  CB    B GLU A 1 429 ? -33.719 22.397  -8.511  0.42 22.33  ? 721  GLU A CB    1 
ATOM   3454 C  CG    A GLU A 1 429 ? -33.003 23.586  -8.761  0.58 21.08  ? 721  GLU A CG    1 
ATOM   3455 C  CG    B GLU A 1 429 ? -35.090 23.005  -8.691  0.42 18.32  ? 721  GLU A CG    1 
ATOM   3456 C  CD    A GLU A 1 429 ? -33.315 24.810  -7.916  0.58 33.00  ? 721  GLU A CD    1 
ATOM   3457 C  CD    B GLU A 1 429 ? -35.236 24.332  -7.971  0.42 32.77  ? 721  GLU A CD    1 
ATOM   3458 O  OE1   A GLU A 1 429 ? -34.410 24.860  -7.320  0.58 37.75  ? 721  GLU A OE1   1 
ATOM   3459 O  OE1   B GLU A 1 429 ? -34.215 25.038  -7.804  0.42 36.03  ? 721  GLU A OE1   1 
ATOM   3460 O  OE2   A GLU A 1 429 ? -32.462 25.718  -7.840  0.58 31.29  ? 721  GLU A OE2   1 
ATOM   3461 O  OE2   B GLU A 1 429 ? -36.372 24.664  -7.571  0.42 34.95  ? 721  GLU A OE2   1 
ATOM   3462 N  N     . THR A 1 430 ? -33.853 19.451  -7.444  1.00 19.35  ? 722  THR A N     1 
ATOM   3463 C  CA    . THR A 1 430 ? -34.582 18.518  -6.601  1.00 16.70  ? 722  THR A CA    1 
ATOM   3464 C  C     . THR A 1 430 ? -35.478 19.330  -5.658  1.00 23.85  ? 722  THR A C     1 
ATOM   3465 O  O     . THR A 1 430 ? -35.429 20.564  -5.647  1.00 23.26  ? 722  THR A O     1 
ATOM   3466 C  CB    . THR A 1 430 ? -33.622 17.698  -5.722  1.00 17.20  ? 722  THR A CB    1 
ATOM   3467 O  OG1   . THR A 1 430 ? -32.968 18.575  -4.802  1.00 20.29  ? 722  THR A OG1   1 
ATOM   3468 C  CG2   . THR A 1 430 ? -32.569 16.966  -6.583  1.00 18.45  ? 722  THR A CG2   1 
ATOM   3469 N  N     . LEU A 1 431 ? -36.259 18.629  -4.841  1.00 20.47  ? 723  LEU A N     1 
ATOM   3470 C  CA    . LEU A 1 431 ? -37.116 19.266  -3.831  1.00 19.59  ? 723  LEU A CA    1 
ATOM   3471 C  C     . LEU A 1 431 ? -36.343 20.214  -2.907  1.00 25.45  ? 723  LEU A C     1 
ATOM   3472 O  O     . LEU A 1 431 ? -36.859 21.274  -2.507  1.00 23.21  ? 723  LEU A O     1 
ATOM   3473 C  CB    . LEU A 1 431 ? -37.821 18.188  -3.005  1.00 24.23  ? 723  LEU A CB    1 
ATOM   3474 C  CG    . LEU A 1 431 ? -38.847 18.646  -1.961  1.00 25.74  ? 723  LEU A CG    1 
ATOM   3475 C  CD1   . LEU A 1 431 ? -39.989 19.417  -2.611  1.00 32.58  ? 723  LEU A CD1   1 
ATOM   3476 C  CD2   . LEU A 1 431 ? -39.388 17.447  -1.208  1.00 31.47  ? 723  LEU A CD2   1 
ATOM   3477 N  N     . PHE A 1 432 ? -35.110 19.834  -2.566  1.00 23.77  ? 724  PHE A N     1 
ATOM   3478 C  CA    . PHE A 1 432 ? -34.280 20.631  -1.661  1.00 18.69  ? 724  PHE A CA    1 
ATOM   3479 C  C     . PHE A 1 432 ? -33.426 21.660  -2.390  1.00 22.80  ? 724  PHE A C     1 
ATOM   3480 O  O     . PHE A 1 432 ? -32.716 22.440  -1.749  1.00 27.63  ? 724  PHE A O     1 
ATOM   3481 C  CB    . PHE A 1 432 ? -33.356 19.719  -0.838  1.00 20.18  ? 724  PHE A CB    1 
ATOM   3482 C  CG    . PHE A 1 432 ? -34.075 18.830  0.139   1.00 27.61  ? 724  PHE A CG    1 
ATOM   3483 C  CD1   . PHE A 1 432 ? -35.345 19.147  0.597   1.00 32.16  ? 724  PHE A CD1   1 
ATOM   3484 C  CD2   . PHE A 1 432 ? -33.457 17.696  0.636   1.00 40.33  ? 724  PHE A CD2   1 
ATOM   3485 C  CE1   . PHE A 1 432 ? -35.993 18.330  1.504   1.00 35.88  ? 724  PHE A CE1   1 
ATOM   3486 C  CE2   . PHE A 1 432 ? -34.098 16.880  1.552   1.00 38.98  ? 724  PHE A CE2   1 
ATOM   3487 C  CZ    . PHE A 1 432 ? -35.371 17.199  1.980   1.00 38.44  ? 724  PHE A CZ    1 
ATOM   3488 N  N     . GLY A 1 433 ? -33.473 21.660  -3.722  1.00 20.46  ? 725  GLY A N     1 
ATOM   3489 C  CA    . GLY A 1 433 ? -32.740 22.653  -4.486  1.00 20.99  ? 725  GLY A CA    1 
ATOM   3490 C  C     . GLY A 1 433 ? -31.366 22.256  -4.998  1.00 24.74  ? 725  GLY A C     1 
ATOM   3491 O  O     . GLY A 1 433 ? -30.618 23.109  -5.475  1.00 22.53  ? 725  GLY A O     1 
ATOM   3492 N  N     . ARG A 1 434 ? -31.031 20.967  -4.919  1.00 22.20  ? 726  ARG A N     1 
ATOM   3493 C  CA    . ARG A 1 434 ? -29.822 20.466  -5.580  1.00 19.96  ? 726  ARG A CA    1 
ATOM   3494 C  C     . ARG A 1 434 ? -30.022 20.642  -7.085  1.00 22.34  ? 726  ARG A C     1 
ATOM   3495 O  O     . ARG A 1 434 ? -31.086 20.324  -7.595  1.00 19.81  ? 726  ARG A O     1 
ATOM   3496 C  CB    . ARG A 1 434 ? -29.574 18.978  -5.257  1.00 18.43  ? 726  ARG A CB    1 
ATOM   3497 C  CG    . ARG A 1 434 ? -28.255 18.477  -5.815  1.00 22.86  ? 726  ARG A CG    1 
ATOM   3498 C  CD    . ARG A 1 434 ? -28.018 16.988  -5.523  1.00 22.34  ? 726  ARG A CD    1 
ATOM   3499 N  NE    . ARG A 1 434 ? -28.087 16.702  -4.095  1.00 24.21  ? 726  ARG A NE    1 
ATOM   3500 C  CZ    . ARG A 1 434 ? -27.068 16.846  -3.250  1.00 27.29  ? 726  ARG A CZ    1 
ATOM   3501 N  NH1   . ARG A 1 434 ? -25.887 17.268  -3.687  1.00 26.18  ? 726  ARG A NH1   1 
ATOM   3502 N  NH2   . ARG A 1 434 ? -27.228 16.557  -1.961  1.00 26.28  ? 726  ARG A NH2   1 
ATOM   3503 N  N     . ARG A 1 435 ? -29.005 21.142  -7.785  1.00 17.03  ? 727  ARG A N     1 
ATOM   3504 C  CA    . ARG A 1 435 ? -29.116 21.525  -9.199  1.00 19.23  ? 727  ARG A CA    1 
ATOM   3505 C  C     . ARG A 1 435 ? -28.336 20.634  -10.141 1.00 26.44  ? 727  ARG A C     1 
ATOM   3506 O  O     . ARG A 1 435 ? -27.228 20.218  -9.823  1.00 26.91  ? 727  ARG A O     1 
ATOM   3507 C  CB    . ARG A 1 435 ? -28.529 22.917  -9.407  1.00 24.42  ? 727  ARG A CB    1 
ATOM   3508 C  CG    . ARG A 1 435 ? -29.445 24.043  -9.141  1.00 34.17  ? 727  ARG A CG    1 
ATOM   3509 C  CD    . ARG A 1 435 ? -28.702 25.360  -9.310  1.00 32.30  ? 727  ARG A CD    1 
ATOM   3510 N  NE    . ARG A 1 435 ? -29.354 26.382  -8.507  1.00 39.31  ? 727  ARG A NE    1 
ATOM   3511 C  CZ    . ARG A 1 435 ? -28.818 27.558  -8.217  1.00 43.98  ? 727  ARG A CZ    1 
ATOM   3512 N  NH1   . ARG A 1 435 ? -27.610 27.867  -8.672  1.00 40.44  ? 727  ARG A NH1   1 
ATOM   3513 N  NH2   . ARG A 1 435 ? -29.495 28.416  -7.471  1.00 41.57  ? 727  ARG A NH2   1 
ATOM   3514 N  N     . ARG A 1 436 ? -28.907 20.373  -11.313 1.00 19.52  ? 728  ARG A N     1 
ATOM   3515 C  CA    . ARG A 1 436 ? -28.157 19.803  -12.430 1.00 19.07  ? 728  ARG A CA    1 
ATOM   3516 C  C     . ARG A 1 436 ? -28.318 20.711  -13.642 1.00 19.93  ? 728  ARG A C     1 
ATOM   3517 O  O     . ARG A 1 436 ? -29.449 21.044  -14.035 1.00 21.27  ? 728  ARG A O     1 
ATOM   3518 C  CB    . ARG A 1 436 ? -28.643 18.390  -12.800 1.00 22.15  ? 728  ARG A CB    1 
ATOM   3519 C  CG    . ARG A 1 436 ? -27.740 17.735  -13.846 1.00 27.64  ? 728  ARG A CG    1 
ATOM   3520 C  CD    . ARG A 1 436 ? -28.153 16.309  -14.276 1.00 26.11  ? 728  ARG A CD    1 
ATOM   3521 N  NE    . ARG A 1 436 ? -27.119 15.753  -15.156 1.00 28.87  ? 728  ARG A NE    1 
ATOM   3522 C  CZ    . ARG A 1 436 ? -27.184 14.582  -15.789 1.00 31.75  ? 728  ARG A CZ    1 
ATOM   3523 N  NH1   . ARG A 1 436 ? -28.240 13.795  -15.663 1.00 27.13  ? 728  ARG A NH1   1 
ATOM   3524 N  NH2   . ARG A 1 436 ? -26.176 14.197  -16.555 1.00 33.25  ? 728  ARG A NH2   1 
ATOM   3525 N  N     . TYR A 1 437 ? -27.197 21.118  -14.230 1.00 25.05  ? 729  TYR A N     1 
ATOM   3526 C  CA    . TYR A 1 437 ? -27.241 21.995  -15.401 1.00 22.75  ? 729  TYR A CA    1 
ATOM   3527 C  C     . TYR A 1 437 ? -27.530 21.209  -16.665 1.00 23.14  ? 729  TYR A C     1 
ATOM   3528 O  O     . TYR A 1 437 ? -26.969 20.137  -16.880 1.00 27.89  ? 729  TYR A O     1 
ATOM   3529 C  CB    . TYR A 1 437 ? -25.936 22.789  -15.521 1.00 23.81  ? 729  TYR A CB    1 
ATOM   3530 C  CG    . TYR A 1 437 ? -25.879 23.872  -14.479 1.00 23.55  ? 729  TYR A CG    1 
ATOM   3531 C  CD1   . TYR A 1 437 ? -25.435 23.609  -13.191 1.00 31.31  ? 729  TYR A CD1   1 
ATOM   3532 C  CD2   . TYR A 1 437 ? -26.334 25.156  -14.771 1.00 27.52  ? 729  TYR A CD2   1 
ATOM   3533 C  CE1   . TYR A 1 437 ? -25.419 24.613  -12.226 1.00 27.27  ? 729  TYR A CE1   1 
ATOM   3534 C  CE2   . TYR A 1 437 ? -26.318 26.153  -13.824 1.00 30.49  ? 729  TYR A CE2   1 
ATOM   3535 C  CZ    . TYR A 1 437 ? -25.860 25.882  -12.560 1.00 30.97  ? 729  TYR A CZ    1 
ATOM   3536 O  OH    . TYR A 1 437 ? -25.856 26.890  -11.628 1.00 31.08  ? 729  TYR A OH    1 
ATOM   3537 N  N     . VAL A 1 438 ? -28.430 21.741  -17.490 1.00 23.80  ? 730  VAL A N     1 
ATOM   3538 C  CA    . VAL A 1 438 ? -28.868 21.047  -18.704 1.00 26.98  ? 730  VAL A CA    1 
ATOM   3539 C  C     . VAL A 1 438 ? -28.917 22.005  -19.905 1.00 26.48  ? 730  VAL A C     1 
ATOM   3540 O  O     . VAL A 1 438 ? -29.996 22.318  -20.427 1.00 26.78  ? 730  VAL A O     1 
ATOM   3541 C  CB    . VAL A 1 438 ? -30.234 20.328  -18.511 1.00 26.45  ? 730  VAL A CB    1 
ATOM   3542 C  CG1   . VAL A 1 438 ? -30.043 19.009  -17.774 1.00 29.31  ? 730  VAL A CG1   1 
ATOM   3543 C  CG2   . VAL A 1 438 ? -31.227 21.206  -17.762 1.00 32.97  ? 730  VAL A CG2   1 
ATOM   3544 N  N     . PRO A 1 439 ? -27.739 22.458  -20.352 1.00 29.08  ? 731  PRO A N     1 
ATOM   3545 C  CA    . PRO A 1 439 ? -27.641 23.483  -21.395 1.00 29.74  ? 731  PRO A CA    1 
ATOM   3546 C  C     . PRO A 1 439 ? -28.157 23.000  -22.747 1.00 31.61  ? 731  PRO A C     1 
ATOM   3547 O  O     . PRO A 1 439 ? -28.573 23.829  -23.554 1.00 31.78  ? 731  PRO A O     1 
ATOM   3548 C  CB    . PRO A 1 439 ? -26.136 23.781  -21.458 1.00 30.63  ? 731  PRO A CB    1 
ATOM   3549 C  CG    . PRO A 1 439 ? -25.491 22.540  -20.968 1.00 35.01  ? 731  PRO A CG    1 
ATOM   3550 C  CD    . PRO A 1 439 ? -26.409 22.016  -19.895 1.00 27.99  ? 731  PRO A CD    1 
ATOM   3551 N  N     . ASP A 1 440 ? -28.162 21.692  -22.984 1.00 28.24  ? 732  ASP A N     1 
ATOM   3552 C  CA    . ASP A 1 440 ? -28.637 21.182  -24.270 1.00 28.71  ? 732  ASP A CA    1 
ATOM   3553 C  C     . ASP A 1 440 ? -30.170 21.212  -24.452 1.00 25.57  ? 732  ASP A C     1 
ATOM   3554 O  O     . ASP A 1 440 ? -30.676 20.826  -25.506 1.00 28.84  ? 732  ASP A O     1 
ATOM   3555 C  CB    . ASP A 1 440 ? -28.065 19.783  -24.563 1.00 35.30  ? 732  ASP A CB    1 
ATOM   3556 C  CG    . ASP A 1 440 ? -26.594 19.821  -24.978 1.00 46.50  ? 732  ASP A CG    1 
ATOM   3557 O  OD1   . ASP A 1 440 ? -26.068 20.925  -25.229 1.00 42.08  ? 732  ASP A OD1   1 
ATOM   3558 O  OD2   . ASP A 1 440 ? -25.969 18.740  -25.073 1.00 42.05  ? 732  ASP A OD2   1 
ATOM   3559 N  N     . LEU A 1 441 ? -30.911 21.684  -23.451 1.00 26.12  ? 733  LEU A N     1 
ATOM   3560 C  CA    . LEU A 1 441 ? -32.351 21.897  -23.630 1.00 25.48  ? 733  LEU A CA    1 
ATOM   3561 C  C     . LEU A 1 441 ? -32.612 22.853  -24.792 1.00 27.54  ? 733  LEU A C     1 
ATOM   3562 O  O     . LEU A 1 441 ? -33.672 22.810  -25.410 1.00 26.92  ? 733  LEU A O     1 
ATOM   3563 C  CB    . LEU A 1 441 ? -33.008 22.443  -22.359 1.00 21.98  ? 733  LEU A CB    1 
ATOM   3564 C  CG    . LEU A 1 441 ? -33.167 21.443  -21.210 1.00 24.50  ? 733  LEU A CG    1 
ATOM   3565 C  CD1   . LEU A 1 441 ? -33.973 22.044  -20.071 1.00 28.93  ? 733  LEU A CD1   1 
ATOM   3566 C  CD2   . LEU A 1 441 ? -33.831 20.164  -21.686 1.00 28.50  ? 733  LEU A CD2   1 
ATOM   3567 N  N     . GLU A 1 442 ? -31.640 23.708  -25.094 1.00 26.37  ? 734  GLU A N     1 
ATOM   3568 C  CA    . GLU A 1 442 ? -31.798 24.637  -26.212 1.00 30.49  ? 734  GLU A CA    1 
ATOM   3569 C  C     . GLU A 1 442 ? -31.040 24.215  -27.477 1.00 36.46  ? 734  GLU A C     1 
ATOM   3570 O  O     . GLU A 1 442 ? -30.882 25.013  -28.401 1.00 34.89  ? 734  GLU A O     1 
ATOM   3571 C  CB    . GLU A 1 442 ? -31.430 26.061  -25.775 1.00 42.88  ? 734  GLU A CB    1 
ATOM   3572 C  CG    . GLU A 1 442 ? -32.421 26.637  -24.757 1.00 52.96  ? 734  GLU A CG    1 
ATOM   3573 C  CD    . GLU A 1 442 ? -31.993 27.978  -24.193 1.00 66.16  ? 734  GLU A CD    1 
ATOM   3574 O  OE1   . GLU A 1 442 ? -30.788 28.153  -23.911 1.00 65.88  ? 734  GLU A OE1   1 
ATOM   3575 O  OE2   . GLU A 1 442 ? -32.866 28.859  -24.031 1.00 73.34  ? 734  GLU A OE2   1 
ATOM   3576 N  N     . ALA A 1 443 ? -30.598 22.959  -27.532 1.00 31.89  ? 735  ALA A N     1 
ATOM   3577 C  CA    . ALA A 1 443 ? -29.874 22.460  -28.710 1.00 34.65  ? 735  ALA A CA    1 
ATOM   3578 C  C     . ALA A 1 443 ? -30.789 22.361  -29.935 1.00 37.56  ? 735  ALA A C     1 
ATOM   3579 O  O     . ALA A 1 443 ? -31.980 22.090  -29.804 1.00 35.30  ? 735  ALA A O     1 
ATOM   3580 C  CB    . ALA A 1 443 ? -29.238 21.111  -28.416 1.00 32.51  ? 735  ALA A CB    1 
ATOM   3581 N  N     . ARG A 1 444 ? -30.238 22.587  -31.126 1.00 38.59  ? 736  ARG A N     1 
ATOM   3582 C  CA    . ARG A 1 444 ? -31.044 22.511  -32.346 1.00 39.72  ? 736  ARG A CA    1 
ATOM   3583 C  C     . ARG A 1 444 ? -31.125 21.092  -32.892 1.00 34.45  ? 736  ARG A C     1 
ATOM   3584 O  O     . ARG A 1 444 ? -32.141 20.697  -33.458 1.00 40.80  ? 736  ARG A O     1 
ATOM   3585 C  CB    . ARG A 1 444 ? -30.530 23.476  -33.423 1.00 43.07  ? 736  ARG A CB    1 
ATOM   3586 C  CG    . ARG A 1 444 ? -30.774 24.945  -33.103 1.00 43.44  ? 736  ARG A CG    1 
ATOM   3587 C  CD    . ARG A 1 444 ? -30.720 25.800  -34.355 1.00 51.63  ? 736  ARG A CD    1 
ATOM   3588 N  NE    . ARG A 1 444 ? -30.704 27.224  -34.043 1.00 57.09  ? 736  ARG A NE    1 
ATOM   3589 C  CZ    . ARG A 1 444 ? -30.589 28.182  -34.956 1.00 73.28  ? 736  ARG A CZ    1 
ATOM   3590 N  NH1   . ARG A 1 444 ? -30.480 27.865  -36.239 1.00 78.68  ? 736  ARG A NH1   1 
ATOM   3591 N  NH2   . ARG A 1 444 ? -30.582 29.456  -34.588 1.00 79.53  ? 736  ARG A NH2   1 
ATOM   3592 N  N     . VAL A 1 445 ? -30.055 20.325  -32.723 1.00 37.12  ? 737  VAL A N     1 
ATOM   3593 C  CA    . VAL A 1 445 ? -30.070 18.923  -33.122 1.00 39.96  ? 737  VAL A CA    1 
ATOM   3594 C  C     . VAL A 1 445 ? -31.070 18.143  -32.262 1.00 40.85  ? 737  VAL A C     1 
ATOM   3595 O  O     . VAL A 1 445 ? -30.967 18.132  -31.033 1.00 38.13  ? 737  VAL A O     1 
ATOM   3596 C  CB    . VAL A 1 445 ? -28.682 18.286  -33.001 1.00 39.69  ? 737  VAL A CB    1 
ATOM   3597 C  CG1   . VAL A 1 445 ? -28.761 16.798  -33.307 1.00 41.66  ? 737  VAL A CG1   1 
ATOM   3598 C  CG2   . VAL A 1 445 ? -27.700 18.982  -33.928 1.00 44.63  ? 737  VAL A CG2   1 
ATOM   3599 N  N     . LYS A 1 446 ? -32.028 17.492  -32.917 1.00 35.48  ? 738  LYS A N     1 
ATOM   3600 C  CA    . LYS A 1 446 ? -33.165 16.870  -32.239 1.00 38.28  ? 738  LYS A CA    1 
ATOM   3601 C  C     . LYS A 1 446 ? -32.765 15.818  -31.203 1.00 38.47  ? 738  LYS A C     1 
ATOM   3602 O  O     . LYS A 1 446 ? -33.246 15.847  -30.067 1.00 29.12  ? 738  LYS A O     1 
ATOM   3603 C  CB    . LYS A 1 446 ? -34.136 16.263  -33.260 1.00 35.08  ? 738  LYS A CB    1 
ATOM   3604 C  CG    . LYS A 1 446 ? -35.427 15.722  -32.663 1.00 33.18  ? 738  LYS A CG    1 
ATOM   3605 C  CD    . LYS A 1 446 ? -36.377 15.229  -33.758 1.00 38.94  ? 738  LYS A CD    1 
ATOM   3606 C  CE    . LYS A 1 446 ? -37.658 14.632  -33.188 1.00 44.03  ? 738  LYS A CE    1 
ATOM   3607 N  NZ    . LYS A 1 446 ? -37.425 13.268  -32.624 1.00 44.19  ? 738  LYS A NZ    1 
ATOM   3608 N  N     . SER A 1 447 ? -31.881 14.901  -31.591 1.00 32.19  ? 739  SER A N     1 
ATOM   3609 C  CA    . SER A 1 447 ? -31.444 13.843  -30.685 1.00 33.40  ? 739  SER A CA    1 
ATOM   3610 C  C     . SER A 1 447 ? -30.681 14.403  -29.478 1.00 30.49  ? 739  SER A C     1 
ATOM   3611 O  O     . SER A 1 447 ? -30.783 13.870  -28.375 1.00 31.97  ? 739  SER A O     1 
ATOM   3612 C  CB    . SER A 1 447 ? -30.572 12.824  -31.425 1.00 43.45  ? 739  SER A CB    1 
ATOM   3613 O  OG    . SER A 1 447 ? -29.359 13.411  -31.876 1.00 40.41  ? 739  SER A OG    1 
ATOM   3614 N  N     . VAL A 1 448 ? -29.918 15.470  -29.701 1.00 34.36  ? 740  VAL A N     1 
ATOM   3615 C  CA    . VAL A 1 448 ? -29.142 16.109  -28.641 1.00 37.04  ? 740  VAL A CA    1 
ATOM   3616 C  C     . VAL A 1 448 ? -30.051 16.828  -27.653 1.00 30.43  ? 740  VAL A C     1 
ATOM   3617 O  O     . VAL A 1 448 ? -29.874 16.719  -26.439 1.00 29.09  ? 740  VAL A O     1 
ATOM   3618 C  CB    . VAL A 1 448 ? -28.131 17.121  -29.212 1.00 36.02  ? 740  VAL A CB    1 
ATOM   3619 C  CG1   . VAL A 1 448 ? -27.484 17.932  -28.100 1.00 33.20  ? 740  VAL A CG1   1 
ATOM   3620 C  CG2   . VAL A 1 448 ? -27.076 16.407  -30.059 1.00 38.88  ? 740  VAL A CG2   1 
ATOM   3621 N  N     . ARG A 1 449 ? -31.013 17.580  -28.181 1.00 26.31  ? 741  ARG A N     1 
ATOM   3622 C  CA    . ARG A 1 449 ? -31.969 18.289  -27.341 1.00 25.92  ? 741  ARG A CA    1 
ATOM   3623 C  C     . ARG A 1 449 ? -32.827 17.317  -26.552 1.00 25.95  ? 741  ARG A C     1 
ATOM   3624 O  O     . ARG A 1 449 ? -33.098 17.531  -25.371 1.00 24.55  ? 741  ARG A O     1 
ATOM   3625 C  CB    . ARG A 1 449 ? -32.864 19.200  -28.190 1.00 27.31  ? 741  ARG A CB    1 
ATOM   3626 C  CG    . ARG A 1 449 ? -33.931 19.975  -27.410 1.00 23.96  ? 741  ARG A CG    1 
ATOM   3627 C  CD    . ARG A 1 449 ? -34.738 20.912  -28.349 1.00 21.36  ? 741  ARG A CD    1 
ATOM   3628 N  NE    . ARG A 1 449 ? -35.469 20.145  -29.363 1.00 29.39  ? 741  ARG A NE    1 
ATOM   3629 C  CZ    . ARG A 1 449 ? -35.077 19.986  -30.629 1.00 33.70  ? 741  ARG A CZ    1 
ATOM   3630 N  NH1   . ARG A 1 449 ? -33.962 20.559  -31.069 1.00 27.45  ? 741  ARG A NH1   1 
ATOM   3631 N  NH2   . ARG A 1 449 ? -35.812 19.257  -31.461 1.00 30.83  ? 741  ARG A NH2   1 
ATOM   3632 N  N     . GLU A 1 450 ? -33.247 16.238  -27.197 1.00 24.80  ? 742  GLU A N     1 
ATOM   3633 C  CA    . GLU A 1 450 ? -34.188 15.335  -26.558 1.00 29.46  ? 742  GLU A CA    1 
ATOM   3634 C  C     . GLU A 1 450 ? -33.506 14.541  -25.453 1.00 25.69  ? 742  GLU A C     1 
ATOM   3635 O  O     . GLU A 1 450 ? -34.129 14.240  -24.435 1.00 25.24  ? 742  GLU A O     1 
ATOM   3636 C  CB    . GLU A 1 450 ? -34.880 14.425  -27.578 1.00 33.54  ? 742  GLU A CB    1 
ATOM   3637 C  CG    . GLU A 1 450 ? -35.992 15.154  -28.350 1.00 28.19  ? 742  GLU A CG    1 
ATOM   3638 C  CD    . GLU A 1 450 ? -36.757 14.248  -29.297 1.00 43.72  ? 742  GLU A CD    1 
ATOM   3639 O  OE1   . GLU A 1 450 ? -36.350 13.081  -29.475 1.00 47.74  ? 742  GLU A OE1   1 
ATOM   3640 O  OE2   . GLU A 1 450 ? -37.773 14.710  -29.855 1.00 44.06  ? 742  GLU A OE2   1 
ATOM   3641 N  N     . ALA A 1 451 ? -32.228 14.224  -25.652 1.00 26.24  ? 743  ALA A N     1 
ATOM   3642 C  CA    . ALA A 1 451 ? -31.454 13.545  -24.609 1.00 32.36  ? 743  ALA A CA    1 
ATOM   3643 C  C     . ALA A 1 451 ? -31.352 14.436  -23.375 1.00 27.67  ? 743  ALA A C     1 
ATOM   3644 O  O     . ALA A 1 451 ? -31.420 13.958  -22.247 1.00 27.16  ? 743  ALA A O     1 
ATOM   3645 C  CB    . ALA A 1 451 ? -30.069 13.185  -25.118 1.00 32.78  ? 743  ALA A CB    1 
ATOM   3646 N  N     . ALA A 1 452 ? -31.185 15.735  -23.596 1.00 23.26  ? 744  ALA A N     1 
ATOM   3647 C  CA    . ALA A 1 452 ? -31.113 16.692  -22.490 1.00 23.37  ? 744  ALA A CA    1 
ATOM   3648 C  C     . ALA A 1 452 ? -32.431 16.736  -21.713 1.00 27.59  ? 744  ALA A C     1 
ATOM   3649 O  O     . ALA A 1 452 ? -32.432 16.835  -20.485 1.00 23.92  ? 744  ALA A O     1 
ATOM   3650 C  CB    . ALA A 1 452 ? -30.758 18.073  -23.007 1.00 28.53  ? 744  ALA A CB    1 
ATOM   3651 N  N     . GLU A 1 453 ? -33.548 16.682  -22.435 1.00 24.46  ? 745  GLU A N     1 
ATOM   3652 C  CA    . GLU A 1 453 ? -34.868 16.689  -21.808 1.00 23.54  ? 745  GLU A CA    1 
ATOM   3653 C  C     . GLU A 1 453 ? -35.043 15.495  -20.883 1.00 24.35  ? 745  GLU A C     1 
ATOM   3654 O  O     . GLU A 1 453 ? -35.546 15.633  -19.767 1.00 23.98  ? 745  GLU A O     1 
ATOM   3655 C  CB    . GLU A 1 453 ? -35.980 16.688  -22.860 1.00 21.32  ? 745  GLU A CB    1 
ATOM   3656 C  CG    . GLU A 1 453 ? -35.975 17.948  -23.723 1.00 22.78  ? 745  GLU A CG    1 
ATOM   3657 C  CD    . GLU A 1 453 ? -37.035 17.947  -24.797 1.00 30.37  ? 745  GLU A CD    1 
ATOM   3658 O  OE1   . GLU A 1 453 ? -37.587 16.867  -25.101 1.00 35.90  ? 745  GLU A OE1   1 
ATOM   3659 O  OE2   . GLU A 1 453 ? -37.314 19.041  -25.345 1.00 32.61  ? 745  GLU A OE2   1 
ATOM   3660 N  N     . ARG A 1 454 ? -34.640 14.323  -21.360 1.00 22.75  ? 746  ARG A N     1 
ATOM   3661 C  CA    . ARG A 1 454 ? -34.791 13.106  -20.551 1.00 23.17  ? 746  ARG A CA    1 
ATOM   3662 C  C     . ARG A 1 454 ? -33.948 13.160  -19.265 1.00 24.38  ? 746  ARG A C     1 
ATOM   3663 O  O     . ARG A 1 454 ? -34.415 12.758  -18.191 1.00 27.28  ? 746  ARG A O     1 
ATOM   3664 C  CB    . ARG A 1 454 ? -34.495 11.869  -21.397 1.00 24.50  ? 746  ARG A CB    1 
ATOM   3665 C  CG    . ARG A 1 454 ? -35.513 11.700  -22.525 1.00 26.59  ? 746  ARG A CG    1 
ATOM   3666 C  CD    . ARG A 1 454 ? -35.356 10.364  -23.259 1.00 29.11  ? 746  ARG A CD    1 
ATOM   3667 N  NE    . ARG A 1 454 ? -33.970 10.124  -23.654 1.00 32.60  ? 746  ARG A NE    1 
ATOM   3668 C  CZ    . ARG A 1 454 ? -33.457 10.402  -24.848 1.00 30.56  ? 746  ARG A CZ    1 
ATOM   3669 N  NH1   . ARG A 1 454 ? -34.208 10.937  -25.812 1.00 32.14  ? 746  ARG A NH1   1 
ATOM   3670 N  NH2   . ARG A 1 454 ? -32.180 10.141  -25.082 1.00 32.91  ? 746  ARG A NH2   1 
ATOM   3671 N  N     . LYS A 1 455 ? -32.719 13.661  -19.378 1.00 22.76  ? 747  LYS A N     1 
ATOM   3672 C  CA    . LYS A 1 455 ? -31.898 13.941  -18.193 1.00 23.31  ? 747  LYS A CA    1 
ATOM   3673 C  C     . LYS A 1 455 ? -32.620 14.914  -17.260 1.00 27.02  ? 747  LYS A C     1 
ATOM   3674 O  O     . LYS A 1 455 ? -32.696 14.689  -16.045 1.00 24.89  ? 747  LYS A O     1 
ATOM   3675 C  CB    . LYS A 1 455 ? -30.541 14.543  -18.587 1.00 24.71  ? 747  LYS A CB    1 
ATOM   3676 C  CG    . LYS A 1 455 ? -29.606 13.607  -19.321 1.00 30.72  ? 747  LYS A CG    1 
ATOM   3677 C  CD    . LYS A 1 455 ? -28.234 14.254  -19.475 1.00 35.57  ? 747  LYS A CD    1 
ATOM   3678 C  CE    . LYS A 1 455 ? -27.261 13.358  -20.219 1.00 43.08  ? 747  LYS A CE    1 
ATOM   3679 N  NZ    . LYS A 1 455 ? -27.675 13.175  -21.633 1.00 49.83  ? 747  LYS A NZ    1 
ATOM   3680 N  N     . ALA A 1 456 ? -33.159 15.987  -17.839 1.00 23.68  ? 748  ALA A N     1 
ATOM   3681 C  CA    . ALA A 1 456 ? -33.737 17.073  -17.067 1.00 20.94  ? 748  ALA A CA    1 
ATOM   3682 C  C     . ALA A 1 456 ? -34.937 16.668  -16.221 1.00 27.89  ? 748  ALA A C     1 
ATOM   3683 O  O     . ALA A 1 456 ? -35.062 17.117  -15.092 1.00 29.60  ? 748  ALA A O     1 
ATOM   3684 C  CB    . ALA A 1 456 ? -34.122 18.265  -17.986 1.00 21.54  ? 748  ALA A CB    1 
ATOM   3685 N  N     . PHE A 1 457 ? -35.848 15.855  -16.748 1.00 22.34  ? 749  PHE A N     1 
ATOM   3686 C  CA    . PHE A 1 457 ? -37.011 15.547  -15.925 1.00 24.13  ? 749  PHE A CA    1 
ATOM   3687 C  C     . PHE A 1 457 ? -36.797 14.318  -15.039 1.00 24.77  ? 749  PHE A C     1 
ATOM   3688 O  O     . PHE A 1 457 ? -37.543 14.114  -14.086 1.00 31.09  ? 749  PHE A O     1 
ATOM   3689 C  CB    . PHE A 1 457 ? -38.341 15.523  -16.704 1.00 28.80  ? 749  PHE A CB    1 
ATOM   3690 C  CG    . PHE A 1 457 ? -38.536 14.319  -17.577 1.00 29.65  ? 749  PHE A CG    1 
ATOM   3691 C  CD1   . PHE A 1 457 ? -39.054 13.145  -17.054 1.00 33.05  ? 749  PHE A CD1   1 
ATOM   3692 C  CD2   . PHE A 1 457 ? -38.262 14.383  -18.938 1.00 36.82  ? 749  PHE A CD2   1 
ATOM   3693 C  CE1   . PHE A 1 457 ? -39.255 12.046  -17.866 1.00 37.65  ? 749  PHE A CE1   1 
ATOM   3694 C  CE2   . PHE A 1 457 ? -38.464 13.288  -19.754 1.00 43.34  ? 749  PHE A CE2   1 
ATOM   3695 C  CZ    . PHE A 1 457 ? -38.960 12.118  -19.216 1.00 34.04  ? 749  PHE A CZ    1 
ATOM   3696 N  N     . ASN A 1 458 ? -35.744 13.549  -15.326 1.00 22.58  ? 750  ASN A N     1 
ATOM   3697 C  CA    . ASN A 1 458 ? -35.374 12.416  -14.461 1.00 23.44  ? 750  ASN A CA    1 
ATOM   3698 C  C     . ASN A 1 458 ? -34.645 12.873  -13.196 1.00 25.37  ? 750  ASN A C     1 
ATOM   3699 O  O     . ASN A 1 458 ? -34.829 12.312  -12.109 1.00 24.64  ? 750  ASN A O     1 
ATOM   3700 C  CB    . ASN A 1 458 ? -34.506 11.412  -15.224 1.00 26.38  ? 750  ASN A CB    1 
ATOM   3701 C  CG    . ASN A 1 458 ? -35.319 10.311  -15.880 1.00 41.19  ? 750  ASN A CG    1 
ATOM   3702 O  OD1   . ASN A 1 458 ? -35.590 9.282   -15.259 1.00 52.39  ? 750  ASN A OD1   1 
ATOM   3703 N  ND2   . ASN A 1 458 ? -35.700 10.510  -17.146 1.00 30.28  ? 750  ASN A ND2   1 
ATOM   3704 N  N     A MET A 1 459 ? -33.819 13.899  -13.323 0.80 20.04  ? 751  MET A N     1 
ATOM   3705 N  N     B MET A 1 459 ? -33.819 13.902  -13.352 0.20 21.48  ? 751  MET A N     1 
ATOM   3706 C  CA    A MET A 1 459 ? -33.001 14.313  -12.178 0.80 20.13  ? 751  MET A CA    1 
ATOM   3707 C  CA    B MET A 1 459 ? -32.996 14.429  -12.260 0.20 21.97  ? 751  MET A CA    1 
ATOM   3708 C  C     A MET A 1 459 ? -33.772 14.728  -10.899 0.80 21.06  ? 751  MET A C     1 
ATOM   3709 C  C     B MET A 1 459 ? -33.743 14.761  -10.951 0.20 21.43  ? 751  MET A C     1 
ATOM   3710 O  O     A MET A 1 459 ? -33.416 14.280  -9.800  0.80 21.59  ? 751  MET A O     1 
ATOM   3711 O  O     B MET A 1 459 ? -33.344 14.287  -9.885  0.20 22.75  ? 751  MET A O     1 
ATOM   3712 C  CB    A MET A 1 459 ? -31.969 15.363  -12.598 0.80 22.83  ? 751  MET A CB    1 
ATOM   3713 C  CB    B MET A 1 459 ? -32.162 15.625  -12.745 0.20 23.43  ? 751  MET A CB    1 
ATOM   3714 C  CG    A MET A 1 459 ? -30.993 15.760  -11.500 0.80 22.14  ? 751  MET A CG    1 
ATOM   3715 C  CG    B MET A 1 459 ? -31.570 16.469  -11.632 0.20 25.76  ? 751  MET A CG    1 
ATOM   3716 S  SD    A MET A 1 459 ? -31.570 17.229  -10.618 0.80 21.13  ? 751  MET A SD    1 
ATOM   3717 S  SD    B MET A 1 459 ? -30.411 15.527  -10.631 0.20 29.11  ? 751  MET A SD    1 
ATOM   3718 C  CE    A MET A 1 459 ? -30.238 17.455  -9.434  0.80 21.20  ? 751  MET A CE    1 
ATOM   3719 C  CE    B MET A 1 459 ? -29.788 16.797  -9.530  0.20 22.74  ? 751  MET A CE    1 
ATOM   3720 N  N     . PRO A 1 460 ? -34.820 15.569  -11.019 1.00 20.67  ? 752  PRO A N     1 
ATOM   3721 C  CA    . PRO A 1 460 ? -35.512 15.952  -9.777  1.00 20.49  ? 752  PRO A CA    1 
ATOM   3722 C  C     . PRO A 1 460 ? -36.075 14.778  -8.972  1.00 21.47  ? 752  PRO A C     1 
ATOM   3723 O  O     . PRO A 1 460 ? -36.093 14.852  -7.745  1.00 23.22  ? 752  PRO A O     1 
ATOM   3724 C  CB    . PRO A 1 460 ? -36.667 16.831  -10.275 1.00 24.38  ? 752  PRO A CB    1 
ATOM   3725 C  CG    . PRO A 1 460 ? -36.142 17.420  -11.546 1.00 24.03  ? 752  PRO A CG    1 
ATOM   3726 C  CD    . PRO A 1 460 ? -35.380 16.298  -12.179 1.00 21.12  ? 752  PRO A CD    1 
ATOM   3727 N  N     . VAL A 1 461 ? -36.510 13.721  -9.649  1.00 20.39  ? 753  VAL A N     1 
ATOM   3728 C  CA    . VAL A 1 461 ? -37.075 12.562  -8.962  1.00 21.25  ? 753  VAL A CA    1 
ATOM   3729 C  C     . VAL A 1 461 ? -35.961 11.750  -8.303  1.00 22.04  ? 753  VAL A C     1 
ATOM   3730 O  O     . VAL A 1 461 ? -35.982 11.535  -7.095  1.00 18.90  ? 753  VAL A O     1 
ATOM   3731 C  CB    . VAL A 1 461 ? -37.908 11.676  -9.917  1.00 22.97  ? 753  VAL A CB    1 
ATOM   3732 C  CG1   . VAL A 1 461 ? -38.439 10.440  -9.183  1.00 28.30  ? 753  VAL A CG1   1 
ATOM   3733 C  CG2   . VAL A 1 461 ? -39.072 12.479  -10.501 1.00 24.46  ? 753  VAL A CG2   1 
ATOM   3734 N  N     . GLN A 1 462 ? -34.985 11.311  -9.094  1.00 19.12  ? 754  GLN A N     1 
ATOM   3735 C  CA    . GLN A 1 462 ? -33.871 10.516  -8.552  1.00 18.70  ? 754  GLN A CA    1 
ATOM   3736 C  C     . GLN A 1 462 ? -33.082 11.284  -7.502  1.00 18.12  ? 754  GLN A C     1 
ATOM   3737 O  O     . GLN A 1 462 ? -32.720 10.717  -6.465  1.00 21.54  ? 754  GLN A O     1 
ATOM   3738 C  CB    . GLN A 1 462 ? -32.912 10.060  -9.659  1.00 21.99  ? 754  GLN A CB    1 
ATOM   3739 C  CG    . GLN A 1 462 ? -33.544 9.262   -10.766 1.00 31.51  ? 754  GLN A CG    1 
ATOM   3740 C  CD    . GLN A 1 462 ? -32.514 8.802   -11.789 1.00 44.22  ? 754  GLN A CD    1 
ATOM   3741 O  OE1   . GLN A 1 462 ? -31.655 9.577   -12.218 1.00 40.10  ? 754  GLN A OE1   1 
ATOM   3742 N  NE2   . GLN A 1 462 ? -32.593 7.536   -12.175 1.00 38.35  ? 754  GLN A NE2   1 
ATOM   3743 N  N     . GLY A 1 463 ? -32.835 12.576  -7.749  1.00 19.17  ? 755  GLY A N     1 
ATOM   3744 C  CA    . GLY A 1 463 ? -32.047 13.380  -6.836  1.00 19.23  ? 755  GLY A CA    1 
ATOM   3745 C  C     . GLY A 1 463 ? -32.767 13.665  -5.530  1.00 18.90  ? 755  GLY A C     1 
ATOM   3746 O  O     . GLY A 1 463 ? -32.141 13.734  -4.470  1.00 20.64  ? 755  GLY A O     1 
ATOM   3747 N  N     . THR A 1 464 ? -34.089 13.831  -5.589  1.00 19.55  ? 756  THR A N     1 
ATOM   3748 C  CA    . THR A 1 464 ? -34.866 14.051  -4.365  1.00 16.71  ? 756  THR A CA    1 
ATOM   3749 C  C     . THR A 1 464 ? -34.856 12.790  -3.500  1.00 18.65  ? 756  THR A C     1 
ATOM   3750 O  O     . THR A 1 464 ? -34.680 12.869  -2.297  1.00 19.10  ? 756  THR A O     1 
ATOM   3751 C  CB    . THR A 1 464 ? -36.329 14.463  -4.649  1.00 19.75  ? 756  THR A CB    1 
ATOM   3752 O  OG1   . THR A 1 464 ? -36.358 15.740  -5.306  1.00 18.88  ? 756  THR A OG1   1 
ATOM   3753 C  CG2   . THR A 1 464 ? -37.117 14.570  -3.326  1.00 19.66  ? 756  THR A CG2   1 
ATOM   3754 N  N     . ALA A 1 465 ? -35.018 11.629  -4.135  1.00 15.87  ? 757  ALA A N     1 
ATOM   3755 C  CA    . ALA A 1 465 ? -34.930 10.348  -3.427  1.00 18.47  ? 757  ALA A CA    1 
ATOM   3756 C  C     . ALA A 1 465 ? -33.564 10.206  -2.735  1.00 20.23  ? 757  ALA A C     1 
ATOM   3757 O  O     . ALA A 1 465 ? -33.477 9.747   -1.583  1.00 18.75  ? 757  ALA A O     1 
ATOM   3758 C  CB    . ALA A 1 465 ? -35.155 9.208   -4.397  1.00 21.31  ? 757  ALA A CB    1 
ATOM   3759 N  N     . ALA A 1 466 ? -32.504 10.606  -3.438  1.00 19.62  ? 758  ALA A N     1 
ATOM   3760 C  CA    . ALA A 1 466 ? -31.147 10.507  -2.890  1.00 22.89  ? 758  ALA A CA    1 
ATOM   3761 C  C     . ALA A 1 466 ? -30.974 11.490  -1.736  1.00 19.66  ? 758  ALA A C     1 
ATOM   3762 O  O     . ALA A 1 466 ? -30.360 11.163  -0.715  1.00 18.74  ? 758  ALA A O     1 
ATOM   3763 C  CB    . ALA A 1 466 ? -30.104 10.761  -3.977  1.00 24.20  ? 758  ALA A CB    1 
ATOM   3764 N  N     . ASP A 1 467 ? -31.530 12.689  -1.899  1.00 20.55  ? 759  ASP A N     1 
ATOM   3765 C  CA    . ASP A 1 467 ? -31.466 13.726  -0.863  1.00 21.72  ? 759  ASP A CA    1 
ATOM   3766 C  C     . ASP A 1 467 ? -32.123 13.225  0.418   1.00 18.02  ? 759  ASP A C     1 
ATOM   3767 O  O     . ASP A 1 467 ? -31.634 13.479  1.528   1.00 19.24  ? 759  ASP A O     1 
ATOM   3768 C  CB    . ASP A 1 467 ? -32.241 14.977  -1.301  1.00 19.77  ? 759  ASP A CB    1 
ATOM   3769 C  CG    . ASP A 1 467 ? -31.486 15.857  -2.295  1.00 30.57  ? 759  ASP A CG    1 
ATOM   3770 O  OD1   . ASP A 1 467 ? -30.249 15.780  -2.365  1.00 25.93  ? 759  ASP A OD1   1 
ATOM   3771 O  OD2   . ASP A 1 467 ? -32.161 16.661  -2.991  1.00 26.27  ? 759  ASP A OD2   1 
ATOM   3772 N  N     . LEU A 1 468 ? -33.253 12.543  0.256   1.00 19.54  ? 760  LEU A N     1 
ATOM   3773 C  CA    . LEU A 1 468 ? -34.009 12.032  1.395   1.00 17.52  ? 760  LEU A CA    1 
ATOM   3774 C  C     . LEU A 1 468 ? -33.219 10.973  2.156   1.00 17.46  ? 760  LEU A C     1 
ATOM   3775 O  O     . LEU A 1 468 ? -33.153 11.018  3.387   1.00 18.05  ? 760  LEU A O     1 
ATOM   3776 C  CB    . LEU A 1 468 ? -35.360 11.466  0.958   1.00 20.52  ? 760  LEU A CB    1 
ATOM   3777 C  CG    . LEU A 1 468 ? -36.321 12.559  0.451   1.00 22.23  ? 760  LEU A CG    1 
ATOM   3778 C  CD1   . LEU A 1 468 ? -37.551 11.958  -0.195  1.00 21.33  ? 760  LEU A CD1   1 
ATOM   3779 C  CD2   . LEU A 1 468 ? -36.705 13.519  1.580   1.00 23.60  ? 760  LEU A CD2   1 
ATOM   3780 N  N     . MET A 1 469 ? -32.626 10.025  1.430   1.00 18.31  ? 761  MET A N     1 
ATOM   3781 C  CA    . MET A 1 469 ? -31.777 9.013   2.083   1.00 17.67  ? 761  MET A CA    1 
ATOM   3782 C  C     . MET A 1 469 ? -30.610 9.667   2.841   1.00 19.40  ? 761  MET A C     1 
ATOM   3783 O  O     . MET A 1 469 ? -30.308 9.300   3.979   1.00 18.58  ? 761  MET A O     1 
ATOM   3784 C  CB    . MET A 1 469 ? -31.257 7.994   1.057   1.00 19.91  ? 761  MET A CB    1 
ATOM   3785 C  CG    . MET A 1 469 ? -30.228 6.995   1.611   1.00 23.57  ? 761  MET A CG    1 
ATOM   3786 S  SD    . MET A 1 469 ? -30.909 5.931   2.922   1.00 27.15  ? 761  MET A SD    1 
ATOM   3787 C  CE    . MET A 1 469 ? -31.718 4.642   1.965   1.00 27.23  ? 761  MET A CE    1 
ATOM   3788 N  N     . LYS A 1 470 ? -29.952 10.639  2.220   1.00 16.61  ? 762  LYS A N     1 
ATOM   3789 C  CA    . LYS A 1 470 ? -28.799 11.276  2.849   1.00 15.34  ? 762  LYS A CA    1 
ATOM   3790 C  C     . LYS A 1 470 ? -29.193 12.003  4.130   1.00 17.29  ? 762  LYS A C     1 
ATOM   3791 O  O     . LYS A 1 470 ? -28.522 11.902  5.163   1.00 19.76  ? 762  LYS A O     1 
ATOM   3792 C  CB    . LYS A 1 470 ? -28.148 12.277  1.891   1.00 18.53  ? 762  LYS A CB    1 
ATOM   3793 C  CG    . LYS A 1 470 ? -27.352 11.640  0.744   1.00 21.50  ? 762  LYS A CG    1 
ATOM   3794 C  CD    . LYS A 1 470 ? -26.844 12.776  -0.139  1.00 30.69  ? 762  LYS A CD    1 
ATOM   3795 C  CE    . LYS A 1 470 ? -25.826 12.334  -1.142  1.00 46.93  ? 762  LYS A CE    1 
ATOM   3796 N  NZ    . LYS A 1 470 ? -25.548 13.461  -2.081  1.00 38.82  ? 762  LYS A NZ    1 
ATOM   3797 N  N     . LEU A 1 471 ? -30.296 12.735  4.064   1.00 18.40  ? 763  LEU A N     1 
ATOM   3798 C  CA    . LEU A 1 471 ? -30.799 13.430  5.247   1.00 17.14  ? 763  LEU A CA    1 
ATOM   3799 C  C     . LEU A 1 471 ? -31.192 12.446  6.336   1.00 19.74  ? 763  LEU A C     1 
ATOM   3800 O  O     . LEU A 1 471 ? -30.954 12.697  7.513   1.00 19.74  ? 763  LEU A O     1 
ATOM   3801 C  CB    . LEU A 1 471 ? -32.003 14.308  4.884   1.00 20.59  ? 763  LEU A CB    1 
ATOM   3802 C  CG    . LEU A 1 471 ? -32.553 15.194  6.000   1.00 24.88  ? 763  LEU A CG    1 
ATOM   3803 C  CD1   . LEU A 1 471 ? -31.483 16.117  6.539   1.00 23.23  ? 763  LEU A CD1   1 
ATOM   3804 C  CD2   . LEU A 1 471 ? -33.754 16.005  5.483   1.00 27.87  ? 763  LEU A CD2   1 
ATOM   3805 N  N     . ALA A 1 472 ? -31.806 11.335  5.951   1.00 17.70  ? 764  ALA A N     1 
ATOM   3806 C  CA    . ALA A 1 472 ? -32.144 10.308  6.937   1.00 18.00  ? 764  ALA A CA    1 
ATOM   3807 C  C     . ALA A 1 472 ? -30.882 9.780   7.625   1.00 18.55  ? 764  ALA A C     1 
ATOM   3808 O  O     . ALA A 1 472 ? -30.871 9.597   8.848   1.00 20.96  ? 764  ALA A O     1 
ATOM   3809 C  CB    . ALA A 1 472 ? -32.922 9.157   6.283   1.00 20.30  ? 764  ALA A CB    1 
ATOM   3810 N  N     . MET A 1 473 ? -29.814 9.548   6.849   1.00 16.75  ? 765  MET A N     1 
ATOM   3811 C  CA    . MET A 1 473 ? -28.549 9.071   7.429   1.00 16.95  ? 765  MET A CA    1 
ATOM   3812 C  C     . MET A 1 473 ? -28.011 10.060  8.447   1.00 18.74  ? 765  MET A C     1 
ATOM   3813 O  O     . MET A 1 473 ? -27.619 9.686   9.554   1.00 18.44  ? 765  MET A O     1 
ATOM   3814 C  CB    . MET A 1 473 ? -27.503 8.798   6.340   1.00 17.06  ? 765  MET A CB    1 
ATOM   3815 C  CG    . MET A 1 473 ? -27.935 7.664   5.411   1.00 15.21  ? 765  MET A CG    1 
ATOM   3816 S  SD    . MET A 1 473 ? -26.939 7.536   3.904   1.00 19.20  ? 765  MET A SD    1 
ATOM   3817 C  CE    . MET A 1 473 ? -25.361 6.975   4.576   1.00 18.28  ? 765  MET A CE    1 
ATOM   3818 N  N     . VAL A 1 474 ? -28.017 11.328  8.069   1.00 18.38  ? 766  VAL A N     1 
ATOM   3819 C  CA    . VAL A 1 474 ? -27.568 12.393  8.948   1.00 16.03  ? 766  VAL A CA    1 
ATOM   3820 C  C     . VAL A 1 474 ? -28.412 12.452  10.225  1.00 16.88  ? 766  VAL A C     1 
ATOM   3821 O  O     . VAL A 1 474 ? -27.878 12.635  11.321  1.00 21.54  ? 766  VAL A O     1 
ATOM   3822 C  CB    . VAL A 1 474 ? -27.611 13.741  8.208   1.00 17.45  ? 766  VAL A CB    1 
ATOM   3823 C  CG1   . VAL A 1 474 ? -27.452 14.907  9.185   1.00 20.62  ? 766  VAL A CG1   1 
ATOM   3824 C  CG2   . VAL A 1 474 ? -26.509 13.772  7.151   1.00 18.27  ? 766  VAL A CG2   1 
ATOM   3825 N  N     . LYS A 1 475 ? -29.718 12.285  10.087  1.00 18.86  ? 767  LYS A N     1 
ATOM   3826 C  CA    . LYS A 1 475 ? -30.596 12.350  11.257  1.00 19.39  ? 767  LYS A CA    1 
ATOM   3827 C  C     . LYS A 1 475 ? -30.450 11.126  12.138  1.00 27.28  ? 767  LYS A C     1 
ATOM   3828 O  O     . LYS A 1 475 ? -30.563 11.210  13.359  1.00 22.65  ? 767  LYS A O     1 
ATOM   3829 C  CB    . LYS A 1 475 ? -32.057 12.499  10.831  1.00 21.31  ? 767  LYS A CB    1 
ATOM   3830 C  CG    . LYS A 1 475 ? -32.371 13.872  10.242  1.00 27.88  ? 767  LYS A CG    1 
ATOM   3831 C  CD    . LYS A 1 475 ? -33.861 14.026  9.967   1.00 36.44  ? 767  LYS A CD    1 
ATOM   3832 C  CE    . LYS A 1 475 ? -34.182 15.417  9.415   1.00 43.11  ? 767  LYS A CE    1 
ATOM   3833 N  NZ    . LYS A 1 475 ? -35.655 15.625  9.299   1.00 48.19  ? 767  LYS A NZ    1 
ATOM   3834 N  N     . LEU A 1 476 ? -30.189 9.982   11.520  1.00 21.04  ? 768  LEU A N     1 
ATOM   3835 C  CA    . LEU A 1 476 ? -30.138 8.731   12.276  1.00 20.42  ? 768  LEU A CA    1 
ATOM   3836 C  C     . LEU A 1 476 ? -28.817 8.518   13.018  1.00 25.15  ? 768  LEU A C     1 
ATOM   3837 O  O     . LEU A 1 476 ? -28.797 7.971   14.130  1.00 20.57  ? 768  LEU A O     1 
ATOM   3838 C  CB    . LEU A 1 476 ? -30.415 7.558   11.335  1.00 21.48  ? 768  LEU A CB    1 
ATOM   3839 C  CG    . LEU A 1 476 ? -30.419 6.145   11.921  1.00 28.30  ? 768  LEU A CG    1 
ATOM   3840 C  CD1   . LEU A 1 476 ? -31.442 5.997   13.055  1.00 25.89  ? 768  LEU A CD1   1 
ATOM   3841 C  CD2   . LEU A 1 476 ? -30.695 5.147   10.799  1.00 26.80  ? 768  LEU A CD2   1 
ATOM   3842 N  N     . PHE A 1 477 ? -27.719 8.938   12.398  1.00 23.25  ? 769  PHE A N     1 
ATOM   3843 C  CA    . PHE A 1 477 ? -26.385 8.580   12.886  1.00 24.47  ? 769  PHE A CA    1 
ATOM   3844 C  C     . PHE A 1 477 ? -26.107 8.880   14.384  1.00 25.83  ? 769  PHE A C     1 
ATOM   3845 O  O     . PHE A 1 477 ? -25.692 7.969   15.114  1.00 21.84  ? 769  PHE A O     1 
ATOM   3846 C  CB    . PHE A 1 477 ? -25.293 9.144   11.968  1.00 22.17  ? 769  PHE A CB    1 
ATOM   3847 C  CG    . PHE A 1 477 ? -23.907 8.824   12.426  1.00 23.20  ? 769  PHE A CG    1 
ATOM   3848 C  CD1   . PHE A 1 477 ? -23.446 7.517   12.396  1.00 24.83  ? 769  PHE A CD1   1 
ATOM   3849 C  CD2   . PHE A 1 477 ? -23.074 9.821   12.899  1.00 31.05  ? 769  PHE A CD2   1 
ATOM   3850 C  CE1   . PHE A 1 477 ? -22.167 7.211   12.831  1.00 34.27  ? 769  PHE A CE1   1 
ATOM   3851 C  CE2   . PHE A 1 477 ? -21.794 9.519   13.325  1.00 37.94  ? 769  PHE A CE2   1 
ATOM   3852 C  CZ    . PHE A 1 477 ? -21.346 8.210   13.289  1.00 29.75  ? 769  PHE A CZ    1 
ATOM   3853 N  N     . PRO A 1 478 ? -26.364 10.124  14.855  1.00 24.68  ? 770  PRO A N     1 
ATOM   3854 C  CA    . PRO A 1 478 ? -26.071 10.420  16.269  1.00 25.33  ? 770  PRO A CA    1 
ATOM   3855 C  C     . PRO A 1 478 ? -26.889 9.572   17.237  1.00 25.61  ? 770  PRO A C     1 
ATOM   3856 O  O     . PRO A 1 478 ? -26.372 9.181   18.283  1.00 28.92  ? 770  PRO A O     1 
ATOM   3857 C  CB    . PRO A 1 478 ? -26.485 11.892  16.426  1.00 28.77  ? 770  PRO A CB    1 
ATOM   3858 C  CG    . PRO A 1 478 ? -26.467 12.445  15.036  1.00 30.44  ? 770  PRO A CG    1 
ATOM   3859 C  CD    . PRO A 1 478 ? -26.872 11.314  14.144  1.00 24.55  ? 770  PRO A CD    1 
ATOM   3860 N  N     . ARG A 1 479 ? -28.142 9.284   16.902  1.00 25.91  ? 771  ARG A N     1 
ATOM   3861 C  CA    . ARG A 1 479 ? -28.955 8.451   17.777  1.00 33.32  ? 771  ARG A CA    1 
ATOM   3862 C  C     . ARG A 1 479 ? -28.510 6.987   17.772  1.00 32.29  ? 771  ARG A C     1 
ATOM   3863 O  O     . ARG A 1 479 ? -28.578 6.307   18.800  1.00 27.41  ? 771  ARG A O     1 
ATOM   3864 C  CB    . ARG A 1 479 ? -30.440 8.599   17.453  1.00 37.16  ? 771  ARG A CB    1 
ATOM   3865 C  CG    . ARG A 1 479 ? -31.107 9.644   18.355  1.00 45.51  ? 771  ARG A CG    1 
ATOM   3866 C  CD    . ARG A 1 479 ? -32.524 9.929   17.942  1.00 46.37  ? 771  ARG A CD    1 
ATOM   3867 N  NE    . ARG A 1 479 ? -32.563 10.716  16.716  1.00 57.59  ? 771  ARG A NE    1 
ATOM   3868 C  CZ    . ARG A 1 479 ? -33.669 10.957  16.019  1.00 55.25  ? 771  ARG A CZ    1 
ATOM   3869 N  NH1   . ARG A 1 479 ? -34.834 10.455  16.420  1.00 45.46  ? 771  ARG A NH1   1 
ATOM   3870 N  NH2   . ARG A 1 479 ? -33.604 11.694  14.915  1.00 47.30  ? 771  ARG A NH2   1 
ATOM   3871 N  N     . LEU A 1 480 ? -28.044 6.511   16.622  1.00 29.63  ? 772  LEU A N     1 
ATOM   3872 C  CA    . LEU A 1 480 ? -27.442 5.183   16.543  1.00 33.20  ? 772  LEU A CA    1 
ATOM   3873 C  C     . LEU A 1 480 ? -26.237 5.080   17.460  1.00 27.42  ? 772  LEU A C     1 
ATOM   3874 O  O     . LEU A 1 480 ? -26.107 4.124   18.230  1.00 28.20  ? 772  LEU A O     1 
ATOM   3875 C  CB    . LEU A 1 480 ? -26.976 4.881   15.116  1.00 32.45  ? 772  LEU A CB    1 
ATOM   3876 C  CG    . LEU A 1 480 ? -27.970 4.302   14.126  1.00 35.13  ? 772  LEU A CG    1 
ATOM   3877 C  CD1   . LEU A 1 480 ? -27.215 3.978   12.844  1.00 27.74  ? 772  LEU A CD1   1 
ATOM   3878 C  CD2   . LEU A 1 480 ? -28.625 3.067   14.700  1.00 25.24  ? 772  LEU A CD2   1 
ATOM   3879 N  N     . GLU A 1 481 ? -25.337 6.054   17.350  1.00 24.53  ? 773  GLU A N     1 
ATOM   3880 C  CA    . GLU A 1 481 ? -24.118 6.060   18.151  1.00 33.74  ? 773  GLU A CA    1 
ATOM   3881 C  C     . GLU A 1 481 ? -24.429 6.061   19.644  1.00 35.88  ? 773  GLU A C     1 
ATOM   3882 O  O     . GLU A 1 481 ? -23.722 5.426   20.433  1.00 32.96  ? 773  GLU A O     1 
ATOM   3883 C  CB    . GLU A 1 481 ? -23.222 7.247   17.785  1.00 43.85  ? 773  GLU A CB    1 
ATOM   3884 C  CG    . GLU A 1 481 ? -22.213 6.942   16.681  1.00 48.48  ? 773  GLU A CG    1 
ATOM   3885 C  CD    . GLU A 1 481 ? -21.072 7.953   16.635  1.00 59.27  ? 773  GLU A CD    1 
ATOM   3886 O  OE1   . GLU A 1 481 ? -21.323 9.153   16.883  1.00 52.06  ? 773  GLU A OE1   1 
ATOM   3887 O  OE2   . GLU A 1 481 ? -19.920 7.545   16.361  1.00 64.96  ? 773  GLU A OE2   1 
ATOM   3888 N  N     . GLU A 1 482 ? -25.505 6.748   20.018  1.00 38.45  ? 774  GLU A N     1 
ATOM   3889 C  CA    . GLU A 1 482 ? -25.960 6.790   21.409  1.00 38.44  ? 774  GLU A CA    1 
ATOM   3890 C  C     . GLU A 1 482 ? -26.391 5.422   21.916  1.00 42.82  ? 774  GLU A C     1 
ATOM   3891 O  O     . GLU A 1 482 ? -26.350 5.161   23.116  1.00 41.80  ? 774  GLU A O     1 
ATOM   3892 C  CB    . GLU A 1 482 ? -27.128 7.762   21.565  1.00 40.64  ? 774  GLU A CB    1 
ATOM   3893 C  CG    . GLU A 1 482 ? -26.750 9.229   21.486  1.00 50.65  ? 774  GLU A CG    1 
ATOM   3894 C  CD    . GLU A 1 482 ? -27.965 10.132  21.343  1.00 61.65  ? 774  GLU A CD    1 
ATOM   3895 O  OE1   . GLU A 1 482 ? -29.100 9.645   21.548  1.00 61.67  ? 774  GLU A OE1   1 
ATOM   3896 O  OE2   . GLU A 1 482 ? -27.786 11.327  21.016  1.00 67.88  ? 774  GLU A OE2   1 
ATOM   3897 N  N     . MET A 1 483 ? -26.831 4.559   21.007  1.00 33.25  ? 775  MET A N     1 
ATOM   3898 C  CA    . MET A 1 483 ? -27.289 3.219   21.384  1.00 31.57  ? 775  MET A CA    1 
ATOM   3899 C  C     . MET A 1 483 ? -26.196 2.166   21.217  1.00 32.00  ? 775  MET A C     1 
ATOM   3900 O  O     . MET A 1 483 ? -26.438 0.979   21.425  1.00 36.47  ? 775  MET A O     1 
ATOM   3901 C  CB    . MET A 1 483 ? -28.499 2.808   20.550  1.00 34.27  ? 775  MET A CB    1 
ATOM   3902 C  CG    . MET A 1 483 ? -29.675 3.750   20.641  1.00 49.29  ? 775  MET A CG    1 
ATOM   3903 S  SD    . MET A 1 483 ? -31.008 3.209   19.559  1.00 52.03  ? 775  MET A SD    1 
ATOM   3904 C  CE    . MET A 1 483 ? -31.536 1.716   20.387  1.00 47.88  ? 775  MET A CE    1 
ATOM   3905 N  N     . GLY A 1 484 ? -25.002 2.596   20.823  1.00 27.06  ? 776  GLY A N     1 
ATOM   3906 C  CA    . GLY A 1 484 ? -23.890 1.676   20.669  1.00 28.44  ? 776  GLY A CA    1 
ATOM   3907 C  C     . GLY A 1 484 ? -23.995 0.877   19.389  1.00 21.76  ? 776  GLY A C     1 
ATOM   3908 O  O     . GLY A 1 484 ? -23.419 -0.206  19.286  1.00 22.34  ? 776  GLY A O     1 
ATOM   3909 N  N     . ALA A 1 485 ? -24.745 1.409   18.422  1.00 21.86  ? 777  ALA A N     1 
ATOM   3910 C  CA    . ALA A 1 485 ? -24.900 0.754   17.118  1.00 25.93  ? 777  ALA A CA    1 
ATOM   3911 C  C     . ALA A 1 485 ? -24.056 1.437   16.034  1.00 20.50  ? 777  ALA A C     1 
ATOM   3912 O  O     . ALA A 1 485 ? -23.489 2.504   16.256  1.00 21.57  ? 777  ALA A O     1 
ATOM   3913 C  CB    . ALA A 1 485 ? -26.368 0.729   16.712  1.00 21.54  ? 777  ALA A CB    1 
ATOM   3914 N  N     . ARG A 1 486 ? -23.988 0.812   14.861  1.00 19.06  ? 778  ARG A N     1 
ATOM   3915 C  CA    . ARG A 1 486 ? -23.132 1.295   13.777  1.00 18.94  ? 778  ARG A CA    1 
ATOM   3916 C  C     . ARG A 1 486 ? -23.957 1.398   12.512  1.00 21.72  ? 778  ARG A C     1 
ATOM   3917 O  O     . ARG A 1 486 ? -24.922 0.667   12.339  1.00 19.01  ? 778  ARG A O     1 
ATOM   3918 C  CB    . ARG A 1 486 ? -22.003 0.295   13.517  1.00 17.72  ? 778  ARG A CB    1 
ATOM   3919 C  CG    . ARG A 1 486 ? -21.069 0.079   14.695  1.00 21.97  ? 778  ARG A CG    1 
ATOM   3920 C  CD    . ARG A 1 486 ? -20.358 -1.254  14.538  1.00 19.17  ? 778  ARG A CD    1 
ATOM   3921 N  NE    . ARG A 1 486 ? -19.396 -1.476  15.616  1.00 23.01  ? 778  ARG A NE    1 
ATOM   3922 C  CZ    . ARG A 1 486 ? -18.807 -2.648  15.849  1.00 31.82  ? 778  ARG A CZ    1 
ATOM   3923 N  NH1   . ARG A 1 486 ? -19.102 -3.698  15.094  1.00 27.31  ? 778  ARG A NH1   1 
ATOM   3924 N  NH2   . ARG A 1 486 ? -17.935 -2.773  16.842  1.00 27.66  ? 778  ARG A NH2   1 
ATOM   3925 N  N     . MET A 1 487 ? -23.562 2.304   11.624  1.00 20.81  ? 779  MET A N     1 
ATOM   3926 C  CA    . MET A 1 487 ? -24.126 2.350   10.282  1.00 16.22  ? 779  MET A CA    1 
ATOM   3927 C  C     . MET A 1 487 ? -23.041 1.805   9.361   1.00 19.23  ? 779  MET A C     1 
ATOM   3928 O  O     . MET A 1 487 ? -21.902 2.259   9.439   1.00 18.04  ? 779  MET A O     1 
ATOM   3929 C  CB    . MET A 1 487 ? -24.475 3.799   9.920   1.00 16.58  ? 779  MET A CB    1 
ATOM   3930 C  CG    . MET A 1 487 ? -25.170 3.946   8.578   1.00 15.75  ? 779  MET A CG    1 
ATOM   3931 S  SD    . MET A 1 487 ? -25.687 5.675   8.279   1.00 22.72  ? 779  MET A SD    1 
ATOM   3932 C  CE    . MET A 1 487 ? -27.039 5.890   9.417   1.00 21.51  ? 779  MET A CE    1 
ATOM   3933 N  N     . LEU A 1 488 ? -23.365 0.809   8.528   1.00 19.00  ? 780  LEU A N     1 
ATOM   3934 C  CA    . LEU A 1 488 ? -22.339 0.125   7.723   1.00 16.24  ? 780  LEU A CA    1 
ATOM   3935 C  C     . LEU A 1 488 ? -22.399 0.373   6.221   1.00 19.13  ? 780  LEU A C     1 
ATOM   3936 O  O     . LEU A 1 488 ? -21.385 0.688   5.613   1.00 19.22  ? 780  LEU A O     1 
ATOM   3937 C  CB    . LEU A 1 488 ? -22.384 -1.384  7.943   1.00 16.42  ? 780  LEU A CB    1 
ATOM   3938 C  CG    . LEU A 1 488 ? -22.246 -1.917  9.372   1.00 16.53  ? 780  LEU A CG    1 
ATOM   3939 C  CD1   . LEU A 1 488 ? -22.017 -3.431  9.298   1.00 19.45  ? 780  LEU A CD1   1 
ATOM   3940 C  CD2   . LEU A 1 488 ? -21.127 -1.240  10.101  1.00 19.74  ? 780  LEU A CD2   1 
ATOM   3941 N  N     . LEU A 1 489 ? -23.571 0.176   5.623   1.00 18.75  ? 781  LEU A N     1 
ATOM   3942 C  CA    . LEU A 1 489 ? -23.691 0.210   4.168   1.00 17.34  ? 781  LEU A CA    1 
ATOM   3943 C  C     . LEU A 1 489 ? -24.913 0.988   3.701   1.00 16.80  ? 781  LEU A C     1 
ATOM   3944 O  O     . LEU A 1 489 ? -25.953 0.991   4.354   1.00 16.92  ? 781  LEU A O     1 
ATOM   3945 C  CB    . LEU A 1 489 ? -23.796 -1.212  3.601   1.00 16.06  ? 781  LEU A CB    1 
ATOM   3946 C  CG    . LEU A 1 489 ? -22.769 -2.279  4.009   1.00 21.52  ? 781  LEU A CG    1 
ATOM   3947 C  CD1   . LEU A 1 489 ? -23.221 -3.630  3.477   1.00 20.13  ? 781  LEU A CD1   1 
ATOM   3948 C  CD2   . LEU A 1 489 ? -21.346 -1.969  3.533   1.00 21.55  ? 781  LEU A CD2   1 
ATOM   3949 N  N     . GLN A 1 490 ? -24.786 1.629   2.544   1.00 16.40  ? 782  GLN A N     1 
ATOM   3950 C  CA    . GLN A 1 490 ? -25.924 2.220   1.869   1.00 13.63  ? 782  GLN A CA    1 
ATOM   3951 C  C     . GLN A 1 490 ? -25.803 1.801   0.409   1.00 19.72  ? 782  GLN A C     1 
ATOM   3952 O  O     . GLN A 1 490 ? -24.728 1.898   -0.191  1.00 18.54  ? 782  GLN A O     1 
ATOM   3953 C  CB    . GLN A 1 490 ? -25.918 3.755   1.975   1.00 18.50  ? 782  GLN A CB    1 
ATOM   3954 C  CG    . GLN A 1 490 ? -27.283 4.420   1.675   1.00 18.68  ? 782  GLN A CG    1 
ATOM   3955 C  CD    . GLN A 1 490 ? -27.666 4.426   0.216   1.00 26.07  ? 782  GLN A CD    1 
ATOM   3956 O  OE1   . GLN A 1 490 ? -26.958 4.983   -0.620  1.00 27.91  ? 782  GLN A OE1   1 
ATOM   3957 N  NE2   . GLN A 1 490 ? -28.801 3.808   -0.101  1.00 23.99  ? 782  GLN A NE2   1 
ATOM   3958 N  N     . VAL A 1 491 ? -26.897 1.306   -0.149  1.00 18.07  ? 783  VAL A N     1 
ATOM   3959 C  CA    . VAL A 1 491 ? -26.907 0.910   -1.563  1.00 19.07  ? 783  VAL A CA    1 
ATOM   3960 C  C     . VAL A 1 491 ? -28.357 0.938   -2.047  1.00 23.36  ? 783  VAL A C     1 
ATOM   3961 O  O     . VAL A 1 491 ? -29.266 0.646   -1.282  1.00 19.35  ? 783  VAL A O     1 
ATOM   3962 C  CB    . VAL A 1 491 ? -26.286 -0.496  -1.769  1.00 20.80  ? 783  VAL A CB    1 
ATOM   3963 C  CG1   . VAL A 1 491 ? -27.032 -1.543  -0.947  1.00 23.10  ? 783  VAL A CG1   1 
ATOM   3964 C  CG2   . VAL A 1 491 ? -26.263 -0.887  -3.266  1.00 24.81  ? 783  VAL A CG2   1 
ATOM   3965 N  N     . HIS A 1 492 ? -28.573 1.288   -3.314  1.00 25.97  ? 784  HIS A N     1 
ATOM   3966 C  CA    . HIS A 1 492 ? -29.937 1.375   -3.841  1.00 26.86  ? 784  HIS A CA    1 
ATOM   3967 C  C     . HIS A 1 492 ? -30.759 2.298   -2.925  1.00 33.68  ? 784  HIS A C     1 
ATOM   3968 O  O     . HIS A 1 492 ? -30.358 3.434   -2.681  1.00 28.26  ? 784  HIS A O     1 
ATOM   3969 C  CB    . HIS A 1 492 ? -30.569 -0.016  -3.956  1.00 30.43  ? 784  HIS A CB    1 
ATOM   3970 C  CG    . HIS A 1 492 ? -29.726 -1.017  -4.693  1.00 30.09  ? 784  HIS A CG    1 
ATOM   3971 N  ND1   . HIS A 1 492 ? -29.709 -2.359  -4.369  1.00 36.66  ? 784  HIS A ND1   1 
ATOM   3972 C  CD2   . HIS A 1 492 ? -28.878 -0.874  -5.742  1.00 30.65  ? 784  HIS A CD2   1 
ATOM   3973 C  CE1   . HIS A 1 492 ? -28.886 -2.998  -5.182  1.00 33.17  ? 784  HIS A CE1   1 
ATOM   3974 N  NE2   . HIS A 1 492 ? -28.367 -2.121  -6.023  1.00 27.82  ? 784  HIS A NE2   1 
ATOM   3975 N  N     . ASP A 1 493 ? -31.874 1.794   -2.389  1.00 23.70  ? 785  ASP A N     1 
ATOM   3976 C  CA    . ASP A 1 493 ? -32.734 2.555   -1.465  1.00 20.06  ? 785  ASP A CA    1 
ATOM   3977 C  C     . ASP A 1 493 ? -32.636 1.994   -0.033  1.00 20.56  ? 785  ASP A C     1 
ATOM   3978 O  O     . ASP A 1 493 ? -33.529 2.200   0.808   1.00 19.83  ? 785  ASP A O     1 
ATOM   3979 C  CB    . ASP A 1 493 ? -34.193 2.463   -1.923  1.00 23.91  ? 785  ASP A CB    1 
ATOM   3980 C  CG    . ASP A 1 493 ? -34.423 3.100   -3.298  1.00 30.81  ? 785  ASP A CG    1 
ATOM   3981 O  OD1   . ASP A 1 493 ? -33.684 4.038   -3.665  1.00 39.07  ? 785  ASP A OD1   1 
ATOM   3982 O  OD2   . ASP A 1 493 ? -35.344 2.656   -4.009  1.00 33.51  ? 785  ASP A OD2   1 
ATOM   3983 N  N     . GLU A 1 494 ? -31.531 1.306   0.222   1.00 17.80  ? 786  GLU A N     1 
ATOM   3984 C  CA    . GLU A 1 494 ? -31.360 0.484   1.423   1.00 16.91  ? 786  GLU A CA    1 
ATOM   3985 C  C     . GLU A 1 494 ? -30.242 1.029   2.324   1.00 18.97  ? 786  GLU A C     1 
ATOM   3986 O  O     . GLU A 1 494 ? -29.278 1.634   1.837   1.00 19.09  ? 786  GLU A O     1 
ATOM   3987 C  CB    . GLU A 1 494 ? -31.024 -0.947  0.972   1.00 20.33  ? 786  GLU A CB    1 
ATOM   3988 C  CG    . GLU A 1 494 ? -30.939 -1.949  2.113   1.00 33.14  ? 786  GLU A CG    1 
ATOM   3989 C  CD    . GLU A 1 494 ? -30.627 -3.356  1.637   1.00 37.53  ? 786  GLU A CD    1 
ATOM   3990 O  OE1   . GLU A 1 494 ? -30.208 -3.513  0.471   1.00 33.01  ? 786  GLU A OE1   1 
ATOM   3991 O  OE2   . GLU A 1 494 ? -30.816 -4.298  2.430   1.00 38.67  ? 786  GLU A OE2   1 
ATOM   3992 N  N     . LEU A 1 495 ? -30.384 0.815   3.636   1.00 17.27  ? 787  LEU A N     1 
ATOM   3993 C  CA    . LEU A 1 495 ? -29.342 1.105   4.618   1.00 18.92  ? 787  LEU A CA    1 
ATOM   3994 C  C     . LEU A 1 495 ? -29.144 -0.154  5.485   1.00 21.82  ? 787  LEU A C     1 
ATOM   3995 O  O     . LEU A 1 495 ? -30.122 -0.810  5.863   1.00 23.16  ? 787  LEU A O     1 
ATOM   3996 C  CB    . LEU A 1 495 ? -29.806 2.279   5.486   1.00 22.69  ? 787  LEU A CB    1 
ATOM   3997 C  CG    . LEU A 1 495 ? -28.882 3.167   6.301   1.00 32.30  ? 787  LEU A CG    1 
ATOM   3998 C  CD1   . LEU A 1 495 ? -27.823 3.809   5.423   1.00 25.69  ? 787  LEU A CD1   1 
ATOM   3999 C  CD2   . LEU A 1 495 ? -29.737 4.231   6.989   1.00 26.92  ? 787  LEU A CD2   1 
ATOM   4000 N  N     . VAL A 1 496 ? -27.890 -0.510  5.765   1.00 18.25  ? 788  VAL A N     1 
ATOM   4001 C  CA    . VAL A 1 496 ? -27.592 -1.661  6.620   1.00 17.24  ? 788  VAL A CA    1 
ATOM   4002 C  C     . VAL A 1 496 ? -26.856 -1.173  7.862   1.00 18.03  ? 788  VAL A C     1 
ATOM   4003 O  O     . VAL A 1 496 ? -25.831 -0.485  7.764   1.00 18.93  ? 788  VAL A O     1 
ATOM   4004 C  CB    . VAL A 1 496 ? -26.729 -2.698  5.890   1.00 18.74  ? 788  VAL A CB    1 
ATOM   4005 C  CG1   . VAL A 1 496 ? -26.446 -3.907  6.796   1.00 24.07  ? 788  VAL A CG1   1 
ATOM   4006 C  CG2   . VAL A 1 496 ? -27.407 -3.147  4.611   1.00 23.19  ? 788  VAL A CG2   1 
ATOM   4007 N  N     . LEU A 1 497 ? -27.407 -1.514  9.028   1.00 16.45  ? 789  LEU A N     1 
ATOM   4008 C  CA    . LEU A 1 497 ? -26.828 -1.131  10.312  1.00 18.77  ? 789  LEU A CA    1 
ATOM   4009 C  C     . LEU A 1 497 ? -26.352 -2.374  11.037  1.00 21.15  ? 789  LEU A C     1 
ATOM   4010 O  O     . LEU A 1 497 ? -26.730 -3.498  10.690  1.00 19.37  ? 789  LEU A O     1 
ATOM   4011 C  CB    . LEU A 1 497 ? -27.892 -0.459  11.185  1.00 17.02  ? 789  LEU A CB    1 
ATOM   4012 C  CG    . LEU A 1 497 ? -28.777 0.601   10.514  1.00 18.69  ? 789  LEU A CG    1 
ATOM   4013 C  CD1   . LEU A 1 497 ? -29.804 1.100   11.514  1.00 23.11  ? 789  LEU A CD1   1 
ATOM   4014 C  CD2   . LEU A 1 497 ? -27.930 1.755   9.970   1.00 17.30  ? 789  LEU A CD2   1 
ATOM   4015 N  N     . GLU A 1 498 ? -25.550 -2.170  12.071  1.00 14.88  ? 790  GLU A N     1 
ATOM   4016 C  CA    . GLU A 1 498 ? -25.116 -3.288  12.910  1.00 17.58  ? 790  GLU A CA    1 
ATOM   4017 C  C     . GLU A 1 498 ? -25.349 -2.886  14.368  1.00 17.09  ? 790  GLU A C     1 
ATOM   4018 O  O     . GLU A 1 498 ? -24.929 -1.816  14.780  1.00 19.77  ? 790  GLU A O     1 
ATOM   4019 C  CB    . GLU A 1 498 ? -23.630 -3.563  12.656  1.00 18.18  ? 790  GLU A CB    1 
ATOM   4020 C  CG    . GLU A 1 498 ? -23.088 -4.915  13.177  1.00 19.75  ? 790  GLU A CG    1 
ATOM   4021 C  CD    . GLU A 1 498 ? -21.581 -5.062  12.949  1.00 24.13  ? 790  GLU A CD    1 
ATOM   4022 O  OE1   . GLU A 1 498 ? -20.869 -4.035  12.948  1.00 22.65  ? 790  GLU A OE1   1 
ATOM   4023 O  OE2   . GLU A 1 498 ? -21.105 -6.201  12.765  1.00 22.15  ? 790  GLU A OE2   1 
ATOM   4024 N  N     . ALA A 1 499 ? -26.025 -3.738  15.139  1.00 18.70  ? 791  ALA A N     1 
ATOM   4025 C  CA    . ALA A 1 499 ? -26.337 -3.407  16.526  1.00 21.06  ? 791  ALA A CA    1 
ATOM   4026 C  C     . ALA A 1 499 ? -26.022 -4.580  17.444  1.00 22.74  ? 791  ALA A C     1 
ATOM   4027 O  O     . ALA A 1 499 ? -26.140 -5.727  17.036  1.00 20.87  ? 791  ALA A O     1 
ATOM   4028 C  CB    . ALA A 1 499 ? -27.801 -3.037  16.659  1.00 19.14  ? 791  ALA A CB    1 
ATOM   4029 N  N     . PRO A 1 500 ? -25.627 -4.292  18.694  1.00 21.66  ? 792  PRO A N     1 
ATOM   4030 C  CA    . PRO A 1 500 ? -25.535 -5.398  19.664  1.00 24.18  ? 792  PRO A CA    1 
ATOM   4031 C  C     . PRO A 1 500 ? -26.863 -6.154  19.686  1.00 22.47  ? 792  PRO A C     1 
ATOM   4032 O  O     . PRO A 1 500 ? -27.905 -5.513  19.547  1.00 23.05  ? 792  PRO A O     1 
ATOM   4033 C  CB    . PRO A 1 500 ? -25.302 -4.671  20.996  1.00 28.03  ? 792  PRO A CB    1 
ATOM   4034 C  CG    . PRO A 1 500 ? -24.620 -3.375  20.599  1.00 23.16  ? 792  PRO A CG    1 
ATOM   4035 C  CD    . PRO A 1 500 ? -25.303 -2.985  19.299  1.00 19.99  ? 792  PRO A CD    1 
ATOM   4036 N  N     . LYS A 1 501 ? -26.831 -7.476  19.859  1.00 20.58  ? 793  LYS A N     1 
ATOM   4037 C  CA    . LYS A 1 501 ? -28.042 -8.299  19.775  1.00 25.87  ? 793  LYS A CA    1 
ATOM   4038 C  C     . LYS A 1 501 ? -29.131 -7.787  20.699  1.00 28.23  ? 793  LYS A C     1 
ATOM   4039 O  O     . LYS A 1 501 ? -30.312 -7.816  20.351  1.00 29.24  ? 793  LYS A O     1 
ATOM   4040 C  CB    . LYS A 1 501 ? -27.738 -9.745  20.153  1.00 30.03  ? 793  LYS A CB    1 
ATOM   4041 C  CG    . LYS A 1 501 ? -26.986 -10.537 19.115  1.00 44.29  ? 793  LYS A CG    1 
ATOM   4042 C  CD    . LYS A 1 501 ? -26.888 -11.994 19.552  1.00 50.25  ? 793  LYS A CD    1 
ATOM   4043 C  CE    . LYS A 1 501 ? -25.858 -12.758 18.736  1.00 52.54  ? 793  LYS A CE    1 
ATOM   4044 N  NZ    . LYS A 1 501 ? -26.027 -12.557 17.272  1.00 42.16  ? 793  LYS A NZ    1 
ATOM   4045 N  N     . GLU A 1 502 ? -28.715 -7.319  21.875  1.00 26.06  ? 794  GLU A N     1 
ATOM   4046 C  CA    . GLU A 1 502 ? -29.649 -6.849  22.893  1.00 29.93  ? 794  GLU A CA    1 
ATOM   4047 C  C     . GLU A 1 502 ? -30.344 -5.552  22.507  1.00 30.54  ? 794  GLU A C     1 
ATOM   4048 O  O     . GLU A 1 502 ? -31.385 -5.215  23.066  1.00 29.38  ? 794  GLU A O     1 
ATOM   4049 C  CB    . GLU A 1 502 ? -28.939 -6.679  24.247  1.00 35.55  ? 794  GLU A CB    1 
ATOM   4050 C  CG    . GLU A 1 502 ? -27.848 -5.602  24.274  1.00 39.22  ? 794  GLU A CG    1 
ATOM   4051 C  CD    . GLU A 1 502 ? -26.467 -6.136  23.923  1.00 41.64  ? 794  GLU A CD    1 
ATOM   4052 O  OE1   . GLU A 1 502 ? -26.359 -7.289  23.438  1.00 34.00  ? 794  GLU A OE1   1 
ATOM   4053 O  OE2   . GLU A 1 502 ? -25.483 -5.396  24.147  1.00 42.51  ? 794  GLU A OE2   1 
ATOM   4054 N  N     . ARG A 1 503 ? -29.770 -4.824  21.553  1.00 27.13  ? 795  ARG A N     1 
ATOM   4055 C  CA    . ARG A 1 503 ? -30.325 -3.537  21.141  1.00 25.23  ? 795  ARG A CA    1 
ATOM   4056 C  C     . ARG A 1 503 ? -30.954 -3.556  19.742  1.00 25.09  ? 795  ARG A C     1 
ATOM   4057 O  O     . ARG A 1 503 ? -31.564 -2.575  19.340  1.00 25.04  ? 795  ARG A O     1 
ATOM   4058 C  CB    . ARG A 1 503 ? -29.246 -2.448  21.189  1.00 34.28  ? 795  ARG A CB    1 
ATOM   4059 C  CG    . ARG A 1 503 ? -28.436 -2.408  22.472  1.00 43.61  ? 795  ARG A CG    1 
ATOM   4060 C  CD    . ARG A 1 503 ? -29.312 -2.108  23.673  1.00 53.74  ? 795  ARG A CD    1 
ATOM   4061 N  NE    . ARG A 1 503 ? -29.856 -0.754  23.625  1.00 59.61  ? 795  ARG A NE    1 
ATOM   4062 C  CZ    . ARG A 1 503 ? -29.229 0.319   24.099  1.00 56.99  ? 795  ARG A CZ    1 
ATOM   4063 N  NH1   . ARG A 1 503 ? -28.033 0.201   24.656  1.00 53.57  ? 795  ARG A NH1   1 
ATOM   4064 N  NH2   . ARG A 1 503 ? -29.798 1.513   24.008  1.00 61.70  ? 795  ARG A NH2   1 
ATOM   4065 N  N     . ALA A 1 504 ? -30.805 -4.658  19.014  1.00 22.04  ? 796  ALA A N     1 
ATOM   4066 C  CA    . ALA A 1 504 ? -31.208 -4.703  17.597  1.00 24.23  ? 796  ALA A CA    1 
ATOM   4067 C  C     . ALA A 1 504 ? -32.677 -4.367  17.348  1.00 25.51  ? 796  ALA A C     1 
ATOM   4068 O  O     . ALA A 1 504 ? -33.009 -3.641  16.406  1.00 23.82  ? 796  ALA A O     1 
ATOM   4069 C  CB    . ALA A 1 504 ? -30.873 -6.065  16.984  1.00 21.45  ? 796  ALA A CB    1 
ATOM   4070 N  N     . GLU A 1 505 ? -33.571 -4.896  18.178  1.00 23.86  ? 797  GLU A N     1 
ATOM   4071 C  CA    . GLU A 1 505 ? -34.981 -4.579  17.982  1.00 22.85  ? 797  GLU A CA    1 
ATOM   4072 C  C     . GLU A 1 505 ? -35.292 -3.103  18.219  1.00 30.86  ? 797  GLU A C     1 
ATOM   4073 O  O     . GLU A 1 505 ? -36.061 -2.498  17.467  1.00 28.17  ? 797  GLU A O     1 
ATOM   4074 C  CB    . GLU A 1 505 ? -35.878 -5.508  18.812  1.00 32.92  ? 797  GLU A CB    1 
ATOM   4075 C  CG    . GLU A 1 505 ? -35.513 -6.979  18.598  1.00 45.87  ? 797  GLU A CG    1 
ATOM   4076 C  CD    . GLU A 1 505 ? -36.658 -7.945  18.852  1.00 65.90  ? 797  GLU A CD    1 
ATOM   4077 O  OE1   . GLU A 1 505 ? -37.233 -7.921  19.962  1.00 67.89  ? 797  GLU A OE1   1 
ATOM   4078 O  OE2   . GLU A 1 505 ? -36.973 -8.737  17.936  1.00 73.36  ? 797  GLU A OE2   1 
ATOM   4079 N  N     . ALA A 1 506 ? -34.673 -2.512  19.239  1.00 24.99  ? 798  ALA A N     1 
ATOM   4080 C  CA    . ALA A 1 506 ? -34.855 -1.086  19.499  1.00 24.45  ? 798  ALA A CA    1 
ATOM   4081 C  C     . ALA A 1 506 ? -34.245 -0.264  18.375  1.00 25.70  ? 798  ALA A C     1 
ATOM   4082 O  O     . ALA A 1 506 ? -34.815 0.744   17.953  1.00 27.09  ? 798  ALA A O     1 
ATOM   4083 C  CB    . ALA A 1 506 ? -34.241 -0.698  20.821  1.00 27.41  ? 798  ALA A CB    1 
ATOM   4084 N  N     . VAL A 1 507 ? -33.075 -0.690  17.904  1.00 22.31  ? 799  VAL A N     1 
ATOM   4085 C  CA    . VAL A 1 507 ? -32.429 -0.004  16.786  1.00 24.95  ? 799  VAL A CA    1 
ATOM   4086 C  C     . VAL A 1 507 ? -33.306 -0.044  15.533  1.00 22.84  ? 799  VAL A C     1 
ATOM   4087 O  O     . VAL A 1 507 ? -33.465 0.980   14.843  1.00 23.39  ? 799  VAL A O     1 
ATOM   4088 C  CB    . VAL A 1 507 ? -31.002 -0.545  16.522  1.00 26.37  ? 799  VAL A CB    1 
ATOM   4089 C  CG1   . VAL A 1 507 ? -30.508 -0.159  15.121  1.00 25.52  ? 799  VAL A CG1   1 
ATOM   4090 C  CG2   . VAL A 1 507 ? -30.039 0.000   17.597  1.00 23.44  ? 799  VAL A CG2   1 
ATOM   4091 N  N     . ALA A 1 508 ? -33.879 -1.206  15.241  1.00 23.02  ? 800  ALA A N     1 
ATOM   4092 C  CA    . ALA A 1 508 ? -34.751 -1.345  14.066  1.00 26.11  ? 800  ALA A CA    1 
ATOM   4093 C  C     . ALA A 1 508 ? -35.964 -0.432  14.156  1.00 31.76  ? 800  ALA A C     1 
ATOM   4094 O  O     . ALA A 1 508 ? -36.364 0.187   13.170  1.00 23.96  ? 800  ALA A O     1 
ATOM   4095 C  CB    . ALA A 1 508 ? -35.200 -2.779  13.896  1.00 23.72  ? 800  ALA A CB    1 
ATOM   4096 N  N     . ARG A 1 509 ? -36.557 -0.362  15.344  1.00 24.35  ? 801  ARG A N     1 
ATOM   4097 C  CA    . ARG A 1 509 ? -37.688 0.536   15.559  1.00 24.19  ? 801  ARG A CA    1 
ATOM   4098 C  C     . ARG A 1 509 ? -37.331 1.999   15.355  1.00 22.39  ? 801  ARG A C     1 
ATOM   4099 O  O     . ARG A 1 509 ? -38.075 2.739   14.702  1.00 24.41  ? 801  ARG A O     1 
ATOM   4100 C  CB    . ARG A 1 509 ? -38.253 0.353   16.968  1.00 27.52  ? 801  ARG A CB    1 
ATOM   4101 C  CG    . ARG A 1 509 ? -39.092 -0.883  17.124  1.00 33.89  ? 801  ARG A CG    1 
ATOM   4102 C  CD    . ARG A 1 509 ? -39.903 -0.805  18.415  1.00 46.11  ? 801  ARG A CD    1 
ATOM   4103 N  NE    . ARG A 1 509 ? -39.048 -0.721  19.594  1.00 52.46  ? 801  ARG A NE    1 
ATOM   4104 C  CZ    . ARG A 1 509 ? -38.609 -1.782  20.264  1.00 48.86  ? 801  ARG A CZ    1 
ATOM   4105 N  NH1   . ARG A 1 509 ? -38.947 -3.000  19.867  1.00 53.43  ? 801  ARG A NH1   1 
ATOM   4106 N  NH2   . ARG A 1 509 ? -37.835 -1.625  21.328  1.00 44.83  ? 801  ARG A NH2   1 
ATOM   4107 N  N     . LEU A 1 510 ? -36.206 2.419   15.927  1.00 24.62  ? 802  LEU A N     1 
ATOM   4108 C  CA    . LEU A 1 510 ? -35.745 3.801   15.822  1.00 25.90  ? 802  LEU A CA    1 
ATOM   4109 C  C     . LEU A 1 510 ? -35.431 4.193   14.379  1.00 27.42  ? 802  LEU A C     1 
ATOM   4110 O  O     . LEU A 1 510 ? -35.781 5.285   13.926  1.00 22.91  ? 802  LEU A O     1 
ATOM   4111 C  CB    . LEU A 1 510 ? -34.496 4.024   16.680  1.00 29.75  ? 802  LEU A CB    1 
ATOM   4112 C  CG    . LEU A 1 510 ? -33.713 5.309   16.359  1.00 38.79  ? 802  LEU A CG    1 
ATOM   4113 C  CD1   . LEU A 1 510 ? -34.417 6.540   16.931  1.00 37.60  ? 802  LEU A CD1   1 
ATOM   4114 C  CD2   . LEU A 1 510 ? -32.270 5.233   16.842  1.00 41.31  ? 802  LEU A CD2   1 
ATOM   4115 N  N     . ALA A 1 511 ? -34.745 3.307   13.667  1.00 23.44  ? 803  ALA A N     1 
ATOM   4116 C  CA    . ALA A 1 511 ? -34.313 3.619   12.302  1.00 21.23  ? 803  ALA A CA    1 
ATOM   4117 C  C     . ALA A 1 511 ? -35.509 3.720   11.360  1.00 22.20  ? 803  ALA A C     1 
ATOM   4118 O  O     . ALA A 1 511 ? -35.564 4.591   10.494  1.00 20.75  ? 803  ALA A O     1 
ATOM   4119 C  CB    . ALA A 1 511 ? -33.327 2.565   11.811  1.00 20.55  ? 803  ALA A CB    1 
ATOM   4120 N  N     . LYS A 1 512 ? -36.467 2.819   11.519  1.00 22.99  ? 804  LYS A N     1 
ATOM   4121 C  CA    . LYS A 1 512 ? -37.668 2.851   10.694  1.00 23.38  ? 804  LYS A CA    1 
ATOM   4122 C  C     . LYS A 1 512 ? -38.398 4.166   10.895  1.00 27.19  ? 804  LYS A C     1 
ATOM   4123 O  O     . LYS A 1 512 ? -38.816 4.809   9.936   1.00 25.64  ? 804  LYS A O     1 
ATOM   4124 C  CB    . LYS A 1 512 ? -38.573 1.669   11.051  1.00 24.33  ? 804  LYS A CB    1 
ATOM   4125 C  CG    . LYS A 1 512 ? -39.850 1.568   10.233  1.00 29.44  ? 804  LYS A CG    1 
ATOM   4126 C  CD    . LYS A 1 512 ? -40.702 0.416   10.740  1.00 29.92  ? 804  LYS A CD    1 
ATOM   4127 C  CE    . LYS A 1 512 ? -42.132 0.501   10.223  1.00 36.89  ? 804  LYS A CE    1 
ATOM   4128 N  NZ    . LYS A 1 512 ? -42.200 0.447   8.745   1.00 46.94  ? 804  LYS A NZ    1 
ATOM   4129 N  N     . GLU A 1 513 ? -38.532 4.569   12.152  1.00 24.12  ? 805  GLU A N     1 
ATOM   4130 C  CA    . GLU A 1 513 ? -39.200 5.820   12.495  1.00 26.80  ? 805  GLU A CA    1 
ATOM   4131 C  C     . GLU A 1 513 ? -38.505 7.040   11.886  1.00 24.77  ? 805  GLU A C     1 
ATOM   4132 O  O     . GLU A 1 513 ? -39.154 7.905   11.294  1.00 24.48  ? 805  GLU A O     1 
ATOM   4133 C  CB    . GLU A 1 513 ? -39.273 5.974   14.016  1.00 31.32  ? 805  GLU A CB    1 
ATOM   4134 C  CG    . GLU A 1 513 ? -39.872 7.295   14.462  1.00 51.36  ? 805  GLU A CG    1 
ATOM   4135 C  CD    . GLU A 1 513 ? -39.653 7.562   15.937  1.00 75.39  ? 805  GLU A CD    1 
ATOM   4136 O  OE1   . GLU A 1 513 ? -39.533 6.587   16.710  1.00 79.51  ? 805  GLU A OE1   1 
ATOM   4137 O  OE2   . GLU A 1 513 ? -39.594 8.749   16.321  1.00 85.87  ? 805  GLU A OE2   1 
ATOM   4138 N  N     . VAL A 1 514 ? -37.183 7.109   12.030  1.00 22.68  ? 806  VAL A N     1 
ATOM   4139 C  CA    . VAL A 1 514 ? -36.423 8.262   11.557  1.00 25.29  ? 806  VAL A CA    1 
ATOM   4140 C  C     . VAL A 1 514 ? -36.492 8.362   10.038  1.00 25.80  ? 806  VAL A C     1 
ATOM   4141 O  O     . VAL A 1 514 ? -36.716 9.438   9.478   1.00 23.91  ? 806  VAL A O     1 
ATOM   4142 C  CB    . VAL A 1 514 ? -34.956 8.193   12.035  1.00 24.97  ? 806  VAL A CB    1 
ATOM   4143 C  CG1   . VAL A 1 514 ? -34.079 9.198   11.282  1.00 21.89  ? 806  VAL A CG1   1 
ATOM   4144 C  CG2   . VAL A 1 514 ? -34.893 8.436   13.541  1.00 23.24  ? 806  VAL A CG2   1 
ATOM   4145 N  N     . MET A 1 515 ? -36.303 7.228   9.381   1.00 21.60  ? 807  MET A N     1 
ATOM   4146 C  CA    . MET A 1 515 ? -36.386 7.169   7.928   1.00 20.92  ? 807  MET A CA    1 
ATOM   4147 C  C     . MET A 1 515 ? -37.788 7.511   7.402   1.00 25.69  ? 807  MET A C     1 
ATOM   4148 O  O     . MET A 1 515 ? -37.925 8.262   6.436   1.00 24.62  ? 807  MET A O     1 
ATOM   4149 C  CB    . MET A 1 515 ? -35.945 5.788   7.442   1.00 22.19  ? 807  MET A CB    1 
ATOM   4150 C  CG    . MET A 1 515 ? -34.479 5.548   7.732   1.00 23.68  ? 807  MET A CG    1 
ATOM   4151 S  SD    . MET A 1 515 ? -33.954 3.882   7.288   1.00 23.74  ? 807  MET A SD    1 
ATOM   4152 C  CE    . MET A 1 515 ? -34.034 3.919   5.492   1.00 24.78  ? 807  MET A CE    1 
ATOM   4153 N  N     . GLU A 1 516 ? -38.830 6.966   8.026   1.00 21.95  ? 808  GLU A N     1 
ATOM   4154 C  CA    . GLU A 1 516 ? -40.187 7.242   7.534   1.00 23.06  ? 808  GLU A CA    1 
ATOM   4155 C  C     . GLU A 1 516 ? -40.596 8.693   7.759   1.00 27.65  ? 808  GLU A C     1 
ATOM   4156 O  O     . GLU A 1 516 ? -41.363 9.252   6.977   1.00 25.50  ? 808  GLU A O     1 
ATOM   4157 C  CB    . GLU A 1 516 ? -41.211 6.260   8.125   1.00 23.62  ? 808  GLU A CB    1 
ATOM   4158 C  CG    . GLU A 1 516 ? -41.044 4.829   7.583   1.00 21.50  ? 808  GLU A CG    1 
ATOM   4159 C  CD    . GLU A 1 516 ? -42.159 3.895   8.031   1.00 35.09  ? 808  GLU A CD    1 
ATOM   4160 O  OE1   . GLU A 1 516 ? -42.878 4.245   8.988   1.00 33.15  ? 808  GLU A OE1   1 
ATOM   4161 O  OE2   . GLU A 1 516 ? -42.319 2.814   7.425   1.00 31.05  ? 808  GLU A OE2   1 
ATOM   4162 N  N     . GLY A 1 517 ? -40.059 9.320   8.799   1.00 23.71  ? 809  GLY A N     1 
ATOM   4163 C  CA    . GLY A 1 517 ? -40.413 10.702  9.094   1.00 25.47  ? 809  GLY A CA    1 
ATOM   4164 C  C     . GLY A 1 517 ? -39.405 11.754  8.673   1.00 27.51  ? 809  GLY A C     1 
ATOM   4165 O  O     . GLY A 1 517 ? -39.482 12.896  9.123   1.00 29.44  ? 809  GLY A O     1 
ATOM   4166 N  N     . VAL A 1 518 ? -38.471 11.384  7.795   1.00 23.34  ? 810  VAL A N     1 
ATOM   4167 C  CA    . VAL A 1 518 ? -37.362 12.269  7.441   1.00 22.04  ? 810  VAL A CA    1 
ATOM   4168 C  C     . VAL A 1 518 ? -37.829 13.616  6.866   1.00 26.86  ? 810  VAL A C     1 
ATOM   4169 O  O     . VAL A 1 518 ? -37.268 14.660  7.200   1.00 25.97  ? 810  VAL A O     1 
ATOM   4170 C  CB    . VAL A 1 518 ? -36.346 11.570  6.476   1.00 24.43  ? 810  VAL A CB    1 
ATOM   4171 C  CG1   . VAL A 1 518 ? -36.985 11.274  5.130   1.00 23.25  ? 810  VAL A CG1   1 
ATOM   4172 C  CG2   . VAL A 1 518 ? -35.089 12.422  6.312   1.00 30.35  ? 810  VAL A CG2   1 
ATOM   4173 N  N     . TYR A 1 519 ? -38.874 13.589  6.041   1.00 26.72  ? 811  TYR A N     1 
ATOM   4174 C  CA    . TYR A 1 519 ? -39.435 14.806  5.448   1.00 25.28  ? 811  TYR A CA    1 
ATOM   4175 C  C     . TYR A 1 519 ? -40.894 14.572  5.065   1.00 26.92  ? 811  TYR A C     1 
ATOM   4176 O  O     . TYR A 1 519 ? -41.233 13.529  4.517   1.00 27.84  ? 811  TYR A O     1 
ATOM   4177 C  CB    . TYR A 1 519 ? -38.637 15.199  4.197   1.00 24.19  ? 811  TYR A CB    1 
ATOM   4178 C  CG    . TYR A 1 519 ? -38.845 16.634  3.802   1.00 25.96  ? 811  TYR A CG    1 
ATOM   4179 C  CD1   . TYR A 1 519 ? -38.116 17.638  4.403   1.00 28.24  ? 811  TYR A CD1   1 
ATOM   4180 C  CD2   . TYR A 1 519 ? -39.788 16.985  2.838   1.00 30.69  ? 811  TYR A CD2   1 
ATOM   4181 C  CE1   . TYR A 1 519 ? -38.313 18.971  4.059   1.00 35.13  ? 811  TYR A CE1   1 
ATOM   4182 C  CE2   . TYR A 1 519 ? -39.988 18.312  2.487   1.00 32.28  ? 811  TYR A CE2   1 
ATOM   4183 C  CZ    . TYR A 1 519 ? -39.248 19.296  3.097   1.00 41.00  ? 811  TYR A CZ    1 
ATOM   4184 O  OH    . TYR A 1 519 ? -39.448 20.615  2.746   1.00 49.29  ? 811  TYR A OH    1 
ATOM   4185 N  N     . PRO A 1 520 ? -41.771 15.549  5.356   1.00 27.32  ? 812  PRO A N     1 
ATOM   4186 C  CA    . PRO A 1 520 ? -43.195 15.360  5.080   1.00 30.88  ? 812  PRO A CA    1 
ATOM   4187 C  C     . PRO A 1 520 ? -43.490 15.509  3.600   1.00 25.91  ? 812  PRO A C     1 
ATOM   4188 O  O     . PRO A 1 520 ? -43.146 16.526  3.004   1.00 31.83  ? 812  PRO A O     1 
ATOM   4189 C  CB    . PRO A 1 520 ? -43.851 16.501  5.871   1.00 31.67  ? 812  PRO A CB    1 
ATOM   4190 C  CG    . PRO A 1 520 ? -42.821 17.561  5.897   1.00 38.66  ? 812  PRO A CG    1 
ATOM   4191 C  CD    . PRO A 1 520 ? -41.507 16.832  6.028   1.00 34.71  ? 812  PRO A CD    1 
ATOM   4192 N  N     . LEU A 1 521 ? -44.104 14.486  3.018   1.00 29.48  ? 813  LEU A N     1 
ATOM   4193 C  CA    . LEU A 1 521 ? -44.520 14.500  1.625   1.00 29.76  ? 813  LEU A CA    1 
ATOM   4194 C  C     . LEU A 1 521 ? -46.041 14.327  1.541   1.00 31.18  ? 813  LEU A C     1 
ATOM   4195 O  O     . LEU A 1 521 ? -46.710 14.144  2.556   1.00 31.80  ? 813  LEU A O     1 
ATOM   4196 C  CB    . LEU A 1 521 ? -43.835 13.362  0.860   1.00 26.65  ? 813  LEU A CB    1 
ATOM   4197 C  CG    . LEU A 1 521 ? -42.302 13.367  0.860   1.00 26.32  ? 813  LEU A CG    1 
ATOM   4198 C  CD1   . LEU A 1 521 ? -41.795 12.158  0.101   1.00 25.55  ? 813  LEU A CD1   1 
ATOM   4199 C  CD2   . LEU A 1 521 ? -41.748 14.648  0.256   1.00 24.65  ? 813  LEU A CD2   1 
ATOM   4200 N  N     . ALA A 1 522 ? -46.568 14.366  0.323   1.00 25.52  ? 814  ALA A N     1 
ATOM   4201 C  CA    . ALA A 1 522 ? -48.003 14.239  0.078   1.00 33.17  ? 814  ALA A CA    1 
ATOM   4202 C  C     . ALA A 1 522 ? -48.446 12.785  0.165   1.00 34.59  ? 814  ALA A C     1 
ATOM   4203 O  O     . ALA A 1 522 ? -49.644 12.480  0.158   1.00 30.44  ? 814  ALA A O     1 
ATOM   4204 C  CB    . ALA A 1 522 ? -48.355 14.831  -1.285  1.00 30.81  ? 814  ALA A CB    1 
ATOM   4205 N  N     . VAL A 1 523 ? -47.461 11.888  0.233   1.00 28.52  ? 815  VAL A N     1 
ATOM   4206 C  CA    . VAL A 1 523 ? -47.698 10.482  0.500   1.00 25.48  ? 815  VAL A CA    1 
ATOM   4207 C  C     . VAL A 1 523 ? -46.810 10.051  1.667   1.00 24.23  ? 815  VAL A C     1 
ATOM   4208 O  O     . VAL A 1 523 ? -45.778 10.684  1.946   1.00 27.48  ? 815  VAL A O     1 
ATOM   4209 C  CB    . VAL A 1 523 ? -47.413 9.598   -0.736  1.00 24.86  ? 815  VAL A CB    1 
ATOM   4210 C  CG1   . VAL A 1 523 ? -48.428 9.889   -1.843  1.00 25.89  ? 815  VAL A CG1   1 
ATOM   4211 C  CG2   . VAL A 1 523 ? -45.997 9.841   -1.244  1.00 24.83  ? 815  VAL A CG2   1 
ATOM   4212 N  N     . PRO A 1 524 ? -47.218 9.001   2.380   1.00 30.09  ? 816  PRO A N     1 
ATOM   4213 C  CA    . PRO A 1 524 ? -46.336 8.523   3.444   1.00 26.47  ? 816  PRO A CA    1 
ATOM   4214 C  C     . PRO A 1 524 ? -45.087 7.881   2.847   1.00 25.26  ? 816  PRO A C     1 
ATOM   4215 O  O     . PRO A 1 524 ? -45.118 7.404   1.717   1.00 26.61  ? 816  PRO A O     1 
ATOM   4216 C  CB    . PRO A 1 524 ? -47.184 7.454   4.140   1.00 35.78  ? 816  PRO A CB    1 
ATOM   4217 C  CG    . PRO A 1 524 ? -48.140 6.990   3.100   1.00 39.54  ? 816  PRO A CG    1 
ATOM   4218 C  CD    . PRO A 1 524 ? -48.451 8.202   2.273   1.00 31.89  ? 816  PRO A CD    1 
ATOM   4219 N  N     . LEU A 1 525 ? -43.987 7.897   3.588   1.00 21.66  ? 817  LEU A N     1 
ATOM   4220 C  CA    . LEU A 1 525 ? -42.850 7.059   3.214   1.00 24.95  ? 817  LEU A CA    1 
ATOM   4221 C  C     . LEU A 1 525 ? -42.972 5.732   3.956   1.00 30.96  ? 817  LEU A C     1 
ATOM   4222 O  O     . LEU A 1 525 ? -43.337 5.710   5.128   1.00 33.25  ? 817  LEU A O     1 
ATOM   4223 C  CB    . LEU A 1 525 ? -41.543 7.747   3.567   1.00 24.93  ? 817  LEU A CB    1 
ATOM   4224 C  CG    . LEU A 1 525 ? -41.251 9.001   2.741   1.00 27.37  ? 817  LEU A CG    1 
ATOM   4225 C  CD1   . LEU A 1 525 ? -40.022 9.688   3.267   1.00 27.02  ? 817  LEU A CD1   1 
ATOM   4226 C  CD2   . LEU A 1 525 ? -41.075 8.637   1.277   1.00 31.28  ? 817  LEU A CD2   1 
ATOM   4227 N  N     . GLU A 1 526 ? -42.694 4.629   3.267   1.00 24.61  ? 818  GLU A N     1 
ATOM   4228 C  CA    . GLU A 1 526 ? -42.718 3.316   3.899   1.00 22.20  ? 818  GLU A CA    1 
ATOM   4229 C  C     . GLU A 1 526 ? -41.319 2.708   3.877   1.00 21.59  ? 818  GLU A C     1 
ATOM   4230 O  O     . GLU A 1 526 ? -40.607 2.791   2.871   1.00 22.29  ? 818  GLU A O     1 
ATOM   4231 C  CB    . GLU A 1 526 ? -43.706 2.376   3.206   1.00 29.36  ? 818  GLU A CB    1 
ATOM   4232 C  CG    . GLU A 1 526 ? -45.156 2.624   3.595   1.00 48.82  ? 818  GLU A CG    1 
ATOM   4233 C  CD    . GLU A 1 526 ? -46.069 1.472   3.215   1.00 70.04  ? 818  GLU A CD    1 
ATOM   4234 O  OE1   . GLU A 1 526 ? -45.920 0.927   2.100   1.00 72.01  ? 818  GLU A OE1   1 
ATOM   4235 O  OE2   . GLU A 1 526 ? -46.935 1.106   4.040   1.00 83.86  ? 818  GLU A OE2   1 
ATOM   4236 N  N     . VAL A 1 527 ? -40.948 2.098   4.992   1.00 20.51  ? 819  VAL A N     1 
ATOM   4237 C  CA    . VAL A 1 527 ? -39.653 1.440   5.128   1.00 20.57  ? 819  VAL A CA    1 
ATOM   4238 C  C     . VAL A 1 527 ? -39.891 0.027   5.606   1.00 21.20  ? 819  VAL A C     1 
ATOM   4239 O  O     . VAL A 1 527 ? -40.622 -0.195  6.574   1.00 27.40  ? 819  VAL A O     1 
ATOM   4240 C  CB    . VAL A 1 527 ? -38.764 2.204   6.115   1.00 22.16  ? 819  VAL A CB    1 
ATOM   4241 C  CG1   . VAL A 1 527 ? -37.520 1.386   6.487   1.00 22.54  ? 819  VAL A CG1   1 
ATOM   4242 C  CG2   . VAL A 1 527 ? -38.353 3.528   5.497   1.00 21.85  ? 819  VAL A CG2   1 
ATOM   4243 N  N     . GLU A 1 528 ? -39.311 -0.930  4.896   1.00 21.73  ? 820  GLU A N     1 
ATOM   4244 C  CA    . GLU A 1 528 ? -39.343 -2.316  5.328   1.00 21.34  ? 820  GLU A CA    1 
ATOM   4245 C  C     . GLU A 1 528 ? -38.070 -2.567  6.122   1.00 22.87  ? 820  GLU A C     1 
ATOM   4246 O  O     . GLU A 1 528 ? -37.003 -2.101  5.743   1.00 26.92  ? 820  GLU A O     1 
ATOM   4247 C  CB    . GLU A 1 528 ? -39.436 -3.234  4.112   1.00 28.59  ? 820  GLU A CB    1 
ATOM   4248 C  CG    . GLU A 1 528 ? -40.782 -3.115  3.391   1.00 38.67  ? 820  GLU A CG    1 
ATOM   4249 C  CD    . GLU A 1 528 ? -40.773 -3.736  2.001   1.00 53.47  ? 820  GLU A CD    1 
ATOM   4250 O  OE1   . GLU A 1 528 ? -39.771 -4.388  1.639   1.00 47.74  ? 820  GLU A OE1   1 
ATOM   4251 O  OE2   . GLU A 1 528 ? -41.766 -3.559  1.262   1.00 66.56  ? 820  GLU A OE2   1 
ATOM   4252 N  N     . VAL A 1 529 ? -38.180 -3.287  7.236   1.00 22.91  ? 821  VAL A N     1 
ATOM   4253 C  CA    . VAL A 1 529 ? -37.022 -3.483  8.100   1.00 18.16  ? 821  VAL A CA    1 
ATOM   4254 C  C     . VAL A 1 529 ? -36.927 -4.956  8.505   1.00 22.27  ? 821  VAL A C     1 
ATOM   4255 O  O     . VAL A 1 529 ? -37.944 -5.621  8.683   1.00 23.12  ? 821  VAL A O     1 
ATOM   4256 C  CB    . VAL A 1 529 ? -37.099 -2.554  9.340   1.00 23.42  ? 821  VAL A CB    1 
ATOM   4257 C  CG1   . VAL A 1 529 ? -38.384 -2.798  10.108  1.00 34.35  ? 821  VAL A CG1   1 
ATOM   4258 C  CG2   . VAL A 1 529 ? -35.890 -2.737  10.251  1.00 24.82  ? 821  VAL A CG2   1 
ATOM   4259 N  N     . GLY A 1 530 ? -35.707 -5.476  8.587   1.00 18.54  ? 822  GLY A N     1 
ATOM   4260 C  CA    . GLY A 1 530 ? -35.485 -6.859  8.985   1.00 23.28  ? 822  GLY A CA    1 
ATOM   4261 C  C     . GLY A 1 530 ? -34.210 -6.947  9.812   1.00 26.49  ? 822  GLY A C     1 
ATOM   4262 O  O     . GLY A 1 530 ? -33.368 -6.036  9.776   1.00 20.77  ? 822  GLY A O     1 
ATOM   4263 N  N     . ILE A 1 531 ? -34.081 -8.028  10.582  1.00 19.18  ? 823  ILE A N     1 
ATOM   4264 C  CA    . ILE A 1 531 ? -32.922 -8.223  11.445  1.00 18.55  ? 823  ILE A CA    1 
ATOM   4265 C  C     . ILE A 1 531 ? -32.381 -9.631  11.213  1.00 21.20  ? 823  ILE A C     1 
ATOM   4266 O  O     . ILE A 1 531 ? -33.154 -10.580 11.070  1.00 23.66  ? 823  ILE A O     1 
ATOM   4267 C  CB    . ILE A 1 531 ? -33.327 -8.076  12.937  1.00 23.10  ? 823  ILE A CB    1 
ATOM   4268 C  CG1   . ILE A 1 531 ? -34.052 -6.750  13.182  1.00 27.80  ? 823  ILE A CG1   1 
ATOM   4269 C  CG2   . ILE A 1 531 ? -32.114 -8.196  13.860  1.00 27.47  ? 823  ILE A CG2   1 
ATOM   4270 C  CD1   . ILE A 1 531 ? -34.504 -6.559  14.626  1.00 28.04  ? 823  ILE A CD1   1 
ATOM   4271 N  N     . GLY A 1 532 ? -31.060 -9.777  11.161  1.00 19.00  ? 824  GLY A N     1 
ATOM   4272 C  CA    . GLY A 1 532 ? -30.470 -11.104 10.981  1.00 20.76  ? 824  GLY A CA    1 
ATOM   4273 C  C     . GLY A 1 532 ? -28.968 -11.130 11.183  1.00 21.30  ? 824  GLY A C     1 
ATOM   4274 O  O     . GLY A 1 532 ? -28.317 -10.088 11.267  1.00 20.80  ? 824  GLY A O     1 
ATOM   4275 N  N     . GLU A 1 533 ? -28.406 -12.331 11.263  1.00 18.45  ? 825  GLU A N     1 
ATOM   4276 C  CA    . GLU A 1 533 ? -26.978 -12.466 11.453  1.00 19.77  ? 825  GLU A CA    1 
ATOM   4277 C  C     . GLU A 1 533 ? -26.224 -12.227 10.165  1.00 18.67  ? 825  GLU A C     1 
ATOM   4278 O  O     . GLU A 1 533 ? -25.021 -12.001 10.183  1.00 23.51  ? 825  GLU A O     1 
ATOM   4279 C  CB    . GLU A 1 533 ? -26.641 -13.847 12.019  1.00 25.84  ? 825  GLU A CB    1 
ATOM   4280 C  CG    . GLU A 1 533 ? -27.082 -13.988 13.461  1.00 33.39  ? 825  GLU A CG    1 
ATOM   4281 C  CD    . GLU A 1 533 ? -26.282 -15.023 14.224  1.00 49.30  ? 825  GLU A CD    1 
ATOM   4282 O  OE1   . GLU A 1 533 ? -25.798 -15.987 13.595  1.00 47.25  ? 825  GLU A OE1   1 
ATOM   4283 O  OE2   . GLU A 1 533 ? -26.132 -14.860 15.450  1.00 47.88  ? 825  GLU A OE2   1 
ATOM   4284 N  N     . ASP A 1 534 ? -26.943 -12.276 9.052   1.00 21.01  ? 826  ASP A N     1 
ATOM   4285 C  CA    . ASP A 1 534 ? -26.366 -11.928 7.766   1.00 16.28  ? 826  ASP A CA    1 
ATOM   4286 C  C     . ASP A 1 534 ? -27.319 -11.033 6.976   1.00 19.36  ? 826  ASP A C     1 
ATOM   4287 O  O     . ASP A 1 534 ? -28.506 -10.940 7.282   1.00 22.00  ? 826  ASP A O     1 
ATOM   4288 C  CB    . ASP A 1 534 ? -25.989 -13.185 6.967   1.00 17.53  ? 826  ASP A CB    1 
ATOM   4289 C  CG    . ASP A 1 534 ? -27.180 -14.039 6.614   1.00 26.51  ? 826  ASP A CG    1 
ATOM   4290 O  OD1   . ASP A 1 534 ? -27.812 -13.783 5.576   1.00 25.66  ? 826  ASP A OD1   1 
ATOM   4291 O  OD2   . ASP A 1 534 ? -27.484 -14.987 7.368   1.00 35.06  ? 826  ASP A OD2   1 
ATOM   4292 N  N     . TRP A 1 535 ? -26.787 -10.376 5.949   1.00 17.44  ? 827  TRP A N     1 
ATOM   4293 C  CA    . TRP A 1 535 ? -27.535 -9.364  5.223   1.00 18.22  ? 827  TRP A CA    1 
ATOM   4294 C  C     . TRP A 1 535 ? -28.774 -9.983  4.551   1.00 19.40  ? 827  TRP A C     1 
ATOM   4295 O  O     . TRP A 1 535 ? -29.854 -9.393  4.553   1.00 19.83  ? 827  TRP A O     1 
ATOM   4296 C  CB    . TRP A 1 535 ? -26.602 -8.691  4.210   1.00 16.84  ? 827  TRP A CB    1 
ATOM   4297 C  CG    . TRP A 1 535 ? -27.170 -7.521  3.459   1.00 18.39  ? 827  TRP A CG    1 
ATOM   4298 C  CD1   . TRP A 1 535 ? -28.397 -6.937  3.614   1.00 20.25  ? 827  TRP A CD1   1 
ATOM   4299 C  CD2   . TRP A 1 535 ? -26.504 -6.807  2.422   1.00 17.41  ? 827  TRP A CD2   1 
ATOM   4300 N  NE1   . TRP A 1 535 ? -28.530 -5.884  2.725   1.00 21.81  ? 827  TRP A NE1   1 
ATOM   4301 C  CE2   . TRP A 1 535 ? -27.383 -5.799  1.972   1.00 22.99  ? 827  TRP A CE2   1 
ATOM   4302 C  CE3   . TRP A 1 535 ? -25.246 -6.935  1.817   1.00 20.55  ? 827  TRP A CE3   1 
ATOM   4303 C  CZ2   . TRP A 1 535 ? -27.029 -4.897  0.958   1.00 28.05  ? 827  TRP A CZ2   1 
ATOM   4304 C  CZ3   . TRP A 1 535 ? -24.897 -6.060  0.805   1.00 23.03  ? 827  TRP A CZ3   1 
ATOM   4305 C  CH2   . TRP A 1 535 ? -25.789 -5.051  0.382   1.00 25.38  ? 827  TRP A CH2   1 
ATOM   4306 N  N     . LEU A 1 536 ? -28.625 -11.182 3.986   1.00 19.47  ? 828  LEU A N     1 
ATOM   4307 C  CA    . LEU A 1 536 ? -29.769 -11.830 3.329   1.00 19.98  ? 828  LEU A CA    1 
ATOM   4308 C  C     . LEU A 1 536 ? -30.897 -12.128 4.310   1.00 15.59  ? 828  LEU A C     1 
ATOM   4309 O  O     . LEU A 1 536 ? -32.072 -11.854 4.027   1.00 18.30  ? 828  LEU A O     1 
ATOM   4310 C  CB    . LEU A 1 536 ? -29.326 -13.123 2.635   1.00 20.17  ? 828  LEU A CB    1 
ATOM   4311 C  CG    . LEU A 1 536 ? -30.445 -13.860 1.887   1.00 23.22  ? 828  LEU A CG    1 
ATOM   4312 C  CD1   . LEU A 1 536 ? -30.994 -13.044 0.733   1.00 22.57  ? 828  LEU A CD1   1 
ATOM   4313 C  CD2   . LEU A 1 536 ? -29.917 -15.186 1.368   1.00 24.19  ? 828  LEU A CD2   1 
ATOM   4314 N  N     . SER A 1 537 ? -30.536 -12.704 5.464   1.00 20.75  ? 829  SER A N     1 
ATOM   4315 C  CA    . SER A 1 537 ? -31.504 -13.008 6.514   1.00 25.31  ? 829  SER A CA    1 
ATOM   4316 C  C     . SER A 1 537 ? -32.217 -11.759 6.997   1.00 25.39  ? 829  SER A C     1 
ATOM   4317 O  O     . SER A 1 537 ? -33.397 -11.813 7.343   1.00 23.61  ? 829  SER A O     1 
ATOM   4318 C  CB    . SER A 1 537 ? -30.831 -13.703 7.700   1.00 30.97  ? 829  SER A CB    1 
ATOM   4319 O  OG    . SER A 1 537 ? -30.381 -14.992 7.327   1.00 33.23  ? 829  SER A OG    1 
ATOM   4320 N  N     . ALA A 1 538 ? -31.499 -10.635 7.020   1.00 18.30  ? 830  ALA A N     1 
ATOM   4321 C  CA    . ALA A 1 538 ? -32.076 -9.364  7.421   1.00 20.18  ? 830  ALA A CA    1 
ATOM   4322 C  C     . ALA A 1 538 ? -32.968 -8.760  6.323   1.00 30.10  ? 830  ALA A C     1 
ATOM   4323 O  O     . ALA A 1 538 ? -33.810 -7.913  6.600   1.00 30.77  ? 830  ALA A O     1 
ATOM   4324 C  CB    . ALA A 1 538 ? -30.947 -8.362  7.802   1.00 21.38  ? 830  ALA A CB    1 
ATOM   4325 N  N     . LYS A 1 539 ? -32.761 -9.180  5.077   1.00 32.23  ? 831  LYS A N     1 
ATOM   4326 C  CA    . LYS A 1 539 ? -33.388 -8.510  3.930   1.00 37.47  ? 831  LYS A CA    1 
ATOM   4327 C  C     . LYS A 1 539 ? -34.657 -9.252  3.541   1.00 58.95  ? 831  LYS A C     1 
ATOM   4328 O  O     . LYS A 1 539 ? -35.551 -8.688  2.906   1.00 58.79  ? 831  LYS A O     1 
ATOM   4329 C  CB    . LYS A 1 539 ? -32.413 -8.435  2.749   1.00 37.09  ? 831  LYS A CB    1 
ATOM   4330 C  CG    . LYS A 1 539 ? -32.642 -7.282  1.775   1.00 49.26  ? 831  LYS A CG    1 
ATOM   4331 C  CD    . LYS A 1 539 ? -31.950 -7.566  0.442   1.00 52.46  ? 831  LYS A CD    1 
ATOM   4332 C  CE    . LYS A 1 539 ? -31.480 -6.302  -0.258  1.00 60.88  ? 831  LYS A CE    1 
ATOM   4333 N  NZ    . LYS A 1 539 ? -32.579 -5.332  -0.516  1.00 60.08  ? 831  LYS A NZ    1 
ATOM   4334 N  N     . GLU A 1 540 ? -34.713 -10.527 3.921   1.00 74.04  ? 832  GLU A N     1 
ATOM   4335 C  CA    . GLU A 1 540 ? -35.947 -11.313 3.887   1.00 91.46  ? 832  GLU A CA    1 
ATOM   4336 C  C     . GLU A 1 540 ? -36.613 -11.380 2.510   1.00 96.95  ? 832  GLU A C     1 
ATOM   4337 O  O     . GLU A 1 540 ? -37.805 -11.676 2.388   1.00 92.57  ? 832  GLU A O     1 
ATOM   4338 C  CB    . GLU A 1 540 ? -36.924 -10.783 4.943   1.00 97.33  ? 832  GLU A CB    1 
ATOM   4339 C  CG    . GLU A 1 540 ? -36.346 -10.790 6.354   1.00 101.05 ? 832  GLU A CG    1 
ATOM   4340 C  CD    . GLU A 1 540 ? -37.139 -9.940  7.327   1.00 106.45 ? 832  GLU A CD    1 
ATOM   4341 O  OE1   . GLU A 1 540 ? -37.909 -9.069  6.870   1.00 109.68 ? 832  GLU A OE1   1 
ATOM   4342 O  OE2   . GLU A 1 540 ? -36.990 -10.142 8.551   1.00 106.63 ? 832  GLU A OE2   1 
ATOM   4343 O  OXT   . GLU A 1 540 ? -35.975 -11.143 1.484   1.00 102.55 ? 832  GLU A OXT   1 
ATOM   4344 P  P     . DC  B 2 3   ? -7.884  4.917   -15.843 1.00 145.70 ? 103  DC  B P     1 
ATOM   4345 O  OP1   . DC  B 2 3   ? -8.227  5.090   -14.414 1.00 146.77 ? 103  DC  B OP1   1 
ATOM   4346 O  OP2   . DC  B 2 3   ? -8.706  4.035   -16.701 1.00 146.51 ? 103  DC  B OP2   1 
ATOM   4347 O  "O5'" . DC  B 2 3   ? -7.818  6.358   -16.533 1.00 128.88 ? 103  DC  B "O5'" 1 
ATOM   4348 C  "C5'" . DC  B 2 3   ? -8.905  6.832   -17.318 1.00 127.94 ? 103  DC  B "C5'" 1 
ATOM   4349 C  "C4'" . DC  B 2 3   ? -8.431  7.942   -18.238 1.00 126.74 ? 103  DC  B "C4'" 1 
ATOM   4350 O  "O4'" . DC  B 2 3   ? -7.136  7.574   -18.774 1.00 126.02 ? 103  DC  B "O4'" 1 
ATOM   4351 C  "C3'" . DC  B 2 3   ? -9.338  8.213   -19.431 1.00 125.79 ? 103  DC  B "C3'" 1 
ATOM   4352 O  "O3'" . DC  B 2 3   ? -10.140 9.353   -19.158 1.00 125.37 ? 103  DC  B "O3'" 1 
ATOM   4353 C  "C2'" . DC  B 2 3   ? -8.373  8.486   -20.581 1.00 125.11 ? 103  DC  B "C2'" 1 
ATOM   4354 C  "C1'" . DC  B 2 3   ? -7.113  7.723   -20.180 1.00 125.48 ? 103  DC  B "C1'" 1 
ATOM   4355 N  N1    . DC  B 2 3   ? -6.973  6.367   -20.800 1.00 125.57 ? 103  DC  B N1    1 
ATOM   4356 C  C2    . DC  B 2 3   ? -6.597  6.254   -22.144 1.00 125.21 ? 103  DC  B C2    1 
ATOM   4357 O  O2    . DC  B 2 3   ? -6.391  7.281   -22.804 1.00 124.80 ? 103  DC  B O2    1 
ATOM   4358 N  N3    . DC  B 2 3   ? -6.470  5.017   -22.687 1.00 123.45 ? 103  DC  B N3    1 
ATOM   4359 C  C4    . DC  B 2 3   ? -6.699  3.931   -21.947 1.00 120.90 ? 103  DC  B C4    1 
ATOM   4360 N  N4    . DC  B 2 3   ? -6.562  2.735   -22.527 1.00 118.02 ? 103  DC  B N4    1 
ATOM   4361 C  C5    . DC  B 2 3   ? -7.080  4.024   -20.577 1.00 122.34 ? 103  DC  B C5    1 
ATOM   4362 C  C6    . DC  B 2 3   ? -7.201  5.247   -20.052 1.00 124.27 ? 103  DC  B C6    1 
ATOM   4363 P  P     . DC  B 2 4   ? -11.722 9.311   -19.433 1.00 150.76 ? 104  DC  B P     1 
ATOM   4364 O  OP1   . DC  B 2 4   ? -12.318 10.510  -18.801 1.00 150.74 ? 104  DC  B OP1   1 
ATOM   4365 O  OP2   . DC  B 2 4   ? -12.204 7.962   -19.061 1.00 151.39 ? 104  DC  B OP2   1 
ATOM   4366 O  "O5'" . DC  B 2 4   ? -11.842 9.484   -21.018 1.00 123.88 ? 104  DC  B "O5'" 1 
ATOM   4367 C  "C5'" . DC  B 2 4   ? -11.449 10.705  -21.629 1.00 122.29 ? 104  DC  B "C5'" 1 
ATOM   4368 C  "C4'" . DC  B 2 4   ? -11.445 10.561  -23.137 1.00 120.46 ? 104  DC  B "C4'" 1 
ATOM   4369 O  "O4'" . DC  B 2 4   ? -10.332 9.727   -23.544 1.00 117.84 ? 104  DC  B "O4'" 1 
ATOM   4370 C  "C3'" . DC  B 2 4   ? -12.666 9.862   -23.713 1.00 121.57 ? 104  DC  B "C3'" 1 
ATOM   4371 O  "O3'" . DC  B 2 4   ? -13.735 10.789  -23.878 1.00 125.48 ? 104  DC  B "O3'" 1 
ATOM   4372 C  "C2'" . DC  B 2 4   ? -12.126 9.373   -25.052 1.00 117.67 ? 104  DC  B "C2'" 1 
ATOM   4373 C  "C1'" . DC  B 2 4   ? -10.681 9.012   -24.715 1.00 114.43 ? 104  DC  B "C1'" 1 
ATOM   4374 N  N1    . DC  B 2 4   ? -10.472 7.554   -24.475 1.00 107.89 ? 104  DC  B N1    1 
ATOM   4375 C  C2    . DC  B 2 4   ? -10.375 6.683   -25.565 1.00 106.67 ? 104  DC  B C2    1 
ATOM   4376 O  O2    . DC  B 2 4   ? -10.466 7.136   -26.712 1.00 106.15 ? 104  DC  B O2    1 
ATOM   4377 N  N3    . DC  B 2 4   ? -10.184 5.360   -25.332 1.00 107.99 ? 104  DC  B N3    1 
ATOM   4378 C  C4    . DC  B 2 4   ? -10.092 4.906   -24.081 1.00 106.75 ? 104  DC  B C4    1 
ATOM   4379 N  N4    . DC  B 2 4   ? -9.905  3.594   -23.905 1.00 104.23 ? 104  DC  B N4    1 
ATOM   4380 C  C5    . DC  B 2 4   ? -10.187 5.780   -22.958 1.00 106.38 ? 104  DC  B C5    1 
ATOM   4381 C  C6    . DC  B 2 4   ? -10.375 7.082   -23.199 1.00 106.22 ? 104  DC  B C6    1 
ATOM   4382 P  P     . DA  B 2 5   ? -15.259 10.277  -23.878 1.00 156.51 ? 105  DA  B P     1 
ATOM   4383 O  OP1   . DA  B 2 5   ? -16.137 11.465  -23.804 1.00 155.62 ? 105  DA  B OP1   1 
ATOM   4384 O  OP2   . DA  B 2 5   ? -15.374 9.213   -22.856 1.00 156.49 ? 105  DA  B OP2   1 
ATOM   4385 O  "O5'" . DA  B 2 5   ? -15.437 9.597   -25.316 1.00 100.83 ? 105  DA  B "O5'" 1 
ATOM   4386 C  "C5'" . DA  B 2 5   ? -15.260 10.373  -26.497 1.00 98.75  ? 105  DA  B "C5'" 1 
ATOM   4387 C  "C4'" . DA  B 2 5   ? -15.099 9.481   -27.715 1.00 95.65  ? 105  DA  B "C4'" 1 
ATOM   4388 O  "O4'" . DA  B 2 5   ? -13.917 8.654   -27.589 1.00 92.13  ? 105  DA  B "O4'" 1 
ATOM   4389 C  "C3'" . DA  B 2 5   ? -16.219 8.478   -27.926 1.00 95.44  ? 105  DA  B "C3'" 1 
ATOM   4390 O  "O3'" . DA  B 2 5   ? -17.322 9.113   -28.552 1.00 98.78  ? 105  DA  B "O3'" 1 
ATOM   4391 C  "C2'" . DA  B 2 5   ? -15.540 7.468   -28.843 1.00 90.16  ? 105  DA  B "C2'" 1 
ATOM   4392 C  "C1'" . DA  B 2 5   ? -14.124 7.432   -28.275 1.00 87.69  ? 105  DA  B "C1'" 1 
ATOM   4393 N  N9    . DA  B 2 5   ? -13.874 6.326   -27.353 1.00 81.60  ? 105  DA  B N9    1 
ATOM   4394 C  C8    . DA  B 2 5   ? -13.739 6.396   -25.993 1.00 78.67  ? 105  DA  B C8    1 
ATOM   4395 N  N7    . DA  B 2 5   ? -13.514 5.233   -25.423 1.00 74.21  ? 105  DA  B N7    1 
ATOM   4396 C  C5    . DA  B 2 5   ? -13.500 4.338   -26.482 1.00 69.32  ? 105  DA  B C5    1 
ATOM   4397 C  C6    . DA  B 2 5   ? -13.309 2.941   -26.548 1.00 61.51  ? 105  DA  B C6    1 
ATOM   4398 N  N6    . DA  B 2 5   ? -13.084 2.173   -25.475 1.00 50.52  ? 105  DA  B N6    1 
ATOM   4399 N  N1    . DA  B 2 5   ? -13.356 2.361   -27.766 1.00 62.84  ? 105  DA  B N1    1 
ATOM   4400 C  C2    . DA  B 2 5   ? -13.580 3.128   -28.840 1.00 67.63  ? 105  DA  B C2    1 
ATOM   4401 N  N3    . DA  B 2 5   ? -13.772 4.445   -28.904 1.00 72.66  ? 105  DA  B N3    1 
ATOM   4402 C  C4    . DA  B 2 5   ? -13.720 4.996   -27.679 1.00 74.40  ? 105  DA  B C4    1 
ATOM   4403 P  P     . DC  B 2 6   ? -18.821 8.699   -28.154 1.00 110.98 ? 106  DC  B P     1 
ATOM   4404 O  OP1   . DC  B 2 6   ? -19.739 9.698   -28.745 1.00 110.38 ? 106  DC  B OP1   1 
ATOM   4405 O  OP2   . DC  B 2 6   ? -18.842 8.449   -26.695 1.00 109.72 ? 106  DC  B OP2   1 
ATOM   4406 O  "O5'" . DC  B 2 6   ? -19.034 7.296   -28.892 1.00 95.84  ? 106  DC  B "O5'" 1 
ATOM   4407 C  "C5'" . DC  B 2 6   ? -18.813 7.198   -30.292 1.00 91.07  ? 106  DC  B "C5'" 1 
ATOM   4408 C  "C4'" . DC  B 2 6   ? -18.630 5.750   -30.711 1.00 86.82  ? 106  DC  B "C4'" 1 
ATOM   4409 O  "O4'" . DC  B 2 6   ? -17.396 5.217   -30.165 1.00 86.44  ? 106  DC  B "O4'" 1 
ATOM   4410 C  "C3'" . DC  B 2 6   ? -19.703 4.800   -30.206 1.00 80.02  ? 106  DC  B "C3'" 1 
ATOM   4411 O  "O3'" . DC  B 2 6   ? -20.842 4.855   -31.059 1.00 75.11  ? 106  DC  B "O3'" 1 
ATOM   4412 C  "C2'" . DC  B 2 6   ? -18.979 3.460   -30.291 1.00 80.64  ? 106  DC  B "C2'" 1 
ATOM   4413 C  "C1'" . DC  B 2 6   ? -17.561 3.840   -29.870 1.00 82.79  ? 106  DC  B "C1'" 1 
ATOM   4414 N  N1    . DC  B 2 6   ? -17.275 3.615   -28.418 1.00 78.55  ? 106  DC  B N1    1 
ATOM   4415 C  C2    . DC  B 2 6   ? -16.968 2.326   -27.967 1.00 76.04  ? 106  DC  B C2    1 
ATOM   4416 O  O2    . DC  B 2 6   ? -16.942 1.395   -28.781 1.00 77.79  ? 106  DC  B O2    1 
ATOM   4417 N  N3    . DC  B 2 6   ? -16.707 2.132   -26.649 1.00 72.11  ? 106  DC  B N3    1 
ATOM   4418 C  C4    . DC  B 2 6   ? -16.747 3.161   -25.802 1.00 70.29  ? 106  DC  B C4    1 
ATOM   4419 N  N4    . DC  B 2 6   ? -16.484 2.923   -24.512 1.00 65.01  ? 106  DC  B N4    1 
ATOM   4420 C  C5    . DC  B 2 6   ? -17.057 4.482   -26.242 1.00 75.96  ? 106  DC  B C5    1 
ATOM   4421 C  C6    . DC  B 2 6   ? -17.311 4.661   -27.543 1.00 76.82  ? 106  DC  B C6    1 
ATOM   4422 P  P     . DG  B 2 7   ? -22.310 4.586   -30.463 1.00 80.27  ? 107  DG  B P     1 
ATOM   4423 O  OP1   . DG  B 2 7   ? -23.299 4.974   -31.493 1.00 77.95  ? 107  DG  B OP1   1 
ATOM   4424 O  OP2   . DG  B 2 7   ? -22.369 5.191   -29.113 1.00 74.57  ? 107  DG  B OP2   1 
ATOM   4425 O  "O5'" . DG  B 2 7   ? -22.360 2.997   -30.279 1.00 51.55  ? 107  DG  B "O5'" 1 
ATOM   4426 C  "C5'" . DG  B 2 7   ? -22.132 2.129   -31.389 1.00 51.04  ? 107  DG  B "C5'" 1 
ATOM   4427 C  "C4'" . DG  B 2 7   ? -22.072 0.707   -30.875 1.00 48.79  ? 107  DG  B "C4'" 1 
ATOM   4428 O  "O4'" . DG  B 2 7   ? -20.897 0.572   -30.042 1.00 48.92  ? 107  DG  B "O4'" 1 
ATOM   4429 C  "C3'" . DG  B 2 7   ? -23.273 0.353   -30.006 1.00 48.34  ? 107  DG  B "C3'" 1 
ATOM   4430 O  "O3'" . DG  B 2 7   ? -24.098 -0.583  -30.665 1.00 40.52  ? 107  DG  B "O3'" 1 
ATOM   4431 C  "C2'" . DG  B 2 7   ? -22.708 -0.280  -28.746 1.00 52.12  ? 107  DG  B "C2'" 1 
ATOM   4432 C  "C1'" . DG  B 2 7   ? -21.199 -0.225  -28.918 1.00 54.05  ? 107  DG  B "C1'" 1 
ATOM   4433 N  N9    . DG  B 2 7   ? -20.603 0.356   -27.728 1.00 52.19  ? 107  DG  B N9    1 
ATOM   4434 C  C8    . DG  B 2 7   ? -20.554 1.679   -27.356 1.00 44.71  ? 107  DG  B C8    1 
ATOM   4435 N  N7    . DG  B 2 7   ? -19.949 1.858   -26.211 1.00 47.71  ? 107  DG  B N7    1 
ATOM   4436 C  C5    . DG  B 2 7   ? -19.589 0.574   -25.810 1.00 44.57  ? 107  DG  B C5    1 
ATOM   4437 C  C6    . DG  B 2 7   ? -18.913 0.129   -24.656 1.00 38.40  ? 107  DG  B C6    1 
ATOM   4438 O  O6    . DG  B 2 7   ? -18.481 0.818   -23.722 1.00 36.11  ? 107  DG  B O6    1 
ATOM   4439 N  N1    . DG  B 2 7   ? -18.756 -1.261  -24.648 1.00 44.42  ? 107  DG  B N1    1 
ATOM   4440 C  C2    . DG  B 2 7   ? -19.203 -2.115  -25.636 1.00 42.66  ? 107  DG  B C2    1 
ATOM   4441 N  N2    . DG  B 2 7   ? -18.973 -3.430  -25.474 1.00 43.22  ? 107  DG  B N2    1 
ATOM   4442 N  N3    . DG  B 2 7   ? -19.839 -1.704  -26.720 1.00 47.55  ? 107  DG  B N3    1 
ATOM   4443 C  C4    . DG  B 2 7   ? -19.991 -0.359  -26.733 1.00 44.30  ? 107  DG  B C4    1 
ATOM   4444 P  P     . DG  B 2 8   ? -25.517 -0.996  -30.032 1.00 40.86  ? 108  DG  B P     1 
ATOM   4445 O  OP1   . DG  B 2 8   ? -26.392 -1.397  -31.155 1.00 49.30  ? 108  DG  B OP1   1 
ATOM   4446 O  OP2   . DG  B 2 8   ? -25.952 0.048   -29.081 1.00 52.57  ? 108  DG  B OP2   1 
ATOM   4447 O  "O5'" . DG  B 2 8   ? -25.180 -2.284  -29.134 1.00 38.67  ? 108  DG  B "O5'" 1 
ATOM   4448 C  "C5'" . DG  B 2 8   ? -24.503 -3.407  -29.665 1.00 32.80  ? 108  DG  B "C5'" 1 
ATOM   4449 C  "C4'" . DG  B 2 8   ? -24.303 -4.461  -28.586 1.00 34.75  ? 108  DG  B "C4'" 1 
ATOM   4450 O  "O4'" . DG  B 2 8   ? -23.333 -3.994  -27.605 1.00 35.92  ? 108  DG  B "O4'" 1 
ATOM   4451 C  "C3'" . DG  B 2 8   ? -25.548 -4.846  -27.792 1.00 32.77  ? 108  DG  B "C3'" 1 
ATOM   4452 O  "O3'" . DG  B 2 8   ? -25.468 -6.241  -27.502 1.00 29.27  ? 108  DG  B "O3'" 1 
ATOM   4453 C  "C2'" . DG  B 2 8   ? -25.420 -4.005  -26.524 1.00 32.43  ? 108  DG  B "C2'" 1 
ATOM   4454 C  "C1'" . DG  B 2 8   ? -23.910 -3.999  -26.314 1.00 33.83  ? 108  DG  B "C1'" 1 
ATOM   4455 N  N9    . DG  B 2 8   ? -23.432 -2.835  -25.567 1.00 29.39  ? 108  DG  B N9    1 
ATOM   4456 C  C8    . DG  B 2 8   ? -23.736 -1.519  -25.823 1.00 34.34  ? 108  DG  B C8    1 
ATOM   4457 N  N7    . DG  B 2 8   ? -23.179 -0.681  -24.994 1.00 33.46  ? 108  DG  B N7    1 
ATOM   4458 C  C5    . DG  B 2 8   ? -22.459 -1.492  -24.126 1.00 30.84  ? 108  DG  B C5    1 
ATOM   4459 C  C6    . DG  B 2 8   ? -21.653 -1.147  -23.013 1.00 33.15  ? 108  DG  B C6    1 
ATOM   4460 O  O6    . DG  B 2 8   ? -21.414 -0.020  -22.568 1.00 31.81  ? 108  DG  B O6    1 
ATOM   4461 N  N1    . DG  B 2 8   ? -21.102 -2.265  -22.397 1.00 32.88  ? 108  DG  B N1    1 
ATOM   4462 C  C2    . DG  B 2 8   ? -21.311 -3.563  -22.799 1.00 29.95  ? 108  DG  B C2    1 
ATOM   4463 N  N2    . DG  B 2 8   ? -20.697 -4.521  -22.085 1.00 35.45  ? 108  DG  B N2    1 
ATOM   4464 N  N3    . DG  B 2 8   ? -22.065 -3.894  -23.838 1.00 28.89  ? 108  DG  B N3    1 
ATOM   4465 C  C4    . DG  B 2 8   ? -22.607 -2.820  -24.457 1.00 29.62  ? 108  DG  B C4    1 
ATOM   4466 P  P     . DC  B 2 9   ? -26.742 -7.025  -26.925 1.00 29.89  ? 109  DC  B P     1 
ATOM   4467 O  OP1   . DC  B 2 9   ? -26.634 -8.409  -27.456 1.00 32.07  ? 109  DC  B OP1   1 
ATOM   4468 O  OP2   . DC  B 2 9   ? -27.983 -6.258  -27.081 1.00 33.62  ? 109  DC  B OP2   1 
ATOM   4469 O  "O5'" . DC  B 2 9   ? -26.442 -7.111  -25.336 1.00 29.77  ? 109  DC  B "O5'" 1 
ATOM   4470 C  "C5'" . DC  B 2 9   ? -25.221 -7.708  -24.929 1.00 30.96  ? 109  DC  B "C5'" 1 
ATOM   4471 C  "C4'" . DC  B 2 9   ? -24.927 -7.329  -23.485 1.00 34.11  ? 109  DC  B "C4'" 1 
ATOM   4472 O  "O4'" . DC  B 2 9   ? -24.592 -5.922  -23.396 1.00 33.17  ? 109  DC  B "O4'" 1 
ATOM   4473 C  "C3'" . DC  B 2 9   ? -26.104 -7.518  -22.534 1.00 33.72  ? 109  DC  B "C3'" 1 
ATOM   4474 O  "O3'" . DC  B 2 9   ? -25.776 -8.542  -21.592 1.00 30.77  ? 109  DC  B "O3'" 1 
ATOM   4475 C  "C2'" . DC  B 2 9   ? -26.279 -6.162  -21.849 1.00 35.33  ? 109  DC  B "C2'" 1 
ATOM   4476 C  "C1'" . DC  B 2 9   ? -24.919 -5.520  -22.088 1.00 35.39  ? 109  DC  B "C1'" 1 
ATOM   4477 N  N1    . DC  B 2 9   ? -24.924 -4.031  -22.025 1.00 30.31  ? 109  DC  B N1    1 
ATOM   4478 C  C2    . DC  B 2 9   ? -24.141 -3.403  -21.052 1.00 31.06  ? 109  DC  B C2    1 
ATOM   4479 O  O2    . DC  B 2 9   ? -23.465 -4.108  -20.275 1.00 28.18  ? 109  DC  B O2    1 
ATOM   4480 N  N3    . DC  B 2 9   ? -24.148 -2.046  -21.004 1.00 29.87  ? 109  DC  B N3    1 
ATOM   4481 C  C4    . DC  B 2 9   ? -24.888 -1.332  -21.861 1.00 32.25  ? 109  DC  B C4    1 
ATOM   4482 N  N4    . DC  B 2 9   ? -24.860 0.009   -21.763 1.00 30.27  ? 109  DC  B N4    1 
ATOM   4483 C  C5    . DC  B 2 9   ? -25.697 -1.964  -22.859 1.00 32.22  ? 109  DC  B C5    1 
ATOM   4484 C  C6    . DC  B 2 9   ? -25.679 -3.304  -22.903 1.00 30.91  ? 109  DC  B C6    1 
ATOM   4485 P  P     . DG  B 2 10  ? -26.875 -9.048  -20.537 1.00 30.15  ? 110  DG  B P     1 
ATOM   4486 O  OP1   . DG  B 2 10  ? -26.535 -10.464 -20.286 1.00 37.95  ? 110  DG  B OP1   1 
ATOM   4487 O  OP2   . DG  B 2 10  ? -28.248 -8.635  -20.874 1.00 32.58  ? 110  DG  B OP2   1 
ATOM   4488 O  "O5'" . DG  B 2 10  ? -26.548 -8.214  -19.194 1.00 31.25  ? 110  DG  B "O5'" 1 
ATOM   4489 C  "C5'" . DG  B 2 10  ? -25.266 -8.304  -18.621 1.00 32.09  ? 110  DG  B "C5'" 1 
ATOM   4490 C  "C4'" . DG  B 2 10  ? -25.290 -7.640  -17.255 1.00 31.98  ? 110  DG  B "C4'" 1 
ATOM   4491 O  "O4'" . DG  B 2 10  ? -24.954 -6.244  -17.374 1.00 32.83  ? 110  DG  B "O4'" 1 
ATOM   4492 C  "C3'" . DG  B 2 10  ? -26.628 -7.666  -16.534 1.00 40.04  ? 110  DG  B "C3'" 1 
ATOM   4493 O  "O3'" . DG  B 2 10  ? -26.330 -7.696  -15.161 1.00 49.08  ? 110  DG  B "O3'" 1 
ATOM   4494 C  "C2'" . DG  B 2 10  ? -27.216 -6.308  -16.881 1.00 37.90  ? 110  DG  B "C2'" 1 
ATOM   4495 C  "C1'" . DG  B 2 10  ? -25.946 -5.495  -16.707 1.00 35.66  ? 110  DG  B "C1'" 1 
ATOM   4496 N  N9    . DG  B 2 10  ? -26.051 -4.187  -17.318 1.00 31.96  ? 110  DG  B N9    1 
ATOM   4497 C  C8    . DG  B 2 10  ? -26.510 -3.920  -18.585 1.00 29.82  ? 110  DG  B C8    1 
ATOM   4498 N  N7    . DG  B 2 10  ? -26.501 -2.651  -18.870 1.00 32.46  ? 110  DG  B N7    1 
ATOM   4499 C  C5    . DG  B 2 10  ? -26.012 -2.045  -17.715 1.00 29.55  ? 110  DG  B C5    1 
ATOM   4500 C  C6    . DG  B 2 10  ? -25.791 -0.680  -17.448 1.00 27.13  ? 110  DG  B C6    1 
ATOM   4501 O  O6    . DG  B 2 10  ? -25.979 0.273   -18.213 1.00 24.78  ? 110  DG  B O6    1 
ATOM   4502 N  N1    . DG  B 2 10  ? -25.293 -0.483  -16.156 1.00 21.93  ? 110  DG  B N1    1 
ATOM   4503 C  C2    . DG  B 2 10  ? -25.034 -1.488  -15.245 1.00 18.78  ? 110  DG  B C2    1 
ATOM   4504 N  N2    . DG  B 2 10  ? -24.550 -1.104  -14.054 1.00 22.75  ? 110  DG  B N2    1 
ATOM   4505 N  N3    . DG  B 2 10  ? -25.237 -2.785  -15.490 1.00 27.05  ? 110  DG  B N3    1 
ATOM   4506 C  C4    . DG  B 2 10  ? -25.731 -2.973  -16.742 1.00 26.51  ? 110  DG  B C4    1 
ATOM   4507 P  P     . DC  B 2 11  ? -27.253 -8.530  -14.148 1.00 66.65  ? 111  DC  B P     1 
ATOM   4508 O  OP1   . DC  B 2 11  ? -26.722 -9.908  -14.085 1.00 67.94  ? 111  DC  B OP1   1 
ATOM   4509 O  OP2   . DC  B 2 11  ? -28.672 -8.288  -14.524 1.00 49.54  ? 111  DC  B OP2   1 
ATOM   4510 O  "O5'" . DC  B 2 11  ? -26.965 -7.821  -12.736 1.00 42.93  ? 111  DC  B "O5'" 1 
ATOM   4511 C  "C5'" . DC  B 2 11  ? -28.031 -7.049  -12.256 1.00 33.20  ? 111  DC  B "C5'" 1 
ATOM   4512 C  "C4'" . DC  B 2 11  ? -27.629 -5.834  -11.443 1.00 25.02  ? 111  DC  B "C4'" 1 
ATOM   4513 O  "O4'" . DC  B 2 11  ? -26.871 -4.873  -12.209 1.00 24.55  ? 111  DC  B "O4'" 1 
ATOM   4514 C  "C3'" . DC  B 2 11  ? -28.894 -5.084  -11.150 1.00 26.47  ? 111  DC  B "C3'" 1 
ATOM   4515 O  "O3'" . DC  B 2 11  ? -29.486 -5.819  -10.102 1.00 26.29  ? 111  DC  B "O3'" 1 
ATOM   4516 C  "C2'" . DC  B 2 11  ? -28.400 -3.683  -10.798 1.00 20.63  ? 111  DC  B "C2'" 1 
ATOM   4517 C  "C1'" . DC  B 2 11  ? -27.323 -3.563  -11.869 1.00 24.08  ? 111  DC  B "C1'" 1 
ATOM   4518 N  N1    . DC  B 2 11  ? -27.811 -2.884  -13.114 1.00 22.96  ? 111  DC  B N1    1 
ATOM   4519 C  C2    . DC  B 2 11  ? -27.820 -1.487  -13.119 1.00 21.45  ? 111  DC  B C2    1 
ATOM   4520 O  O2    . DC  B 2 11  ? -27.422 -0.912  -12.104 1.00 22.33  ? 111  DC  B O2    1 
ATOM   4521 N  N3    . DC  B 2 11  ? -28.238 -0.824  -14.226 1.00 25.92  ? 111  DC  B N3    1 
ATOM   4522 C  C4    . DC  B 2 11  ? -28.649 -1.513  -15.291 1.00 25.77  ? 111  DC  B C4    1 
ATOM   4523 N  N4    . DC  B 2 11  ? -29.050 -0.825  -16.370 1.00 28.84  ? 111  DC  B N4    1 
ATOM   4524 C  C5    . DC  B 2 11  ? -28.670 -2.944  -15.305 1.00 28.02  ? 111  DC  B C5    1 
ATOM   4525 C  C6    . DC  B 2 11  ? -28.244 -3.584  -14.205 1.00 29.20  ? 111  DC  B C6    1 
HETATM 4526 N  N1    . DOC B 2 12  ? -31.264 -0.363  -10.870 1.00 26.11  ? 112  DOC B N1    1 
HETATM 4527 C  C2    . DOC B 2 12  ? -31.372 0.798   -11.581 1.00 29.47  ? 112  DOC B C2    1 
HETATM 4528 N  N3    . DOC B 2 12  ? -31.563 0.813   -12.914 1.00 26.12  ? 112  DOC B N3    1 
HETATM 4529 C  C4    . DOC B 2 12  ? -31.651 -0.354  -13.594 1.00 24.17  ? 112  DOC B C4    1 
HETATM 4530 C  C5    . DOC B 2 12  ? -31.542 -1.574  -12.926 1.00 30.11  ? 112  DOC B C5    1 
HETATM 4531 C  C6    . DOC B 2 12  ? -31.339 -1.538  -11.511 1.00 29.01  ? 112  DOC B C6    1 
HETATM 4532 O  O2    . DOC B 2 12  ? -31.314 1.893   -11.031 1.00 27.69  ? 112  DOC B O2    1 
HETATM 4533 N  N4    . DOC B 2 12  ? -31.850 -0.348  -15.045 1.00 29.51  ? 112  DOC B N4    1 
HETATM 4534 C  "C1'" . DOC B 2 12  ? -31.071 -0.396  -9.448  1.00 34.26  ? 112  DOC B "C1'" 1 
HETATM 4535 C  "C2'" . DOC B 2 12  ? -32.358 -0.458  -8.700  1.00 28.80  ? 112  DOC B "C2'" 1 
HETATM 4536 C  "C3'" . DOC B 2 12  ? -32.503 -1.825  -8.255  1.00 34.26  ? 112  DOC B "C3'" 1 
HETATM 4537 C  "C4'" . DOC B 2 12  ? -31.110 -2.284  -8.087  1.00 28.99  ? 112  DOC B "C4'" 1 
HETATM 4538 O  "O4'" . DOC B 2 12  ? -30.335 -1.532  -9.028  1.00 28.40  ? 112  DOC B "O4'" 1 
HETATM 4539 C  "C5'" . DOC B 2 12  ? -31.002 -3.706  -8.304  1.00 32.27  ? 112  DOC B "C5'" 1 
HETATM 4540 O  "O5'" . DOC B 2 12  ? -31.523 -4.225  -9.486  1.00 21.36  ? 112  DOC B "O5'" 1 
HETATM 4541 P  P     . DOC B 2 12  ? -31.053 -5.657  -9.969  1.00 30.39  ? 112  DOC B P     1 
HETATM 4542 O  OP1   . DOC B 2 12  ? -31.455 -6.715  -8.930  1.00 29.77  ? 112  DOC B OP1   1 
HETATM 4543 O  OP2   . DOC B 2 12  ? -31.714 -5.923  -11.324 1.00 26.60  ? 112  DOC B OP2   1 
ATOM   4544 O  "O5'" . A   C 3 1   ? -38.886 6.305   -38.965 1.00 176.30 ? 1    A   G "O5'" 1 
ATOM   4545 C  "C5'" . A   C 3 1   ? -38.133 6.838   -37.880 1.00 174.65 ? 1    A   G "C5'" 1 
ATOM   4546 C  "C4'" . A   C 3 1   ? -37.881 5.808   -36.803 1.00 171.56 ? 1    A   G "C4'" 1 
ATOM   4547 O  "O4'" . A   C 3 1   ? -39.147 5.379   -36.234 1.00 167.87 ? 1    A   G "O4'" 1 
ATOM   4548 C  "C3'" . A   C 3 1   ? -37.166 4.536   -37.258 1.00 170.23 ? 1    A   G "C3'" 1 
ATOM   4549 O  "O3'" . A   C 3 1   ? -36.345 4.004   -36.207 1.00 170.29 ? 1    A   G "O3'" 1 
ATOM   4550 C  "C2'" . A   C 3 1   ? -38.329 3.581   -37.507 1.00 167.08 ? 1    A   G "C2'" 1 
ATOM   4551 O  "O2'" . A   C 3 1   ? -37.989 2.211   -37.444 1.00 167.06 ? 1    A   G "O2'" 1 
ATOM   4552 C  "C1'" . A   C 3 1   ? -39.289 3.979   -36.388 1.00 162.72 ? 1    A   G "C1'" 1 
ATOM   4553 N  N9    . A   C 3 1   ? -40.700 3.679   -36.656 1.00 152.60 ? 1    A   G N9    1 
ATOM   4554 C  C8    . A   C 3 1   ? -41.292 2.441   -36.616 1.00 149.33 ? 1    A   G C8    1 
ATOM   4555 N  N7    . A   C 3 1   ? -42.569 2.452   -36.906 1.00 146.21 ? 1    A   G N7    1 
ATOM   4556 C  C5    . A   C 3 1   ? -42.843 3.788   -37.160 1.00 142.54 ? 1    A   G C5    1 
ATOM   4557 C  C6    . A   C 3 1   ? -44.027 4.454   -37.523 1.00 136.14 ? 1    A   G C6    1 
ATOM   4558 N  N6    . A   C 3 1   ? -45.198 3.838   -37.698 1.00 131.90 ? 1    A   G N6    1 
ATOM   4559 N  N1    . A   C 3 1   ? -43.970 5.792   -37.702 1.00 136.14 ? 1    A   G N1    1 
ATOM   4560 C  C2    . A   C 3 1   ? -42.797 6.409   -37.527 1.00 138.09 ? 1    A   G C2    1 
ATOM   4561 N  N3    . A   C 3 1   ? -41.619 5.892   -37.188 1.00 141.10 ? 1    A   G N3    1 
ATOM   4562 C  C4    . A   C 3 1   ? -41.701 4.559   -37.018 1.00 145.34 ? 1    A   G C4    1 
ATOM   4563 P  P     . A   C 3 2   ? -35.702 4.922   -35.046 1.00 218.86 ? 2    A   G P     1 
ATOM   4564 O  OP1   . A   C 3 2   ? -34.571 4.143   -34.482 1.00 219.16 ? 2    A   G OP1   1 
ATOM   4565 O  OP2   . A   C 3 2   ? -36.771 5.352   -34.106 1.00 219.22 ? 2    A   G OP2   1 
ATOM   4566 O  "O5'" . A   C 3 2   ? -35.043 6.159   -35.810 1.00 164.52 ? 2    A   G "O5'" 1 
ATOM   4567 C  "C5'" . A   C 3 2   ? -35.165 7.488   -35.311 1.00 166.95 ? 2    A   G "C5'" 1 
ATOM   4568 C  "C4'" . A   C 3 2   ? -34.716 7.601   -33.874 1.00 170.36 ? 2    A   G "C4'" 1 
ATOM   4569 O  "O4'" . A   C 3 2   ? -33.277 7.405   -33.798 1.00 171.75 ? 2    A   G "O4'" 1 
ATOM   4570 C  "C3'" . A   C 3 2   ? -34.994 8.949   -33.214 1.00 172.82 ? 2    A   G "C3'" 1 
ATOM   4571 O  "O3'" . A   C 3 2   ? -35.213 8.753   -31.816 1.00 173.72 ? 2    A   G "O3'" 1 
ATOM   4572 C  "C2'" . A   C 3 2   ? -33.671 9.680   -33.405 1.00 173.65 ? 2    A   G "C2'" 1 
ATOM   4573 O  "O2'" . A   C 3 2   ? -33.447 10.739  -32.498 1.00 174.38 ? 2    A   G "O2'" 1 
ATOM   4574 C  "C1'" . A   C 3 2   ? -32.678 8.540   -33.204 1.00 172.89 ? 2    A   G "C1'" 1 
ATOM   4575 N  N9    . A   C 3 2   ? -31.365 8.748   -33.817 1.00 173.05 ? 2    A   G N9    1 
ATOM   4576 C  C8    . A   C 3 2   ? -30.991 8.533   -35.120 1.00 173.13 ? 2    A   G C8    1 
ATOM   4577 N  N7    . A   C 3 2   ? -29.729 8.798   -35.354 1.00 173.51 ? 2    A   G N7    1 
ATOM   4578 C  C5    . A   C 3 2   ? -29.239 9.204   -34.120 1.00 174.40 ? 2    A   G C5    1 
ATOM   4579 C  C6    . A   C 3 2   ? -27.966 9.622   -33.694 1.00 176.04 ? 2    A   G C6    1 
ATOM   4580 N  N6    . A   C 3 2   ? -26.906 9.705   -34.501 1.00 177.53 ? 2    A   G N6    1 
ATOM   4581 N  N1    . A   C 3 2   ? -27.814 9.958   -32.394 1.00 175.02 ? 2    A   G N1    1 
ATOM   4582 C  C2    . A   C 3 2   ? -28.875 9.878   -31.585 1.00 173.48 ? 2    A   G C2    1 
ATOM   4583 N  N3    . A   C 3 2   ? -30.120 9.498   -31.864 1.00 172.62 ? 2    A   G N3    1 
ATOM   4584 C  C4    . A   C 3 2   ? -30.235 9.168   -33.162 1.00 173.24 ? 2    A   G C4    1 
ATOM   4585 P  P     . A   C 3 3   ? -36.594 8.140   -31.261 1.00 138.26 ? 3    A   G P     1 
ATOM   4586 O  OP1   . A   C 3 3   ? -36.706 6.717   -31.668 1.00 138.75 ? 3    A   G OP1   1 
ATOM   4587 O  OP2   . A   C 3 3   ? -37.694 9.079   -31.592 1.00 136.30 ? 3    A   G OP2   1 
ATOM   4588 O  "O5'" . A   C 3 3   ? -36.385 8.143   -29.682 1.00 99.27  ? 3    A   G "O5'" 1 
ATOM   4589 C  "C5'" . A   C 3 3   ? -35.087 7.974   -29.115 1.00 98.28  ? 3    A   G "C5'" 1 
ATOM   4590 C  "C4'" . A   C 3 3   ? -34.777 6.521   -28.847 1.00 100.08 ? 3    A   G "C4'" 1 
ATOM   4591 O  "O4'" . A   C 3 3   ? -34.081 5.952   -29.994 1.00 108.51 ? 3    A   G "O4'" 1 
ATOM   4592 C  "C3'" . A   C 3 3   ? -33.880 6.249   -27.636 1.00 97.10  ? 3    A   G "C3'" 1 
ATOM   4593 O  "O3'" . A   C 3 3   ? -34.234 4.988   -27.070 1.00 91.24  ? 3    A   G "O3'" 1 
ATOM   4594 C  "C2'" . A   C 3 3   ? -32.508 6.102   -28.277 1.00 106.30 ? 3    A   G "C2'" 1 
ATOM   4595 O  "O2'" . A   C 3 3   ? -31.570 5.387   -27.500 1.00 107.78 ? 3    A   G "O2'" 1 
ATOM   4596 C  "C1'" . A   C 3 3   ? -32.876 5.355   -29.554 1.00 114.24 ? 3    A   G "C1'" 1 
ATOM   4597 N  N9    . A   C 3 3   ? -31.884 5.386   -30.642 1.00 126.08 ? 3    A   G N9    1 
ATOM   4598 C  C8    . A   C 3 3   ? -32.089 4.824   -31.879 1.00 127.15 ? 3    A   G C8    1 
ATOM   4599 N  N7    . A   C 3 3   ? -31.087 4.951   -32.709 1.00 130.22 ? 3    A   G N7    1 
ATOM   4600 C  C5    . A   C 3 3   ? -30.141 5.646   -31.973 1.00 136.08 ? 3    A   G C5    1 
ATOM   4601 C  C6    . A   C 3 3   ? -28.848 6.090   -32.305 1.00 141.98 ? 3    A   G C6    1 
ATOM   4602 N  N6    . A   C 3 3   ? -28.281 5.889   -33.497 1.00 143.29 ? 3    A   G N6    1 
ATOM   4603 N  N1    . A   C 3 3   ? -28.149 6.758   -31.363 1.00 143.52 ? 3    A   G N1    1 
ATOM   4604 C  C2    . A   C 3 3   ? -28.719 6.955   -30.170 1.00 142.00 ? 3    A   G C2    1 
ATOM   4605 N  N3    . A   C 3 3   ? -29.922 6.588   -29.744 1.00 138.71 ? 3    A   G N3    1 
ATOM   4606 C  C4    . A   C 3 3   ? -30.610 5.929   -30.698 1.00 134.25 ? 3    A   G C4    1 
ATOM   4607 P  P     . G   C 3 4   ? -35.474 4.841   -26.061 1.00 59.17  ? 4    G   G P     1 
ATOM   4608 O  OP1   . G   C 3 4   ? -35.284 3.577   -25.315 1.00 69.40  ? 4    G   G OP1   1 
ATOM   4609 O  OP2   . G   C 3 4   ? -36.748 5.095   -26.783 1.00 52.07  ? 4    G   G OP2   1 
ATOM   4610 O  "O5'" . G   C 3 4   ? -35.272 6.022   -25.016 1.00 46.50  ? 4    G   G "O5'" 1 
ATOM   4611 C  "C5'" . G   C 3 4   ? -34.325 5.917   -23.965 1.00 35.02  ? 4    G   G "C5'" 1 
ATOM   4612 C  "C4'" . G   C 3 4   ? -34.775 6.719   -22.773 1.00 23.62  ? 4    G   G "C4'" 1 
ATOM   4613 O  "O4'" . G   C 3 4   ? -35.877 6.045   -22.118 1.00 26.39  ? 4    G   G "O4'" 1 
ATOM   4614 C  "C3'" . G   C 3 4   ? -33.741 6.916   -21.677 1.00 24.76  ? 4    G   G "C3'" 1 
ATOM   4615 O  "O3'" . G   C 3 4   ? -32.902 8.008   -21.976 1.00 22.93  ? 4    G   G "O3'" 1 
ATOM   4616 C  "C2'" . G   C 3 4   ? -34.606 7.145   -20.446 1.00 25.75  ? 4    G   G "C2'" 1 
ATOM   4617 O  "O2'" . G   C 3 4   ? -35.134 8.468   -20.453 1.00 27.31  ? 4    G   G "O2'" 1 
ATOM   4618 C  "C1'" . G   C 3 4   ? -35.759 6.184   -20.717 1.00 30.27  ? 4    G   G "C1'" 1 
ATOM   4619 N  N9    . G   C 3 4   ? -35.538 4.842   -20.151 1.00 25.31  ? 4    G   G N9    1 
ATOM   4620 C  C8    . G   C 3 4   ? -35.470 3.666   -20.870 1.00 32.44  ? 4    G   G C8    1 
ATOM   4621 N  N7    . G   C 3 4   ? -35.302 2.615   -20.110 1.00 30.13  ? 4    G   G N7    1 
ATOM   4622 C  C5    . G   C 3 4   ? -35.286 3.129   -18.816 1.00 32.06  ? 4    G   G C5    1 
ATOM   4623 C  C6    . G   C 3 4   ? -35.139 2.464   -17.571 1.00 33.39  ? 4    G   G C6    1 
ATOM   4624 O  O6    . G   C 3 4   ? -35.000 1.254   -17.368 1.00 31.06  ? 4    G   G O6    1 
ATOM   4625 N  N1    . G   C 3 4   ? -35.164 3.356   -16.509 1.00 26.48  ? 4    G   G N1    1 
ATOM   4626 C  C2    . G   C 3 4   ? -35.319 4.712   -16.603 1.00 29.53  ? 4    G   G C2    1 
ATOM   4627 N  N2    . G   C 3 4   ? -35.318 5.394   -15.435 1.00 24.93  ? 4    G   G N2    1 
ATOM   4628 N  N3    . G   C 3 4   ? -35.456 5.350   -17.759 1.00 25.26  ? 4    G   G N3    1 
ATOM   4629 C  C4    . G   C 3 4   ? -35.436 4.501   -18.817 1.00 25.77  ? 4    G   G C4    1 
ATOM   4630 P  P     . G   C 3 5   ? -31.384 8.070   -21.494 1.00 28.24  ? 5    G   G P     1 
ATOM   4631 O  OP1   . G   C 3 5   ? -30.808 9.244   -22.199 1.00 33.49  ? 5    G   G OP1   1 
ATOM   4632 O  OP2   . G   C 3 5   ? -30.773 6.726   -21.653 1.00 36.61  ? 5    G   G OP2   1 
ATOM   4633 O  "O5'" . G   C 3 5   ? -31.486 8.372   -19.931 1.00 28.50  ? 5    G   G "O5'" 1 
ATOM   4634 C  "C5'" . G   C 3 5   ? -31.995 9.607   -19.445 1.00 27.65  ? 5    G   G "C5'" 1 
ATOM   4635 C  "C4'" . G   C 3 5   ? -31.963 9.645   -17.937 1.00 25.34  ? 5    G   G "C4'" 1 
ATOM   4636 O  "O4'" . G   C 3 5   ? -32.889 8.657   -17.416 1.00 26.24  ? 5    G   G "O4'" 1 
ATOM   4637 C  "C3'" . G   C 3 5   ? -30.630 9.273   -17.297 1.00 25.59  ? 5    G   G "C3'" 1 
ATOM   4638 O  "O3'" . G   C 3 5   ? -29.721 10.354  -17.242 1.00 24.30  ? 5    G   G "O3'" 1 
ATOM   4639 C  "C2'" . G   C 3 5   ? -31.051 8.765   -15.927 1.00 22.63  ? 5    G   G "C2'" 1 
ATOM   4640 O  "O2'" . G   C 3 5   ? -31.371 9.860   -15.074 1.00 29.51  ? 5    G   G "O2'" 1 
ATOM   4641 C  "C1'" . G   C 3 5   ? -32.346 8.042   -16.269 1.00 27.25  ? 5    G   G "C1'" 1 
ATOM   4642 N  N9    . G   C 3 5   ? -32.148 6.614   -16.578 1.00 25.81  ? 5    G   G N9    1 
ATOM   4643 C  C8    . G   C 3 5   ? -32.164 6.034   -17.825 1.00 31.66  ? 5    G   G C8    1 
ATOM   4644 N  N7    . G   C 3 5   ? -31.994 4.740   -17.799 1.00 28.08  ? 5    G   G N7    1 
ATOM   4645 C  C5    . G   C 3 5   ? -31.869 4.444   -16.449 1.00 25.43  ? 5    G   G C5    1 
ATOM   4646 C  C6    . G   C 3 5   ? -31.684 3.198   -15.803 1.00 23.26  ? 5    G   G C6    1 
ATOM   4647 O  O6    . G   C 3 5   ? -31.578 2.073   -16.295 1.00 27.91  ? 5    G   G O6    1 
ATOM   4648 N  N1    . G   C 3 5   ? -31.605 3.353   -14.420 1.00 23.96  ? 5    G   G N1    1 
ATOM   4649 C  C2    . G   C 3 5   ? -31.713 4.536   -13.749 1.00 23.74  ? 5    G   G C2    1 
ATOM   4650 N  N2    . G   C 3 5   ? -31.628 4.458   -12.408 1.00 27.79  ? 5    G   G N2    1 
ATOM   4651 N  N3    . G   C 3 5   ? -31.894 5.711   -14.337 1.00 26.02  ? 5    G   G N3    1 
ATOM   4652 C  C4    . G   C 3 5   ? -31.970 5.584   -15.680 1.00 24.82  ? 5    G   G C4    1 
ATOM   4653 P  P     . G   C 3 6   ? -28.132 10.103  -17.225 1.00 25.39  ? 6    G   G P     1 
ATOM   4654 O  OP1   . G   C 3 6   ? -27.464 11.426  -17.223 1.00 28.48  ? 6    G   G OP1   1 
ATOM   4655 O  OP2   . G   C 3 6   ? -27.757 9.100   -18.271 1.00 27.36  ? 6    G   G OP2   1 
ATOM   4656 O  "O5'" . G   C 3 6   ? -27.891 9.390   -15.824 1.00 24.02  ? 6    G   G "O5'" 1 
ATOM   4657 C  "C5'" . G   C 3 6   ? -28.126 10.080  -14.601 1.00 25.29  ? 6    G   G "C5'" 1 
ATOM   4658 C  "C4'" . G   C 3 6   ? -27.904 9.176   -13.415 1.00 24.61  ? 6    G   G "C4'" 1 
ATOM   4659 O  "O4'" . G   C 3 6   ? -28.884 8.105   -13.418 1.00 23.00  ? 6    G   G "O4'" 1 
ATOM   4660 C  "C3'" . G   C 3 6   ? -26.569 8.450   -13.397 1.00 22.13  ? 6    G   G "C3'" 1 
ATOM   4661 O  "O3'" . G   C 3 6   ? -25.516 9.265   -12.916 1.00 22.88  ? 6    G   G "O3'" 1 
ATOM   4662 C  "C2'" . G   C 3 6   ? -26.862 7.239   -12.522 1.00 22.43  ? 6    G   G "C2'" 1 
ATOM   4663 O  "O2'" . G   C 3 6   ? -26.886 7.607   -11.145 1.00 23.08  ? 6    G   G "O2'" 1 
ATOM   4664 C  "C1'" . G   C 3 6   ? -28.288 6.903   -12.958 1.00 21.20  ? 6    G   G "C1'" 1 
ATOM   4665 N  N9    . G   C 3 6   ? -28.316 5.926   -14.067 1.00 21.30  ? 6    G   G N9    1 
ATOM   4666 C  C8    . G   C 3 6   ? -28.420 6.167   -15.422 1.00 22.37  ? 6    G   G C8    1 
ATOM   4667 N  N7    . G   C 3 6   ? -28.432 5.065   -16.134 1.00 22.14  ? 6    G   G N7    1 
ATOM   4668 C  C5    . G   C 3 6   ? -28.334 4.057   -15.168 1.00 19.57  ? 6    G   G C5    1 
ATOM   4669 C  C6    . G   C 3 6   ? -28.287 2.653   -15.320 1.00 23.84  ? 6    G   G C6    1 
ATOM   4670 O  O6    . G   C 3 6   ? -28.344 2.019   -16.381 1.00 19.92  ? 6    G   G O6    1 
ATOM   4671 N  N1    . G   C 3 6   ? -28.179 1.995   -14.095 1.00 20.83  ? 6    G   G N1    1 
ATOM   4672 C  C2    . G   C 3 6   ? -28.105 2.621   -12.871 1.00 23.90  ? 6    G   G C2    1 
ATOM   4673 N  N2    . G   C 3 6   ? -27.998 1.835   -11.792 1.00 23.78  ? 6    G   G N2    1 
ATOM   4674 N  N3    . G   C 3 6   ? -28.140 3.937   -12.722 1.00 19.65  ? 6    G   G N3    1 
ATOM   4675 C  C4    . G   C 3 6   ? -28.259 4.575   -13.909 1.00 20.77  ? 6    G   G C4    1 
ATOM   4676 P  P     . C   C 3 7   ? -24.054 9.156   -13.540 1.00 25.02  ? 7    C   G P     1 
ATOM   4677 O  OP1   . C   C 3 7   ? -23.257 10.195  -12.859 1.00 24.75  ? 7    C   G OP1   1 
ATOM   4678 O  OP2   . C   C 3 7   ? -24.081 9.125   -15.034 1.00 24.97  ? 7    C   G OP2   1 
ATOM   4679 O  "O5'" . C   C 3 7   ? -23.557 7.720   -13.078 1.00 25.62  ? 7    C   G "O5'" 1 
ATOM   4680 C  "C5'" . C   C 3 7   ? -23.401 7.463   -11.694 1.00 22.75  ? 7    C   G "C5'" 1 
ATOM   4681 C  "C4'" . C   C 3 7   ? -23.260 5.988   -11.405 1.00 22.92  ? 7    C   G "C4'" 1 
ATOM   4682 O  "O4'" . C   C 3 7   ? -24.440 5.267   -11.831 1.00 21.59  ? 7    C   G "O4'" 1 
ATOM   4683 C  "C3'" . C   C 3 7   ? -22.129 5.267   -12.107 1.00 22.07  ? 7    C   G "C3'" 1 
ATOM   4684 O  "O3'" . C   C 3 7   ? -20.885 5.539   -11.492 1.00 25.79  ? 7    C   G "O3'" 1 
ATOM   4685 C  "C2'" . C   C 3 7   ? -22.575 3.814   -12.003 1.00 24.32  ? 7    C   G "C2'" 1 
ATOM   4686 O  "O2'" . C   C 3 7   ? -22.395 3.343   -10.678 1.00 23.98  ? 7    C   G "O2'" 1 
ATOM   4687 C  "C1'" . C   C 3 7   ? -24.080 3.958   -12.227 1.00 20.09  ? 7    C   G "C1'" 1 
ATOM   4688 N  N1    . C   C 3 7   ? -24.446 3.771   -13.650 1.00 21.87  ? 7    C   G N1    1 
ATOM   4689 C  C2    . C   C 3 7   ? -24.595 2.463   -14.114 1.00 23.50  ? 7    C   G C2    1 
ATOM   4690 O  O2    . C   C 3 7   ? -24.425 1.526   -13.310 1.00 21.97  ? 7    C   G O2    1 
ATOM   4691 N  N3    . C   C 3 7   ? -24.922 2.252   -15.412 1.00 21.37  ? 7    C   G N3    1 
ATOM   4692 C  C4    . C   C 3 7   ? -25.080 3.297   -16.234 1.00 22.13  ? 7    C   G C4    1 
ATOM   4693 N  N4    . C   C 3 7   ? -25.398 3.048   -17.515 1.00 24.31  ? 7    C   G N4    1 
ATOM   4694 C  C5    . C   C 3 7   ? -24.918 4.633   -15.789 1.00 18.67  ? 7    C   G C5    1 
ATOM   4695 C  C6    . C   C 3 7   ? -24.600 4.832   -14.499 1.00 20.85  ? 7    C   G C6    1 
ATOM   4696 P  P     . G   C 3 8   ? -19.513 5.306   -12.281 1.00 33.05  ? 8    G   G P     1 
ATOM   4697 O  OP1   . G   C 3 8   ? -18.425 5.887   -11.457 1.00 36.36  ? 8    G   G OP1   1 
ATOM   4698 O  OP2   . G   C 3 8   ? -19.632 5.647   -13.713 1.00 34.56  ? 8    G   G OP2   1 
ATOM   4699 O  "O5'" . G   C 3 8   ? -19.353 3.744   -12.112 1.00 35.84  ? 8    G   G "O5'" 1 
ATOM   4700 C  "C5'" . G   C 3 8   ? -18.906 2.955   -13.172 1.00 30.76  ? 8    G   G "C5'" 1 
ATOM   4701 C  "C4'" . G   C 3 8   ? -19.355 1.542   -12.977 1.00 26.83  ? 8    G   G "C4'" 1 
ATOM   4702 O  "O4'" . G   C 3 8   ? -20.771 1.440   -13.280 1.00 27.42  ? 8    G   G "O4'" 1 
ATOM   4703 C  "C3'" . G   C 3 8   ? -18.670 0.562   -13.908 1.00 22.85  ? 8    G   G "C3'" 1 
ATOM   4704 O  "O3'" . G   C 3 8   ? -17.480 0.068   -13.321 1.00 23.58  ? 8    G   G "O3'" 1 
ATOM   4705 C  "C2'" . G   C 3 8   ? -19.728 -0.505  -14.145 1.00 27.49  ? 8    G   G "C2'" 1 
ATOM   4706 O  "O2'" . G   C 3 8   ? -19.746 -1.424  -13.065 1.00 28.43  ? 8    G   G "O2'" 1 
ATOM   4707 C  "C1'" . G   C 3 8   ? -21.014 0.324   -14.101 1.00 30.13  ? 8    G   G "C1'" 1 
ATOM   4708 N  N9    . G   C 3 8   ? -21.429 0.843   -15.422 1.00 25.00  ? 8    G   G N9    1 
ATOM   4709 C  C8    . G   C 3 8   ? -21.508 2.165   -15.793 1.00 30.73  ? 8    G   G C8    1 
ATOM   4710 N  N7    . G   C 3 8   ? -21.949 2.332   -17.011 1.00 26.68  ? 8    G   G N7    1 
ATOM   4711 C  C5    . G   C 3 8   ? -22.195 1.038   -17.462 1.00 24.70  ? 8    G   G C5    1 
ATOM   4712 C  C6    . G   C 3 8   ? -22.680 0.559   -18.712 1.00 24.38  ? 8    G   G C6    1 
ATOM   4713 O  O6    . G   C 3 8   ? -23.011 1.210   -19.710 1.00 27.21  ? 8    G   G O6    1 
ATOM   4714 N  N1    . G   C 3 8   ? -22.766 -0.835  -18.743 1.00 24.72  ? 8    G   G N1    1 
ATOM   4715 C  C2    . G   C 3 8   ? -22.425 -1.664  -17.698 1.00 30.10  ? 8    G   G C2    1 
ATOM   4716 N  N2    . G   C 3 8   ? -22.549 -2.987  -17.884 1.00 29.64  ? 8    G   G N2    1 
ATOM   4717 N  N3    . G   C 3 8   ? -21.964 -1.225  -16.539 1.00 24.57  ? 8    G   G N3    1 
ATOM   4718 C  C4    . G   C 3 8   ? -21.879 0.118   -16.494 1.00 25.41  ? 8    G   G C4    1 
ATOM   4719 P  P     . C   C 3 9   ? -16.154 -0.092  -14.201 1.00 30.80  ? 9    C   G P     1 
ATOM   4720 O  OP1   . C   C 3 9   ? -15.021 -0.316  -13.262 1.00 33.01  ? 9    C   G OP1   1 
ATOM   4721 O  OP2   . C   C 3 9   ? -16.092 0.980   -15.221 1.00 32.95  ? 9    C   G OP2   1 
ATOM   4722 O  "O5'" . C   C 3 9   ? -16.412 -1.458  -14.971 1.00 33.91  ? 9    C   G "O5'" 1 
ATOM   4723 C  "C5'" . C   C 3 9   ? -16.685 -2.656  -14.260 1.00 31.97  ? 9    C   G "C5'" 1 
ATOM   4724 C  "C4'" . C   C 3 9   ? -17.211 -3.723  -15.185 1.00 35.14  ? 9    C   G "C4'" 1 
ATOM   4725 O  "O4'" . C   C 3 9   ? -18.507 -3.329  -15.698 1.00 34.15  ? 9    C   G "O4'" 1 
ATOM   4726 C  "C3'" . C   C 3 9   ? -16.385 -3.987  -16.436 1.00 38.56  ? 9    C   G "C3'" 1 
ATOM   4727 O  "O3'" . C   C 3 9   ? -15.280 -4.842  -16.189 1.00 42.11  ? 9    C   G "O3'" 1 
ATOM   4728 C  "C2'" . C   C 3 9   ? -17.413 -4.586  -17.389 1.00 35.52  ? 9    C   G "C2'" 1 
ATOM   4729 O  "O2'" . C   C 3 9   ? -17.657 -5.947  -17.060 1.00 38.21  ? 9    C   G "O2'" 1 
ATOM   4730 C  "C1'" . C   C 3 9   ? -18.664 -3.789  -17.024 1.00 33.48  ? 9    C   G "C1'" 1 
ATOM   4731 N  N1    . C   C 3 9   ? -18.904 -2.619  -17.900 1.00 30.24  ? 9    C   G N1    1 
ATOM   4732 C  C2    . C   C 3 9   ? -19.501 -2.827  -19.146 1.00 33.48  ? 9    C   G C2    1 
ATOM   4733 O  O2    . C   C 3 9   ? -19.772 -3.993  -19.481 1.00 32.58  ? 9    C   G O2    1 
ATOM   4734 N  N3    . C   C 3 9   ? -19.749 -1.760  -19.947 1.00 33.80  ? 9    C   G N3    1 
ATOM   4735 C  C4    . C   C 3 9   ? -19.430 -0.531  -19.522 1.00 30.24  ? 9    C   G C4    1 
ATOM   4736 N  N4    . C   C 3 9   ? -19.694 0.509   -20.316 1.00 29.41  ? 9    C   G N4    1 
ATOM   4737 C  C5    . C   C 3 9   ? -18.827 -0.303  -18.251 1.00 28.06  ? 9    C   G C5    1 
ATOM   4738 C  C6    . C   C 3 9   ? -18.581 -1.362  -17.479 1.00 29.30  ? 9    C   G C6    1 
ATOM   4739 P  P     . C   C 3 10  ? -13.897 -4.625  -16.971 1.00 47.82  ? 10   C   G P     1 
ATOM   4740 O  OP1   . C   C 3 10  ? -12.893 -5.464  -16.270 1.00 60.81  ? 10   C   G OP1   1 
ATOM   4741 O  OP2   . C   C 3 10  ? -13.633 -3.181  -17.187 1.00 42.89  ? 10   C   G OP2   1 
ATOM   4742 O  "O5'" . C   C 3 10  ? -14.166 -5.271  -18.403 1.00 44.03  ? 10   C   G "O5'" 1 
ATOM   4743 C  "C5'" . C   C 3 10  ? -14.586 -6.621  -18.527 1.00 40.18  ? 10   C   G "C5'" 1 
ATOM   4744 C  "C4'" . C   C 3 10  ? -15.259 -6.865  -19.854 1.00 42.15  ? 10   C   G "C4'" 1 
ATOM   4745 O  "O4'" . C   C 3 10  ? -16.427 -6.017  -19.966 1.00 44.10  ? 10   C   G "O4'" 1 
ATOM   4746 C  "C3'" . C   C 3 10  ? -14.442 -6.535  -21.095 1.00 54.94  ? 10   C   G "C3'" 1 
ATOM   4747 O  "O3'" . C   C 3 10  ? -13.553 -7.580  -21.453 1.00 58.62  ? 10   C   G "O3'" 1 
ATOM   4748 C  "C2'" . C   C 3 10  ? -15.515 -6.278  -22.144 1.00 54.71  ? 10   C   G "C2'" 1 
ATOM   4749 O  "O2'" . C   C 3 10  ? -16.020 -7.510  -22.641 1.00 60.29  ? 10   C   G "O2'" 1 
ATOM   4750 C  "C1'" . C   C 3 10  ? -16.614 -5.623  -21.307 1.00 49.92  ? 10   C   G "C1'" 1 
ATOM   4751 N  N1    . C   C 3 10  ? -16.616 -4.142  -21.383 1.00 42.03  ? 10   C   G N1    1 
ATOM   4752 C  C2    . C   C 3 10  ? -17.293 -3.553  -22.451 1.00 46.62  ? 10   C   G C2    1 
ATOM   4753 O  O2    . C   C 3 10  ? -17.826 -4.293  -23.291 1.00 48.78  ? 10   C   G O2    1 
ATOM   4754 N  N3    . C   C 3 10  ? -17.346 -2.206  -22.539 1.00 42.18  ? 10   C   G N3    1 
ATOM   4755 C  C4    . C   C 3 10  ? -16.754 -1.447  -21.611 1.00 39.23  ? 10   C   G C4    1 
ATOM   4756 N  N4    . C   C 3 10  ? -16.830 -0.118  -21.744 1.00 36.14  ? 10   C   G N4    1 
ATOM   4757 C  C5    . C   C 3 10  ? -16.062 -2.019  -20.505 1.00 35.03  ? 10   C   G C5    1 
ATOM   4758 C  C6    . C   C 3 10  ? -16.026 -3.358  -20.431 1.00 38.47  ? 10   C   G C6    1 
ATOM   4759 P  P     . G   C 3 11  ? -12.259 -7.280  -22.358 1.00 70.84  ? 11   G   G P     1 
ATOM   4760 O  OP1   . G   C 3 11  ? -11.452 -8.527  -22.373 1.00 69.89  ? 11   G   G OP1   1 
ATOM   4761 O  OP2   . G   C 3 11  ? -11.639 -6.001  -21.918 1.00 71.44  ? 11   G   G OP2   1 
ATOM   4762 O  "O5'" . G   C 3 11  ? -12.846 -7.041  -23.819 1.00 78.26  ? 11   G   G "O5'" 1 
ATOM   4763 C  "C5'" . G   C 3 11  ? -13.532 -8.071  -24.516 1.00 75.75  ? 11   G   G "C5'" 1 
ATOM   4764 C  "C4'" . G   C 3 11  ? -14.200 -7.535  -25.758 1.00 76.57  ? 11   G   G "C4'" 1 
ATOM   4765 O  "O4'" . G   C 3 11  ? -15.276 -6.630  -25.393 1.00 71.34  ? 11   G   G "O4'" 1 
ATOM   4766 C  "C3'" . G   C 3 11  ? -13.319 -6.705  -26.676 1.00 82.32  ? 11   G   G "C3'" 1 
ATOM   4767 O  "O3'" . G   C 3 11  ? -12.492 -7.495  -27.513 1.00 87.71  ? 11   G   G "O3'" 1 
ATOM   4768 C  "C2'" . G   C 3 11  ? -14.333 -5.856  -27.432 1.00 77.79  ? 11   G   G "C2'" 1 
ATOM   4769 O  "O2'" . G   C 3 11  ? -14.946 -6.608  -28.468 1.00 80.61  ? 11   G   G "O2'" 1 
ATOM   4770 C  "C1'" . G   C 3 11  ? -15.373 -5.588  -26.344 1.00 68.82  ? 11   G   G "C1'" 1 
ATOM   4771 N  N9    . G   C 3 11  ? -15.132 -4.302  -25.663 1.00 61.96  ? 11   G   G N9    1 
ATOM   4772 C  C8    . G   C 3 11  ? -14.471 -4.105  -24.474 1.00 60.37  ? 11   G   G C8    1 
ATOM   4773 N  N7    . G   C 3 11  ? -14.408 -2.849  -24.119 1.00 55.92  ? 11   G   G N7    1 
ATOM   4774 C  C5    . G   C 3 11  ? -15.063 -2.175  -25.139 1.00 51.58  ? 11   G   G C5    1 
ATOM   4775 C  C6    . G   C 3 11  ? -15.312 -0.786  -25.307 1.00 55.80  ? 11   G   G C6    1 
ATOM   4776 O  O6    . G   C 3 11  ? -14.999 0.156   -24.569 1.00 53.76  ? 11   G   G O6    1 
ATOM   4777 N  N1    . G   C 3 11  ? -16.008 -0.535  -26.485 1.00 58.16  ? 11   G   G N1    1 
ATOM   4778 C  C2    . G   C 3 11  ? -16.412 -1.491  -27.384 1.00 59.33  ? 11   G   G C2    1 
ATOM   4779 N  N2    . G   C 3 11  ? -17.071 -1.034  -28.458 1.00 64.50  ? 11   G   G N2    1 
ATOM   4780 N  N3    . G   C 3 11  ? -16.189 -2.789  -27.238 1.00 54.21  ? 11   G   G N3    1 
ATOM   4781 C  C4    . G   C 3 11  ? -15.514 -3.057  -26.101 1.00 51.39  ? 11   G   G C4    1 
ATOM   4782 P  P     . U   C 3 12  ? -11.033 -6.970  -27.940 1.00 108.50 ? 12   U   G P     1 
ATOM   4783 O  OP1   . U   C 3 12  ? -10.297 -8.109  -28.544 1.00 109.61 ? 12   U   G OP1   1 
ATOM   4784 O  OP2   . U   C 3 12  ? -10.437 -6.245  -26.790 1.00 110.80 ? 12   U   G OP2   1 
ATOM   4785 O  "O5'" . U   C 3 12  ? -11.336 -5.906  -29.083 1.00 97.93  ? 12   U   G "O5'" 1 
ATOM   4786 C  "C5'" . U   C 3 12  ? -12.182 -6.234  -30.175 1.00 102.60 ? 12   U   G "C5'" 1 
ATOM   4787 C  "C4'" . U   C 3 12  ? -12.639 -4.997  -30.902 1.00 105.98 ? 12   U   G "C4'" 1 
ATOM   4788 O  "O4'" . U   C 3 12  ? -13.543 -4.231  -30.065 1.00 103.58 ? 12   U   G "O4'" 1 
ATOM   4789 C  "C3'" . U   C 3 12  ? -11.544 -4.008  -31.258 1.00 111.52 ? 12   U   G "C3'" 1 
ATOM   4790 O  "O3'" . U   C 3 12  ? -10.820 -4.386  -32.415 1.00 115.36 ? 12   U   G "O3'" 1 
ATOM   4791 C  "C2'" . U   C 3 12  ? -12.310 -2.699  -31.402 1.00 109.57 ? 12   U   G "C2'" 1 
ATOM   4792 O  "O2'" . U   C 3 12  ? -12.967 -2.636  -32.659 1.00 112.50 ? 12   U   G "O2'" 1 
ATOM   4793 C  "C1'" . U   C 3 12  ? -13.370 -2.849  -30.309 1.00 101.98 ? 12   U   G "C1'" 1 
ATOM   4794 N  N1    . U   C 3 12  ? -12.972 -2.185  -29.044 1.00 90.33  ? 12   U   G N1    1 
ATOM   4795 C  C2    . U   C 3 12  ? -13.149 -0.815  -28.947 1.00 79.94  ? 12   U   G C2    1 
ATOM   4796 O  O2    . U   C 3 12  ? -13.612 -0.137  -29.848 1.00 78.86  ? 12   U   G O2    1 
ATOM   4797 N  N3    . U   C 3 12  ? -12.764 -0.261  -27.752 1.00 70.13  ? 12   U   G N3    1 
ATOM   4798 C  C4    . U   C 3 12  ? -12.230 -0.923  -26.667 1.00 71.81  ? 12   U   G C4    1 
ATOM   4799 O  O4    . U   C 3 12  ? -11.932 -0.283  -25.658 1.00 68.71  ? 12   U   G O4    1 
ATOM   4800 C  C5    . U   C 3 12  ? -12.079 -2.336  -26.840 1.00 77.76  ? 12   U   G C5    1 
ATOM   4801 C  C6    . U   C 3 12  ? -12.447 -2.903  -27.994 1.00 84.28  ? 12   U   G C6    1 
ATOM   4802 P  P     . G   C 3 13  ? -9.321  -3.858  -32.637 1.00 119.76 ? 13   G   G P     1 
ATOM   4803 O  OP1   . G   C 3 13  ? -8.601  -4.857  -33.464 1.00 122.98 ? 13   G   G OP1   1 
ATOM   4804 O  OP2   . G   C 3 13  ? -8.758  -3.458  -31.322 1.00 120.27 ? 13   G   G OP2   1 
ATOM   4805 O  "O5'" . G   C 3 13  ? -9.521  -2.541  -33.505 1.00 139.69 ? 13   G   G "O5'" 1 
ATOM   4806 C  "C5'" . G   C 3 13  ? -8.628  -1.449  -33.380 1.00 141.35 ? 13   G   G "C5'" 1 
ATOM   4807 C  "C4'" . G   C 3 13  ? -9.366  -0.137  -33.374 1.00 141.56 ? 13   G   G "C4'" 1 
ATOM   4808 O  "O4'" . G   C 3 13  ? -10.353 -0.142  -32.310 1.00 136.51 ? 13   G   G "O4'" 1 
ATOM   4809 C  "C3'" . G   C 3 13  ? -8.520  1.095   -33.096 1.00 144.86 ? 13   G   G "C3'" 1 
ATOM   4810 O  "O3'" . G   C 3 13  ? -7.859  1.580   -34.256 1.00 148.08 ? 13   G   G "O3'" 1 
ATOM   4811 C  "C2'" . G   C 3 13  ? -9.534  2.079   -32.522 1.00 141.50 ? 13   G   G "C2'" 1 
ATOM   4812 O  "O2'" . G   C 3 13  ? -10.280 2.696   -33.562 1.00 143.46 ? 13   G   G "O2'" 1 
ATOM   4813 C  "C1'" . G   C 3 13  ? -10.468 1.147   -31.749 1.00 133.21 ? 13   G   G "C1'" 1 
ATOM   4814 N  N9    . G   C 3 13  ? -10.140 1.066   -30.311 1.00 121.92 ? 13   G   G N9    1 
ATOM   4815 C  C8    . G   C 3 13  ? -9.790  -0.067  -29.614 1.00 117.08 ? 13   G   G C8    1 
ATOM   4816 N  N7    . G   C 3 13  ? -9.567  0.155   -28.348 1.00 114.65 ? 13   G   G N7    1 
ATOM   4817 C  C5    . G   C 3 13  ? -9.790  1.517   -28.192 1.00 113.13 ? 13   G   G C5    1 
ATOM   4818 C  C6    . G   C 3 13  ? -9.702  2.337   -27.035 1.00 108.33 ? 13   G   G C6    1 
ATOM   4819 O  O6    . G   C 3 13  ? -9.401  2.012   -25.879 1.00 104.14 ? 13   G   G O6    1 
ATOM   4820 N  N1    . G   C 3 13  ? -10.011 3.663   -27.323 1.00 108.25 ? 13   G   G N1    1 
ATOM   4821 C  C2    . G   C 3 13  ? -10.358 4.142   -28.563 1.00 109.61 ? 13   G   G C2    1 
ATOM   4822 N  N2    . G   C 3 13  ? -10.620 5.455   -28.641 1.00 108.00 ? 13   G   G N2    1 
ATOM   4823 N  N3    . G   C 3 13  ? -10.444 3.388   -29.647 1.00 112.81 ? 13   G   G N3    1 
ATOM   4824 C  C4    . G   C 3 13  ? -10.150 2.094   -29.393 1.00 115.78 ? 13   G   G C4    1 
ATOM   4825 P  P     . G   C 3 14  ? -6.346  1.146   -34.594 1.00 298.90 ? 14   G   G P     1 
ATOM   4826 O  OP1   . G   C 3 14  ? -5.783  2.175   -35.504 1.00 299.71 ? 14   G   G OP1   1 
ATOM   4827 O  OP2   . G   C 3 14  ? -6.326  -0.273  -35.026 1.00 298.94 ? 14   G   G OP2   1 
ATOM   4828 O  "O5'" . G   C 3 14  ? -5.587  1.256   -33.199 1.00 178.56 ? 14   G   G "O5'" 1 
ATOM   4829 C  "C5'" . G   C 3 14  ? -4.714  2.342   -32.929 1.00 180.43 ? 14   G   G "C5'" 1 
ATOM   4830 C  "C4'" . G   C 3 14  ? -5.484  3.604   -32.635 1.00 181.85 ? 14   G   G "C4'" 1 
ATOM   4831 O  "O4'" . G   C 3 14  ? -6.619  3.294   -31.786 1.00 180.34 ? 14   G   G "O4'" 1 
ATOM   4832 C  "C3'" . G   C 3 14  ? -4.731  4.683   -31.873 1.00 183.44 ? 14   G   G "C3'" 1 
ATOM   4833 O  "O3'" . G   C 3 14  ? -3.905  5.477   -32.707 1.00 184.71 ? 14   G   G "O3'" 1 
ATOM   4834 C  "C2'" . G   C 3 14  ? -5.854  5.462   -31.205 1.00 181.70 ? 14   G   G "C2'" 1 
ATOM   4835 O  "O2'" . G   C 3 14  ? -6.481  6.334   -32.134 1.00 182.12 ? 14   G   G "O2'" 1 
ATOM   4836 C  "C1'" . G   C 3 14  ? -6.834  4.340   -30.865 1.00 177.74 ? 14   G   G "C1'" 1 
ATOM   4837 N  N9    . G   C 3 14  ? -6.618  3.803   -29.508 1.00 170.09 ? 14   G   G N9    1 
ATOM   4838 C  C8    . G   C 3 14  ? -6.282  2.509   -29.189 1.00 166.26 ? 14   G   G C8    1 
ATOM   4839 N  N7    . G   C 3 14  ? -6.157  2.312   -27.906 1.00 163.87 ? 14   G   G N7    1 
ATOM   4840 C  C5    . G   C 3 14  ? -6.429  3.552   -27.344 1.00 163.77 ? 14   G   G C5    1 
ATOM   4841 C  C6    . G   C 3 14  ? -6.448  3.956   -25.985 1.00 161.89 ? 14   G   G C6    1 
ATOM   4842 O  O6    . G   C 3 14  ? -6.220  3.274   -24.979 1.00 160.76 ? 14   G   G O6    1 
ATOM   4843 N  N1    . G   C 3 14  ? -6.773  5.303   -25.856 1.00 161.84 ? 14   G   G N1    1 
ATOM   4844 C  C2    . G   C 3 14  ? -7.045  6.153   -26.899 1.00 162.22 ? 14   G   G C2    1 
ATOM   4845 N  N2    . G   C 3 14  ? -7.338  7.420   -26.573 1.00 161.44 ? 14   G   G N2    1 
ATOM   4846 N  N3    . G   C 3 14  ? -7.032  5.789   -28.170 1.00 164.02 ? 14   G   G N3    1 
ATOM   4847 C  C4    . G   C 3 14  ? -6.719  4.484   -28.318 1.00 166.05 ? 14   G   G C4    1 
HETATM 4848 N  N1    . DCT D 4 .   ? -34.924 2.290   -11.605 1.00 28.12  ? 1833 DCT A N1    1 
HETATM 4849 C  C2    . DCT D 4 .   ? -34.997 2.810   -12.881 1.00 24.40  ? 1833 DCT A C2    1 
HETATM 4850 N  N3    . DCT D 4 .   ? -35.047 1.964   -13.951 1.00 28.01  ? 1833 DCT A N3    1 
HETATM 4851 C  C4    . DCT D 4 .   ? -35.031 0.600   -13.776 1.00 25.57  ? 1833 DCT A C4    1 
HETATM 4852 C  C5    . DCT D 4 .   ? -34.955 0.060   -12.488 1.00 30.26  ? 1833 DCT A C5    1 
HETATM 4853 C  C6    . DCT D 4 .   ? -34.909 0.935   -11.405 1.00 24.30  ? 1833 DCT A C6    1 
HETATM 4854 O  O2    . DCT D 4 .   ? -35.014 4.031   -13.045 1.00 25.47  ? 1833 DCT A O2    1 
HETATM 4855 N  N4    . DCT D 4 .   ? -35.077 -0.179  -14.844 1.00 26.66  ? 1833 DCT A N4    1 
HETATM 4856 C  "C1'" . DCT D 4 .   ? -34.891 3.222   -10.478 1.00 31.74  ? 1833 DCT A "C1'" 1 
HETATM 4857 C  "C2'" . DCT D 4 .   ? -36.344 3.570   -10.151 1.00 34.85  ? 1833 DCT A "C2'" 1 
HETATM 4858 C  "C3'" . DCT D 4 .   ? -36.598 3.002   -8.760  1.00 28.57  ? 1833 DCT A "C3'" 1 
HETATM 4859 C  "C4'" . DCT D 4 .   ? -35.204 2.735   -8.222  1.00 30.13  ? 1833 DCT A "C4'" 1 
HETATM 4860 O  "O4'" . DCT D 4 .   ? -34.377 2.532   -9.352  1.00 33.75  ? 1833 DCT A "O4'" 1 
HETATM 4861 C  "C5'" . DCT D 4 .   ? -35.196 1.534   -7.277  1.00 24.68  ? 1833 DCT A "C5'" 1 
HETATM 4862 O  "O5'" . DCT D 4 .   ? -35.469 0.328   -7.954  1.00 25.30  ? 1833 DCT A "O5'" 1 
HETATM 4863 P  PA    . DCT D 4 .   ? -36.388 -0.796  -7.304  1.00 27.21  ? 1833 DCT A PA    1 
HETATM 4864 O  O1A   . DCT D 4 .   ? -36.237 -2.119  -8.010  1.00 27.84  ? 1833 DCT A O1A   1 
HETATM 4865 O  O2A   . DCT D 4 .   ? -36.184 -0.836  -5.803  1.00 26.83  ? 1833 DCT A O2A   1 
HETATM 4866 O  O3A   . DCT D 4 .   ? -37.846 -0.248  -7.725  1.00 30.21  ? 1833 DCT A O3A   1 
HETATM 4867 P  PB    . DCT D 4 .   ? -39.110 -0.013  -6.766  1.00 24.87  ? 1833 DCT A PB    1 
HETATM 4868 O  O1B   . DCT D 4 .   ? -38.697 0.434   -5.376  1.00 22.84  ? 1833 DCT A O1B   1 
HETATM 4869 O  O2B   . DCT D 4 .   ? -40.001 1.024   -7.407  1.00 21.88  ? 1833 DCT A O2B   1 
HETATM 4870 O  O3B   . DCT D 4 .   ? -39.877 -1.418  -6.871  1.00 26.62  ? 1833 DCT A O3B   1 
HETATM 4871 P  PG    . DCT D 4 .   ? -39.743 -2.616  -5.786  1.00 27.44  ? 1833 DCT A PG    1 
HETATM 4872 O  O1G   . DCT D 4 .   ? -38.437 -2.481  -5.077  1.00 25.92  ? 1833 DCT A O1G   1 
HETATM 4873 O  O2G   . DCT D 4 .   ? -39.889 -3.929  -6.510  1.00 35.29  ? 1833 DCT A O2G   1 
HETATM 4874 O  O3G   . DCT D 4 .   ? -40.847 -2.454  -4.802  1.00 19.88  ? 1833 DCT A O3G   1 
HETATM 4875 CL CL    . CL  E 5 .   ? -15.953 -8.305  13.193  1.00 31.44  ? 1834 CL  A CL    1 
HETATM 4876 CL CL    . CL  F 5 .   ? -27.466 18.876  -21.220 1.00 36.65  ? 1835 CL  A CL    1 
HETATM 4877 MG MG    . MG  G 6 .   ? -37.520 -0.952  -4.352  1.00 24.32  ? 1836 MG  A MG    1 
HETATM 4878 C  C     . FMT H 7 .   ? -24.852 31.545  4.619   1.00 51.92  ? 1837 FMT A C     1 
HETATM 4879 O  O1    . FMT H 7 .   ? -25.681 30.997  5.346   1.00 48.48  ? 1837 FMT A O1    1 
HETATM 4880 O  O2    . FMT H 7 .   ? -23.654 31.654  4.881   1.00 46.89  ? 1837 FMT A O2    1 
HETATM 4881 C  C     . FMT I 7 .   ? -17.107 26.463  9.426   1.00 56.37  ? 1838 FMT A C     1 
HETATM 4882 O  O1    . FMT I 7 .   ? -18.188 26.187  9.952   1.00 58.48  ? 1838 FMT A O1    1 
HETATM 4883 O  O2    . FMT I 7 .   ? -16.971 26.839  8.258   1.00 46.77  ? 1838 FMT A O2    1 
HETATM 4884 C  C     . FMT J 7 .   ? -18.876 -4.199  -9.772  1.00 50.23  ? 1839 FMT A C     1 
HETATM 4885 O  O1    . FMT J 7 .   ? -17.746 -3.764  -10.011 1.00 49.59  ? 1839 FMT A O1    1 
HETATM 4886 O  O2    . FMT J 7 .   ? -19.647 -4.660  -10.618 1.00 46.36  ? 1839 FMT A O2    1 
HETATM 4887 MG MG    . MG  K 6 .   ? -30.165 -6.749  -15.115 1.00 51.17  ? 1112 MG  B MG    1 
HETATM 4888 MG MG    . MG  L 6 .   ? -20.993 4.011   -22.606 1.00 54.63  ? 1113 MG  B MG    1 
HETATM 4889 C  C     . FMT M 7 .   ? -25.482 2.985   -9.311  1.00 49.44  ? 1015 FMT G C     1 
HETATM 4890 O  O1    . FMT M 7 .   ? -26.712 3.008   -9.312  1.00 59.50  ? 1015 FMT G O1    1 
HETATM 4891 O  O2    . FMT M 7 .   ? -24.753 3.875   -8.898  1.00 34.25  ? 1015 FMT G O2    1 
HETATM 4892 O  O     . HOH N 8 .   ? 2.542   25.965  -0.816  1.00 59.35  ? 2001 HOH A O     1 
HETATM 4893 O  O     . HOH N 8 .   ? 8.493   23.541  6.382   1.00 55.27  ? 2002 HOH A O     1 
HETATM 4894 O  O     . HOH N 8 .   ? 6.771   23.790  8.221   1.00 36.80  ? 2003 HOH A O     1 
HETATM 4895 O  O     . HOH N 8 .   ? 3.475   27.333  14.967  1.00 56.85  ? 2004 HOH A O     1 
HETATM 4896 O  O     . HOH N 8 .   ? 7.766   21.849  10.739  1.00 49.57  ? 2005 HOH A O     1 
HETATM 4897 O  O     . HOH N 8 .   ? 7.836   21.754  13.177  1.00 63.23  ? 2006 HOH A O     1 
HETATM 4898 O  O     . HOH N 8 .   ? 6.072   24.603  17.135  1.00 49.54  ? 2007 HOH A O     1 
HETATM 4899 O  O     . HOH N 8 .   ? -5.500  23.517  12.645  1.00 51.05  ? 2008 HOH A O     1 
HETATM 4900 O  O     . HOH N 8 .   ? -8.405  23.175  11.012  1.00 53.94  ? 2009 HOH A O     1 
HETATM 4901 O  O     . HOH N 8 .   ? -7.830  28.612  8.014   1.00 49.26  ? 2010 HOH A O     1 
HETATM 4902 O  O     . HOH N 8 .   ? -7.836  20.737  9.285   1.00 35.75  ? 2011 HOH A O     1 
HETATM 4903 O  O     . HOH N 8 .   ? -6.724  18.428  1.818   1.00 31.53  ? 2012 HOH A O     1 
HETATM 4904 O  O     . HOH N 8 .   ? -4.928  16.811  0.522   1.00 24.71  ? 2013 HOH A O     1 
HETATM 4905 O  O     . HOH N 8 .   ? -5.589  14.156  -0.104  1.00 34.62  ? 2014 HOH A O     1 
HETATM 4906 O  O     . HOH N 8 .   ? -3.211  11.099  -1.600  1.00 23.99  ? 2015 HOH A O     1 
HETATM 4907 O  O     . HOH N 8 .   ? -2.647  8.127   -3.171  1.00 52.89  ? 2016 HOH A O     1 
HETATM 4908 O  O     . HOH N 8 .   ? 1.273   8.254   -2.935  1.00 38.09  ? 2017 HOH A O     1 
HETATM 4909 O  O     . HOH N 8 .   ? 0.509   1.174   -2.905  1.00 35.98  ? 2018 HOH A O     1 
HETATM 4910 O  O     . HOH N 8 .   ? -0.661  3.011   -4.911  1.00 41.71  ? 2019 HOH A O     1 
HETATM 4911 O  O     . HOH N 8 .   ? 2.875   5.498   -2.846  1.00 40.42  ? 2020 HOH A O     1 
HETATM 4912 O  O     . HOH N 8 .   ? 1.967   1.859   3.002   1.00 34.66  ? 2021 HOH A O     1 
HETATM 4913 O  O     . HOH N 8 .   ? 0.520   1.550   0.116   1.00 37.59  ? 2022 HOH A O     1 
HETATM 4914 O  O     . HOH N 8 .   ? -4.276  -4.626  -0.806  1.00 31.16  ? 2023 HOH A O     1 
HETATM 4915 O  O     . HOH N 8 .   ? -7.463  -3.278  -0.835  1.00 35.66  ? 2024 HOH A O     1 
HETATM 4916 O  O     . HOH N 8 .   ? -2.799  -0.992  -4.350  1.00 49.86  ? 2025 HOH A O     1 
HETATM 4917 O  O     . HOH N 8 .   ? -3.866  3.815   -5.221  1.00 35.86  ? 2026 HOH A O     1 
HETATM 4918 O  O     . HOH N 8 .   ? -8.109  9.103   -1.595  1.00 44.84  ? 2027 HOH A O     1 
HETATM 4919 O  O     . HOH N 8 .   ? -4.986  0.874   -4.700  1.00 37.24  ? 2028 HOH A O     1 
HETATM 4920 O  O     . HOH N 8 .   ? -9.021  -1.787  -2.369  1.00 37.00  ? 2029 HOH A O     1 
HETATM 4921 O  O     . HOH N 8 .   ? -10.573 3.069   2.644   1.00 23.48  ? 2030 HOH A O     1 
HETATM 4922 O  O     . HOH N 8 .   ? -11.343 -3.148  2.381   1.00 15.03  ? 2031 HOH A O     1 
HETATM 4923 O  O     . HOH N 8 .   ? -10.990 0.571   1.698   1.00 20.17  ? 2032 HOH A O     1 
HETATM 4924 O  O     . HOH N 8 .   ? -1.093  1.409   6.368   1.00 47.35  ? 2033 HOH A O     1 
HETATM 4925 O  O     . HOH N 8 .   ? 0.233   1.859   8.297   1.00 41.21  ? 2034 HOH A O     1 
HETATM 4926 O  O     . HOH N 8 .   ? 3.270   0.458   6.477   1.00 27.45  ? 2035 HOH A O     1 
HETATM 4927 O  O     . HOH N 8 .   ? 6.100   13.493  5.857   1.00 23.47  ? 2036 HOH A O     1 
HETATM 4928 O  O     . HOH N 8 .   ? 4.464   15.585  6.839   1.00 24.54  ? 2037 HOH A O     1 
HETATM 4929 O  O     . HOH N 8 .   ? 4.478   17.982  4.681   1.00 33.84  ? 2038 HOH A O     1 
HETATM 4930 O  O     . HOH N 8 .   ? -4.458  32.424  12.844  1.00 57.05  ? 2039 HOH A O     1 
HETATM 4931 O  O     . HOH N 8 .   ? 8.600   19.430  8.549   1.00 35.13  ? 2040 HOH A O     1 
HETATM 4932 O  O     . HOH N 8 .   ? 7.741   17.179  7.079   1.00 43.91  ? 2041 HOH A O     1 
HETATM 4933 O  O     . HOH N 8 .   ? 8.665   11.593  9.774   1.00 32.59  ? 2042 HOH A O     1 
HETATM 4934 O  O     . HOH N 8 .   ? 4.901   16.007  14.460  1.00 36.90  ? 2043 HOH A O     1 
HETATM 4935 O  O     . HOH N 8 .   ? 9.020   9.099   13.521  1.00 41.55  ? 2044 HOH A O     1 
HETATM 4936 O  O     . HOH N 8 .   ? 2.055   8.421   16.618  1.00 48.68  ? 2045 HOH A O     1 
HETATM 4937 O  O     . HOH N 8 .   ? 0.835   15.038  18.765  1.00 40.61  ? 2046 HOH A O     1 
HETATM 4938 O  O     . HOH N 8 .   ? -6.811  15.095  16.576  1.00 56.87  ? 2047 HOH A O     1 
HETATM 4939 O  O     . HOH N 8 .   ? -6.205  14.956  19.565  1.00 49.74  ? 2048 HOH A O     1 
HETATM 4940 O  O     . HOH N 8 .   ? -1.368  6.601   15.125  1.00 29.14  ? 2049 HOH A O     1 
HETATM 4941 O  O     . HOH N 8 .   ? 3.077   16.815  16.844  1.00 52.06  ? 2050 HOH A O     1 
HETATM 4942 O  O     . HOH N 8 .   ? -9.628  15.194  17.259  1.00 53.16  ? 2051 HOH A O     1 
HETATM 4943 O  O     . HOH N 8 .   ? -7.604  22.212  13.807  1.00 50.05  ? 2052 HOH A O     1 
HETATM 4944 O  O     . HOH N 8 .   ? -11.614 16.981  17.685  1.00 47.04  ? 2053 HOH A O     1 
HETATM 4945 O  O     . HOH N 8 .   ? -13.656 19.760  15.644  1.00 52.98  ? 2054 HOH A O     1 
HETATM 4946 O  O     . HOH N 8 .   ? -14.617 23.198  9.103   1.00 29.98  ? 2055 HOH A O     1 
HETATM 4947 O  O     . HOH N 8 .   ? -16.793 18.822  11.724  1.00 48.96  ? 2056 HOH A O     1 
HETATM 4948 O  O     . HOH N 8 .   ? -13.126 30.124  8.129   1.00 62.00  ? 2057 HOH A O     1 
HETATM 4949 O  O     . HOH N 8 .   ? -15.040 15.387  3.015   1.00 24.41  ? 2058 HOH A O     1 
HETATM 4950 O  O     . HOH N 8 .   ? -14.256 7.476   -1.516  1.00 35.67  ? 2059 HOH A O     1 
HETATM 4951 O  O     . HOH N 8 .   ? -12.276 6.610   0.376   1.00 24.92  ? 2060 HOH A O     1 
HETATM 4952 O  O     . HOH N 8 .   ? -13.042 12.380  0.731   1.00 28.23  ? 2061 HOH A O     1 
HETATM 4953 O  O     . HOH N 8 .   ? -12.330 10.339  -1.778  1.00 39.56  ? 2062 HOH A O     1 
HETATM 4954 O  O     . HOH N 8 .   ? -11.607 10.419  12.670  1.00 41.21  ? 2063 HOH A O     1 
HETATM 4955 O  O     . HOH N 8 .   ? -14.981 11.110  12.427  1.00 45.77  ? 2064 HOH A O     1 
HETATM 4956 O  O     . HOH N 8 .   ? -11.445 4.841   16.018  1.00 52.18  ? 2065 HOH A O     1 
HETATM 4957 O  O     . HOH N 8 .   ? -9.244  0.219   12.948  1.00 35.03  ? 2066 HOH A O     1 
HETATM 4958 O  O     . HOH N 8 .   ? -7.000  -0.603  12.886  1.00 45.17  ? 2067 HOH A O     1 
HETATM 4959 O  O     . HOH N 8 .   ? -1.950  2.483   14.769  1.00 41.42  ? 2068 HOH A O     1 
HETATM 4960 O  O     . HOH N 8 .   ? -10.176 10.377  19.842  1.00 51.93  ? 2069 HOH A O     1 
HETATM 4961 O  O     . HOH N 8 .   ? -14.139 8.179   17.419  1.00 54.98  ? 2070 HOH A O     1 
HETATM 4962 O  O     . HOH N 8 .   ? -14.534 11.992  14.706  1.00 43.96  ? 2071 HOH A O     1 
HETATM 4963 O  O     . HOH N 8 .   ? -18.775 16.515  9.419   1.00 37.27  ? 2072 HOH A O     1 
HETATM 4964 O  O     . HOH N 8 .   ? -16.138 17.072  4.776   1.00 21.50  ? 2073 HOH A O     1 
HETATM 4965 O  O     . HOH N 8 .   ? -14.688 14.872  -0.483  1.00 30.22  ? 2074 HOH A O     1 
HETATM 4966 O  O     . HOH N 8 .   ? -25.032 18.591  -6.183  1.00 21.82  ? 2075 HOH A O     1 
HETATM 4967 O  O     . HOH N 8 .   ? -23.686 12.362  -3.773  1.00 49.66  ? 2076 HOH A O     1 
HETATM 4968 O  O     . HOH N 8 .   ? -26.319 20.894  -7.028  1.00 24.61  ? 2077 HOH A O     1 
HETATM 4969 O  O     . HOH N 8 .   ? -24.621 26.704  -9.353  1.00 37.55  ? 2078 HOH A O     1 
HETATM 4970 O  O     . HOH N 8 .   ? -22.079 26.234  -11.519 1.00 36.08  ? 2079 HOH A O     1 
HETATM 4971 O  O     . HOH N 8 .   ? -24.615 19.752  -13.766 1.00 27.19  ? 2080 HOH A O     1 
HETATM 4972 O  O     . HOH N 8 .   ? -21.957 21.531  -16.164 1.00 47.05  ? 2081 HOH A O     1 
HETATM 4973 O  O     . HOH N 8 .   ? -22.084 25.245  -13.780 1.00 45.56  ? 2082 HOH A O     1 
HETATM 4974 O  O     . HOH N 8 .   ? -21.306 14.099  -12.405 1.00 31.13  ? 2083 HOH A O     1 
HETATM 4975 O  O     . HOH N 8 .   ? -14.248 17.076  -11.692 1.00 30.82  ? 2084 HOH A O     1 
HETATM 4976 O  O     . HOH N 8 .   ? -16.250 18.603  -15.073 1.00 54.66  ? 2085 HOH A O     1 
HETATM 4977 O  O     . HOH N 8 .   ? -17.455 21.124  -13.724 1.00 52.94  ? 2086 HOH A O     1 
HETATM 4978 O  O     . HOH N 8 .   ? -14.880 19.651  -12.753 1.00 37.41  ? 2087 HOH A O     1 
HETATM 4979 O  O     . HOH N 8 .   ? -15.780 11.444  -7.054  1.00 37.20  ? 2088 HOH A O     1 
HETATM 4980 O  O     . HOH N 8 .   ? -13.394 13.357  -5.336  1.00 35.55  ? 2089 HOH A O     1 
HETATM 4981 O  O     . HOH N 8 .   ? -15.407 11.400  -11.260 1.00 43.92  ? 2090 HOH A O     1 
HETATM 4982 O  O     . HOH N 8 .   ? -10.114 14.345  -12.782 1.00 60.69  ? 2091 HOH A O     1 
HETATM 4983 O  O     . HOH N 8 .   ? -5.342  20.005  -11.405 1.00 40.72  ? 2092 HOH A O     1 
HETATM 4984 O  O     . HOH N 8 .   ? -8.278  12.307  -5.900  1.00 49.54  ? 2093 HOH A O     1 
HETATM 4985 O  O     . HOH N 8 .   ? -12.415 20.512  -14.960 1.00 50.28  ? 2094 HOH A O     1 
HETATM 4986 O  O     . HOH N 8 .   ? -6.505  25.872  -12.772 1.00 49.14  ? 2095 HOH A O     1 
HETATM 4987 O  O     . HOH N 8 .   ? -5.068  22.701  -12.614 1.00 56.13  ? 2096 HOH A O     1 
HETATM 4988 O  O     . HOH N 8 .   ? -16.248 28.280  -13.760 1.00 49.35  ? 2097 HOH A O     1 
HETATM 4989 O  O     . HOH N 8 .   ? -18.608 28.485  -13.428 1.00 56.10  ? 2098 HOH A O     1 
HETATM 4990 O  O     . HOH N 8 .   ? -19.430 26.927  -10.825 1.00 35.80  ? 2099 HOH A O     1 
HETATM 4991 O  O     . HOH N 8 .   ? -12.188 30.709  -10.348 1.00 43.21  ? 2100 HOH A O     1 
HETATM 4992 O  O     . HOH N 8 .   ? -4.562  28.246  -12.104 1.00 54.41  ? 2101 HOH A O     1 
HETATM 4993 O  O     . HOH N 8 .   ? -2.562  25.690  -6.560  1.00 40.84  ? 2102 HOH A O     1 
HETATM 4994 O  O     . HOH N 8 .   ? -1.832  20.670  -4.789  1.00 33.97  ? 2103 HOH A O     1 
HETATM 4995 O  O     . HOH N 8 .   ? -0.757  23.765  -5.687  1.00 50.47  ? 2104 HOH A O     1 
HETATM 4996 O  O     . HOH N 8 .   ? -1.512  15.394  -8.614  1.00 45.09  ? 2105 HOH A O     1 
HETATM 4997 O  O     . HOH N 8 .   ? 3.828   17.007  -6.718  1.00 52.70  ? 2106 HOH A O     1 
HETATM 4998 O  O     . HOH N 8 .   ? 4.059   12.631  -2.456  1.00 34.08  ? 2107 HOH A O     1 
HETATM 4999 O  O     . HOH N 8 .   ? 5.910   15.831  -4.362  1.00 46.49  ? 2108 HOH A O     1 
HETATM 5000 O  O     . HOH N 8 .   ? -1.891  11.099  -4.229  1.00 44.74  ? 2109 HOH A O     1 
HETATM 5001 O  O     . HOH N 8 .   ? 1.088   26.567  -3.193  1.00 54.21  ? 2110 HOH A O     1 
HETATM 5002 O  O     . HOH N 8 .   ? 5.758   16.936  2.126   1.00 43.53  ? 2111 HOH A O     1 
HETATM 5003 O  O     . HOH N 8 .   ? 9.352   20.974  6.816   1.00 54.68  ? 2112 HOH A O     1 
HETATM 5004 O  O     . HOH N 8 .   ? 4.123   15.665  0.406   1.00 24.81  ? 2113 HOH A O     1 
HETATM 5005 O  O     . HOH N 8 .   ? -1.168  25.010  -3.886  1.00 36.29  ? 2114 HOH A O     1 
HETATM 5006 O  O     . HOH N 8 .   ? 4.520   19.752  -6.877  1.00 46.20  ? 2115 HOH A O     1 
HETATM 5007 O  O     . HOH N 8 .   ? 6.356   21.494  -4.299  1.00 59.49  ? 2116 HOH A O     1 
HETATM 5008 O  O     . HOH N 8 .   ? -5.896  11.613  -1.313  1.00 39.42  ? 2117 HOH A O     1 
HETATM 5009 O  O     . HOH N 8 .   ? -1.534  6.819   -5.108  1.00 58.20  ? 2118 HOH A O     1 
HETATM 5010 O  O     . HOH N 8 .   ? 3.059   10.342  -3.532  1.00 35.35  ? 2119 HOH A O     1 
HETATM 5011 O  O     . HOH N 8 .   ? 4.723   8.080   -3.943  1.00 52.62  ? 2120 HOH A O     1 
HETATM 5012 O  O     . HOH N 8 .   ? 3.630   3.410   -4.478  1.00 54.24  ? 2121 HOH A O     1 
HETATM 5013 O  O     . HOH N 8 .   ? -3.821  29.383  0.383   1.00 34.05  ? 2122 HOH A O     1 
HETATM 5014 O  O     . HOH N 8 .   ? -9.995  30.408  2.552   1.00 42.26  ? 2123 HOH A O     1 
HETATM 5015 O  O     . HOH N 8 .   ? -7.547  30.930  5.858   1.00 48.81  ? 2124 HOH A O     1 
HETATM 5016 O  O     . HOH N 8 .   ? 7.888   11.844  7.200   1.00 24.30  ? 2125 HOH A O     1 
HETATM 5017 O  O     . HOH N 8 .   ? 7.385   16.540  4.074   1.00 65.91  ? 2126 HOH A O     1 
HETATM 5018 O  O     . HOH N 8 .   ? -9.227  32.043  -3.514  1.00 40.16  ? 2127 HOH A O     1 
HETATM 5019 O  O     . HOH N 8 .   ? -9.039  31.639  -5.687  1.00 58.77  ? 2128 HOH A O     1 
HETATM 5020 O  O     . HOH N 8 .   ? -2.513  30.087  -1.806  1.00 66.84  ? 2129 HOH A O     1 
HETATM 5021 O  O     . HOH N 8 .   ? -14.627 33.734  0.216   1.00 44.89  ? 2130 HOH A O     1 
HETATM 5022 O  O     . HOH N 8 .   ? 9.968   15.827  7.137   1.00 39.81  ? 2131 HOH A O     1 
HETATM 5023 O  O     . HOH N 8 .   ? -11.157 33.873  -3.715  1.00 50.07  ? 2132 HOH A O     1 
HETATM 5024 O  O     . HOH N 8 .   ? -15.454 33.609  -5.542  1.00 33.45  ? 2133 HOH A O     1 
HETATM 5025 O  O     . HOH N 8 .   ? 11.378  10.873  13.065  1.00 52.29  ? 2134 HOH A O     1 
HETATM 5026 O  O     . HOH N 8 .   ? -21.260 30.908  0.531   1.00 37.02  ? 2135 HOH A O     1 
HETATM 5027 O  O     . HOH N 8 .   ? -19.630 34.308  4.356   1.00 35.55  ? 2136 HOH A O     1 
HETATM 5028 O  O     . HOH N 8 .   ? -17.902 18.150  13.747  1.00 47.47  ? 2137 HOH A O     1 
HETATM 5029 O  O     . HOH N 8 .   ? -22.174 30.828  -8.325  1.00 50.88  ? 2138 HOH A O     1 
HETATM 5030 O  O     . HOH N 8 .   ? -23.275 33.807  -5.423  1.00 41.75  ? 2139 HOH A O     1 
HETATM 5031 O  O     . HOH N 8 .   ? -19.929 29.891  -10.076 1.00 36.32  ? 2140 HOH A O     1 
HETATM 5032 O  O     . HOH N 8 .   ? -16.779 35.058  0.679   1.00 51.24  ? 2141 HOH A O     1 
HETATM 5033 O  O     . HOH N 8 .   ? -24.818 33.820  1.506   1.00 35.91  ? 2142 HOH A O     1 
HETATM 5034 O  O     . HOH N 8 .   ? -29.489 28.150  -3.800  1.00 26.52  ? 2143 HOH A O     1 
HETATM 5035 O  O     . HOH N 8 .   ? -24.396 29.379  -8.305  1.00 49.13  ? 2144 HOH A O     1 
HETATM 5036 O  O     . HOH N 8 .   ? -31.743 29.473  -2.680  1.00 48.18  ? 2145 HOH A O     1 
HETATM 5037 O  O     . HOH N 8 .   ? -32.858 27.858  2.551   1.00 55.36  ? 2146 HOH A O     1 
HETATM 5038 O  O     . HOH N 8 .   ? -28.715 28.443  4.062   1.00 27.11  ? 2147 HOH A O     1 
HETATM 5039 O  O     . HOH N 8 .   ? -28.671 35.098  1.200   1.00 47.21  ? 2148 HOH A O     1 
HETATM 5040 O  O     . HOH N 8 .   ? -15.350 9.511   15.939  1.00 42.53  ? 2149 HOH A O     1 
HETATM 5041 O  O     . HOH N 8 .   ? -32.063 23.254  0.458   1.00 33.79  ? 2150 HOH A O     1 
HETATM 5042 O  O     . HOH N 8 .   ? -36.880 22.833  -5.583  1.00 43.78  ? 2151 HOH A O     1 
HETATM 5043 O  O     . HOH N 8 .   ? -19.474 16.254  12.070  1.00 52.41  ? 2152 HOH A O     1 
HETATM 5044 O  O     . HOH N 8 .   ? -27.277 26.883  5.782   1.00 32.72  ? 2153 HOH A O     1 
HETATM 5045 O  O     . HOH N 8 .   ? -35.078 24.882  4.750   1.00 54.32  ? 2154 HOH A O     1 
HETATM 5046 O  O     . HOH N 8 .   ? -23.017 22.994  -18.197 1.00 41.59  ? 2155 HOH A O     1 
HETATM 5047 O  O     . HOH N 8 .   ? -23.215 25.877  -16.059 1.00 52.09  ? 2156 HOH A O     1 
HETATM 5048 O  O     . HOH N 8 .   ? -22.652 15.111  -14.579 1.00 46.53  ? 2157 HOH A O     1 
HETATM 5049 O  O     . HOH N 8 .   ? -20.391 15.275  -16.047 1.00 53.49  ? 2158 HOH A O     1 
HETATM 5050 O  O     . HOH N 8 .   ? -11.359 11.674  -5.308  1.00 46.24  ? 2159 HOH A O     1 
HETATM 5051 O  O     . HOH N 8 .   ? -23.017 21.461  9.503   1.00 40.79  ? 2160 HOH A O     1 
HETATM 5052 O  O     . HOH N 8 .   ? -21.097 26.710  9.303   1.00 44.27  ? 2161 HOH A O     1 
HETATM 5053 O  O     . HOH N 8 .   ? -6.290  11.675  -4.266  1.00 38.26  ? 2162 HOH A O     1 
HETATM 5054 O  O     . HOH N 8 .   ? -12.242 22.599  -16.644 1.00 53.62  ? 2163 HOH A O     1 
HETATM 5055 O  O     . HOH N 8 .   ? -28.530 18.286  9.538   1.00 38.67  ? 2164 HOH A O     1 
HETATM 5056 O  O     . HOH N 8 .   ? -27.980 25.989  7.662   1.00 44.10  ? 2165 HOH A O     1 
HETATM 5057 O  O     . HOH N 8 .   ? 4.092   13.024  0.345   1.00 28.26  ? 2166 HOH A O     1 
HETATM 5058 O  O     . HOH N 8 .   ? -21.103 19.377  9.854   1.00 33.88  ? 2167 HOH A O     1 
HETATM 5059 O  O     . HOH N 8 .   ? -22.590 13.822  11.128  1.00 25.66  ? 2168 HOH A O     1 
HETATM 5060 O  O     . HOH N 8 .   ? -8.620  32.519  2.232   1.00 52.45  ? 2169 HOH A O     1 
HETATM 5061 O  O     . HOH N 8 .   ? -17.665 9.980   12.136  1.00 34.20  ? 2170 HOH A O     1 
HETATM 5062 O  O     . HOH N 8 .   ? -17.183 35.000  -6.346  1.00 52.23  ? 2171 HOH A O     1 
HETATM 5063 O  O     . HOH N 8 .   ? -19.229 4.508   16.075  1.00 59.41  ? 2172 HOH A O     1 
HETATM 5064 O  O     . HOH N 8 .   ? -16.837 5.581   14.091  1.00 38.59  ? 2173 HOH A O     1 
HETATM 5065 O  O     . HOH N 8 .   ? -33.741 24.827  2.425   1.00 55.89  ? 2174 HOH A O     1 
HETATM 5066 O  O     . HOH N 8 .   ? -31.530 28.501  4.842   1.00 43.39  ? 2175 HOH A O     1 
HETATM 5067 O  O     . HOH N 8 .   ? -18.914 -0.280  5.962   1.00 21.25  ? 2176 HOH A O     1 
HETATM 5068 O  O     . HOH N 8 .   ? -35.398 22.348  3.277   1.00 59.89  ? 2177 HOH A O     1 
HETATM 5069 O  O     . HOH N 8 .   ? -36.397 24.346  2.293   1.00 52.20  ? 2178 HOH A O     1 
HETATM 5070 O  O     . HOH N 8 .   ? -11.280 1.462   11.782  1.00 42.89  ? 2179 HOH A O     1 
HETATM 5071 O  O     . HOH N 8 .   ? -27.111 18.015  11.127  1.00 50.61  ? 2180 HOH A O     1 
HETATM 5072 O  O     . HOH N 8 .   ? -15.412 -2.218  13.389  1.00 37.99  ? 2181 HOH A O     1 
HETATM 5073 O  O     . HOH N 8 .   ? -13.554 -1.926  12.287  1.00 36.27  ? 2182 HOH A O     1 
HETATM 5074 O  O     . HOH N 8 .   ? -17.368 1.962   14.634  1.00 37.83  ? 2183 HOH A O     1 
HETATM 5075 O  O     . HOH N 8 .   ? -15.206 3.826   13.090  1.00 53.51  ? 2184 HOH A O     1 
HETATM 5076 O  O     . HOH N 8 .   ? -21.096 13.166  13.281  1.00 39.06  ? 2185 HOH A O     1 
HETATM 5077 O  O     . HOH N 8 .   ? -22.066 16.398  12.080  1.00 43.38  ? 2186 HOH A O     1 
HETATM 5078 O  O     . HOH N 8 .   ? -18.906 11.771  13.652  1.00 37.98  ? 2187 HOH A O     1 
HETATM 5079 O  O     . HOH N 8 .   ? -20.366 -6.655  10.131  1.00 19.92  ? 2188 HOH A O     1 
HETATM 5080 O  O     . HOH N 8 .   ? -14.208 -12.504 11.182  1.00 41.03  ? 2189 HOH A O     1 
HETATM 5081 O  O     . HOH N 8 .   ? -16.625 -11.031 15.033  1.00 32.48  ? 2190 HOH A O     1 
HETATM 5082 O  O     . HOH N 8 .   ? -14.394 -10.576 7.711   1.00 28.02  ? 2191 HOH A O     1 
HETATM 5083 O  O     . HOH N 8 .   ? -14.525 -14.607 8.048   1.00 38.90  ? 2192 HOH A O     1 
HETATM 5084 O  O     . HOH N 8 .   ? -13.031 2.285   13.912  1.00 39.58  ? 2193 HOH A O     1 
HETATM 5085 O  O     . HOH N 8 .   ? -15.381 -0.213  14.843  1.00 46.56  ? 2194 HOH A O     1 
HETATM 5086 O  O     . HOH N 8 .   ? -19.158 -20.464 6.758   1.00 55.35  ? 2195 HOH A O     1 
HETATM 5087 O  O     . HOH N 8 .   ? -15.063 -17.379 7.598   1.00 34.17  ? 2196 HOH A O     1 
HETATM 5088 O  O     . HOH N 8 .   ? -21.321 -19.964 6.780   1.00 44.41  ? 2197 HOH A O     1 
HETATM 5089 O  O     . HOH N 8 .   ? -22.976 -16.534 6.153   1.00 27.20  ? 2198 HOH A O     1 
HETATM 5090 O  O     . HOH N 8 .   ? -15.804 -10.459 17.825  1.00 55.71  ? 2199 HOH A O     1 
HETATM 5091 O  O     . HOH N 8 .   ? -12.495 -12.691 7.650   1.00 27.45  ? 2200 HOH A O     1 
HETATM 5092 O  O     . HOH N 8 .   ? -19.116 -22.180 4.905   1.00 47.55  ? 2201 HOH A O     1 
HETATM 5093 O  O     . HOH N 8 .   ? -24.291 -18.570 5.846   1.00 49.67  ? 2202 HOH A O     1 
HETATM 5094 O  O     . HOH N 8 .   ? -24.174 -16.489 8.640   1.00 48.73  ? 2203 HOH A O     1 
HETATM 5095 O  O     . HOH N 8 .   ? -14.657 -22.732 2.788   1.00 30.73  ? 2204 HOH A O     1 
HETATM 5096 O  O     . HOH N 8 .   ? -13.992 -24.291 0.758   1.00 34.79  ? 2205 HOH A O     1 
HETATM 5097 O  O     . HOH N 8 .   ? -16.298 -24.230 4.374   1.00 46.57  ? 2206 HOH A O     1 
HETATM 5098 O  O     . HOH N 8 .   ? -12.134 -22.164 4.207   1.00 37.62  ? 2207 HOH A O     1 
HETATM 5099 O  O     . HOH N 8 .   ? -20.842 -23.062 2.637   1.00 50.85  ? 2208 HOH A O     1 
HETATM 5100 O  O     . HOH N 8 .   ? -24.013 -24.274 0.797   1.00 50.57  ? 2209 HOH A O     1 
HETATM 5101 O  O     . HOH N 8 .   ? -20.821 -21.283 -0.011  1.00 32.14  ? 2210 HOH A O     1 
HETATM 5102 O  O     . HOH N 8 .   ? -25.576 -22.145 0.858   1.00 49.48  ? 2211 HOH A O     1 
HETATM 5103 O  O     . HOH N 8 .   ? -10.536 -22.437 -1.836  1.00 50.86  ? 2212 HOH A O     1 
HETATM 5104 O  O     . HOH N 8 .   ? -11.470 -19.601 4.687   1.00 36.99  ? 2213 HOH A O     1 
HETATM 5105 O  O     . HOH N 8 .   ? -6.444  -12.211 1.712   1.00 25.16  ? 2214 HOH A O     1 
HETATM 5106 O  O     . HOH N 8 .   ? -15.678 -26.141 -0.033  1.00 34.68  ? 2215 HOH A O     1 
HETATM 5107 O  O     . HOH N 8 .   ? -11.512 -23.768 -0.263  1.00 49.20  ? 2216 HOH A O     1 
HETATM 5108 O  O     . HOH N 8 .   ? -14.038 -16.555 -2.717  1.00 27.09  ? 2217 HOH A O     1 
HETATM 5109 O  O     . HOH N 8 .   ? -12.034 -21.078 -3.022  1.00 33.42  ? 2218 HOH A O     1 
HETATM 5110 O  O     . HOH N 8 .   ? -9.683  -18.032 3.566   1.00 47.48  ? 2219 HOH A O     1 
HETATM 5111 O  O     . HOH N 8 .   ? -9.732  -14.538 -3.536  1.00 38.58  ? 2220 HOH A O     1 
HETATM 5112 O  O     . HOH N 8 .   ? -11.804 -17.635 -3.264  1.00 49.33  ? 2221 HOH A O     1 
HETATM 5113 O  O     . HOH N 8 .   ? -6.281  -15.249 -1.714  1.00 66.32  ? 2222 HOH A O     1 
HETATM 5114 O  O     . HOH N 8 .   ? -7.638  -13.343 -0.225  1.00 41.13  ? 2223 HOH A O     1 
HETATM 5115 O  O     . HOH N 8 .   ? -7.247  -14.106 3.371   1.00 31.24  ? 2224 HOH A O     1 
HETATM 5116 O  O     . HOH N 8 .   ? -11.921 -23.424 -8.774  1.00 42.99  ? 2225 HOH A O     1 
HETATM 5117 O  O     . HOH N 8 .   ? -26.527 -24.482 -8.497  1.00 55.87  ? 2226 HOH A O     1 
HETATM 5118 O  O     . HOH N 8 .   ? -15.179 -28.653 -12.598 1.00 47.52  ? 2227 HOH A O     1 
HETATM 5119 O  O     . HOH N 8 .   ? -12.900 -24.440 -13.304 1.00 48.51  ? 2228 HOH A O     1 
HETATM 5120 O  O     . HOH N 8 .   ? -14.773 -22.657 -16.965 1.00 38.48  ? 2229 HOH A O     1 
HETATM 5121 O  O     . HOH N 8 .   ? -14.722 -20.276 -13.199 1.00 39.07  ? 2230 HOH A O     1 
HETATM 5122 O  O     . HOH N 8 .   ? -17.374 -29.976 -16.295 1.00 52.24  ? 2231 HOH A O     1 
HETATM 5123 O  O     . HOH N 8 .   ? -15.145 -28.476 -4.632  1.00 55.26  ? 2232 HOH A O     1 
HETATM 5124 O  O     . HOH N 8 .   ? -21.283 -28.302 -4.061  1.00 55.69  ? 2233 HOH A O     1 
HETATM 5125 O  O     . HOH N 8 .   ? -17.536 -25.587 -2.159  1.00 29.53  ? 2234 HOH A O     1 
HETATM 5126 O  O     . HOH N 8 .   ? -24.995 -27.972 -17.652 1.00 51.32  ? 2235 HOH A O     1 
HETATM 5127 O  O     . HOH N 8 .   ? -25.693 -22.096 -9.763  1.00 55.52  ? 2236 HOH A O     1 
HETATM 5128 O  O     . HOH N 8 .   ? -15.132 -29.249 -18.599 1.00 51.55  ? 2237 HOH A O     1 
HETATM 5129 O  O     . HOH N 8 .   ? -13.659 -24.788 -18.300 1.00 53.40  ? 2238 HOH A O     1 
HETATM 5130 O  O     . HOH N 8 .   ? -23.377 -31.076 -17.749 1.00 62.91  ? 2239 HOH A O     1 
HETATM 5131 O  O     . HOH N 8 .   ? -19.306 -31.118 -17.484 1.00 50.15  ? 2240 HOH A O     1 
HETATM 5132 O  O     . HOH N 8 .   ? -19.096 -32.278 -22.148 1.00 54.50  ? 2241 HOH A O     1 
HETATM 5133 O  O     . HOH N 8 .   ? -13.989 -25.727 -8.487  1.00 44.39  ? 2242 HOH A O     1 
HETATM 5134 O  O     . HOH N 8 .   ? -21.197 -26.723 -8.273  1.00 38.30  ? 2243 HOH A O     1 
HETATM 5135 O  O     . HOH N 8 .   ? -24.100 -25.378 -1.286  1.00 46.60  ? 2244 HOH A O     1 
HETATM 5136 O  O     . HOH N 8 .   ? -25.950 -23.504 -5.953  1.00 48.59  ? 2245 HOH A O     1 
HETATM 5137 O  O     . HOH N 8 .   ? -14.151 -26.269 -11.277 1.00 42.84  ? 2246 HOH A O     1 
HETATM 5138 O  O     . HOH N 8 .   ? -14.804 -22.851 -14.195 1.00 32.11  ? 2247 HOH A O     1 
HETATM 5139 O  O     . HOH N 8 .   ? -17.157 -28.980 -13.617 1.00 40.34  ? 2248 HOH A O     1 
HETATM 5140 O  O     . HOH N 8 .   ? -14.724 -28.066 -6.954  1.00 48.68  ? 2249 HOH A O     1 
HETATM 5141 O  O     . HOH N 8 .   ? -19.389 -28.195 -6.275  1.00 54.60  ? 2250 HOH A O     1 
HETATM 5142 O  O     . HOH N 8 .   ? -19.116 -31.039 -12.406 1.00 57.43  ? 2251 HOH A O     1 
HETATM 5143 O  O     . HOH N 8 .   ? -21.883 -8.931  -24.369 1.00 49.01  ? 2252 HOH A O     1 
HETATM 5144 O  O     . HOH N 8 .   ? -24.664 -27.751 -15.068 1.00 65.40  ? 2253 HOH A O     1 
HETATM 5145 O  O     . HOH N 8 .   ? -26.554 -23.447 -12.987 1.00 59.14  ? 2254 HOH A O     1 
HETATM 5146 O  O     . HOH N 8 .   ? -15.649 -26.802 -19.262 1.00 42.25  ? 2255 HOH A O     1 
HETATM 5147 O  O     . HOH N 8 .   ? -35.558 -16.275 -37.722 1.00 44.88  ? 2256 HOH A O     1 
HETATM 5148 O  O     . HOH N 8 .   ? -21.348 -30.263 -18.770 1.00 42.43  ? 2257 HOH A O     1 
HETATM 5149 O  O     . HOH N 8 .   ? -24.988 -21.397 -40.440 1.00 58.78  ? 2258 HOH A O     1 
HETATM 5150 O  O     . HOH N 8 .   ? -15.780 -19.127 -21.345 1.00 49.85  ? 2259 HOH A O     1 
HETATM 5151 O  O     . HOH N 8 .   ? -15.341 -20.425 -18.390 1.00 38.11  ? 2260 HOH A O     1 
HETATM 5152 O  O     . HOH N 8 .   ? -15.494 -26.509 -21.820 1.00 51.40  ? 2261 HOH A O     1 
HETATM 5153 O  O     . HOH N 8 .   ? -18.489 -30.034 -24.489 1.00 45.00  ? 2262 HOH A O     1 
HETATM 5154 O  O     . HOH N 8 .   ? -21.428 -31.526 -21.564 1.00 57.54  ? 2263 HOH A O     1 
HETATM 5155 O  O     . HOH N 8 .   ? -29.280 -4.214  -22.338 1.00 41.87  ? 2264 HOH A O     1 
HETATM 5156 O  O     . HOH N 8 .   ? -33.278 -8.020  -18.548 1.00 52.25  ? 2265 HOH A O     1 
HETATM 5157 O  O     . HOH N 8 .   ? -37.239 -10.937 -18.812 1.00 58.43  ? 2266 HOH A O     1 
HETATM 5158 O  O     . HOH N 8 .   ? -36.580 -29.005 -26.134 1.00 56.82  ? 2267 HOH A O     1 
HETATM 5159 O  O     . HOH N 8 .   ? -15.339 -18.626 -24.274 1.00 59.26  ? 2268 HOH A O     1 
HETATM 5160 O  O     . HOH N 8 .   ? -15.061 -17.931 -14.886 1.00 37.99  ? 2269 HOH A O     1 
HETATM 5161 O  O     . HOH N 8 .   ? -22.671 -10.496 -17.938 1.00 37.86  ? 2270 HOH A O     1 
HETATM 5162 O  O     . HOH N 8 .   ? -18.114 -11.323 -17.371 1.00 47.35  ? 2271 HOH A O     1 
HETATM 5163 O  O     . HOH N 8 .   ? -27.344 -19.586 -9.279  1.00 51.49  ? 2272 HOH A O     1 
HETATM 5164 O  O     . HOH N 8 .   ? -14.561 -13.521 -16.137 1.00 48.63  ? 2273 HOH A O     1 
HETATM 5165 O  O     . HOH N 8 .   ? -19.408 -9.354  -25.645 1.00 43.63  ? 2274 HOH A O     1 
HETATM 5166 O  O     . HOH N 8 .   ? -19.678 -13.364 -20.512 1.00 34.58  ? 2275 HOH A O     1 
HETATM 5167 O  O     . HOH N 8 .   ? -14.901 -16.399 -18.955 1.00 46.95  ? 2276 HOH A O     1 
HETATM 5168 O  O     . HOH N 8 .   ? -10.908 -7.347  -9.061  1.00 54.35  ? 2277 HOH A O     1 
HETATM 5169 O  O     . HOH N 8 .   ? -13.412 -4.898  -6.033  1.00 33.64  ? 2278 HOH A O     1 
HETATM 5170 O  O     . HOH N 8 .   ? -18.983 -9.030  -29.365 1.00 41.87  ? 2279 HOH A O     1 
HETATM 5171 O  O     . HOH N 8 .   ? -10.662 -5.854  -5.810  1.00 36.22  ? 2280 HOH A O     1 
HETATM 5172 O  O     . HOH N 8 .   ? -7.338  -6.788  -3.603  1.00 34.35  ? 2281 HOH A O     1 
HETATM 5173 O  O     . HOH N 8 .   ? -22.038 -12.614 -24.696 1.00 55.45  ? 2282 HOH A O     1 
HETATM 5174 O  O     . HOH N 8 .   ? -10.165 -13.112 6.217   1.00 26.44  ? 2283 HOH A O     1 
HETATM 5175 O  O     . HOH N 8 .   ? -9.073  -8.593  -8.394  1.00 62.66  ? 2284 HOH A O     1 
HETATM 5176 O  O     . HOH N 8 .   ? -4.576  -8.573  14.692  1.00 53.27  ? 2285 HOH A O     1 
HETATM 5177 O  O     . HOH N 8 .   ? -10.860 -6.040  16.050  1.00 61.74  ? 2286 HOH A O     1 
HETATM 5178 O  O     . HOH N 8 .   ? -6.145  -5.694  16.875  1.00 61.93  ? 2287 HOH A O     1 
HETATM 5179 O  O     . HOH N 8 .   ? -16.706 0.591   -9.347  1.00 39.23  ? 2288 HOH A O     1 
HETATM 5180 O  O     . HOH N 8 .   ? -32.684 -16.693 -36.695 1.00 37.04  ? 2289 HOH A O     1 
HETATM 5181 O  O     . HOH N 8 .   ? -26.528 -19.908 -41.143 1.00 54.78  ? 2290 HOH A O     1 
HETATM 5182 O  O     . HOH N 8 .   ? -23.337 -22.557 -8.640  1.00 47.71  ? 2291 HOH A O     1 
HETATM 5183 O  O     . HOH N 8 .   ? -32.891 -11.044 -30.801 1.00 41.31  ? 2292 HOH A O     1 
HETATM 5184 O  O     . HOH N 8 .   ? -23.004 -15.408 10.682  1.00 36.21  ? 2293 HOH A O     1 
HETATM 5185 O  O     . HOH N 8 .   ? -17.994 -3.745  21.442  1.00 59.40  ? 2294 HOH A O     1 
HETATM 5186 O  O     . HOH N 8 .   ? -22.228 -10.111 23.549  1.00 52.12  ? 2295 HOH A O     1 
HETATM 5187 O  O     . HOH N 8 .   ? -28.786 -2.449  -27.475 1.00 36.28  ? 2296 HOH A O     1 
HETATM 5188 O  O     . HOH N 8 .   ? -34.605 -4.177  -4.366  1.00 36.13  ? 2297 HOH A O     1 
HETATM 5189 O  O     . HOH N 8 .   ? -35.734 -6.170  -2.771  1.00 48.21  ? 2298 HOH A O     1 
HETATM 5190 O  O     . HOH N 8 .   ? -50.609 17.056  -3.989  1.00 46.81  ? 2299 HOH A O     1 
HETATM 5191 O  O     . HOH N 8 .   ? -31.691 -14.179 -37.857 1.00 45.89  ? 2300 HOH A O     1 
HETATM 5192 O  O     . HOH N 8 .   ? -50.462 20.036  -12.932 1.00 45.61  ? 2301 HOH A O     1 
HETATM 5193 O  O     . HOH N 8 .   ? -55.552 10.049  -2.057  1.00 45.34  ? 2302 HOH A O     1 
HETATM 5194 O  O     . HOH N 8 .   ? -52.373 19.516  -14.885 1.00 47.85  ? 2303 HOH A O     1 
HETATM 5195 O  O     . HOH N 8 .   ? -28.475 -4.549  -25.013 1.00 43.00  ? 2304 HOH A O     1 
HETATM 5196 O  O     . HOH N 8 .   ? -36.071 -6.755  -24.324 0.43 37.78  ? 2305 HOH A O     1 
HETATM 5197 O  O     . HOH N 8 .   ? -32.151 -7.555  -20.794 1.00 31.39  ? 2306 HOH A O     1 
HETATM 5198 O  O     . HOH N 8 .   ? -38.069 -11.255 -21.402 1.00 40.86  ? 2307 HOH A O     1 
HETATM 5199 O  O     . HOH N 8 .   ? -33.154 -23.127 -22.334 1.00 30.92  ? 2308 HOH A O     1 
HETATM 5200 O  O     . HOH N 8 .   ? -31.515 -19.424 -16.427 1.00 61.90  ? 2309 HOH A O     1 
HETATM 5201 O  O     . HOH N 8 .   ? -43.878 -7.864  -21.190 1.00 46.03  ? 2310 HOH A O     1 
HETATM 5202 O  O     . HOH N 8 .   ? -39.761 -25.682 -27.351 1.00 39.84  ? 2311 HOH A O     1 
HETATM 5203 O  O     . HOH N 8 .   ? -36.051 -26.457 -25.857 1.00 40.27  ? 2312 HOH A O     1 
HETATM 5204 O  O     . HOH N 8 .   ? -30.117 -27.834 -32.102 1.00 42.73  ? 2313 HOH A O     1 
HETATM 5205 O  O     . HOH N 8 .   ? -43.368 9.919   -23.222 1.00 53.35  ? 2314 HOH A O     1 
HETATM 5206 O  O     . HOH N 8 .   ? -29.479 2.479   -22.250 1.00 57.30  ? 2315 HOH A O     1 
HETATM 5207 O  O     . HOH N 8 .   ? -31.618 -3.166  -22.354 1.00 48.17  ? 2316 HOH A O     1 
HETATM 5208 O  O     . HOH N 8 .   ? -27.473 -14.028 -17.802 1.00 36.99  ? 2317 HOH A O     1 
HETATM 5209 O  O     . HOH N 8 .   ? -16.100 -18.061 -17.473 1.00 39.47  ? 2318 HOH A O     1 
HETATM 5210 O  O     . HOH N 8 .   ? -20.628 -12.598 -18.032 1.00 34.20  ? 2319 HOH A O     1 
HETATM 5211 O  O     . HOH N 8 .   ? -24.428 -11.059 -16.019 1.00 37.60  ? 2320 HOH A O     1 
HETATM 5212 O  O     . HOH N 8 .   ? -23.312 -10.862 -20.439 1.00 40.23  ? 2321 HOH A O     1 
HETATM 5213 O  O     . HOH N 8 .   ? -27.805 -12.671 -20.538 1.00 34.65  ? 2322 HOH A O     1 
HETATM 5214 O  O     . HOH N 8 .   ? -28.005 -16.817 -9.704  1.00 45.83  ? 2323 HOH A O     1 
HETATM 5215 O  O     . HOH N 8 .   ? -28.476 -11.324 -12.722 1.00 44.95  ? 2324 HOH A O     1 
HETATM 5216 O  O     . HOH N 8 .   ? -15.543 -15.397 -13.825 1.00 35.42  ? 2325 HOH A O     1 
HETATM 5217 O  O     . HOH N 8 .   ? -16.186 -11.609 -15.804 1.00 49.59  ? 2326 HOH A O     1 
HETATM 5218 O  O     . HOH N 8 .   ? -16.521 -7.836  -15.113 1.00 47.03  ? 2327 HOH A O     1 
HETATM 5219 O  O     . HOH N 8 .   ? -40.870 30.533  -19.510 1.00 40.22  ? 2328 HOH A O     1 
HETATM 5220 O  O     . HOH N 8 .   ? -13.498 -15.647 -12.346 1.00 48.88  ? 2329 HOH A O     1 
HETATM 5221 O  O     . HOH N 8 .   ? -31.091 32.840  -21.481 1.00 60.73  ? 2330 HOH A O     1 
HETATM 5222 O  O     . HOH N 8 .   ? -11.509 -11.636 -9.932  1.00 46.76  ? 2331 HOH A O     1 
HETATM 5223 O  O     . HOH N 8 .   ? -12.787 -7.806  -10.375 1.00 59.58  ? 2332 HOH A O     1 
HETATM 5224 O  O     . HOH N 8 .   ? -24.425 25.057  -18.179 1.00 31.33  ? 2333 HOH A O     1 
HETATM 5225 O  O     . HOH N 8 .   ? -23.563 26.470  -20.498 1.00 48.09  ? 2334 HOH A O     1 
HETATM 5226 O  O     . HOH N 8 .   ? -16.022 -6.056  -5.705  1.00 42.64  ? 2335 HOH A O     1 
HETATM 5227 O  O     . HOH N 8 .   ? -28.941 30.637  -10.733 1.00 59.22  ? 2336 HOH A O     1 
HETATM 5228 O  O     . HOH N 8 .   ? -12.109 -14.518 -10.455 1.00 36.48  ? 2337 HOH A O     1 
HETATM 5229 O  O     . HOH N 8 .   ? -26.336 13.975  -26.250 1.00 56.38  ? 2338 HOH A O     1 
HETATM 5230 O  O     . HOH N 8 .   ? -9.719  -7.850  -4.332  1.00 32.37  ? 2339 HOH A O     1 
HETATM 5231 O  O     . HOH N 8 .   ? -37.341 29.643  -22.323 1.00 44.90  ? 2340 HOH A O     1 
HETATM 5232 O  O     . HOH N 8 .   ? -9.715  -13.100 3.477   1.00 24.06  ? 2341 HOH A O     1 
HETATM 5233 O  O     . HOH N 8 .   ? -6.809  -9.446  2.358   1.00 23.46  ? 2342 HOH A O     1 
HETATM 5234 O  O     . HOH N 8 .   ? -6.710  -6.034  -0.959  1.00 32.50  ? 2343 HOH A O     1 
HETATM 5235 O  O     . HOH N 8 .   ? -8.761  -9.272  -6.064  1.00 39.85  ? 2344 HOH A O     1 
HETATM 5236 O  O     . HOH N 8 .   ? -6.564  -9.897  5.839   1.00 22.49  ? 2345 HOH A O     1 
HETATM 5237 O  O     . HOH N 8 .   ? -7.784  -9.680  11.298  1.00 30.83  ? 2346 HOH A O     1 
HETATM 5238 O  O     . HOH N 8 .   ? -4.326  -9.708  12.147  1.00 27.53  ? 2347 HOH A O     1 
HETATM 5239 O  O     . HOH N 8 .   ? -9.085  -6.620  14.691  1.00 40.91  ? 2348 HOH A O     1 
HETATM 5240 O  O     . HOH N 8 .   ? -5.196  -6.172  14.433  1.00 55.15  ? 2349 HOH A O     1 
HETATM 5241 O  O     . HOH N 8 .   ? -2.938  -0.319  9.436   1.00 40.80  ? 2350 HOH A O     1 
HETATM 5242 O  O     . HOH N 8 .   ? -2.663  -5.220  14.356  1.00 49.72  ? 2351 HOH A O     1 
HETATM 5243 O  O     . HOH N 8 .   ? 3.224   -0.955  11.785  1.00 33.90  ? 2352 HOH A O     1 
HETATM 5244 O  O     . HOH N 8 .   ? -12.293 -4.392  13.733  1.00 49.31  ? 2353 HOH A O     1 
HETATM 5245 O  O     . HOH N 8 .   ? -13.730 -10.013 11.628  1.00 27.95  ? 2354 HOH A O     1 
HETATM 5246 O  O     . HOH N 8 .   ? -11.446 -11.819 10.099  1.00 36.13  ? 2355 HOH A O     1 
HETATM 5247 O  O     . HOH N 8 .   ? -15.470 -4.662  14.800  1.00 35.85  ? 2356 HOH A O     1 
HETATM 5248 O  O     . HOH N 8 .   ? -26.103 15.965  12.812  1.00 51.35  ? 2357 HOH A O     1 
HETATM 5249 O  O     . HOH N 8 .   ? -17.701 -1.942  4.193   1.00 18.48  ? 2358 HOH A O     1 
HETATM 5250 O  O     . HOH N 8 .   ? -12.435 -2.049  0.089   1.00 28.17  ? 2359 HOH A O     1 
HETATM 5251 O  O     . HOH N 8 .   ? -33.116 7.589   20.455  1.00 67.42  ? 2360 HOH A O     1 
HETATM 5252 O  O     . HOH N 8 .   ? -21.337 -3.686  22.263  1.00 46.53  ? 2361 HOH A O     1 
HETATM 5253 O  O     . HOH N 8 .   ? -19.029 -0.685  20.398  1.00 49.05  ? 2362 HOH A O     1 
HETATM 5254 O  O     . HOH N 8 .   ? -16.621 5.224   -3.944  1.00 40.70  ? 2363 HOH A O     1 
HETATM 5255 O  O     . HOH N 8 .   ? -11.846 2.818   -4.601  1.00 46.79  ? 2364 HOH A O     1 
HETATM 5256 O  O     . HOH N 8 .   ? -21.977 10.698  -5.159  1.00 36.49  ? 2365 HOH A O     1 
HETATM 5257 O  O     . HOH N 8 .   ? -16.760 11.715  -0.769  1.00 34.71  ? 2366 HOH A O     1 
HETATM 5258 O  O     . HOH N 8 .   ? -16.570 13.591  1.375   1.00 27.64  ? 2367 HOH A O     1 
HETATM 5259 O  O     . HOH N 8 .   ? -15.357 13.804  -2.836  1.00 34.55  ? 2368 HOH A O     1 
HETATM 5260 O  O     . HOH N 8 .   ? -20.943 11.391  -12.713 1.00 40.45  ? 2369 HOH A O     1 
HETATM 5261 O  O     . HOH N 8 .   ? -18.388 8.709   -10.702 1.00 48.13  ? 2370 HOH A O     1 
HETATM 5262 O  O     . HOH N 8 .   ? -42.321 3.539   13.095  1.00 48.58  ? 2371 HOH A O     1 
HETATM 5263 O  O     . HOH N 8 .   ? -41.268 -0.500  14.267  1.00 45.99  ? 2372 HOH A O     1 
HETATM 5264 O  O     . HOH N 8 .   ? -29.647 8.917   -10.272 1.00 35.02  ? 2373 HOH A O     1 
HETATM 5265 O  O     . HOH N 8 .   ? -28.641 13.691  -3.315  1.00 41.71  ? 2374 HOH A O     1 
HETATM 5266 O  O     . HOH N 8 .   ? -28.711 2.301   -7.040  1.00 49.73  ? 2375 HOH A O     1 
HETATM 5267 O  O     . HOH N 8 .   ? -32.017 8.027   -6.179  1.00 25.74  ? 2376 HOH A O     1 
HETATM 5268 O  O     . HOH N 8 .   ? -30.199 7.353   -3.550  1.00 38.69  ? 2377 HOH A O     1 
HETATM 5269 O  O     . HOH N 8 .   ? -26.289 4.459   -3.255  1.00 39.30  ? 2378 HOH A O     1 
HETATM 5270 O  O     . HOH N 8 .   ? -26.495 1.884   -5.287  1.00 40.22  ? 2379 HOH A O     1 
HETATM 5271 O  O     . HOH N 8 .   ? -27.486 4.905   -10.283 1.00 34.68  ? 2380 HOH A O     1 
HETATM 5272 O  O     . HOH N 8 .   ? -31.640 2.853   -8.620  1.00 37.60  ? 2381 HOH A O     1 
HETATM 5273 O  O     . HOH N 8 .   ? -46.337 10.040  7.206   1.00 53.26  ? 2382 HOH A O     1 
HETATM 5274 O  O     . HOH N 8 .   ? -43.937 11.501  9.830   1.00 55.96  ? 2383 HOH A O     1 
HETATM 5275 O  O     . HOH N 8 .   ? -43.374 12.832  7.769   1.00 41.46  ? 2384 HOH A O     1 
HETATM 5276 O  O     . HOH N 8 .   ? -27.728 7.366   -2.614  1.00 36.21  ? 2385 HOH A O     1 
HETATM 5277 O  O     . HOH N 8 .   ? -24.538 3.545   -6.173  1.00 37.70  ? 2386 HOH A O     1 
HETATM 5278 O  O     . HOH N 8 .   ? -19.560 6.283   -9.121  1.00 48.97  ? 2387 HOH A O     1 
HETATM 5279 O  O     . HOH N 8 .   ? -17.460 5.861   -6.017  1.00 48.13  ? 2388 HOH A O     1 
HETATM 5280 O  O     . HOH N 8 .   ? -41.907 -3.250  10.684  1.00 58.70  ? 2389 HOH A O     1 
HETATM 5281 O  O     . HOH N 8 .   ? -22.048 2.619   -6.499  1.00 21.31  ? 2390 HOH A O     1 
HETATM 5282 O  O     . HOH N 8 .   ? -18.209 2.504   -8.170  1.00 32.92  ? 2391 HOH A O     1 
HETATM 5283 O  O     . HOH N 8 .   ? -23.745 1.836   -2.804  1.00 27.65  ? 2392 HOH A O     1 
HETATM 5284 O  O     . HOH N 8 .   ? -15.299 -1.268  -7.198  1.00 33.17  ? 2393 HOH A O     1 
HETATM 5285 O  O     . HOH N 8 .   ? -12.770 -2.653  -6.354  1.00 59.02  ? 2394 HOH A O     1 
HETATM 5286 O  O     . HOH N 8 .   ? -10.601 -0.534  -0.960  1.00 36.54  ? 2395 HOH A O     1 
HETATM 5287 O  O     . HOH N 8 .   ? -17.038 -3.897  -7.359  1.00 28.51  ? 2396 HOH A O     1 
HETATM 5288 O  O     . HOH N 8 .   ? -22.776 0.458   -10.823 1.00 33.51  ? 2397 HOH A O     1 
HETATM 5289 O  O     . HOH N 8 .   ? -18.218 -1.298  -10.700 1.00 34.52  ? 2398 HOH A O     1 
HETATM 5290 O  O     . HOH N 8 .   ? -26.476 -4.704  -3.148  1.00 44.01  ? 2399 HOH A O     1 
HETATM 5291 O  O     . HOH N 8 .   ? -23.545 -7.738  -12.080 1.00 39.41  ? 2400 HOH A O     1 
HETATM 5292 O  O     . HOH N 8 .   ? -23.852 -4.757  -13.760 1.00 32.68  ? 2401 HOH A O     1 
HETATM 5293 O  O     . HOH N 8 .   ? -21.513 -3.244  -14.510 1.00 37.88  ? 2402 HOH A O     1 
HETATM 5294 O  O     . HOH N 8 .   ? -32.026 -9.363  -9.643  1.00 35.08  ? 2403 HOH A O     1 
HETATM 5295 O  O     . HOH N 8 .   ? -31.160 -10.339 -2.143  1.00 41.85  ? 2404 HOH A O     1 
HETATM 5296 O  O     . HOH N 8 .   ? -35.180 -6.728  -11.482 1.00 51.73  ? 2405 HOH A O     1 
HETATM 5297 O  O     . HOH N 8 .   ? -29.519 -18.431 -3.244  1.00 42.81  ? 2406 HOH A O     1 
HETATM 5298 O  O     . HOH N 8 .   ? -32.977 -18.287 -4.122  1.00 48.27  ? 2407 HOH A O     1 
HETATM 5299 O  O     . HOH N 8 .   ? -34.415 -12.584 -0.966  1.00 47.78  ? 2408 HOH A O     1 
HETATM 5300 O  O     . HOH N 8 .   ? -24.513 -21.161 -5.966  1.00 49.69  ? 2409 HOH A O     1 
HETATM 5301 O  O     . HOH N 8 .   ? -28.932 -4.429  -2.035  1.00 41.97  ? 2410 HOH A O     1 
HETATM 5302 O  O     . HOH N 8 .   ? -29.276 -16.506 4.941   1.00 43.20  ? 2411 HOH A O     1 
HETATM 5303 O  O     . HOH N 8 .   ? -22.752 -13.170 12.359  1.00 29.26  ? 2412 HOH A O     1 
HETATM 5304 O  O     . HOH N 8 .   ? -23.785 -12.348 16.406  1.00 59.95  ? 2413 HOH A O     1 
HETATM 5305 O  O     . HOH N 8 .   ? -14.498 -7.242  17.250  1.00 61.94  ? 2414 HOH A O     1 
HETATM 5306 O  O     . HOH N 8 .   ? -16.738 -4.715  19.200  1.00 49.70  ? 2415 HOH A O     1 
HETATM 5307 O  O     . HOH N 8 .   ? -17.393 -9.417  19.302  1.00 49.92  ? 2416 HOH A O     1 
HETATM 5308 O  O     . HOH N 8 .   ? -22.850 -14.249 17.155  1.00 55.54  ? 2417 HOH A O     1 
HETATM 5309 O  O     . HOH N 8 .   ? -23.788 -8.255  22.344  1.00 38.21  ? 2418 HOH A O     1 
HETATM 5310 O  O     . HOH N 8 .   ? -24.225 -12.771 14.346  1.00 59.24  ? 2419 HOH A O     1 
HETATM 5311 O  O     . HOH N 8 .   ? -35.294 -4.703  4.653   1.00 42.07  ? 2420 HOH A O     1 
HETATM 5312 O  O     . HOH N 8 .   ? -33.215 -0.883  -2.312  1.00 26.84  ? 2421 HOH A O     1 
HETATM 5313 O  O     . HOH N 8 .   ? -38.915 -2.175  -0.145  1.00 39.76  ? 2422 HOH A O     1 
HETATM 5314 O  O     . HOH N 8 .   ? -36.348 -2.301  -3.232  1.00 26.89  ? 2423 HOH A O     1 
HETATM 5315 O  O     . HOH N 8 .   ? -34.869 -4.735  -0.188  1.00 43.70  ? 2424 HOH A O     1 
HETATM 5316 O  O     . HOH N 8 .   ? -38.938 -1.103  -2.858  1.00 28.74  ? 2425 HOH A O     1 
HETATM 5317 O  O     . HOH N 8 .   ? -36.929 0.627   -3.388  1.00 29.00  ? 2426 HOH A O     1 
HETATM 5318 O  O     . HOH N 8 .   ? -40.868 4.839   0.909   1.00 24.89  ? 2427 HOH A O     1 
HETATM 5319 O  O     . HOH N 8 .   ? -43.401 -1.036  2.610   1.00 56.22  ? 2428 HOH A O     1 
HETATM 5320 O  O     . HOH N 8 .   ? -37.618 2.624   -4.395  0.62 44.02  ? 2429 HOH A O     1 
HETATM 5321 O  O     . HOH N 8 .   ? -39.692 3.701   -6.964  1.00 22.99  ? 2430 HOH A O     1 
HETATM 5322 O  O     . HOH N 8 .   ? -44.539 0.677   -2.040  1.00 34.79  ? 2431 HOH A O     1 
HETATM 5323 O  O     . HOH N 8 .   ? -37.108 4.061   -5.645  1.00 30.37  ? 2432 HOH A O     1 
HETATM 5324 O  O     . HOH N 8 .   ? -34.629 6.361   -11.879 1.00 40.74  ? 2433 HOH A O     1 
HETATM 5325 O  O     . HOH N 8 .   ? -48.132 3.756   1.370   1.00 33.97  ? 2434 HOH A O     1 
HETATM 5326 O  O     . HOH N 8 .   ? -47.831 1.509   -0.369  1.00 41.38  ? 2435 HOH A O     1 
HETATM 5327 O  O     . HOH N 8 .   ? -47.809 17.480  -3.880  1.00 39.50  ? 2436 HOH A O     1 
HETATM 5328 O  O     . HOH N 8 .   ? -42.729 20.037  -0.530  1.00 50.54  ? 2437 HOH A O     1 
HETATM 5329 O  O     . HOH N 8 .   ? -48.558 18.177  -12.305 1.00 34.82  ? 2438 HOH A O     1 
HETATM 5330 O  O     . HOH N 8 .   ? -52.533 16.766  -6.138  1.00 46.21  ? 2439 HOH A O     1 
HETATM 5331 O  O     . HOH N 8 .   ? -54.514 11.463  -11.502 1.00 42.82  ? 2440 HOH A O     1 
HETATM 5332 O  O     . HOH N 8 .   ? -55.249 11.438  -4.236  1.00 46.94  ? 2441 HOH A O     1 
HETATM 5333 O  O     . HOH N 8 .   ? -56.128 19.148  -7.486  1.00 54.58  ? 2442 HOH A O     1 
HETATM 5334 O  O     . HOH N 8 .   ? -52.130 6.166   4.182   1.00 61.85  ? 2443 HOH A O     1 
HETATM 5335 O  O     . HOH N 8 .   ? -54.158 12.423  -0.237  1.00 58.44  ? 2444 HOH A O     1 
HETATM 5336 O  O     . HOH N 8 .   ? -51.785 13.974  0.032   1.00 31.61  ? 2445 HOH A O     1 
HETATM 5337 O  O     . HOH N 8 .   ? -48.085 -2.436  -0.433  1.00 48.00  ? 2446 HOH A O     1 
HETATM 5338 O  O     . HOH N 8 .   ? -51.687 -3.106  -4.756  1.00 44.60  ? 2447 HOH A O     1 
HETATM 5339 O  O     . HOH N 8 .   ? -43.839 -6.162  -3.438  1.00 46.20  ? 2448 HOH A O     1 
HETATM 5340 O  O     . HOH N 8 .   ? -55.141 -1.980  -11.108 1.00 53.51  ? 2449 HOH A O     1 
HETATM 5341 O  O     . HOH N 8 .   ? -57.286 -6.097  -14.693 1.00 59.53  ? 2450 HOH A O     1 
HETATM 5342 O  O     . HOH N 8 .   ? -57.255 -7.407  -8.834  1.00 48.71  ? 2451 HOH A O     1 
HETATM 5343 O  O     . HOH N 8 .   ? -49.643 -9.994  -6.499  1.00 45.90  ? 2452 HOH A O     1 
HETATM 5344 O  O     . HOH N 8 .   ? -45.479 -10.688 -7.294  1.00 44.65  ? 2453 HOH A O     1 
HETATM 5345 O  O     . HOH N 8 .   ? -43.671 -15.751 -11.336 1.00 44.02  ? 2454 HOH A O     1 
HETATM 5346 O  O     . HOH N 8 .   ? -41.708 -6.082  -19.799 1.00 42.60  ? 2455 HOH A O     1 
HETATM 5347 O  O     . HOH N 8 .   ? -37.602 -6.549  -10.039 1.00 45.97  ? 2456 HOH A O     1 
HETATM 5348 O  O     . HOH N 8 .   ? -37.009 -0.305  -18.800 1.00 44.21  ? 2457 HOH A O     1 
HETATM 5349 O  O     . HOH N 8 .   ? -42.033 10.309  -20.082 1.00 36.35  ? 2458 HOH A O     1 
HETATM 5350 O  O     . HOH N 8 .   ? -42.582 7.430   -22.626 1.00 37.56  ? 2459 HOH A O     1 
HETATM 5351 O  O     . HOH N 8 .   ? -39.274 4.986   -9.952  1.00 49.27  ? 2460 HOH A O     1 
HETATM 5352 O  O     . HOH N 8 .   ? -39.314 10.726  -24.324 1.00 56.18  ? 2461 HOH A O     1 
HETATM 5353 O  O     . HOH N 8 .   ? -36.646 8.024   -25.857 1.00 40.40  ? 2462 HOH A O     1 
HETATM 5354 O  O     . HOH N 8 .   ? -40.827 6.154   -31.236 1.00 56.76  ? 2463 HOH A O     1 
HETATM 5355 O  O     . HOH N 8 .   ? -31.532 4.184   -24.116 1.00 59.39  ? 2464 HOH A O     1 
HETATM 5356 O  O     . HOH N 8 .   ? -34.032 0.592   -20.999 1.00 45.67  ? 2465 HOH A O     1 
HETATM 5357 O  O     . HOH N 8 .   ? -31.821 -0.219  -20.437 1.00 50.75  ? 2466 HOH A O     1 
HETATM 5358 O  O     . HOH N 8 .   ? -47.634 8.046   -27.699 1.00 60.40  ? 2467 HOH A O     1 
HETATM 5359 O  O     . HOH N 8 .   ? -54.168 5.007   -26.620 1.00 54.95  ? 2468 HOH A O     1 
HETATM 5360 O  O     . HOH N 8 .   ? -55.826 4.944   -19.123 1.00 51.34  ? 2469 HOH A O     1 
HETATM 5361 O  O     . HOH N 8 .   ? -51.427 16.107  -18.377 1.00 48.17  ? 2470 HOH A O     1 
HETATM 5362 O  O     . HOH N 8 .   ? -47.507 21.484  -17.775 1.00 38.85  ? 2471 HOH A O     1 
HETATM 5363 O  O     . HOH N 8 .   ? -46.899 20.358  -12.738 1.00 49.05  ? 2472 HOH A O     1 
HETATM 5364 O  O     . HOH N 8 .   ? -40.591 19.664  -9.088  1.00 37.11  ? 2473 HOH A O     1 
HETATM 5365 O  O     . HOH N 8 .   ? -41.940 21.175  -12.071 1.00 46.16  ? 2474 HOH A O     1 
HETATM 5366 O  O     . HOH N 8 .   ? -42.704 21.758  -22.047 1.00 43.15  ? 2475 HOH A O     1 
HETATM 5367 O  O     . HOH N 8 .   ? -41.589 19.679  -24.427 1.00 44.53  ? 2476 HOH A O     1 
HETATM 5368 O  O     . HOH N 8 .   ? -41.493 16.160  -23.845 1.00 58.19  ? 2477 HOH A O     1 
HETATM 5369 O  O     . HOH N 8 .   ? -44.557 26.708  -9.484  1.00 47.08  ? 2478 HOH A O     1 
HETATM 5370 O  O     . HOH N 8 .   ? -37.478 22.759  -13.778 1.00 24.81  ? 2479 HOH A O     1 
HETATM 5371 O  O     . HOH N 8 .   ? -39.130 19.883  -11.461 1.00 45.47  ? 2480 HOH A O     1 
HETATM 5372 O  O     . HOH N 8 .   ? -39.933 28.692  -18.707 1.00 148.91 ? 2481 HOH A O     1 
HETATM 5373 O  O     . HOH N 8 .   ? -45.818 23.635  -19.178 1.00 50.54  ? 2482 HOH A O     1 
HETATM 5374 O  O     . HOH N 8 .   ? -43.979 28.809  -22.244 1.00 51.06  ? 2483 HOH A O     1 
HETATM 5375 O  O     . HOH N 8 .   ? -41.824 29.769  -21.679 1.00 49.78  ? 2484 HOH A O     1 
HETATM 5376 O  O     . HOH N 8 .   ? -40.070 22.904  -12.308 1.00 39.48  ? 2485 HOH A O     1 
HETATM 5377 O  O     . HOH N 8 .   ? -36.086 25.127  -10.832 1.00 53.45  ? 2486 HOH A O     1 
HETATM 5378 O  O     . HOH N 8 .   ? -31.307 24.995  -20.504 1.00 46.46  ? 2487 HOH A O     1 
HETATM 5379 O  O     . HOH N 8 .   ? -35.933 21.413  -24.662 1.00 35.30  ? 2488 HOH A O     1 
HETATM 5380 O  O     . HOH N 8 .   ? -40.817 25.700  -23.324 1.00 31.28  ? 2489 HOH A O     1 
HETATM 5381 O  O     . HOH N 8 .   ? -33.673 32.163  -20.407 1.00 46.34  ? 2490 HOH A O     1 
HETATM 5382 O  O     . HOH N 8 .   ? -40.575 29.317  -16.519 1.00 41.17  ? 2491 HOH A O     1 
HETATM 5383 O  O     . HOH N 8 .   ? -30.827 30.839  -14.458 1.00 39.58  ? 2492 HOH A O     1 
HETATM 5384 O  O     . HOH N 8 .   ? -35.314 27.227  -9.322  1.00 54.86  ? 2493 HOH A O     1 
HETATM 5385 O  O     . HOH N 8 .   ? -32.626 31.202  -12.354 1.00 43.20  ? 2494 HOH A O     1 
HETATM 5386 O  O     . HOH N 8 .   ? -27.327 25.529  -18.547 1.00 29.80  ? 2495 HOH A O     1 
HETATM 5387 O  O     . HOH N 8 .   ? -35.633 24.554  -13.257 1.00 28.53  ? 2496 HOH A O     1 
HETATM 5388 O  O     . HOH N 8 .   ? -36.634 21.395  -11.620 1.00 25.01  ? 2497 HOH A O     1 
HETATM 5389 O  O     . HOH N 8 .   ? -38.192 20.432  -8.864  1.00 54.73  ? 2498 HOH A O     1 
HETATM 5390 O  O     . HOH N 8 .   ? -30.817 25.793  -5.428  1.00 39.17  ? 2499 HOH A O     1 
HETATM 5391 O  O     . HOH N 8 .   ? -38.218 23.938  -8.871  1.00 57.80  ? 2500 HOH A O     1 
HETATM 5392 O  O     . HOH N 8 .   ? -34.663 16.932  -2.338  1.00 32.14  ? 2501 HOH A O     1 
HETATM 5393 O  O     . HOH N 8 .   ? -39.105 23.045  -3.861  1.00 54.00  ? 2502 HOH A O     1 
HETATM 5394 O  O     . HOH N 8 .   ? -39.049 22.546  -1.155  1.00 52.05  ? 2503 HOH A O     1 
HETATM 5395 O  O     . HOH N 8 .   ? -26.997 29.347  -11.893 1.00 37.96  ? 2504 HOH A O     1 
HETATM 5396 O  O     . HOH N 8 .   ? -24.245 17.065  -14.843 1.00 41.13  ? 2505 HOH A O     1 
HETATM 5397 O  O     . HOH N 8 .   ? -30.837 12.861  -14.934 1.00 27.23  ? 2506 HOH A O     1 
HETATM 5398 O  O     . HOH N 8 .   ? -24.622 11.322  -16.617 1.00 45.28  ? 2507 HOH A O     1 
HETATM 5399 O  O     . HOH N 8 .   ? -26.685 17.600  -18.366 1.00 43.17  ? 2508 HOH A O     1 
HETATM 5400 O  O     . HOH N 8 .   ? -24.198 19.963  -17.387 1.00 48.88  ? 2509 HOH A O     1 
HETATM 5401 O  O     . HOH N 8 .   ? -28.597 26.462  -23.244 1.00 50.13  ? 2510 HOH A O     1 
HETATM 5402 O  O     . HOH N 8 .   ? -27.634 16.223  -25.144 1.00 31.82  ? 2511 HOH A O     1 
HETATM 5403 O  O     . HOH N 8 .   ? -35.525 24.582  -26.316 1.00 33.78  ? 2512 HOH A O     1 
HETATM 5404 O  O     . HOH N 8 .   ? -30.554 27.371  -29.737 1.00 50.62  ? 2513 HOH A O     1 
HETATM 5405 O  O     . HOH N 8 .   ? -34.947 28.847  -26.407 1.00 59.70  ? 2514 HOH A O     1 
HETATM 5406 O  O     . HOH N 8 .   ? -34.042 31.171  -22.402 1.00 60.02  ? 2515 HOH A O     1 
HETATM 5407 O  O     . HOH N 8 .   ? -36.738 12.661  -36.696 1.00 62.60  ? 2516 HOH A O     1 
HETATM 5408 O  O     . HOH N 8 .   ? -31.231 14.247  -34.420 1.00 50.76  ? 2517 HOH A O     1 
HETATM 5409 O  O     . HOH N 8 .   ? -32.264 11.509  -28.079 1.00 37.48  ? 2518 HOH A O     1 
HETATM 5410 O  O     . HOH N 8 .   ? -27.845 11.781  -27.822 1.00 64.62  ? 2519 HOH A O     1 
HETATM 5411 O  O     . HOH N 8 .   ? -37.716 19.168  -28.024 1.00 31.96  ? 2520 HOH A O     1 
HETATM 5412 O  O     . HOH N 8 .   ? -37.960 17.450  -30.200 1.00 42.24  ? 2521 HOH A O     1 
HETATM 5413 O  O     . HOH N 8 .   ? -29.925 11.553  -21.953 1.00 38.47  ? 2522 HOH A O     1 
HETATM 5414 O  O     . HOH N 8 .   ? -27.765 15.818  -22.535 1.00 37.54  ? 2523 HOH A O     1 
HETATM 5415 O  O     . HOH N 8 .   ? -37.778 14.462  -24.962 1.00 40.67  ? 2524 HOH A O     1 
HETATM 5416 O  O     . HOH N 8 .   ? -40.421 17.786  -25.822 1.00 48.12  ? 2525 HOH A O     1 
HETATM 5417 O  O     . HOH N 8 .   ? -37.337 12.144  -25.693 1.00 39.99  ? 2526 HOH A O     1 
HETATM 5418 O  O     . HOH N 8 .   ? -28.534 14.905  12.959  1.00 35.49  ? 2527 HOH A O     1 
HETATM 5419 O  O     . HOH N 8 .   ? -25.281 13.499  11.963  1.00 28.38  ? 2528 HOH A O     1 
HETATM 5420 O  O     . HOH N 8 .   ? -38.046 17.719  8.234   1.00 54.90  ? 2529 HOH A O     1 
HETATM 5421 O  O     . HOH N 8 .   ? -37.290 14.617  10.504  1.00 47.31  ? 2530 HOH A O     1 
HETATM 5422 O  O     . HOH N 8 .   ? -35.015 18.756  7.854   1.00 47.23  ? 2531 HOH A O     1 
HETATM 5423 O  O     . HOH N 8 .   ? -24.160 10.444  19.245  1.00 44.30  ? 2532 HOH A O     1 
HETATM 5424 O  O     . HOH N 8 .   ? -30.528 7.222   20.765  1.00 44.07  ? 2533 HOH A O     1 
HETATM 5425 O  O     . HOH N 8 .   ? -37.480 10.869  15.026  1.00 53.95  ? 2534 HOH A O     1 
HETATM 5426 O  O     . HOH N 8 .   ? -35.531 12.382  13.321  1.00 37.00  ? 2535 HOH A O     1 
HETATM 5427 O  O     . HOH N 8 .   ? -21.087 4.131   19.911  1.00 43.62  ? 2536 HOH A O     1 
HETATM 5428 O  O     . HOH N 8 .   ? -18.910 10.660  15.983  1.00 54.37  ? 2537 HOH A O     1 
HETATM 5429 O  O     . HOH N 8 .   ? -17.192 8.336   14.127  1.00 35.34  ? 2538 HOH A O     1 
HETATM 5430 O  O     . HOH N 8 .   ? -22.686 12.377  15.608  1.00 59.63  ? 2539 HOH A O     1 
HETATM 5431 O  O     . HOH N 8 .   ? -25.490 12.682  20.241  1.00 56.21  ? 2540 HOH A O     1 
HETATM 5432 O  O     . HOH N 8 .   ? -21.898 -1.193  21.327  1.00 31.20  ? 2541 HOH A O     1 
HETATM 5433 O  O     . HOH N 8 .   ? -21.122 3.300   17.298  1.00 41.24  ? 2542 HOH A O     1 
HETATM 5434 O  O     . HOH N 8 .   ? -18.912 0.613   17.663  1.00 40.47  ? 2543 HOH A O     1 
HETATM 5435 O  O     . HOH N 8 .   ? -32.242 -3.321  -2.769  1.00 38.30  ? 2544 HOH A O     1 
HETATM 5436 O  O     . HOH N 8 .   ? -32.440 1.911   -5.816  1.00 39.70  ? 2545 HOH A O     1 
HETATM 5437 O  O     . HOH N 8 .   ? -33.704 -0.333  -4.851  1.00 32.55  ? 2546 HOH A O     1 
HETATM 5438 O  O     . HOH N 8 .   ? -33.326 -3.841  3.059   1.00 39.51  ? 2547 HOH A O     1 
HETATM 5439 O  O     . HOH N 8 .   ? -32.964 -6.742  20.474  1.00 28.58  ? 2548 HOH A O     1 
HETATM 5440 O  O     . HOH N 8 .   ? -31.816 -9.805  19.780  1.00 39.95  ? 2549 HOH A O     1 
HETATM 5441 O  O     . HOH N 8 .   ? -33.736 -3.943  21.579  1.00 30.52  ? 2550 HOH A O     1 
HETATM 5442 O  O     . HOH N 8 .   ? -32.584 -2.081  23.633  1.00 46.91  ? 2551 HOH A O     1 
HETATM 5443 O  O     . HOH N 8 .   ? -33.199 -6.597  23.980  1.00 63.51  ? 2552 HOH A O     1 
HETATM 5444 O  O     . HOH N 8 .   ? -25.445 -3.030  24.903  1.00 46.80  ? 2553 HOH A O     1 
HETATM 5445 O  O     . HOH N 8 .   ? -37.979 -3.923  16.223  1.00 37.33  ? 2554 HOH A O     1 
HETATM 5446 O  O     . HOH N 8 .   ? -34.571 -7.596  22.120  1.00 55.04  ? 2555 HOH A O     1 
HETATM 5447 O  O     . HOH N 8 .   ? -38.073 -6.212  15.893  1.00 52.29  ? 2556 HOH A O     1 
HETATM 5448 O  O     . HOH N 8 .   ? -36.151 2.368   19.662  1.00 38.29  ? 2557 HOH A O     1 
HETATM 5449 O  O     . HOH N 8 .   ? -40.563 2.406   14.428  1.00 40.27  ? 2558 HOH A O     1 
HETATM 5450 O  O     . HOH N 8 .   ? -40.497 -3.872  17.554  1.00 54.89  ? 2559 HOH A O     1 
HETATM 5451 O  O     . HOH N 8 .   ? -36.370 -3.872  22.622  1.00 54.71  ? 2560 HOH A O     1 
HETATM 5452 O  O     . HOH N 8 .   ? -43.647 -0.514  5.910   1.00 51.49  ? 2561 HOH A O     1 
HETATM 5453 O  O     . HOH N 8 .   ? -41.731 8.228   11.509  1.00 32.26  ? 2562 HOH A O     1 
HETATM 5454 O  O     . HOH N 8 .   ? -39.075 11.221  12.799  1.00 51.57  ? 2563 HOH A O     1 
HETATM 5455 O  O     . HOH N 8 .   ? -38.100 4.132   18.674  1.00 48.30  ? 2564 HOH A O     1 
HETATM 5456 O  O     . HOH N 8 .   ? -37.097 11.710  11.025  1.00 33.24  ? 2565 HOH A O     1 
HETATM 5457 O  O     . HOH N 8 .   ? -44.297 8.853   6.256   1.00 39.11  ? 2566 HOH A O     1 
HETATM 5458 O  O     . HOH N 8 .   ? -43.772 8.978   9.426   1.00 47.22  ? 2567 HOH A O     1 
HETATM 5459 O  O     . HOH N 8 .   ? -42.353 11.540  5.898   1.00 30.16  ? 2568 HOH A O     1 
HETATM 5460 O  O     . HOH N 8 .   ? -45.210 6.118   7.290   1.00 43.55  ? 2569 HOH A O     1 
HETATM 5461 O  O     . HOH N 8 .   ? -42.801 5.531   11.138  1.00 45.67  ? 2570 HOH A O     1 
HETATM 5462 O  O     . HOH N 8 .   ? -41.635 14.537  8.364   1.00 51.66  ? 2571 HOH A O     1 
HETATM 5463 O  O     . HOH N 8 .   ? -40.996 21.429  0.692   1.00 53.13  ? 2572 HOH A O     1 
HETATM 5464 O  O     . HOH N 8 .   ? -44.812 11.875  4.181   1.00 31.07  ? 2573 HOH A O     1 
HETATM 5465 O  O     . HOH N 8 .   ? -47.052 15.477  4.971   1.00 47.45  ? 2574 HOH A O     1 
HETATM 5466 O  O     . HOH N 8 .   ? -41.007 -3.952  8.046   1.00 33.80  ? 2575 HOH A O     1 
HETATM 5467 O  O     . HOH N 8 .   ? -30.228 -14.546 11.233  1.00 26.77  ? 2576 HOH A O     1 
HETATM 5468 O  O     . HOH N 8 .   ? -34.656 -14.361 7.664   1.00 41.84  ? 2577 HOH A O     1 
HETATM 5469 O  O     . HOH N 8 .   ? -35.679 -5.803  2.201   1.00 48.54  ? 2578 HOH A O     1 
HETATM 5470 O  O     . HOH N 8 .   ? -37.508 -12.682 -0.210  1.00 46.46  ? 2579 HOH A O     1 
HETATM 5471 O  O     . HOH N 8 .   ? -33.309 -10.319 -0.684  1.00 48.28  ? 2580 HOH A O     1 
HETATM 5472 O  O     . HOH N 8 .   ? -35.163 -2.694  -10.705 1.00 36.42  ? 2581 HOH A O     1 
HETATM 5473 O  O     . HOH N 8 .   ? -34.981 -4.332  -6.742  1.00 34.23  ? 2582 HOH A O     1 
HETATM 5474 O  O     . HOH N 8 .   ? -38.205 -4.708  -2.716  1.00 50.79  ? 2583 HOH A O     1 
HETATM 5475 O  O     . HOH N 8 .   ? -22.375 32.869  2.040   1.00 39.30  ? 2584 HOH A O     1 
HETATM 5476 O  O     . HOH O 8 .   ? -19.172 2.972   -22.566 1.00 50.36  ? 2001 HOH B O     1 
HETATM 5477 O  O     . HOH O 8 .   ? -20.631 4.361   -24.809 1.00 43.79  ? 2002 HOH B O     1 
HETATM 5478 O  O     . HOH O 8 .   ? -21.071 -4.888  -27.621 1.00 50.34  ? 2003 HOH B O     1 
HETATM 5479 O  O     . HOH O 8 .   ? -19.767 -6.153  -26.311 1.00 49.48  ? 2004 HOH B O     1 
HETATM 5480 O  O     . HOH O 8 .   ? -23.787 1.955   -24.990 1.00 46.62  ? 2005 HOH B O     1 
HETATM 5481 O  O     . HOH O 8 .   ? -22.280 2.306   -23.009 1.00 39.13  ? 2006 HOH B O     1 
HETATM 5482 O  O     . HOH O 8 .   ? -22.122 -6.338  -19.588 1.00 44.99  ? 2007 HOH B O     1 
HETATM 5483 O  O     . HOH O 8 .   ? -18.625 -6.929  -23.824 1.00 55.02  ? 2008 HOH B O     1 
HETATM 5484 O  O     . HOH O 8 .   ? -21.671 -6.552  -25.004 1.00 39.90  ? 2009 HOH B O     1 
HETATM 5485 O  O     . HOH O 8 .   ? -27.290 1.289   -20.216 1.00 42.07  ? 2010 HOH B O     1 
HETATM 5486 O  O     . HOH O 8 .   ? -25.658 3.233   -21.139 1.00 54.56  ? 2011 HOH B O     1 
HETATM 5487 O  O     . HOH O 8 .   ? -26.543 -11.572 -17.605 1.00 39.24  ? 2012 HOH B O     1 
HETATM 5488 O  O     . HOH O 8 .   ? -29.602 -6.750  -20.108 1.00 41.35  ? 2013 HOH B O     1 
HETATM 5489 O  O     . HOH O 8 .   ? -22.097 -5.447  -16.422 1.00 48.91  ? 2014 HOH B O     1 
HETATM 5490 O  O     . HOH O 8 .   ? -24.401 -9.214  -13.827 1.00 44.87  ? 2015 HOH B O     1 
HETATM 5491 O  O     . HOH O 8 .   ? -28.533 -1.906  -20.737 1.00 43.25  ? 2016 HOH B O     1 
HETATM 5492 O  O     . HOH O 8 .   ? -30.713 -9.992  -12.198 1.00 50.32  ? 2017 HOH B O     1 
HETATM 5493 O  O     . HOH O 8 .   ? -28.923 -10.594 -16.384 1.00 48.67  ? 2018 HOH B O     1 
HETATM 5494 O  O     . HOH O 8 .   ? -30.353 -2.170  -18.655 1.00 44.41  ? 2019 HOH B O     1 
HETATM 5495 O  O     . HOH O 8 .   ? -31.946 -3.567  -16.036 1.00 43.80  ? 2020 HOH B O     1 
HETATM 5496 O  O     . HOH O 8 .   ? -33.275 -0.509  -18.346 1.00 55.10  ? 2021 HOH B O     1 
HETATM 5497 O  O     . HOH O 8 .   ? -34.065 -6.308  -8.285  1.00 38.81  ? 2022 HOH B O     1 
HETATM 5498 O  O     . HOH O 8 .   ? -33.977 -4.847  -11.835 1.00 44.90  ? 2023 HOH B O     1 
HETATM 5499 O  O     . HOH O 8 .   ? -21.528 -7.828  -17.616 1.00 49.45  ? 2024 HOH B O     1 
HETATM 5500 O  O     . HOH O 8 .   ? -31.858 -8.433  -16.808 1.00 61.27  ? 2025 HOH B O     1 
HETATM 5501 O  O     . HOH O 8 .   ? -30.583 -5.043  -18.048 1.00 50.68  ? 2026 HOH B O     1 
HETATM 5502 O  O     . HOH O 8 .   ? -21.774 3.715   -20.613 1.00 51.28  ? 2027 HOH B O     1 
HETATM 5503 O  O     . HOH O 8 .   ? -23.061 5.206   -22.794 1.00 65.65  ? 2028 HOH B O     1 
HETATM 5504 O  O     . HOH O 8 .   ? -20.142 5.916   -22.056 1.00 55.25  ? 2029 HOH B O     1 
HETATM 5505 O  O     . HOH P 8 .   ? -31.897 3.042   -20.283 1.00 50.12  ? 2001 HOH G O     1 
HETATM 5506 O  O     . HOH P 8 .   ? -29.386 4.554   -20.944 1.00 55.76  ? 2002 HOH G O     1 
HETATM 5507 O  O     . HOH P 8 .   ? -31.244 1.183   -18.736 1.00 41.63  ? 2003 HOH G O     1 
HETATM 5508 O  O     . HOH P 8 .   ? -28.249 6.026   -18.677 1.00 41.03  ? 2004 HOH G O     1 
HETATM 5509 O  O     . HOH P 8 .   ? -26.996 9.399   -20.763 1.00 51.55  ? 2005 HOH G O     1 
HETATM 5510 O  O     . HOH P 8 .   ? -25.382 7.850   -17.242 1.00 25.60  ? 2006 HOH G O     1 
HETATM 5511 O  O     . HOH P 8 .   ? -29.002 2.464   -19.010 1.00 38.18  ? 2007 HOH G O     1 
HETATM 5512 O  O     . HOH P 8 .   ? -22.219 7.317   -16.158 1.00 45.61  ? 2008 HOH G O     1 
HETATM 5513 O  O     . HOH P 8 .   ? -20.644 3.771   -8.737  1.00 32.10  ? 2009 HOH G O     1 
HETATM 5514 O  O     . HOH P 8 .   ? -25.664 5.008   -19.539 1.00 36.20  ? 2010 HOH G O     1 
HETATM 5515 O  O     . HOH P 8 .   ? -18.877 4.778   -16.502 1.00 50.30  ? 2011 HOH G O     1 
HETATM 5516 O  O     . HOH P 8 .   ? -22.076 4.885   -18.177 1.00 32.86  ? 2012 HOH G O     1 
HETATM 5517 O  O     . HOH P 8 .   ? -14.958 0.099   -17.547 1.00 60.03  ? 2013 HOH G O     1 
HETATM 5518 O  O     . HOH P 8 .   ? -18.619 -8.200  -18.248 1.00 54.57  ? 2014 HOH G O     1 
HETATM 5519 O  O     . HOH P 8 .   ? -18.877 3.184   -19.341 1.00 34.10  ? 2015 HOH G O     1 
HETATM 5520 O  O     . HOH P 8 .   ? -18.653 -9.011  -21.404 1.00 58.09  ? 2016 HOH G O     1 
HETATM 5521 O  O     . HOH P 8 .   ? -15.842 1.723   -19.590 1.00 53.61  ? 2017 HOH G O     1 
HETATM 5522 O  O     . HOH P 8 .   ? -24.046 6.464   -19.386 1.00 52.63  ? 2018 HOH G O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLU A 3   ? 1.2419 1.2288 1.4900 -0.0166 -0.0756 0.0061  295 GLU A N     
2    C CA    . GLU A 3   ? 1.2158 1.2028 1.4550 -0.0166 -0.0732 0.0057  295 GLU A CA    
3    C C     . GLU A 3   ? 1.1219 1.1106 1.3531 -0.0142 -0.0712 -0.0007 295 GLU A C     
4    O O     . GLU A 3   ? 1.1420 1.1297 1.3671 -0.0124 -0.0713 -0.0042 295 GLU A O     
5    C CB    . GLU A 3   ? 1.2617 1.2519 1.4965 -0.0215 -0.0678 0.0141  295 GLU A CB    
6    C CG    . GLU A 3   ? 1.3350 1.3245 1.5623 -0.0218 -0.0660 0.0147  295 GLU A CG    
7    C CD    . GLU A 3   ? 1.3833 1.3774 1.6029 -0.0256 -0.0593 0.0203  295 GLU A CD    
8    O OE1   . GLU A 3   ? 1.3894 1.3876 1.6100 -0.0281 -0.0562 0.0242  295 GLU A OE1   
9    O OE2   . GLU A 3   ? 1.4033 1.3972 1.6161 -0.0259 -0.0572 0.0207  295 GLU A OE2   
10   N N     . GLU A 4   ? 0.9833 0.9748 1.2144 -0.0142 -0.0696 -0.0022 296 GLU A N     
11   C CA    . GLU A 4   ? 0.8189 0.8125 1.0432 -0.0118 -0.0683 -0.0083 296 GLU A CA    
12   C C     . GLU A 4   ? 0.6078 0.5988 0.8342 -0.0063 -0.0738 -0.0168 296 GLU A C     
13   O O     . GLU A 4   ? 0.4858 0.4736 0.7203 -0.0047 -0.0783 -0.0181 296 GLU A O     
14   C CB    . GLU A 4   ? 0.9191 0.9171 1.1427 -0.0136 -0.0647 -0.0067 296 GLU A CB    
15   C CG    . GLU A 4   ? 1.0462 1.0482 1.2651 -0.0181 -0.0585 0.0002  296 GLU A CG    
16   C CD    . GLU A 4   ? 1.1716 1.1784 1.3910 -0.0196 -0.0553 0.0016  296 GLU A CD    
17   O OE1   . GLU A 4   ? 1.2273 1.2340 1.4532 -0.0186 -0.0579 -0.0003 296 GLU A OE1   
18   O OE2   . GLU A 4   ? 1.2014 1.2124 1.4149 -0.0217 -0.0503 0.0042  296 GLU A OE2   
19   N N     . ALA A 5   ? 0.4165 0.4093 0.6355 -0.0035 -0.0734 -0.0225 297 ALA A N     
20   C CA    . ALA A 5   ? 0.4578 0.4494 0.6765 0.0021  -0.0781 -0.0310 297 ALA A CA    
21   C C     . ALA A 5   ? 0.4824 0.4786 0.6926 0.0044  -0.0762 -0.0353 297 ALA A C     
22   O O     . ALA A 5   ? 0.4394 0.4381 0.6417 0.0024  -0.0712 -0.0320 297 ALA A O     
23   C CB    . ALA A 5   ? 0.4925 0.4810 0.7107 0.0044  -0.0812 -0.0337 297 ALA A CB    
24   N N     . PRO A 6   ? 0.5714 0.5681 0.7810 0.0091  -0.0794 -0.0422 298 PRO A N     
25   C CA    . PRO A 6   ? 0.5660 0.5676 0.7675 0.0122  -0.0780 -0.0459 298 PRO A CA    
26   C C     . PRO A 6   ? 0.4281 0.4306 0.6160 0.0143  -0.0748 -0.0467 298 PRO A C     
27   O O     . PRO A 6   ? 0.3924 0.3940 0.5812 0.0159  -0.0776 -0.0494 298 PRO A O     
28   C CB    . PRO A 6   ? 0.6296 0.6299 0.8322 0.0172  -0.0824 -0.0532 298 PRO A CB    
29   C CG    . PRO A 6   ? 0.6701 0.6653 0.8837 0.0156  -0.0852 -0.0519 298 PRO A CG    
30   C CD    . PRO A 6   ? 0.6376 0.6302 0.8545 0.0120  -0.0843 -0.0463 298 PRO A CD    
31   N N     . TRP A 7   ? 0.3820 0.3862 0.5579 0.0143  -0.0691 -0.0445 299 TRP A N     
32   C CA    . TRP A 7   ? 0.3506 0.3564 0.5134 0.0170  -0.0664 -0.0461 299 TRP A CA    
33   C C     . TRP A 7   ? 0.4063 0.4147 0.5683 0.0229  -0.0712 -0.0539 299 TRP A C     
34   O O     . TRP A 7   ? 0.4324 0.4418 0.5998 0.0248  -0.0744 -0.0572 299 TRP A O     
35   C CB    . TRP A 7   ? 0.3530 0.3599 0.5048 0.0159  -0.0602 -0.0422 299 TRP A CB    
36   C CG    . TRP A 7   ? 0.4065 0.4146 0.5457 0.0173  -0.0567 -0.0419 299 TRP A CG    
37   C CD1   . TRP A 7   ? 0.3612 0.3721 0.4915 0.0214  -0.0566 -0.0453 299 TRP A CD1   
38   C CD2   . TRP A 7   ? 0.3240 0.3309 0.4587 0.0146  -0.0531 -0.0378 299 TRP A CD2   
39   N NE1   . TRP A 7   ? 0.3299 0.3414 0.4506 0.0211  -0.0530 -0.0434 299 TRP A NE1   
40   C CE2   . TRP A 7   ? 0.2978 0.3066 0.4210 0.0171  -0.0509 -0.0390 299 TRP A CE2   
41   C CE3   . TRP A 7   ? 0.3346 0.3392 0.4738 0.0102  -0.0515 -0.0329 299 TRP A CE3   
42   C CZ2   . TRP A 7   ? 0.2965 0.3049 0.4131 0.0154  -0.0472 -0.0360 299 TRP A CZ2   
43   C CZ3   . TRP A 7   ? 0.3376 0.3417 0.4697 0.0088  -0.0479 -0.0300 299 TRP A CZ3   
44   C CH2   . TRP A 7   ? 0.3308 0.3366 0.4520 0.0113  -0.0458 -0.0318 299 TRP A CH2   
45   N N     . PRO A 8   ? 0.4441 0.4544 0.5995 0.0260  -0.0717 -0.0571 300 PRO A N     
46   C CA    . PRO A 8   ? 0.3957 0.4057 0.5443 0.0246  -0.0685 -0.0545 300 PRO A CA    
47   C C     . PRO A 8   ? 0.4027 0.4101 0.5605 0.0233  -0.0721 -0.0550 300 PRO A C     
48   O O     . PRO A 8   ? 0.3746 0.3812 0.5437 0.0248  -0.0782 -0.0592 300 PRO A O     
49   C CB    . PRO A 8   ? 0.3745 0.3891 0.5130 0.0296  -0.0686 -0.0593 300 PRO A CB    
50   C CG    . PRO A 8   ? 0.3902 0.4072 0.5350 0.0341  -0.0746 -0.0663 300 PRO A CG    
51   C CD    . PRO A 8   ? 0.4724 0.4866 0.6261 0.0319  -0.0759 -0.0646 300 PRO A CD    
52   N N     . PRO A 9   ? 0.3440 0.3498 0.4975 0.0206  -0.0687 -0.0509 301 PRO A N     
53   C CA    . PRO A 9   ? 0.3760 0.3791 0.5377 0.0191  -0.0719 -0.0507 301 PRO A CA    
54   C C     . PRO A 9   ? 0.4007 0.4063 0.5615 0.0238  -0.0759 -0.0577 301 PRO A C     
55   O O     . PRO A 9   ? 0.3976 0.4077 0.5494 0.0277  -0.0749 -0.0615 301 PRO A O     
56   C CB    . PRO A 9   ? 0.3527 0.3542 0.5078 0.0149  -0.0659 -0.0438 301 PRO A CB    
57   C CG    . PRO A 9   ? 0.3216 0.3262 0.4628 0.0165  -0.0608 -0.0436 301 PRO A CG    
58   C CD    . PRO A 9   ? 0.3056 0.3122 0.4468 0.0187  -0.0617 -0.0461 301 PRO A CD    
59   N N     . PRO A 10  ? 0.4538 0.4569 0.6241 0.0236  -0.0808 -0.0594 302 PRO A N     
60   C CA    . PRO A 10  ? 0.5148 0.5202 0.6839 0.0280  -0.0844 -0.0661 302 PRO A CA    
61   C C     . PRO A 10  ? 0.5553 0.5633 0.7132 0.0279  -0.0796 -0.0644 302 PRO A C     
62   O O     . PRO A 10  ? 0.4766 0.4821 0.6297 0.0235  -0.0742 -0.0574 302 PRO A O     
63   C CB    . PRO A 10  ? 0.5057 0.5037 0.6841 0.0266  -0.0881 -0.0660 302 PRO A CB    
64   C CG    . PRO A 10  ? 0.5721 0.5666 0.7568 0.0207  -0.0862 -0.0575 302 PRO A CG    
65   C CD    . PRO A 10  ? 0.4449 0.4429 0.6276 0.0194  -0.0832 -0.0551 302 PRO A CD    
66   N N     . GLU A 11  ? 0.6284 0.6413 0.7817 0.0326  -0.0814 -0.0707 303 GLU A N     
67   C CA    . GLU A 11  ? 0.7361 0.7515 0.8786 0.0325  -0.0770 -0.0694 303 GLU A CA    
68   C C     . GLU A 11  ? 0.5550 0.5655 0.7017 0.0288  -0.0767 -0.0654 303 GLU A C     
69   O O     . GLU A 11  ? 0.4686 0.4759 0.6269 0.0287  -0.0824 -0.0674 303 GLU A O     
70   C CB    . GLU A 11  ? 0.9379 0.9605 1.0769 0.0385  -0.0799 -0.0776 303 GLU A CB    
71   C CG    . GLU A 11  ? 1.1509 1.1776 1.2783 0.0387  -0.0750 -0.0765 303 GLU A CG    
72   C CD    . GLU A 11  ? 1.2772 1.3129 1.3994 0.0447  -0.0770 -0.0841 303 GLU A CD    
73   O OE1   . GLU A 11  ? 1.3163 1.3565 1.4342 0.0474  -0.0767 -0.0861 303 GLU A OE1   
74   O OE2   . GLU A 11  ? 1.2831 1.3218 1.4057 0.0467  -0.0789 -0.0881 303 GLU A OE2   
75   N N     . GLY A 12  ? 0.4802 0.4901 0.6180 0.0257  -0.0704 -0.0597 304 GLY A N     
76   C CA    . GLY A 12  ? 0.4233 0.4291 0.5638 0.0222  -0.0697 -0.0556 304 GLY A CA    
77   C C     . GLY A 12  ? 0.4490 0.4495 0.5936 0.0166  -0.0673 -0.0477 304 GLY A C     
78   O O     . GLY A 12  ? 0.4557 0.4531 0.6013 0.0135  -0.0659 -0.0433 304 GLY A O     
79   N N     . ALA A 13  ? 0.3534 0.3532 0.5003 0.0155  -0.0667 -0.0457 305 ALA A N     
80   C CA    . ALA A 13  ? 0.2934 0.2895 0.4442 0.0104  -0.0643 -0.0384 305 ALA A CA    
81   C C     . ALA A 13  ? 0.3726 0.3690 0.5128 0.0075  -0.0570 -0.0326 305 ALA A C     
82   O O     . ALA A 13  ? 0.4053 0.4047 0.5352 0.0094  -0.0537 -0.0342 305 ALA A O     
83   C CB    . ALA A 13  ? 0.3373 0.3338 0.4915 0.0103  -0.0646 -0.0381 305 ALA A CB    
84   N N     . PHE A 14  ? 0.2991 0.2929 0.4423 0.0030  -0.0548 -0.0260 306 PHE A N     
85   C CA    . PHE A 14  ? 0.3070 0.3012 0.4411 0.0003  -0.0483 -0.0207 306 PHE A CA    
86   C C     . PHE A 14  ? 0.2959 0.2916 0.4265 -0.0011 -0.0442 -0.0179 306 PHE A C     
87   O O     . PHE A 14  ? 0.2944 0.2895 0.4322 -0.0026 -0.0457 -0.0163 306 PHE A O     
88   C CB    . PHE A 14  ? 0.3137 0.3053 0.4524 -0.0037 -0.0479 -0.0152 306 PHE A CB    
89   C CG    . PHE A 14  ? 0.3295 0.3196 0.4701 -0.0025 -0.0511 -0.0176 306 PHE A CG    
90   C CD1   . PHE A 14  ? 0.4186 0.4065 0.5702 -0.0014 -0.0579 -0.0207 306 PHE A CD1   
91   C CD2   . PHE A 14  ? 0.3117 0.3025 0.4436 -0.0025 -0.0476 -0.0169 306 PHE A CD2   
92   C CE1   . PHE A 14  ? 0.4022 0.3886 0.5558 0.0000  -0.0613 -0.0233 306 PHE A CE1   
93   C CE2   . PHE A 14  ? 0.3881 0.3778 0.5219 -0.0013 -0.0506 -0.0194 306 PHE A CE2   
94   C CZ    . PHE A 14  ? 0.3717 0.3592 0.5163 0.0000  -0.0575 -0.0226 306 PHE A CZ    
95   N N     . VAL A 15  ? 0.2755 0.2731 0.3952 -0.0006 -0.0393 -0.0172 307 VAL A N     
96   C CA    . VAL A 15  ? 0.2953 0.2943 0.4110 -0.0013 -0.0357 -0.0151 307 VAL A CA    
97   C C     . VAL A 15  ? 0.3252 0.3239 0.4402 -0.0054 -0.0315 -0.0088 307 VAL A C     
98   O O     . VAL A 15  ? 0.2725 0.2704 0.3860 -0.0073 -0.0299 -0.0061 307 VAL A O     
99   C CB    . VAL A 15  ? 0.3190 0.3202 0.4239 0.0014  -0.0330 -0.0175 307 VAL A CB    
100  C CG1   . VAL A 15  ? 0.3595 0.3609 0.4566 0.0003  -0.0290 -0.0152 307 VAL A CG1   
101  C CG2   . VAL A 15  ? 0.3874 0.3897 0.4895 0.0014  -0.0308 -0.0165 307 VAL A CG2   
102  N N     . GLY A 16  ? 0.2374 0.2371 0.3538 -0.0067 -0.0299 -0.0068 308 GLY A N     
103  C CA    . GLY A 16  ? 0.2312 0.2323 0.3457 -0.0099 -0.0254 -0.0017 308 GLY A CA    
104  C C     . GLY A 16  ? 0.2439 0.2467 0.3529 -0.0087 -0.0228 -0.0024 308 GLY A C     
105  O O     . GLY A 16  ? 0.2349 0.2379 0.3451 -0.0065 -0.0250 -0.0057 308 GLY A O     
106  N N     . PHE A 17  ? 0.2306 0.2347 0.3334 -0.0100 -0.0183 0.0003  309 PHE A N     
107  C CA    . PHE A 17  ? 0.2087 0.2140 0.3063 -0.0087 -0.0161 -0.0006 309 PHE A CA    
108  C C     . PHE A 17  ? 0.2273 0.2347 0.3226 -0.0110 -0.0120 0.0030  309 PHE A C     
109  O O     . PHE A 17  ? 0.2355 0.2433 0.3302 -0.0130 -0.0102 0.0058  309 PHE A O     
110  C CB    . PHE A 17  ? 0.2632 0.2676 0.3525 -0.0058 -0.0158 -0.0036 309 PHE A CB    
111  C CG    . PHE A 17  ? 0.2318 0.2357 0.3150 -0.0065 -0.0132 -0.0022 309 PHE A CG    
112  C CD1   . PHE A 17  ? 0.2352 0.2381 0.3196 -0.0065 -0.0147 -0.0028 309 PHE A CD1   
113  C CD2   . PHE A 17  ? 0.2553 0.2597 0.3319 -0.0069 -0.0095 -0.0005 309 PHE A CD2   
114  C CE1   . PHE A 17  ? 0.2495 0.2521 0.3284 -0.0070 -0.0124 -0.0017 309 PHE A CE1   
115  C CE2   . PHE A 17  ? 0.2664 0.2705 0.3380 -0.0075 -0.0072 0.0006  309 PHE A CE2   
116  C CZ    . PHE A 17  ? 0.2426 0.2458 0.3151 -0.0076 -0.0086 0.0000  309 PHE A CZ    
117  N N     . VAL A 18  ? 0.2218 0.2308 0.3162 -0.0105 -0.0107 0.0027  310 VAL A N     
118  C CA    . VAL A 18  ? 0.2597 0.2714 0.3521 -0.0121 -0.0071 0.0052  310 VAL A CA    
119  C C     . VAL A 18  ? 0.2369 0.2479 0.3223 -0.0100 -0.0057 0.0033  310 VAL A C     
120  O O     . VAL A 18  ? 0.2446 0.2548 0.3297 -0.0080 -0.0074 0.0009  310 VAL A O     
121  C CB    . VAL A 18  ? 0.2341 0.2493 0.3337 -0.0139 -0.0071 0.0068  310 VAL A CB    
122  C CG1   . VAL A 18  ? 0.2261 0.2453 0.3234 -0.0150 -0.0034 0.0087  310 VAL A CG1   
123  C CG2   . VAL A 18  ? 0.2459 0.2617 0.3534 -0.0163 -0.0090 0.0093  310 VAL A CG2   
124  N N     . LEU A 19  ? 0.2122 0.2236 0.2923 -0.0105 -0.0028 0.0046  311 LEU A N     
125  C CA    . LEU A 19  ? 0.2298 0.2404 0.3040 -0.0089 -0.0015 0.0034  311 LEU A CA    
126  C C     . LEU A 19  ? 0.2597 0.2734 0.3349 -0.0096 0.0005  0.0042  311 LEU A C     
127  O O     . LEU A 19  ? 0.2629 0.2800 0.3411 -0.0115 0.0021  0.0062  311 LEU A O     
128  C CB    . LEU A 19  ? 0.2600 0.2687 0.3279 -0.0088 0.0001  0.0040  311 LEU A CB    
129  C CG    . LEU A 19  ? 0.2903 0.2969 0.3565 -0.0081 -0.0015 0.0031  311 LEU A CG    
130  C CD1   . LEU A 19  ? 0.2650 0.2704 0.3251 -0.0082 0.0005  0.0038  311 LEU A CD1   
131  C CD2   . LEU A 19  ? 0.2639 0.2692 0.3293 -0.0056 -0.0041 0.0005  311 LEU A CD2   
132  N N     . SER A 20  ? 0.2419 0.2550 0.3147 -0.0079 0.0003  0.0025  312 SER A N     
133  C CA    . SER A 20  ? 0.2954 0.3115 0.3692 -0.0079 0.0018  0.0023  312 SER A CA    
134  C C     . SER A 20  ? 0.3432 0.3605 0.4137 -0.0086 0.0044  0.0034  312 SER A C     
135  O O     . SER A 20  ? 0.3188 0.3403 0.3912 -0.0091 0.0059  0.0034  312 SER A O     
136  C CB    . SER A 20  ? 0.2774 0.2916 0.3496 -0.0056 0.0002  0.0001  312 SER A CB    
137  O OG    . SER A 20  ? 0.2430 0.2535 0.3091 -0.0044 0.0002  0.0000  312 SER A OG    
138  N N     . ARG A 21  ? 0.2537 0.2679 0.3196 -0.0086 0.0048  0.0040  313 ARG A N     
139  C CA    . ARG A 21  ? 0.2751 0.2900 0.3380 -0.0093 0.0071  0.0049  313 ARG A CA    
140  C C     . ARG A 21  ? 0.3302 0.3425 0.3904 -0.0100 0.0072  0.0060  313 ARG A C     
141  O O     . ARG A 21  ? 0.2703 0.2801 0.3301 -0.0094 0.0055  0.0055  313 ARG A O     
142  C CB    . ARG A 21  ? 0.2707 0.2842 0.3305 -0.0079 0.0073  0.0036  313 ARG A CB    
143  C CG    . ARG A 21  ? 0.2291 0.2379 0.2855 -0.0064 0.0056  0.0030  313 ARG A CG    
144  C CD    . ARG A 21  ? 0.2977 0.3051 0.3525 -0.0052 0.0052  0.0021  313 ARG A CD    
145  N NE    . ARG A 21  ? 0.3146 0.3213 0.3669 -0.0058 0.0067  0.0027  313 ARG A NE    
146  C CZ    . ARG A 21  ? 0.3190 0.3239 0.3701 -0.0049 0.0063  0.0022  313 ARG A CZ    
147  N NH1   . ARG A 21  ? 0.3152 0.3185 0.3671 -0.0035 0.0043  0.0012  313 ARG A NH1   
148  N NH2   . ARG A 21  ? 0.3163 0.3207 0.3658 -0.0055 0.0075  0.0027  313 ARG A NH2   
149  N N     . LYS A 22  ? 0.2971 0.3103 0.3554 -0.0109 0.0091  0.0071  314 LYS A N     
150  C CA    . LYS A 22  ? 0.3576 0.3693 0.4144 -0.0118 0.0092  0.0081  314 LYS A CA    
151  C C     . LYS A 22  ? 0.3016 0.3094 0.3539 -0.0107 0.0085  0.0073  314 LYS A C     
152  O O     . LYS A 22  ? 0.3171 0.3236 0.3686 -0.0109 0.0078  0.0074  314 LYS A O     
153  C CB    . LYS A 22  ? 0.4370 0.4511 0.4930 -0.0130 0.0114  0.0095  314 LYS A CB    
154  C CG    . LYS A 22  ? 0.4843 0.4980 0.5367 -0.0122 0.0127  0.0085  314 LYS A CG    
155  C CD    . LYS A 22  ? 0.5549 0.5718 0.6070 -0.0131 0.0147  0.0094  314 LYS A CD    
156  C CE    . LYS A 22  ? 0.6595 0.6760 0.7091 -0.0121 0.0156  0.0080  314 LYS A CE    
157  N NZ    . LYS A 22  ? 0.7010 0.7212 0.7502 -0.0126 0.0173  0.0083  314 LYS A NZ    
158  N N     . GLU A 23  ? 0.2818 0.2882 0.3313 -0.0096 0.0085  0.0065  315 GLU A N     
159  C CA    . GLU A 23  ? 0.2539 0.2575 0.2991 -0.0087 0.0081  0.0064  315 GLU A CA    
160  C C     . GLU A 23  ? 0.2415 0.2441 0.2866 -0.0073 0.0059  0.0055  315 GLU A C     
161  O O     . GLU A 23  ? 0.2359 0.2382 0.2818 -0.0063 0.0049  0.0048  315 GLU A O     
162  C CB    . GLU A 23  ? 0.3240 0.3264 0.3670 -0.0083 0.0088  0.0065  315 GLU A CB    
163  C CG    . GLU A 23  ? 0.3019 0.3059 0.3456 -0.0092 0.0106  0.0067  315 GLU A CG    
164  C CD    . GLU A 23  ? 0.3951 0.4014 0.4420 -0.0087 0.0106  0.0056  315 GLU A CD    
165  O OE1   . GLU A 23  ? 0.3016 0.3095 0.3513 -0.0085 0.0097  0.0052  315 GLU A OE1   
166  O OE2   . GLU A 23  ? 0.4648 0.4718 0.5118 -0.0084 0.0112  0.0049  315 GLU A OE2   
167  N N     . PRO A 24  ? 0.2397 0.2419 0.2838 -0.0070 0.0049  0.0050  316 PRO A N     
168  C CA    . PRO A 24  ? 0.2420 0.2441 0.2863 -0.0053 0.0025  0.0036  316 PRO A CA    
169  C C     . PRO A 24  ? 0.2411 0.2423 0.2819 -0.0039 0.0019  0.0037  316 PRO A C     
170  O O     . PRO A 24  ? 0.2568 0.2581 0.2986 -0.0025 0.0000  0.0026  316 PRO A O     
171  C CB    . PRO A 24  ? 0.2721 0.2747 0.3158 -0.0050 0.0017  0.0027  316 PRO A CB    
172  C CG    . PRO A 24  ? 0.3059 0.3084 0.3474 -0.0064 0.0038  0.0040  316 PRO A CG    
173  C CD    . PRO A 24  ? 0.2522 0.2547 0.2953 -0.0079 0.0056  0.0054  316 PRO A CD    
174  N N     . MET A 25  ? 0.2117 0.2120 0.2485 -0.0042 0.0032  0.0051  317 MET A N     
175  C CA    . MET A 25  ? 0.2226 0.2219 0.2562 -0.0031 0.0024  0.0060  317 MET A CA    
176  C C     . MET A 25  ? 0.2285 0.2266 0.2645 -0.0027 0.0017  0.0059  317 MET A C     
177  O O     . MET A 25  ? 0.2636 0.2608 0.2981 -0.0015 0.0002  0.0063  317 MET A O     
178  C CB    . MET A 25  ? 0.2352 0.2338 0.2651 -0.0040 0.0039  0.0081  317 MET A CB    
179  C CG    . MET A 25  ? 0.2970 0.2975 0.3236 -0.0038 0.0042  0.0083  317 MET A CG    
180  S SD    . MET A 25  ? 0.2868 0.2896 0.3109 -0.0014 0.0019  0.0073  317 MET A SD    
181  C CE    . MET A 25  ? 0.2398 0.2410 0.2614 -0.0013 0.0015  0.0103  317 MET A CE    
182  N N     . TRP A 26  ? 0.2236 0.2222 0.2632 -0.0037 0.0026  0.0054  318 TRP A N     
183  C CA    . TRP A 26  ? 0.1969 0.1951 0.2391 -0.0032 0.0020  0.0047  318 TRP A CA    
184  C C     . TRP A 26  ? 0.2529 0.2530 0.2996 -0.0028 0.0011  0.0030  318 TRP A C     
185  O O     . TRP A 26  ? 0.2919 0.2926 0.3412 -0.0022 0.0005  0.0021  318 TRP A O     
186  C CB    . TRP A 26  ? 0.2145 0.2130 0.2578 -0.0043 0.0038  0.0050  318 TRP A CB    
187  C CG    . TRP A 26  ? 0.2243 0.2206 0.2644 -0.0046 0.0043  0.0065  318 TRP A CG    
188  C CD1   . TRP A 26  ? 0.2458 0.2418 0.2831 -0.0057 0.0056  0.0077  318 TRP A CD1   
189  C CD2   . TRP A 26  ? 0.2273 0.2213 0.2673 -0.0040 0.0031  0.0069  318 TRP A CD2   
190  N NE1   . TRP A 26  ? 0.2334 0.2272 0.2690 -0.0059 0.0055  0.0092  318 TRP A NE1   
191  C CE2   . TRP A 26  ? 0.2066 0.1990 0.2440 -0.0049 0.0038  0.0088  318 TRP A CE2   
192  C CE3   . TRP A 26  ? 0.2119 0.2050 0.2542 -0.0027 0.0012  0.0059  318 TRP A CE3   
193  C CZ2   . TRP A 26  ? 0.1965 0.1862 0.2340 -0.0048 0.0027  0.0101  318 TRP A CZ2   
194  C CZ3   . TRP A 26  ? 0.2644 0.2546 0.3065 -0.0024 -0.0001 0.0069  318 TRP A CZ3   
195  C CH2   . TRP A 26  ? 0.2456 0.2340 0.2855 -0.0035 0.0006  0.0091  318 TRP A CH2   
196  N N     . ALA A 27  ? 0.2374 0.2387 0.2855 -0.0030 0.0007  0.0026  319 ALA A N     
197  C CA    . ALA A 27  ? 0.2158 0.2192 0.2692 -0.0033 0.0000  0.0015  319 ALA A CA    
198  C C     . ALA A 27  ? 0.2562 0.2594 0.3110 -0.0015 -0.0027 -0.0001 319 ALA A C     
199  O O     . ALA A 27  ? 0.2596 0.2616 0.3110 -0.0002 -0.0040 -0.0005 319 ALA A O     
200  C CB    . ALA A 27  ? 0.2636 0.2683 0.3192 -0.0049 0.0008  0.0021  319 ALA A CB    
201  N N     . ASP A 28  ? 0.2332 0.2380 0.2929 -0.0015 -0.0035 -0.0012 320 ASP A N     
202  C CA    . ASP A 28  ? 0.2315 0.2365 0.2941 -0.0002 -0.0061 -0.0029 320 ASP A CA    
203  C C     . ASP A 28  ? 0.2206 0.2268 0.2875 -0.0014 -0.0066 -0.0030 320 ASP A C     
204  O O     . ASP A 28  ? 0.2525 0.2602 0.3222 -0.0035 -0.0049 -0.0015 320 ASP A O     
205  C CB    . ASP A 28  ? 0.2658 0.2720 0.3322 0.0006  -0.0072 -0.0043 320 ASP A CB    
206  C CG    . ASP A 28  ? 0.4106 0.4148 0.4732 0.0028  -0.0086 -0.0050 320 ASP A CG    
207  O OD1   . ASP A 28  ? 0.3665 0.3696 0.4268 0.0046  -0.0107 -0.0059 320 ASP A OD1   
208  O OD2   . ASP A 28  ? 0.3850 0.3890 0.4473 0.0028  -0.0079 -0.0047 320 ASP A OD2   
209  N N     . LEU A 29  ? 0.2127 0.2184 0.2804 0.0001  -0.0092 -0.0048 321 LEU A N     
210  C CA    . LEU A 29  ? 0.2330 0.2394 0.3060 -0.0006 -0.0107 -0.0053 321 LEU A CA    
211  C C     . LEU A 29  ? 0.2372 0.2451 0.3176 -0.0012 -0.0121 -0.0059 321 LEU A C     
212  O O     . LEU A 29  ? 0.2251 0.2330 0.3077 0.0007  -0.0148 -0.0083 321 LEU A O     
213  C CB    . LEU A 29  ? 0.2221 0.2277 0.2930 0.0017  -0.0134 -0.0077 321 LEU A CB    
214  C CG    . LEU A 29  ? 0.2300 0.2359 0.3065 0.0015  -0.0158 -0.0091 321 LEU A CG    
215  C CD1   . LEU A 29  ? 0.2751 0.2806 0.3520 -0.0010 -0.0138 -0.0067 321 LEU A CD1   
216  C CD2   . LEU A 29  ? 0.2199 0.2260 0.2937 0.0046  -0.0185 -0.0123 321 LEU A CD2   
217  N N     . LEU A 30  ? 0.2234 0.2334 0.3078 -0.0037 -0.0102 -0.0038 322 LEU A N     
218  C CA    . LEU A 30  ? 0.2466 0.2592 0.3385 -0.0046 -0.0110 -0.0038 322 LEU A CA    
219  C C     . LEU A 30  ? 0.2216 0.2338 0.3204 -0.0045 -0.0144 -0.0051 322 LEU A C     
220  O O     . LEU A 30  ? 0.2554 0.2685 0.3592 -0.0037 -0.0166 -0.0069 322 LEU A O     
221  C CB    . LEU A 30  ? 0.2428 0.2588 0.3376 -0.0076 -0.0082 -0.0008 322 LEU A CB    
222  C CG    . LEU A 30  ? 0.2132 0.2305 0.3029 -0.0077 -0.0050 0.0001  322 LEU A CG    
223  C CD1   . LEU A 30  ? 0.2958 0.3182 0.3896 -0.0103 -0.0026 0.0026  322 LEU A CD1   
224  C CD2   . LEU A 30  ? 0.2696 0.2862 0.3568 -0.0054 -0.0057 -0.0023 322 LEU A CD2   
225  N N     . ALA A 31  ? 0.2472 0.2580 0.3466 -0.0053 -0.0152 -0.0044 323 ALA A N     
226  C CA    . ALA A 31  ? 0.2312 0.2415 0.3383 -0.0054 -0.0188 -0.0056 323 ALA A CA    
227  C C     . ALA A 31  ? 0.2427 0.2506 0.3478 -0.0046 -0.0203 -0.0065 323 ALA A C     
228  O O     . ALA A 31  ? 0.2381 0.2455 0.3379 -0.0054 -0.0179 -0.0048 323 ALA A O     
229  C CB    . ALA A 31  ? 0.2179 0.2306 0.3333 -0.0088 -0.0183 -0.0023 323 ALA A CB    
230  N N     . LEU A 32  ? 0.2518 0.2588 0.3616 -0.0029 -0.0245 -0.0096 324 LEU A N     
231  C CA    . LEU A 32  ? 0.2499 0.2554 0.3588 -0.0015 -0.0267 -0.0116 324 LEU A CA    
232  C C     . LEU A 32  ? 0.2183 0.2231 0.3378 -0.0019 -0.0312 -0.0129 324 LEU A C     
233  O O     . LEU A 32  ? 0.2518 0.2572 0.3772 -0.0011 -0.0337 -0.0147 324 LEU A O     
234  C CB    . LEU A 32  ? 0.2391 0.2447 0.3411 0.0024  -0.0278 -0.0155 324 LEU A CB    
235  C CG    . LEU A 32  ? 0.2721 0.2775 0.3726 0.0045  -0.0302 -0.0185 324 LEU A CG    
236  C CD1   . LEU A 32  ? 0.2717 0.2765 0.3665 0.0029  -0.0269 -0.0159 324 LEU A CD1   
237  C CD2   . LEU A 32  ? 0.2959 0.3029 0.3909 0.0085  -0.0317 -0.0225 324 LEU A CD2   
238  N N     . ALA A 33  ? 0.2642 0.2676 0.3866 -0.0030 -0.0325 -0.0121 325 ALA A N     
239  C CA    . ALA A 33  ? 0.2757 0.2779 0.4092 -0.0034 -0.0374 -0.0132 325 ALA A CA    
240  C C     . ALA A 33  ? 0.2505 0.2510 0.3843 -0.0024 -0.0399 -0.0150 325 ALA A C     
241  O O     . ALA A 33  ? 0.2543 0.2547 0.3801 -0.0021 -0.0372 -0.0145 325 ALA A O     
242  C CB    . ALA A 33  ? 0.2728 0.2755 0.4139 -0.0077 -0.0364 -0.0080 325 ALA A CB    
243  N N     . ALA A 34  ? 0.2362 0.2352 0.3797 -0.0017 -0.0453 -0.0175 326 ALA A N     
244  C CA    . ALA A 34  ? 0.2938 0.2913 0.4387 -0.0004 -0.0484 -0.0200 326 ALA A CA    
245  C C     . ALA A 34  ? 0.3564 0.3515 0.5145 -0.0024 -0.0532 -0.0188 326 ALA A C     
246  O O     . ALA A 34  ? 0.3476 0.3426 0.5143 -0.0032 -0.0557 -0.0186 326 ALA A O     
247  C CB    . ALA A 34  ? 0.3104 0.3094 0.4519 0.0047  -0.0513 -0.0269 326 ALA A CB    
248  N N     . ALA A 35  ? 0.3130 0.3061 0.4730 -0.0034 -0.0545 -0.0176 327 ALA A N     
249  C CA    . ALA A 35  ? 0.3641 0.3545 0.5372 -0.0057 -0.0594 -0.0158 327 ALA A CA    
250  C C     . ALA A 35  ? 0.3235 0.3118 0.5004 -0.0028 -0.0649 -0.0208 327 ALA A C     
251  O O     . ALA A 35  ? 0.3166 0.3054 0.4857 -0.0012 -0.0633 -0.0225 327 ALA A O     
252  C CB    . ALA A 35  ? 0.3397 0.3295 0.5140 -0.0108 -0.0560 -0.0076 327 ALA A CB    
253  N N     . ARG A 36  ? 0.3948 0.3811 0.5845 -0.0023 -0.0715 -0.0232 328 ARG A N     
254  C CA    . ARG A 36  ? 0.3743 0.3584 0.5681 0.0009  -0.0770 -0.0281 328 ARG A CA    
255  C C     . ARG A 36  ? 0.4430 0.4228 0.6471 0.0007  -0.0808 -0.0252 328 ARG A C     
256  O O     . ARG A 36  ? 0.4098 0.3893 0.6192 0.0014  -0.0824 -0.0257 328 ARG A O     
257  C CB    . ARG A 36  ? 0.5204 0.5074 0.7113 0.0066  -0.0800 -0.0373 328 ARG A CB    
258  C CG    . ARG A 36  ? 0.7448 0.7288 0.9402 0.0111  -0.0855 -0.0428 328 ARG A CG    
259  C CD    . ARG A 36  ? 0.9247 0.9081 1.1170 0.0114  -0.0857 -0.0433 328 ARG A CD    
260  N NE    . ARG A 36  ? 1.0463 1.0352 1.2295 0.0149  -0.0847 -0.0494 328 ARG A NE    
261  C CZ    . ARG A 36  ? 1.0718 1.0622 1.2532 0.0204  -0.0878 -0.0575 328 ARG A CZ    
262  N NH1   . ARG A 36  ? 1.0917 1.0776 1.2803 0.0230  -0.0924 -0.0609 328 ARG A NH1   
263  N NH2   . ARG A 36  ? 1.0624 1.0592 1.2347 0.0235  -0.0861 -0.0619 328 ARG A NH2   
264  N N     . GLY A 37  ? 0.5549 0.5318 0.7620 -0.0003 -0.0824 -0.0220 329 GLY A N     
265  C CA    . GLY A 37  ? 0.6471 0.6206 0.8644 -0.0010 -0.0860 -0.0179 329 GLY A CA    
266  C C     . GLY A 37  ? 0.7629 0.7376 0.9823 -0.0059 -0.0824 -0.0095 329 GLY A C     
267  O O     . GLY A 37  ? 0.7022 0.6756 0.9303 -0.0064 -0.0851 -0.0066 329 GLY A O     
268  N N     . GLY A 38  ? 0.8596 0.8372 1.0711 -0.0094 -0.0763 -0.0057 330 GLY A N     
269  C CA    . GLY A 38  ? 0.8743 0.8541 1.0864 -0.0138 -0.0722 0.0018  330 GLY A CA    
270  C C     . GLY A 38  ? 0.8349 0.8167 1.0486 -0.0134 -0.0715 -0.0001 330 GLY A C     
271  O O     . GLY A 38  ? 0.8931 0.8778 1.1060 -0.0167 -0.0674 0.0051  330 GLY A O     
272  N N     . ARG A 39  ? 0.6802 0.6611 0.8962 -0.0090 -0.0754 -0.0078 331 ARG A N     
273  C CA    . ARG A 39  ? 0.5046 0.4875 0.7212 -0.0079 -0.0751 -0.0109 331 ARG A CA    
274  C C     . ARG A 39  ? 0.3519 0.3386 0.5588 -0.0086 -0.0703 -0.0124 331 ARG A C     
275  O O     . ARG A 39  ? 0.3564 0.3435 0.5572 -0.0071 -0.0699 -0.0157 331 ARG A O     
276  C CB    . ARG A 39  ? 0.5864 0.5673 0.8071 -0.0025 -0.0808 -0.0192 331 ARG A CB    
277  C CG    . ARG A 39  ? 0.7925 0.7740 1.0183 -0.0014 -0.0822 -0.0210 331 ARG A CG    
278  C CD    . ARG A 39  ? 0.9476 0.9254 1.1818 0.0029  -0.0887 -0.0261 331 ARG A CD    
279  N NE    . ARG A 39  ? 1.1269 1.1048 1.3665 0.0039  -0.0901 -0.0278 331 ARG A NE    
280  C CZ    . ARG A 39  ? 1.1738 1.1512 1.4215 0.0010  -0.0903 -0.0221 331 ARG A CZ    
281  N NH1   . ARG A 39  ? 1.1671 1.1441 1.4178 -0.0030 -0.0891 -0.0142 331 ARG A NH1   
282  N NH2   . ARG A 39  ? 1.1834 1.1610 1.4357 0.0022  -0.0917 -0.0244 331 ARG A NH2   
283  N N     . VAL A 40  ? 0.3928 0.3826 0.5988 -0.0107 -0.0667 -0.0099 332 VAL A N     
284  C CA    . VAL A 40  ? 0.3595 0.3529 0.5557 -0.0111 -0.0616 -0.0103 332 VAL A CA    
285  C C     . VAL A 40  ? 0.4155 0.4107 0.6093 -0.0075 -0.0621 -0.0157 332 VAL A C     
286  O O     . VAL A 40  ? 0.4208 0.4166 0.6238 -0.0080 -0.0649 -0.0163 332 VAL A O     
287  C CB    . VAL A 40  ? 0.3897 0.3856 0.5832 -0.0158 -0.0556 -0.0025 332 VAL A CB    
288  C CG1   . VAL A 40  ? 0.5322 0.5292 0.7348 -0.0183 -0.0564 0.0015  332 VAL A CG1   
289  C CG2   . VAL A 40  ? 0.4305 0.4293 0.6109 -0.0144 -0.0496 -0.0030 332 VAL A CG2   
290  N N     . HIS A 41  ? 0.3975 0.3939 0.5793 -0.0040 -0.0596 -0.0195 333 HIS A N     
291  C CA    . HIS A 41  ? 0.3096 0.3080 0.4875 -0.0003 -0.0599 -0.0243 333 HIS A CA    
292  C C     . HIS A 41  ? 0.3299 0.3305 0.4963 -0.0010 -0.0533 -0.0215 333 HIS A C     
293  O O     . HIS A 41  ? 0.2967 0.2974 0.4532 -0.0007 -0.0498 -0.0205 333 HIS A O     
294  C CB    . HIS A 41  ? 0.2795 0.2780 0.4527 0.0049  -0.0630 -0.0314 333 HIS A CB    
295  C CG    . HIS A 41  ? 0.3542 0.3507 0.5374 0.0062  -0.0695 -0.0349 333 HIS A CG    
296  N ND1   . HIS A 41  ? 0.3727 0.3697 0.5622 0.0102  -0.0756 -0.0418 333 HIS A ND1   
297  C CD2   . HIS A 41  ? 0.3745 0.3684 0.5623 0.0042  -0.0712 -0.0328 333 HIS A CD2   
298  C CE1   . HIS A 41  ? 0.3669 0.3611 0.5639 0.0109  -0.0804 -0.0439 333 HIS A CE1   
299  N NE2   . HIS A 41  ? 0.3777 0.3703 0.5749 0.0071  -0.0783 -0.0385 333 HIS A NE2   
300  N N     . ARG A 42  ? 0.2978 0.3003 0.4658 -0.0019 -0.0518 -0.0203 334 ARG A N     
301  C CA    . ARG A 42  ? 0.2925 0.2970 0.4504 -0.0024 -0.0461 -0.0180 334 ARG A CA    
302  C C     . ARG A 42  ? 0.3577 0.3632 0.5088 0.0019  -0.0463 -0.0228 334 ARG A C     
303  O O     . ARG A 42  ? 0.3750 0.3809 0.5314 0.0041  -0.0502 -0.0267 334 ARG A O     
304  C CB    . ARG A 42  ? 0.3846 0.3913 0.5476 -0.0063 -0.0434 -0.0131 334 ARG A CB    
305  C CG    . ARG A 42  ? 0.4290 0.4357 0.5966 -0.0108 -0.0420 -0.0072 334 ARG A CG    
306  C CD    . ARG A 42  ? 0.4413 0.4517 0.6133 -0.0145 -0.0391 -0.0024 334 ARG A CD    
307  N NE    . ARG A 42  ? 0.5362 0.5477 0.7100 -0.0186 -0.0368 0.0038  334 ARG A NE    
308  C CZ    . ARG A 42  ? 0.5708 0.5812 0.7546 -0.0212 -0.0399 0.0068  334 ARG A CZ    
309  N NH1   . ARG A 42  ? 0.5587 0.5666 0.7521 -0.0201 -0.0457 0.0037  334 ARG A NH1   
310  N NH2   . ARG A 42  ? 0.6130 0.6247 0.7973 -0.0249 -0.0376 0.0128  334 ARG A NH2   
311  N N     . ALA A 43  ? 0.3085 0.3145 0.4479 0.0029  -0.0424 -0.0223 335 ALA A N     
312  C CA    . ALA A 43  ? 0.3224 0.3294 0.4544 0.0069  -0.0426 -0.0261 335 ALA A CA    
313  C C     . ALA A 43  ? 0.2577 0.2661 0.3902 0.0066  -0.0412 -0.0254 335 ALA A C     
314  O O     . ALA A 43  ? 0.3108 0.3198 0.4416 0.0038  -0.0373 -0.0213 335 ALA A O     
315  C CB    . ALA A 43  ? 0.3175 0.3246 0.4377 0.0077  -0.0391 -0.0251 335 ALA A CB    
316  N N     . PRO A 44  ? 0.3194 0.3285 0.4542 0.0097  -0.0446 -0.0297 336 PRO A N     
317  C CA    . PRO A 44  ? 0.3252 0.3357 0.4599 0.0099  -0.0435 -0.0296 336 PRO A CA    
318  C C     . PRO A 44  ? 0.3207 0.3314 0.4440 0.0107  -0.0396 -0.0281 336 PRO A C     
319  O O     . PRO A 44  ? 0.3871 0.3987 0.5101 0.0090  -0.0369 -0.0257 336 PRO A O     
320  C CB    . PRO A 44  ? 0.3443 0.3554 0.4830 0.0138  -0.0486 -0.0351 336 PRO A CB    
321  C CG    . PRO A 44  ? 0.4027 0.4133 0.5418 0.0161  -0.0520 -0.0385 336 PRO A CG    
322  C CD    . PRO A 44  ? 0.3733 0.3824 0.5138 0.0128  -0.0502 -0.0349 336 PRO A CD    
323  N N     . GLU A 45  ? 0.3071 0.3174 0.4216 0.0133  -0.0395 -0.0295 337 GLU A N     
324  C CA    . GLU A 45  ? 0.3162 0.3264 0.4203 0.0140  -0.0362 -0.0277 337 GLU A CA    
325  C C     . GLU A 45  ? 0.3223 0.3319 0.4197 0.0135  -0.0340 -0.0260 337 GLU A C     
326  O O     . GLU A 45  ? 0.3446 0.3550 0.4383 0.0161  -0.0358 -0.0286 337 GLU A O     
327  C CB    . GLU A 45  ? 0.3537 0.3649 0.4533 0.0181  -0.0385 -0.0311 337 GLU A CB    
328  C CG    . GLU A 45  ? 0.3947 0.4066 0.5004 0.0193  -0.0410 -0.0334 337 GLU A CG    
329  C CD    . GLU A 45  ? 0.5646 0.5777 0.6652 0.0237  -0.0436 -0.0367 337 GLU A CD    
330  O OE1   . GLU A 45  ? 0.6919 0.7046 0.7857 0.0244  -0.0419 -0.0352 337 GLU A OE1   
331  O OE2   . GLU A 45  ? 0.5522 0.5667 0.6560 0.0266  -0.0476 -0.0410 337 GLU A OE2   
332  N N     . PRO A 46  ? 0.3214 0.3301 0.4171 0.0102  -0.0301 -0.0220 338 PRO A N     
333  C CA    . PRO A 46  ? 0.3093 0.3174 0.4006 0.0092  -0.0282 -0.0203 338 PRO A CA    
334  C C     . PRO A 46  ? 0.2534 0.2620 0.3355 0.0117  -0.0279 -0.0213 338 PRO A C     
335  O O     . PRO A 46  ? 0.2748 0.2839 0.3558 0.0124  -0.0288 -0.0225 338 PRO A O     
336  C CB    . PRO A 46  ? 0.3180 0.3256 0.4079 0.0058  -0.0240 -0.0160 338 PRO A CB    
337  C CG    . PRO A 46  ? 0.2605 0.2690 0.3585 0.0042  -0.0246 -0.0155 338 PRO A CG    
338  C CD    . PRO A 46  ? 0.3439 0.3529 0.4431 0.0073  -0.0277 -0.0190 338 PRO A CD    
339  N N     . TYR A 47  ? 0.2594 0.2681 0.3353 0.0130  -0.0267 -0.0206 339 TYR A N     
340  C CA    . TYR A 47  ? 0.2936 0.3034 0.3608 0.0150  -0.0262 -0.0207 339 TYR A CA    
341  C C     . TYR A 47  ? 0.3516 0.3642 0.4188 0.0187  -0.0299 -0.0250 339 TYR A C     
342  O O     . TYR A 47  ? 0.3448 0.3594 0.4074 0.0200  -0.0299 -0.0258 339 TYR A O     
343  C CB    . TYR A 47  ? 0.2831 0.2922 0.3443 0.0153  -0.0245 -0.0185 339 TYR A CB    
344  C CG    . TYR A 47  ? 0.2454 0.2525 0.3055 0.0122  -0.0207 -0.0147 339 TYR A CG    
345  C CD1   . TYR A 47  ? 0.2474 0.2541 0.3036 0.0106  -0.0182 -0.0125 339 TYR A CD1   
346  C CD2   . TYR A 47  ? 0.2803 0.2864 0.3434 0.0110  -0.0200 -0.0137 339 TYR A CD2   
347  C CE1   . TYR A 47  ? 0.2831 0.2882 0.3384 0.0080  -0.0151 -0.0095 339 TYR A CE1   
348  C CE2   . TYR A 47  ? 0.2999 0.3048 0.3620 0.0086  -0.0169 -0.0109 339 TYR A CE2   
349  C CZ    . TYR A 47  ? 0.2817 0.2861 0.3400 0.0071  -0.0145 -0.0088 339 TYR A CZ    
350  O OH    . TYR A 47  ? 0.2821 0.2857 0.3397 0.0050  -0.0117 -0.0064 339 TYR A OH    
351  N N     . LYS A 48  ? 0.3004 0.3135 0.3729 0.0205  -0.0332 -0.0280 340 LYS A N     
352  C CA    . LYS A 48  ? 0.3695 0.3855 0.4429 0.0243  -0.0373 -0.0328 340 LYS A CA    
353  C C     . LYS A 48  ? 0.4138 0.4303 0.4923 0.0242  -0.0391 -0.0352 340 LYS A C     
354  O O     . LYS A 48  ? 0.3661 0.3858 0.4422 0.0270  -0.0410 -0.0383 340 LYS A O     
355  C CB    . LYS A 48  ? 0.3397 0.3559 0.4189 0.0261  -0.0406 -0.0357 340 LYS A CB    
356  C CG    . LYS A 48  ? 0.5565 0.5760 0.6377 0.0304  -0.0453 -0.0414 340 LYS A CG    
357  C CD    . LYS A 48  ? 0.7595 0.7788 0.8480 0.0318  -0.0487 -0.0444 340 LYS A CD    
358  C CE    . LYS A 48  ? 0.9054 0.9279 0.9978 0.0360  -0.0540 -0.0506 340 LYS A CE    
359  N NZ    . LYS A 48  ? 1.0072 1.0296 1.1074 0.0375  -0.0576 -0.0539 340 LYS A NZ    
360  N N     . ALA A 49  ? 0.2984 0.3122 0.3844 0.0210  -0.0387 -0.0336 341 ALA A N     
361  C CA    . ALA A 49  ? 0.3005 0.3140 0.3928 0.0204  -0.0409 -0.0353 341 ALA A CA    
362  C C     . ALA A 49  ? 0.3465 0.3607 0.4329 0.0201  -0.0389 -0.0343 341 ALA A C     
363  O O     . ALA A 49  ? 0.3108 0.3258 0.4007 0.0211  -0.0415 -0.0372 341 ALA A O     
364  C CB    . ALA A 49  ? 0.3083 0.3189 0.4094 0.0167  -0.0406 -0.0327 341 ALA A CB    
365  N N     . LEU A 50  ? 0.3159 0.3298 0.3941 0.0186  -0.0345 -0.0305 342 LEU A N     
366  C CA    . LEU A 50  ? 0.3374 0.3523 0.4100 0.0181  -0.0323 -0.0294 342 LEU A CA    
367  C C     . LEU A 50  ? 0.2965 0.3159 0.3658 0.0222  -0.0349 -0.0338 342 LEU A C     
368  O O     . LEU A 50  ? 0.3325 0.3533 0.4011 0.0226  -0.0352 -0.0352 342 LEU A O     
369  C CB    . LEU A 50  ? 0.3382 0.3524 0.4024 0.0164  -0.0277 -0.0249 342 LEU A CB    
370  C CG    . LEU A 50  ? 0.3474 0.3583 0.4124 0.0124  -0.0241 -0.0204 342 LEU A CG    
371  C CD1   . LEU A 50  ? 0.3223 0.3332 0.3790 0.0118  -0.0205 -0.0171 342 LEU A CD1   
372  C CD2   . LEU A 50  ? 0.3247 0.3346 0.3930 0.0104  -0.0237 -0.0198 342 LEU A CD2   
373  N N     . ARG A 51  ? 0.3696 0.3917 0.4368 0.0254  -0.0369 -0.0362 343 ARG A N     
374  C CA    . ARG A 51  ? 0.3998 0.4275 0.4633 0.0297  -0.0394 -0.0406 343 ARG A CA    
375  C C     . ARG A 51  ? 0.4542 0.4835 0.5254 0.0320  -0.0442 -0.0464 343 ARG A C     
376  O O     . ARG A 51  ? 0.4523 0.4869 0.5209 0.0355  -0.0462 -0.0506 343 ARG A O     
377  C CB    . ARG A 51  ? 0.4037 0.4340 0.4636 0.0325  -0.0406 -0.0417 343 ARG A CB    
378  C CG    . ARG A 51  ? 0.5292 0.5610 0.5790 0.0322  -0.0370 -0.0374 343 ARG A CG    
379  C CD    . ARG A 51  ? 0.6705 0.6967 0.7195 0.0279  -0.0330 -0.0317 343 ARG A CD    
380  N NE    . ARG A 51  ? 0.7669 0.7943 0.8070 0.0274  -0.0299 -0.0275 343 ARG A NE    
381  C CZ    . ARG A 51  ? 0.7081 0.7314 0.7464 0.0244  -0.0268 -0.0228 343 ARG A CZ    
382  N NH1   . ARG A 51  ? 0.6339 0.6527 0.6782 0.0218  -0.0262 -0.0219 343 ARG A NH1   
383  N NH2   . ARG A 51  ? 0.5932 0.6175 0.6241 0.0240  -0.0246 -0.0191 343 ARG A NH2   
384  N N     . ASP A 52  ? 0.3860 0.4109 0.4670 0.0301  -0.0462 -0.0467 344 ASP A N     
385  C CA    . ASP A 52  ? 0.3774 0.4029 0.4674 0.0320  -0.0514 -0.0520 344 ASP A CA    
386  C C     . ASP A 52  ? 0.4215 0.4462 0.5127 0.0306  -0.0511 -0.0518 344 ASP A C     
387  O O     . ASP A 52  ? 0.4432 0.4696 0.5400 0.0330  -0.0555 -0.0569 344 ASP A O     
388  C CB    . ASP A 52  ? 0.3736 0.3949 0.4745 0.0303  -0.0540 -0.0519 344 ASP A CB    
389  C CG    . ASP A 52  ? 0.4347 0.4570 0.5353 0.0321  -0.0550 -0.0530 344 ASP A CG    
390  O OD1   . ASP A 52  ? 0.5478 0.5748 0.6431 0.0362  -0.0565 -0.0566 344 ASP A OD1   
391  O OD2   . ASP A 52  ? 0.3847 0.4035 0.4902 0.0294  -0.0543 -0.0502 344 ASP A OD2   
392  N N     . LEU A 53  ? 0.3636 0.3860 0.4500 0.0270  -0.0462 -0.0463 345 LEU A N     
393  C CA    . LEU A 53  ? 0.3491 0.3704 0.4369 0.0253  -0.0456 -0.0456 345 LEU A CA    
394  C C     . LEU A 53  ? 0.3457 0.3722 0.4255 0.0278  -0.0446 -0.0478 345 LEU A C     
395  O O     . LEU A 53  ? 0.3868 0.4166 0.4577 0.0287  -0.0417 -0.0464 345 LEU A O     
396  C CB    . LEU A 53  ? 0.2971 0.3137 0.3837 0.0203  -0.0410 -0.0389 345 LEU A CB    
397  C CG    . LEU A 53  ? 0.3864 0.3988 0.4805 0.0173  -0.0412 -0.0360 345 LEU A CG    
398  C CD1   . LEU A 53  ? 0.4068 0.4164 0.4982 0.0129  -0.0363 -0.0298 345 LEU A CD1   
399  C CD2   . LEU A 53  ? 0.4148 0.4253 0.5204 0.0173  -0.0462 -0.0385 345 LEU A CD2   
400  N N     . LYS A 54  ? 0.3441 0.3717 0.4275 0.0288  -0.0471 -0.0511 346 LYS A N     
401  C CA    . LYS A 54  ? 0.3613 0.3947 0.4378 0.0311  -0.0461 -0.0534 346 LYS A CA    
402  C C     . LYS A 54  ? 0.3929 0.4240 0.4649 0.0276  -0.0415 -0.0485 346 LYS A C     
403  O O     . LYS A 54  ? 0.3802 0.4158 0.4444 0.0282  -0.0387 -0.0481 346 LYS A O     
404  C CB    . LYS A 54  ? 0.4697 0.5063 0.5523 0.0350  -0.0518 -0.0607 346 LYS A CB    
405  C CG    . LYS A 54  ? 0.5935 0.6333 0.6803 0.0392  -0.0568 -0.0665 346 LYS A CG    
406  C CD    . LYS A 54  ? 0.7541 0.8011 0.8312 0.0423  -0.0549 -0.0674 346 LYS A CD    
407  C CE    . LYS A 54  ? 0.8873 0.9431 0.9593 0.0461  -0.0556 -0.0720 346 LYS A CE    
408  N NZ    . LYS A 54  ? 0.9580 1.0147 1.0222 0.0435  -0.0502 -0.0675 346 LYS A NZ    
409  N N     . GLU A 55  ? 0.3721 0.3969 0.4493 0.0237  -0.0408 -0.0448 347 GLU A N     
410  C CA    . GLU A 55  ? 0.3750 0.3974 0.4482 0.0202  -0.0363 -0.0399 347 GLU A CA    
411  C C     . GLU A 55  ? 0.3458 0.3622 0.4233 0.0160  -0.0346 -0.0348 347 GLU A C     
412  O O     . GLU A 55  ? 0.3411 0.3552 0.4256 0.0158  -0.0374 -0.0353 347 GLU A O     
413  C CB    . GLU A 55  ? 0.4736 0.4969 0.5489 0.0207  -0.0379 -0.0425 347 GLU A CB    
414  C CG    . GLU A 55  ? 0.5489 0.5682 0.6352 0.0202  -0.0426 -0.0442 347 GLU A CG    
415  C CD    . GLU A 55  ? 0.5927 0.6122 0.6807 0.0204  -0.0440 -0.0461 347 GLU A CD    
416  O OE1   . GLU A 55  ? 0.5459 0.5696 0.6267 0.0214  -0.0414 -0.0469 347 GLU A OE1   
417  O OE2   . GLU A 55  ? 0.6872 0.7028 0.7841 0.0195  -0.0477 -0.0466 347 GLU A OE2   
418  N N     . ALA A 56  ? 0.2975 0.3119 0.3708 0.0128  -0.0302 -0.0300 348 ALA A N     
419  C CA    . ALA A 56  ? 0.2796 0.2894 0.3567 0.0090  -0.0286 -0.0253 348 ALA A CA    
420  C C     . ALA A 56  ? 0.2777 0.2852 0.3596 0.0073  -0.0297 -0.0245 348 ALA A C     
421  O O     . ALA A 56  ? 0.2852 0.2931 0.3627 0.0065  -0.0274 -0.0235 348 ALA A O     
422  C CB    . ALA A 56  ? 0.2493 0.2586 0.3193 0.0068  -0.0233 -0.0206 348 ALA A CB    
423  N N     . ARG A 57  ? 0.2760 0.2809 0.3673 0.0066  -0.0335 -0.0249 349 ARG A N     
424  C CA    . ARG A 57  ? 0.2947 0.2973 0.3917 0.0052  -0.0356 -0.0244 349 ARG A CA    
425  C C     . ARG A 57  ? 0.3156 0.3148 0.4178 0.0012  -0.0346 -0.0188 349 ARG A C     
426  O O     . ARG A 57  ? 0.3025 0.3004 0.4120 0.0006  -0.0372 -0.0185 349 ARG A O     
427  C CB    . ARG A 57  ? 0.3767 0.3795 0.4814 0.0082  -0.0420 -0.0300 349 ARG A CB    
428  C CG    . ARG A 57  ? 0.3531 0.3536 0.4641 0.0075  -0.0452 -0.0304 349 ARG A CG    
429  C CD    . ARG A 57  ? 0.3725 0.3739 0.4909 0.0112  -0.0519 -0.0372 349 ARG A CD    
430  N NE    . ARG A 57  ? 0.3601 0.3598 0.4829 0.0113  -0.0550 -0.0385 349 ARG A NE    
431  C CZ    . ARG A 57  ? 0.4508 0.4472 0.5849 0.0112  -0.0609 -0.0398 349 ARG A CZ    
432  N NH1   . ARG A 57  ? 0.4772 0.4718 0.6198 0.0109  -0.0644 -0.0400 349 ARG A NH1   
433  N NH2   . ARG A 57  ? 0.4357 0.4306 0.5731 0.0113  -0.0635 -0.0409 349 ARG A NH2   
434  N N     . GLY A 58  ? 0.2800 0.2783 0.3787 -0.0016 -0.0308 -0.0144 350 GLY A N     
435  C CA    . GLY A 58  ? 0.2845 0.2809 0.3874 -0.0053 -0.0295 -0.0090 350 GLY A CA    
436  C C     . GLY A 58  ? 0.2327 0.2297 0.3285 -0.0075 -0.0241 -0.0048 350 GLY A C     
437  O O     . GLY A 58  ? 0.2392 0.2374 0.3274 -0.0063 -0.0216 -0.0061 350 GLY A O     
438  N N     . LEU A 59  ? 0.2462 0.2429 0.3447 -0.0107 -0.0223 0.0001  351 LEU A N     
439  C CA    . LEU A 59  ? 0.2239 0.2218 0.3164 -0.0127 -0.0174 0.0039  351 LEU A CA    
440  C C     . LEU A 59  ? 0.2357 0.2352 0.3203 -0.0113 -0.0139 0.0026  351 LEU A C     
441  O O     . LEU A 59  ? 0.2340 0.2341 0.3192 -0.0103 -0.0144 0.0014  351 LEU A O     
442  C CB    . LEU A 59  ? 0.2628 0.2615 0.3598 -0.0159 -0.0162 0.0090  351 LEU A CB    
443  C CG    . LEU A 59  ? 0.2821 0.2794 0.3861 -0.0181 -0.0188 0.0120  351 LEU A CG    
444  C CD1   . LEU A 59  ? 0.3288 0.3278 0.4393 -0.0211 -0.0186 0.0168  351 LEU A CD1   
445  C CD2   . LEU A 59  ? 0.2585 0.2559 0.3576 -0.0189 -0.0164 0.0140  351 LEU A CD2   
446  N N     . LEU A 60  ? 0.2281 0.2280 0.3057 -0.0113 -0.0108 0.0030  352 LEU A N     
447  C CA    . LEU A 60  ? 0.2319 0.2330 0.3022 -0.0104 -0.0076 0.0025  352 LEU A CA    
448  C C     . LEU A 60  ? 0.2665 0.2682 0.3348 -0.0075 -0.0093 -0.0014 352 LEU A C     
449  O O     . LEU A 60  ? 0.2304 0.2328 0.2955 -0.0068 -0.0079 -0.0015 352 LEU A O     
450  C CB    . LEU A 60  ? 0.2544 0.2567 0.3249 -0.0119 -0.0052 0.0052  352 LEU A CB    
451  C CG    . LEU A 60  ? 0.3066 0.3099 0.3786 -0.0145 -0.0031 0.0091  352 LEU A CG    
452  C CD1   . LEU A 60  ? 0.3883 0.3939 0.4601 -0.0154 -0.0007 0.0108  352 LEU A CD1   
453  C CD2   . LEU A 60  ? 0.3376 0.3407 0.4048 -0.0148 -0.0011 0.0096  352 LEU A CD2   
454  N N     . ALA A 61  ? 0.2706 0.2722 0.3407 -0.0057 -0.0125 -0.0046 353 ALA A N     
455  C CA    . ALA A 61  ? 0.2402 0.2434 0.3084 -0.0027 -0.0144 -0.0086 353 ALA A CA    
456  C C     . ALA A 61  ? 0.2328 0.2379 0.2927 -0.0017 -0.0113 -0.0085 353 ALA A C     
457  O O     . ALA A 61  ? 0.2553 0.2616 0.3130 0.0000  -0.0117 -0.0098 353 ALA A O     
458  C CB    . ALA A 61  ? 0.2504 0.2543 0.3212 -0.0007 -0.0180 -0.0124 353 ALA A CB    
459  N N     . LYS A 62  ? 0.2083 0.2135 0.2637 -0.0029 -0.0084 -0.0069 354 LYS A N     
460  C CA    A LYS A 62  ? 0.2186 0.2253 0.2669 -0.0024 -0.0055 -0.0062 354 LYS A CA    
461  C CA    B LYS A 62  ? 0.2197 0.2264 0.2680 -0.0025 -0.0055 -0.0062 354 LYS A CA    
462  C C     . LYS A 62  ? 0.2232 0.2291 0.2699 -0.0029 -0.0040 -0.0042 354 LYS A C     
463  O O     . LYS A 62  ? 0.2377 0.2450 0.2803 -0.0016 -0.0035 -0.0046 354 LYS A O     
464  C CB    A LYS A 62  ? 0.2465 0.2530 0.2915 -0.0040 -0.0028 -0.0044 354 LYS A CB    
465  C CB    B LYS A 62  ? 0.2298 0.2361 0.2750 -0.0041 -0.0027 -0.0042 354 LYS A CB    
466  C CG    A LYS A 62  ? 0.3055 0.3133 0.3440 -0.0040 0.0001  -0.0033 354 LYS A CG    
467  C CG    B LYS A 62  ? 0.2999 0.3073 0.3388 -0.0043 0.0003  -0.0028 354 LYS A CG    
468  C CD    A LYS A 62  ? 0.2908 0.2967 0.3281 -0.0058 0.0027  -0.0001 354 LYS A CD    
469  C CD    B LYS A 62  ? 0.3129 0.3198 0.3497 -0.0059 0.0027  -0.0013 354 LYS A CD    
470  C CE    A LYS A 62  ? 0.3613 0.3661 0.3993 -0.0078 0.0046  0.0016  354 LYS A CE    
471  C CE    B LYS A 62  ? 0.3806 0.3854 0.4192 -0.0080 0.0044  0.0014  354 LYS A CE    
472  N NZ    A LYS A 62  ? 0.3105 0.3142 0.3478 -0.0091 0.0068  0.0039  354 LYS A NZ    
473  N NZ    B LYS A 62  ? 0.3488 0.3531 0.3856 -0.0084 0.0061  0.0030  354 LYS A NZ    
474  N N     . ASP A 63  ? 0.2309 0.2352 0.2811 -0.0048 -0.0032 -0.0020 355 ASP A N     
475  C CA    . ASP A 63  ? 0.2088 0.2127 0.2582 -0.0052 -0.0018 -0.0005 355 ASP A CA    
476  C C     . ASP A 63  ? 0.2269 0.2313 0.2777 -0.0033 -0.0042 -0.0024 355 ASP A C     
477  O O     . ASP A 63  ? 0.2407 0.2453 0.2884 -0.0025 -0.0036 -0.0021 355 ASP A O     
478  C CB    . ASP A 63  ? 0.2121 0.2154 0.2651 -0.0075 -0.0005 0.0019  355 ASP A CB    
479  C CG    . ASP A 63  ? 0.3567 0.3599 0.4071 -0.0091 0.0023  0.0039  355 ASP A CG    
480  O OD1   . ASP A 63  ? 0.3277 0.3308 0.3732 -0.0087 0.0036  0.0038  355 ASP A OD1   
481  O OD2   . ASP A 63  ? 0.4031 0.4068 0.4564 -0.0108 0.0031  0.0058  355 ASP A OD2   
482  N N     . LEU A 64  ? 0.2342 0.2388 0.2902 -0.0024 -0.0074 -0.0045 356 LEU A N     
483  C CA    . LEU A 64  ? 0.2073 0.2127 0.2646 -0.0002 -0.0100 -0.0070 356 LEU A CA    
484  C C     . LEU A 64  ? 0.2213 0.2289 0.2727 0.0023  -0.0104 -0.0089 356 LEU A C     
485  O O     . LEU A 64  ? 0.2878 0.2963 0.3369 0.0039  -0.0109 -0.0095 356 LEU A O     
486  C CB    . LEU A 64  ? 0.2020 0.2071 0.2670 0.0003  -0.0137 -0.0091 356 LEU A CB    
487  C CG    . LEU A 64  ? 0.2587 0.2648 0.3261 0.0026  -0.0167 -0.0119 356 LEU A CG    
488  C CD1   . LEU A 64  ? 0.2700 0.2755 0.3374 0.0018  -0.0152 -0.0100 356 LEU A CD1   
489  C CD2   . LEU A 64  ? 0.2436 0.2491 0.3195 0.0031  -0.0208 -0.0143 356 LEU A CD2   
490  N N     . SER A 65  ? 0.2018 0.2107 0.2506 0.0027  -0.0100 -0.0098 357 SER A N     
491  C CA    A SER A 65  ? 0.2173 0.2296 0.2602 0.0049  -0.0099 -0.0112 357 SER A CA    
492  C CA    B SER A 65  ? 0.2141 0.2265 0.2570 0.0049  -0.0099 -0.0112 357 SER A CA    
493  C C     . SER A 65  ? 0.2104 0.2227 0.2474 0.0041  -0.0070 -0.0081 357 SER A C     
494  O O     . SER A 65  ? 0.2312 0.2460 0.2643 0.0059  -0.0074 -0.0084 357 SER A O     
495  C CB    A SER A 65  ? 0.2861 0.3002 0.3277 0.0050  -0.0097 -0.0124 357 SER A CB    
496  C CB    B SER A 65  ? 0.2735 0.2878 0.3152 0.0052  -0.0099 -0.0127 357 SER A CB    
497  O OG    A SER A 65  ? 0.2814 0.3001 0.3182 0.0073  -0.0100 -0.0143 357 SER A OG    
498  O OG    B SER A 65  ? 0.2191 0.2338 0.2666 0.0066  -0.0135 -0.0163 357 SER A OG    
499  N N     . VAL A 66  ? 0.2006 0.2103 0.2372 0.0015  -0.0042 -0.0050 358 VAL A N     
500  C CA    . VAL A 66  ? 0.2189 0.2277 0.2512 0.0007  -0.0019 -0.0020 358 VAL A CA    
501  C C     . VAL A 66  ? 0.2544 0.2625 0.2873 0.0017  -0.0031 -0.0019 358 VAL A C     
502  O O     . VAL A 66  ? 0.2286 0.2377 0.2574 0.0027  -0.0031 -0.0009 358 VAL A O     
503  C CB    . VAL A 66  ? 0.2052 0.2116 0.2383 -0.0020 0.0007  0.0004  358 VAL A CB    
504  C CG1   . VAL A 66  ? 0.1820 0.1869 0.2124 -0.0026 0.0023  0.0030  358 VAL A CG1   
505  C CG2   . VAL A 66  ? 0.2233 0.2304 0.2548 -0.0029 0.0020  0.0006  358 VAL A CG2   
506  N N     . LEU A 67  ? 0.2246 0.2312 0.2628 0.0014  -0.0043 -0.0027 359 LEU A N     
507  C CA    . LEU A 67  ? 0.2216 0.2276 0.2610 0.0024  -0.0056 -0.0031 359 LEU A CA    
508  C C     . LEU A 67  ? 0.2219 0.2304 0.2596 0.0053  -0.0082 -0.0055 359 LEU A C     
509  O O     . LEU A 67  ? 0.2378 0.2466 0.2729 0.0066  -0.0088 -0.0049 359 LEU A O     
510  C CB    . LEU A 67  ? 0.2199 0.2247 0.2659 0.0014  -0.0063 -0.0035 359 LEU A CB    
511  C CG    . LEU A 67  ? 0.2287 0.2332 0.2769 0.0024  -0.0078 -0.0042 359 LEU A CG    
512  C CD1   . LEU A 67  ? 0.2541 0.2578 0.3070 0.0004  -0.0067 -0.0030 359 LEU A CD1   
513  C CD2   . LEU A 67  ? 0.2588 0.2646 0.3102 0.0046  -0.0112 -0.0073 359 LEU A CD2   
514  N N     . ALA A 68  ? 0.2166 0.2272 0.2558 0.0067  -0.0101 -0.0083 360 ALA A N     
515  C CA    . ALA A 68  ? 0.2284 0.2425 0.2658 0.0099  -0.0127 -0.0111 360 ALA A CA    
516  C C     . ALA A 68  ? 0.2637 0.2805 0.2935 0.0107  -0.0112 -0.0093 360 ALA A C     
517  O O     . ALA A 68  ? 0.2693 0.2882 0.2965 0.0128  -0.0125 -0.0096 360 ALA A O     
518  C CB    . ALA A 68  ? 0.2426 0.2589 0.2831 0.0113  -0.0150 -0.0149 360 ALA A CB    
519  N N     . LEU A 69  ? 0.2602 0.2774 0.2869 0.0091  -0.0087 -0.0072 361 LEU A N     
520  C CA    . LEU A 69  ? 0.2744 0.2945 0.2945 0.0093  -0.0071 -0.0047 361 LEU A CA    
521  C C     . LEU A 69  ? 0.3204 0.3380 0.3385 0.0087  -0.0065 -0.0014 361 LEU A C     
522  O O     . LEU A 69  ? 0.3215 0.3417 0.3351 0.0100  -0.0069 0.0001  361 LEU A O     
523  C CB    . LEU A 69  ? 0.2040 0.2243 0.2220 0.0072  -0.0043 -0.0028 361 LEU A CB    
524  C CG    . LEU A 69  ? 0.2758 0.2997 0.2945 0.0082  -0.0049 -0.0060 361 LEU A CG    
525  C CD1   . LEU A 69  ? 0.3058 0.3291 0.3231 0.0058  -0.0021 -0.0040 361 LEU A CD1   
526  C CD2   . LEU A 69  ? 0.3235 0.3541 0.3382 0.0112  -0.0064 -0.0080 361 LEU A CD2   
527  N N     . ARG A 70  ? 0.2348 0.2476 0.2563 0.0068  -0.0057 -0.0002 362 ARG A N     
528  C CA    . ARG A 70  ? 0.2628 0.2730 0.2834 0.0064  -0.0056 0.0024  362 ARG A CA    
529  C C     . ARG A 70  ? 0.2866 0.2981 0.3071 0.0090  -0.0083 0.0008  362 ARG A C     
530  O O     . ARG A 70  ? 0.3019 0.3132 0.3192 0.0097  -0.0088 0.0030  362 ARG A O     
531  C CB    . ARG A 70  ? 0.2537 0.2598 0.2788 0.0045  -0.0047 0.0028  362 ARG A CB    
532  C CG    . ARG A 70  ? 0.2757 0.2791 0.3005 0.0042  -0.0048 0.0049  362 ARG A CG    
533  C CD    . ARG A 70  ? 0.2973 0.2981 0.3271 0.0030  -0.0044 0.0041  362 ARG A CD    
534  N NE    . ARG A 70  ? 0.2721 0.2736 0.3061 0.0042  -0.0063 0.0014  362 ARG A NE    
535  C CZ    . ARG A 70  ? 0.3206 0.3215 0.3598 0.0032  -0.0059 0.0004  362 ARG A CZ    
536  N NH1   . ARG A 70  ? 0.2864 0.2863 0.3266 0.0012  -0.0037 0.0017  362 ARG A NH1   
537  N NH2   . ARG A 70  ? 0.2732 0.2750 0.3167 0.0041  -0.0078 -0.0019 362 ARG A NH2   
538  N N     . GLU A 71  ? 0.2692 0.2819 0.2934 0.0106  -0.0104 -0.0030 363 GLU A N     
539  C CA    . GLU A 71  ? 0.3034 0.3175 0.3286 0.0133  -0.0134 -0.0054 363 GLU A CA    
540  C C     . GLU A 71  ? 0.3672 0.3868 0.3876 0.0161  -0.0148 -0.0067 363 GLU A C     
541  O O     . GLU A 71  ? 0.3922 0.4140 0.4130 0.0189  -0.0175 -0.0093 363 GLU A O     
542  C CB    . GLU A 71  ? 0.3026 0.3157 0.3349 0.0136  -0.0152 -0.0090 363 GLU A CB    
543  C CG    . GLU A 71  ? 0.2899 0.2989 0.3271 0.0110  -0.0139 -0.0077 363 GLU A CG    
544  C CD    . GLU A 71  ? 0.3854 0.3924 0.4221 0.0111  -0.0140 -0.0061 363 GLU A CD    
545  O OE1   . GLU A 71  ? 0.3241 0.3321 0.3603 0.0134  -0.0164 -0.0076 363 GLU A OE1   
546  O OE2   . GLU A 71  ? 0.3885 0.3930 0.4252 0.0090  -0.0119 -0.0037 363 GLU A OE2   
547  N N     . GLY A 72  ? 0.3305 0.3529 0.3466 0.0155  -0.0129 -0.0051 364 GLY A N     
548  C CA    . GLY A 72  ? 0.3522 0.3812 0.3632 0.0180  -0.0137 -0.0059 364 GLY A CA    
549  C C     . GLY A 72  ? 0.4022 0.4353 0.4157 0.0205  -0.0159 -0.0113 364 GLY A C     
550  O O     . GLY A 72  ? 0.3647 0.4041 0.3752 0.0236  -0.0177 -0.0136 364 GLY A O     
551  N N     . LEU A 73  ? 0.2939 0.3240 0.3130 0.0192  -0.0160 -0.0134 365 LEU A N     
552  C CA    . LEU A 73  ? 0.3281 0.3612 0.3511 0.0214  -0.0187 -0.0187 365 LEU A CA    
553  C C     . LEU A 73  ? 0.4118 0.4457 0.4348 0.0199  -0.0170 -0.0189 365 LEU A C     
554  O O     . LEU A 73  ? 0.3384 0.3679 0.3628 0.0167  -0.0147 -0.0161 365 LEU A O     
555  C CB    . LEU A 73  ? 0.3859 0.4145 0.4169 0.0211  -0.0211 -0.0211 365 LEU A CB    
556  C CG    . LEU A 73  ? 0.4455 0.4759 0.4824 0.0233  -0.0247 -0.0266 365 LEU A CG    
557  C CD1   . LEU A 73  ? 0.4739 0.5111 0.5083 0.0278  -0.0277 -0.0308 365 LEU A CD1   
558  C CD2   . LEU A 73  ? 0.5710 0.5967 0.6163 0.0223  -0.0266 -0.0276 365 LEU A CD2   
559  N N     . GLY A 74  ? 0.3893 0.4294 0.4106 0.0225  -0.0184 -0.0224 366 GLY A N     
560  C CA    . GLY A 74  ? 0.4707 0.5121 0.4930 0.0217  -0.0176 -0.0235 366 GLY A CA    
561  C C     . GLY A 74  ? 0.4912 0.5298 0.5216 0.0222  -0.0207 -0.0277 366 GLY A C     
562  O O     . GLY A 74  ? 0.4800 0.5225 0.5131 0.0255  -0.0243 -0.0330 366 GLY A O     
563  N N     . LEU A 75  ? 0.3006 0.3326 0.3352 0.0189  -0.0195 -0.0253 367 LEU A N     
564  C CA    . LEU A 75  ? 0.2701 0.2990 0.3130 0.0186  -0.0223 -0.0281 367 LEU A CA    
565  C C     . LEU A 75  ? 0.3389 0.3660 0.3825 0.0162  -0.0204 -0.0266 367 LEU A C     
566  O O     . LEU A 75  ? 0.3678 0.3905 0.4114 0.0129  -0.0176 -0.0225 367 LEU A O     
567  C CB    . LEU A 75  ? 0.3055 0.3290 0.3534 0.0168  -0.0227 -0.0262 367 LEU A CB    
568  C CG    . LEU A 75  ? 0.3243 0.3443 0.3815 0.0159  -0.0255 -0.0278 367 LEU A CG    
569  C CD1   . LEU A 75  ? 0.4114 0.4341 0.4736 0.0195  -0.0307 -0.0336 367 LEU A CD1   
570  C CD2   . LEU A 75  ? 0.3404 0.3559 0.4012 0.0132  -0.0244 -0.0244 367 LEU A CD2   
571  N N     . PRO A 76  ? 0.3649 0.3957 0.4087 0.0180  -0.0220 -0.0302 368 PRO A N     
572  C CA    . PRO A 76  ? 0.3474 0.3769 0.3910 0.0159  -0.0201 -0.0288 368 PRO A CA    
573  C C     . PRO A 76  ? 0.3624 0.3859 0.4133 0.0135  -0.0212 -0.0279 368 PRO A C     
574  O O     . PRO A 76  ? 0.3485 0.3704 0.4063 0.0145  -0.0250 -0.0303 368 PRO A O     
575  C CB    . PRO A 76  ? 0.3757 0.4114 0.4188 0.0191  -0.0224 -0.0340 368 PRO A CB    
576  C CG    . PRO A 76  ? 0.4019 0.4402 0.4487 0.0228  -0.0269 -0.0389 368 PRO A CG    
577  C CD    . PRO A 76  ? 0.3566 0.3935 0.4011 0.0224  -0.0258 -0.0362 368 PRO A CD    
578  N N     . PRO A 77  ? 0.2852 0.3057 0.3350 0.0104  -0.0181 -0.0242 369 PRO A N     
579  C CA    . PRO A 77  ? 0.2393 0.2551 0.2958 0.0082  -0.0193 -0.0230 369 PRO A CA    
580  C C     . PRO A 77  ? 0.3050 0.3218 0.3658 0.0099  -0.0229 -0.0271 369 PRO A C     
581  O O     . PRO A 77  ? 0.3234 0.3443 0.3804 0.0115  -0.0226 -0.0295 369 PRO A O     
582  C CB    . PRO A 77  ? 0.2326 0.2461 0.2853 0.0049  -0.0148 -0.0182 369 PRO A CB    
583  C CG    . PRO A 77  ? 0.3029 0.3203 0.3481 0.0058  -0.0122 -0.0183 369 PRO A CG    
584  C CD    . PRO A 77  ? 0.2817 0.3033 0.3244 0.0088  -0.0137 -0.0209 369 PRO A CD    
585  N N     . GLY A 78  ? 0.2965 0.3101 0.3657 0.0095  -0.0266 -0.0279 370 GLY A N     
586  C CA    . GLY A 78  ? 0.3438 0.3575 0.4185 0.0109  -0.0306 -0.0317 370 GLY A CA    
587  C C     . GLY A 78  ? 0.3172 0.3260 0.3962 0.0076  -0.0304 -0.0280 370 GLY A C     
588  O O     . GLY A 78  ? 0.2845 0.2921 0.3589 0.0050  -0.0261 -0.0237 370 GLY A O     
589  N N     . ASP A 79  ? 0.2963 0.3024 0.3844 0.0077  -0.0352 -0.0295 371 ASP A N     
590  C CA    . ASP A 79  ? 0.2611 0.2629 0.3538 0.0045  -0.0354 -0.0255 371 ASP A CA    
591  C C     . ASP A 79  ? 0.2885 0.2880 0.3797 0.0008  -0.0313 -0.0191 371 ASP A C     
592  O O     . ASP A 79  ? 0.2926 0.2923 0.3842 0.0006  -0.0307 -0.0182 371 ASP A O     
593  C CB    . ASP A 79  ? 0.2653 0.2643 0.3692 0.0050  -0.0417 -0.0275 371 ASP A CB    
594  C CG    . ASP A 79  ? 0.3570 0.3578 0.4632 0.0085  -0.0461 -0.0339 371 ASP A CG    
595  O OD1   . ASP A 79  ? 0.3505 0.3526 0.4522 0.0086  -0.0444 -0.0343 371 ASP A OD1   
596  O OD2   . ASP A 79  ? 0.3553 0.3569 0.4681 0.0113  -0.0514 -0.0388 371 ASP A OD2   
597  N N     . ASP A 80  ? 0.2510 0.2489 0.3406 -0.0019 -0.0286 -0.0150 372 ASP A N     
598  C CA    . ASP A 80  ? 0.2047 0.2014 0.2930 -0.0053 -0.0248 -0.0092 372 ASP A CA    
599  C C     . ASP A 80  ? 0.1959 0.1902 0.2877 -0.0077 -0.0254 -0.0057 372 ASP A C     
600  O O     . ASP A 80  ? 0.2455 0.2400 0.3340 -0.0075 -0.0245 -0.0061 372 ASP A O     
601  C CB    . ASP A 80  ? 0.2552 0.2540 0.3338 -0.0055 -0.0194 -0.0080 372 ASP A CB    
602  C CG    . ASP A 80  ? 0.3115 0.3098 0.3888 -0.0084 -0.0157 -0.0028 372 ASP A CG    
603  O OD1   . ASP A 80  ? 0.2731 0.2700 0.3560 -0.0106 -0.0166 0.0004  372 ASP A OD1   
604  O OD2   . ASP A 80  ? 0.2565 0.2562 0.3272 -0.0085 -0.0118 -0.0019 372 ASP A OD2   
605  N N     . PRO A 81  ? 0.2879 0.2804 0.3869 -0.0101 -0.0270 -0.0021 373 PRO A N     
606  C CA    . PRO A 81  ? 0.3136 0.3043 0.4164 -0.0127 -0.0277 0.0022  373 PRO A CA    
607  C C     . PRO A 81  ? 0.2443 0.2363 0.3397 -0.0144 -0.0225 0.0057  373 PRO A C     
608  O O     . PRO A 81  ? 0.2499 0.2409 0.3462 -0.0156 -0.0229 0.0079  373 PRO A O     
609  C CB    . PRO A 81  ? 0.2819 0.2719 0.3925 -0.0152 -0.0291 0.0062  373 PRO A CB    
610  C CG    . PRO A 81  ? 0.3599 0.3500 0.4735 -0.0130 -0.0317 0.0022  373 PRO A CG    
611  C CD    . PRO A 81  ? 0.2809 0.2733 0.3851 -0.0104 -0.0286 -0.0017 373 PRO A CD    
612  N N     . MET A 82  ? 0.2209 0.2151 0.3097 -0.0144 -0.0180 0.0062  374 MET A N     
613  C CA    . MET A 82  ? 0.2250 0.2207 0.3071 -0.0156 -0.0135 0.0086  374 MET A CA    
614  C C     . MET A 82  ? 0.2356 0.2308 0.3138 -0.0142 -0.0136 0.0060  374 MET A C     
615  O O     . MET A 82  ? 0.2413 0.2366 0.3174 -0.0154 -0.0119 0.0083  374 MET A O     
616  C CB    . MET A 82  ? 0.2276 0.2254 0.3035 -0.0152 -0.0094 0.0086  374 MET A CB    
617  C CG    . MET A 82  ? 0.3497 0.3488 0.4283 -0.0169 -0.0082 0.0116  374 MET A CG    
618  S SD    . MET A 82  ? 0.4450 0.4456 0.5264 -0.0202 -0.0068 0.0175  374 MET A SD    
619  C CE    . MET A 82  ? 0.2606 0.2619 0.3346 -0.0200 -0.0036 0.0176  374 MET A CE    
620  N N     . LEU A 83  ? 0.2122 0.2077 0.2892 -0.0115 -0.0153 0.0011  375 LEU A N     
621  C CA    . LEU A 83  ? 0.2008 0.1970 0.2742 -0.0099 -0.0153 -0.0019 375 LEU A CA    
622  C C     . LEU A 83  ? 0.2642 0.2581 0.3431 -0.0102 -0.0191 -0.0019 375 LEU A C     
623  O O     . LEU A 83  ? 0.2487 0.2426 0.3252 -0.0104 -0.0183 -0.0017 375 LEU A O     
624  C CB    . LEU A 83  ? 0.2252 0.2235 0.2963 -0.0069 -0.0165 -0.0071 375 LEU A CB    
625  C CG    . LEU A 83  ? 0.2745 0.2750 0.3396 -0.0064 -0.0130 -0.0071 375 LEU A CG    
626  C CD1   . LEU A 83  ? 0.2712 0.2747 0.3340 -0.0033 -0.0143 -0.0119 375 LEU A CD1   
627  C CD2   . LEU A 83  ? 0.3121 0.3133 0.3709 -0.0079 -0.0082 -0.0043 375 LEU A CD2   
628  N N     . LEU A 84  ? 0.2143 0.2063 0.3013 -0.0102 -0.0237 -0.0022 376 LEU A N     
629  C CA    . LEU A 84  ? 0.2210 0.2102 0.3146 -0.0108 -0.0279 -0.0014 376 LEU A CA    
630  C C     . LEU A 84  ? 0.2596 0.2479 0.3527 -0.0139 -0.0257 0.0047  376 LEU A C     
631  O O     . LEU A 84  ? 0.2339 0.2211 0.3271 -0.0141 -0.0267 0.0051  376 LEU A O     
632  C CB    . LEU A 84  ? 0.2390 0.2260 0.3424 -0.0107 -0.0332 -0.0019 376 LEU A CB    
633  C CG    . LEU A 84  ? 0.3175 0.3055 0.4228 -0.0072 -0.0365 -0.0084 376 LEU A CG    
634  C CD1   . LEU A 84  ? 0.3050 0.2903 0.4214 -0.0074 -0.0423 -0.0085 376 LEU A CD1   
635  C CD2   . LEU A 84  ? 0.3379 0.3272 0.4410 -0.0042 -0.0383 -0.0140 376 LEU A CD2   
636  N N     . ALA A 85  ? 0.2409 0.2303 0.3336 -0.0162 -0.0228 0.0092  377 ALA A N     
637  C CA    . ALA A 85  ? 0.2694 0.2594 0.3615 -0.0190 -0.0205 0.0151  377 ALA A CA    
638  C C     . ALA A 85  ? 0.2634 0.2549 0.3474 -0.0187 -0.0166 0.0148  377 ALA A C     
639  O O     . ALA A 85  ? 0.2507 0.2420 0.3346 -0.0199 -0.0165 0.0176  377 ALA A O     
640  C CB    . ALA A 85  ? 0.2368 0.2290 0.3295 -0.0211 -0.0179 0.0191  377 ALA A CB    
641  N N     . TYR A 86  ? 0.2156 0.2088 0.2932 -0.0171 -0.0136 0.0115  378 TYR A N     
642  C CA    . TYR A 86  ? 0.2257 0.2205 0.2962 -0.0168 -0.0099 0.0111  378 TYR A CA    
643  C C     . TYR A 86  ? 0.2077 0.2012 0.2782 -0.0155 -0.0121 0.0084  378 TYR A C     
644  O O     . TYR A 86  ? 0.2495 0.2436 0.3167 -0.0160 -0.0103 0.0095  378 TYR A O     
645  C CB    . TYR A 86  ? 0.2366 0.2332 0.3013 -0.0155 -0.0068 0.0084  378 TYR A CB    
646  C CG    . TYR A 86  ? 0.2240 0.2222 0.2820 -0.0154 -0.0029 0.0082  378 TYR A CG    
647  C CD1   . TYR A 86  ? 0.1985 0.1980 0.2543 -0.0170 0.0001  0.0116  378 TYR A CD1   
648  C CD2   . TYR A 86  ? 0.2184 0.2173 0.2727 -0.0137 -0.0024 0.0044  378 TYR A CD2   
649  C CE1   . TYR A 86  ? 0.2295 0.2304 0.2799 -0.0168 0.0033  0.0109  378 TYR A CE1   
650  C CE2   . TYR A 86  ? 0.2743 0.2746 0.3232 -0.0138 0.0010  0.0042  378 TYR A CE2   
651  C CZ    . TYR A 86  ? 0.2940 0.2950 0.3413 -0.0153 0.0036  0.0074  378 TYR A CZ    
652  O OH    . TYR A 86  ? 0.2594 0.2616 0.3021 -0.0153 0.0065  0.0069  378 TYR A OH    
653  N N     . LEU A 87  ? 0.2439 0.2362 0.3182 -0.0137 -0.0161 0.0044  379 LEU A N     
654  C CA    . LEU A 87  ? 0.1927 0.1841 0.2680 -0.0121 -0.0189 0.0012  379 LEU A CA    
655  C C     . LEU A 87  ? 0.2188 0.2075 0.2994 -0.0137 -0.0218 0.0047  379 LEU A C     
656  O O     . LEU A 87  ? 0.2720 0.2604 0.3511 -0.0135 -0.0220 0.0044  379 LEU A O     
657  C CB    . LEU A 87  ? 0.2159 0.2075 0.2944 -0.0093 -0.0228 -0.0045 379 LEU A CB    
658  C CG    . LEU A 87  ? 0.2401 0.2353 0.3122 -0.0074 -0.0199 -0.0084 379 LEU A CG    
659  C CD1   . LEU A 87  ? 0.2838 0.2803 0.3593 -0.0045 -0.0237 -0.0138 379 LEU A CD1   
660  C CD2   . LEU A 87  ? 0.2995 0.2968 0.3660 -0.0068 -0.0173 -0.0100 379 LEU A CD2   
661  N N     . LEU A 88  ? 0.2432 0.2301 0.3300 -0.0154 -0.0242 0.0082  380 LEU A N     
662  C CA    . LEU A 88  ? 0.2699 0.2545 0.3622 -0.0174 -0.0270 0.0128  380 LEU A CA    
663  C C     . LEU A 88  ? 0.3801 0.3666 0.4671 -0.0192 -0.0229 0.0173  380 LEU A C     
664  O O     . LEU A 88  ? 0.3153 0.3006 0.4035 -0.0197 -0.0246 0.0192  380 LEU A O     
665  C CB    . LEU A 88  ? 0.2909 0.2741 0.3909 -0.0193 -0.0297 0.0166  380 LEU A CB    
666  C CG    . LEU A 88  ? 0.3629 0.3430 0.4715 -0.0178 -0.0360 0.0131  380 LEU A CG    
667  C CD1   . LEU A 88  ? 0.3557 0.3353 0.4707 -0.0196 -0.0374 0.0164  380 LEU A CD1   
668  C CD2   . LEU A 88  ? 0.3458 0.3224 0.4604 -0.0178 -0.0413 0.0135  380 LEU A CD2   
669  N N     . ASP A 89  ? 0.2976 0.2872 0.3788 -0.0199 -0.0178 0.0187  381 ASP A N     
670  C CA    . ASP A 89  ? 0.2633 0.2556 0.3396 -0.0213 -0.0139 0.0223  381 ASP A CA    
671  C C     . ASP A 89  ? 0.2793 0.2747 0.3494 -0.0210 -0.0089 0.0213  381 ASP A C     
672  O O     . ASP A 89  ? 0.2844 0.2808 0.3560 -0.0217 -0.0081 0.0226  381 ASP A O     
673  C CB    . ASP A 89  ? 0.2796 0.2726 0.3602 -0.0241 -0.0147 0.0290  381 ASP A CB    
674  C CG    . ASP A 89  ? 0.3479 0.3445 0.4236 -0.0252 -0.0110 0.0328  381 ASP A CG    
675  O OD1   . ASP A 89  ? 0.2958 0.2946 0.3648 -0.0241 -0.0073 0.0303  381 ASP A OD1   
676  O OD2   . ASP A 89  ? 0.3611 0.3589 0.4402 -0.0274 -0.0121 0.0385  381 ASP A OD2   
677  N N     . PRO A 90  ? 0.2436 0.2403 0.3074 -0.0199 -0.0059 0.0189  382 PRO A N     
678  C CA    . PRO A 90  ? 0.2328 0.2318 0.2915 -0.0195 -0.0018 0.0176  382 PRO A CA    
679  C C     . PRO A 90  ? 0.3184 0.3208 0.3758 -0.0211 0.0012  0.0216  382 PRO A C     
680  O O     . PRO A 90  ? 0.2783 0.2824 0.3322 -0.0207 0.0042  0.0207  382 PRO A O     
681  C CB    . PRO A 90  ? 0.2712 0.2707 0.3247 -0.0181 0.0000  0.0143  382 PRO A CB    
682  C CG    . PRO A 90  ? 0.3454 0.3439 0.4004 -0.0183 -0.0020 0.0153  382 PRO A CG    
683  C CD    . PRO A 90  ? 0.2563 0.2522 0.3180 -0.0187 -0.0066 0.0164  382 PRO A CD    
684  N N     . SER A 91  ? 0.2771 0.2805 0.3375 -0.0228 0.0003  0.0262  383 SER A N     
685  C CA    . SER A 91  ? 0.3095 0.3172 0.3696 -0.0242 0.0029  0.0300  383 SER A CA    
686  C C     . SER A 91  ? 0.3378 0.3455 0.4020 -0.0250 0.0021  0.0309  383 SER A C     
687  O O     . SER A 91  ? 0.3313 0.3428 0.3953 -0.0259 0.0043  0.0332  383 SER A O     
688  C CB    . SER A 91  ? 0.3470 0.3570 0.4087 -0.0259 0.0023  0.0351  383 SER A CB    
689  O OG    . SER A 91  ? 0.4667 0.4741 0.5351 -0.0272 -0.0017 0.0379  383 SER A OG    
690  N N     . ASN A 92  ? 0.2743 0.2781 0.3424 -0.0244 -0.0012 0.0287  384 ASN A N     
691  C CA    . ASN A 92  ? 0.2278 0.2312 0.2998 -0.0246 -0.0022 0.0286  384 ASN A CA    
692  C C     . ASN A 92  ? 0.2916 0.2954 0.3590 -0.0229 0.0001  0.0245  384 ASN A C     
693  O O     . ASN A 92  ? 0.3046 0.3060 0.3704 -0.0211 -0.0010 0.0204  384 ASN A O     
694  C CB    . ASN A 92  ? 0.2525 0.2519 0.3309 -0.0243 -0.0072 0.0272  384 ASN A CB    
695  C CG    . ASN A 92  ? 0.3013 0.2999 0.3861 -0.0264 -0.0103 0.0320  384 ASN A CG    
696  O OD1   . ASN A 92  ? 0.3415 0.3433 0.4276 -0.0286 -0.0088 0.0371  384 ASN A OD1   
697  N ND2   . ASN A 92  ? 0.2735 0.2682 0.3626 -0.0257 -0.0147 0.0304  384 ASN A ND2   
698  N N     . THR A 93  ? 0.2748 0.2819 0.3404 -0.0234 0.0031  0.0257  385 THR A N     
699  C CA    . THR A 93  ? 0.2591 0.2665 0.3201 -0.0218 0.0053  0.0223  385 THR A CA    
700  C C     . THR A 93  ? 0.3158 0.3242 0.3786 -0.0218 0.0056  0.0222  385 THR A C     
701  O O     . THR A 93  ? 0.3179 0.3256 0.3777 -0.0204 0.0065  0.0194  385 THR A O     
702  C CB    . THR A 93  ? 0.3613 0.3713 0.4168 -0.0215 0.0088  0.0223  385 THR A CB    
703  O OG1   . THR A 93  ? 0.3198 0.3342 0.3763 -0.0229 0.0105  0.0257  385 THR A OG1   
704  C CG2   . THR A 93  ? 0.3286 0.3372 0.3817 -0.0212 0.0085  0.0216  385 THR A CG2   
705  N N     . THR A 94  ? 0.2710 0.2812 0.3389 -0.0235 0.0048  0.0255  386 THR A N     
706  C CA    . THR A 94  ? 0.2908 0.3025 0.3611 -0.0236 0.0050  0.0254  386 THR A CA    
707  C C     . THR A 94  ? 0.3103 0.3207 0.3881 -0.0247 0.0016  0.0271  386 THR A C     
708  O O     . THR A 94  ? 0.3291 0.3392 0.4110 -0.0263 -0.0002 0.0301  386 THR A O     
709  C CB    . THR A 94  ? 0.3770 0.3942 0.4463 -0.0246 0.0082  0.0279  386 THR A CB    
710  O OG1   . THR A 94  ? 0.3441 0.3644 0.4170 -0.0268 0.0080  0.0326  386 THR A OG1   
711  C CG2   . THR A 94  ? 0.4039 0.4225 0.4666 -0.0234 0.0112  0.0261  386 THR A CG2   
712  N N     . PRO A 95  ? 0.3514 0.3612 0.4317 -0.0240 0.0005  0.0253  387 PRO A N     
713  C CA    . PRO A 95  ? 0.3406 0.3493 0.4290 -0.0251 -0.0030 0.0267  387 PRO A CA    
714  C C     . PRO A 95  ? 0.2992 0.3120 0.3923 -0.0281 -0.0023 0.0323  387 PRO A C     
715  O O     . PRO A 95  ? 0.2906 0.3022 0.3905 -0.0297 -0.0053 0.0351  387 PRO A O     
716  C CB    . PRO A 95  ? 0.3988 0.4073 0.4876 -0.0236 -0.0033 0.0236  387 PRO A CB    
717  C CG    . PRO A 95  ? 0.4103 0.4177 0.4913 -0.0213 -0.0014 0.0198  387 PRO A CG    
718  C CD    . PRO A 95  ? 0.3873 0.3967 0.4633 -0.0220 0.0018  0.0217  387 PRO A CD    
719  N N     . GLU A 96  ? 0.3411 0.3590 0.4309 -0.0287 0.0015  0.0339  388 GLU A N     
720  C CA    . GLU A 96  ? 0.4426 0.4661 0.5357 -0.0313 0.0028  0.0393  388 GLU A CA    
721  C C     . GLU A 96  ? 0.3492 0.3724 0.4435 -0.0329 0.0018  0.0431  388 GLU A C     
722  O O     . GLU A 96  ? 0.3956 0.4198 0.4966 -0.0354 -0.0001 0.0478  388 GLU A O     
723  C CB    . GLU A 96  ? 0.5526 0.5822 0.6406 -0.0309 0.0072  0.0392  388 GLU A CB    
724  C CG    . GLU A 96  ? 0.7073 0.7383 0.7952 -0.0297 0.0082  0.0364  388 GLU A CG    
725  C CD    . GLU A 96  ? 0.7461 0.7734 0.8276 -0.0268 0.0089  0.0311  388 GLU A CD    
726  O OE1   . GLU A 96  ? 0.5447 0.5669 0.6236 -0.0257 0.0076  0.0290  388 GLU A OE1   
727  O OE2   . GLU A 96  ? 0.7838 0.8136 0.8634 -0.0257 0.0107  0.0291  388 GLU A OE2   
728  N N     . GLY A 97  ? 0.3481 0.3698 0.4361 -0.0316 0.0030  0.0413  389 GLY A N     
729  C CA    . GLY A 97  ? 0.3734 0.3948 0.4614 -0.0327 0.0022  0.0444  389 GLY A CA    
730  C C     . GLY A 97  ? 0.3574 0.3729 0.4513 -0.0331 -0.0026 0.0447  389 GLY A C     
731  O O     . GLY A 97  ? 0.3888 0.4046 0.4871 -0.0352 -0.0045 0.0494  389 GLY A O     
732  N N     . VAL A 98  ? 0.2610 0.2717 0.3554 -0.0311 -0.0048 0.0396  390 VAL A N     
733  C CA    . VAL A 98  ? 0.3294 0.3348 0.4297 -0.0308 -0.0099 0.0386  390 VAL A CA    
734  C C     . VAL A 98  ? 0.3978 0.4033 0.5079 -0.0332 -0.0130 0.0425  390 VAL A C     
735  O O     . VAL A 98  ? 0.3155 0.3186 0.4321 -0.0346 -0.0168 0.0453  390 VAL A O     
736  C CB    . VAL A 98  ? 0.2504 0.2520 0.3485 -0.0277 -0.0113 0.0318  390 VAL A CB    
737  C CG1   . VAL A 98  ? 0.2625 0.2595 0.3678 -0.0271 -0.0170 0.0300  390 VAL A CG1   
738  C CG2   . VAL A 98  ? 0.2877 0.2889 0.3774 -0.0258 -0.0089 0.0288  390 VAL A CG2   
739  N N     . ALA A 99  ? 0.3292 0.3376 0.4411 -0.0337 -0.0116 0.0427  391 ALA A N     
740  C CA    . ALA A 99  ? 0.3442 0.3536 0.4658 -0.0362 -0.0142 0.0467  391 ALA A CA    
741  C C     . ALA A 99  ? 0.3913 0.4048 0.5157 -0.0397 -0.0133 0.0543  391 ALA A C     
742  O O     . ALA A 99  ? 0.3967 0.4086 0.5268 -0.0406 -0.0169 0.0573  391 ALA A O     
743  C CB    . ALA A 99  ? 0.3806 0.3931 0.5027 -0.0360 -0.0123 0.0454  391 ALA A CB    
744  N N     . ARG A 100 ? 0.3813 0.4004 0.4987 -0.0399 -0.0086 0.0562  392 ARG A N     
745  C CA    . ARG A 100 ? 0.3950 0.4192 0.5115 -0.0418 -0.0072 0.0622  392 ARG A CA    
746  C C     . ARG A 100 ? 0.4156 0.4356 0.5335 -0.0421 -0.0106 0.0643  392 ARG A C     
747  O O     . ARG A 100 ? 0.4637 0.4849 0.5852 -0.0435 -0.0126 0.0690  392 ARG A O     
748  C CB    . ARG A 100 ? 0.5445 0.5755 0.6534 -0.0416 -0.0018 0.0627  392 ARG A CB    
749  C CG    . ARG A 100 ? 0.7341 0.7719 0.8409 -0.0430 0.0000  0.0682  392 ARG A CG    
750  C CD    . ARG A 100 ? 0.8421 0.8884 0.9446 -0.0428 0.0048  0.0681  392 ARG A CD    
751  N NE    . ARG A 100 ? 0.9024 0.9485 1.0006 -0.0410 0.0075  0.0631  392 ARG A NE    
752  C CZ    . ARG A 100 ? 0.9173 0.9657 1.0149 -0.0399 0.0093  0.0598  392 ARG A CZ    
753  N NH1   . ARG A 100 ? 0.8565 0.9085 0.9591 -0.0412 0.0091  0.0618  392 ARG A NH1   
754  N NH2   . ARG A 100 ? 0.9682 1.0145 1.0591 -0.0369 0.0110  0.0540  392 ARG A NH2   
755  N N     . ARG A 101 ? 0.4208 0.4361 0.5363 -0.0408 -0.0114 0.0608  393 ARG A N     
756  C CA    . ARG A 101 ? 0.3807 0.3919 0.4975 -0.0408 -0.0147 0.0620  393 ARG A CA    
757  C C     . ARG A 101 ? 0.4491 0.4542 0.5743 -0.0405 -0.0210 0.0613  393 ARG A C     
758  O O     . ARG A 101 ? 0.4384 0.4422 0.5669 -0.0413 -0.0241 0.0649  393 ARG A O     
759  C CB    . ARG A 101 ? 0.3328 0.3413 0.4421 -0.0382 -0.0133 0.0568  393 ARG A CB    
760  C CG    . ARG A 101 ? 0.3579 0.3617 0.4689 -0.0380 -0.0171 0.0572  393 ARG A CG    
761  C CD    . ARG A 101 ? 0.3885 0.3920 0.4905 -0.0355 -0.0147 0.0530  393 ARG A CD    
762  N NE    . ARG A 101 ? 0.4764 0.4759 0.5803 -0.0353 -0.0183 0.0535  393 ARG A NE    
763  C CZ    . ARG A 101 ? 0.5007 0.4988 0.5987 -0.0332 -0.0176 0.0498  393 ARG A CZ    
764  N NH1   . ARG A 101 ? 0.4687 0.4689 0.5587 -0.0312 -0.0133 0.0456  393 ARG A NH1   
765  N NH2   . ARG A 101 ? 0.4973 0.4919 0.5981 -0.0331 -0.0214 0.0504  393 ARG A NH2   
766  N N     . TYR A 102 ? 0.3682 0.3698 0.4972 -0.0392 -0.0231 0.0564  394 TYR A N     
767  C CA    . TYR A 102 ? 0.3461 0.3417 0.4827 -0.0381 -0.0294 0.0541  394 TYR A CA    
768  C C     . TYR A 102 ? 0.4058 0.4018 0.5498 -0.0386 -0.0320 0.0554  394 TYR A C     
769  O O     . TYR A 102 ? 0.4561 0.4479 0.6074 -0.0377 -0.0376 0.0544  394 TYR A O     
770  C CB    . TYR A 102 ? 0.2902 0.2812 0.4258 -0.0354 -0.0310 0.0464  394 TYR A CB    
771  C CG    . TYR A 102 ? 0.3414 0.3316 0.4688 -0.0336 -0.0293 0.0439  394 TYR A CG    
772  C CD1   . TYR A 102 ? 0.2817 0.2682 0.4123 -0.0335 -0.0334 0.0444  394 TYR A CD1   
773  C CD2   . TYR A 102 ? 0.2991 0.2923 0.4161 -0.0319 -0.0240 0.0410  394 TYR A CD2   
774  C CE1   . TYR A 102 ? 0.3486 0.3346 0.4721 -0.0318 -0.0319 0.0419  394 TYR A CE1   
775  C CE2   . TYR A 102 ? 0.2987 0.2913 0.4088 -0.0303 -0.0225 0.0387  394 TYR A CE2   
776  C CZ    . TYR A 102 ? 0.2994 0.2886 0.4127 -0.0302 -0.0264 0.0391  394 TYR A CZ    
777  O OH    . TYR A 102 ? 0.3019 0.2907 0.4086 -0.0286 -0.0250 0.0366  394 TYR A OH    
778  N N     . GLY A 103 ? 0.3847 0.3857 0.5271 -0.0398 -0.0283 0.0574  395 GLY A N     
779  C CA    . GLY A 103 ? 0.3968 0.3986 0.5462 -0.0403 -0.0304 0.0588  395 GLY A CA    
780  C C     . GLY A 103 ? 0.4301 0.4331 0.5792 -0.0396 -0.0286 0.0548  395 GLY A C     
781  O O     . GLY A 103 ? 0.5092 0.5096 0.6560 -0.0377 -0.0284 0.0492  395 GLY A O     
782  N N     . GLY A 104 ? 0.4533 0.4605 0.6049 -0.0410 -0.0272 0.0579  396 GLY A N     
783  C CA    . GLY A 104 ? 0.3773 0.3862 0.5294 -0.0403 -0.0257 0.0546  396 GLY A CA    
784  C C     . GLY A 104 ? 0.3945 0.4099 0.5395 -0.0412 -0.0194 0.0558  396 GLY A C     
785  O O     . GLY A 104 ? 0.4252 0.4445 0.5650 -0.0423 -0.0163 0.0595  396 GLY A O     
786  N N     . GLU A 105 ? 0.3937 0.4107 0.5387 -0.0405 -0.0179 0.0525  397 GLU A N     
787  C CA    . GLU A 105 ? 0.4200 0.4434 0.5592 -0.0409 -0.0124 0.0531  397 GLU A CA    
788  C C     . GLU A 105 ? 0.3585 0.3802 0.4945 -0.0384 -0.0115 0.0468  397 GLU A C     
789  O O     . GLU A 105 ? 0.3639 0.3825 0.5044 -0.0371 -0.0145 0.0433  397 GLU A O     
790  C CB    . GLU A 105 ? 0.4150 0.4446 0.5571 -0.0427 -0.0109 0.0569  397 GLU A CB    
791  C CG    . GLU A 105 ? 0.4391 0.4767 0.5751 -0.0431 -0.0054 0.0579  397 GLU A CG    
792  C CD    . GLU A 105 ? 0.5921 0.6362 0.7316 -0.0444 -0.0040 0.0603  397 GLU A CD    
793  O OE1   . GLU A 105 ? 0.6185 0.6608 0.7650 -0.0453 -0.0073 0.0617  397 GLU A OE1   
794  O OE2   . GLU A 105 ? 0.7553 0.8066 0.8906 -0.0445 0.0002  0.0605  397 GLU A OE2   
795  N N     . TRP A 106 ? 0.3722 0.3954 0.4983 -0.0366 -0.0076 0.0446  398 TRP A N     
796  C CA    . TRP A 106 ? 0.3870 0.4089 0.5068 -0.0334 -0.0062 0.0387  398 TRP A CA    
797  C C     . TRP A 106 ? 0.3633 0.3909 0.4838 -0.0339 -0.0036 0.0392  398 TRP A C     
798  O O     . TRP A 106 ? 0.4049 0.4385 0.5223 -0.0348 0.0001  0.0415  398 TRP A O     
799  C CB    . TRP A 106 ? 0.3449 0.3660 0.4548 -0.0316 -0.0033 0.0367  398 TRP A CB    
800  C CG    . TRP A 106 ? 0.3394 0.3593 0.4425 -0.0286 -0.0017 0.0314  398 TRP A CG    
801  C CD1   . TRP A 106 ? 0.3654 0.3889 0.4626 -0.0278 0.0021  0.0306  398 TRP A CD1   
802  C CD2   . TRP A 106 ? 0.3352 0.3501 0.4369 -0.0259 -0.0040 0.0264  398 TRP A CD2   
803  N NE1   . TRP A 106 ? 0.3769 0.3974 0.4694 -0.0251 0.0021  0.0259  398 TRP A NE1   
804  C CE2   . TRP A 106 ? 0.3633 0.3788 0.4580 -0.0239 -0.0014 0.0234  398 TRP A CE2   
805  C CE3   . TRP A 106 ? 0.3239 0.3342 0.4295 -0.0249 -0.0083 0.0241  398 TRP A CE3   
806  C CZ2   . TRP A 106 ? 0.3115 0.3235 0.4029 -0.0212 -0.0026 0.0189  398 TRP A CZ2   
807  C CZ3   . TRP A 106 ? 0.3298 0.3373 0.4320 -0.0219 -0.0094 0.0190  398 TRP A CZ3   
808  C CH2   . TRP A 106 ? 0.2989 0.3074 0.3937 -0.0202 -0.0064 0.0168  398 TRP A CH2   
809  N N     . THR A 107 ? 0.3380 0.3642 0.4632 -0.0331 -0.0058 0.0367  399 THR A N     
810  C CA    . THR A 107 ? 0.3401 0.3716 0.4671 -0.0334 -0.0039 0.0367  399 THR A CA    
811  C C     . THR A 107 ? 0.3911 0.4206 0.5121 -0.0300 -0.0031 0.0308  399 THR A C     
812  O O     . THR A 107 ? 0.3768 0.4017 0.4914 -0.0276 -0.0034 0.0275  399 THR A O     
813  C CB    . THR A 107 ? 0.3497 0.3817 0.4875 -0.0353 -0.0071 0.0385  399 THR A CB    
814  O OG1   . THR A 107 ? 0.3752 0.4007 0.5154 -0.0330 -0.0112 0.0339  399 THR A OG1   
815  C CG2   . THR A 107 ? 0.3324 0.3656 0.4772 -0.0390 -0.0086 0.0449  399 THR A CG2   
816  N N     . GLU A 108 ? 0.3281 0.3612 0.4511 -0.0297 -0.0023 0.0298  400 GLU A N     
817  C CA    . GLU A 108 ? 0.3231 0.3545 0.4410 -0.0265 -0.0019 0.0247  400 GLU A CA    
818  C C     . GLU A 108 ? 0.3136 0.3417 0.4365 -0.0252 -0.0055 0.0216  400 GLU A C     
819  O O     . GLU A 108 ? 0.3985 0.4268 0.5193 -0.0231 -0.0053 0.0183  400 GLU A O     
820  C CB    . GLU A 108 ? 0.3771 0.4148 0.4926 -0.0264 0.0017  0.0247  400 GLU A CB    
821  C CG    . GLU A 108 ? 0.5047 0.5467 0.6155 -0.0274 0.0052  0.0272  400 GLU A CG    
822  C CD    . GLU A 108 ? 0.5875 0.6250 0.6897 -0.0252 0.0061  0.0246  400 GLU A CD    
823  O OE1   . GLU A 108 ? 0.5804 0.6167 0.6781 -0.0228 0.0067  0.0209  400 GLU A OE1   
824  O OE2   . GLU A 108 ? 0.6089 0.6442 0.7092 -0.0260 0.0060  0.0263  400 GLU A OE2   
825  N N     . GLU A 109 ? 0.2835 0.3087 0.4133 -0.0262 -0.0092 0.0225  401 GLU A N     
826  C CA    . GLU A 109 ? 0.2933 0.3156 0.4286 -0.0247 -0.0132 0.0191  401 GLU A CA    
827  C C     . GLU A 109 ? 0.3457 0.3620 0.4791 -0.0224 -0.0164 0.0157  401 GLU A C     
828  O O     . GLU A 109 ? 0.3194 0.3336 0.4538 -0.0235 -0.0175 0.0175  401 GLU A O     
829  C CB    . GLU A 109 ? 0.3390 0.3637 0.4859 -0.0276 -0.0154 0.0225  401 GLU A CB    
830  C CG    . GLU A 109 ? 0.4916 0.5155 0.6448 -0.0263 -0.0187 0.0191  401 GLU A CG    
831  C CD    . GLU A 109 ? 0.5301 0.5481 0.6874 -0.0244 -0.0240 0.0156  401 GLU A CD    
832  O OE1   . GLU A 109 ? 0.4769 0.4931 0.6404 -0.0263 -0.0265 0.0181  401 GLU A OE1   
833  O OE2   . GLU A 109 ? 0.5083 0.5240 0.6631 -0.0210 -0.0258 0.0103  401 GLU A OE2   
834  N N     . ALA A 110 ? 0.2518 0.2657 0.3825 -0.0191 -0.0181 0.0107  402 ALA A N     
835  C CA    . ALA A 110 ? 0.2382 0.2477 0.3659 -0.0163 -0.0209 0.0069  402 ALA A CA    
836  C C     . ALA A 110 ? 0.2351 0.2422 0.3719 -0.0170 -0.0256 0.0067  402 ALA A C     
837  O O     . ALA A 110 ? 0.2403 0.2447 0.3755 -0.0161 -0.0272 0.0056  402 ALA A O     
838  C CB    . ALA A 110 ? 0.2715 0.2802 0.3952 -0.0127 -0.0219 0.0019  402 ALA A CB    
839  N N     . GLY A 111 ? 0.2641 0.2722 0.4108 -0.0184 -0.0282 0.0076  403 GLY A N     
840  C CA    . GLY A 111 ? 0.2844 0.2898 0.4410 -0.0189 -0.0335 0.0073  403 GLY A CA    
841  C C     . GLY A 111 ? 0.3206 0.3253 0.4796 -0.0220 -0.0332 0.0122  403 GLY A C     
842  O O     . GLY A 111 ? 0.3211 0.3224 0.4828 -0.0212 -0.0368 0.0107  403 GLY A O     
843  N N     . GLU A 112 ? 0.2769 0.2854 0.4349 -0.0253 -0.0291 0.0178  404 GLU A N     
844  C CA    . GLU A 112 ? 0.2614 0.2701 0.4207 -0.0283 -0.0283 0.0231  404 GLU A CA    
845  C C     . GLU A 112 ? 0.3537 0.3599 0.5037 -0.0266 -0.0269 0.0215  404 GLU A C     
846  O O     . GLU A 112 ? 0.3039 0.3077 0.4562 -0.0276 -0.0289 0.0233  404 GLU A O     
847  C CB    . GLU A 112 ? 0.3642 0.3790 0.5234 -0.0318 -0.0239 0.0291  404 GLU A CB    
848  C CG    . GLU A 112 ? 0.4092 0.4270 0.5798 -0.0346 -0.0256 0.0324  404 GLU A CG    
849  C CD    . GLU A 112 ? 0.4815 0.5068 0.6509 -0.0374 -0.0208 0.0375  404 GLU A CD    
850  O OE1   . GLU A 112 ? 0.3921 0.4204 0.5526 -0.0369 -0.0163 0.0378  404 GLU A OE1   
851  O OE2   . GLU A 112 ? 0.5697 0.5977 0.7444 -0.0389 -0.0214 0.0406  404 GLU A OE2   
852  N N     . ARG A 113 ? 0.2700 0.2768 0.4099 -0.0240 -0.0237 0.0182  405 ARG A N     
853  C CA    . ARG A 113 ? 0.2341 0.2385 0.3656 -0.0221 -0.0226 0.0161  405 ARG A CA    
854  C C     . ARG A 113 ? 0.2656 0.2660 0.3992 -0.0194 -0.0274 0.0113  405 ARG A C     
855  O O     . ARG A 113 ? 0.2800 0.2784 0.4113 -0.0190 -0.0280 0.0110  405 ARG A O     
856  C CB    . ARG A 113 ? 0.2391 0.2451 0.3601 -0.0202 -0.0184 0.0139  405 ARG A CB    
857  C CG    . ARG A 113 ? 0.2585 0.2687 0.3763 -0.0224 -0.0137 0.0180  405 ARG A CG    
858  C CD    . ARG A 113 ? 0.2255 0.2367 0.3344 -0.0202 -0.0104 0.0154  405 ARG A CD    
859  N NE    . ARG A 113 ? 0.2574 0.2729 0.3633 -0.0219 -0.0062 0.0185  405 ARG A NE    
860  C CZ    . ARG A 113 ? 0.2788 0.2953 0.3775 -0.0205 -0.0032 0.0171  405 ARG A CZ    
861  N NH1   . ARG A 113 ? 0.2371 0.2507 0.3308 -0.0178 -0.0038 0.0132  405 ARG A NH1   
862  N NH2   . ARG A 113 ? 0.2709 0.2919 0.3679 -0.0219 0.0001  0.0195  405 ARG A NH2   
863  N N     . ALA A 114 ? 0.2557 0.2552 0.3938 -0.0174 -0.0308 0.0074  406 ALA A N     
864  C CA    . ALA A 114 ? 0.2080 0.2046 0.3486 -0.0144 -0.0357 0.0022  406 ALA A CA    
865  C C     . ALA A 114 ? 0.2778 0.2719 0.4281 -0.0162 -0.0400 0.0042  406 ALA A C     
866  O O     . ALA A 114 ? 0.2773 0.2691 0.4271 -0.0147 -0.0425 0.0016  406 ALA A O     
867  C CB    . ALA A 114 ? 0.2479 0.2447 0.3919 -0.0117 -0.0388 -0.0026 406 ALA A CB    
868  N N     . ALA A 115 ? 0.2968 0.2915 0.4560 -0.0196 -0.0410 0.0088  407 ALA A N     
869  C CA    . ALA A 115 ? 0.3324 0.3247 0.5022 -0.0220 -0.0453 0.0120  407 ALA A CA    
870  C C     . ALA A 115 ? 0.3421 0.3336 0.5076 -0.0238 -0.0433 0.0158  407 ALA A C     
871  O O     . ALA A 115 ? 0.2958 0.2840 0.4658 -0.0235 -0.0473 0.0152  407 ALA A O     
872  C CB    . ALA A 115 ? 0.3148 0.3089 0.4941 -0.0258 -0.0457 0.0172  407 ALA A CB    
873  N N     . LEU A 116 ? 0.2825 0.2774 0.4399 -0.0254 -0.0373 0.0195  408 LEU A N     
874  C CA    . LEU A 116 ? 0.3067 0.3017 0.4587 -0.0268 -0.0347 0.0229  408 LEU A CA    
875  C C     . LEU A 116 ? 0.3571 0.3493 0.5026 -0.0234 -0.0355 0.0177  408 LEU A C     
876  O O     . LEU A 116 ? 0.2914 0.2815 0.4380 -0.0240 -0.0372 0.0189  408 LEU A O     
877  C CB    . LEU A 116 ? 0.3053 0.3049 0.4493 -0.0283 -0.0282 0.0265  408 LEU A CB    
878  C CG    . LEU A 116 ? 0.3141 0.3147 0.4517 -0.0295 -0.0250 0.0297  408 LEU A CG    
879  C CD1   . LEU A 116 ? 0.3234 0.3235 0.4688 -0.0329 -0.0273 0.0358  408 LEU A CD1   
880  C CD2   . LEU A 116 ? 0.3337 0.3392 0.4633 -0.0301 -0.0189 0.0316  408 LEU A CD2   
881  N N     . SER A 117 ? 0.3304 0.3231 0.4692 -0.0201 -0.0344 0.0123  409 SER A N     
882  C CA    . SER A 117 ? 0.3025 0.2938 0.4356 -0.0167 -0.0352 0.0071  409 SER A CA    
883  C C     . SER A 117 ? 0.2980 0.2860 0.4391 -0.0154 -0.0416 0.0040  409 SER A C     
884  O O     . SER A 117 ? 0.2869 0.2735 0.4264 -0.0147 -0.0426 0.0030  409 SER A O     
885  C CB    . SER A 117 ? 0.2410 0.2338 0.3675 -0.0134 -0.0339 0.0019  409 SER A CB    
886  O OG    . SER A 117 ? 0.2582 0.2535 0.3765 -0.0143 -0.0282 0.0043  409 SER A OG    
887  N N     . GLU A 118 ? 0.3267 0.3137 0.4771 -0.0149 -0.0462 0.0022  410 GLU A N     
888  C CA    . GLU A 118 ? 0.3169 0.3007 0.4767 -0.0134 -0.0532 -0.0012 410 GLU A CA    
889  C C     . GLU A 118 ? 0.3628 0.3440 0.5286 -0.0166 -0.0551 0.0039  410 GLU A C     
890  O O     . GLU A 118 ? 0.3173 0.2962 0.4849 -0.0151 -0.0586 0.0013  410 GLU A O     
891  C CB    . GLU A 118 ? 0.3171 0.3003 0.4870 -0.0128 -0.0577 -0.0033 410 GLU A CB    
892  C CG    . GLU A 118 ? 0.3584 0.3382 0.5397 -0.0112 -0.0657 -0.0071 410 GLU A CG    
893  C CD    . GLU A 118 ? 0.4639 0.4434 0.6534 -0.0094 -0.0698 -0.0100 410 GLU A CD    
894  O OE1   . GLU A 118 ? 0.4121 0.3928 0.6036 -0.0118 -0.0677 -0.0059 410 GLU A OE1   
895  O OE2   . GLU A 118 ? 0.5186 0.4970 0.7115 -0.0051 -0.0749 -0.0166 410 GLU A OE2   
896  N N     . ARG A 119 ? 0.2854 0.2674 0.4539 -0.0208 -0.0527 0.0113  411 ARG A N     
897  C CA    . ARG A 119 ? 0.3628 0.3433 0.5360 -0.0236 -0.0540 0.0174  411 ARG A CA    
898  C C     . ARG A 119 ? 0.4307 0.4108 0.5968 -0.0242 -0.0515 0.0186  411 ARG A C     
899  O O     . ARG A 119 ? 0.3409 0.3184 0.5097 -0.0240 -0.0546 0.0193  411 ARG A O     
900  C CB    . ARG A 119 ? 0.3715 0.3552 0.5458 -0.0270 -0.0508 0.0250  411 ARG A CB    
901  C CG    . ARG A 119 ? 0.6592 0.6431 0.8344 -0.0294 -0.0505 0.0321  411 ARG A CG    
902  C CD    . ARG A 119 ? 0.9549 0.9407 1.1365 -0.0314 -0.0513 0.0377  411 ARG A CD    
903  N NE    . ARG A 119 ? 1.1884 1.1709 1.3796 -0.0292 -0.0578 0.0347  411 ARG A NE    
904  C CZ    . ARG A 119 ? 1.3239 1.3036 1.5219 -0.0288 -0.0628 0.0365  411 ARG A CZ    
905  N NH1   . ARG A 119 ? 1.3678 1.3476 1.5638 -0.0305 -0.0622 0.0413  411 ARG A NH1   
906  N NH2   . ARG A 119 ? 1.3460 1.3229 1.5531 -0.0264 -0.0687 0.0334  411 ARG A NH2   
907  N N     . LEU A 120 ? 0.3583 0.3418 0.5127 -0.0236 -0.0451 0.0184  412 LEU A N     
908  C CA    . LEU A 120 ? 0.3051 0.2889 0.4510 -0.0234 -0.0420 0.0189  412 LEU A CA    
909  C C     . LEU A 120 ? 0.2592 0.2409 0.4027 -0.0196 -0.0448 0.0121  412 LEU A C     
910  O O     . LEU A 120 ? 0.2982 0.2786 0.4402 -0.0196 -0.0454 0.0126  412 LEU A O     
911  C CB    . LEU A 120 ? 0.3521 0.3399 0.4869 -0.0236 -0.0349 0.0201  412 LEU A CB    
912  C CG    . LEU A 120 ? 0.3469 0.3381 0.4820 -0.0274 -0.0312 0.0274  412 LEU A CG    
913  C CD1   . LEU A 120 ? 0.3410 0.3361 0.4661 -0.0269 -0.0250 0.0270  412 LEU A CD1   
914  C CD2   . LEU A 120 ? 0.4016 0.3924 0.5382 -0.0300 -0.0314 0.0328  412 LEU A CD2   
915  N N     . PHE A 121 ? 0.2533 0.2354 0.3964 -0.0162 -0.0466 0.0056  413 PHE A N     
916  C CA    . PHE A 121 ? 0.2559 0.2373 0.3970 -0.0123 -0.0493 -0.0011 413 PHE A CA    
917  C C     . PHE A 121 ? 0.3193 0.2969 0.4706 -0.0124 -0.0560 -0.0017 413 PHE A C     
918  O O     . PHE A 121 ? 0.3056 0.2823 0.4550 -0.0112 -0.0571 -0.0035 413 PHE A O     
919  C CB    . PHE A 121 ? 0.2999 0.2832 0.4398 -0.0085 -0.0507 -0.0079 413 PHE A CB    
920  C CG    . PHE A 121 ? 0.3290 0.3132 0.4664 -0.0044 -0.0533 -0.0150 413 PHE A CG    
921  C CD1   . PHE A 121 ? 0.3558 0.3431 0.4823 -0.0028 -0.0488 -0.0169 413 PHE A CD1   
922  C CD2   . PHE A 121 ? 0.4291 0.4116 0.5759 -0.0020 -0.0604 -0.0199 413 PHE A CD2   
923  C CE1   . PHE A 121 ? 0.3944 0.3836 0.5186 0.0009  -0.0509 -0.0233 413 PHE A CE1   
924  C CE2   . PHE A 121 ? 0.4735 0.4579 0.6180 0.0021  -0.0628 -0.0269 413 PHE A CE2   
925  C CZ    . PHE A 121 ? 0.3416 0.3297 0.4746 0.0035  -0.0578 -0.0285 413 PHE A CZ    
926  N N     . ALA A 122 ? 0.3377 0.3130 0.5003 -0.0138 -0.0606 0.0001  414 ALA A N     
927  C CA    . ALA A 122 ? 0.3265 0.2978 0.5000 -0.0137 -0.0677 -0.0004 414 ALA A CA    
928  C C     . ALA A 122 ? 0.3581 0.3280 0.5301 -0.0163 -0.0664 0.0059  414 ALA A C     
929  O O     . ALA A 122 ? 0.3582 0.3260 0.5318 -0.0145 -0.0699 0.0036  414 ALA A O     
930  C CB    . ALA A 122 ? 0.3058 0.2762 0.4881 -0.0134 -0.0711 0.0016  414 ALA A CB    
931  N N     . ASN A 123 ? 0.2698 0.2414 0.4387 -0.0202 -0.0614 0.0135  415 ASN A N     
932  C CA    . ASN A 123 ? 0.3300 0.3014 0.4968 -0.0228 -0.0596 0.0200  415 ASN A CA    
933  C C     . ASN A 123 ? 0.3523 0.3233 0.5118 -0.0217 -0.0579 0.0168  415 ASN A C     
934  O O     . ASN A 123 ? 0.3057 0.2740 0.4676 -0.0213 -0.0612 0.0167  415 ASN A O     
935  C CB    . ASN A 123 ? 0.3507 0.3258 0.5138 -0.0266 -0.0539 0.0275  415 ASN A CB    
936  C CG    . ASN A 123 ? 0.4328 0.4089 0.5937 -0.0292 -0.0520 0.0346  415 ASN A CG    
937  O OD1   . ASN A 123 ? 0.4974 0.4714 0.6569 -0.0285 -0.0535 0.0338  415 ASN A OD1   
938  N ND2   . ASN A 123 ? 0.5454 0.5253 0.7058 -0.0320 -0.0488 0.0414  415 ASN A ND2   
939  N N     . LEU A 124 ? 0.2740 0.2486 0.4224 -0.0201 -0.0521 0.0141  416 LEU A N     
940  C CA    . LEU A 124 ? 0.2868 0.2626 0.4258 -0.0184 -0.0490 0.0116  416 LEU A CA    
941  C C     . LEU A 124 ? 0.2815 0.2559 0.4218 -0.0144 -0.0535 0.0038  416 LEU A C     
942  O O     . LEU A 124 ? 0.2733 0.2471 0.4109 -0.0136 -0.0538 0.0027  416 LEU A O     
943  C CB    . LEU A 124 ? 0.2050 0.1850 0.3329 -0.0179 -0.0420 0.0110  416 LEU A CB    
944  C CG    . LEU A 124 ? 0.3433 0.3256 0.4693 -0.0215 -0.0374 0.0181  416 LEU A CG    
945  C CD1   . LEU A 124 ? 0.3320 0.3179 0.4483 -0.0207 -0.0314 0.0169  416 LEU A CD1   
946  C CD2   . LEU A 124 ? 0.3866 0.3687 0.5115 -0.0239 -0.0363 0.0236  416 LEU A CD2   
947  N N     . TRP A 125 ? 0.2975 0.2720 0.4420 -0.0117 -0.0570 -0.0018 417 TRP A N     
948  C CA    . TRP A 125 ? 0.2977 0.2719 0.4442 -0.0075 -0.0616 -0.0097 417 TRP A CA    
949  C C     . TRP A 125 ? 0.3257 0.2955 0.4815 -0.0081 -0.0679 -0.0089 417 TRP A C     
950  O O     . TRP A 125 ? 0.3479 0.3176 0.5024 -0.0058 -0.0698 -0.0130 417 TRP A O     
951  C CB    . TRP A 125 ? 0.3361 0.3115 0.4872 -0.0045 -0.0652 -0.0157 417 TRP A CB    
952  C CG    . TRP A 125 ? 0.3307 0.3079 0.4817 0.0003  -0.0689 -0.0245 417 TRP A CG    
953  C CD1   . TRP A 125 ? 0.3389 0.3140 0.5002 0.0029  -0.0768 -0.0297 417 TRP A CD1   
954  C CD2   . TRP A 125 ? 0.3614 0.3435 0.5020 0.0032  -0.0651 -0.0293 417 TRP A CD2   
955  N NE1   . TRP A 125 ? 0.3665 0.3456 0.5240 0.0075  -0.0780 -0.0379 417 TRP A NE1   
956  C CE2   . TRP A 125 ? 0.3803 0.3639 0.5251 0.0076  -0.0707 -0.0374 417 TRP A CE2   
957  C CE3   . TRP A 125 ? 0.3272 0.3129 0.4559 0.0025  -0.0578 -0.0274 417 TRP A CE3   
958  C CZ2   . TRP A 125 ? 0.3161 0.3054 0.4531 0.0112  -0.0688 -0.0434 417 TRP A CZ2   
959  C CZ3   . TRP A 125 ? 0.3124 0.3028 0.4338 0.0058  -0.0560 -0.0329 417 TRP A CZ3   
960  C CH2   . TRP A 125 ? 0.3471 0.3398 0.4724 0.0100  -0.0613 -0.0407 417 TRP A CH2   
961  N N     . GLY A 126 ? 0.3394 0.3059 0.5047 -0.0112 -0.0710 -0.0032 418 GLY A N     
962  C CA    . GLY A 126 ? 0.3714 0.3345 0.5437 -0.0113 -0.0760 -0.0005 418 GLY A CA    
963  C C     . GLY A 126 ? 0.3672 0.3294 0.5348 -0.0134 -0.0736 0.0034  418 GLY A C     
964  O O     . GLY A 126 ? 0.3381 0.2985 0.5082 -0.0116 -0.0775 0.0014  418 GLY A O     
965  N N     . ARG A 127 ? 0.3257 0.2900 0.4858 -0.0167 -0.0670 0.0088  419 ARG A N     
966  C CA    . ARG A 127 ? 0.3138 0.2785 0.4679 -0.0182 -0.0639 0.0128  419 ARG A CA    
967  C C     . ARG A 127 ? 0.4074 0.3736 0.5541 -0.0146 -0.0628 0.0059  419 ARG A C     
968  O O     . ARG A 127 ? 0.3590 0.3243 0.5034 -0.0148 -0.0628 0.0071  419 ARG A O     
969  C CB    . ARG A 127 ? 0.3456 0.3138 0.4920 -0.0214 -0.0565 0.0194  419 ARG A CB    
970  C CG    . ARG A 127 ? 0.3111 0.2788 0.4646 -0.0256 -0.0573 0.0277  419 ARG A CG    
971  C CD    . ARG A 127 ? 0.3166 0.2892 0.4623 -0.0280 -0.0500 0.0329  419 ARG A CD    
972  N NE    . ARG A 127 ? 0.4070 0.3814 0.5574 -0.0309 -0.0500 0.0403  419 ARG A NE    
973  C CZ    . ARG A 127 ? 0.4663 0.4424 0.6162 -0.0331 -0.0492 0.0472  419 ARG A CZ    
974  N NH1   . ARG A 127 ? 0.4648 0.4399 0.6111 -0.0332 -0.0489 0.0480  419 ARG A NH1   
975  N NH2   . ARG A 127 ? 0.4459 0.4251 0.5991 -0.0351 -0.0489 0.0533  419 ARG A NH2   
976  N N     . LEU A 128 ? 0.3120 0.2808 0.4552 -0.0112 -0.0620 -0.0012 420 LEU A N     
977  C CA    . LEU A 128 ? 0.3310 0.3024 0.4672 -0.0078 -0.0606 -0.0077 420 LEU A CA    
978  C C     . LEU A 128 ? 0.3399 0.3098 0.4831 -0.0042 -0.0678 -0.0149 420 LEU A C     
979  O O     . LEU A 128 ? 0.3324 0.3051 0.4707 -0.0013 -0.0672 -0.0205 420 LEU A O     
980  C CB    . LEU A 128 ? 0.3522 0.3284 0.4796 -0.0061 -0.0554 -0.0111 420 LEU A CB    
981  C CG    . LEU A 128 ? 0.3336 0.3123 0.4514 -0.0086 -0.0477 -0.0061 420 LEU A CG    
982  C CD1   . LEU A 128 ? 0.3158 0.2981 0.4279 -0.0073 -0.0440 -0.0088 420 LEU A CD1   
983  C CD2   . LEU A 128 ? 0.2772 0.2572 0.3879 -0.0082 -0.0447 -0.0067 420 LEU A CD2   
984  N N     . GLU A 129 ? 0.3582 0.3241 0.5132 -0.0044 -0.0747 -0.0148 421 GLU A N     
985  C CA    . GLU A 129 ? 0.3966 0.3610 0.5595 -0.0007 -0.0823 -0.0221 421 GLU A CA    
986  C C     . GLU A 129 ? 0.3806 0.3445 0.5414 0.0003  -0.0833 -0.0237 421 GLU A C     
987  O O     . GLU A 129 ? 0.3543 0.3153 0.5150 -0.0027 -0.0824 -0.0171 421 GLU A O     
988  C CB    . GLU A 129 ? 0.4883 0.4492 0.6617 -0.0001 -0.0879 -0.0190 421 GLU A CB    
989  C CG    . GLU A 129 ? 0.7725 0.7345 0.9492 0.0007  -0.0884 -0.0203 421 GLU A CG    
990  C CD    . GLU A 129 ? 0.9357 0.8949 1.1236 0.0018  -0.0944 -0.0179 421 GLU A CD    
991  O OE1   . GLU A 129 ? 0.9615 0.9183 1.1548 0.0025  -0.0988 -0.0162 421 GLU A OE1   
992  O OE2   . GLU A 129 ? 0.9735 0.9331 1.1649 0.0019  -0.0949 -0.0176 421 GLU A OE2   
993  N N     . GLY A 130 ? 0.3906 0.3579 0.5494 0.0047  -0.0848 -0.0324 422 GLY A N     
994  C CA    . GLY A 130 ? 0.3765 0.3440 0.5337 0.0062  -0.0861 -0.0350 422 GLY A CA    
995  C C     . GLY A 130 ? 0.4084 0.3798 0.5528 0.0052  -0.0780 -0.0331 422 GLY A C     
996  O O     . GLY A 130 ? 0.3501 0.3226 0.4920 0.0067  -0.0782 -0.0358 422 GLY A O     
997  N N     . GLU A 131 ? 0.3263 0.2997 0.4630 0.0029  -0.0711 -0.0285 423 GLU A N     
998  C CA    . GLU A 131 ? 0.3449 0.3219 0.4702 0.0020  -0.0637 -0.0267 423 GLU A CA    
999  C C     . GLU A 131 ? 0.3951 0.3785 0.5139 0.0053  -0.0610 -0.0336 423 GLU A C     
1000 O O     . GLU A 131 ? 0.3079 0.2943 0.4204 0.0046  -0.0558 -0.0323 423 GLU A O     
1001 C CB    . GLU A 131 ? 0.3681 0.3446 0.4886 -0.0021 -0.0579 -0.0187 423 GLU A CB    
1002 C CG    . GLU A 131 ? 0.3714 0.3431 0.4970 -0.0057 -0.0595 -0.0108 423 GLU A CG    
1003 C CD    . GLU A 131 ? 0.4194 0.3905 0.5412 -0.0067 -0.0580 -0.0082 423 GLU A CD    
1004 O OE1   . GLU A 131 ? 0.4503 0.4242 0.5663 -0.0045 -0.0561 -0.0130 423 GLU A OE1   
1005 O OE2   . GLU A 131 ? 0.5971 0.5652 0.7217 -0.0097 -0.0587 -0.0013 423 GLU A OE2   
1006 N N     . GLU A 132 ? 0.3393 0.3252 0.4598 0.0089  -0.0645 -0.0409 424 GLU A N     
1007 C CA    . GLU A 132 ? 0.3283 0.3214 0.4439 0.0123  -0.0627 -0.0477 424 GLU A CA    
1008 C C     . GLU A 132 ? 0.2851 0.2831 0.3891 0.0113  -0.0546 -0.0460 424 GLU A C     
1009 O O     . GLU A 132 ? 0.2948 0.2980 0.3940 0.0127  -0.0518 -0.0485 424 GLU A O     
1010 C CB    . GLU A 132 ? 0.4196 0.4156 0.5402 0.0167  -0.0685 -0.0564 424 GLU A CB    
1011 C CG    . GLU A 132 ? 0.4581 0.4500 0.5910 0.0185  -0.0772 -0.0595 424 GLU A CG    
1012 C CD    . GLU A 132 ? 0.6042 0.5967 0.7395 0.0190  -0.0780 -0.0601 424 GLU A CD    
1013 O OE1   . GLU A 132 ? 0.5565 0.5550 0.6844 0.0202  -0.0735 -0.0620 424 GLU A OE1   
1014 O OE2   . GLU A 132 ? 0.5371 0.5241 0.6821 0.0181  -0.0833 -0.0584 424 GLU A OE2   
1015 N N     . ARG A 133 ? 0.2477 0.2441 0.3475 0.0089  -0.0512 -0.0417 425 ARG A N     
1016 C CA    . ARG A 133 ? 0.2285 0.2290 0.3183 0.0078  -0.0439 -0.0401 425 ARG A CA    
1017 C C     . ARG A 133 ? 0.2372 0.2368 0.3229 0.0051  -0.0392 -0.0344 425 ARG A C     
1018 O O     . ARG A 133 ? 0.2702 0.2742 0.3495 0.0054  -0.0348 -0.0350 425 ARG A O     
1019 C CB    . ARG A 133 ? 0.2712 0.2705 0.3581 0.0064  -0.0420 -0.0378 425 ARG A CB    
1020 C CG    . ARG A 133 ? 0.4317 0.4342 0.5205 0.0096  -0.0452 -0.0446 425 ARG A CG    
1021 C CD    . ARG A 133 ? 0.4943 0.4932 0.5844 0.0085  -0.0464 -0.0426 425 ARG A CD    
1022 N NE    . ARG A 133 ? 0.5988 0.5982 0.6815 0.0060  -0.0403 -0.0381 425 ARG A NE    
1023 C CZ    . ARG A 133 ? 0.5971 0.6019 0.6735 0.0066  -0.0359 -0.0404 425 ARG A CZ    
1024 N NH1   . ARG A 133 ? 0.8021 0.8131 0.8778 0.0095  -0.0364 -0.0467 425 ARG A NH1   
1025 N NH2   . ARG A 133 ? 0.5482 0.5527 0.6191 0.0043  -0.0310 -0.0363 425 ARG A NH2   
1026 N N     . LEU A 134 ? 0.2612 0.2556 0.3510 0.0025  -0.0403 -0.0289 426 LEU A N     
1027 C CA    . LEU A 134 ? 0.2488 0.2426 0.3358 0.0002  -0.0365 -0.0241 426 LEU A CA    
1028 C C     . LEU A 134 ? 0.2799 0.2760 0.3686 0.0023  -0.0381 -0.0277 426 LEU A C     
1029 O O     . LEU A 134 ? 0.2524 0.2506 0.3361 0.0017  -0.0341 -0.0263 426 LEU A O     
1030 C CB    . LEU A 134 ? 0.2275 0.2162 0.3191 -0.0030 -0.0376 -0.0176 426 LEU A CB    
1031 C CG    . LEU A 134 ? 0.2857 0.2727 0.3750 -0.0053 -0.0355 -0.0128 426 LEU A CG    
1032 C CD1   . LEU A 134 ? 0.2745 0.2574 0.3693 -0.0083 -0.0373 -0.0062 426 LEU A CD1   
1033 C CD2   . LEU A 134 ? 0.2823 0.2724 0.3622 -0.0063 -0.0287 -0.0111 426 LEU A CD2   
1034 N N     . LEU A 135 ? 0.2156 0.2113 0.3116 0.0049  -0.0442 -0.0326 427 LEU A N     
1035 C CA    . LEU A 135 ? 0.2531 0.2515 0.3507 0.0073  -0.0461 -0.0368 427 LEU A CA    
1036 C C     . LEU A 135 ? 0.2613 0.2670 0.3517 0.0100  -0.0431 -0.0416 427 LEU A C     
1037 O O     . LEU A 135 ? 0.2570 0.2658 0.3447 0.0111  -0.0417 -0.0428 427 LEU A O     
1038 C CB    . LEU A 135 ? 0.2422 0.2386 0.3505 0.0097  -0.0541 -0.0414 427 LEU A CB    
1039 C CG    . LEU A 135 ? 0.2597 0.2492 0.3764 0.0069  -0.0575 -0.0362 427 LEU A CG    
1040 C CD1   . LEU A 135 ? 0.2953 0.2823 0.4233 0.0092  -0.0659 -0.0408 427 LEU A CD1   
1041 C CD2   . LEU A 135 ? 0.2982 0.2872 0.4146 0.0052  -0.0553 -0.0326 427 LEU A CD2   
1042 N N     . TRP A 136 ? 0.2534 0.2620 0.3405 0.0110  -0.0421 -0.0441 428 TRP A N     
1043 C CA    . TRP A 136 ? 0.2730 0.2891 0.3529 0.0130  -0.0386 -0.0476 428 TRP A CA    
1044 C C     . TRP A 136 ? 0.2485 0.2651 0.3204 0.0102  -0.0319 -0.0421 428 TRP A C     
1045 O O     . TRP A 136 ? 0.2715 0.2930 0.3389 0.0113  -0.0294 -0.0432 428 TRP A O     
1046 C CB    . TRP A 136 ? 0.2471 0.2660 0.3255 0.0140  -0.0385 -0.0506 428 TRP A CB    
1047 C CG    . TRP A 136 ? 0.2860 0.3136 0.3579 0.0160  -0.0353 -0.0542 428 TRP A CG    
1048 C CD1   . TRP A 136 ? 0.3588 0.3936 0.4317 0.0201  -0.0380 -0.0613 428 TRP A CD1   
1049 C CD2   . TRP A 136 ? 0.2803 0.3108 0.3439 0.0140  -0.0287 -0.0506 428 TRP A CD2   
1050 N NE1   . TRP A 136 ? 0.3808 0.4234 0.4462 0.0205  -0.0333 -0.0619 428 TRP A NE1   
1051 C CE2   . TRP A 136 ? 0.3970 0.4366 0.4569 0.0167  -0.0277 -0.0553 428 TRP A CE2   
1052 C CE3   . TRP A 136 ? 0.2895 0.3162 0.3489 0.0102  -0.0239 -0.0441 428 TRP A CE3   
1053 C CZ2   . TRP A 136 ? 0.3895 0.4340 0.4421 0.0153  -0.0220 -0.0530 428 TRP A CZ2   
1054 C CZ3   . TRP A 136 ? 0.3377 0.3688 0.3901 0.0092  -0.0186 -0.0425 428 TRP A CZ3   
1055 C CH2   . TRP A 136 ? 0.2949 0.3346 0.3442 0.0116  -0.0177 -0.0466 428 TRP A CH2   
1056 N N     . LEU A 137 ? 0.2362 0.2483 0.3067 0.0068  -0.0290 -0.0363 429 LEU A N     
1057 C CA    . LEU A 137 ? 0.2590 0.2711 0.3230 0.0043  -0.0232 -0.0312 429 LEU A CA    
1058 C C     . LEU A 137 ? 0.2538 0.2651 0.3185 0.0040  -0.0231 -0.0297 429 LEU A C     
1059 O O     . LEU A 137 ? 0.2517 0.2658 0.3109 0.0038  -0.0195 -0.0286 429 LEU A O     
1060 C CB    . LEU A 137 ? 0.2645 0.2719 0.3281 0.0010  -0.0211 -0.0258 429 LEU A CB    
1061 C CG    . LEU A 137 ? 0.2401 0.2490 0.3002 0.0007  -0.0189 -0.0261 429 LEU A CG    
1062 C CD1   . LEU A 137 ? 0.2874 0.2918 0.3481 -0.0020 -0.0178 -0.0211 429 LEU A CD1   
1063 C CD2   . LEU A 137 ? 0.2450 0.2587 0.2977 0.0006  -0.0138 -0.0261 429 LEU A CD2   
1064 N N     . TYR A 138 ? 0.1978 0.2052 0.2696 0.0040  -0.0274 -0.0295 430 TYR A N     
1065 C CA    . TYR A 138 ? 0.2407 0.2474 0.3141 0.0040  -0.0279 -0.0286 430 TYR A CA    
1066 C C     . TYR A 138 ? 0.3309 0.3431 0.4021 0.0072  -0.0286 -0.0335 430 TYR A C     
1067 O O     . TYR A 138 ? 0.2508 0.2647 0.3177 0.0069  -0.0256 -0.0319 430 TYR A O     
1068 C CB    . TYR A 138 ? 0.2330 0.2350 0.3156 0.0034  -0.0328 -0.0276 430 TYR A CB    
1069 C CG    . TYR A 138 ? 0.2300 0.2311 0.3150 0.0031  -0.0334 -0.0265 430 TYR A CG    
1070 C CD1   . TYR A 138 ? 0.2628 0.2627 0.3443 0.0004  -0.0291 -0.0212 430 TYR A CD1   
1071 C CD2   . TYR A 138 ? 0.2465 0.2482 0.3377 0.0058  -0.0386 -0.0312 430 TYR A CD2   
1072 C CE1   . TYR A 138 ? 0.2523 0.2516 0.3363 0.0002  -0.0298 -0.0204 430 TYR A CE1   
1073 C CE2   . TYR A 138 ? 0.2442 0.2451 0.3380 0.0056  -0.0394 -0.0303 430 TYR A CE2   
1074 C CZ    . TYR A 138 ? 0.2491 0.2489 0.3392 0.0027  -0.0348 -0.0248 430 TYR A CZ    
1075 O OH    . TYR A 138 ? 0.2549 0.2541 0.3478 0.0026  -0.0355 -0.0240 430 TYR A OH    
1076 N N     . ARG A 139 ? 0.2503 0.2658 0.3246 0.0105  -0.0327 -0.0397 431 ARG A N     
1077 C CA    . ARG A 139 ? 0.2933 0.3148 0.3662 0.0141  -0.0340 -0.0449 431 ARG A CA    
1078 C C     . ARG A 139 ? 0.2627 0.2909 0.3268 0.0147  -0.0293 -0.0454 431 ARG A C     
1079 O O     . ARG A 139 ? 0.2740 0.3071 0.3344 0.0163  -0.0282 -0.0466 431 ARG A O     
1080 C CB    . ARG A 139 ? 0.2709 0.2944 0.3510 0.0179  -0.0406 -0.0520 431 ARG A CB    
1081 C CG    . ARG A 139 ? 0.3014 0.3188 0.3914 0.0177  -0.0462 -0.0521 431 ARG A CG    
1082 C CD    . ARG A 139 ? 0.3285 0.3490 0.4254 0.0222  -0.0530 -0.0603 431 ARG A CD    
1083 N NE    . ARG A 139 ? 0.3882 0.4029 0.4957 0.0220  -0.0589 -0.0606 431 ARG A NE    
1084 C CZ    . ARG A 139 ? 0.4122 0.4214 0.5279 0.0212  -0.0634 -0.0602 431 ARG A CZ    
1085 N NH1   . ARG A 139 ? 0.3661 0.3749 0.4801 0.0205  -0.0627 -0.0598 431 ARG A NH1   
1086 N NH2   . ARG A 139 ? 0.4159 0.4201 0.5417 0.0209  -0.0689 -0.0600 431 ARG A NH2   
1087 N N     . GLU A 140 ? 0.2171 0.2459 0.2780 0.0134  -0.0267 -0.0441 432 GLU A N     
1088 C CA    . GLU A 140 ? 0.3010 0.3369 0.3547 0.0141  -0.0228 -0.0450 432 GLU A CA    
1089 C C     . GLU A 140 ? 0.2932 0.3276 0.3406 0.0107  -0.0169 -0.0388 432 GLU A C     
1090 O O     . GLU A 140 ? 0.2736 0.3135 0.3152 0.0109  -0.0135 -0.0384 432 GLU A O     
1091 C CB    . GLU A 140 ? 0.3151 0.3543 0.3698 0.0155  -0.0240 -0.0490 432 GLU A CB    
1092 C CG    . GLU A 140 ? 0.3352 0.3771 0.3961 0.0195  -0.0302 -0.0562 432 GLU A CG    
1093 C CD    . GLU A 140 ? 0.5727 0.6224 0.6319 0.0230  -0.0313 -0.0607 432 GLU A CD    
1094 O OE1   . GLU A 140 ? 0.5363 0.5928 0.5884 0.0231  -0.0271 -0.0598 432 GLU A OE1   
1095 O OE2   . GLU A 140 ? 0.5886 0.6380 0.6538 0.0257  -0.0366 -0.0650 432 GLU A OE2   
1096 N N     . VAL A 141 ? 0.2614 0.2888 0.3103 0.0077  -0.0158 -0.0340 433 VAL A N     
1097 C CA    . VAL A 141 ? 0.2650 0.2909 0.3087 0.0047  -0.0106 -0.0285 433 VAL A CA    
1098 C C     . VAL A 141 ? 0.3110 0.3323 0.3554 0.0030  -0.0099 -0.0246 433 VAL A C     
1099 O O     . VAL A 141 ? 0.2549 0.2781 0.2956 0.0029  -0.0078 -0.0232 433 VAL A O     
1100 C CB    . VAL A 141 ? 0.2108 0.2339 0.2541 0.0026  -0.0089 -0.0264 433 VAL A CB    
1101 C CG1   . VAL A 141 ? 0.2578 0.2790 0.2966 -0.0003 -0.0040 -0.0212 433 VAL A CG1   
1102 C CG2   . VAL A 141 ? 0.2686 0.2967 0.3107 0.0042  -0.0091 -0.0303 433 VAL A CG2   
1103 N N     . GLU A 142 ? 0.2532 0.2645 0.2496 0.0061  -0.0394 -0.0247 434 GLU A N     
1104 C CA    . GLU A 142 ? 0.2880 0.2953 0.2855 0.0042  -0.0357 -0.0225 434 GLU A CA    
1105 C C     . GLU A 142 ? 0.2716 0.2828 0.2756 0.0032  -0.0347 -0.0221 434 GLU A C     
1106 O O     . GLU A 142 ? 0.2535 0.2664 0.2599 0.0018  -0.0323 -0.0208 434 GLU A O     
1107 C CB    . GLU A 142 ? 0.3742 0.3725 0.3674 0.0042  -0.0346 -0.0215 434 GLU A CB    
1108 C CG    . GLU A 142 ? 0.4104 0.4039 0.3969 0.0051  -0.0351 -0.0217 434 GLU A CG    
1109 C CD    . GLU A 142 ? 0.6063 0.5999 0.5909 0.0041  -0.0331 -0.0203 434 GLU A CD    
1110 O OE1   . GLU A 142 ? 0.5232 0.5204 0.5114 0.0028  -0.0312 -0.0193 434 GLU A OE1   
1111 O OE2   . GLU A 142 ? 0.6771 0.6671 0.6564 0.0049  -0.0335 -0.0204 434 GLU A OE2   
1112 N N     . ARG A 143 ? 0.2482 0.2607 0.2549 0.0041  -0.0365 -0.0233 435 ARG A N     
1113 C CA    . ARG A 143 ? 0.2339 0.2499 0.2467 0.0032  -0.0356 -0.0231 435 ARG A CA    
1114 C C     . ARG A 143 ? 0.2183 0.2428 0.2354 0.0030  -0.0360 -0.0235 435 ARG A C     
1115 O O     . ARG A 143 ? 0.2727 0.2990 0.2933 0.0017  -0.0337 -0.0224 435 ARG A O     
1116 C CB    . ARG A 143 ? 0.2596 0.2749 0.2743 0.0040  -0.0377 -0.0243 435 ARG A CB    
1117 C CG    . ARG A 143 ? 0.3124 0.3277 0.3320 0.0026  -0.0357 -0.0235 435 ARG A CG    
1118 C CD    . ARG A 143 ? 0.3359 0.3492 0.3566 0.0033  -0.0378 -0.0246 435 ARG A CD    
1119 N NE    . ARG A 143 ? 0.3876 0.4054 0.4087 0.0055  -0.0417 -0.0268 435 ARG A NE    
1120 C CZ    . ARG A 143 ? 0.3881 0.4040 0.4088 0.0067  -0.0443 -0.0282 435 ARG A CZ    
1121 N NH1   . ARG A 143 ? 0.3122 0.3215 0.3320 0.0057  -0.0435 -0.0274 435 ARG A NH1   
1122 N NH2   . ARG A 143 ? 0.4016 0.4220 0.4225 0.0090  -0.0479 -0.0304 435 ARG A NH2   
1123 N N     . PRO A 144 ? 0.2739 0.3037 0.2907 0.0043  -0.0389 -0.0252 436 PRO A N     
1124 C CA    . PRO A 144 ? 0.2605 0.2978 0.2809 0.0037  -0.0389 -0.0253 436 PRO A CA    
1125 C C     . PRO A 144 ? 0.2188 0.2551 0.2371 0.0022  -0.0366 -0.0236 436 PRO A C     
1126 O O     . PRO A 144 ? 0.2155 0.2556 0.2369 0.0012  -0.0355 -0.0230 436 PRO A O     
1127 C CB    . PRO A 144 ? 0.2960 0.3390 0.3157 0.0052  -0.0424 -0.0274 436 PRO A CB    
1128 C CG    . PRO A 144 ? 0.3321 0.3701 0.3471 0.0068  -0.0440 -0.0284 436 PRO A CG    
1129 C CD    . PRO A 144 ? 0.3017 0.3319 0.3160 0.0063  -0.0423 -0.0272 436 PRO A CD    
1130 N N     . LEU A 145 ? 0.2055 0.2364 0.2182 0.0022  -0.0359 -0.0230 437 LEU A N     
1131 C CA    . LEU A 145 ? 0.2086 0.2381 0.2191 0.0009  -0.0338 -0.0214 437 LEU A CA    
1132 C C     . LEU A 145 ? 0.2314 0.2584 0.2442 -0.0004 -0.0306 -0.0197 437 LEU A C     
1133 O O     . LEU A 145 ? 0.2171 0.2452 0.2300 -0.0014 -0.0292 -0.0186 437 LEU A O     
1134 C CB    . LEU A 145 ? 0.1784 0.2020 0.1826 0.0012  -0.0336 -0.0210 437 LEU A CB    
1135 C CG    . LEU A 145 ? 0.2015 0.2231 0.2025 0.0000  -0.0317 -0.0195 437 LEU A CG    
1136 C CD1   . LEU A 145 ? 0.2294 0.2574 0.2308 -0.0006 -0.0331 -0.0200 437 LEU A CD1   
1137 C CD2   . LEU A 145 ? 0.2262 0.2409 0.2211 0.0005  -0.0313 -0.0191 437 LEU A CD2   
1138 N N     . SER A 146 ? 0.2323 0.2555 0.2464 -0.0003 -0.0296 -0.0194 438 SER A N     
1139 C CA    . SER A 146 ? 0.2250 0.2464 0.2415 -0.0014 -0.0265 -0.0179 438 SER A CA    
1140 C C     . SER A 146 ? 0.2342 0.2619 0.2559 -0.0019 -0.0264 -0.0180 438 SER A C     
1141 O O     . SER A 146 ? 0.1974 0.2248 0.2199 -0.0027 -0.0242 -0.0169 438 SER A O     
1142 C CB    . SER A 146 ? 0.2581 0.2752 0.2756 -0.0016 -0.0256 -0.0177 438 SER A CB    
1143 O OG    . SER A 146 ? 0.2700 0.2909 0.2918 -0.0010 -0.0275 -0.0191 438 SER A OG    
1144 N N     . ALA A 147 ? 0.1946 0.2282 0.2196 -0.0012 -0.0288 -0.0195 439 ALA A N     
1145 C CA    . ALA A 147 ? 0.2125 0.2522 0.2422 -0.0015 -0.0289 -0.0197 439 ALA A CA    
1146 C C     . ALA A 147 ? 0.2298 0.2719 0.2574 -0.0021 -0.0290 -0.0193 439 ALA A C     
1147 O O     . ALA A 147 ? 0.2153 0.2594 0.2450 -0.0028 -0.0279 -0.0186 439 ALA A O     
1148 C CB    . ALA A 147 ? 0.2226 0.2678 0.2564 -0.0005 -0.0316 -0.0215 439 ALA A CB    
1149 N N     . VAL A 148 ? 0.2103 0.2519 0.2336 -0.0019 -0.0305 -0.0196 440 VAL A N     
1150 C CA    . VAL A 148 ? 0.1951 0.2383 0.2157 -0.0028 -0.0307 -0.0191 440 VAL A CA    
1151 C C     . VAL A 148 ? 0.2003 0.2382 0.2183 -0.0037 -0.0279 -0.0172 440 VAL A C     
1152 O O     . VAL A 148 ? 0.1985 0.2378 0.2167 -0.0045 -0.0272 -0.0165 440 VAL A O     
1153 C CB    . VAL A 148 ? 0.2483 0.2917 0.2645 -0.0024 -0.0327 -0.0200 440 VAL A CB    
1154 C CG1   . VAL A 148 ? 0.2190 0.2637 0.2320 -0.0037 -0.0327 -0.0192 440 VAL A CG1   
1155 C CG2   . VAL A 148 ? 0.2252 0.2745 0.2439 -0.0013 -0.0356 -0.0220 440 VAL A CG2   
1156 N N     . LEU A 149 ? 0.1949 0.2265 0.2102 -0.0034 -0.0264 -0.0166 441 LEU A N     
1157 C CA    . LEU A 149 ? 0.1860 0.2124 0.1986 -0.0040 -0.0237 -0.0149 441 LEU A CA    
1158 C C     . LEU A 149 ? 0.2390 0.2664 0.2557 -0.0043 -0.0217 -0.0143 441 LEU A C     
1159 O O     . LEU A 149 ? 0.2211 0.2468 0.2362 -0.0048 -0.0202 -0.0132 441 LEU A O     
1160 C CB    . LEU A 149 ? 0.2076 0.2274 0.2167 -0.0036 -0.0225 -0.0144 441 LEU A CB    
1161 C CG    . LEU A 149 ? 0.2417 0.2596 0.2461 -0.0031 -0.0243 -0.0150 441 LEU A CG    
1162 C CD1   . LEU A 149 ? 0.2358 0.2466 0.2365 -0.0027 -0.0229 -0.0144 441 LEU A CD1   
1163 C CD2   . LEU A 149 ? 0.2475 0.2662 0.2483 -0.0037 -0.0249 -0.0146 441 LEU A CD2   
1164 N N     . ALA A 150 ? 0.1707 0.2008 0.1923 -0.0040 -0.0219 -0.0150 442 ALA A N     
1165 C CA    . ALA A 150 ? 0.1943 0.2261 0.2203 -0.0041 -0.0202 -0.0147 442 ALA A CA    
1166 C C     . ALA A 150 ? 0.2263 0.2625 0.2533 -0.0044 -0.0211 -0.0147 442 ALA A C     
1167 O O     . ALA A 150 ? 0.1983 0.2338 0.2256 -0.0046 -0.0194 -0.0139 442 ALA A O     
1168 C CB    . ALA A 150 ? 0.1993 0.2336 0.2303 -0.0038 -0.0206 -0.0157 442 ALA A CB    
1169 N N     . HIS A 151 ? 0.1748 0.2155 0.2024 -0.0044 -0.0236 -0.0157 443 HIS A N     
1170 C CA    . HIS A 151 ? 0.1687 0.2136 0.1968 -0.0049 -0.0247 -0.0158 443 HIS A CA    
1171 C C     . HIS A 151 ? 0.1802 0.2215 0.2031 -0.0057 -0.0239 -0.0145 443 HIS A C     
1172 O O     . HIS A 151 ? 0.2300 0.2716 0.2530 -0.0060 -0.0232 -0.0139 443 HIS A O     
1173 C CB    . HIS A 151 ? 0.2242 0.2746 0.2529 -0.0049 -0.0276 -0.0171 443 HIS A CB    
1174 C CG    . HIS A 151 ? 0.2978 0.3515 0.3248 -0.0059 -0.0288 -0.0169 443 HIS A CG    
1175 N ND1   . HIS A 151 ? 0.3185 0.3769 0.3488 -0.0062 -0.0294 -0.0171 443 HIS A ND1   
1176 C CD2   . HIS A 151 ? 0.3244 0.3771 0.3465 -0.0069 -0.0295 -0.0164 443 HIS A CD2   
1177 C CE1   . HIS A 151 ? 0.3030 0.3631 0.3304 -0.0074 -0.0305 -0.0168 443 HIS A CE1   
1178 N NE2   . HIS A 151 ? 0.2720 0.3288 0.2944 -0.0080 -0.0306 -0.0163 443 HIS A NE2   
1179 N N     . MET A 152 ? 0.1789 0.2166 0.1970 -0.0059 -0.0241 -0.0142 444 MET A N     
1180 C CA    . MET A 152 ? 0.2196 0.2536 0.2324 -0.0066 -0.0235 -0.0130 444 MET A CA    
1181 C C     . MET A 152 ? 0.1938 0.2234 0.2060 -0.0064 -0.0209 -0.0118 444 MET A C     
1182 O O     . MET A 152 ? 0.2204 0.2491 0.2307 -0.0068 -0.0206 -0.0110 444 MET A O     
1183 C CB    . MET A 152 ? 0.2114 0.2420 0.2195 -0.0066 -0.0240 -0.0130 444 MET A CB    
1184 C CG    . MET A 152 ? 0.2179 0.2533 0.2258 -0.0069 -0.0267 -0.0142 444 MET A CG    
1185 S SD    . MET A 152 ? 0.2351 0.2667 0.2383 -0.0063 -0.0274 -0.0147 444 MET A SD    
1186 C CE    . MET A 152 ? 0.2725 0.2991 0.2694 -0.0073 -0.0265 -0.0132 444 MET A CE    
1187 N N     . GLU A 153 ? 0.1995 0.2262 0.2130 -0.0057 -0.0191 -0.0117 445 GLU A N     
1188 C CA    . GLU A 153 ? 0.2051 0.2279 0.2179 -0.0053 -0.0166 -0.0107 445 GLU A CA    
1189 C C     . GLU A 153 ? 0.2393 0.2654 0.2562 -0.0051 -0.0160 -0.0108 445 GLU A C     
1190 O O     . GLU A 153 ? 0.2495 0.2735 0.2644 -0.0049 -0.0150 -0.0101 445 GLU A O     
1191 C CB    . GLU A 153 ? 0.2395 0.2591 0.2530 -0.0049 -0.0148 -0.0105 445 GLU A CB    
1192 C CG    . GLU A 153 ? 0.3007 0.3163 0.3132 -0.0046 -0.0119 -0.0095 445 GLU A CG    
1193 C CD    . GLU A 153 ? 0.2807 0.2924 0.2922 -0.0045 -0.0103 -0.0092 445 GLU A CD    
1194 O OE1   . GLU A 153 ? 0.3379 0.3479 0.3472 -0.0046 -0.0114 -0.0094 445 GLU A OE1   
1195 O OE2   . GLU A 153 ? 0.3270 0.3373 0.3397 -0.0043 -0.0079 -0.0087 445 GLU A OE2   
1196 N N     . ALA A 154 ? 0.1979 0.2290 0.2201 -0.0049 -0.0169 -0.0119 446 ALA A N     
1197 C CA    . ALA A 154 ? 0.1931 0.2274 0.2193 -0.0045 -0.0165 -0.0122 446 ALA A CA    
1198 C C     . ALA A 154 ? 0.2112 0.2475 0.2359 -0.0049 -0.0181 -0.0121 446 ALA A C     
1199 O O     . ALA A 154 ? 0.2370 0.2735 0.2623 -0.0045 -0.0174 -0.0119 446 ALA A O     
1200 C CB    . ALA A 154 ? 0.2138 0.2527 0.2462 -0.0042 -0.0170 -0.0134 446 ALA A CB    
1201 N N     . THR A 155 ? 0.1921 0.2300 0.2145 -0.0058 -0.0202 -0.0122 447 THR A N     
1202 C CA    . THR A 155 ? 0.2109 0.2507 0.2313 -0.0067 -0.0218 -0.0120 447 THR A CA    
1203 C C     . THR A 155 ? 0.2294 0.2638 0.2441 -0.0070 -0.0211 -0.0107 447 THR A C     
1204 O O     . THR A 155 ? 0.2443 0.2784 0.2578 -0.0071 -0.0213 -0.0104 447 THR A O     
1205 C CB    . THR A 155 ? 0.2239 0.2673 0.2434 -0.0077 -0.0242 -0.0126 447 THR A CB    
1206 O OG1   . THR A 155 ? 0.2239 0.2725 0.2489 -0.0071 -0.0251 -0.0139 447 THR A OG1   
1207 C CG2   . THR A 155 ? 0.2322 0.2775 0.2492 -0.0090 -0.0258 -0.0123 447 THR A CG2   
1208 N N     . GLY A 156 ? 0.2149 0.2447 0.2256 -0.0071 -0.0203 -0.0101 448 GLY A N     
1209 C CA    . GLY A 156 ? 0.1927 0.2170 0.1978 -0.0073 -0.0195 -0.0090 448 GLY A CA    
1210 C C     . GLY A 156 ? 0.1967 0.2211 0.1975 -0.0088 -0.0216 -0.0085 448 GLY A C     
1211 O O     . GLY A 156 ? 0.2414 0.2705 0.2434 -0.0098 -0.0235 -0.0091 448 GLY A O     
1212 N N     . VAL A 157 ? 0.1811 0.2003 0.1766 -0.0090 -0.0212 -0.0075 449 VAL A N     
1213 C CA    . VAL A 157 ? 0.1949 0.2134 0.1857 -0.0107 -0.0231 -0.0069 449 VAL A CA    
1214 C C     . VAL A 157 ? 0.1777 0.1920 0.1651 -0.0104 -0.0228 -0.0060 449 VAL A C     
1215 O O     . VAL A 157 ? 0.2017 0.2118 0.1882 -0.0089 -0.0210 -0.0057 449 VAL A O     
1216 C CB    . VAL A 157 ? 0.2409 0.2567 0.2269 -0.0117 -0.0236 -0.0065 449 VAL A CB    
1217 C CG1   . VAL A 157 ? 0.2288 0.2379 0.2113 -0.0105 -0.0217 -0.0057 449 VAL A CG1   
1218 C CG2   . VAL A 157 ? 0.2590 0.2748 0.2403 -0.0139 -0.0257 -0.0060 449 VAL A CG2   
1219 N N     . ARG A 158 ? 0.2070 0.2225 0.1925 -0.0119 -0.0246 -0.0058 450 ARG A N     
1220 C CA    . ARG A 158 ? 0.1758 0.1868 0.1572 -0.0117 -0.0249 -0.0050 450 ARG A CA    
1221 C C     . ARG A 158 ? 0.2129 0.2173 0.1871 -0.0123 -0.0250 -0.0039 450 ARG A C     
1222 O O     . ARG A 158 ? 0.2285 0.2331 0.2001 -0.0140 -0.0260 -0.0037 450 ARG A O     
1223 C CB    . ARG A 158 ? 0.2306 0.2447 0.2117 -0.0133 -0.0270 -0.0050 450 ARG A CB    
1224 C CG    . ARG A 158 ? 0.3129 0.3224 0.2899 -0.0130 -0.0275 -0.0043 450 ARG A CG    
1225 C CD    . ARG A 158 ? 0.2969 0.3095 0.2733 -0.0150 -0.0298 -0.0042 450 ARG A CD    
1226 N NE    . ARG A 158 ? 0.3281 0.3358 0.3000 -0.0148 -0.0306 -0.0036 450 ARG A NE    
1227 C CZ    . ARG A 158 ? 0.4278 0.4351 0.3959 -0.0170 -0.0327 -0.0030 450 ARG A CZ    
1228 N NH1   . ARG A 158 ? 0.2689 0.2808 0.2372 -0.0197 -0.0341 -0.0030 450 ARG A NH1   
1229 N NH2   . ARG A 158 ? 0.3881 0.3901 0.3516 -0.0164 -0.0335 -0.0025 450 ARG A NH2   
1230 N N     . LEU A 159 ? 0.2365 0.2353 0.2078 -0.0107 -0.0240 -0.0034 451 LEU A N     
1231 C CA    . LEU A 159 ? 0.2010 0.1930 0.1649 -0.0112 -0.0244 -0.0023 451 LEU A CA    
1232 C C     . LEU A 159 ? 0.2396 0.2277 0.1986 -0.0116 -0.0260 -0.0016 451 LEU A C     
1233 O O     . LEU A 159 ? 0.2867 0.2756 0.2476 -0.0105 -0.0260 -0.0020 451 LEU A O     
1234 C CB    . LEU A 159 ? 0.2246 0.2121 0.1875 -0.0089 -0.0222 -0.0021 451 LEU A CB    
1235 C CG    . LEU A 159 ? 0.2591 0.2488 0.2258 -0.0083 -0.0205 -0.0026 451 LEU A CG    
1236 C CD1   . LEU A 159 ? 0.2576 0.2422 0.2221 -0.0062 -0.0184 -0.0022 451 LEU A CD1   
1237 C CD2   . LEU A 159 ? 0.2619 0.2530 0.2271 -0.0103 -0.0217 -0.0025 451 LEU A CD2   
1238 N N     . ASP A 160 ? 0.2204 0.2039 0.1727 -0.0133 -0.0274 -0.0007 452 ASP A N     
1239 C CA    . ASP A 160 ? 0.2330 0.2112 0.1793 -0.0138 -0.0290 0.0001  452 ASP A CA    
1240 C C     . ASP A 160 ? 0.2793 0.2509 0.2223 -0.0111 -0.0277 0.0004  452 ASP A C     
1241 O O     . ASP A 160 ? 0.2719 0.2383 0.2096 -0.0113 -0.0278 0.0011  452 ASP A O     
1242 C CB    . ASP A 160 ? 0.2326 0.2090 0.1732 -0.0171 -0.0311 0.0010  452 ASP A CB    
1243 C CG    . ASP A 160 ? 0.3429 0.3140 0.2769 -0.0183 -0.0332 0.0019  452 ASP A CG    
1244 O OD1   . ASP A 160 ? 0.3344 0.3012 0.2667 -0.0160 -0.0330 0.0019  452 ASP A OD1   
1245 O OD2   . ASP A 160 ? 0.3321 0.3035 0.2626 -0.0216 -0.0352 0.0025  452 ASP A OD2   
1246 N N     . VAL A 161 ? 0.3099 0.2820 0.2560 -0.0084 -0.0265 -0.0003 453 VAL A N     
1247 C CA    A VAL A 161 ? 0.2840 0.2512 0.2280 -0.0055 -0.0250 -0.0004 453 VAL A CA    
1248 C CA    B VAL A 161 ? 0.2810 0.2483 0.2250 -0.0055 -0.0250 -0.0004 453 VAL A CA    
1249 C C     . VAL A 161 ? 0.3023 0.2617 0.2380 -0.0053 -0.0268 0.0004  453 VAL A C     
1250 O O     . VAL A 161 ? 0.2899 0.2441 0.2216 -0.0038 -0.0261 0.0008  453 VAL A O     
1251 C CB    A VAL A 161 ? 0.3106 0.2812 0.2604 -0.0026 -0.0232 -0.0015 453 VAL A CB    
1252 C CB    B VAL A 161 ? 0.2938 0.2646 0.2438 -0.0027 -0.0232 -0.0015 453 VAL A CB    
1253 C CG1   A VAL A 161 ? 0.2943 0.2653 0.2440 -0.0022 -0.0248 -0.0019 453 VAL A CG1   
1254 C CG1   B VAL A 161 ? 0.3701 0.3358 0.3170 0.0004  -0.0222 -0.0016 453 VAL A CG1   
1255 C CG2   A VAL A 161 ? 0.3465 0.3133 0.2949 0.0003  -0.0213 -0.0017 453 VAL A CG2   
1256 C CG2   B VAL A 161 ? 0.2461 0.2229 0.2033 -0.0026 -0.0212 -0.0021 453 VAL A CG2   
1257 N N     . ALA A 162 ? 0.2830 0.2413 0.2157 -0.0068 -0.0291 0.0008  454 ALA A N     
1258 C CA    . ALA A 162 ? 0.3476 0.2979 0.2717 -0.0069 -0.0311 0.0016  454 ALA A CA    
1259 C C     . ALA A 162 ? 0.3581 0.3042 0.2767 -0.0090 -0.0318 0.0027  454 ALA A C     
1260 O O     . ALA A 162 ? 0.3194 0.2584 0.2317 -0.0079 -0.0323 0.0032  454 ALA A O     
1261 C CB    . ALA A 162 ? 0.3683 0.3182 0.2899 -0.0088 -0.0337 0.0019  454 ALA A CB    
1262 N N     . TYR A 163 ? 0.3033 0.2541 0.2243 -0.0118 -0.0319 0.0029  455 TYR A N     
1263 C CA    . TYR A 163 ? 0.2954 0.2433 0.2119 -0.0140 -0.0326 0.0037  455 TYR A CA    
1264 C C     . TYR A 163 ? 0.3078 0.2534 0.2245 -0.0115 -0.0305 0.0035  455 TYR A C     
1265 O O     . TYR A 163 ? 0.3300 0.2693 0.2406 -0.0114 -0.0310 0.0042  455 TYR A O     
1266 C CB    . TYR A 163 ? 0.2990 0.2538 0.2191 -0.0171 -0.0331 0.0036  455 TYR A CB    
1267 C CG    . TYR A 163 ? 0.3600 0.3128 0.2755 -0.0196 -0.0340 0.0042  455 TYR A CG    
1268 C CD1   . TYR A 163 ? 0.4392 0.3869 0.3474 -0.0221 -0.0363 0.0052  455 TYR A CD1   
1269 C CD2   . TYR A 163 ? 0.4569 0.4129 0.3755 -0.0195 -0.0326 0.0038  455 TYR A CD2   
1270 C CE1   . TYR A 163 ? 0.6164 0.5625 0.5205 -0.0244 -0.0372 0.0058  455 TYR A CE1   
1271 C CE2   . TYR A 163 ? 0.5216 0.4760 0.4360 -0.0217 -0.0335 0.0043  455 TYR A CE2   
1272 C CZ    . TYR A 163 ? 0.6231 0.5726 0.5304 -0.0242 -0.0358 0.0052  455 TYR A CZ    
1273 O OH    . TYR A 163 ? 0.7985 0.7465 0.7016 -0.0264 -0.0368 0.0057  455 TYR A OH    
1274 N N     . LEU A 164 ? 0.2754 0.2258 0.1989 -0.0095 -0.0280 0.0026  456 LEU A N     
1275 C CA    . LEU A 164 ? 0.2834 0.2317 0.2073 -0.0071 -0.0258 0.0025  456 LEU A CA    
1276 C C     . LEU A 164 ? 0.2674 0.2092 0.1868 -0.0042 -0.0255 0.0026  456 LEU A C     
1277 O O     . LEU A 164 ? 0.3290 0.2663 0.2447 -0.0031 -0.0248 0.0030  456 LEU A O     
1278 C CB    . LEU A 164 ? 0.3346 0.2893 0.2667 -0.0057 -0.0233 0.0016  456 LEU A CB    
1279 C CG    . LEU A 164 ? 0.3088 0.2692 0.2450 -0.0079 -0.0233 0.0013  456 LEU A CG    
1280 C CD1   . LEU A 164 ? 0.3115 0.2783 0.2557 -0.0068 -0.0215 0.0003  456 LEU A CD1   
1281 C CD2   . LEU A 164 ? 0.3992 0.3570 0.3325 -0.0083 -0.0227 0.0017  456 LEU A CD2   
1282 N N     . ARG A 165 ? 0.3034 0.2448 0.2230 -0.0028 -0.0261 0.0022  457 ARG A N     
1283 C CA    . ARG A 165 ? 0.3164 0.2516 0.2313 0.0002  -0.0262 0.0021  457 ARG A CA    
1284 C C     . ARG A 165 ? 0.3241 0.2514 0.2299 -0.0009 -0.0285 0.0032  457 ARG A C     
1285 O O     . ARG A 165 ? 0.3505 0.2723 0.2519 0.0012  -0.0281 0.0034  457 ARG A O     
1286 C CB    . ARG A 165 ? 0.3753 0.3114 0.2915 0.0019  -0.0269 0.0014  457 ARG A CB    
1287 C CG    . ARG A 165 ? 0.4152 0.3588 0.3401 0.0033  -0.0247 0.0002  457 ARG A CG    
1288 C CD    . ARG A 165 ? 0.5448 0.4894 0.4726 0.0062  -0.0217 -0.0004 457 ARG A CD    
1289 N NE    . ARG A 165 ? 0.5453 0.4966 0.4810 0.0076  -0.0198 -0.0016 457 ARG A NE    
1290 C CZ    . ARG A 165 ? 0.6388 0.5932 0.5790 0.0092  -0.0170 -0.0022 457 ARG A CZ    
1291 N NH1   . ARG A 165 ? 0.5855 0.5367 0.5230 0.0098  -0.0157 -0.0017 457 ARG A NH1   
1292 N NH2   . ARG A 165 ? 0.6003 0.5608 0.5474 0.0102  -0.0155 -0.0032 457 ARG A NH2   
1293 N N     . ALA A 166 ? 0.3300 0.2568 0.2330 -0.0043 -0.0309 0.0039  458 ALA A N     
1294 C CA    . ALA A 166 ? 0.2851 0.2043 0.1792 -0.0059 -0.0333 0.0050  458 ALA A CA    
1295 C C     . ALA A 166 ? 0.3739 0.2916 0.2663 -0.0067 -0.0325 0.0055  458 ALA A C     
1296 O O     . ALA A 166 ? 0.3781 0.2887 0.2638 -0.0060 -0.0334 0.0061  458 ALA A O     
1297 C CB    . ALA A 166 ? 0.3463 0.2664 0.2384 -0.0099 -0.0359 0.0056  458 ALA A CB    
1298 N N     . MET A 167 ? 0.3438 0.2680 0.2421 -0.0079 -0.0310 0.0052  459 MET A N     
1299 C CA    . MET A 167 ? 0.2968 0.2202 0.1939 -0.0087 -0.0302 0.0055  459 MET A CA    
1300 C C     . MET A 167 ? 0.3195 0.2393 0.2158 -0.0051 -0.0282 0.0053  459 MET A C     
1301 O O     . MET A 167 ? 0.3811 0.2961 0.2726 -0.0049 -0.0284 0.0058  459 MET A O     
1302 C CB    . MET A 167 ? 0.3281 0.2594 0.2320 -0.0103 -0.0290 0.0050  459 MET A CB    
1303 C CG    . MET A 167 ? 0.4371 0.3679 0.3392 -0.0117 -0.0290 0.0053  459 MET A CG    
1304 S SD    . MET A 167 ? 0.4742 0.4139 0.3844 -0.0125 -0.0274 0.0044  459 MET A SD    
1305 C CE    . MET A 167 ? 0.4575 0.4036 0.3717 -0.0147 -0.0288 0.0040  459 MET A CE    
1306 N N     . SER A 168 ? 0.3086 0.2311 0.2097 -0.0022 -0.0262 0.0045  460 SER A N     
1307 C CA    . SER A 168 ? 0.3461 0.2661 0.2467 0.0011  -0.0241 0.0042  460 SER A CA    
1308 C C     . SER A 168 ? 0.3942 0.3058 0.2867 0.0027  -0.0256 0.0047  460 SER A C     
1309 O O     . SER A 168 ? 0.3681 0.2755 0.2570 0.0041  -0.0249 0.0050  460 SER A O     
1310 C CB    . SER A 168 ? 0.4029 0.3277 0.3100 0.0037  -0.0219 0.0032  460 SER A CB    
1311 O OG    . SER A 168 ? 0.4326 0.3553 0.3392 0.0068  -0.0198 0.0029  460 SER A OG    
1312 N N     . LEU A 169 ? 0.4017 0.3104 0.2907 0.0025  -0.0279 0.0048  461 LEU A N     
1313 C CA    . LEU A 169 ? 0.3916 0.2918 0.2724 0.0041  -0.0298 0.0051  461 LEU A CA    
1314 C C     . LEU A 169 ? 0.3666 0.2616 0.2409 0.0017  -0.0315 0.0062  461 LEU A C     
1315 O O     . LEU A 169 ? 0.4369 0.3256 0.3056 0.0034  -0.0318 0.0065  461 LEU A O     
1316 C CB    . LEU A 169 ? 0.3657 0.2637 0.2437 0.0041  -0.0322 0.0050  461 LEU A CB    
1317 C CG    . LEU A 169 ? 0.4296 0.3318 0.3129 0.0072  -0.0308 0.0037  461 LEU A CG    
1318 C CD1   . LEU A 169 ? 0.5023 0.4026 0.3830 0.0068  -0.0334 0.0036  461 LEU A CD1   
1319 C CD2   . LEU A 169 ? 0.5565 0.4560 0.4385 0.0116  -0.0293 0.0030  461 LEU A CD2   
1320 N N     . GLU A 170 ? 0.3968 0.2945 0.2719 -0.0024 -0.0328 0.0068  462 GLU A N     
1321 C CA    . GLU A 170 ? 0.4405 0.3340 0.3096 -0.0052 -0.0346 0.0077  462 GLU A CA    
1322 C C     . GLU A 170 ? 0.4842 0.3775 0.3539 -0.0043 -0.0327 0.0077  462 GLU A C     
1323 O O     . GLU A 170 ? 0.4103 0.2974 0.2737 -0.0041 -0.0337 0.0083  462 GLU A O     
1324 C CB    . GLU A 170 ? 0.4340 0.3321 0.3048 -0.0097 -0.0360 0.0081  462 GLU A CB    
1325 C CG    . GLU A 170 ? 0.7381 0.6329 0.6034 -0.0130 -0.0379 0.0089  462 GLU A CG    
1326 C CD    . GLU A 170 ? 0.9323 0.8326 0.7995 -0.0175 -0.0392 0.0092  462 GLU A CD    
1327 O OE1   . GLU A 170 ? 0.8015 0.7079 0.6743 -0.0179 -0.0387 0.0087  462 GLU A OE1   
1328 O OE2   . GLU A 170 ? 0.9991 0.8978 0.8621 -0.0207 -0.0409 0.0098  462 GLU A OE2   
1329 N N     . VAL A 171 ? 0.3629 0.2631 0.2401 -0.0036 -0.0300 0.0071  463 VAL A N     
1330 C CA    . VAL A 171 ? 0.3597 0.2602 0.2378 -0.0028 -0.0281 0.0070  463 VAL A CA    
1331 C C     . VAL A 171 ? 0.4252 0.3206 0.3005 0.0011  -0.0267 0.0069  463 VAL A C     
1332 O O     . VAL A 171 ? 0.4335 0.3250 0.3050 0.0016  -0.0265 0.0073  463 VAL A O     
1333 C CB    . VAL A 171 ? 0.3430 0.2517 0.2295 -0.0031 -0.0258 0.0064  463 VAL A CB    
1334 C CG1   . VAL A 171 ? 0.3688 0.2771 0.2561 -0.0016 -0.0236 0.0063  463 VAL A CG1   
1335 C CG2   . VAL A 171 ? 0.4029 0.3164 0.2915 -0.0069 -0.0273 0.0064  463 VAL A CG2   
1336 N N     . ALA A 172 ? 0.3968 0.2926 0.2738 0.0040  -0.0258 0.0064  464 ALA A N     
1337 C CA    . ALA A 172 ? 0.4660 0.3576 0.3403 0.0078  -0.0246 0.0061  464 ALA A CA    
1338 C C     . ALA A 172 ? 0.4848 0.3676 0.3499 0.0083  -0.0271 0.0067  464 ALA A C     
1339 O O     . ALA A 172 ? 0.4854 0.3641 0.3470 0.0102  -0.0264 0.0069  464 ALA A O     
1340 C CB    . ALA A 172 ? 0.4678 0.3619 0.3455 0.0107  -0.0236 0.0052  464 ALA A CB    
1341 N N     . GLU A 173 ? 0.4891 0.3688 0.3501 0.0064  -0.0301 0.0071  465 GLU A N     
1342 C CA    . GLU A 173 ? 0.5032 0.3741 0.3551 0.0062  -0.0329 0.0078  465 GLU A CA    
1343 C C     . GLU A 173 ? 0.5629 0.4315 0.4117 0.0041  -0.0333 0.0086  465 GLU A C     
1344 O O     . GLU A 173 ? 0.5615 0.4237 0.4044 0.0057  -0.0338 0.0088  465 GLU A O     
1345 C CB    . GLU A 173 ? 0.5350 0.4034 0.3833 0.0038  -0.0361 0.0082  465 GLU A CB    
1346 C CG    . GLU A 173 ? 0.7221 0.5812 0.5606 0.0029  -0.0393 0.0090  465 GLU A CG    
1347 C CD    . GLU A 173 ? 0.8216 0.6781 0.6563 0.0005  -0.0424 0.0095  465 GLU A CD    
1348 O OE1   . GLU A 173 ? 0.7876 0.6463 0.6250 0.0020  -0.0423 0.0088  465 GLU A OE1   
1349 O OE2   . GLU A 173 ? 0.8740 0.7264 0.7032 -0.0031 -0.0450 0.0105  465 GLU A OE2   
1350 N N     . GLU A 174 ? 0.4542 0.3283 0.3070 0.0006  -0.0329 0.0087  466 GLU A N     
1351 C CA    . GLU A 174 ? 0.4858 0.3585 0.3361 -0.0014 -0.0333 0.0092  466 GLU A CA    
1352 C C     . GLU A 174 ? 0.5128 0.3856 0.3647 0.0013  -0.0306 0.0090  466 GLU A C     
1353 O O     . GLU A 174 ? 0.5113 0.3794 0.3583 0.0014  -0.0312 0.0093  466 GLU A O     
1354 C CB    . GLU A 174 ? 0.5338 0.4128 0.3880 -0.0056 -0.0338 0.0093  466 GLU A CB    
1355 C CG    . GLU A 174 ? 0.5692 0.4478 0.4213 -0.0077 -0.0342 0.0096  466 GLU A CG    
1356 C CD    . GLU A 174 ? 0.7508 0.6224 0.5944 -0.0100 -0.0374 0.0104  466 GLU A CD    
1357 O OE1   . GLU A 174 ? 0.7435 0.6104 0.5827 -0.0101 -0.0393 0.0108  466 GLU A OE1   
1358 O OE2   . GLU A 174 ? 0.6988 0.5697 0.5401 -0.0118 -0.0379 0.0106  466 GLU A OE2   
1359 N N     . ILE A 175 ? 0.4480 0.3262 0.3066 0.0034  -0.0278 0.0083  467 ILE A N     
1360 C CA    . ILE A 175 ? 0.4695 0.3475 0.3293 0.0061  -0.0251 0.0081  467 ILE A CA    
1361 C C     . ILE A 175 ? 0.5716 0.4423 0.4250 0.0094  -0.0254 0.0082  467 ILE A C     
1362 O O     . ILE A 175 ? 0.5029 0.3702 0.3532 0.0105  -0.0248 0.0084  467 ILE A O     
1363 C CB    . ILE A 175 ? 0.4697 0.3545 0.3374 0.0077  -0.0220 0.0073  467 ILE A CB    
1364 C CG1   . ILE A 175 ? 0.4904 0.3820 0.3640 0.0048  -0.0215 0.0072  467 ILE A CG1   
1365 C CG2   . ILE A 175 ? 0.4160 0.2997 0.2840 0.0108  -0.0193 0.0072  467 ILE A CG2   
1366 C CD1   . ILE A 175 ? 0.4488 0.3471 0.3303 0.0058  -0.0189 0.0065  467 ILE A CD1   
1367 N N     . ALA A 176 ? 0.4849 0.3531 0.3362 0.0111  -0.0265 0.0080  468 ALA A N     
1368 C CA    . ALA A 176 ? 0.5119 0.3732 0.3570 0.0145  -0.0272 0.0079  468 ALA A CA    
1369 C C     . ALA A 176 ? 0.5340 0.3878 0.3709 0.0132  -0.0298 0.0087  468 ALA A C     
1370 O O     . ALA A 176 ? 0.5817 0.4308 0.4145 0.0155  -0.0295 0.0087  468 ALA A O     
1371 C CB    . ALA A 176 ? 0.5000 0.3602 0.3441 0.0164  -0.0284 0.0073  468 ALA A CB    
1372 N N     . ARG A 177 ? 0.5442 0.3970 0.3789 0.0094  -0.0325 0.0092  469 ARG A N     
1373 C CA    . ARG A 177 ? 0.5848 0.4307 0.4118 0.0075  -0.0352 0.0100  469 ARG A CA    
1374 C C     . ARG A 177 ? 0.6155 0.4621 0.4430 0.0069  -0.0338 0.0102  469 ARG A C     
1375 O O     . ARG A 177 ? 0.5432 0.3836 0.3648 0.0081  -0.0347 0.0105  469 ARG A O     
1376 C CB    . ARG A 177 ? 0.6405 0.4869 0.4662 0.0029  -0.0380 0.0106  469 ARG A CB    
1377 C CG    . ARG A 177 ? 0.7805 0.6215 0.6022 0.0025  -0.0405 0.0104  469 ARG A CG    
1378 C CD    . ARG A 177 ? 0.8484 0.6920 0.6718 -0.0024 -0.0423 0.0107  469 ARG A CD    
1379 N NE    . ARG A 177 ? 0.9055 0.7555 0.7329 -0.0034 -0.0417 0.0109  469 ARG A NE    
1380 C CZ    . ARG A 177 ? 0.8868 0.7409 0.7167 -0.0075 -0.0428 0.0111  469 ARG A CZ    
1381 N NH1   . ARG A 177 ? 1.0628 0.9153 0.8915 -0.0110 -0.0445 0.0113  469 ARG A NH1   
1382 N NH2   . ARG A 177 ? 0.6082 0.4685 0.4426 -0.0079 -0.0420 0.0110  469 ARG A NH2   
1383 N N     . LEU A 178 ? 0.5025 0.3566 0.3369 0.0053  -0.0319 0.0099  470 LEU A N     
1384 C CA    . LEU A 178 ? 0.4692 0.3245 0.3045 0.0047  -0.0306 0.0100  470 LEU A CA    
1385 C C     . LEU A 178 ? 0.5062 0.3590 0.3406 0.0087  -0.0283 0.0098  470 LEU A C     
1386 O O     . LEU A 178 ? 0.5566 0.4052 0.3867 0.0091  -0.0286 0.0100  470 LEU A O     
1387 C CB    . LEU A 178 ? 0.4763 0.3402 0.3192 0.0026  -0.0290 0.0096  470 LEU A CB    
1388 C CG    . LEU A 178 ? 0.4886 0.3557 0.3322 -0.0019 -0.0312 0.0097  470 LEU A CG    
1389 C CD1   . LEU A 178 ? 0.4852 0.3612 0.3370 -0.0032 -0.0295 0.0091  470 LEU A CD1   
1390 C CD2   . LEU A 178 ? 0.5324 0.3963 0.3708 -0.0043 -0.0332 0.0101  470 LEU A CD2   
1391 N N     . GLU A 179 ? 0.4657 0.3211 0.3040 0.0117  -0.0260 0.0093  471 GLU A N     
1392 C CA    . GLU A 179 ? 0.5180 0.3718 0.3559 0.0154  -0.0236 0.0091  471 GLU A CA    
1393 C C     . GLU A 179 ? 0.5929 0.4381 0.4224 0.0176  -0.0254 0.0093  471 GLU A C     
1394 O O     . GLU A 179 ? 0.5746 0.4166 0.4011 0.0192  -0.0247 0.0095  471 GLU A O     
1395 C CB    . GLU A 179 ? 0.5953 0.4537 0.4386 0.0180  -0.0211 0.0084  471 GLU A CB    
1396 C CG    . GLU A 179 ? 0.7321 0.5892 0.5749 0.0218  -0.0185 0.0082  471 GLU A CG    
1397 C CD    . GLU A 179 ? 0.8568 0.7194 0.7055 0.0239  -0.0159 0.0075  471 GLU A CD    
1398 O OE1   . GLU A 179 ? 0.8630 0.7321 0.7184 0.0222  -0.0143 0.0073  471 GLU A OE1   
1399 O OE2   . GLU A 179 ? 0.9590 0.8195 0.8054 0.0273  -0.0156 0.0070  471 GLU A OE2   
1400 N N     . ALA A 180 ? 0.6113 0.4528 0.4370 0.0178  -0.0279 0.0093  472 ALA A N     
1401 C CA    . ALA A 180 ? 0.6568 0.4897 0.4741 0.0200  -0.0301 0.0095  472 ALA A CA    
1402 C C     . ALA A 180 ? 0.6331 0.4625 0.4472 0.0176  -0.0317 0.0096  472 ALA A C     
1403 O O     . ALA A 180 ? 0.6586 0.4840 0.4698 0.0196  -0.0316 0.0091  472 ALA A O     
1404 C CB    . ALA A 180 ? 0.6581 0.4880 0.4722 0.0201  -0.0328 0.0094  472 ALA A CB    
1405 N N     . GLU A 181 ? 0.6100 0.4423 0.4262 0.0132  -0.0328 0.0099  473 GLU A N     
1406 C CA    . GLU A 181 ? 0.5574 0.3884 0.3728 0.0104  -0.0340 0.0096  473 GLU A CA    
1407 C C     . GLU A 181 ? 0.6355 0.4675 0.4516 0.0115  -0.0319 0.0097  473 GLU A C     
1408 O O     . GLU A 181 ? 0.6054 0.4342 0.4193 0.0116  -0.0323 0.0093  473 GLU A O     
1409 C CB    . GLU A 181 ? 0.6302 0.4647 0.4478 0.0055  -0.0356 0.0099  473 GLU A CB    
1410 C CG    . GLU A 181 ? 0.7434 0.5773 0.5605 0.0024  -0.0368 0.0097  473 GLU A CG    
1411 C CD    . GLU A 181 ? 0.9125 0.7400 0.7253 0.0023  -0.0389 0.0092  473 GLU A CD    
1412 O OE1   . GLU A 181 ? 0.9228 0.7461 0.7330 0.0048  -0.0395 0.0089  473 GLU A OE1   
1413 O OE2   . GLU A 181 ? 0.9016 0.7281 0.7136 -0.0003 -0.0399 0.0091  473 GLU A OE2   
1414 N N     . VAL A 182 ? 0.5093 0.3455 0.3283 0.0122  -0.0297 0.0102  474 VAL A N     
1415 C CA    . VAL A 182 ? 0.5105 0.3474 0.3300 0.0135  -0.0275 0.0103  474 VAL A CA    
1416 C C     . VAL A 182 ? 0.5855 0.4178 0.4019 0.0176  -0.0263 0.0100  474 VAL A C     
1417 O O     . VAL A 182 ? 0.6277 0.4579 0.4427 0.0181  -0.0259 0.0097  474 VAL A O     
1418 C CB    . VAL A 182 ? 0.4893 0.3340 0.3168 0.0133  -0.0246 0.0100  474 VAL A CB    
1419 C CG1   . VAL A 182 ? 0.5011 0.3462 0.3297 0.0153  -0.0219 0.0098  474 VAL A CG1   
1420 C CG2   . VAL A 182 ? 0.5064 0.3564 0.3375 0.0092  -0.0257 0.0099  474 VAL A CG2   
1421 N N     . PHE A 183 ? 0.5766 0.4077 0.3922 0.0207  -0.0256 0.0101  475 PHE A N     
1422 C CA    . PHE A 183 ? 0.6398 0.4670 0.4522 0.0250  -0.0244 0.0098  475 PHE A CA    
1423 C C     . PHE A 183 ? 0.6219 0.4440 0.4307 0.0250  -0.0266 0.0089  475 PHE A C     
1424 O O     . PHE A 183 ? 0.6298 0.4489 0.4362 0.0275  -0.0258 0.0084  475 PHE A O     
1425 C CB    . PHE A 183 ? 0.6163 0.4453 0.4307 0.0280  -0.0232 0.0094  475 PHE A CB    
1426 C CG    . PHE A 183 ? 0.5950 0.4321 0.4178 0.0281  -0.0197 0.0090  475 PHE A CG    
1427 C CD1   . PHE A 183 ? 0.6278 0.4689 0.4548 0.0261  -0.0179 0.0092  475 PHE A CD1   
1428 C CD2   . PHE A 183 ? 0.6073 0.4477 0.4334 0.0303  -0.0184 0.0084  475 PHE A CD2   
1429 C CE1   . PHE A 183 ? 0.6496 0.4976 0.4838 0.0261  -0.0149 0.0089  475 PHE A CE1   
1430 C CE2   . PHE A 183 ? 0.6015 0.4492 0.4351 0.0302  -0.0152 0.0081  475 PHE A CE2   
1431 C CZ    . PHE A 183 ? 0.5967 0.4480 0.4343 0.0280  -0.0135 0.0084  475 PHE A CZ    
1432 N N     . ARG A 184 ? 0.6142 0.4351 0.4223 0.0222  -0.0294 0.0085  476 ARG A N     
1433 C CA    . ARG A 184 ? 0.7073 0.5231 0.5118 0.0217  -0.0317 0.0077  476 ARG A CA    
1434 C C     . ARG A 184 ? 0.7212 0.5368 0.5257 0.0196  -0.0317 0.0076  476 ARG A C     
1435 O O     . ARG A 184 ? 0.6732 0.4849 0.4748 0.0211  -0.0320 0.0069  476 ARG A O     
1436 C CB    . ARG A 184 ? 0.7385 0.5531 0.5423 0.0188  -0.0345 0.0076  476 ARG A CB    
1437 C CG    . ARG A 184 ? 0.8330 0.6417 0.6326 0.0184  -0.0369 0.0068  476 ARG A CG    
1438 C CD    . ARG A 184 ? 0.8957 0.7034 0.6949 0.0148  -0.0396 0.0068  476 ARG A CD    
1439 N NE    . ARG A 184 ? 0.9392 0.7506 0.7412 0.0100  -0.0401 0.0075  476 ARG A NE    
1440 C CZ    . ARG A 184 ? 0.9819 0.7916 0.7828 0.0074  -0.0412 0.0074  476 ARG A CZ    
1441 N NH1   . ARG A 184 ? 0.9977 0.8018 0.7947 0.0091  -0.0420 0.0067  476 ARG A NH1   
1442 N NH2   . ARG A 184 ? 0.9945 0.8084 0.7982 0.0032  -0.0416 0.0080  476 ARG A NH2   
1443 N N     . LEU A 185 ? 0.6364 0.4565 0.4443 0.0162  -0.0315 0.0081  477 LEU A N     
1444 C CA    . LEU A 185 ? 0.6281 0.4487 0.4363 0.0141  -0.0317 0.0080  477 LEU A CA    
1445 C C     . LEU A 185 ? 0.6844 0.5046 0.4923 0.0172  -0.0292 0.0078  477 LEU A C     
1446 O O     . LEU A 185 ? 0.6826 0.5009 0.4891 0.0170  -0.0295 0.0074  477 LEU A O     
1447 C CB    . LEU A 185 ? 0.7256 0.5519 0.5376 0.0103  -0.0319 0.0085  477 LEU A CB    
1448 C CG    . LEU A 185 ? 0.7770 0.6039 0.5892 0.0058  -0.0344 0.0084  477 LEU A CG    
1449 C CD1   . LEU A 185 ? 0.6803 0.5017 0.4889 0.0056  -0.0366 0.0081  477 LEU A CD1   
1450 C CD2   . LEU A 185 ? 0.6788 0.5115 0.4947 0.0027  -0.0348 0.0089  477 LEU A CD2   
1451 N N     . ALA A 186 ? 0.5962 0.4182 0.4054 0.0200  -0.0268 0.0083  478 ALA A N     
1452 C CA    . ALA A 186 ? 0.5991 0.4208 0.4081 0.0229  -0.0242 0.0084  478 ALA A CA    
1453 C C     . ALA A 186 ? 0.6505 0.4674 0.4557 0.0267  -0.0239 0.0078  478 ALA A C     
1454 O O     . ALA A 186 ? 0.6785 0.4943 0.4827 0.0289  -0.0221 0.0076  478 ALA A O     
1455 C CB    . ALA A 186 ? 0.5774 0.4029 0.3892 0.0241  -0.0216 0.0093  478 ALA A CB    
1456 N N     . GLY A 187 ? 0.6781 0.4924 0.4811 0.0275  -0.0256 0.0074  479 GLY A N     
1457 C CA    . GLY A 187 ? 0.7971 0.6070 0.5963 0.0312  -0.0256 0.0066  479 GLY A CA    
1458 C C     . GLY A 187 ? 0.7662 0.5771 0.5653 0.0353  -0.0233 0.0070  479 GLY A C     
1459 O O     . GLY A 187 ? 0.7412 0.5489 0.5371 0.0388  -0.0234 0.0063  479 GLY A O     
1460 N N     . HIS A 188 ? 0.6428 0.4581 0.4454 0.0350  -0.0214 0.0080  480 HIS A N     
1461 C CA    . HIS A 188 ? 0.6347 0.4513 0.4374 0.0386  -0.0190 0.0085  480 HIS A CA    
1462 C C     . HIS A 188 ? 0.7312 0.5535 0.5390 0.0369  -0.0175 0.0093  480 HIS A C     
1463 O O     . HIS A 188 ? 0.7693 0.5942 0.5800 0.0334  -0.0177 0.0097  480 HIS A O     
1464 C CB    . HIS A 188 ? 0.7427 0.5587 0.5444 0.0414  -0.0162 0.0087  480 HIS A CB    
1465 C CG    . HIS A 188 ? 0.8404 0.6584 0.6445 0.0391  -0.0148 0.0092  480 HIS A CG    
1466 N ND1   . HIS A 188 ? 0.9107 0.7339 0.7197 0.0378  -0.0125 0.0099  480 HIS A ND1   
1467 C CD2   . HIS A 188 ? 0.8783 0.6948 0.6817 0.0377  -0.0153 0.0087  480 HIS A CD2   
1468 C CE1   . HIS A 188 ? 0.8912 0.7144 0.7006 0.0361  -0.0119 0.0102  480 HIS A CE1   
1469 N NE2   . HIS A 188 ? 0.8803 0.6998 0.6866 0.0361  -0.0136 0.0094  480 HIS A NE2   
1470 N N     . PRO A 189 ? 0.7850 0.6115 0.5967 0.0389  -0.0157 0.0088  481 PRO A N     
1471 C CA    . PRO A 189 ? 0.7266 0.5609 0.5463 0.0369  -0.0136 0.0086  481 PRO A CA    
1472 C C     . PRO A 189 ? 0.7375 0.5759 0.5615 0.0367  -0.0102 0.0088  481 PRO A C     
1473 O O     . PRO A 189 ? 0.7538 0.5900 0.5753 0.0392  -0.0085 0.0089  481 PRO A O     
1474 C CB    . PRO A 189 ? 0.7347 0.5715 0.5563 0.0396  -0.0129 0.0079  481 PRO A CB    
1475 C CG    . PRO A 189 ? 0.7799 0.6120 0.5959 0.0438  -0.0127 0.0076  481 PRO A CG    
1476 C CD    . PRO A 189 ? 0.7691 0.5935 0.5778 0.0432  -0.0156 0.0081  481 PRO A CD    
1477 N N     . PHE A 190 ? 0.6542 0.4981 0.4843 0.0337  -0.0091 0.0089  482 PHE A N     
1478 C CA    . PHE A 190 ? 0.6151 0.4629 0.4495 0.0333  -0.0059 0.0091  482 PHE A CA    
1479 C C     . PHE A 190 ? 0.6239 0.4789 0.4659 0.0309  -0.0048 0.0089  482 PHE A C     
1480 O O     . PHE A 190 ? 0.6291 0.4858 0.4728 0.0296  -0.0066 0.0086  482 PHE A O     
1481 C CB    . PHE A 190 ? 0.6231 0.4677 0.4546 0.0320  -0.0065 0.0095  482 PHE A CB    
1482 C CG    . PHE A 190 ? 0.5674 0.4122 0.3991 0.0284  -0.0092 0.0096  482 PHE A CG    
1483 C CD1   . PHE A 190 ? 0.5578 0.3979 0.3844 0.0277  -0.0125 0.0097  482 PHE A CD1   
1484 C CD2   . PHE A 190 ? 0.5315 0.3810 0.3682 0.0258  -0.0083 0.0096  482 PHE A CD2   
1485 C CE1   . PHE A 190 ? 0.5188 0.3596 0.3455 0.0242  -0.0149 0.0098  482 PHE A CE1   
1486 C CE2   . PHE A 190 ? 0.5138 0.3641 0.3507 0.0226  -0.0108 0.0095  482 PHE A CE2   
1487 C CZ    . PHE A 190 ? 0.5200 0.3663 0.3521 0.0217  -0.0140 0.0096  482 PHE A CZ    
1488 N N     . ASN A 191 ? 0.6656 0.5245 0.5119 0.0305  -0.0020 0.0089  483 ASN A N     
1489 C CA    . ASN A 191 ? 0.6180 0.4834 0.4714 0.0282  -0.0009 0.0087  483 ASN A CA    
1490 C C     . ASN A 191 ? 0.5875 0.4535 0.4418 0.0249  -0.0030 0.0088  483 ASN A C     
1491 O O     . ASN A 191 ? 0.6004 0.4661 0.4548 0.0238  -0.0025 0.0090  483 ASN A O     
1492 C CB    . ASN A 191 ? 0.6269 0.4957 0.4841 0.0286  0.0027  0.0088  483 ASN A CB    
1493 C CG    . ASN A 191 ? 0.6351 0.5107 0.4998 0.0267  0.0039  0.0085  483 ASN A CG    
1494 O OD1   . ASN A 191 ? 0.6580 0.5360 0.5252 0.0248  0.0020  0.0083  483 ASN A OD1   
1495 N ND2   . ASN A 191 ? 0.6247 0.5033 0.4927 0.0270  0.0070  0.0086  483 ASN A ND2   
1496 N N     . LEU A 192 ? 0.5620 0.4289 0.4168 0.0233  -0.0055 0.0086  484 LEU A N     
1497 C CA    . LEU A 192 ? 0.5179 0.3855 0.3730 0.0202  -0.0078 0.0087  484 LEU A CA    
1498 C C     . LEU A 192 ? 0.5925 0.4662 0.4541 0.0181  -0.0065 0.0084  484 LEU A C     
1499 O O     . LEU A 192 ? 0.6179 0.4929 0.4802 0.0158  -0.0079 0.0083  484 LEU A O     
1500 C CB    . LEU A 192 ? 0.5830 0.4501 0.4370 0.0190  -0.0106 0.0086  484 LEU A CB    
1501 C CG    . LEU A 192 ? 0.6473 0.5132 0.4988 0.0160  -0.0137 0.0087  484 LEU A CG    
1502 C CD1   . LEU A 192 ? 0.7511 0.6130 0.5983 0.0159  -0.0141 0.0089  484 LEU A CD1   
1503 C CD2   . LEU A 192 ? 0.6573 0.5194 0.5045 0.0158  -0.0165 0.0089  484 LEU A CD2   
1504 N N     . ASN A 193 ? 0.5785 0.4560 0.4448 0.0192  -0.0038 0.0083  485 ASN A N     
1505 C CA    . ASN A 193 ? 0.5969 0.4798 0.4692 0.0175  -0.0023 0.0080  485 ASN A CA    
1506 C C     . ASN A 193 ? 0.5675 0.4492 0.4393 0.0181  -0.0002 0.0083  485 ASN A C     
1507 O O     . ASN A 193 ? 0.5676 0.4529 0.4437 0.0168  0.0009  0.0081  485 ASN A O     
1508 C CB    . ASN A 193 ? 0.6164 0.5046 0.4945 0.0178  -0.0008 0.0077  485 ASN A CB    
1509 C CG    . ASN A 193 ? 0.6167 0.5063 0.4956 0.0170  -0.0030 0.0074  485 ASN A CG    
1510 O OD1   . ASN A 193 ? 0.6197 0.5103 0.4990 0.0147  -0.0053 0.0073  485 ASN A OD1   
1511 N ND2   . ASN A 193 ? 0.6450 0.5349 0.5241 0.0189  -0.0025 0.0071  485 ASN A ND2   
1512 N N     . SER A 194 ? 0.5685 0.4449 0.4349 0.0200  0.0002  0.0087  486 SER A N     
1513 C CA    . SER A 194 ? 0.5767 0.4511 0.4416 0.0207  0.0021  0.0090  486 SER A CA    
1514 C C     . SER A 194 ? 0.5267 0.3977 0.3877 0.0197  0.0001  0.0089  486 SER A C     
1515 O O     . SER A 194 ? 0.4797 0.3461 0.3353 0.0204  -0.0017 0.0091  486 SER A O     
1516 C CB    . SER A 194 ? 0.6430 0.5137 0.5041 0.0236  0.0040  0.0094  486 SER A CB    
1517 O OG    . SER A 194 ? 0.6560 0.5237 0.5146 0.0241  0.0054  0.0097  486 SER A OG    
1518 N N     . ARG A 195 ? 0.5467 0.4197 0.4100 0.0182  0.0002  0.0087  487 ARG A N     
1519 C CA    . ARG A 195 ? 0.5045 0.3748 0.3642 0.0174  -0.0017 0.0084  487 ARG A CA    
1520 C C     . ARG A 195 ? 0.5200 0.3843 0.3739 0.0195  -0.0009 0.0088  487 ARG A C     
1521 O O     . ARG A 195 ? 0.5101 0.3709 0.3595 0.0194  -0.0029 0.0087  487 ARG A O     
1522 C CB    . ARG A 195 ? 0.4884 0.3624 0.3519 0.0157  -0.0019 0.0078  487 ARG A CB    
1523 C CG    . ARG A 195 ? 0.4819 0.3565 0.3476 0.0163  0.0008  0.0080  487 ARG A CG    
1524 C CD    . ARG A 195 ? 0.4869 0.3565 0.3479 0.0175  0.0015  0.0082  487 ARG A CD    
1525 N NE    . ARG A 195 ? 0.5625 0.4307 0.4205 0.0168  -0.0012 0.0075  487 ARG A NE    
1526 C CZ    . ARG A 195 ? 0.5523 0.4153 0.4046 0.0180  -0.0018 0.0076  487 ARG A CZ    
1527 N NH1   . ARG A 195 ? 0.5127 0.3713 0.3614 0.0201  0.0001  0.0083  487 ARG A NH1   
1528 N NH2   . ARG A 195 ? 0.5181 0.3807 0.3682 0.0172  -0.0043 0.0068  487 ARG A NH2   
1529 N N     . ASP A 196 ? 0.4874 0.3505 0.3412 0.0213  0.0019  0.0094  488 ASP A N     
1530 C CA    . ASP A 196 ? 0.5217 0.3792 0.3699 0.0235  0.0029  0.0098  488 ASP A CA    
1531 C C     . ASP A 196 ? 0.5013 0.3549 0.3447 0.0249  0.0014  0.0100  488 ASP A C     
1532 O O     . ASP A 196 ? 0.5434 0.3922 0.3815 0.0258  0.0002  0.0100  488 ASP A O     
1533 C CB    . ASP A 196 ? 0.5762 0.4341 0.4256 0.0249  0.0064  0.0103  488 ASP A CB    
1534 C CG    . ASP A 196 ? 0.6890 0.5483 0.5408 0.0237  0.0077  0.0103  488 ASP A CG    
1535 O OD1   . ASP A 196 ? 0.6824 0.5411 0.5335 0.0225  0.0059  0.0098  488 ASP A OD1   
1536 O OD2   . ASP A 196 ? 0.8632 0.7243 0.7175 0.0239  0.0104  0.0107  488 ASP A OD2   
1537 N N     . GLN A 197 ? 0.5135 0.3692 0.3588 0.0253  0.0014  0.0100  489 GLN A N     
1538 C CA    . GLN A 197 ? 0.5639 0.4157 0.4046 0.0267  -0.0004 0.0101  489 GLN A CA    
1539 C C     . GLN A 197 ? 0.5440 0.3942 0.3824 0.0247  -0.0039 0.0098  489 GLN A C     
1540 O O     . GLN A 197 ? 0.5238 0.3688 0.3564 0.0256  -0.0056 0.0099  489 GLN A O     
1541 C CB    . GLN A 197 ? 0.5845 0.4387 0.4275 0.0277  0.0003  0.0100  489 GLN A CB    
1542 C CG    . GLN A 197 ? 0.6919 0.5476 0.5365 0.0299  0.0037  0.0102  489 GLN A CG    
1543 C CD    . GLN A 197 ? 0.7317 0.5888 0.5770 0.0317  0.0041  0.0099  489 GLN A CD    
1544 O OE1   . GLN A 197 ? 0.7532 0.6075 0.5952 0.0324  0.0017  0.0097  489 GLN A OE1   
1545 N NE2   . GLN A 197 ? 0.7544 0.6157 0.6037 0.0324  0.0070  0.0099  489 GLN A NE2   
1546 N N     . LEU A 198 ? 0.5431 0.3978 0.3856 0.0220  -0.0050 0.0094  490 LEU A N     
1547 C CA    . LEU A 198 ? 0.4840 0.3381 0.3246 0.0198  -0.0082 0.0091  490 LEU A CA    
1548 C C     . LEU A 198 ? 0.4415 0.2919 0.2778 0.0199  -0.0090 0.0090  490 LEU A C     
1549 O O     . LEU A 198 ? 0.4705 0.3173 0.3021 0.0194  -0.0114 0.0089  490 LEU A O     
1550 C CB    . LEU A 198 ? 0.4714 0.3318 0.3177 0.0169  -0.0090 0.0086  490 LEU A CB    
1551 C CG    . LEU A 198 ? 0.7039 0.5666 0.5518 0.0153  -0.0108 0.0085  490 LEU A CG    
1552 C CD1   . LEU A 198 ? 0.6717 0.5295 0.5136 0.0149  -0.0137 0.0088  490 LEU A CD1   
1553 C CD2   . LEU A 198 ? 0.8392 0.7039 0.6903 0.0168  -0.0090 0.0087  490 LEU A CD2   
1554 N N     . GLU A 199 ? 0.4181 0.2695 0.2560 0.0203  -0.0071 0.0088  491 GLU A N     
1555 C CA    . GLU A 199 ? 0.4506 0.2987 0.2846 0.0207  -0.0078 0.0086  491 GLU A CA    
1556 C C     . GLU A 199 ? 0.4912 0.3326 0.3186 0.0229  -0.0082 0.0090  491 GLU A C     
1557 O O     . GLU A 199 ? 0.4916 0.3298 0.3147 0.0225  -0.0103 0.0087  491 GLU A O     
1558 C CB    . GLU A 199 ? 0.4786 0.3276 0.3146 0.0214  -0.0054 0.0085  491 GLU A CB    
1559 C CG    . GLU A 199 ? 0.5318 0.3771 0.3635 0.0220  -0.0061 0.0081  491 GLU A CG    
1560 C CD    . GLU A 199 ? 0.6085 0.4535 0.4410 0.0230  -0.0038 0.0081  491 GLU A CD    
1561 O OE1   . GLU A 199 ? 0.5131 0.3608 0.3497 0.0230  -0.0016 0.0085  491 GLU A OE1   
1562 O OE2   . GLU A 199 ? 0.6086 0.4505 0.4376 0.0237  -0.0043 0.0077  491 GLU A OE2   
1563 N N     . ARG A 200 ? 0.4807 0.3203 0.3074 0.0252  -0.0062 0.0096  492 ARG A N     
1564 C CA    . ARG A 200 ? 0.5372 0.3707 0.3578 0.0277  -0.0064 0.0099  492 ARG A CA    
1565 C C     . ARG A 200 ? 0.5781 0.4089 0.3951 0.0269  -0.0096 0.0099  492 ARG A C     
1566 O O     . ARG A 200 ? 0.5458 0.3735 0.3597 0.0270  -0.0112 0.0092  492 ARG A O     
1567 C CB    . ARG A 200 ? 0.6579 0.4913 0.4791 0.0303  -0.0037 0.0104  492 ARG A CB    
1568 C CG    . ARG A 200 ? 0.8247 0.6522 0.6397 0.0333  -0.0038 0.0107  492 ARG A CG    
1569 C CD    . ARG A 200 ? 0.9736 0.8023 0.7898 0.0356  -0.0015 0.0110  492 ARG A CD    
1570 N NE    . ARG A 200 ? 1.1071 0.9383 0.9257 0.0349  -0.0028 0.0108  492 ARG A NE    
1571 C CZ    . ARG A 200 ? 1.1583 0.9944 0.9818 0.0352  -0.0009 0.0107  492 ARG A CZ    
1572 N NH1   . ARG A 200 ? 1.1422 0.9813 0.9689 0.0358  0.0024  0.0109  492 ARG A NH1   
1573 N NH2   . ARG A 200 ? 1.1775 1.0154 1.0026 0.0347  -0.0024 0.0104  492 ARG A NH2   
1574 N N     . VAL A 201 ? 0.5336 0.3673 0.3533 0.0257  -0.0104 0.0099  493 VAL A N     
1575 C CA    . VAL A 201 ? 0.4856 0.3165 0.3018 0.0248  -0.0135 0.0099  493 VAL A CA    
1576 C C     . VAL A 201 ? 0.5490 0.3809 0.3654 0.0218  -0.0160 0.0091  493 VAL A C     
1577 O O     . VAL A 201 ? 0.5144 0.3435 0.3286 0.0215  -0.0177 0.0083  493 VAL A O     
1578 C CB    . VAL A 201 ? 0.5153 0.3499 0.3353 0.0237  -0.0139 0.0099  493 VAL A CB    
1579 C CG1   . VAL A 201 ? 0.5093 0.3416 0.3262 0.0218  -0.0174 0.0098  493 VAL A CG1   
1580 C CG2   . VAL A 201 ? 0.5827 0.4173 0.4036 0.0267  -0.0116 0.0101  493 VAL A CG2   
1581 N N     . LEU A 202 ? 0.4984 0.3343 0.3174 0.0195  -0.0162 0.0091  494 LEU A N     
1582 C CA    . LEU A 202 ? 0.4271 0.2650 0.2467 0.0166  -0.0185 0.0082  494 LEU A CA    
1583 C C     . LEU A 202 ? 0.4636 0.2992 0.2813 0.0174  -0.0186 0.0075  494 LEU A C     
1584 O O     . LEU A 202 ? 0.5243 0.3590 0.3409 0.0159  -0.0207 0.0067  494 LEU A O     
1585 C CB    . LEU A 202 ? 0.4090 0.2532 0.2332 0.0143  -0.0185 0.0080  494 LEU A CB    
1586 C CG    . LEU A 202 ? 0.4061 0.2549 0.2348 0.0126  -0.0188 0.0081  494 LEU A CG    
1587 C CD1   . LEU A 202 ? 0.4497 0.3056 0.2845 0.0105  -0.0185 0.0074  494 LEU A CD1   
1588 C CD2   . LEU A 202 ? 0.5379 0.3845 0.3631 0.0106  -0.0218 0.0083  494 LEU A CD2   
1589 N N     . PHE A 203 ? 0.4394 0.2739 0.2566 0.0196  -0.0163 0.0076  495 PHE A N     
1590 C CA    . PHE A 203 ? 0.4422 0.2752 0.2580 0.0201  -0.0164 0.0068  495 PHE A CA    
1591 C C     . PHE A 203 ? 0.5787 0.4066 0.3913 0.0229  -0.0155 0.0066  495 PHE A C     
1592 O O     . PHE A 203 ? 0.6224 0.4484 0.4334 0.0230  -0.0164 0.0057  495 PHE A O     
1593 C CB    . PHE A 203 ? 0.4244 0.2596 0.2415 0.0203  -0.0150 0.0067  495 PHE A CB    
1594 C CG    . PHE A 203 ? 0.4443 0.2851 0.2648 0.0176  -0.0162 0.0065  495 PHE A CG    
1595 C CD1   . PHE A 203 ? 0.4997 0.3434 0.3210 0.0148  -0.0189 0.0056  495 PHE A CD1   
1596 C CD2   . PHE A 203 ? 0.4754 0.3207 0.3015 0.0174  -0.0142 0.0066  495 PHE A CD2   
1597 C CE1   . PHE A 203 ? 0.5085 0.3581 0.3334 0.0123  -0.0199 0.0051  495 PHE A CE1   
1598 C CE2   . PHE A 203 ? 0.4466 0.2983 0.2778 0.0149  -0.0151 0.0059  495 PHE A CE2   
1599 C CZ    . PHE A 203 ? 0.4858 0.3397 0.3163 0.0125  -0.0179 0.0052  495 PHE A CZ    
1600 N N     . ASP A 204 ? 0.5989 0.4250 0.4108 0.0252  -0.0135 0.0073  496 ASP A N     
1601 C CA    . ASP A 204 ? 0.6054 0.4272 0.4143 0.0280  -0.0127 0.0070  496 ASP A CA    
1602 C C     . ASP A 204 ? 0.6745 0.4941 0.4817 0.0279  -0.0146 0.0067  496 ASP A C     
1603 O O     . ASP A 204 ? 0.6927 0.5096 0.4977 0.0278  -0.0162 0.0058  496 ASP A O     
1604 C CB    . ASP A 204 ? 0.6065 0.4277 0.4153 0.0307  -0.0094 0.0079  496 ASP A CB    
1605 C CG    . ASP A 204 ? 0.6006 0.4227 0.4103 0.0310  -0.0074 0.0081  496 ASP A CG    
1606 O OD1   . ASP A 204 ? 0.6688 0.4905 0.4779 0.0303  -0.0084 0.0073  496 ASP A OD1   
1607 O OD2   . ASP A 204 ? 0.7033 0.5263 0.5141 0.0320  -0.0049 0.0092  496 ASP A OD2   
1608 N N     . GLU A 205 ? 0.5445 0.3650 0.3525 0.0280  -0.0146 0.0073  497 GLU A N     
1609 C CA    . GLU A 205 ? 0.5161 0.3341 0.3222 0.0283  -0.0164 0.0069  497 GLU A CA    
1610 C C     . GLU A 205 ? 0.5932 0.4111 0.3991 0.0251  -0.0195 0.0064  497 GLU A C     
1611 O O     . GLU A 205 ? 0.5831 0.3974 0.3863 0.0253  -0.0211 0.0056  497 GLU A O     
1612 C CB    . GLU A 205 ? 0.5939 0.4129 0.4008 0.0293  -0.0156 0.0077  497 GLU A CB    
1613 C CG    . GLU A 205 ? 0.7500 0.5685 0.5563 0.0327  -0.0125 0.0083  497 GLU A CG    
1614 C CD    . GLU A 205 ? 0.8228 0.6428 0.6303 0.0337  -0.0118 0.0091  497 GLU A CD    
1615 O OE1   . GLU A 205 ? 0.8113 0.6321 0.6194 0.0320  -0.0139 0.0090  497 GLU A OE1   
1616 O OE2   . GLU A 205 ? 0.9172 0.7377 0.7247 0.0362  -0.0090 0.0098  497 GLU A OE2   
1617 N N     . LEU A 206 ? 0.5029 0.3247 0.3116 0.0221  -0.0205 0.0067  498 LEU A N     
1618 C CA    . LEU A 206 ? 0.5100 0.3324 0.3188 0.0187  -0.0234 0.0062  498 LEU A CA    
1619 C C     . LEU A 206 ? 0.5526 0.3759 0.3616 0.0173  -0.0241 0.0056  498 LEU A C     
1620 O O     . LEU A 206 ? 0.5856 0.4094 0.3946 0.0145  -0.0263 0.0053  498 LEU A O     
1621 C CB    . LEU A 206 ? 0.5165 0.3430 0.3281 0.0159  -0.0244 0.0068  498 LEU A CB    
1622 C CG    . LEU A 206 ? 0.5097 0.3356 0.3212 0.0169  -0.0241 0.0074  498 LEU A CG    
1623 C CD1   . LEU A 206 ? 0.5316 0.3621 0.3462 0.0141  -0.0250 0.0078  498 LEU A CD1   
1624 C CD2   . LEU A 206 ? 0.4902 0.3114 0.2985 0.0175  -0.0259 0.0069  498 LEU A CD2   
1625 N N     . GLY A 207 ? 0.5068 0.3303 0.3159 0.0191  -0.0221 0.0055  499 GLY A N     
1626 C CA    . GLY A 207 ? 0.5360 0.3599 0.3449 0.0185  -0.0226 0.0048  499 GLY A CA    
1627 C C     . GLY A 207 ? 0.5800 0.4088 0.3916 0.0151  -0.0242 0.0045  499 GLY A C     
1628 O O     . GLY A 207 ? 0.5048 0.3341 0.3162 0.0141  -0.0255 0.0038  499 GLY A O     
1629 N N     . LEU A 208 ? 0.4731 0.3063 0.2876 0.0135  -0.0242 0.0050  500 LEU A N     
1630 C CA    . LEU A 208 ? 0.4814 0.3203 0.2988 0.0103  -0.0256 0.0045  500 LEU A CA    
1631 C C     . LEU A 208 ? 0.5115 0.3522 0.3297 0.0113  -0.0246 0.0038  500 LEU A C     
1632 O O     . LEU A 208 ? 0.5014 0.3399 0.3186 0.0140  -0.0225 0.0041  500 LEU A O     
1633 C CB    . LEU A 208 ? 0.4603 0.3033 0.2804 0.0085  -0.0258 0.0051  500 LEU A CB    
1634 C CG    . LEU A 208 ? 0.5378 0.3787 0.3570 0.0078  -0.0267 0.0058  500 LEU A CG    
1635 C CD1   . LEU A 208 ? 0.5350 0.3804 0.3571 0.0059  -0.0269 0.0062  500 LEU A CD1   
1636 C CD2   . LEU A 208 ? 0.5816 0.4207 0.3993 0.0057  -0.0290 0.0055  500 LEU A CD2   
1637 N N     . PRO A 209 ? 0.4853 0.3301 0.3052 0.0092  -0.0262 0.0029  501 PRO A N     
1638 C CA    . PRO A 209 ? 0.5172 0.3639 0.3379 0.0103  -0.0255 0.0020  501 PRO A CA    
1639 C C     . PRO A 209 ? 0.5775 0.4279 0.4006 0.0104  -0.0243 0.0021  501 PRO A C     
1640 O O     . PRO A 209 ? 0.5460 0.4009 0.3718 0.0081  -0.0251 0.0022  501 PRO A O     
1641 C CB    . PRO A 209 ? 0.5728 0.4241 0.3955 0.0077  -0.0276 0.0010  501 PRO A CB    
1642 C CG    . PRO A 209 ? 0.5511 0.4047 0.3749 0.0045  -0.0293 0.0014  501 PRO A CG    
1643 C CD    . PRO A 209 ? 0.5392 0.3869 0.3602 0.0058  -0.0286 0.0026  501 PRO A CD    
1644 N N     . ALA A 210 ? 0.5742 0.4226 0.3963 0.0129  -0.0225 0.0020  502 ALA A N     
1645 C CA    . ALA A 210 ? 0.6458 0.4972 0.4698 0.0130  -0.0214 0.0020  502 ALA A CA    
1646 C C     . ALA A 210 ? 0.7485 0.6059 0.5755 0.0115  -0.0230 0.0004  502 ALA A C     
1647 O O     . ALA A 210 ? 0.7938 0.6516 0.6206 0.0117  -0.0240 -0.0006 502 ALA A O     
1648 C CB    . ALA A 210 ? 0.7290 0.5759 0.5507 0.0162  -0.0188 0.0026  502 ALA A CB    
1649 N N     . ILE A 211 ? 0.8450 0.7073 0.6750 0.0101  -0.0232 0.0001  503 ILE A N     
1650 C CA    . ILE A 211 ? 0.9582 0.8272 0.7917 0.0087  -0.0247 -0.0016 503 ILE A CA    
1651 C C     . ILE A 211 ? 0.9158 0.7850 0.7495 0.0105  -0.0237 -0.0022 503 ILE A C     
1652 O O     . ILE A 211 ? 1.0636 0.9338 0.8977 0.0115  -0.0241 -0.0035 503 ILE A O     
1653 C CB    . ILE A 211 ? 1.0345 0.9101 0.8718 0.0054  -0.0263 -0.0018 503 ILE A CB    
1654 C CG1   . ILE A 211 ? 1.0457 0.9200 0.8821 0.0036  -0.0272 -0.0009 503 ILE A CG1   
1655 C CG2   . ILE A 211 ? 1.0275 0.9109 0.8689 0.0040  -0.0279 -0.0036 503 ILE A CG2   
1656 C CD1   . ILE A 211 ? 1.0076 0.8884 0.8477 0.0002  -0.0288 -0.0010 503 ILE A CD1   
1657 N N     . GLY A 212 ? 0.8023 0.6719 0.6391 0.0108  -0.0217 -0.0013 504 GLY A N     
1658 C CA    . GLY A 212 ? 0.7740 0.6451 0.6138 0.0120  -0.0204 -0.0017 504 GLY A CA    
1659 C C     . GLY A 212 ? 0.6526 0.5183 0.4914 0.0143  -0.0174 -0.0004 504 GLY A C     
1660 O O     . GLY A 212 ? 0.5852 0.4474 0.4225 0.0148  -0.0161 0.0010  504 GLY A O     
1661 N N     . LYS A 213 ? 0.6216 0.4869 0.4612 0.0156  -0.0164 -0.0009 505 LYS A N     
1662 C CA    . LYS A 213 ? 0.6090 0.4698 0.4479 0.0174  -0.0135 0.0003  505 LYS A CA    
1663 C C     . LYS A 213 ? 0.6081 0.4731 0.4528 0.0165  -0.0123 0.0006  505 LYS A C     
1664 O O     . LYS A 213 ? 0.6414 0.5118 0.4898 0.0153  -0.0138 -0.0006 505 LYS A O     
1665 C CB    . LYS A 213 ? 0.6723 0.5285 0.5069 0.0195  -0.0134 -0.0003 505 LYS A CB    
1666 C CG    . LYS A 213 ? 0.8598 0.7122 0.6887 0.0205  -0.0149 -0.0008 505 LYS A CG    
1667 C CD    . LYS A 213 ? 0.9937 0.8390 0.8181 0.0226  -0.0128 0.0006  505 LYS A CD    
1668 C CE    . LYS A 213 ? 1.0212 0.8619 0.8421 0.0247  -0.0120 0.0002  505 LYS A CE    
1669 N NZ    . LYS A 213 ? 0.9718 0.8070 0.7903 0.0264  -0.0090 0.0019  505 LYS A NZ    
1670 N N     . THR A 214 ? 0.5077 0.3706 0.3535 0.0172  -0.0095 0.0020  506 THR A N     
1671 C CA    . THR A 214 ? 0.4969 0.3633 0.3480 0.0164  -0.0081 0.0023  506 THR A CA    
1672 C C     . THR A 214 ? 0.5713 0.4365 0.4219 0.0172  -0.0080 0.0015  506 THR A C     
1673 O O     . THR A 214 ? 0.5968 0.4572 0.4424 0.0188  -0.0083 0.0012  506 THR A O     
1674 C CB    . THR A 214 ? 0.5352 0.4002 0.3876 0.0168  -0.0052 0.0039  506 THR A CB    
1675 O OG1   . THR A 214 ? 0.4979 0.3568 0.3459 0.0187  -0.0032 0.0047  506 THR A OG1   
1676 C CG2   . THR A 214 ? 0.4873 0.3528 0.3395 0.0164  -0.0055 0.0045  506 THR A CG2   
1677 N N     . GLU A 215 ? 0.6158 0.4850 0.4711 0.0163  -0.0078 0.0012  507 GLU A N     
1678 C CA    . GLU A 215 ? 0.6489 0.5172 0.5037 0.0169  -0.0084 0.0003  507 GLU A CA    
1679 C C     . GLU A 215 ? 0.6910 0.5528 0.5421 0.0184  -0.0061 0.0012  507 GLU A C     
1680 O O     . GLU A 215 ? 0.7227 0.5802 0.5691 0.0199  -0.0069 0.0006  507 GLU A O     
1681 C CB    . GLU A 215 ? 0.6868 0.5610 0.5477 0.0155  -0.0088 -0.0003 507 GLU A CB    
1682 C CG    . GLU A 215 ? 0.8949 0.7755 0.7587 0.0142  -0.0117 -0.0018 507 GLU A CG    
1683 C CD    . GLU A 215 ? 1.1335 1.0200 1.0035 0.0124  -0.0113 -0.0014 507 GLU A CD    
1684 O OE1   . GLU A 215 ? 1.2443 1.1302 1.1168 0.0122  -0.0090 -0.0002 507 GLU A OE1   
1685 O OE2   . GLU A 215 ? 1.1603 1.0524 1.0328 0.0111  -0.0135 -0.0024 507 GLU A OE2   
1686 N N     . LYS A 216 ? 0.5952 0.4564 0.4484 0.0180  -0.0033 0.0027  508 LYS A N     
1687 C CA    . LYS A 216 ? 0.7092 0.5649 0.5594 0.0189  -0.0010 0.0037  508 LYS A CA    
1688 C C     . LYS A 216 ? 0.7098 0.5598 0.5546 0.0205  0.0005  0.0047  508 LYS A C     
1689 O O     . LYS A 216 ? 0.8143 0.6587 0.6543 0.0218  0.0011  0.0049  508 LYS A O     
1690 C CB    . LYS A 216 ? 0.8673 0.7253 0.7221 0.0177  0.0016  0.0048  508 LYS A CB    
1691 C CG    . LYS A 216 ? 0.9721 0.8362 0.8330 0.0161  0.0003  0.0040  508 LYS A CG    
1692 C CD    . LYS A 216 ? 1.0974 0.9599 0.9577 0.0161  -0.0004 0.0032  508 LYS A CD    
1693 C CE    . LYS A 216 ? 1.2033 1.0719 1.0698 0.0146  -0.0016 0.0024  508 LYS A CE    
1694 N NZ    . LYS A 216 ? 1.2792 1.1532 1.1480 0.0143  -0.0043 0.0010  508 LYS A NZ    
1695 N N     . THR A 217 ? 0.6200 0.4711 0.4652 0.0205  0.0009  0.0053  509 THR A N     
1696 C CA    . THR A 217 ? 0.6223 0.4684 0.4629 0.0220  0.0026  0.0064  509 THR A CA    
1697 C C     . THR A 217 ? 0.5603 0.4040 0.3964 0.0231  0.0005  0.0058  509 THR A C     
1698 O O     . THR A 217 ? 0.6206 0.4595 0.4521 0.0247  0.0015  0.0065  509 THR A O     
1699 C CB    . THR A 217 ? 0.6914 0.5395 0.5348 0.0216  0.0050  0.0077  509 THR A CB    
1700 O OG1   . THR A 217 ? 0.6852 0.5381 0.5321 0.0206  0.0034  0.0072  509 THR A OG1   
1701 C CG2   . THR A 217 ? 0.6817 0.5319 0.5291 0.0206  0.0073  0.0083  509 THR A CG2   
1702 N N     . GLY A 218 ? 0.5532 0.4004 0.3907 0.0222  -0.0023 0.0044  510 GLY A N     
1703 C CA    . GLY A 218 ? 0.5401 0.3856 0.3736 0.0229  -0.0046 0.0036  510 GLY A CA    
1704 C C     . GLY A 218 ? 0.5758 0.4204 0.4079 0.0231  -0.0045 0.0044  510 GLY A C     
1705 O O     . GLY A 218 ? 0.5253 0.3666 0.3528 0.0240  -0.0058 0.0041  510 GLY A O     
1706 N N     . LYS A 219 ? 0.5251 0.3723 0.3609 0.0222  -0.0031 0.0053  511 LYS A N     
1707 C CA    . LYS A 219 ? 0.5136 0.3601 0.3483 0.0224  -0.0032 0.0060  511 LYS A CA    
1708 C C     . LYS A 219 ? 0.5261 0.3757 0.3613 0.0208  -0.0063 0.0051  511 LYS A C     
1709 O O     . LYS A 219 ? 0.5122 0.3657 0.3498 0.0195  -0.0080 0.0039  511 LYS A O     
1710 C CB    . LYS A 219 ? 0.5284 0.3775 0.3671 0.0220  -0.0010 0.0070  511 LYS A CB    
1711 C CG    . LYS A 219 ? 0.6640 0.5105 0.5021 0.0233  0.0022  0.0080  511 LYS A CG    
1712 C CD    . LYS A 219 ? 0.7286 0.5782 0.5707 0.0230  0.0042  0.0088  511 LYS A CD    
1713 C CE    . LYS A 219 ? 0.8626 0.7104 0.7044 0.0239  0.0075  0.0098  511 LYS A CE    
1714 N NZ    . LYS A 219 ? 0.9800 0.8217 0.8155 0.0261  0.0084  0.0103  511 LYS A NZ    
1715 N N     . ARG A 220 ? 0.4191 0.2669 0.2519 0.0210  -0.0070 0.0055  512 ARG A N     
1716 C CA    . ARG A 220 ? 0.4375 0.2881 0.2706 0.0191  -0.0099 0.0048  512 ARG A CA    
1717 C C     . ARG A 220 ? 0.4540 0.3106 0.2931 0.0171  -0.0100 0.0048  512 ARG A C     
1718 O O     . ARG A 220 ? 0.4613 0.3180 0.3020 0.0173  -0.0086 0.0058  512 ARG A O     
1719 C CB    . ARG A 220 ? 0.4853 0.3315 0.3135 0.0198  -0.0109 0.0053  512 ARG A CB    
1720 C CG    . ARG A 220 ? 0.5185 0.3589 0.3406 0.0217  -0.0112 0.0051  512 ARG A CG    
1721 C CD    . ARG A 220 ? 0.4899 0.3250 0.3072 0.0230  -0.0114 0.0059  512 ARG A CD    
1722 N NE    . ARG A 220 ? 0.4983 0.3319 0.3162 0.0246  -0.0088 0.0071  512 ARG A NE    
1723 C CZ    . ARG A 220 ? 0.5303 0.3596 0.3447 0.0263  -0.0084 0.0076  512 ARG A CZ    
1724 N NH1   . ARG A 220 ? 0.5210 0.3485 0.3336 0.0263  -0.0102 0.0066  512 ARG A NH1   
1725 N NH2   . ARG A 220 ? 0.5394 0.3678 0.3541 0.0279  -0.0061 0.0087  512 ARG A NH2   
1726 N N     . SER A 221 ? 0.4482 0.3099 0.2904 0.0152  -0.0117 0.0037  513 SER A N     
1727 C CA    . SER A 221 ? 0.4291 0.2967 0.2771 0.0133  -0.0119 0.0037  513 SER A CA    
1728 C C     . SER A 221 ? 0.4311 0.2996 0.2789 0.0119  -0.0133 0.0041  513 SER A C     
1729 O O     . SER A 221 ? 0.4539 0.3201 0.2976 0.0114  -0.0152 0.0039  513 SER A O     
1730 C CB    . SER A 221 ? 0.4656 0.3386 0.3168 0.0119  -0.0135 0.0023  513 SER A CB    
1731 O OG    . SER A 221 ? 0.4775 0.3564 0.3343 0.0101  -0.0138 0.0022  513 SER A OG    
1732 N N     . THR A 222 ? 0.4144 0.2860 0.2664 0.0112  -0.0124 0.0047  514 THR A N     
1733 C CA    . THR A 222 ? 0.4185 0.2914 0.2708 0.0097  -0.0138 0.0050  514 THR A CA    
1734 C C     . THR A 222 ? 0.4311 0.3109 0.2890 0.0074  -0.0148 0.0044  514 THR A C     
1735 O O     . THR A 222 ? 0.4417 0.3234 0.3012 0.0062  -0.0155 0.0048  514 THR A O     
1736 C CB    . THR A 222 ? 0.4453 0.3156 0.2974 0.0112  -0.0121 0.0061  514 THR A CB    
1737 O OG1   . THR A 222 ? 0.4421 0.3160 0.2997 0.0115  -0.0099 0.0063  514 THR A OG1   
1738 C CG2   . THR A 222 ? 0.4621 0.3259 0.3090 0.0138  -0.0108 0.0067  514 THR A CG2   
1739 N N     . ARG A 223 ? 0.4084 0.2920 0.2691 0.0069  -0.0151 0.0034  515 ARG A N     
1740 C CA    A ARG A 223 ? 0.4171 0.3076 0.2833 0.0049  -0.0159 0.0027  515 ARG A CA    
1741 C CA    B ARG A 223 ? 0.4176 0.3080 0.2838 0.0049  -0.0159 0.0028  515 ARG A CA    
1742 C C     . ARG A 223 ? 0.4848 0.3779 0.3502 0.0024  -0.0187 0.0024  515 ARG A C     
1743 O O     . ARG A 223 ? 0.4375 0.3277 0.2982 0.0020  -0.0202 0.0023  515 ARG A O     
1744 C CB    A ARG A 223 ? 0.4395 0.3330 0.3080 0.0051  -0.0160 0.0016  515 ARG A CB    
1745 C CB    B ARG A 223 ? 0.4258 0.3193 0.2946 0.0052  -0.0158 0.0017  515 ARG A CB    
1746 C CG    A ARG A 223 ? 0.4174 0.3112 0.2827 0.0046  -0.0183 0.0003  515 ARG A CG    
1747 C CG    B ARG A 223 ? 0.4367 0.3310 0.3029 0.0047  -0.0181 0.0004  515 ARG A CG    
1748 C CD    A ARG A 223 ? 0.4995 0.3963 0.3670 0.0052  -0.0186 -0.0010 515 ARG A CD    
1749 C CD    B ARG A 223 ? 0.5075 0.4042 0.3759 0.0054  -0.0180 -0.0008 515 ARG A CD    
1750 N NE    A ARG A 223 ? 0.5294 0.4217 0.3958 0.0075  -0.0164 -0.0006 515 ARG A NE    
1751 N NE    B ARG A 223 ? 0.5656 0.4569 0.4297 0.0075  -0.0172 -0.0009 515 ARG A NE    
1752 C CZ    A ARG A 223 ? 0.5449 0.4324 0.4066 0.0091  -0.0163 -0.0008 515 ARG A CZ    
1753 C CZ    B ARG A 223 ? 0.5600 0.4501 0.4202 0.0079  -0.0190 -0.0019 515 ARG A CZ    
1754 N NH1   A ARG A 223 ? 0.5321 0.4190 0.3901 0.0088  -0.0184 -0.0017 515 ARG A NH1   
1755 N NH1   B ARG A 223 ? 0.5151 0.4092 0.3752 0.0060  -0.0215 -0.0029 515 ARG A NH1   
1756 N NH2   A ARG A 223 ? 0.4350 0.3184 0.2957 0.0110  -0.0142 -0.0003 515 ARG A NH2   
1757 N NH2   B ARG A 223 ? 0.5837 0.4684 0.4399 0.0100  -0.0182 -0.0020 515 ARG A NH2   
1758 N N     . ALA A 224 ? 0.4270 0.3258 0.2970 0.0006  -0.0193 0.0022  516 ALA A N     
1759 C CA    . ALA A 224 ? 0.4704 0.3720 0.3399 -0.0021 -0.0218 0.0020  516 ALA A CA    
1760 C C     . ALA A 224 ? 0.4575 0.3601 0.3239 -0.0034 -0.0241 0.0010  516 ALA A C     
1761 O O     . ALA A 224 ? 0.5350 0.4361 0.3978 -0.0051 -0.0259 0.0013  516 ALA A O     
1762 C CB    . ALA A 224 ? 0.4837 0.3921 0.3592 -0.0037 -0.0221 0.0017  516 ALA A CB    
1763 N N     . ALA A 225 ? 0.4857 0.3908 0.3534 -0.0027 -0.0242 -0.0002 517 ALA A N     
1764 C CA    . ALA A 225 ? 0.4989 0.4057 0.3639 -0.0038 -0.0264 -0.0015 517 ALA A CA    
1765 C C     . ALA A 225 ? 0.5582 0.4584 0.4167 -0.0031 -0.0268 -0.0011 517 ALA A C     
1766 O O     . ALA A 225 ? 0.5122 0.4132 0.3678 -0.0049 -0.0289 -0.0016 517 ALA A O     
1767 C CB    . ALA A 225 ? 0.5574 0.4675 0.4247 -0.0025 -0.0263 -0.0030 517 ALA A CB    
1768 N N     . VAL A 226 ? 0.4719 0.3658 0.3281 -0.0005 -0.0248 -0.0002 518 VAL A N     
1769 C CA    . VAL A 226 ? 0.4441 0.3313 0.2942 0.0006  -0.0250 0.0004  518 VAL A CA    
1770 C C     . VAL A 226 ? 0.5309 0.4157 0.3784 -0.0011 -0.0261 0.0014  518 VAL A C     
1771 O O     . VAL A 226 ? 0.5130 0.3957 0.3560 -0.0023 -0.0280 0.0013  518 VAL A O     
1772 C CB    . VAL A 226 ? 0.5061 0.3873 0.3545 0.0039  -0.0224 0.0011  518 VAL A CB    
1773 C CG1   . VAL A 226 ? 0.4672 0.3412 0.3092 0.0050  -0.0226 0.0018  518 VAL A CG1   
1774 C CG2   . VAL A 226 ? 0.5416 0.4240 0.3913 0.0054  -0.0217 0.0001  518 VAL A CG2   
1775 N N     . LEU A 227 ? 0.4739 0.3591 0.3240 -0.0012 -0.0251 0.0024  519 LEU A N     
1776 C CA    . LEU A 227 ? 0.4464 0.3289 0.2939 -0.0025 -0.0262 0.0034  519 LEU A CA    
1777 C C     . LEU A 227 ? 0.5150 0.4018 0.3623 -0.0062 -0.0290 0.0029  519 LEU A C     
1778 O O     . LEU A 227 ? 0.4977 0.3816 0.3413 -0.0076 -0.0306 0.0034  519 LEU A O     
1779 C CB    . LEU A 227 ? 0.4928 0.3758 0.3437 -0.0017 -0.0246 0.0043  519 LEU A CB    
1780 C CG    . LEU A 227 ? 0.6486 0.5253 0.4970 0.0012  -0.0227 0.0054  519 LEU A CG    
1781 C CD1   . LEU A 227 ? 0.5854 0.4580 0.4312 0.0038  -0.0212 0.0052  519 LEU A CD1   
1782 C CD2   . LEU A 227 ? 0.6056 0.4848 0.4591 0.0021  -0.0207 0.0057  519 LEU A CD2   
1783 N N     . GLU A 228 ? 0.5049 0.3991 0.3570 -0.0078 -0.0295 0.0019  520 GLU A N     
1784 C CA    . GLU A 228 ? 0.5393 0.4387 0.3918 -0.0114 -0.0319 0.0013  520 GLU A CA    
1785 C C     . GLU A 228 ? 0.5731 0.4729 0.4250 -0.0121 -0.0328 0.0007  520 GLU A C     
1786 O O     . GLU A 228 ? 0.5822 0.4836 0.4346 -0.0146 -0.0340 0.0009  520 GLU A O     
1787 C CB    . GLU A 228 ? 0.6126 0.5205 0.4708 -0.0124 -0.0321 0.0000  520 GLU A CB    
1788 C CG    . GLU A 228 ? 0.7411 0.6520 0.6043 -0.0126 -0.0311 0.0006  520 GLU A CG    
1789 C CD    . GLU A 228 ? 0.9636 0.8758 0.8262 -0.0157 -0.0327 0.0013  520 GLU A CD    
1790 O OE1   . GLU A 228 ? 1.0523 0.9648 0.9128 -0.0179 -0.0343 0.0013  520 GLU A OE1   
1791 O OE2   . GLU A 228 ? 1.0708 0.9845 0.9368 -0.0157 -0.0320 0.0019  520 GLU A OE2   
1792 N N     . ALA A 229 ? 0.4914 0.3895 0.3421 -0.0098 -0.0320 -0.0001 521 ALA A N     
1793 C CA    . ALA A 229 ? 0.5269 0.4253 0.3769 -0.0100 -0.0328 -0.0008 521 ALA A CA    
1794 C C     . ALA A 229 ? 0.6141 0.5050 0.4597 -0.0095 -0.0328 0.0003  521 ALA A C     
1795 O O     . ALA A 229 ? 0.5968 0.4879 0.4418 -0.0104 -0.0337 0.0000  521 ALA A O     
1796 C CB    . ALA A 229 ? 0.5461 0.4448 0.3962 -0.0076 -0.0321 -0.0020 521 ALA A CB    
1797 N N     . LEU A 230 ? 0.5318 0.4164 0.3745 -0.0078 -0.0317 0.0016  522 LEU A N     
1798 C CA    . LEU A 230 ? 0.5223 0.3996 0.3608 -0.0069 -0.0318 0.0026  522 LEU A CA    
1799 C C     . LEU A 230 ? 0.5229 0.3995 0.3612 -0.0092 -0.0329 0.0036  522 LEU A C     
1800 O O     . LEU A 230 ? 0.5429 0.4131 0.3777 -0.0082 -0.0329 0.0045  522 LEU A O     
1801 C CB    . LEU A 230 ? 0.4906 0.3612 0.3258 -0.0031 -0.0298 0.0033  522 LEU A CB    
1802 C CG    . LEU A 230 ? 0.5421 0.4113 0.3763 -0.0006 -0.0287 0.0025  522 LEU A CG    
1803 C CD1   . LEU A 230 ? 0.5341 0.3978 0.3657 0.0029  -0.0264 0.0033  522 LEU A CD1   
1804 C CD2   . LEU A 230 ? 0.5663 0.4333 0.3986 -0.0007 -0.0297 0.0021  522 LEU A CD2   
1805 N N     . ARG A 231 ? 0.4927 0.3756 0.3346 -0.0121 -0.0338 0.0034  523 ARG A N     
1806 C CA    . ARG A 231 ? 0.5226 0.4052 0.3645 -0.0143 -0.0348 0.0043  523 ARG A CA    
1807 C C     . ARG A 231 ? 0.5183 0.3967 0.3573 -0.0156 -0.0361 0.0048  523 ARG A C     
1808 O O     . ARG A 231 ? 0.5647 0.4378 0.4011 -0.0154 -0.0365 0.0058  523 ARG A O     
1809 C CB    . ARG A 231 ? 0.7100 0.6011 0.5566 -0.0176 -0.0357 0.0038  523 ARG A CB    
1810 C CG    . ARG A 231 ? 0.9599 0.8537 0.8088 -0.0172 -0.0350 0.0039  523 ARG A CG    
1811 C CD    . ARG A 231 ? 1.0254 0.9279 0.8791 -0.0206 -0.0361 0.0034  523 ARG A CD    
1812 N NE    . ARG A 231 ? 1.0690 0.9748 0.9254 -0.0203 -0.0356 0.0034  523 ARG A NE    
1813 C CZ    . ARG A 231 ? 1.1640 1.0681 1.0200 -0.0209 -0.0358 0.0043  523 ARG A CZ    
1814 N NH1   . ARG A 231 ? 1.2066 1.1058 1.0596 -0.0217 -0.0365 0.0054  523 ARG A NH1   
1815 N NH2   . ARG A 231 ? 1.2041 1.1115 1.0626 -0.0206 -0.0353 0.0042  523 ARG A NH2   
1816 N N     . GLU A 232 ? 0.6131 0.4938 0.4526 -0.0170 -0.0368 0.0041  524 GLU A N     
1817 C CA    . GLU A 232 ? 0.7024 0.5798 0.5393 -0.0186 -0.0382 0.0045  524 GLU A CA    
1818 C C     . GLU A 232 ? 0.6805 0.5500 0.5130 -0.0157 -0.0378 0.0047  524 GLU A C     
1819 O O     . GLU A 232 ? 0.6744 0.5404 0.5044 -0.0167 -0.0389 0.0049  524 GLU A O     
1820 C CB    . GLU A 232 ? 0.8371 0.7216 0.6769 -0.0218 -0.0392 0.0037  524 GLU A CB    
1821 C CG    . GLU A 232 ? 1.1032 0.9925 0.9453 -0.0203 -0.0385 0.0023  524 GLU A CG    
1822 C CD    . GLU A 232 ? 1.2822 1.1667 1.1211 -0.0184 -0.0384 0.0020  524 GLU A CD    
1823 O OE1   . GLU A 232 ? 1.3673 1.2474 1.2033 -0.0194 -0.0393 0.0026  524 GLU A OE1   
1824 O OE2   . GLU A 232 ? 1.2857 1.1707 1.1250 -0.0158 -0.0374 0.0011  524 GLU A OE2   
1825 N N     . ALA A 233 ? 0.6119 0.4787 0.4435 -0.0121 -0.0361 0.0045  525 ALA A N     
1826 C CA    . ALA A 233 ? 0.4962 0.3560 0.3239 -0.0090 -0.0354 0.0046  525 ALA A CA    
1827 C C     . ALA A 233 ? 0.5973 0.4497 0.4213 -0.0072 -0.0353 0.0054  525 ALA A C     
1828 O O     . ALA A 233 ? 0.5947 0.4413 0.4153 -0.0054 -0.0354 0.0055  525 ALA A O     
1829 C CB    . ALA A 233 ? 0.5065 0.3667 0.3346 -0.0059 -0.0336 0.0040  525 ALA A CB    
1830 N N     . HIS A 234 ? 0.4978 0.3507 0.3227 -0.0074 -0.0351 0.0061  526 HIS A N     
1831 C CA    . HIS A 234 ? 0.4888 0.3355 0.3107 -0.0054 -0.0350 0.0067  526 HIS A CA    
1832 C C     . HIS A 234 ? 0.4998 0.3489 0.3235 -0.0069 -0.0354 0.0073  526 HIS A C     
1833 O O     . HIS A 234 ? 0.5317 0.3865 0.3588 -0.0077 -0.0347 0.0072  526 HIS A O     
1834 C CB    . HIS A 234 ? 0.4764 0.3195 0.2967 -0.0010 -0.0328 0.0067  526 HIS A CB    
1835 C CG    . HIS A 234 ? 0.5330 0.3695 0.3497 0.0016  -0.0327 0.0070  526 HIS A CG    
1836 N ND1   . HIS A 234 ? 0.4934 0.3291 0.3102 0.0022  -0.0327 0.0075  526 HIS A ND1   
1837 C CD2   . HIS A 234 ? 0.5273 0.3581 0.3406 0.0038  -0.0328 0.0067  526 HIS A CD2   
1838 C CE1   . HIS A 234 ? 0.5536 0.3835 0.3670 0.0048  -0.0327 0.0075  526 HIS A CE1   
1839 N NE2   . HIS A 234 ? 0.5541 0.3810 0.3654 0.0057  -0.0327 0.0070  526 HIS A NE2   
1840 N N     . PRO A 235 ? 0.5060 0.3508 0.3273 -0.0072 -0.0366 0.0077  527 PRO A N     
1841 C CA    . PRO A 235 ? 0.5261 0.3730 0.3490 -0.0085 -0.0370 0.0082  527 PRO A CA    
1842 C C     . PRO A 235 ? 0.5824 0.4304 0.4065 -0.0056 -0.0351 0.0085  527 PRO A C     
1843 O O     . PRO A 235 ? 0.5213 0.3731 0.3479 -0.0070 -0.0353 0.0087  527 PRO A O     
1844 C CB    . PRO A 235 ? 0.5566 0.3973 0.3759 -0.0087 -0.0387 0.0085  527 PRO A CB    
1845 C CG    . PRO A 235 ? 0.6138 0.4488 0.4295 -0.0064 -0.0386 0.0081  527 PRO A CG    
1846 C CD    . PRO A 235 ? 0.5493 0.3877 0.3667 -0.0070 -0.0379 0.0077  527 PRO A CD    
1847 N N     . ILE A 236 ? 0.5381 0.3831 0.3608 -0.0018 -0.0333 0.0084  528 ILE A N     
1848 C CA    . ILE A 236 ? 0.5056 0.3512 0.3291 0.0010  -0.0313 0.0088  528 ILE A CA    
1849 C C     . ILE A 236 ? 0.5310 0.3829 0.3583 -0.0001 -0.0303 0.0087  528 ILE A C     
1850 O O     . ILE A 236 ? 0.5011 0.3548 0.3298 0.0009  -0.0292 0.0091  528 ILE A O     
1851 C CB    . ILE A 236 ? 0.4765 0.3177 0.2976 0.0052  -0.0293 0.0087  528 ILE A CB    
1852 C CG1   . ILE A 236 ? 0.5338 0.3744 0.3551 0.0082  -0.0275 0.0093  528 ILE A CG1   
1853 C CG2   . ILE A 236 ? 0.4730 0.3161 0.2951 0.0057  -0.0280 0.0084  528 ILE A CG2   
1854 C CD1   . ILE A 236 ? 0.5290 0.3658 0.3482 0.0124  -0.0254 0.0094  528 ILE A CD1   
1855 N N     . VAL A 237 ? 0.4077 0.2632 0.2366 -0.0023 -0.0309 0.0081  529 VAL A N     
1856 C CA    . VAL A 237 ? 0.4350 0.2959 0.2669 -0.0026 -0.0298 0.0077  529 VAL A CA    
1857 C C     . VAL A 237 ? 0.4611 0.3275 0.2964 -0.0050 -0.0305 0.0078  529 VAL A C     
1858 O O     . VAL A 237 ? 0.4944 0.3651 0.3351 -0.0039 -0.0285 0.0075  529 VAL A O     
1859 C CB    . VAL A 237 ? 0.4929 0.3567 0.3259 -0.0041 -0.0304 0.0067  529 VAL A CB    
1860 C CG1   . VAL A 237 ? 0.4669 0.3367 0.3032 -0.0046 -0.0297 0.0060  529 VAL A CG1   
1861 C CG2   . VAL A 237 ? 0.4975 0.3560 0.3273 -0.0014 -0.0295 0.0066  529 VAL A CG2   
1862 N N     . GLU A 238 ? 0.4986 0.3669 0.3347 -0.0083 -0.0325 0.0077  530 GLU A N     
1863 C CA    . GLU A 238 ? 0.5187 0.3924 0.3582 -0.0107 -0.0333 0.0078  530 GLU A CA    
1864 C C     . GLU A 238 ? 0.4912 0.3629 0.3307 -0.0088 -0.0324 0.0084  530 GLU A C     
1865 O O     . GLU A 238 ? 0.4790 0.3566 0.3243 -0.0092 -0.0315 0.0081  530 GLU A O     
1866 C CB    . GLU A 238 ? 0.5981 0.4735 0.4381 -0.0145 -0.0354 0.0078  530 GLU A CB    
1867 C CG    . GLU A 238 ? 0.9245 0.8058 0.7681 -0.0173 -0.0363 0.0078  530 GLU A CG    
1868 C CD    . GLU A 238 ? 1.1732 1.0545 1.0164 -0.0208 -0.0381 0.0082  530 GLU A CD    
1869 O OE1   . GLU A 238 ? 1.2298 1.1047 1.0692 -0.0203 -0.0389 0.0086  530 GLU A OE1   
1870 O OE2   . GLU A 238 ? 1.2672 1.1548 1.1139 -0.0238 -0.0389 0.0080  530 GLU A OE2   
1871 N N     . LYS A 239 ? 0.4623 0.3270 0.2973 -0.0063 -0.0323 0.0091  531 LYS A N     
1872 C CA    . LYS A 239 ? 0.4908 0.3544 0.3274 -0.0039 -0.0311 0.0094  531 LYS A CA    
1873 C C     . LYS A 239 ? 0.5121 0.3800 0.3549 -0.0013 -0.0278 0.0089  531 LYS A C     
1874 O O     . LYS A 239 ? 0.4957 0.3673 0.3432 -0.0008 -0.0266 0.0088  531 LYS A O     
1875 C CB    . LYS A 239 ? 0.5545 0.4097 0.3846 -0.0014 -0.0317 0.0100  531 LYS A CB    
1876 C CG    . LYS A 239 ? 0.6414 0.4939 0.4696 -0.0039 -0.0341 0.0098  531 LYS A CG    
1877 C CD    . LYS A 239 ? 0.7650 0.6206 0.5950 -0.0072 -0.0359 0.0100  531 LYS A CD    
1878 C CE    . LYS A 239 ? 0.8659 0.7164 0.6926 -0.0082 -0.0379 0.0101  531 LYS A CE    
1879 N NZ    . LYS A 239 ? 0.8486 0.6960 0.6732 -0.0091 -0.0386 0.0098  531 LYS A NZ    
1880 N N     . ILE A 240 ? 0.4336 0.3006 0.2761 0.0003  -0.0263 0.0087  532 ILE A N     
1881 C CA    . ILE A 240 ? 0.4073 0.2778 0.2551 0.0025  -0.0232 0.0083  532 ILE A CA    
1882 C C     . ILE A 240 ? 0.4602 0.3386 0.3147 0.0004  -0.0228 0.0077  532 ILE A C     
1883 O O     . ILE A 240 ? 0.4412 0.3234 0.3010 0.0015  -0.0209 0.0075  532 ILE A O     
1884 C CB    . ILE A 240 ? 0.4888 0.3568 0.3345 0.0041  -0.0221 0.0081  532 ILE A CB    
1885 C CG1   . ILE A 240 ? 0.5931 0.4533 0.4322 0.0064  -0.0223 0.0087  532 ILE A CG1   
1886 C CG2   . ILE A 240 ? 0.5032 0.3747 0.3541 0.0058  -0.0190 0.0078  532 ILE A CG2   
1887 C CD1   . ILE A 240 ? 0.6676 0.5260 0.5070 0.0093  -0.0207 0.0090  532 ILE A CD1   
1888 N N     . LEU A 241 ? 0.4494 0.3305 0.3036 -0.0024 -0.0247 0.0072  533 LEU A N     
1889 C CA    . LEU A 241 ? 0.4309 0.3196 0.2910 -0.0044 -0.0247 0.0065  533 LEU A CA    
1890 C C     . LEU A 241 ? 0.4975 0.3897 0.3614 -0.0053 -0.0249 0.0067  533 LEU A C     
1891 O O     . LEU A 241 ? 0.4366 0.3340 0.3065 -0.0049 -0.0234 0.0062  533 LEU A O     
1892 C CB    . LEU A 241 ? 0.4677 0.3588 0.3262 -0.0074 -0.0271 0.0060  533 LEU A CB    
1893 C CG    . LEU A 241 ? 0.5456 0.4364 0.4028 -0.0068 -0.0268 0.0053  533 LEU A CG    
1894 C CD1   . LEU A 241 ? 0.5380 0.4298 0.3919 -0.0098 -0.0295 0.0048  533 LEU A CD1   
1895 C CD2   . LEU A 241 ? 0.5326 0.4289 0.3957 -0.0059 -0.0251 0.0044  533 LEU A CD2   
1896 N N     . GLN A 242 ? 0.4366 0.3256 0.2966 -0.0065 -0.0268 0.0073  534 GLN A N     
1897 C CA    . GLN A 242 ? 0.4361 0.3276 0.2988 -0.0074 -0.0273 0.0075  534 GLN A CA    
1898 C C     . GLN A 242 ? 0.4794 0.3703 0.3448 -0.0042 -0.0250 0.0076  534 GLN A C     
1899 O O     . GLN A 242 ? 0.4523 0.3481 0.3231 -0.0042 -0.0241 0.0072  534 GLN A O     
1900 C CB    . GLN A 242 ? 0.4171 0.3042 0.2738 -0.0094 -0.0301 0.0081  534 GLN A CB    
1901 C CG    . GLN A 242 ? 0.5430 0.4324 0.3980 -0.0133 -0.0324 0.0080  534 GLN A CG    
1902 C CD    . GLN A 242 ? 0.8141 0.6977 0.6619 -0.0153 -0.0352 0.0088  534 GLN A CD    
1903 O OE1   . GLN A 242 ? 0.8800 0.7570 0.7235 -0.0136 -0.0356 0.0094  534 GLN A OE1   
1904 N NE2   . GLN A 242 ? 0.8190 0.7058 0.6668 -0.0190 -0.0369 0.0085  534 GLN A NE2   
1905 N N     . TYR A 243 ? 0.4100 0.2950 0.2716 -0.0014 -0.0240 0.0079  535 TYR A N     
1906 C CA    . TYR A 243 ? 0.4260 0.3107 0.2900 0.0018  -0.0216 0.0079  535 TYR A CA    
1907 C C     . TYR A 243 ? 0.4140 0.3048 0.2850 0.0024  -0.0191 0.0073  535 TYR A C     
1908 O O     . TYR A 243 ? 0.4801 0.3742 0.3557 0.0033  -0.0177 0.0071  535 TYR A O     
1909 C CB    . TYR A 243 ? 0.4567 0.3348 0.3156 0.0048  -0.0208 0.0083  535 TYR A CB    
1910 C CG    . TYR A 243 ? 0.4522 0.3312 0.3142 0.0080  -0.0179 0.0081  535 TYR A CG    
1911 C CD1   . TYR A 243 ? 0.4635 0.3450 0.3291 0.0091  -0.0152 0.0079  535 TYR A CD1   
1912 C CD2   . TYR A 243 ? 0.4850 0.3625 0.3463 0.0099  -0.0179 0.0081  535 TYR A CD2   
1913 C CE1   . TYR A 243 ? 0.4883 0.3711 0.3567 0.0117  -0.0125 0.0077  535 TYR A CE1   
1914 C CE2   . TYR A 243 ? 0.5257 0.4047 0.3900 0.0128  -0.0152 0.0078  535 TYR A CE2   
1915 C CZ    . TYR A 243 ? 0.5190 0.4008 0.3869 0.0135  -0.0124 0.0077  535 TYR A CZ    
1916 O OH    . TYR A 243 ? 0.5518 0.4356 0.4228 0.0160  -0.0097 0.0074  535 TYR A OH    
1917 N N     . ARG A 244 ? 0.3863 0.2781 0.2579 0.0019  -0.0185 0.0071  536 ARG A N     
1918 C CA    . ARG A 244 ? 0.4109 0.3073 0.2882 0.0026  -0.0161 0.0066  536 ARG A CA    
1919 C C     . ARG A 244 ? 0.4974 0.4007 0.3808 0.0008  -0.0165 0.0061  536 ARG A C     
1920 O O     . ARG A 244 ? 0.4538 0.3606 0.3423 0.0017  -0.0147 0.0058  536 ARG A O     
1921 C CB    . ARG A 244 ? 0.4724 0.3683 0.3485 0.0025  -0.0159 0.0063  536 ARG A CB    
1922 C CG    . ARG A 244 ? 0.5409 0.4314 0.4133 0.0051  -0.0142 0.0067  536 ARG A CG    
1923 C CD    . ARG A 244 ? 0.5585 0.4478 0.4287 0.0047  -0.0145 0.0064  536 ARG A CD    
1924 N NE    . ARG A 244 ? 0.5437 0.4291 0.4119 0.0073  -0.0124 0.0067  536 ARG A NE    
1925 C CZ    . ARG A 244 ? 0.5520 0.4357 0.4181 0.0076  -0.0123 0.0064  536 ARG A CZ    
1926 N NH1   . ARG A 244 ? 0.4693 0.3554 0.3354 0.0056  -0.0142 0.0057  536 ARG A NH1   
1927 N NH2   . ARG A 244 ? 0.5042 0.3841 0.3682 0.0098  -0.0102 0.0068  536 ARG A NH2   
1928 N N     . GLU A 245 ? 0.4002 0.3058 0.2831 -0.0020 -0.0189 0.0059  537 GLU A N     
1929 C CA    . GLU A 245 ? 0.4716 0.3839 0.3599 -0.0039 -0.0196 0.0053  537 GLU A CA    
1930 C C     . GLU A 245 ? 0.4351 0.3486 0.3257 -0.0036 -0.0195 0.0055  537 GLU A C     
1931 O O     . GLU A 245 ? 0.4235 0.3420 0.3199 -0.0035 -0.0184 0.0050  537 GLU A O     
1932 C CB    . GLU A 245 ? 0.4835 0.3981 0.3703 -0.0070 -0.0223 0.0050  537 GLU A CB    
1933 C CG    . GLU A 245 ? 0.7256 0.6472 0.6176 -0.0090 -0.0231 0.0045  537 GLU A CG    
1934 C CD    . GLU A 245 ? 0.8651 0.7912 0.7574 -0.0118 -0.0251 0.0038  537 GLU A CD    
1935 O OE1   . GLU A 245 ? 1.0330 0.9564 0.9203 -0.0131 -0.0266 0.0040  537 GLU A OE1   
1936 O OE2   . GLU A 245 ? 0.6521 0.5848 0.5498 -0.0126 -0.0251 0.0031  537 GLU A OE2   
1937 N N     . LEU A 246 ? 0.3890 0.2976 0.2747 -0.0033 -0.0207 0.0061  538 LEU A N     
1938 C CA    . LEU A 246 ? 0.4162 0.3254 0.3034 -0.0028 -0.0209 0.0062  538 LEU A CA    
1939 C C     . LEU A 246 ? 0.4773 0.3873 0.3681 0.0002  -0.0181 0.0060  538 LEU A C     
1940 O O     . LEU A 246 ? 0.4171 0.3313 0.3128 0.0004  -0.0174 0.0056  538 LEU A O     
1941 C CB    . LEU A 246 ? 0.4053 0.3081 0.2855 -0.0029 -0.0229 0.0069  538 LEU A CB    
1942 C CG    . LEU A 246 ? 0.4884 0.3914 0.3660 -0.0063 -0.0260 0.0072  538 LEU A CG    
1943 C CD1   . LEU A 246 ? 0.4997 0.4057 0.3776 -0.0090 -0.0268 0.0069  538 LEU A CD1   
1944 C CD2   . LEU A 246 ? 0.4084 0.3036 0.2782 -0.0061 -0.0279 0.0079  538 LEU A CD2   
1945 N N     . THR A 247 ? 0.4165 0.3227 0.3049 0.0024  -0.0165 0.0062  539 THR A N     
1946 C CA    . THR A 247 ? 0.4263 0.3333 0.3178 0.0051  -0.0137 0.0060  539 THR A CA    
1947 C C     . THR A 247 ? 0.3974 0.3109 0.2961 0.0045  -0.0119 0.0054  539 THR A C     
1948 O O     . THR A 247 ? 0.4893 0.4062 0.3925 0.0055  -0.0105 0.0051  539 THR A O     
1949 C CB    . THR A 247 ? 0.4849 0.3868 0.3722 0.0073  -0.0122 0.0064  539 THR A CB    
1950 O OG1   . THR A 247 ? 0.4740 0.3698 0.3548 0.0082  -0.0139 0.0068  539 THR A OG1   
1951 C CG2   . THR A 247 ? 0.4545 0.3581 0.3454 0.0097  -0.0091 0.0061  539 THR A CG2   
1952 N N     . LYS A 248 ? 0.3817 0.2971 0.2813 0.0029  -0.0123 0.0053  540 LYS A N     
1953 C CA    . LYS A 248 ? 0.4363 0.3571 0.3420 0.0023  -0.0110 0.0047  540 LYS A CA    
1954 C C     . LYS A 248 ? 0.4763 0.4029 0.3871 0.0009  -0.0119 0.0042  540 LYS A C     
1955 O O     . LYS A 248 ? 0.3949 0.3252 0.3110 0.0016  -0.0103 0.0038  540 LYS A O     
1956 C CB    . LYS A 248 ? 0.4617 0.3827 0.3663 0.0010  -0.0118 0.0045  540 LYS A CB    
1957 C CG    . LYS A 248 ? 0.6080 0.5342 0.5183 0.0005  -0.0108 0.0038  540 LYS A CG    
1958 C CD    . LYS A 248 ? 0.7245 0.6503 0.6373 0.0024  -0.0079 0.0039  540 LYS A CD    
1959 C CE    . LYS A 248 ? 0.7973 0.7273 0.7150 0.0018  -0.0072 0.0033  540 LYS A CE    
1960 N NZ    . LYS A 248 ? 0.8850 0.8147 0.8050 0.0032  -0.0043 0.0035  540 LYS A NZ    
1961 N N     . LEU A 249 ? 0.3529 0.2801 0.2620 -0.0012 -0.0145 0.0042  541 LEU A N     
1962 C CA    . LEU A 249 ? 0.3755 0.3083 0.2891 -0.0027 -0.0155 0.0037  541 LEU A CA    
1963 C C     . LEU A 249 ? 0.4106 0.3435 0.3257 -0.0014 -0.0151 0.0038  541 LEU A C     
1964 O O     . LEU A 249 ? 0.3639 0.3019 0.2844 -0.0018 -0.0148 0.0032  541 LEU A O     
1965 C CB    . LEU A 249 ? 0.3742 0.3080 0.2854 -0.0054 -0.0184 0.0038  541 LEU A CB    
1966 C CG    . LEU A 249 ? 0.4075 0.3423 0.3180 -0.0066 -0.0189 0.0034  541 LEU A CG    
1967 C CD1   . LEU A 249 ? 0.4305 0.3665 0.3382 -0.0094 -0.0217 0.0034  541 LEU A CD1   
1968 C CD2   . LEU A 249 ? 0.4299 0.3703 0.3466 -0.0063 -0.0177 0.0026  541 LEU A CD2   
1969 N N     . LYS A 250 ? 0.3336 0.2610 0.2438 0.0001  -0.0151 0.0043  542 LYS A N     
1970 C CA    . LYS A 250 ? 0.3443 0.2715 0.2555 0.0018  -0.0147 0.0041  542 LYS A CA    
1971 C C     . LYS A 250 ? 0.3699 0.3007 0.2867 0.0036  -0.0118 0.0036  542 LYS A C     
1972 O O     . LYS A 250 ? 0.3795 0.3145 0.3011 0.0039  -0.0114 0.0031  542 LYS A O     
1973 C CB    . LYS A 250 ? 0.3473 0.2676 0.2517 0.0036  -0.0153 0.0047  542 LYS A CB    
1974 C CG    . LYS A 250 ? 0.4773 0.3971 0.3819 0.0053  -0.0155 0.0043  542 LYS A CG    
1975 C CD    . LYS A 250 ? 0.4814 0.3940 0.3786 0.0070  -0.0168 0.0048  542 LYS A CD    
1976 C CE    . LYS A 250 ? 0.5665 0.4787 0.4637 0.0090  -0.0172 0.0042  542 LYS A CE    
1977 N NZ    . LYS A 250 ? 0.6413 0.5569 0.5433 0.0118  -0.0142 0.0035  542 LYS A NZ    
1978 N N     . SER A 251 ? 0.3882 0.3173 0.3045 0.0048  -0.0098 0.0038  543 SER A N     
1979 C CA    . SER A 251 ? 0.4244 0.3562 0.3452 0.0064  -0.0070 0.0034  543 SER A CA    
1980 C C     . SER A 251 ? 0.4256 0.3635 0.3531 0.0050  -0.0062 0.0029  543 SER A C     
1981 O O     . SER A 251 ? 0.3670 0.3087 0.2995 0.0058  -0.0045 0.0024  543 SER A O     
1982 C CB    . SER A 251 ? 0.5357 0.4636 0.4534 0.0079  -0.0051 0.0039  543 SER A CB    
1983 O OG    . SER A 251 ? 0.6149 0.5417 0.5312 0.0064  -0.0056 0.0041  543 SER A OG    
1984 N N     . THR A 252 ? 0.3725 0.3117 0.3002 0.0030  -0.0076 0.0029  544 THR A N     
1985 C CA    . THR A 252 ? 0.4228 0.3673 0.3563 0.0019  -0.0071 0.0023  544 THR A CA    
1986 C C     . THR A 252 ? 0.3848 0.3345 0.3222 0.0003  -0.0089 0.0017  544 THR A C     
1987 O O     . THR A 252 ? 0.3496 0.3042 0.2928 0.0000  -0.0082 0.0011  544 THR A O     
1988 C CB    . THR A 252 ? 0.5270 0.4705 0.4590 0.0010  -0.0074 0.0023  544 THR A CB    
1989 O OG1   . THR A 252 ? 0.6535 0.5963 0.5822 -0.0007 -0.0101 0.0024  544 THR A OG1   
1990 C CG2   . THR A 252 ? 0.4439 0.3822 0.3718 0.0024  -0.0057 0.0029  544 THR A CG2   
1991 N N     . TYR A 253 ? 0.2903 0.2389 0.2246 -0.0007 -0.0112 0.0019  545 TYR A N     
1992 C CA    . TYR A 253 ? 0.2660 0.2194 0.2036 -0.0023 -0.0129 0.0014  545 TYR A CA    
1993 C C     . TYR A 253 ? 0.3342 0.2866 0.2703 -0.0019 -0.0140 0.0016  545 TYR A C     
1994 O O     . TYR A 253 ? 0.3271 0.2833 0.2676 -0.0016 -0.0137 0.0011  545 TYR A O     
1995 C CB    . TYR A 253 ? 0.3063 0.2611 0.2423 -0.0047 -0.0152 0.0014  545 TYR A CB    
1996 C CG    . TYR A 253 ? 0.2809 0.2374 0.2187 -0.0049 -0.0145 0.0010  545 TYR A CG    
1997 C CD1   . TYR A 253 ? 0.3159 0.2777 0.2599 -0.0050 -0.0138 0.0002  545 TYR A CD1   
1998 C CD2   . TYR A 253 ? 0.3761 0.3287 0.3094 -0.0049 -0.0146 0.0013  545 TYR A CD2   
1999 C CE1   . TYR A 253 ? 0.3336 0.2966 0.2790 -0.0050 -0.0134 -0.0003 545 TYR A CE1   
2000 C CE2   . TYR A 253 ? 0.3910 0.3449 0.3258 -0.0049 -0.0141 0.0008  545 TYR A CE2   
2001 C CZ    . TYR A 253 ? 0.3946 0.3535 0.3352 -0.0049 -0.0136 0.0000  545 TYR A CZ    
2002 O OH    . TYR A 253 ? 0.3638 0.3234 0.3054 -0.0048 -0.0133 -0.0005 545 TYR A OH    
2003 N N     . ILE A 254 ? 0.3211 0.2681 0.2508 -0.0020 -0.0153 0.0022  546 ILE A N     
2004 C CA    . ILE A 254 ? 0.2637 0.2091 0.1912 -0.0019 -0.0168 0.0024  546 ILE A CA    
2005 C C     . ILE A 254 ? 0.3525 0.2985 0.2826 0.0006  -0.0153 0.0019  546 ILE A C     
2006 O O     . ILE A 254 ? 0.3276 0.2765 0.2603 0.0006  -0.0160 0.0015  546 ILE A O     
2007 C CB    . ILE A 254 ? 0.3203 0.2587 0.2397 -0.0023 -0.0186 0.0032  546 ILE A CB    
2008 C CG1   . ILE A 254 ? 0.4103 0.3490 0.3273 -0.0051 -0.0204 0.0036  546 ILE A CG1   
2009 C CG2   . ILE A 254 ? 0.3479 0.2839 0.2645 -0.0019 -0.0202 0.0033  546 ILE A CG2   
2010 C CD1   . ILE A 254 ? 0.4416 0.3734 0.3507 -0.0056 -0.0219 0.0044  546 ILE A CD1   
2011 N N     . ASP A 255 ? 0.3216 0.2652 0.2510 0.0029  -0.0132 0.0019  547 ASP A N     
2012 C CA    . ASP A 255 ? 0.4642 0.4090 0.3962 0.0054  -0.0115 0.0013  547 ASP A CA    
2013 C C     . ASP A 255 ? 0.3598 0.3114 0.2999 0.0055  -0.0097 0.0005  547 ASP A C     
2014 O O     . ASP A 255 ? 0.3931 0.3475 0.3363 0.0064  -0.0097 -0.0002 547 ASP A O     
2015 C CB    . ASP A 255 ? 0.4752 0.4153 0.4034 0.0079  -0.0100 0.0016  547 ASP A CB    
2016 C CG    . ASP A 255 ? 0.5481 0.4816 0.4687 0.0087  -0.0120 0.0021  547 ASP A CG    
2017 O OD1   . ASP A 255 ? 0.6036 0.5363 0.5224 0.0077  -0.0144 0.0021  547 ASP A OD1   
2018 O OD2   . ASP A 255 ? 0.5738 0.5025 0.4899 0.0102  -0.0113 0.0024  547 ASP A OD2   
2019 N N     . PRO A 256 ? 0.3309 0.2849 0.2741 0.0045  -0.0084 0.0005  548 PRO A N     
2020 C CA    . PRO A 256 ? 0.2823 0.2424 0.2329 0.0045  -0.0067 -0.0002 548 PRO A CA    
2021 C C     . PRO A 256 ? 0.3415 0.3068 0.2965 0.0030  -0.0083 -0.0008 548 PRO A C     
2022 O O     . PRO A 256 ? 0.3194 0.2892 0.2800 0.0035  -0.0073 -0.0015 548 PRO A O     
2023 C CB    . PRO A 256 ? 0.3894 0.3494 0.3408 0.0037  -0.0054 0.0001  548 PRO A CB    
2024 C CG    . PRO A 256 ? 0.4211 0.3751 0.3660 0.0042  -0.0055 0.0009  548 PRO A CG    
2025 C CD    . PRO A 256 ? 0.3195 0.2704 0.2596 0.0038  -0.0081 0.0012  548 PRO A CD    
2026 N N     . LEU A 257 ? 0.2981 0.2632 0.2510 0.0010  -0.0107 -0.0005 549 LEU A N     
2027 C CA    . LEU A 257 ? 0.2903 0.2608 0.2475 -0.0006 -0.0121 -0.0010 549 LEU A CA    
2028 C C     . LEU A 257 ? 0.2761 0.2492 0.2361 0.0002  -0.0124 -0.0016 549 LEU A C     
2029 O O     . LEU A 257 ? 0.2466 0.2251 0.2126 0.0001  -0.0120 -0.0024 549 LEU A O     
2030 C CB    . LEU A 257 ? 0.2814 0.2515 0.2354 -0.0030 -0.0146 -0.0006 549 LEU A CB    
2031 C CG    . LEU A 257 ? 0.2834 0.2538 0.2371 -0.0041 -0.0145 -0.0006 549 LEU A CG    
2032 C CD1   . LEU A 257 ? 0.3329 0.3027 0.2826 -0.0063 -0.0170 -0.0002 549 LEU A CD1   
2033 C CD2   . LEU A 257 ? 0.3562 0.3324 0.3166 -0.0043 -0.0138 -0.0014 549 LEU A CD2   
2034 N N     . PRO A 258 ? 0.2713 0.2404 0.2269 0.0013  -0.0133 -0.0014 550 PRO A N     
2035 C CA    . PRO A 258 ? 0.2427 0.2144 0.2010 0.0022  -0.0138 -0.0021 550 PRO A CA    
2036 C C     . PRO A 258 ? 0.2715 0.2471 0.2357 0.0042  -0.0114 -0.0030 550 PRO A C     
2037 O O     . PRO A 258 ? 0.3052 0.2853 0.2740 0.0044  -0.0117 -0.0038 550 PRO A O     
2038 C CB    . PRO A 258 ? 0.3170 0.2825 0.2685 0.0035  -0.0150 -0.0017 550 PRO A CB    
2039 C CG    . PRO A 258 ? 0.3626 0.3232 0.3079 0.0020  -0.0161 -0.0006 550 PRO A CG    
2040 C CD    . PRO A 258 ? 0.3159 0.2781 0.2638 0.0015  -0.0143 -0.0005 550 PRO A CD    
2041 N N     . ASP A 259 ? 0.2524 0.2266 0.2167 0.0055  -0.0091 -0.0030 551 ASP A N     
2042 C CA    . ASP A 259 ? 0.3336 0.3117 0.3033 0.0070  -0.0066 -0.0038 551 ASP A CA    
2043 C C     . ASP A 259 ? 0.2962 0.2800 0.2726 0.0055  -0.0059 -0.0043 551 ASP A C     
2044 O O     . ASP A 259 ? 0.2988 0.2868 0.2807 0.0063  -0.0043 -0.0051 551 ASP A O     
2045 C CB    . ASP A 259 ? 0.3920 0.3671 0.3596 0.0084  -0.0043 -0.0035 551 ASP A CB    
2046 C CG    . ASP A 259 ? 0.6177 0.5874 0.5789 0.0103  -0.0048 -0.0033 551 ASP A CG    
2047 O OD1   . ASP A 259 ? 0.5880 0.5575 0.5484 0.0116  -0.0060 -0.0038 551 ASP A OD1   
2048 O OD2   . ASP A 259 ? 0.7032 0.6685 0.6601 0.0107  -0.0041 -0.0025 551 ASP A OD2   
2049 N N     . LEU A 260 ? 0.2540 0.2379 0.2298 0.0034  -0.0072 -0.0038 552 LEU A N     
2050 C CA    . LEU A 260 ? 0.2107 0.1995 0.1922 0.0021  -0.0069 -0.0042 552 LEU A CA    
2051 C C     . LEU A 260 ? 0.2411 0.2346 0.2263 0.0013  -0.0087 -0.0049 552 LEU A C     
2052 O O     . LEU A 260 ? 0.2544 0.2522 0.2443 0.0003  -0.0089 -0.0054 552 LEU A O     
2053 C CB    . LEU A 260 ? 0.1982 0.1851 0.1772 0.0006  -0.0074 -0.0036 552 LEU A CB    
2054 C CG    . LEU A 260 ? 0.2793 0.2618 0.2553 0.0014  -0.0054 -0.0030 552 LEU A CG    
2055 C CD1   . LEU A 260 ? 0.2884 0.2685 0.2611 0.0001  -0.0062 -0.0024 552 LEU A CD1   
2056 C CD2   . LEU A 260 ? 0.3203 0.3056 0.3013 0.0021  -0.0028 -0.0035 552 LEU A CD2   
2057 N N     . ILE A 261 ? 0.2391 0.2316 0.2220 0.0017  -0.0102 -0.0049 553 ILE A N     
2058 C CA    . ILE A 261 ? 0.2180 0.2150 0.2045 0.0011  -0.0118 -0.0056 553 ILE A CA    
2059 C C     . ILE A 261 ? 0.2384 0.2399 0.2312 0.0025  -0.0102 -0.0067 553 ILE A C     
2060 O O     . ILE A 261 ? 0.2610 0.2613 0.2534 0.0045  -0.0090 -0.0071 553 ILE A O     
2061 C CB    . ILE A 261 ? 0.2353 0.2296 0.2171 0.0011  -0.0139 -0.0053 553 ILE A CB    
2062 C CG1   . ILE A 261 ? 0.2695 0.2599 0.2452 -0.0009 -0.0157 -0.0042 553 ILE A CG1   
2063 C CG2   . ILE A 261 ? 0.2615 0.2606 0.2474 0.0008  -0.0152 -0.0061 553 ILE A CG2   
2064 C CD1   . ILE A 261 ? 0.3312 0.3255 0.3092 -0.0031 -0.0168 -0.0043 553 ILE A CD1   
2065 N N     . HIS A 262 ? 0.2082 0.2150 0.2067 0.0016  -0.0104 -0.0074 554 HIS A N     
2066 C CA    . HIS A 262 ? 0.2222 0.2337 0.2272 0.0027  -0.0089 -0.0085 554 HIS A CA    
2067 C C     . HIS A 262 ? 0.2345 0.2480 0.2407 0.0037  -0.0102 -0.0092 554 HIS A C     
2068 O O     . HIS A 262 ? 0.2392 0.2538 0.2447 0.0026  -0.0124 -0.0091 554 HIS A O     
2069 C CB    . HIS A 262 ? 0.2223 0.2382 0.2326 0.0014  -0.0090 -0.0089 554 HIS A CB    
2070 C CG    . HIS A 262 ? 0.2687 0.2886 0.2852 0.0022  -0.0071 -0.0099 554 HIS A CG    
2071 N ND1   . HIS A 262 ? 0.3058 0.3294 0.3262 0.0034  -0.0071 -0.0109 554 HIS A ND1   
2072 C CD2   . HIS A 262 ? 0.2535 0.2743 0.2730 0.0019  -0.0053 -0.0100 554 HIS A CD2   
2073 C CE1   . HIS A 262 ? 0.3067 0.3336 0.3324 0.0037  -0.0053 -0.0116 554 HIS A CE1   
2074 N NE2   . HIS A 262 ? 0.2974 0.3225 0.3225 0.0027  -0.0042 -0.0110 554 HIS A NE2   
2075 N N     . PRO A 263 ? 0.2292 0.2433 0.2369 0.0057  -0.0089 -0.0099 555 PRO A N     
2076 C CA    . PRO A 263 ? 0.2724 0.2876 0.2802 0.0069  -0.0103 -0.0106 555 PRO A CA    
2077 C C     . PRO A 263 ? 0.2661 0.2872 0.2798 0.0062  -0.0113 -0.0115 555 PRO A C     
2078 O O     . PRO A 263 ? 0.2951 0.3168 0.3081 0.0066  -0.0130 -0.0118 555 PRO A O     
2079 C CB    . PRO A 263 ? 0.2954 0.3105 0.3039 0.0094  -0.0084 -0.0114 555 PRO A CB    
2080 C CG    . PRO A 263 ? 0.2942 0.3108 0.3060 0.0092  -0.0058 -0.0114 555 PRO A CG    
2081 C CD    . PRO A 263 ? 0.2531 0.2668 0.2619 0.0071  -0.0062 -0.0102 555 PRO A CD    
2082 N N     . ARG A 264 ? 0.2786 0.3038 0.2977 0.0053  -0.0104 -0.0119 556 ARG A N     
2083 C CA    . ARG A 264 ? 0.2691 0.3001 0.2940 0.0049  -0.0114 -0.0128 556 ARG A CA    
2084 C C     . ARG A 264 ? 0.3466 0.3779 0.3697 0.0030  -0.0138 -0.0122 556 ARG A C     
2085 O O     . ARG A 264 ? 0.3690 0.4034 0.3940 0.0028  -0.0154 -0.0128 556 ARG A O     
2086 C CB    . ARG A 264 ? 0.4357 0.4707 0.4668 0.0046  -0.0098 -0.0135 556 ARG A CB    
2087 C CG    . ARG A 264 ? 0.4999 0.5359 0.5338 0.0062  -0.0073 -0.0142 556 ARG A CG    
2088 C CD    . ARG A 264 ? 0.4244 0.4665 0.4653 0.0068  -0.0072 -0.0156 556 ARG A CD    
2089 N NE    . ARG A 264 ? 0.3736 0.4171 0.4172 0.0080  -0.0047 -0.0164 556 ARG A NE    
2090 C CZ    . ARG A 264 ? 0.3529 0.3986 0.3983 0.0100  -0.0043 -0.0176 556 ARG A CZ    
2091 N NH1   . ARG A 264 ? 0.3227 0.3690 0.3674 0.0110  -0.0063 -0.0181 556 ARG A NH1   
2092 N NH2   . ARG A 264 ? 0.3761 0.4236 0.4240 0.0110  -0.0019 -0.0183 556 ARG A NH2   
2093 N N     . THR A 265 ? 0.2153 0.2436 0.2347 0.0016  -0.0140 -0.0112 557 THR A N     
2094 C CA    . THR A 265 ? 0.2355 0.2650 0.2536 -0.0003 -0.0161 -0.0108 557 THR A CA    
2095 C C     . THR A 265 ? 0.2669 0.2920 0.2780 -0.0012 -0.0177 -0.0098 557 THR A C     
2096 O O     . THR A 265 ? 0.2852 0.3119 0.2950 -0.0028 -0.0198 -0.0096 557 THR A O     
2097 C CB    . THR A 265 ? 0.2415 0.2708 0.2600 -0.0014 -0.0155 -0.0106 557 THR A CB    
2098 O OG1   . THR A 265 ? 0.2324 0.2561 0.2456 -0.0013 -0.0145 -0.0096 557 THR A OG1   
2099 C CG2   . THR A 265 ? 0.2668 0.2995 0.2915 -0.0008 -0.0139 -0.0114 557 THR A CG2   
2100 N N     . GLY A 266 ? 0.2370 0.2567 0.2433 -0.0003 -0.0169 -0.0092 558 GLY A N     
2101 C CA    . GLY A 266 ? 0.2604 0.2750 0.2594 -0.0012 -0.0184 -0.0081 558 GLY A CA    
2102 C C     . GLY A 266 ? 0.2631 0.2762 0.2590 -0.0032 -0.0189 -0.0073 558 GLY A C     
2103 O O     . GLY A 266 ? 0.2466 0.2571 0.2373 -0.0047 -0.0206 -0.0065 558 GLY A O     
2104 N N     . ARG A 267 ? 0.2068 0.2216 0.2059 -0.0032 -0.0175 -0.0075 559 ARG A N     
2105 C CA    . ARG A 267 ? 0.2144 0.2281 0.2110 -0.0047 -0.0180 -0.0070 559 ARG A CA    
2106 C C     . ARG A 267 ? 0.2153 0.2256 0.2109 -0.0039 -0.0159 -0.0067 559 ARG A C     
2107 O O     . ARG A 267 ? 0.2317 0.2417 0.2299 -0.0023 -0.0139 -0.0070 559 ARG A O     
2108 C CB    . ARG A 267 ? 0.2437 0.2633 0.2446 -0.0059 -0.0193 -0.0077 559 ARG A CB    
2109 C CG    . ARG A 267 ? 0.2499 0.2719 0.2495 -0.0074 -0.0217 -0.0077 559 ARG A CG    
2110 C CD    . ARG A 267 ? 0.3238 0.3526 0.3287 -0.0080 -0.0228 -0.0087 559 ARG A CD    
2111 N NE    . ARG A 267 ? 0.3048 0.3356 0.3093 -0.0093 -0.0238 -0.0089 559 ARG A NE    
2112 C CZ    . ARG A 267 ? 0.3236 0.3570 0.3261 -0.0111 -0.0258 -0.0088 559 ARG A CZ    
2113 N NH1   . ARG A 267 ? 0.2977 0.3313 0.2979 -0.0122 -0.0272 -0.0084 559 ARG A NH1   
2114 N NH2   . ARG A 267 ? 0.2102 0.2458 0.2128 -0.0119 -0.0266 -0.0093 559 ARG A NH2   
2115 N N     . LEU A 268 ? 0.2128 0.2205 0.2045 -0.0050 -0.0164 -0.0061 560 LEU A N     
2116 C CA    . LEU A 268 ? 0.1985 0.2030 0.1888 -0.0045 -0.0147 -0.0057 560 LEU A CA    
2117 C C     . LEU A 268 ? 0.2195 0.2277 0.2142 -0.0049 -0.0146 -0.0064 560 LEU A C     
2118 O O     . LEU A 268 ? 0.2191 0.2306 0.2146 -0.0061 -0.0164 -0.0068 560 LEU A O     
2119 C CB    . LEU A 268 ? 0.2122 0.2120 0.1958 -0.0054 -0.0157 -0.0048 560 LEU A CB    
2120 C CG    . LEU A 268 ? 0.2956 0.2928 0.2775 -0.0054 -0.0146 -0.0045 560 LEU A CG    
2121 C CD1   . LEU A 268 ? 0.3046 0.2976 0.2853 -0.0037 -0.0122 -0.0041 560 LEU A CD1   
2122 C CD2   . LEU A 268 ? 0.2801 0.2746 0.2564 -0.0067 -0.0163 -0.0040 560 LEU A CD2   
2123 N N     . HIS A 269 ? 0.2157 0.2234 0.2130 -0.0039 -0.0125 -0.0066 561 HIS A N     
2124 C CA    . HIS A 269 ? 0.1870 0.1977 0.1883 -0.0042 -0.0124 -0.0073 561 HIS A CA    
2125 C C     . HIS A 269 ? 0.2083 0.2148 0.2065 -0.0043 -0.0114 -0.0068 561 HIS A C     
2126 O O     . HIS A 269 ? 0.2529 0.2575 0.2519 -0.0036 -0.0093 -0.0065 561 HIS A O     
2127 C CB    . HIS A 269 ? 0.1930 0.2071 0.2004 -0.0035 -0.0110 -0.0080 561 HIS A CB    
2128 C CG    . HIS A 269 ? 0.1890 0.2074 0.1995 -0.0034 -0.0122 -0.0086 561 HIS A CG    
2129 N ND1   . HIS A 269 ? 0.1976 0.2209 0.2115 -0.0040 -0.0141 -0.0094 561 HIS A ND1   
2130 C CD2   . HIS A 269 ? 0.2444 0.2624 0.2543 -0.0026 -0.0120 -0.0085 561 HIS A CD2   
2131 C CE1   . HIS A 269 ? 0.2029 0.2289 0.2185 -0.0038 -0.0149 -0.0097 561 HIS A CE1   
2132 N NE2   . HIS A 269 ? 0.2268 0.2495 0.2400 -0.0029 -0.0137 -0.0092 561 HIS A NE2   
2133 N N     . THR A 270 ? 0.2072 0.2126 0.2017 -0.0051 -0.0130 -0.0066 562 THR A N     
2134 C CA    . THR A 270 ? 0.2059 0.2072 0.1968 -0.0051 -0.0125 -0.0062 562 THR A CA    
2135 C C     . THR A 270 ? 0.2695 0.2724 0.2642 -0.0049 -0.0120 -0.0069 562 THR A C     
2136 O O     . THR A 270 ? 0.2606 0.2683 0.2597 -0.0051 -0.0132 -0.0079 562 THR A O     
2137 C CB    . THR A 270 ? 0.2503 0.2515 0.2374 -0.0061 -0.0147 -0.0063 562 THR A CB    
2138 O OG1   . THR A 270 ? 0.2682 0.2683 0.2520 -0.0066 -0.0156 -0.0057 562 THR A OG1   
2139 C CG2   . THR A 270 ? 0.2481 0.2446 0.2309 -0.0058 -0.0142 -0.0059 562 THR A CG2   
2140 N N     . ARG A 271 ? 0.2333 0.2321 0.2262 -0.0044 -0.0102 -0.0064 563 ARG A N     
2141 C CA    . ARG A 271 ? 0.2418 0.2411 0.2376 -0.0044 -0.0097 -0.0069 563 ARG A CA    
2142 C C     . ARG A 271 ? 0.2447 0.2424 0.2375 -0.0045 -0.0113 -0.0073 563 ARG A C     
2143 O O     . ARG A 271 ? 0.2815 0.2749 0.2691 -0.0044 -0.0112 -0.0067 563 ARG A O     
2144 C CB    . ARG A 271 ? 0.2457 0.2414 0.2412 -0.0040 -0.0068 -0.0062 563 ARG A CB    
2145 C CG    . ARG A 271 ? 0.3245 0.3220 0.3229 -0.0036 -0.0051 -0.0060 563 ARG A CG    
2146 C CD    . ARG A 271 ? 0.3956 0.3910 0.3947 -0.0033 -0.0023 -0.0055 563 ARG A CD    
2147 N NE    . ARG A 271 ? 0.5982 0.5951 0.6009 -0.0040 -0.0021 -0.0060 563 ARG A NE    
2148 C CZ    . ARG A 271 ? 0.6032 0.5970 0.6051 -0.0044 -0.0002 -0.0056 563 ARG A CZ    
2149 N NH1   . ARG A 271 ? 0.6193 0.6087 0.6169 -0.0040 0.0016  -0.0046 563 ARG A NH1   
2150 N NH2   . ARG A 271 ? 0.5099 0.5048 0.5148 -0.0051 -0.0004 -0.0060 563 ARG A NH2   
2151 N N     . PHE A 272 ? 0.2229 0.2240 0.2187 -0.0046 -0.0129 -0.0084 564 PHE A N     
2152 C CA    . PHE A 272 ? 0.2138 0.2137 0.2068 -0.0045 -0.0147 -0.0090 564 PHE A CA    
2153 C C     . PHE A 272 ? 0.2665 0.2639 0.2603 -0.0042 -0.0139 -0.0092 564 PHE A C     
2154 O O     . PHE A 272 ? 0.2961 0.2958 0.2945 -0.0043 -0.0135 -0.0096 564 PHE A O     
2155 C CB    . PHE A 272 ? 0.2660 0.2715 0.2607 -0.0047 -0.0176 -0.0102 564 PHE A CB    
2156 C CG    . PHE A 272 ? 0.2629 0.2702 0.2557 -0.0054 -0.0185 -0.0099 564 PHE A CG    
2157 C CD1   . PHE A 272 ? 0.2558 0.2607 0.2434 -0.0057 -0.0193 -0.0096 564 PHE A CD1   
2158 C CD2   . PHE A 272 ? 0.2580 0.2692 0.2542 -0.0058 -0.0185 -0.0099 564 PHE A CD2   
2159 C CE1   . PHE A 272 ? 0.2540 0.2601 0.2395 -0.0066 -0.0201 -0.0092 564 PHE A CE1   
2160 C CE2   . PHE A 272 ? 0.2580 0.2702 0.2519 -0.0066 -0.0194 -0.0095 564 PHE A CE2   
2161 C CZ    . PHE A 272 ? 0.2402 0.2498 0.2288 -0.0071 -0.0202 -0.0091 564 PHE A CZ    
2162 N N     . ASN A 273 ? 0.2807 0.2731 0.2698 -0.0038 -0.0139 -0.0089 565 ASN A N     
2163 C CA    . ASN A 273 ? 0.2579 0.2468 0.2467 -0.0036 -0.0133 -0.0090 565 ASN A CA    
2164 C C     . ASN A 273 ? 0.2503 0.2381 0.2361 -0.0029 -0.0157 -0.0100 565 ASN A C     
2165 O O     . ASN A 273 ? 0.2670 0.2531 0.2484 -0.0026 -0.0167 -0.0101 565 ASN A O     
2166 C CB    . ASN A 273 ? 0.3324 0.3153 0.3179 -0.0038 -0.0104 -0.0076 565 ASN A CB    
2167 C CG    . ASN A 273 ? 0.5007 0.4808 0.4871 -0.0041 -0.0092 -0.0074 565 ASN A CG    
2168 O OD1   . ASN A 273 ? 0.3947 0.3713 0.3782 -0.0038 -0.0103 -0.0077 565 ASN A OD1   
2169 N ND2   . ASN A 273 ? 0.6290 0.6104 0.6192 -0.0048 -0.0070 -0.0069 565 ASN A ND2   
2170 N N     . GLN A 274 ? 0.2658 0.2546 0.2539 -0.0027 -0.0170 -0.0110 566 GLN A N     
2171 C CA    . GLN A 274 ? 0.2966 0.2853 0.2824 -0.0017 -0.0198 -0.0124 566 GLN A CA    
2172 C C     . GLN A 274 ? 0.3159 0.2978 0.2980 -0.0013 -0.0194 -0.0122 566 GLN A C     
2173 O O     . GLN A 274 ? 0.3143 0.2952 0.2941 -0.0002 -0.0217 -0.0134 566 GLN A O     
2174 C CB    . GLN A 274 ? 0.3354 0.3304 0.3259 -0.0013 -0.0223 -0.0140 566 GLN A CB    
2175 C CG    . GLN A 274 ? 0.3434 0.3380 0.3375 -0.0014 -0.0220 -0.0143 566 GLN A CG    
2176 C CD    . GLN A 274 ? 0.2994 0.3007 0.2986 -0.0010 -0.0243 -0.0158 566 GLN A CD    
2177 O OE1   . GLN A 274 ? 0.2775 0.2824 0.2816 -0.0017 -0.0233 -0.0156 566 GLN A OE1   
2178 N NE2   . GLN A 274 ? 0.2676 0.2706 0.2656 0.0002  -0.0273 -0.0174 566 GLN A NE2   
2179 N N     . THR A 275 ? 0.2714 0.2488 0.2528 -0.0021 -0.0165 -0.0107 567 THR A N     
2180 C CA    . THR A 275 ? 0.2726 0.2429 0.2496 -0.0019 -0.0158 -0.0102 567 THR A CA    
2181 C C     . THR A 275 ? 0.3175 0.2828 0.2903 -0.0023 -0.0132 -0.0086 567 THR A C     
2182 O O     . THR A 275 ? 0.3563 0.3174 0.3282 -0.0031 -0.0109 -0.0075 567 THR A O     
2183 C CB    . THR A 275 ? 0.3194 0.2885 0.2993 -0.0028 -0.0151 -0.0100 567 THR A CB    
2184 O OG1   . THR A 275 ? 0.3068 0.2766 0.2898 -0.0041 -0.0119 -0.0087 567 THR A OG1   
2185 C CG2   . THR A 275 ? 0.2849 0.2592 0.2693 -0.0024 -0.0177 -0.0117 567 THR A CG2   
2186 N N     . ALA A 276 ? 0.2758 0.2414 0.2457 -0.0017 -0.0137 -0.0085 568 ALA A N     
2187 C CA    . ALA A 276 ? 0.2968 0.2584 0.2633 -0.0019 -0.0112 -0.0070 568 ALA A CA    
2188 C C     . ALA A 276 ? 0.3921 0.3486 0.3519 -0.0010 -0.0119 -0.0070 568 ALA A C     
2189 O O     . ALA A 276 ? 0.4095 0.3611 0.3657 -0.0010 -0.0099 -0.0058 568 ALA A O     
2190 C CB    . ALA A 276 ? 0.3750 0.3409 0.3440 -0.0023 -0.0104 -0.0066 568 ALA A CB    
2191 N N     . THR A 277 ? 0.3400 0.2979 0.2983 0.0000  -0.0149 -0.0085 569 THR A N     
2192 C CA    . THR A 277 ? 0.2603 0.2144 0.2126 0.0010  -0.0158 -0.0087 569 THR A CA    
2193 C C     . THR A 277 ? 0.2835 0.2336 0.2323 0.0022  -0.0177 -0.0098 569 THR A C     
2194 O O     . THR A 277 ? 0.3116 0.2634 0.2629 0.0024  -0.0192 -0.0108 569 THR A O     
2195 C CB    . THR A 277 ? 0.3060 0.2651 0.2584 0.0012  -0.0179 -0.0096 569 THR A CB    
2196 O OG1   . THR A 277 ? 0.3140 0.2782 0.2691 0.0017  -0.0207 -0.0114 569 THR A OG1   
2197 C CG2   . THR A 277 ? 0.3270 0.2898 0.2827 0.0001  -0.0164 -0.0087 569 THR A CG2   
2198 N N     . ALA A 278 ? 0.2988 0.2438 0.2416 0.0031  -0.0179 -0.0096 570 ALA A N     
2199 C CA    . ALA A 278 ? 0.3239 0.2639 0.2623 0.0044  -0.0195 -0.0105 570 ALA A CA    
2200 C C     . ALA A 278 ? 0.4187 0.3630 0.3574 0.0058  -0.0233 -0.0129 570 ALA A C     
2201 O O     . ALA A 278 ? 0.4185 0.3599 0.3549 0.0070  -0.0252 -0.0140 570 ALA A O     
2202 C CB    . ALA A 278 ? 0.3834 0.3166 0.3153 0.0051  -0.0185 -0.0097 570 ALA A CB    
2203 N N     . THR A 279 ? 0.3431 0.2942 0.2844 0.0056  -0.0245 -0.0136 571 THR A N     
2204 C CA    . THR A 279 ? 0.4234 0.3793 0.3646 0.0069  -0.0280 -0.0159 571 THR A CA    
2205 C C     . THR A 279 ? 0.4090 0.3730 0.3565 0.0064  -0.0294 -0.0170 571 THR A C     
2206 O O     . THR A 279 ? 0.3814 0.3501 0.3294 0.0075  -0.0324 -0.0190 571 THR A O     
2207 C CB    . THR A 279 ? 0.4620 0.4200 0.4005 0.0070  -0.0287 -0.0163 571 THR A CB    
2208 O OG1   . THR A 279 ? 0.5052 0.4673 0.4470 0.0053  -0.0272 -0.0152 571 THR A OG1   
2209 C CG2   . THR A 279 ? 0.4318 0.3819 0.3638 0.0077  -0.0276 -0.0155 571 THR A CG2   
2210 N N     . GLY A 280 ? 0.3178 0.2837 0.2700 0.0049  -0.0274 -0.0157 572 GLY A N     
2211 C CA    . GLY A 280 ? 0.3173 0.2905 0.2754 0.0045  -0.0286 -0.0167 572 GLY A CA    
2212 C C     . GLY A 280 ? 0.3318 0.3112 0.2930 0.0032  -0.0282 -0.0162 572 GLY A C     
2213 O O     . GLY A 280 ? 0.3736 0.3590 0.3398 0.0027  -0.0289 -0.0168 572 GLY A O     
2214 N N     A ARG A 281 ? 0.2912 0.2688 0.2493 0.0026  -0.0270 -0.0153 573 ARG A N     
2215 N N     B ARG A 281 ? 0.2895 0.2670 0.2475 0.0026  -0.0271 -0.0153 573 ARG A N     
2216 C CA    A ARG A 281 ? 0.2896 0.2717 0.2500 0.0012  -0.0264 -0.0145 573 ARG A CA    
2217 C CA    B ARG A 281 ? 0.3030 0.2851 0.2633 0.0012  -0.0264 -0.0146 573 ARG A CA    
2218 C C     A ARG A 281 ? 0.3241 0.3068 0.2890 0.0001  -0.0241 -0.0132 573 ARG A C     
2219 C C     B ARG A 281 ? 0.3222 0.3048 0.2870 0.0001  -0.0241 -0.0132 573 ARG A C     
2220 O O     A ARG A 281 ? 0.3274 0.3052 0.2921 0.0001  -0.0219 -0.0121 573 ARG A O     
2221 O O     B ARG A 281 ? 0.3252 0.3029 0.2897 0.0001  -0.0219 -0.0121 573 ARG A O     
2222 C CB    A ARG A 281 ? 0.3540 0.3323 0.3095 0.0008  -0.0253 -0.0135 573 ARG A CB    
2223 C CB    B ARG A 281 ? 0.3920 0.3702 0.3473 0.0009  -0.0254 -0.0135 573 ARG A CB    
2224 C CG    A ARG A 281 ? 0.4241 0.4039 0.3758 0.0014  -0.0277 -0.0148 573 ARG A CG    
2225 C CG    B ARG A 281 ? 0.4496 0.4290 0.4009 0.0015  -0.0277 -0.0149 573 ARG A CG    
2226 C CD    A ARG A 281 ? 0.5008 0.4785 0.4490 0.0005  -0.0267 -0.0137 573 ARG A CD    
2227 C CD    B ARG A 281 ? 0.4514 0.4264 0.3980 0.0011  -0.0265 -0.0136 573 ARG A CD    
2228 N NE    A ARG A 281 ? 0.4454 0.4270 0.3969 -0.0012 -0.0259 -0.0127 573 ARG A NE    
2229 N NE    B ARG A 281 ? 0.3507 0.3279 0.2939 0.0012  -0.0286 -0.0149 573 ARG A NE    
2230 C CZ    A ARG A 281 ? 0.3440 0.3313 0.2962 -0.0024 -0.0276 -0.0133 573 ARG A CZ    
2231 C CZ    B ARG A 281 ? 0.4286 0.4032 0.3679 0.0006  -0.0281 -0.0141 573 ARG A CZ    
2232 N NH1   A ARG A 281 ? 0.3833 0.3737 0.3335 -0.0021 -0.0300 -0.0149 573 ARG A NH1   
2233 N NH1   B ARG A 281 ? 0.2686 0.2383 0.2067 0.0001  -0.0256 -0.0121 573 ARG A NH1   
2234 N NH2   A ARG A 281 ? 0.3881 0.3779 0.3429 -0.0038 -0.0268 -0.0124 573 ARG A NH2   
2235 N NH2   B ARG A 281 ? 0.3876 0.3647 0.3240 0.0006  -0.0302 -0.0153 573 ARG A NH2   
2236 N N     . LEU A 282 ? 0.2848 0.2737 0.2537 -0.0008 -0.0245 -0.0134 574 LEU A N     
2237 C CA    . LEU A 282 ? 0.2054 0.1953 0.1784 -0.0018 -0.0224 -0.0122 574 LEU A CA    
2238 C C     . LEU A 282 ? 0.3125 0.2982 0.2827 -0.0024 -0.0201 -0.0105 574 LEU A C     
2239 O O     . LEU A 282 ? 0.3910 0.3752 0.3571 -0.0025 -0.0206 -0.0103 574 LEU A O     
2240 C CB    . LEU A 282 ? 0.2705 0.2680 0.2479 -0.0025 -0.0238 -0.0129 574 LEU A CB    
2241 C CG    . LEU A 282 ? 0.3633 0.3660 0.3446 -0.0020 -0.0260 -0.0146 574 LEU A CG    
2242 C CD1   . LEU A 282 ? 0.3246 0.3347 0.3094 -0.0028 -0.0273 -0.0151 574 LEU A CD1   
2243 C CD2   . LEU A 282 ? 0.3453 0.3464 0.3301 -0.0016 -0.0248 -0.0144 574 LEU A CD2   
2244 N N     . SER A 283 ? 0.2596 0.2436 0.2320 -0.0027 -0.0176 -0.0094 575 SER A N     
2245 C CA    . SER A 283 ? 0.2425 0.2231 0.2126 -0.0030 -0.0155 -0.0079 575 SER A CA    
2246 C C     . SER A 283 ? 0.2644 0.2488 0.2387 -0.0037 -0.0146 -0.0074 575 SER A C     
2247 O O     . SER A 283 ? 0.2653 0.2538 0.2446 -0.0039 -0.0149 -0.0080 575 SER A O     
2248 C CB    . SER A 283 ? 0.3389 0.3131 0.3065 -0.0026 -0.0130 -0.0068 575 SER A CB    
2249 O OG    . SER A 283 ? 0.5332 0.5083 0.5051 -0.0029 -0.0113 -0.0065 575 SER A OG    
2250 N N     . SER A 284 ? 0.2426 0.2254 0.2146 -0.0040 -0.0137 -0.0064 576 SER A N     
2251 C CA    . SER A 284 ? 0.2120 0.1974 0.1873 -0.0044 -0.0129 -0.0060 576 SER A CA    
2252 C C     . SER A 284 ? 0.2376 0.2184 0.2107 -0.0039 -0.0102 -0.0048 576 SER A C     
2253 O O     . SER A 284 ? 0.2510 0.2267 0.2193 -0.0035 -0.0095 -0.0041 576 SER A O     
2254 C CB    . SER A 284 ? 0.2261 0.2146 0.2005 -0.0052 -0.0148 -0.0062 576 SER A CB    
2255 O OG    . SER A 284 ? 0.2471 0.2320 0.2157 -0.0054 -0.0153 -0.0057 576 SER A OG    
2256 N N     . SER A 285 ? 0.2559 0.2385 0.2325 -0.0038 -0.0088 -0.0045 577 SER A N     
2257 C CA    A SER A 285 ? 0.2856 0.2647 0.2606 -0.0032 -0.0064 -0.0035 577 SER A CA    
2258 C CA    B SER A 285 ? 0.2544 0.2335 0.2292 -0.0032 -0.0065 -0.0035 577 SER A CA    
2259 C C     . SER A 285 ? 0.3113 0.2933 0.2887 -0.0031 -0.0063 -0.0035 577 SER A C     
2260 O O     . SER A 285 ? 0.3043 0.2913 0.2861 -0.0035 -0.0074 -0.0042 577 SER A O     
2261 C CB    A SER A 285 ? 0.3346 0.3125 0.3117 -0.0029 -0.0040 -0.0033 577 SER A CB    
2262 C CB    B SER A 285 ? 0.3051 0.2819 0.2809 -0.0028 -0.0040 -0.0031 577 SER A CB    
2263 O OG    A SER A 285 ? 0.2795 0.2542 0.2542 -0.0029 -0.0041 -0.0033 577 SER A OG    
2264 O OG    B SER A 285 ? 0.3250 0.3060 0.3068 -0.0031 -0.0036 -0.0038 577 SER A OG    
2265 N N     . ASP A 286 ? 0.3341 0.3130 0.3085 -0.0023 -0.0051 -0.0027 578 ASP A N     
2266 C CA    . ASP A 286 ? 0.3544 0.3351 0.3302 -0.0019 -0.0051 -0.0027 578 ASP A CA    
2267 C C     . ASP A 286 ? 0.2893 0.2732 0.2657 -0.0028 -0.0077 -0.0032 578 ASP A C     
2268 O O     . ASP A 286 ? 0.3544 0.3426 0.3352 -0.0028 -0.0080 -0.0038 578 ASP A O     
2269 C CB    . ASP A 286 ? 0.4101 0.3945 0.3918 -0.0015 -0.0034 -0.0032 578 ASP A CB    
2270 C CG    . ASP A 286 ? 0.6172 0.5995 0.5993 -0.0011 -0.0008 -0.0029 578 ASP A CG    
2271 O OD1   . ASP A 286 ? 0.4919 0.4699 0.4699 -0.0004 0.0006  -0.0021 578 ASP A OD1   
2272 O OD2   . ASP A 286 ? 0.6433 0.6285 0.6299 -0.0016 -0.0002 -0.0034 578 ASP A OD2   
2273 N N     . PRO A 287 ? 0.3254 0.3075 0.2974 -0.0036 -0.0095 -0.0029 579 PRO A N     
2274 C CA    . PRO A 287 ? 0.4345 0.4115 0.4007 -0.0035 -0.0096 -0.0023 579 PRO A CA    
2275 C C     . PRO A 287 ? 0.3575 0.3348 0.3237 -0.0040 -0.0101 -0.0027 579 PRO A C     
2276 O O     . PRO A 287 ? 0.3072 0.2890 0.2772 -0.0046 -0.0113 -0.0036 579 PRO A O     
2277 C CB    . PRO A 287 ? 0.4404 0.4169 0.4029 -0.0046 -0.0118 -0.0020 579 PRO A CB    
2278 C CG    . PRO A 287 ? 0.3776 0.3602 0.3444 -0.0057 -0.0135 -0.0029 579 PRO A CG    
2279 C CD    . PRO A 287 ? 0.3326 0.3181 0.3051 -0.0047 -0.0119 -0.0033 579 PRO A CD    
2280 N N     . ASN A 288 ? 0.3118 0.2842 0.2736 -0.0035 -0.0093 -0.0022 580 ASN A N     
2281 C CA    . ASN A 288 ? 0.3686 0.3404 0.3285 -0.0039 -0.0106 -0.0026 580 ASN A CA    
2282 C C     . ASN A 288 ? 0.2972 0.2699 0.2540 -0.0050 -0.0130 -0.0028 580 ASN A C     
2283 O O     . ASN A 288 ? 0.3124 0.2810 0.2642 -0.0050 -0.0131 -0.0021 580 ASN A O     
2284 C CB    . ASN A 288 ? 0.3779 0.3439 0.3338 -0.0030 -0.0089 -0.0020 580 ASN A CB    
2285 C CG    . ASN A 288 ? 0.4152 0.3800 0.3685 -0.0031 -0.0102 -0.0025 580 ASN A CG    
2286 O OD1   . ASN A 288 ? 0.3327 0.3013 0.2872 -0.0038 -0.0124 -0.0034 580 ASN A OD1   
2287 N ND2   . ASN A 288 ? 0.3940 0.3536 0.3438 -0.0022 -0.0089 -0.0020 580 ASN A ND2   
2288 N N     . LEU A 289 ? 0.2675 0.2455 0.2270 -0.0060 -0.0150 -0.0037 581 LEU A N     
2289 C CA    . LEU A 289 ? 0.2698 0.2497 0.2269 -0.0074 -0.0174 -0.0040 581 LEU A CA    
2290 C C     . LEU A 289 ? 0.3102 0.2871 0.2623 -0.0075 -0.0183 -0.0041 581 LEU A C     
2291 O O     . LEU A 289 ? 0.2817 0.2589 0.2305 -0.0087 -0.0199 -0.0040 581 LEU A O     
2292 C CB    . LEU A 289 ? 0.2332 0.2202 0.1947 -0.0084 -0.0193 -0.0051 581 LEU A CB    
2293 C CG    . LEU A 289 ? 0.2890 0.2795 0.2556 -0.0083 -0.0187 -0.0051 581 LEU A CG    
2294 C CD1   . LEU A 289 ? 0.3169 0.3143 0.2883 -0.0088 -0.0203 -0.0064 581 LEU A CD1   
2295 C CD2   . LEU A 289 ? 0.3002 0.2901 0.2649 -0.0092 -0.0192 -0.0044 581 LEU A CD2   
2296 N N     . GLN A 290 ? 0.3145 0.2887 0.2659 -0.0063 -0.0173 -0.0042 582 GLN A N     
2297 C CA    . GLN A 290 ? 0.3130 0.2847 0.2599 -0.0062 -0.0183 -0.0046 582 GLN A CA    
2298 C C     . GLN A 290 ? 0.3597 0.3266 0.3009 -0.0064 -0.0182 -0.0037 582 GLN A C     
2299 O O     . GLN A 290 ? 0.2940 0.2609 0.2317 -0.0071 -0.0199 -0.0041 582 GLN A O     
2300 C CB    . GLN A 290 ? 0.3231 0.2916 0.2698 -0.0047 -0.0169 -0.0048 582 GLN A CB    
2301 C CG    . GLN A 290 ? 0.4585 0.4224 0.3996 -0.0041 -0.0173 -0.0048 582 GLN A CG    
2302 C CD    . GLN A 290 ? 0.5962 0.5636 0.5361 -0.0046 -0.0200 -0.0062 582 GLN A CD    
2303 O OE1   . GLN A 290 ? 0.6394 0.6124 0.5831 -0.0049 -0.0214 -0.0074 582 GLN A OE1   
2304 N NE2   . GLN A 290 ? 0.4736 0.4381 0.4084 -0.0047 -0.0208 -0.0062 582 GLN A NE2   
2305 N N     . ASN A 291 ? 0.2969 0.2600 0.2369 -0.0059 -0.0165 -0.0025 583 ASN A N     
2306 C CA    . ASN A 291 ? 0.3251 0.2824 0.2593 -0.0056 -0.0162 -0.0016 583 ASN A CA    
2307 C C     . ASN A 291 ? 0.3279 0.2852 0.2598 -0.0070 -0.0175 -0.0010 583 ASN A C     
2308 O O     . ASN A 291 ? 0.3500 0.3022 0.2772 -0.0067 -0.0173 -0.0002 583 ASN A O     
2309 C CB    . ASN A 291 ? 0.3950 0.3472 0.3282 -0.0039 -0.0135 -0.0006 583 ASN A CB    
2310 C CG    . ASN A 291 ? 0.4128 0.3635 0.3466 -0.0028 -0.0122 -0.0009 583 ASN A CG    
2311 O OD1   . ASN A 291 ? 0.3640 0.3144 0.2958 -0.0029 -0.0134 -0.0016 583 ASN A OD1   
2312 N ND2   . ASN A 291 ? 0.4686 0.4185 0.4049 -0.0019 -0.0099 -0.0005 583 ASN A ND2   
2313 N N     . ILE A 292 ? 0.3300 0.2929 0.2652 -0.0085 -0.0191 -0.0016 584 ILE A N     
2314 C CA    . ILE A 292 ? 0.3447 0.3077 0.2772 -0.0102 -0.0207 -0.0011 584 ILE A CA    
2315 C C     . ILE A 292 ? 0.3465 0.3104 0.2755 -0.0117 -0.0228 -0.0016 584 ILE A C     
2316 O O     . ILE A 292 ? 0.3612 0.3305 0.2927 -0.0125 -0.0240 -0.0027 584 ILE A O     
2317 C CB    . ILE A 292 ? 0.3297 0.2985 0.2668 -0.0114 -0.0216 -0.0014 584 ILE A CB    
2318 C CG1   . ILE A 292 ? 0.2953 0.2643 0.2367 -0.0098 -0.0196 -0.0013 584 ILE A CG1   
2319 C CG2   . ILE A 292 ? 0.3170 0.2847 0.2504 -0.0132 -0.0233 -0.0008 584 ILE A CG2   
2320 C CD1   . ILE A 292 ? 0.3452 0.3205 0.2920 -0.0106 -0.0203 -0.0019 584 ILE A CD1   
2321 N N     . PRO A 293 ? 0.3590 0.3177 0.2821 -0.0122 -0.0233 -0.0008 585 PRO A N     
2322 C CA    . PRO A 293 ? 0.4191 0.3784 0.3386 -0.0137 -0.0251 -0.0013 585 PRO A CA    
2323 C C     . PRO A 293 ? 0.4665 0.4320 0.3874 -0.0163 -0.0274 -0.0018 585 PRO A C     
2324 O O     . PRO A 293 ? 0.4275 0.3942 0.3496 -0.0174 -0.0277 -0.0013 585 PRO A O     
2325 C CB    . PRO A 293 ? 0.4230 0.3751 0.3361 -0.0136 -0.0251 -0.0002 585 PRO A CB    
2326 C CG    . PRO A 293 ? 0.5003 0.4478 0.4138 -0.0113 -0.0228 0.0007  585 PRO A CG    
2327 C CD    . PRO A 293 ? 0.3858 0.3381 0.3054 -0.0112 -0.0222 0.0004  585 PRO A CD    
2328 N N     . VAL A 294 ? 0.3906 0.3604 0.3114 -0.0174 -0.0289 -0.0030 586 VAL A N     
2329 C CA    . VAL A 294 ? 0.4669 0.4438 0.3895 -0.0199 -0.0310 -0.0037 586 VAL A CA    
2330 C C     . VAL A 294 ? 0.4805 0.4558 0.3978 -0.0227 -0.0327 -0.0031 586 VAL A C     
2331 O O     . VAL A 294 ? 0.5284 0.5073 0.4462 -0.0251 -0.0340 -0.0029 586 VAL A O     
2332 C CB    . VAL A 294 ? 0.5669 0.5497 0.4919 -0.0196 -0.0319 -0.0055 586 VAL A CB    
2333 C CG1   . VAL A 294 ? 0.5769 0.5674 0.5029 -0.0224 -0.0342 -0.0065 586 VAL A CG1   
2334 C CG2   . VAL A 294 ? 0.4430 0.4275 0.3733 -0.0172 -0.0306 -0.0062 586 VAL A CG2   
2335 N N     . ARG A 295 ? 0.4738 0.4436 0.3860 -0.0224 -0.0327 -0.0027 587 ARG A N     
2336 C CA    . ARG A 295 ? 0.6317 0.6005 0.5386 -0.0252 -0.0346 -0.0024 587 ARG A CA    
2337 C C     . ARG A 295 ? 0.6231 0.5848 0.5253 -0.0259 -0.0346 -0.0006 587 ARG A C     
2338 O O     . ARG A 295 ? 0.7419 0.7039 0.6409 -0.0289 -0.0363 -0.0001 587 ARG A O     
2339 C CB    . ARG A 295 ? 0.8341 0.8019 0.7380 -0.0246 -0.0350 -0.0032 587 ARG A CB    
2340 C CG    . ARG A 295 ? 1.0027 0.9702 0.9014 -0.0276 -0.0370 -0.0031 587 ARG A CG    
2341 C CD    . ARG A 295 ? 1.1344 1.0989 1.0294 -0.0265 -0.0372 -0.0037 587 ARG A CD    
2342 N NE    . ARG A 295 ? 1.1787 1.1342 1.0705 -0.0241 -0.0355 -0.0026 587 ARG A NE    
2343 C CZ    . ARG A 295 ? 1.2038 1.1568 1.0973 -0.0207 -0.0336 -0.0028 587 ARG A CZ    
2344 N NH1   . ARG A 295 ? 1.1731 1.1313 1.0712 -0.0195 -0.0333 -0.0041 587 ARG A NH1   
2345 N NH2   . ARG A 295 ? 1.2425 1.1876 1.1327 -0.0187 -0.0322 -0.0018 587 ARG A NH2   
2346 N N     . THR A 296 ? 0.4805 0.4359 0.3820 -0.0232 -0.0327 0.0002  588 THR A N     
2347 C CA    . THR A 296 ? 0.5210 0.4689 0.4173 -0.0233 -0.0327 0.0016  588 THR A CA    
2348 C C     . THR A 296 ? 0.4677 0.4166 0.3648 -0.0249 -0.0335 0.0024  588 THR A C     
2349 O O     . THR A 296 ? 0.5246 0.4791 0.4272 -0.0248 -0.0331 0.0019  588 THR A O     
2350 C CB    . THR A 296 ? 0.6488 0.5905 0.5446 -0.0197 -0.0304 0.0022  588 THR A CB    
2351 O OG1   . THR A 296 ? 0.4667 0.4106 0.3678 -0.0181 -0.0288 0.0022  588 THR A OG1   
2352 C CG2   . THR A 296 ? 0.6393 0.5806 0.5350 -0.0180 -0.0295 0.0014  588 THR A CG2   
2353 N N     . PRO A 297 ? 0.4694 0.4126 0.3609 -0.0262 -0.0347 0.0035  589 PRO A N     
2354 C CA    . PRO A 297 ? 0.5019 0.4449 0.3931 -0.0275 -0.0356 0.0042  589 PRO A CA    
2355 C C     . PRO A 297 ? 0.4756 0.4186 0.3714 -0.0247 -0.0337 0.0043  589 PRO A C     
2356 O O     . PRO A 297 ? 0.4422 0.3894 0.3414 -0.0256 -0.0341 0.0042  589 PRO A O     
2357 C CB    . PRO A 297 ? 0.5329 0.4677 0.4165 -0.0284 -0.0369 0.0055  589 PRO A CB    
2358 C CG    . PRO A 297 ? 0.5552 0.4889 0.4352 -0.0294 -0.0376 0.0052  589 PRO A CG    
2359 C CD    . PRO A 297 ? 0.5333 0.4700 0.4178 -0.0267 -0.0356 0.0041  589 PRO A CD    
2360 N N     . LEU A 298 ? 0.4970 0.4357 0.3928 -0.0214 -0.0317 0.0044  590 LEU A N     
2361 C CA    . LEU A 298 ? 0.4786 0.4172 0.3782 -0.0188 -0.0299 0.0044  590 LEU A CA    
2362 C C     . LEU A 298 ? 0.3942 0.3401 0.3014 -0.0180 -0.0286 0.0034  590 LEU A C     
2363 O O     . LEU A 298 ? 0.4589 0.4076 0.3704 -0.0173 -0.0279 0.0032  590 LEU A O     
2364 C CB    . LEU A 298 ? 0.5045 0.4363 0.4015 -0.0156 -0.0282 0.0049  590 LEU A CB    
2365 C CG    . LEU A 298 ? 0.5508 0.4819 0.4508 -0.0129 -0.0265 0.0049  590 LEU A CG    
2366 C CD1   . LEU A 298 ? 0.5450 0.4755 0.4438 -0.0140 -0.0280 0.0053  590 LEU A CD1   
2367 C CD2   . LEU A 298 ? 0.5483 0.4730 0.4451 -0.0099 -0.0249 0.0053  590 LEU A CD2   
2368 N N     . GLY A 299 ? 0.4131 0.3619 0.3218 -0.0181 -0.0283 0.0026  591 GLY A N     
2369 C CA    . GLY A 299 ? 0.3846 0.3402 0.2999 -0.0176 -0.0275 0.0015  591 GLY A CA    
2370 C C     . GLY A 299 ? 0.3911 0.3531 0.3093 -0.0201 -0.0292 0.0011  591 GLY A C     
2371 O O     . GLY A 299 ? 0.3718 0.3385 0.2956 -0.0194 -0.0285 0.0006  591 GLY A O     
2372 N N     . GLN A 300 ? 0.4032 0.3656 0.3175 -0.0230 -0.0313 0.0014  592 GLN A N     
2373 C CA    . GLN A 300 ? 0.3954 0.3637 0.3116 -0.0256 -0.0330 0.0011  592 GLN A CA    
2374 C C     . GLN A 300 ? 0.3801 0.3468 0.2970 -0.0253 -0.0329 0.0019  592 GLN A C     
2375 O O     . GLN A 300 ? 0.3903 0.3625 0.3119 -0.0258 -0.0331 0.0014  592 GLN A O     
2376 C CB    . GLN A 300 ? 0.4542 0.4228 0.3655 -0.0291 -0.0353 0.0014  592 GLN A CB    
2377 C CG    . GLN A 300 ? 0.5315 0.5040 0.4430 -0.0297 -0.0358 0.0003  592 GLN A CG    
2378 C CD    . GLN A 300 ? 0.7343 0.7067 0.6405 -0.0331 -0.0379 0.0005  592 GLN A CD    
2379 O OE1   . GLN A 300 ? 0.6907 0.6581 0.5919 -0.0348 -0.0389 0.0017  592 GLN A OE1   
2380 N NE2   . GLN A 300 ? 0.8365 0.8143 0.7437 -0.0340 -0.0386 -0.0008 592 GLN A NE2   
2381 N N     . ARG A 301 ? 0.3768 0.3359 0.2890 -0.0244 -0.0326 0.0029  593 ARG A N     
2382 C CA    . ARG A 301 ? 0.4064 0.3632 0.3187 -0.0236 -0.0326 0.0035  593 ARG A CA    
2383 C C     . ARG A 301 ? 0.3676 0.3276 0.2866 -0.0208 -0.0305 0.0028  593 ARG A C     
2384 O O     . ARG A 301 ? 0.4133 0.3754 0.3350 -0.0206 -0.0306 0.0027  593 ARG A O     
2385 C CB    . ARG A 301 ? 0.4954 0.4432 0.4012 -0.0226 -0.0327 0.0046  593 ARG A CB    
2386 C CG    . ARG A 301 ? 0.5411 0.4850 0.4397 -0.0256 -0.0352 0.0054  593 ARG A CG    
2387 C CD    . ARG A 301 ? 0.6747 0.6095 0.5671 -0.0243 -0.0356 0.0064  593 ARG A CD    
2388 N NE    . ARG A 301 ? 0.7747 0.7088 0.6680 -0.0234 -0.0358 0.0066  593 ARG A NE    
2389 C CZ    . ARG A 301 ? 0.8029 0.7300 0.6920 -0.0214 -0.0360 0.0071  593 ARG A CZ    
2390 N NH1   . ARG A 301 ? 0.7443 0.6645 0.6281 -0.0200 -0.0360 0.0076  593 ARG A NH1   
2391 N NH2   . ARG A 301 ? 0.7729 0.7000 0.6631 -0.0205 -0.0364 0.0071  593 ARG A NH2   
2392 N N     . ILE A 302 ? 0.3655 0.3256 0.2870 -0.0187 -0.0286 0.0023  594 ILE A N     
2393 C CA    . ILE A 302 ? 0.3357 0.2991 0.2636 -0.0164 -0.0266 0.0017  594 ILE A CA    
2394 C C     . ILE A 302 ? 0.3160 0.2875 0.2496 -0.0177 -0.0273 0.0007  594 ILE A C     
2395 O O     . ILE A 302 ? 0.2929 0.2673 0.2310 -0.0168 -0.0266 0.0004  594 ILE A O     
2396 C CB    . ILE A 302 ? 0.3379 0.2994 0.2667 -0.0141 -0.0245 0.0014  594 ILE A CB    
2397 C CG1   . ILE A 302 ? 0.4001 0.3540 0.3241 -0.0123 -0.0235 0.0023  594 ILE A CG1   
2398 C CG2   . ILE A 302 ? 0.3179 0.2838 0.2536 -0.0124 -0.0227 0.0006  594 ILE A CG2   
2399 C CD1   . ILE A 302 ? 0.4526 0.4036 0.3757 -0.0105 -0.0217 0.0023  594 ILE A CD1   
2400 N N     . ARG A 303 ? 0.3401 0.3157 0.2736 -0.0197 -0.0287 0.0002  595 ARG A N     
2401 C CA    . ARG A 303 ? 0.2974 0.2809 0.2362 -0.0209 -0.0295 -0.0008 595 ARG A CA    
2402 C C     . ARG A 303 ? 0.3205 0.3060 0.2592 -0.0227 -0.0309 -0.0004 595 ARG A C     
2403 O O     . ARG A 303 ? 0.2914 0.2827 0.2351 -0.0228 -0.0311 -0.0011 595 ARG A O     
2404 C CB    . ARG A 303 ? 0.2750 0.2629 0.2136 -0.0224 -0.0307 -0.0016 595 ARG A CB    
2405 C CG    . ARG A 303 ? 0.3466 0.3342 0.2871 -0.0203 -0.0293 -0.0023 595 ARG A CG    
2406 C CD    . ARG A 303 ? 0.3852 0.3776 0.3258 -0.0214 -0.0307 -0.0035 595 ARG A CD    
2407 N NE    . ARG A 303 ? 0.4633 0.4539 0.4047 -0.0191 -0.0294 -0.0040 595 ARG A NE    
2408 C CZ    . ARG A 303 ? 0.4547 0.4391 0.3917 -0.0183 -0.0286 -0.0035 595 ARG A CZ    
2409 N NH1   . ARG A 303 ? 0.4285 0.4082 0.3600 -0.0195 -0.0292 -0.0024 595 ARG A NH1   
2410 N NH2   . ARG A 303 ? 0.4342 0.4169 0.3718 -0.0163 -0.0274 -0.0040 595 ARG A NH2   
2411 N N     . ARG A 304 ? 0.2619 0.2423 0.1946 -0.0241 -0.0320 0.0007  596 ARG A N     
2412 C CA    . ARG A 304 ? 0.2722 0.2530 0.2037 -0.0258 -0.0335 0.0012  596 ARG A CA    
2413 C C     . ARG A 304 ? 0.2902 0.2705 0.2253 -0.0234 -0.0323 0.0011  596 ARG A C     
2414 O O     . ARG A 304 ? 0.2961 0.2788 0.2324 -0.0244 -0.0333 0.0012  596 ARG A O     
2415 C CB    . ARG A 304 ? 0.3064 0.2805 0.2299 -0.0277 -0.0350 0.0025  596 ARG A CB    
2416 C CG    . ARG A 304 ? 0.3772 0.3514 0.2985 -0.0300 -0.0369 0.0031  596 ARG A CG    
2417 C CD    . ARG A 304 ? 0.5540 0.5212 0.4669 -0.0322 -0.0386 0.0043  596 ARG A CD    
2418 N NE    . ARG A 304 ? 0.5625 0.5318 0.4726 -0.0353 -0.0399 0.0044  596 ARG A NE    
2419 C CZ    . ARG A 304 ? 0.6326 0.5966 0.5372 -0.0360 -0.0404 0.0049  596 ARG A CZ    
2420 N NH1   . ARG A 304 ? 0.6547 0.6105 0.5556 -0.0336 -0.0396 0.0056  596 ARG A NH1   
2421 N NH2   . ARG A 304 ? 0.5960 0.5628 0.4986 -0.0389 -0.0416 0.0048  596 ARG A NH2   
2422 N N     . ALA A 305 ? 0.3164 0.2938 0.2531 -0.0204 -0.0301 0.0010  597 ALA A N     
2423 C CA    . ALA A 305 ? 0.2969 0.2742 0.2372 -0.0179 -0.0288 0.0007  597 ALA A CA    
2424 C C     . ALA A 305 ? 0.2519 0.2367 0.1999 -0.0173 -0.0281 -0.0004 597 ALA A C     
2425 O O     . ALA A 305 ? 0.2578 0.2437 0.2093 -0.0158 -0.0273 -0.0007 597 ALA A O     
2426 C CB    . ALA A 305 ? 0.3196 0.2915 0.2588 -0.0150 -0.0267 0.0010  597 ALA A CB    
2427 N N     . PHE A 306 ? 0.2207 0.2105 0.1714 -0.0184 -0.0284 -0.0010 598 PHE A N     
2428 C CA    . PHE A 306 ? 0.2147 0.2116 0.1724 -0.0179 -0.0280 -0.0022 598 PHE A CA    
2429 C C     . PHE A 306 ? 0.2503 0.2525 0.2089 -0.0203 -0.0301 -0.0024 598 PHE A C     
2430 O O     . PHE A 306 ? 0.2646 0.2688 0.2207 -0.0226 -0.0317 -0.0024 598 PHE A O     
2431 C CB    . PHE A 306 ? 0.2341 0.2335 0.1939 -0.0175 -0.0275 -0.0029 598 PHE A CB    
2432 C CG    . PHE A 306 ? 0.2211 0.2161 0.1810 -0.0151 -0.0252 -0.0028 598 PHE A CG    
2433 C CD1   . PHE A 306 ? 0.2625 0.2508 0.2169 -0.0147 -0.0247 -0.0019 598 PHE A CD1   
2434 C CD2   . PHE A 306 ? 0.2615 0.2592 0.2271 -0.0134 -0.0237 -0.0036 598 PHE A CD2   
2435 C CE1   . PHE A 306 ? 0.2885 0.2730 0.2428 -0.0126 -0.0226 -0.0018 598 PHE A CE1   
2436 C CE2   . PHE A 306 ? 0.2343 0.2282 0.1998 -0.0115 -0.0216 -0.0034 598 PHE A CE2   
2437 C CZ    . PHE A 306 ? 0.2229 0.2102 0.1827 -0.0111 -0.0210 -0.0025 598 PHE A CZ    
2438 N N     . ILE A 307 ? 0.2152 0.2201 0.1775 -0.0196 -0.0301 -0.0027 599 ILE A N     
2439 C CA    . ILE A 307 ? 0.2068 0.2158 0.1692 -0.0219 -0.0320 -0.0027 599 ILE A CA    
2440 C C     . ILE A 307 ? 0.2298 0.2462 0.1994 -0.0212 -0.0320 -0.0039 599 ILE A C     
2441 O O     . ILE A 307 ? 0.2650 0.2823 0.2393 -0.0188 -0.0303 -0.0045 599 ILE A O     
2442 C CB    . ILE A 307 ? 0.2317 0.2356 0.1899 -0.0221 -0.0327 -0.0017 599 ILE A CB    
2443 C CG1   . ILE A 307 ? 0.2741 0.2764 0.2356 -0.0190 -0.0310 -0.0020 599 ILE A CG1   
2444 C CG2   . ILE A 307 ? 0.2943 0.2908 0.2448 -0.0231 -0.0332 -0.0006 599 ILE A CG2   
2445 C CD1   . ILE A 307 ? 0.2941 0.2914 0.2516 -0.0187 -0.0318 -0.0013 599 ILE A CD1   
2446 N N     . ALA A 308 ? 0.2590 0.2807 0.2292 -0.0233 -0.0338 -0.0041 600 ALA A N     
2447 C CA    . ALA A 308 ? 0.2563 0.2850 0.2329 -0.0228 -0.0340 -0.0052 600 ALA A CA    
2448 C C     . ALA A 308 ? 0.2732 0.3008 0.2514 -0.0216 -0.0337 -0.0050 600 ALA A C     
2449 O O     . ALA A 308 ? 0.2958 0.3182 0.2692 -0.0222 -0.0342 -0.0040 600 ALA A O     
2450 C CB    . ALA A 308 ? 0.2516 0.2868 0.2280 -0.0256 -0.0361 -0.0056 600 ALA A CB    
2451 N N     . GLU A 309 ? 0.2484 0.2809 0.2332 -0.0199 -0.0331 -0.0061 601 GLU A N     
2452 C CA    . GLU A 309 ? 0.2308 0.2640 0.2180 -0.0189 -0.0331 -0.0063 601 GLU A CA    
2453 C C     . GLU A 309 ? 0.2746 0.3092 0.2584 -0.0215 -0.0353 -0.0057 601 GLU A C     
2454 O O     . GLU A 309 ? 0.2507 0.2888 0.2331 -0.0240 -0.0366 -0.0057 601 GLU A O     
2455 C CB    . GLU A 309 ? 0.2406 0.2803 0.2357 -0.0173 -0.0325 -0.0077 601 GLU A CB    
2456 C CG    . GLU A 309 ? 0.2489 0.2908 0.2473 -0.0163 -0.0328 -0.0081 601 GLU A CG    
2457 C CD    . GLU A 309 ? 0.4220 0.4690 0.4281 -0.0142 -0.0318 -0.0095 601 GLU A CD    
2458 O OE1   . GLU A 309 ? 0.3511 0.3985 0.3598 -0.0132 -0.0306 -0.0100 601 GLU A OE1   
2459 O OE2   . GLU A 309 ? 0.4306 0.4812 0.4401 -0.0137 -0.0324 -0.0101 601 GLU A OE2   
2460 N N     . GLU A 310 ? 0.2976 0.3292 0.2798 -0.0211 -0.0356 -0.0053 602 GLU A N     
2461 C CA    . GLU A 310 ? 0.3267 0.3594 0.3057 -0.0235 -0.0376 -0.0047 602 GLU A CA    
2462 C C     . GLU A 310 ? 0.2665 0.3083 0.2506 -0.0246 -0.0386 -0.0057 602 GLU A C     
2463 O O     . GLU A 310 ? 0.2855 0.3318 0.2761 -0.0226 -0.0378 -0.0069 602 GLU A O     
2464 C CB    . GLU A 310 ? 0.3489 0.3776 0.3266 -0.0221 -0.0378 -0.0045 602 GLU A CB    
2465 C CG    . GLU A 310 ? 0.4626 0.4821 0.4336 -0.0215 -0.0375 -0.0034 602 GLU A CG    
2466 C CD    . GLU A 310 ? 0.6563 0.6722 0.6200 -0.0248 -0.0390 -0.0021 602 GLU A CD    
2467 O OE1   . GLU A 310 ? 0.6450 0.6632 0.6064 -0.0277 -0.0409 -0.0017 602 GLU A OE1   
2468 O OE2   . GLU A 310 ? 0.6265 0.6374 0.5865 -0.0247 -0.0384 -0.0015 602 GLU A OE2   
2469 N N     . GLY A 311 ? 0.3238 0.3684 0.3048 -0.0279 -0.0403 -0.0053 603 GLY A N     
2470 C CA    . GLY A 311 ? 0.3136 0.3668 0.2990 -0.0287 -0.0410 -0.0062 603 GLY A CA    
2471 C C     . GLY A 311 ? 0.3743 0.4308 0.3630 -0.0278 -0.0399 -0.0072 603 GLY A C     
2472 O O     . GLY A 311 ? 0.3085 0.3691 0.3013 -0.0268 -0.0392 -0.0080 603 GLY A O     
2473 N N     . TRP A 312 ? 0.2578 0.3128 0.2205 0.0135  -0.0433 0.0064  604 TRP A N     
2474 C CA    . TRP A 312 ? 0.2637 0.3207 0.2276 0.0140  -0.0416 0.0059  604 TRP A CA    
2475 C C     . TRP A 312 ? 0.2799 0.3302 0.2418 0.0137  -0.0436 0.0079  604 TRP A C     
2476 O O     . TRP A 312 ? 0.2892 0.3330 0.2481 0.0131  -0.0464 0.0095  604 TRP A O     
2477 C CB    . TRP A 312 ? 0.2662 0.3268 0.2309 0.0162  -0.0394 0.0040  604 TRP A CB    
2478 C CG    . TRP A 312 ? 0.2435 0.3106 0.2101 0.0157  -0.0379 0.0023  604 TRP A CG    
2479 C CD1   . TRP A 312 ? 0.2678 0.3363 0.2346 0.0150  -0.0386 0.0024  604 TRP A CD1   
2480 C CD2   . TRP A 312 ? 0.2611 0.3333 0.2288 0.0153  -0.0360 0.0006  604 TRP A CD2   
2481 N NE1   . TRP A 312 ? 0.2944 0.3687 0.2626 0.0139  -0.0374 0.0010  604 TRP A NE1   
2482 C CE2   . TRP A 312 ? 0.3282 0.4044 0.2965 0.0139  -0.0359 -0.0002 604 TRP A CE2   
2483 C CE3   . TRP A 312 ? 0.2263 0.2998 0.1940 0.0158  -0.0346 -0.0002 604 TRP A CE3   
2484 C CZ2   . TRP A 312 ? 0.3223 0.4027 0.2905 0.0126  -0.0348 -0.0018 604 TRP A CZ2   
2485 C CZ3   . TRP A 312 ? 0.2574 0.3351 0.2250 0.0150  -0.0334 -0.0021 604 TRP A CZ3   
2486 C CH2   . TRP A 312 ? 0.2737 0.3544 0.2412 0.0132  -0.0336 -0.0029 604 TRP A CH2   
2487 N N     . LEU A 313 ? 0.2188 0.2707 0.1818 0.0139  -0.0426 0.0081  605 LEU A N     
2488 C CA    . LEU A 313 ? 0.2085 0.2542 0.1697 0.0134  -0.0446 0.0102  605 LEU A CA    
2489 C C     . LEU A 313 ? 0.2143 0.2622 0.1765 0.0154  -0.0424 0.0092  605 LEU A C     
2490 O O     . LEU A 313 ? 0.2474 0.3020 0.2120 0.0164  -0.0396 0.0074  605 LEU A O     
2491 C CB    . LEU A 313 ? 0.2711 0.3168 0.2333 0.0116  -0.0460 0.0124  605 LEU A CB    
2492 C CG    . LEU A 313 ? 0.2926 0.3342 0.2532 0.0100  -0.0491 0.0135  605 LEU A CG    
2493 C CD1   . LEU A 313 ? 0.2917 0.3373 0.2546 0.0092  -0.0489 0.0153  605 LEU A CD1   
2494 C CD2   . LEU A 313 ? 0.2953 0.3255 0.2510 0.0094  -0.0529 0.0146  605 LEU A CD2   
2495 N N     . LEU A 314 ? 0.2272 0.2692 0.1870 0.0156  -0.0439 0.0105  606 LEU A N     
2496 C CA    . LEU A 314 ? 0.2367 0.2800 0.1973 0.0173  -0.0422 0.0098  606 LEU A CA    
2497 C C     . LEU A 314 ? 0.3091 0.3534 0.2716 0.0158  -0.0427 0.0120  606 LEU A C     
2498 O O     . LEU A 314 ? 0.2535 0.2939 0.2152 0.0136  -0.0456 0.0146  606 LEU A O     
2499 C CB    . LEU A 314 ? 0.2110 0.2477 0.1677 0.0186  -0.0431 0.0101  606 LEU A CB    
2500 C CG    . LEU A 314 ? 0.2545 0.2909 0.2092 0.0215  -0.0420 0.0082  606 LEU A CG    
2501 C CD1   . LEU A 314 ? 0.2488 0.2785 0.1989 0.0237  -0.0425 0.0085  606 LEU A CD1   
2502 C CD2   . LEU A 314 ? 0.2263 0.2705 0.1842 0.0235  -0.0390 0.0056  606 LEU A CD2   
2503 N N     . VAL A 315 ? 0.2325 0.2822 0.1975 0.0173  -0.0402 0.0112  607 VAL A N     
2504 C CA    . VAL A 315 ? 0.2244 0.2765 0.1919 0.0167  -0.0401 0.0137  607 VAL A CA    
2505 C C     . VAL A 315 ? 0.2697 0.3194 0.2365 0.0180  -0.0397 0.0137  607 VAL A C     
2506 O O     . VAL A 315 ? 0.2684 0.3211 0.2355 0.0203  -0.0374 0.0111  607 VAL A O     
2507 C CB    . VAL A 315 ? 0.2046 0.2664 0.1754 0.0176  -0.0370 0.0131  607 VAL A CB    
2508 C CG1   . VAL A 315 ? 0.2258 0.2914 0.1996 0.0177  -0.0364 0.0166  607 VAL A CG1   
2509 C CG2   . VAL A 315 ? 0.2771 0.3415 0.2481 0.0164  -0.0371 0.0130  607 VAL A CG2   
2510 N N     . ALA A 316 ? 0.2023 0.2461 0.1678 0.0165  -0.0425 0.0166  608 ALA A N     
2511 C CA    . ALA A 316 ? 0.2797 0.3203 0.2441 0.0174  -0.0425 0.0169  608 ALA A CA    
2512 C C     . ALA A 316 ? 0.2902 0.3346 0.2584 0.0170  -0.0421 0.0198  608 ALA A C     
2513 O O     . ALA A 316 ? 0.2725 0.3164 0.2420 0.0150  -0.0439 0.0229  608 ALA A O     
2514 C CB    . ALA A 316 ? 0.2764 0.3068 0.2356 0.0155  -0.0461 0.0183  608 ALA A CB    
2515 N N     . LEU A 317 ? 0.1977 0.2462 0.1678 0.0192  -0.0394 0.0190  609 LEU A N     
2516 C CA    . LEU A 317 ? 0.2245 0.2777 0.1989 0.0193  -0.0384 0.0221  609 LEU A CA    
2517 C C     . LEU A 317 ? 0.3173 0.3656 0.2903 0.0197  -0.0392 0.0227  609 LEU A C     
2518 O O     . LEU A 317 ? 0.3317 0.3770 0.3024 0.0214  -0.0378 0.0193  609 LEU A O     
2519 C CB    . LEU A 317 ? 0.2429 0.3028 0.2211 0.0215  -0.0336 0.0199  609 LEU A CB    
2520 C CG    . LEU A 317 ? 0.2242 0.2892 0.2028 0.0214  -0.0327 0.0193  609 LEU A CG    
2521 C CD1   . LEU A 317 ? 0.2522 0.3165 0.2288 0.0224  -0.0306 0.0141  609 LEU A CD1   
2522 C CD2   . LEU A 317 ? 0.2464 0.3181 0.2293 0.0222  -0.0299 0.0220  609 LEU A CD2   
2523 N N     . ASP A 318 ? 0.2431 0.2896 0.2179 0.0177  -0.0408 0.0268  610 ASP A N     
2524 C CA    . ASP A 318 ? 0.2401 0.2813 0.2133 0.0177  -0.0419 0.0277  610 ASP A CA    
2525 C C     . ASP A 318 ? 0.2733 0.3201 0.2525 0.0177  -0.0403 0.0315  610 ASP A C     
2526 O O     . ASP A 318 ? 0.2738 0.3231 0.2565 0.0158  -0.0408 0.0351  610 ASP A O     
2527 C CB    . ASP A 318 ? 0.3029 0.3330 0.2700 0.0157  -0.0461 0.0282  610 ASP A CB    
2528 C CG    . ASP A 318 ? 0.4146 0.4381 0.3774 0.0165  -0.0470 0.0279  610 ASP A CG    
2529 O OD1   . ASP A 318 ? 0.5249 0.5501 0.4882 0.0179  -0.0453 0.0265  610 ASP A OD1   
2530 O OD2   . ASP A 318 ? 0.4765 0.4958 0.4366 0.0152  -0.0481 0.0295  610 ASP A OD2   
2531 N N     . TYR A 319 ? 0.2434 0.2899 0.2243 0.0194  -0.0373 0.0298  611 TYR A N     
2532 C CA    . TYR A 319 ? 0.2282 0.2782 0.2145 0.0194  -0.0359 0.0335  611 TYR A CA    
2533 C C     . TYR A 319 ? 0.3991 0.4445 0.3840 0.0164  -0.0404 0.0381  611 TYR A C     
2534 O O     . TYR A 319 ? 0.4199 0.4570 0.3993 0.0157  -0.0426 0.0365  611 TYR A O     
2535 C CB    . TYR A 319 ? 0.2835 0.3320 0.2715 0.0216  -0.0316 0.0300  611 TYR A CB    
2536 C CG    . TYR A 319 ? 0.2609 0.3134 0.2515 0.0242  -0.0266 0.0267  611 TYR A CG    
2537 C CD1   . TYR A 319 ? 0.2687 0.3274 0.2640 0.0258  -0.0241 0.0295  611 TYR A CD1   
2538 C CD2   . TYR A 319 ? 0.2523 0.3021 0.2404 0.0252  -0.0245 0.0212  611 TYR A CD2   
2539 C CE1   . TYR A 319 ? 0.2347 0.2951 0.2305 0.0286  -0.0195 0.0262  611 TYR A CE1   
2540 C CE2   . TYR A 319 ? 0.2859 0.3377 0.2750 0.0270  -0.0206 0.0182  611 TYR A CE2   
2541 C CZ    . TYR A 319 ? 0.2411 0.2972 0.2333 0.0288  -0.0181 0.0204  611 TYR A CZ    
2542 O OH    . TYR A 319 ? 0.2890 0.3451 0.2803 0.0310  -0.0144 0.0171  611 TYR A OH    
2543 N N     . SER A 320 ? 0.2750 0.3234 0.2641 0.0144  -0.0408 0.0422  612 SER A N     
2544 C CA    . SER A 320 ? 0.2508 0.2931 0.2385 0.0110  -0.0437 0.0448  612 SER A CA    
2545 C C     . SER A 320 ? 0.2730 0.3151 0.2633 0.0113  -0.0429 0.0468  612 SER A C     
2546 O O     . SER A 320 ? 0.2829 0.3332 0.2802 0.0129  -0.0401 0.0498  612 SER A O     
2547 C CB    . SER A 320 ? 0.3983 0.4457 0.3905 0.0084  -0.0440 0.0491  612 SER A CB    
2548 O OG    . SER A 320 ? 0.4440 0.4923 0.4344 0.0083  -0.0444 0.0475  612 SER A OG    
2549 N N     . GLN A 321 ? 0.2647 0.2977 0.2492 0.0103  -0.0451 0.0452  613 GLN A N     
2550 C CA    . GLN A 321 ? 0.2213 0.2527 0.2075 0.0099  -0.0449 0.0471  613 GLN A CA    
2551 C C     . GLN A 321 ? 0.2720 0.3107 0.2642 0.0133  -0.0414 0.0478  613 GLN A C     
2552 O O     . GLN A 321 ? 0.2369 0.2791 0.2346 0.0134  -0.0401 0.0513  613 GLN A O     
2553 C CB    . GLN A 321 ? 0.2774 0.3096 0.2669 0.0063  -0.0463 0.0518  613 GLN A CB    
2554 C CG    . GLN A 321 ? 0.2764 0.2999 0.2590 0.0031  -0.0497 0.0510  613 GLN A CG    
2555 C CD    . GLN A 321 ? 0.4423 0.4678 0.4284 -0.0013 -0.0516 0.0558  613 GLN A CD    
2556 O OE1   . GLN A 321 ? 0.4286 0.4617 0.4224 -0.0023 -0.0504 0.0602  613 GLN A OE1   
2557 N NE2   . GLN A 321 ? 0.4467 0.4658 0.4274 -0.0041 -0.0545 0.0552  613 GLN A NE2   
2558 N N     . ILE A 322 ? 0.2632 0.3035 0.2543 0.0164  -0.0389 0.0436  614 ILE A N     
2559 C CA    . ILE A 322 ? 0.2345 0.2782 0.2301 0.0196  -0.0332 0.0406  614 ILE A CA    
2560 C C     . ILE A 322 ? 0.2489 0.2887 0.2452 0.0197  -0.0323 0.0406  614 ILE A C     
2561 O O     . ILE A 322 ? 0.2357 0.2792 0.2373 0.0215  -0.0293 0.0421  614 ILE A O     
2562 C CB    . ILE A 322 ? 0.2417 0.2852 0.2351 0.0218  -0.0298 0.0341  614 ILE A CB    
2563 C CG1   . ILE A 322 ? 0.2410 0.2869 0.2382 0.0248  -0.0246 0.0317  614 ILE A CG1   
2564 C CG2   . ILE A 322 ? 0.2498 0.2864 0.2369 0.0212  -0.0312 0.0300  614 ILE A CG2   
2565 C CD1   . ILE A 322 ? 0.2729 0.3196 0.2684 0.0266  -0.0214 0.0265  614 ILE A CD1   
2566 N N     . GLU A 323 ? 0.2115 0.2439 0.2022 0.0181  -0.0350 0.0393  615 GLU A N     
2567 C CA    . GLU A 323 ? 0.2212 0.2500 0.2124 0.0180  -0.0343 0.0394  615 GLU A CA    
2568 C C     . GLU A 323 ? 0.2699 0.3014 0.2659 0.0165  -0.0361 0.0460  615 GLU A C     
2569 O O     . GLU A 323 ? 0.2518 0.2843 0.2519 0.0177  -0.0336 0.0466  615 GLU A O     
2570 C CB    . GLU A 323 ? 0.3288 0.3492 0.3124 0.0170  -0.0367 0.0371  615 GLU A CB    
2571 C CG    . GLU A 323 ? 0.4870 0.5059 0.4675 0.0190  -0.0338 0.0310  615 GLU A CG    
2572 C CD    . GLU A 323 ? 0.6142 0.6262 0.5884 0.0189  -0.0347 0.0293  615 GLU A CD    
2573 O OE1   . GLU A 323 ? 0.6818 0.6906 0.6558 0.0177  -0.0360 0.0318  615 GLU A OE1   
2574 O OE2   . GLU A 323 ? 0.6365 0.6467 0.6061 0.0203  -0.0341 0.0257  615 GLU A OE2   
2575 N N     . LEU A 324 ? 0.2622 0.2948 0.2578 0.0138  -0.0405 0.0512  616 LEU A N     
2576 C CA    . LEU A 324 ? 0.2162 0.2511 0.2169 0.0116  -0.0407 0.0558  616 LEU A CA    
2577 C C     . LEU A 324 ? 0.2268 0.2725 0.2364 0.0147  -0.0369 0.0590  616 LEU A C     
2578 O O     . LEU A 324 ? 0.2500 0.2989 0.2651 0.0152  -0.0355 0.0626  616 LEU A O     
2579 C CB    . LEU A 324 ? 0.2332 0.2644 0.2308 0.0072  -0.0439 0.0570  616 LEU A CB    
2580 C CG    . LEU A 324 ? 0.2793 0.2992 0.2677 0.0048  -0.0471 0.0544  616 LEU A CG    
2581 C CD1   . LEU A 324 ? 0.2767 0.2930 0.2611 0.0017  -0.0498 0.0545  616 LEU A CD1   
2582 C CD2   . LEU A 324 ? 0.3459 0.3628 0.3352 0.0030  -0.0478 0.0566  616 LEU A CD2   
2583 N N     . ARG A 325 ? 0.2842 0.3355 0.2950 0.0173  -0.0350 0.0578  617 ARG A N     
2584 C CA    . ARG A 325 ? 0.2403 0.3008 0.2579 0.0214  -0.0303 0.0598  617 ARG A CA    
2585 C C     . ARG A 325 ? 0.2956 0.3534 0.3141 0.0251  -0.0254 0.0556  617 ARG A C     
2586 O O     . ARG A 325 ? 0.2755 0.3382 0.2994 0.0282  -0.0222 0.0586  617 ARG A O     
2587 C CB    . ARG A 325 ? 0.2103 0.2747 0.2269 0.0229  -0.0287 0.0573  617 ARG A CB    
2588 C CG    . ARG A 325 ? 0.2378 0.3032 0.2537 0.0185  -0.0324 0.0602  617 ARG A CG    
2589 C CD    . ARG A 325 ? 0.2604 0.3304 0.2756 0.0199  -0.0313 0.0587  617 ARG A CD    
2590 N NE    . ARG A 325 ? 0.2603 0.3275 0.2732 0.0149  -0.0348 0.0596  617 ARG A NE    
2591 C CZ    . ARG A 325 ? 0.3411 0.4146 0.3584 0.0131  -0.0346 0.0640  617 ARG A CZ    
2592 N NH1   . ARG A 325 ? 0.2895 0.3731 0.3138 0.0162  -0.0306 0.0681  617 ARG A NH1   
2593 N NH2   . ARG A 325 ? 0.3239 0.3936 0.3383 0.0085  -0.0381 0.0645  617 ARG A NH2   
2594 N N     . VAL A 326 ? 0.2496 0.2998 0.2626 0.0249  -0.0248 0.0489  618 VAL A N     
2595 C CA    . VAL A 326 ? 0.2489 0.2952 0.2618 0.0272  -0.0212 0.0449  618 VAL A CA    
2596 C C     . VAL A 326 ? 0.2273 0.2723 0.2432 0.0263  -0.0224 0.0491  618 VAL A C     
2597 O O     . VAL A 326 ? 0.2590 0.3047 0.2781 0.0292  -0.0191 0.0495  618 VAL A O     
2598 C CB    . VAL A 326 ? 0.2053 0.2446 0.2121 0.0263  -0.0211 0.0381  618 VAL A CB    
2599 C CG1   . VAL A 326 ? 0.2359 0.2706 0.2424 0.0272  -0.0189 0.0354  618 VAL A CG1   
2600 C CG2   . VAL A 326 ? 0.2510 0.2920 0.2556 0.0278  -0.0191 0.0339  618 VAL A CG2   
2601 N N     . LEU A 327 ? 0.2313 0.2735 0.2451 0.0224  -0.0271 0.0520  619 LEU A N     
2602 C CA    . LEU A 327 ? 0.2279 0.2687 0.2441 0.0208  -0.0290 0.0564  619 LEU A CA    
2603 C C     . LEU A 327 ? 0.2720 0.3214 0.2963 0.0224  -0.0280 0.0635  619 LEU A C     
2604 O O     . LEU A 327 ? 0.2752 0.3253 0.3034 0.0240  -0.0263 0.0656  619 LEU A O     
2605 C CB    . LEU A 327 ? 0.2730 0.3084 0.2842 0.0161  -0.0349 0.0587  619 LEU A CB    
2606 C CG    . LEU A 327 ? 0.2783 0.3110 0.2906 0.0135  -0.0373 0.0628  619 LEU A CG    
2607 C CD1   . LEU A 327 ? 0.2856 0.3147 0.2982 0.0155  -0.0343 0.0596  619 LEU A CD1   
2608 C CD2   . LEU A 327 ? 0.3130 0.3371 0.3175 0.0087  -0.0414 0.0615  619 LEU A CD2   
2609 N N     . ALA A 328 ? 0.2761 0.3326 0.3030 0.0221  -0.0290 0.0674  620 ALA A N     
2610 C CA    . ALA A 328 ? 0.3204 0.3855 0.3546 0.0236  -0.0264 0.0724  620 ALA A CA    
2611 C C     . ALA A 328 ? 0.3045 0.3731 0.3422 0.0307  -0.0207 0.0717  620 ALA A C     
2612 O O     . ALA A 328 ? 0.3077 0.3799 0.3507 0.0332  -0.0187 0.0758  620 ALA A O     
2613 C CB    . ALA A 328 ? 0.2791 0.3499 0.3143 0.0218  -0.0269 0.0741  620 ALA A CB    
2614 N N     . HIS A 329 ? 0.2734 0.3385 0.3066 0.0332  -0.0175 0.0644  621 HIS A N     
2615 C CA    . HIS A 329 ? 0.2781 0.3423 0.3113 0.0389  -0.0117 0.0609  621 HIS A CA    
2616 C C     . HIS A 329 ? 0.3231 0.3802 0.3555 0.0397  -0.0106 0.0587  621 HIS A C     
2617 O O     . HIS A 329 ? 0.3041 0.3627 0.3396 0.0441  -0.0073 0.0607  621 HIS A O     
2618 C CB    . HIS A 329 ? 0.2532 0.3138 0.2807 0.0403  -0.0095 0.0536  621 HIS A CB    
2619 C CG    . HIS A 329 ? 0.3125 0.3703 0.3382 0.0459  -0.0041 0.0498  621 HIS A CG    
2620 N ND1   . HIS A 329 ? 0.3339 0.3976 0.3615 0.0513  -0.0001 0.0521  621 HIS A ND1   
2621 C CD2   . HIS A 329 ? 0.3643 0.4131 0.3854 0.0470  -0.0023 0.0441  621 HIS A CD2   
2622 C CE1   . HIS A 329 ? 0.3820 0.4393 0.4054 0.0557  0.0039  0.0476  621 HIS A CE1   
2623 N NE2   . HIS A 329 ? 0.3539 0.4020 0.3734 0.0528  0.0023  0.0428  621 HIS A NE2   
2624 N N     . LEU A 330 ? 0.2591 0.3085 0.2870 0.0357  -0.0134 0.0548  622 LEU A N     
2625 C CA    . LEU A 330 ? 0.2975 0.3400 0.3241 0.0360  -0.0125 0.0523  622 LEU A CA    
2626 C C     . LEU A 330 ? 0.3082 0.3532 0.3403 0.0355  -0.0139 0.0590  622 LEU A C     
2627 O O     . LEU A 330 ? 0.2850 0.3276 0.3186 0.0382  -0.0116 0.0591  622 LEU A O     
2628 C CB    . LEU A 330 ? 0.2608 0.2959 0.2816 0.0320  -0.0149 0.0472  622 LEU A CB    
2629 C CG    . LEU A 330 ? 0.2924 0.3245 0.3079 0.0324  -0.0135 0.0404  622 LEU A CG    
2630 C CD1   . LEU A 330 ? 0.3773 0.4038 0.3880 0.0287  -0.0159 0.0367  622 LEU A CD1   
2631 C CD2   . LEU A 330 ? 0.3321 0.3614 0.3463 0.0363  -0.0093 0.0366  622 LEU A CD2   
2632 N N     . SER A 331 ? 0.2614 0.3108 0.2960 0.0318  -0.0181 0.0648  623 SER A N     
2633 C CA    . SER A 331 ? 0.2865 0.3382 0.3260 0.0301  -0.0205 0.0717  623 SER A CA    
2634 C C     . SER A 331 ? 0.3450 0.4067 0.3925 0.0342  -0.0180 0.0787  623 SER A C     
2635 O O     . SER A 331 ? 0.3208 0.3834 0.3722 0.0347  -0.0172 0.0819  623 SER A O     
2636 C CB    . SER A 331 ? 0.2999 0.3502 0.3371 0.0237  -0.0266 0.0747  623 SER A CB    
2637 O OG    . SER A 331 ? 0.2982 0.3541 0.3365 0.0217  -0.0274 0.0765  623 SER A OG    
2638 N N     . GLY A 332 ? 0.3321 0.4005 0.3810 0.0362  -0.0161 0.0795  624 GLY A N     
2639 C CA    . GLY A 332 ? 0.3876 0.4654 0.4427 0.0383  -0.0132 0.0846  624 GLY A CA    
2640 C C     . GLY A 332 ? 0.3657 0.4476 0.4242 0.0315  -0.0167 0.0897  624 GLY A C     
2641 O O     . GLY A 332 ? 0.4593 0.5493 0.5240 0.0326  -0.0144 0.0951  624 GLY A O     
2642 N N     . ASP A 333 ? 0.3274 0.4035 0.3816 0.0247  -0.0220 0.0881  625 ASP A N     
2643 C CA    . ASP A 333 ? 0.3383 0.4166 0.3947 0.0180  -0.0256 0.0925  625 ASP A CA    
2644 C C     . ASP A 333 ? 0.3776 0.4656 0.4383 0.0170  -0.0248 0.0967  625 ASP A C     
2645 O O     . ASP A 333 ? 0.3158 0.4040 0.3734 0.0170  -0.0251 0.0943  625 ASP A O     
2646 C CB    . ASP A 333 ? 0.3347 0.4031 0.3837 0.0117  -0.0311 0.0892  625 ASP A CB    
2647 C CG    . ASP A 333 ? 0.4051 0.4744 0.4559 0.0051  -0.0348 0.0934  625 ASP A CG    
2648 O OD1   . ASP A 333 ? 0.4534 0.5217 0.5065 0.0038  -0.0354 0.0956  625 ASP A OD1   
2649 O OD2   . ASP A 333 ? 0.3777 0.4489 0.4280 0.0013  -0.0371 0.0947  625 ASP A OD2   
2650 N N     . GLU A 334 ? 0.3656 0.4622 0.4336 0.0160  -0.0237 0.1032  626 GLU A N     
2651 C CA    . GLU A 334 ? 0.3563 0.4641 0.4298 0.0157  -0.0220 0.1084  626 GLU A CA    
2652 C C     . GLU A 334 ? 0.3346 0.4407 0.4055 0.0083  -0.0270 0.1086  626 GLU A C     
2653 O O     . GLU A 334 ? 0.3733 0.4850 0.4450 0.0086  -0.0260 0.1097  626 GLU A O     
2654 C CB    . GLU A 334 ? 0.4175 0.5357 0.5000 0.0164  -0.0194 0.1161  626 GLU A CB    
2655 C CG    . GLU A 334 ? 0.4844 0.6060 0.5696 0.0252  -0.0132 0.1166  626 GLU A CG    
2656 C CD    . GLU A 334 ? 0.6835 0.7969 0.7671 0.0261  -0.0139 0.1141  626 GLU A CD    
2657 O OE1   . GLU A 334 ? 0.6767 0.7829 0.7575 0.0198  -0.0191 0.1127  626 GLU A OE1   
2658 O OE2   . GLU A 334 ? 0.7927 0.9062 0.8772 0.0334  -0.0091 0.1134  626 GLU A OE2   
2659 N N     . ASN A 335 ? 0.3727 0.4708 0.4400 0.0020  -0.0323 0.1076  627 ASN A N     
2660 C CA    . ASN A 335 ? 0.3905 0.4848 0.4540 -0.0047 -0.0373 0.1073  627 ASN A CA    
2661 C C     . ASN A 335 ? 0.4184 0.5050 0.4734 -0.0034 -0.0381 0.1006  627 ASN A C     
2662 O O     . ASN A 335 ? 0.3645 0.4523 0.4182 -0.0058 -0.0396 0.1008  627 ASN A O     
2663 C CB    . ASN A 335 ? 0.4285 0.5148 0.4889 -0.0110 -0.0424 0.1073  627 ASN A CB    
2664 C CG    . ASN A 335 ? 0.6011 0.6957 0.6704 -0.0133 -0.0422 0.1144  627 ASN A CG    
2665 O OD1   . ASN A 335 ? 0.5976 0.7051 0.6758 -0.0113 -0.0387 0.1204  627 ASN A OD1   
2666 N ND2   . ASN A 335 ? 0.6534 0.7412 0.7205 -0.0173 -0.0457 0.1141  627 ASN A ND2   
2667 N N     . LEU A 336 ? 0.3381 0.4170 0.3876 0.0003  -0.0371 0.0949  628 LEU A N     
2668 C CA    . LEU A 336 ? 0.3268 0.3995 0.3690 0.0022  -0.0375 0.0888  628 LEU A CA    
2669 C C     . LEU A 336 ? 0.3154 0.3968 0.3611 0.0067  -0.0335 0.0894  628 LEU A C     
2670 O O     . LEU A 336 ? 0.3455 0.4261 0.3878 0.0054  -0.0348 0.0875  628 LEU A O     
2671 C CB    . LEU A 336 ? 0.3210 0.3854 0.3581 0.0052  -0.0369 0.0836  628 LEU A CB    
2672 C CG    . LEU A 336 ? 0.4610 0.5177 0.4898 0.0063  -0.0380 0.0773  628 LEU A CG    
2673 C CD1   . LEU A 336 ? 0.5189 0.5692 0.5413 0.0011  -0.0424 0.0760  628 LEU A CD1   
2674 C CD2   . LEU A 336 ? 0.3984 0.4475 0.4228 0.0080  -0.0380 0.0735  628 LEU A CD2   
2675 N N     . ILE A 337 ? 0.3426 0.4319 0.3944 0.0124  -0.0285 0.0918  629 ILE A N     
2676 C CA    . ILE A 337 ? 0.3320 0.4299 0.3868 0.0175  -0.0241 0.0927  629 ILE A CA    
2677 C C     . ILE A 337 ? 0.3745 0.4803 0.4328 0.0137  -0.0250 0.0974  629 ILE A C     
2678 O O     . ILE A 337 ? 0.3455 0.4541 0.4024 0.0149  -0.0240 0.0962  629 ILE A O     
2679 C CB    . ILE A 337 ? 0.3713 0.4758 0.4315 0.0247  -0.0182 0.0950  629 ILE A CB    
2680 C CG1   . ILE A 337 ? 0.2912 0.3880 0.3471 0.0297  -0.0165 0.0892  629 ILE A CG1   
2681 C CG2   . ILE A 337 ? 0.3478 0.4626 0.4115 0.0295  -0.0134 0.0977  629 ILE A CG2   
2682 C CD1   . ILE A 337 ? 0.3810 0.4800 0.4406 0.0362  -0.0116 0.0908  629 ILE A CD1   
2683 N N     . ARG A 338 ? 0.3641 0.4732 0.4269 0.0087  -0.0272 0.1029  630 ARG A N     
2684 C CA    . ARG A 338 ? 0.3633 0.4806 0.4305 0.0043  -0.0283 0.1085  630 ARG A CA    
2685 C C     . ARG A 338 ? 0.3392 0.4494 0.4000 -0.0007 -0.0330 0.1051  630 ARG A C     
2686 O O     . ARG A 338 ? 0.4061 0.5226 0.4689 -0.0018 -0.0326 0.1074  630 ARG A O     
2687 C CB    . ARG A 338 ? 0.4320 0.5538 0.5056 -0.0006 -0.0302 0.1151  630 ARG A CB    
2688 C CG    . ARG A 338 ? 0.6271 0.7596 0.7072 -0.0050 -0.0309 0.1223  630 ARG A CG    
2689 C CD    . ARG A 338 ? 0.7747 0.9134 0.8623 -0.0095 -0.0323 0.1296  630 ARG A CD    
2690 N NE    . ARG A 338 ? 0.8811 1.0262 0.9742 -0.0037 -0.0273 0.1325  630 ARG A NE    
2691 C CZ    . ARG A 338 ? 0.9641 1.1037 1.0568 -0.0040 -0.0285 0.1315  630 ARG A CZ    
2692 N NH1   . ARG A 338 ? 1.0142 1.1420 1.1010 -0.0099 -0.0343 0.1277  630 ARG A NH1   
2693 N NH2   . ARG A 338 ? 0.9416 1.0870 1.0393 0.0017  -0.0236 0.1343  630 ARG A NH2   
2694 N N     . VAL A 339 ? 0.3639 0.4610 0.4169 -0.0036 -0.0372 0.0998  631 VAL A N     
2695 C CA    . VAL A 339 ? 0.3675 0.4559 0.4128 -0.0074 -0.0414 0.0958  631 VAL A CA    
2696 C C     . VAL A 339 ? 0.3416 0.4326 0.3850 -0.0034 -0.0389 0.0927  631 VAL A C     
2697 O O     . VAL A 339 ? 0.3916 0.4837 0.4340 -0.0061 -0.0405 0.0933  631 VAL A O     
2698 C CB    . VAL A 339 ? 0.4162 0.4899 0.4521 -0.0087 -0.0448 0.0897  631 VAL A CB    
2699 C CG1   . VAL A 339 ? 0.4314 0.4962 0.4586 -0.0108 -0.0480 0.0851  631 VAL A CG1   
2700 C CG2   . VAL A 339 ? 0.4787 0.5491 0.5154 -0.0134 -0.0479 0.0926  631 VAL A CG2   
2701 N N     . PHE A 340 ? 0.3343 0.4264 0.3775 0.0030  -0.0349 0.0896  632 PHE A N     
2702 C CA    . PHE A 340 ? 0.3033 0.3969 0.3440 0.0069  -0.0328 0.0860  632 PHE A CA    
2703 C C     . PHE A 340 ? 0.3529 0.4599 0.4006 0.0103  -0.0281 0.0906  632 PHE A C     
2704 O O     . PHE A 340 ? 0.3274 0.4373 0.3738 0.0108  -0.0276 0.0898  632 PHE A O     
2705 C CB    . PHE A 340 ? 0.3128 0.4006 0.3491 0.0118  -0.0311 0.0801  632 PHE A CB    
2706 C CG    . PHE A 340 ? 0.2956 0.3707 0.3242 0.0088  -0.0352 0.0754  632 PHE A CG    
2707 C CD1   . PHE A 340 ? 0.3027 0.3704 0.3243 0.0055  -0.0389 0.0721  632 PHE A CD1   
2708 C CD2   . PHE A 340 ? 0.3342 0.4046 0.3621 0.0098  -0.0352 0.0744  632 PHE A CD2   
2709 C CE1   . PHE A 340 ? 0.3466 0.4027 0.3605 0.0037  -0.0421 0.0680  632 PHE A CE1   
2710 C CE2   . PHE A 340 ? 0.3808 0.4400 0.4012 0.0074  -0.0386 0.0704  632 PHE A CE2   
2711 C CZ    . PHE A 340 ? 0.3283 0.3804 0.3415 0.0047  -0.0419 0.0672  632 PHE A CZ    
2712 N N     . GLN A 341 ? 0.3466 0.4618 0.4011 0.0130  -0.0246 0.0957  633 GLN A N     
2713 C CA    . GLN A 341 ? 0.3675 0.4961 0.4283 0.0168  -0.0197 0.1010  633 GLN A CA    
2714 C C     . GLN A 341 ? 0.3975 0.5319 0.4612 0.0109  -0.0221 0.1058  633 GLN A C     
2715 O O     . GLN A 341 ? 0.4031 0.5462 0.4691 0.0131  -0.0191 0.1082  633 GLN A O     
2716 C CB    . GLN A 341 ? 0.3495 0.4855 0.4169 0.0210  -0.0153 0.1060  633 GLN A CB    
2717 C CG    . GLN A 341 ? 0.3982 0.5307 0.4634 0.0289  -0.0111 0.1017  633 GLN A CG    
2718 C CD    . GLN A 341 ? 0.5198 0.6562 0.5829 0.0364  -0.0060 0.0993  633 GLN A CD    
2719 O OE1   . GLN A 341 ? 0.5593 0.7029 0.6235 0.0363  -0.0048 0.1016  633 GLN A OE1   
2720 N NE2   . GLN A 341 ? 0.5030 0.6341 0.5628 0.0430  -0.0030 0.0944  633 GLN A NE2   
2721 N N     . GLU A 342 ? 0.3659 0.4951 0.4292 0.0034  -0.0275 0.1073  634 GLU A N     
2722 C CA    . GLU A 342 ? 0.4380 0.5715 0.5040 -0.0030 -0.0305 0.1121  634 GLU A CA    
2723 C C     . GLU A 342 ? 0.4698 0.5940 0.5281 -0.0064 -0.0347 0.1069  634 GLU A C     
2724 O O     . GLU A 342 ? 0.5080 0.6325 0.5669 -0.0124 -0.0383 0.1098  634 GLU A O     
2725 C CB    . GLU A 342 ? 0.5113 0.6443 0.5810 -0.0094 -0.0343 0.1169  634 GLU A CB    
2726 C CG    . GLU A 342 ? 0.5922 0.7371 0.6711 -0.0071 -0.0302 0.1239  634 GLU A CG    
2727 C CD    . GLU A 342 ? 0.6409 0.7853 0.7236 -0.0140 -0.0344 0.1287  634 GLU A CD    
2728 O OE1   . GLU A 342 ? 0.7148 0.8493 0.7924 -0.0206 -0.0405 0.1264  634 GLU A OE1   
2729 O OE2   . GLU A 342 ? 0.6489 0.8027 0.7394 -0.0126 -0.0316 0.1347  634 GLU A OE2   
2730 N N     . GLY A 343 ? 0.4352 0.5512 0.4865 -0.0026 -0.0343 0.0995  635 GLY A N     
2731 C CA    . GLY A 343 ? 0.4024 0.5098 0.4462 -0.0048 -0.0376 0.0944  635 GLY A CA    
2732 C C     . GLY A 343 ? 0.4610 0.5561 0.4987 -0.0108 -0.0436 0.0924  635 GLY A C     
2733 O O     . GLY A 343 ? 0.5026 0.5926 0.5358 -0.0140 -0.0466 0.0907  635 GLY A O     
2734 N N     . ARG A 344 ? 0.3889 0.4787 0.4258 -0.0122 -0.0451 0.0924  636 ARG A N     
2735 C CA    . ARG A 344 ? 0.3975 0.4751 0.4278 -0.0174 -0.0505 0.0905  636 ARG A CA    
2736 C C     . ARG A 344 ? 0.5038 0.5681 0.5239 -0.0150 -0.0518 0.0827  636 ARG A C     
2737 O O     . ARG A 344 ? 0.4738 0.5382 0.4927 -0.0098 -0.0487 0.0789  636 ARG A O     
2738 C CB    . ARG A 344 ? 0.4729 0.5521 0.5078 -0.0212 -0.0521 0.0954  636 ARG A CB    
2739 C CG    . ARG A 344 ? 0.6599 0.7536 0.7056 -0.0235 -0.0507 0.1040  636 ARG A CG    
2740 C CD    . ARG A 344 ? 0.9350 1.0294 0.9848 -0.0287 -0.0535 0.1090  636 ARG A CD    
2741 N NE    . ARG A 344 ? 1.1096 1.2188 1.1702 -0.0315 -0.0523 0.1179  636 ARG A NE    
2742 C CZ    . ARG A 344 ? 1.1993 1.3118 1.2622 -0.0373 -0.0553 0.1220  636 ARG A CZ    
2743 N NH1   . ARG A 344 ? 1.2004 1.3013 1.2548 -0.0406 -0.0597 0.1178  636 ARG A NH1   
2744 N NH2   . ARG A 344 ? 1.2560 1.3834 1.3296 -0.0397 -0.0538 0.1308  636 ARG A NH2   
2745 N N     . ASP A 345 ? 0.4703 0.5233 0.4831 -0.0189 -0.0562 0.0805  637 ASP A N     
2746 C CA    . ASP A 345 ? 0.4468 0.4874 0.4497 -0.0167 -0.0573 0.0739  637 ASP A CA    
2747 C C     . ASP A 345 ? 0.5398 0.5747 0.5409 -0.0179 -0.0585 0.0740  637 ASP A C     
2748 O O     . ASP A 345 ? 0.4859 0.5175 0.4867 -0.0230 -0.0619 0.0769  637 ASP A O     
2749 C CB    . ASP A 345 ? 0.4081 0.4395 0.4032 -0.0193 -0.0608 0.0714  637 ASP A CB    
2750 C CG    . ASP A 345 ? 0.4919 0.5117 0.4768 -0.0164 -0.0613 0.0649  637 ASP A CG    
2751 O OD1   . ASP A 345 ? 0.5160 0.5295 0.4974 -0.0164 -0.0621 0.0637  637 ASP A OD1   
2752 O OD2   . ASP A 345 ? 0.6072 0.6247 0.5879 -0.0139 -0.0608 0.0612  637 ASP A OD2   
2753 N N     . PHE A 346 ? 0.4196 0.4533 0.4196 -0.0135 -0.0560 0.0709  638 PHE A N     
2754 C CA    . PHE A 346 ? 0.3296 0.3589 0.3286 -0.0142 -0.0567 0.0712  638 PHE A CA    
2755 C C     . PHE A 346 ? 0.3879 0.4051 0.3784 -0.0179 -0.0608 0.0695  638 PHE A C     
2756 O O     . PHE A 346 ? 0.3580 0.3736 0.3498 -0.0217 -0.0630 0.0724  638 PHE A O     
2757 C CB    . PHE A 346 ? 0.3439 0.3722 0.3415 -0.0090 -0.0537 0.0674  638 PHE A CB    
2758 C CG    . PHE A 346 ? 0.3829 0.4071 0.3797 -0.0096 -0.0541 0.0678  638 PHE A CG    
2759 C CD1   . PHE A 346 ? 0.3550 0.3869 0.3603 -0.0098 -0.0525 0.0723  638 PHE A CD1   
2760 C CD2   . PHE A 346 ? 0.3366 0.3496 0.3244 -0.0097 -0.0559 0.0638  638 PHE A CD2   
2761 C CE1   . PHE A 346 ? 0.3272 0.3553 0.3319 -0.0105 -0.0530 0.0727  638 PHE A CE1   
2762 C CE2   . PHE A 346 ? 0.3746 0.3839 0.3616 -0.0104 -0.0563 0.0642  638 PHE A CE2   
2763 C CZ    . PHE A 346 ? 0.3703 0.3869 0.3657 -0.0109 -0.0550 0.0686  638 PHE A CZ    
2764 N N     . HIS A 347 ? 0.3505 0.3595 0.3324 -0.0165 -0.0617 0.0648  639 HIS A N     
2765 C CA    . HIS A 347 ? 0.3722 0.3690 0.3450 -0.0188 -0.0650 0.0625  639 HIS A CA    
2766 C C     . HIS A 347 ? 0.4483 0.4425 0.4210 -0.0251 -0.0693 0.0662  639 HIS A C     
2767 O O     . HIS A 347 ? 0.4320 0.4177 0.3997 -0.0286 -0.0727 0.0664  639 HIS A O     
2768 C CB    . HIS A 347 ? 0.3233 0.3128 0.2873 -0.0150 -0.0643 0.0568  639 HIS A CB    
2769 C CG    . HIS A 347 ? 0.3905 0.3817 0.3540 -0.0095 -0.0608 0.0534  639 HIS A CG    
2770 N ND1   . HIS A 347 ? 0.3709 0.3591 0.3329 -0.0085 -0.0600 0.0527  639 HIS A ND1   
2771 C CD2   . HIS A 347 ? 0.3544 0.3501 0.3187 -0.0052 -0.0580 0.0507  639 HIS A CD2   
2772 C CE1   . HIS A 347 ? 0.3634 0.3542 0.3256 -0.0039 -0.0570 0.0499  639 HIS A CE1   
2773 N NE2   . HIS A 347 ? 0.3352 0.3305 0.2988 -0.0019 -0.0558 0.0486  639 HIS A NE2   
2774 N N     . THR A 348 ? 0.4129 0.4145 0.3911 -0.0268 -0.0694 0.0691  640 THR A N     
2775 C CA    . THR A 348 ? 0.4397 0.4406 0.4194 -0.0334 -0.0737 0.0735  640 THR A CA    
2776 C C     . THR A 348 ? 0.4698 0.4777 0.4578 -0.0376 -0.0746 0.0795  640 THR A C     
2777 O O     . THR A 348 ? 0.5042 0.5070 0.4906 -0.0434 -0.0791 0.0821  640 THR A O     
2778 C CB    . THR A 348 ? 0.4204 0.4282 0.4040 -0.0341 -0.0733 0.0754  640 THR A CB    
2779 O OG1   . THR A 348 ? 0.4564 0.4572 0.4321 -0.0308 -0.0730 0.0700  640 THR A OG1   
2780 C CG2   . THR A 348 ? 0.4113 0.4194 0.3975 -0.0417 -0.0779 0.0808  640 THR A CG2   
2781 N N     . GLU A 349 ? 0.4244 0.4436 0.4211 -0.0346 -0.0707 0.0818  641 GLU A N     
2782 C CA    . GLU A 349 ? 0.4663 0.4936 0.4719 -0.0378 -0.0710 0.0878  641 GLU A CA    
2783 C C     . GLU A 349 ? 0.4780 0.4960 0.4785 -0.0396 -0.0734 0.0865  641 GLU A C     
2784 O O     . GLU A 349 ? 0.5113 0.5285 0.5137 -0.0456 -0.0772 0.0906  641 GLU A O     
2785 C CB    . GLU A 349 ? 0.5363 0.5762 0.5509 -0.0330 -0.0656 0.0899  641 GLU A CB    
2786 C CG    . GLU A 349 ? 0.5167 0.5679 0.5378 -0.0315 -0.0630 0.0925  641 GLU A CG    
2787 C CD    . GLU A 349 ? 0.5949 0.6536 0.6228 -0.0378 -0.0656 0.0996  641 GLU A CD    
2788 O OE1   . GLU A 349 ? 0.6234 0.6900 0.6594 -0.0405 -0.0656 0.1056  641 GLU A OE1   
2789 O OE2   . GLU A 349 ? 0.6399 0.6970 0.6654 -0.0402 -0.0675 0.0995  641 GLU A OE2   
2790 N N     . THR A 350 ? 0.4146 0.4259 0.4088 -0.0347 -0.0713 0.0810  642 THR A N     
2791 C CA    . THR A 350 ? 0.3975 0.3999 0.3863 -0.0358 -0.0731 0.0793  642 THR A CA    
2792 C C     . THR A 350 ? 0.4417 0.4308 0.4205 -0.0402 -0.0782 0.0776  642 THR A C     
2793 O O     . THR A 350 ? 0.4670 0.4508 0.4438 -0.0442 -0.0815 0.0790  642 THR A O     
2794 C CB    . THR A 350 ? 0.4588 0.4577 0.4432 -0.0295 -0.0695 0.0741  642 THR A CB    
2795 O OG1   . THR A 350 ? 0.5011 0.4961 0.4793 -0.0256 -0.0681 0.0693  642 THR A OG1   
2796 C CG2   . THR A 350 ? 0.4149 0.4253 0.4089 -0.0261 -0.0653 0.0765  642 THR A CG2   
2797 N N     . ALA A 351 ? 0.4595 0.4430 0.4320 -0.0394 -0.0790 0.0745  643 ALA A N     
2798 C CA    . ALA A 351 ? 0.4945 0.4650 0.4575 -0.0435 -0.0841 0.0732  643 ALA A CA    
2799 C C     . ALA A 351 ? 0.5398 0.5120 0.5074 -0.0521 -0.0894 0.0794  643 ALA A C     
2800 O O     . ALA A 351 ? 0.5819 0.5439 0.5437 -0.0575 -0.0947 0.0801  643 ALA A O     
2801 C CB    . ALA A 351 ? 0.5246 0.4904 0.4814 -0.0412 -0.0839 0.0695  643 ALA A CB    
2802 N N     . SER A 352 ? 0.5214 0.5065 0.4996 -0.0539 -0.0884 0.0844  644 SER A N     
2803 C CA    . SER A 352 ? 0.5346 0.5246 0.5197 -0.0626 -0.0933 0.0918  644 SER A CA    
2804 C C     . SER A 352 ? 0.6230 0.6147 0.6120 -0.0656 -0.0947 0.0949  644 SER A C     
2805 O O     . SER A 352 ? 0.6086 0.5950 0.5963 -0.0734 -0.1010 0.0983  644 SER A O     
2806 C CB    . SER A 352 ? 0.5189 0.5251 0.5158 -0.0622 -0.0903 0.0967  644 SER A CB    
2807 O OG    . SER A 352 ? 0.6030 0.6178 0.6093 -0.0698 -0.0938 0.1048  644 SER A OG    
2808 N N     . TRP A 353 ? 0.5041 0.5026 0.4973 -0.0594 -0.0892 0.0936  645 TRP A N     
2809 C CA    . TRP A 353 ? 0.5550 0.5552 0.5519 -0.0613 -0.0899 0.0961  645 TRP A CA    
2810 C C     . TRP A 353 ? 0.6068 0.5913 0.5923 -0.0634 -0.0940 0.0924  645 TRP A C     
2811 O O     . TRP A 353 ? 0.6656 0.6474 0.6518 -0.0702 -0.0990 0.0961  645 TRP A O     
2812 C CB    . TRP A 353 ? 0.4926 0.5025 0.4962 -0.0547 -0.0837 0.0958  645 TRP A CB    
2813 C CG    . TRP A 353 ? 0.7097 0.7192 0.7151 -0.0554 -0.0840 0.0970  645 TRP A CG    
2814 C CD1   . TRP A 353 ? 0.7948 0.8127 0.8095 -0.0601 -0.0857 0.1035  645 TRP A CD1   
2815 C CD2   . TRP A 353 ? 0.7946 0.7956 0.7928 -0.0514 -0.0825 0.0918  645 TRP A CD2   
2816 N NE1   . TRP A 353 ? 0.8020 0.8165 0.8153 -0.0592 -0.0855 0.1024  645 TRP A NE1   
2817 C CE2   . TRP A 353 ? 0.8277 0.8317 0.8309 -0.0540 -0.0835 0.0953  645 TRP A CE2   
2818 C CE3   . TRP A 353 ? 0.8005 0.7920 0.7887 -0.0461 -0.0804 0.0849  645 TRP A CE3   
2819 C CZ2   . TRP A 353 ? 0.8218 0.8194 0.8201 -0.0514 -0.0825 0.0919  645 TRP A CZ2   
2820 C CZ3   . TRP A 353 ? 0.7529 0.7386 0.7366 -0.0436 -0.0793 0.0819  645 TRP A CZ3   
2821 C CH2   . TRP A 353 ? 0.7901 0.7786 0.7787 -0.0463 -0.0804 0.0853  645 TRP A CH2   
2822 N N     . MET A 354 ? 0.5746 0.5489 0.5495 -0.0578 -0.0918 0.0854  646 MET A N     
2823 C CA    . MET A 354 ? 0.6541 0.6140 0.6179 -0.0584 -0.0945 0.0816  646 MET A CA    
2824 C C     . MET A 354 ? 0.6792 0.6245 0.6327 -0.0648 -0.1016 0.0810  646 MET A C     
2825 O O     . MET A 354 ? 0.6521 0.5858 0.5974 -0.0677 -0.1054 0.0797  646 MET A O     
2826 C CB    . MET A 354 ? 0.6805 0.6362 0.6377 -0.0500 -0.0893 0.0750  646 MET A CB    
2827 C CG    . MET A 354 ? 0.6745 0.6242 0.6240 -0.0461 -0.0881 0.0703  646 MET A CG    
2828 S SD    . MET A 354 ? 0.6045 0.5503 0.5475 -0.0375 -0.0829 0.0638  646 MET A SD    
2829 C CE    . MET A 354 ? 0.6056 0.5682 0.5618 -0.0334 -0.0773 0.0661  646 MET A CE    
2830 N N     . PHE A 355 ? 0.6226 0.5677 0.5758 -0.0670 -0.1035 0.0820  647 PHE A N     
2831 C CA    . PHE A 355 ? 0.6858 0.6162 0.6290 -0.0733 -0.1106 0.0816  647 PHE A CA    
2832 C C     . PHE A 355 ? 0.6886 0.6234 0.6389 -0.0834 -0.1169 0.0891  647 PHE A C     
2833 O O     . PHE A 355 ? 0.6655 0.5878 0.6080 -0.0903 -0.1239 0.0897  647 PHE A O     
2834 C CB    . PHE A 355 ? 0.7170 0.6419 0.6536 -0.0697 -0.1095 0.0776  647 PHE A CB    
2835 C CG    . PHE A 355 ? 0.7902 0.7051 0.7156 -0.0620 -0.1061 0.0703  647 PHE A CG    
2836 C CD1   . PHE A 355 ? 0.8772 0.7734 0.7880 -0.0633 -0.1104 0.0666  647 PHE A CD1   
2837 C CD2   . PHE A 355 ? 0.8603 0.7841 0.7895 -0.0534 -0.0987 0.0672  647 PHE A CD2   
2838 C CE1   . PHE A 355 ? 0.9140 0.8020 0.8150 -0.0559 -0.1069 0.0603  647 PHE A CE1   
2839 C CE2   . PHE A 355 ? 0.8413 0.7573 0.7612 -0.0467 -0.0955 0.0611  647 PHE A CE2   
2840 C CZ    . PHE A 355 ? 0.9380 0.8367 0.8441 -0.0478 -0.0994 0.0578  647 PHE A CZ    
2841 N N     . GLY A 356 ? 0.5773 0.5297 0.5423 -0.0843 -0.1143 0.0948  648 GLY A N     
2842 C CA    . GLY A 356 ? 0.5798 0.5399 0.5540 -0.0937 -0.1195 0.1029  648 GLY A CA    
2843 C C     . GLY A 356 ? 0.7278 0.6881 0.7029 -0.0988 -0.1231 0.1059  648 GLY A C     
2844 O O     . GLY A 356 ? 0.7446 0.7037 0.7218 -0.1084 -0.1301 0.1115  648 GLY A O     
2845 N N     . VAL A 357 ? 0.6577 0.6197 0.6314 -0.0926 -0.1187 0.1024  649 VAL A N     
2846 C CA    . VAL A 357 ? 0.6765 0.6387 0.6507 -0.0967 -0.1215 0.1048  649 VAL A CA    
2847 C C     . VAL A 357 ? 0.6225 0.6032 0.6089 -0.0923 -0.1152 0.1076  649 VAL A C     
2848 O O     . VAL A 357 ? 0.6000 0.5895 0.5910 -0.0845 -0.1083 0.1055  649 VAL A O     
2849 C CB    . VAL A 357 ? 0.5872 0.5315 0.5461 -0.0942 -0.1232 0.0977  649 VAL A CB    
2850 C CG1   . VAL A 357 ? 0.6249 0.5497 0.5701 -0.0969 -0.1286 0.0941  649 VAL A CG1   
2851 C CG2   . VAL A 357 ? 0.5562 0.5033 0.5132 -0.0831 -0.1153 0.0914  649 VAL A CG2   
2852 N N     . PRO A 358 ? 0.6626 0.6491 0.6542 -0.0974 -0.1176 0.1124  650 PRO A N     
2853 C CA    . PRO A 358 ? 0.6478 0.6510 0.6497 -0.0928 -0.1115 0.1147  650 PRO A CA    
2854 C C     . PRO A 358 ? 0.5035 0.5023 0.4983 -0.0832 -0.1060 0.1067  650 PRO A C     
2855 O O     . PRO A 358 ? 0.5422 0.5252 0.5244 -0.0819 -0.1081 0.1008  650 PRO A O     
2856 C CB    . PRO A 358 ? 0.5864 0.5928 0.5922 -0.1011 -0.1164 0.1209  650 PRO A CB    
2857 C CG    . PRO A 358 ? 0.6381 0.6346 0.6404 -0.1113 -0.1251 0.1243  650 PRO A CG    
2858 C CD    . PRO A 358 ? 0.6053 0.5840 0.5939 -0.1079 -0.1262 0.1166  650 PRO A CD    
2859 N N     . ARG A 359 ? 0.5261 0.5387 0.5287 -0.0766 -0.0991 0.1069  651 ARG A N     
2860 C CA    . ARG A 359 ? 0.4947 0.5049 0.4919 -0.0675 -0.0938 0.0997  651 ARG A CA    
2861 C C     . ARG A 359 ? 0.4462 0.4477 0.4357 -0.0686 -0.0963 0.0969  651 ARG A C     
2862 O O     . ARG A 359 ? 0.4416 0.4341 0.4221 -0.0629 -0.0945 0.0900  651 ARG A O     
2863 C CB    . ARG A 359 ? 0.5545 0.5810 0.5615 -0.0614 -0.0868 0.1011  651 ARG A CB    
2864 C CG    . ARG A 359 ? 0.7168 0.7578 0.7351 -0.0658 -0.0869 0.1090  651 ARG A CG    
2865 C CD    . ARG A 359 ? 0.8375 0.8936 0.8645 -0.0591 -0.0798 0.1102  651 ARG A CD    
2866 N NE    . ARG A 359 ? 0.9138 0.9746 0.9455 -0.0566 -0.0772 0.1113  651 ARG A NE    
2867 C CZ    . ARG A 359 ? 1.0005 1.0769 1.0439 -0.0559 -0.0738 0.1176  651 ARG A CZ    
2868 N NH1   . ARG A 359 ? 1.0374 1.1268 1.0891 -0.0575 -0.0724 0.1237  651 ARG A NH1   
2869 N NH2   . ARG A 359 ? 1.0186 1.0977 1.0653 -0.0533 -0.0715 0.1182  651 ARG A NH2   
2870 N N     . GLU A 360 ? 0.5498 0.5539 0.5431 -0.0762 -0.1008 0.1026  652 GLU A N     
2871 C CA    . GLU A 360 ? 0.5463 0.5417 0.5325 -0.0780 -0.1038 0.1007  652 GLU A CA    
2872 C C     . GLU A 360 ? 0.5423 0.5170 0.5143 -0.0801 -0.1092 0.0959  652 GLU A C     
2873 O O     . GLU A 360 ? 0.5641 0.5288 0.5275 -0.0785 -0.1103 0.0917  652 GLU A O     
2874 C CB    . GLU A 360 ? 0.6774 0.6810 0.6715 -0.0862 -0.1075 0.1086  652 GLU A CB    
2875 C CG    . GLU A 360 ? 0.9026 0.9148 0.9062 -0.0938 -0.1106 0.1168  652 GLU A CG    
2876 C CD    . GLU A 360 ? 0.9747 1.0068 0.9917 -0.0896 -0.1040 0.1208  652 GLU A CD    
2877 O OE1   . GLU A 360 ? 1.0138 1.0549 1.0342 -0.0834 -0.0983 0.1195  652 GLU A OE1   
2878 O OE2   . GLU A 360 ? 1.0283 1.0664 1.0517 -0.0925 -0.1047 0.1253  652 GLU A OE2   
2879 N N     . ALA A 361 ? 0.5565 0.5248 0.5260 -0.0833 -0.1123 0.0965  653 ALA A N     
2880 C CA    . ALA A 361 ? 0.5989 0.5468 0.5541 -0.0853 -0.1175 0.0922  653 ALA A CA    
2881 C C     . ALA A 361 ? 0.6141 0.5551 0.5611 -0.0760 -0.1127 0.0843  653 ALA A C     
2882 O O     . ALA A 361 ? 0.6408 0.5651 0.5752 -0.0757 -0.1157 0.0799  653 ALA A O     
2883 C CB    . ALA A 361 ? 0.6433 0.5867 0.5989 -0.0939 -0.1238 0.0967  653 ALA A CB    
2884 N N     . VAL A 362 ? 0.5011 0.4548 0.4550 -0.0684 -0.1054 0.0827  654 VAL A N     
2885 C CA    . VAL A 362 ? 0.5677 0.5169 0.5152 -0.0597 -0.1005 0.0758  654 VAL A CA    
2886 C C     . VAL A 362 ? 0.6126 0.5567 0.5534 -0.0548 -0.0988 0.0708  654 VAL A C     
2887 O O     . VAL A 362 ? 0.5473 0.5022 0.4939 -0.0504 -0.0942 0.0703  654 VAL A O     
2888 C CB    . VAL A 362 ? 0.5016 0.4656 0.4587 -0.0540 -0.0939 0.0761  654 VAL A CB    
2889 C CG1   . VAL A 362 ? 0.4839 0.4435 0.4346 -0.0456 -0.0892 0.0694  654 VAL A CG1   
2890 C CG2   . VAL A 362 ? 0.4542 0.4237 0.4185 -0.0589 -0.0956 0.0815  654 VAL A CG2   
2891 N N     . ASP A 363 ? 0.5967 0.5242 0.5250 -0.0554 -0.1025 0.0672  655 ASP A N     
2892 C CA    . ASP A 363 ? 0.5972 0.5189 0.5186 -0.0506 -0.1011 0.0625  655 ASP A CA    
2893 C C     . ASP A 363 ? 0.5996 0.5230 0.5184 -0.0414 -0.0949 0.0568  655 ASP A C     
2894 O O     . ASP A 363 ? 0.6137 0.5405 0.5348 -0.0394 -0.0924 0.0565  655 ASP A O     
2895 C CB    . ASP A 363 ? 0.7750 0.6775 0.6836 -0.0550 -0.1078 0.0611  655 ASP A CB    
2896 C CG    . ASP A 363 ? 0.9097 0.7983 0.8089 -0.0568 -0.1112 0.0596  655 ASP A CG    
2897 O OD1   . ASP A 363 ? 0.8735 0.7650 0.7733 -0.0520 -0.1072 0.0574  655 ASP A OD1   
2898 O OD2   . ASP A 363 ? 0.9924 0.8664 0.8831 -0.0631 -0.1182 0.0606  655 ASP A OD2   
2899 N N     . PRO A 364 ? 0.5653 0.4872 0.4800 -0.0361 -0.0924 0.0527  656 PRO A N     
2900 C CA    . PRO A 364 ? 0.6393 0.5644 0.5527 -0.0279 -0.0865 0.0481  656 PRO A CA    
2901 C C     . PRO A 364 ? 0.6892 0.6033 0.5939 -0.0261 -0.0869 0.0452  656 PRO A C     
2902 O O     . PRO A 364 ? 0.6163 0.5361 0.5230 -0.0209 -0.0822 0.0430  656 PRO A O     
2903 C CB    . PRO A 364 ? 0.6279 0.5511 0.5374 -0.0241 -0.0853 0.0447  656 PRO A CB    
2904 C CG    . PRO A 364 ? 0.6606 0.5758 0.5667 -0.0302 -0.0911 0.0471  656 PRO A CG    
2905 C CD    . PRO A 364 ? 0.6403 0.5614 0.5542 -0.0372 -0.0939 0.0529  656 PRO A CD    
2906 N N     . LEU A 365 ? 0.7159 0.6143 0.6108 -0.0305 -0.0926 0.0451  657 LEU A N     
2907 C CA    . LEU A 365 ? 0.7732 0.6599 0.6587 -0.0288 -0.0933 0.0424  657 LEU A CA    
2908 C C     . LEU A 365 ? 0.6366 0.5299 0.5286 -0.0310 -0.0926 0.0451  657 LEU A C     
2909 O O     . LEU A 365 ? 0.5981 0.4928 0.4892 -0.0265 -0.0890 0.0429  657 LEU A O     
2910 C CB    . LEU A 365 ? 1.0053 0.8721 0.8777 -0.0333 -0.1002 0.0417  657 LEU A CB    
2911 C CG    . LEU A 365 ? 1.1544 1.0060 1.0135 -0.0299 -0.1007 0.0375  657 LEU A CG    
2912 C CD1   . LEU A 365 ? 1.1999 1.0502 1.0538 -0.0214 -0.0960 0.0326  657 LEU A CD1   
2913 C CD2   . LEU A 365 ? 1.2278 1.0592 1.0742 -0.0357 -0.1084 0.0376  657 LEU A CD2   
2914 N N     . MET A 366 ? 0.5546 0.4523 0.4534 -0.0380 -0.0961 0.0502  658 MET A N     
2915 C CA    . MET A 366 ? 0.5237 0.4288 0.4299 -0.0404 -0.0956 0.0535  658 MET A CA    
2916 C C     . MET A 366 ? 0.5411 0.4625 0.4575 -0.0344 -0.0885 0.0532  658 MET A C     
2917 O O     . MET A 366 ? 0.6288 0.5532 0.5472 -0.0323 -0.0860 0.0529  658 MET A O     
2918 C CB    . MET A 366 ? 0.5867 0.4953 0.4996 -0.0491 -0.1006 0.0597  658 MET A CB    
2919 C CG    . MET A 366 ? 0.5738 0.4913 0.4955 -0.0520 -0.1003 0.0638  658 MET A CG    
2920 S SD    . MET A 366 ? 0.7076 0.6298 0.6375 -0.0629 -0.1066 0.0719  658 MET A SD    
2921 C CE    . MET A 366 ? 0.7247 0.6240 0.6392 -0.0696 -0.1154 0.0706  658 MET A CE    
2922 N N     . ARG A 367 ? 0.5119 0.4430 0.4342 -0.0318 -0.0856 0.0532  659 ARG A N     
2923 C CA    . ARG A 367 ? 0.4613 0.4059 0.3921 -0.0268 -0.0799 0.0529  659 ARG A CA    
2924 C C     . ARG A 367 ? 0.5146 0.4560 0.4402 -0.0207 -0.0764 0.0483  659 ARG A C     
2925 O O     . ARG A 367 ? 0.4370 0.3852 0.3675 -0.0182 -0.0733 0.0484  659 ARG A O     
2926 C CB    . ARG A 367 ? 0.4482 0.4018 0.3846 -0.0255 -0.0781 0.0535  659 ARG A CB    
2927 C CG    . ARG A 367 ? 0.4931 0.4602 0.4387 -0.0216 -0.0733 0.0540  659 ARG A CG    
2928 C CD    . ARG A 367 ? 0.5424 0.5179 0.4930 -0.0209 -0.0720 0.0549  659 ARG A CD    
2929 N NE    . ARG A 367 ? 0.4461 0.4335 0.4048 -0.0175 -0.0678 0.0555  659 ARG A NE    
2930 C CZ    . ARG A 367 ? 0.4214 0.4108 0.3791 -0.0119 -0.0644 0.0516  659 ARG A CZ    
2931 N NH1   . ARG A 367 ? 0.5037 0.4852 0.4532 -0.0092 -0.0643 0.0473  659 ARG A NH1   
2932 N NH2   . ARG A 367 ? 0.4220 0.4213 0.3868 -0.0094 -0.0612 0.0524  659 ARG A NH2   
2933 N N     . ARG A 368 ? 0.4949 0.4260 0.4106 -0.0184 -0.0771 0.0444  660 ARG A N     
2934 C CA    . ARG A 368 ? 0.5506 0.4781 0.4607 -0.0129 -0.0742 0.0402  660 ARG A CA    
2935 C C     . ARG A 368 ? 0.4470 0.3690 0.3539 -0.0137 -0.0749 0.0404  660 ARG A C     
2936 O O     . ARG A 368 ? 0.5636 0.4888 0.4714 -0.0100 -0.0716 0.0389  660 ARG A O     
2937 C CB    . ARG A 368 ? 0.6756 0.5914 0.5748 -0.0106 -0.0754 0.0365  660 ARG A CB    
2938 C CG    . ARG A 368 ? 0.9810 0.9015 0.8819 -0.0081 -0.0738 0.0352  660 ARG A CG    
2939 C CD    . ARG A 368 ? 1.1835 1.0902 1.0728 -0.0070 -0.0762 0.0322  660 ARG A CD    
2940 N NE    . ARG A 368 ? 1.3368 1.2350 1.2172 -0.0022 -0.0747 0.0285  660 ARG A NE    
2941 C CZ    . ARG A 368 ? 1.4210 1.3058 1.2916 -0.0030 -0.0772 0.0275  660 ARG A CZ    
2942 N NH1   . ARG A 368 ? 1.4498 1.3279 1.3185 -0.0089 -0.0819 0.0299  660 ARG A NH1   
2943 N NH2   . ARG A 368 ? 1.4376 1.3155 1.3001 0.0021  -0.0752 0.0241  660 ARG A NH2   
2944 N N     . ALA A 369 ? 0.4762 0.3896 0.3791 -0.0189 -0.0794 0.0422  661 ALA A N     
2945 C CA    . ALA A 369 ? 0.4624 0.3697 0.3616 -0.0203 -0.0807 0.0425  661 ALA A CA    
2946 C C     . ALA A 369 ? 0.5519 0.4718 0.4624 -0.0210 -0.0784 0.0457  661 ALA A C     
2947 O O     . ALA A 369 ? 0.5489 0.4693 0.4590 -0.0187 -0.0762 0.0447  661 ALA A O     
2948 C CB    . ALA A 369 ? 0.5572 0.4527 0.4499 -0.0264 -0.0867 0.0440  661 ALA A CB    
2949 N N     . ALA A 370 ? 0.4786 0.4084 0.3988 -0.0241 -0.0788 0.0495  662 ALA A N     
2950 C CA    . ALA A 370 ? 0.4774 0.4194 0.4086 -0.0244 -0.0765 0.0529  662 ALA A CA    
2951 C C     . ALA A 370 ? 0.4449 0.3945 0.3797 -0.0183 -0.0713 0.0506  662 ALA A C     
2952 O O     . ALA A 370 ? 0.4355 0.3894 0.3745 -0.0173 -0.0694 0.0516  662 ALA A O     
2953 C CB    . ALA A 370 ? 0.4141 0.3652 0.3544 -0.0283 -0.0777 0.0574  662 ALA A CB    
2954 N N     . LYS A 371 ? 0.4089 0.3600 0.3420 -0.0144 -0.0692 0.0478  663 LYS A N     
2955 C CA    A LYS A 371 ? 0.3986 0.3565 0.3347 -0.0091 -0.0648 0.0456  663 LYS A CA    
2956 C CA    B LYS A 371 ? 0.4001 0.3580 0.3362 -0.0091 -0.0648 0.0456  663 LYS A CA    
2957 C C     . LYS A 371 ? 0.4480 0.4006 0.3788 -0.0064 -0.0634 0.0431  663 LYS A C     
2958 O O     . LYS A 371 ? 0.4440 0.4023 0.3794 -0.0042 -0.0608 0.0434  663 LYS A O     
2959 C CB    A LYS A 371 ? 0.3967 0.3559 0.3307 -0.0058 -0.0633 0.0427  663 LYS A CB    
2960 C CB    B LYS A 371 ? 0.4053 0.3640 0.3390 -0.0060 -0.0635 0.0428  663 LYS A CB    
2961 C CG    A LYS A 371 ? 0.4351 0.4022 0.3758 -0.0072 -0.0634 0.0449  663 LYS A CG    
2962 C CG    B LYS A 371 ? 0.3851 0.3546 0.3257 -0.0024 -0.0599 0.0423  663 LYS A CG    
2963 C CD    A LYS A 371 ? 0.4271 0.3949 0.3651 -0.0039 -0.0621 0.0418  663 LYS A CD    
2964 C CD    B LYS A 371 ? 0.4022 0.3719 0.3395 0.0010  -0.0586 0.0389  663 LYS A CD    
2965 C CE    A LYS A 371 ? 0.3428 0.3149 0.2815 0.0011  -0.0584 0.0389  663 LYS A CE    
2966 C CE    B LYS A 371 ? 0.4228 0.3928 0.3605 -0.0012 -0.0604 0.0398  663 LYS A CE    
2967 N NZ    A LYS A 371 ? 0.3491 0.3226 0.2858 0.0039  -0.0572 0.0361  663 LYS A NZ    
2968 N NZ    B LYS A 371 ? 0.3535 0.3272 0.2909 0.0022  -0.0585 0.0371  663 LYS A NZ    
2969 N N     . THR A 372 ? 0.5153 0.4563 0.4359 -0.0065 -0.0653 0.0408  664 THR A N     
2970 C CA    . THR A 372 ? 0.5105 0.4454 0.4247 -0.0039 -0.0642 0.0384  664 THR A CA    
2971 C C     . THR A 372 ? 0.4630 0.3988 0.3805 -0.0064 -0.0647 0.0410  664 THR A C     
2972 O O     . THR A 372 ? 0.5517 0.4893 0.4699 -0.0039 -0.0623 0.0402  664 THR A O     
2973 C CB    . THR A 372 ? 0.6057 0.5265 0.5073 -0.0035 -0.0665 0.0356  664 THR A CB    
2974 O OG1   . THR A 372 ? 0.8214 0.7359 0.7209 -0.0089 -0.0710 0.0377  664 THR A OG1   
2975 C CG2   . THR A 372 ? 0.5986 0.5184 0.4965 0.0001  -0.0652 0.0326  664 THR A CG2   
2976 N N     . ILE A 373 ? 0.4939 0.4286 0.4138 -0.0116 -0.0680 0.0442  665 ILE A N     
2977 C CA    . ILE A 373 ? 0.4392 0.3761 0.3637 -0.0144 -0.0688 0.0472  665 ILE A CA    
2978 C C     . ILE A 373 ? 0.4678 0.4173 0.4035 -0.0129 -0.0656 0.0494  665 ILE A C     
2979 O O     . ILE A 373 ? 0.4371 0.3882 0.3747 -0.0118 -0.0640 0.0497  665 ILE A O     
2980 C CB    . ILE A 373 ? 0.4795 0.4129 0.4044 -0.0209 -0.0735 0.0506  665 ILE A CB    
2981 C CG1   . ILE A 373 ? 0.5749 0.4933 0.4872 -0.0225 -0.0771 0.0481  665 ILE A CG1   
2982 C CG2   . ILE A 373 ? 0.5070 0.4456 0.4392 -0.0240 -0.0740 0.0544  665 ILE A CG2   
2983 C CD1   . ILE A 373 ? 0.6696 0.5830 0.5810 -0.0294 -0.0826 0.0512  665 ILE A CD1   
2984 N N     . ASN A 374 ? 0.3865 0.3444 0.3290 -0.0127 -0.0646 0.0508  666 ASN A N     
2985 C CA    . ASN A 374 ? 0.3367 0.3060 0.2894 -0.0110 -0.0617 0.0529  666 ASN A CA    
2986 C C     . ASN A 374 ? 0.3238 0.2944 0.2757 -0.0061 -0.0583 0.0501  666 ASN A C     
2987 O O     . ASN A 374 ? 0.3416 0.3162 0.2987 -0.0055 -0.0569 0.0517  666 ASN A O     
2988 C CB    . ASN A 374 ? 0.3891 0.3662 0.3474 -0.0107 -0.0610 0.0541  666 ASN A CB    
2989 C CG    . ASN A 374 ? 0.3871 0.3662 0.3493 -0.0159 -0.0640 0.0583  666 ASN A CG    
2990 O OD1   . ASN A 374 ? 0.4071 0.3865 0.3723 -0.0195 -0.0658 0.0616  666 ASN A OD1   
2991 N ND2   . ASN A 374 ? 0.3357 0.3169 0.2985 -0.0164 -0.0646 0.0585  666 ASN A ND2   
2992 N N     . PHE A 375 ? 0.3984 0.3660 0.3445 -0.0028 -0.0572 0.0463  667 PHE A N     
2993 C CA    . PHE A 375 ? 0.3336 0.3029 0.2791 0.0014  -0.0544 0.0438  667 PHE A CA    
2994 C C     . PHE A 375 ? 0.3654 0.3289 0.3065 0.0015  -0.0544 0.0433  667 PHE A C     
2995 O O     . PHE A 375 ? 0.3858 0.3527 0.3305 0.0031  -0.0526 0.0437  667 PHE A O     
2996 C CB    . PHE A 375 ? 0.3790 0.3463 0.3188 0.0046  -0.0535 0.0400  667 PHE A CB    
2997 C CG    . PHE A 375 ? 0.5114 0.4850 0.4556 0.0049  -0.0532 0.0403  667 PHE A CG    
2998 C CD1   . PHE A 375 ? 0.5515 0.5342 0.5049 0.0047  -0.0522 0.0428  667 PHE A CD1   
2999 C CD2   . PHE A 375 ? 0.5206 0.4907 0.4594 0.0056  -0.0539 0.0381  667 PHE A CD2   
3000 C CE1   . PHE A 375 ? 0.4011 0.3896 0.3581 0.0051  -0.0518 0.0429  667 PHE A CE1   
3001 C CE2   . PHE A 375 ? 0.5442 0.5201 0.4869 0.0058  -0.0536 0.0383  667 PHE A CE2   
3002 C CZ    . PHE A 375 ? 0.4346 0.4197 0.3861 0.0055  -0.0526 0.0407  667 PHE A CZ    
3003 N N     . GLY A 376 ? 0.3865 0.3408 0.3196 -0.0002 -0.0565 0.0424  668 GLY A N     
3004 C CA    . GLY A 376 ? 0.3577 0.3059 0.2858 -0.0002 -0.0566 0.0419  668 GLY A CA    
3005 C C     . GLY A 376 ? 0.4261 0.3784 0.3615 -0.0028 -0.0568 0.0454  668 GLY A C     
3006 O O     . GLY A 376 ? 0.3852 0.3386 0.3218 -0.0013 -0.0552 0.0454  668 GLY A O     
3007 N N     . VAL A 377 ? 0.3880 0.3430 0.3287 -0.0067 -0.0590 0.0487  669 VAL A N     
3008 C CA    . VAL A 377 ? 0.3551 0.3144 0.3031 -0.0094 -0.0594 0.0525  669 VAL A CA    
3009 C C     . VAL A 377 ? 0.3532 0.3223 0.3109 -0.0070 -0.0564 0.0540  669 VAL A C     
3010 O O     . VAL A 377 ? 0.3478 0.3180 0.3082 -0.0066 -0.0553 0.0550  669 VAL A O     
3011 C CB    . VAL A 377 ? 0.4637 0.4240 0.4152 -0.0145 -0.0626 0.0560  669 VAL A CB    
3012 C CG1   . VAL A 377 ? 0.4769 0.4444 0.4381 -0.0168 -0.0626 0.0604  669 VAL A CG1   
3013 C CG2   . VAL A 377 ? 0.4329 0.3820 0.3747 -0.0176 -0.0663 0.0548  669 VAL A CG2   
3014 N N     . LEU A 378 ? 0.3442 0.3199 0.3066 -0.0055 -0.0551 0.0542  670 LEU A N     
3015 C CA    . LEU A 378 ? 0.3350 0.3196 0.3062 -0.0030 -0.0524 0.0556  670 LEU A CA    
3016 C C     . LEU A 378 ? 0.3753 0.3584 0.3445 0.0004  -0.0504 0.0531  670 LEU A C     
3017 O O     . LEU A 378 ? 0.3695 0.3569 0.3449 0.0014  -0.0487 0.0549  670 LEU A O     
3018 C CB    . LEU A 378 ? 0.3749 0.3657 0.3496 -0.0013 -0.0514 0.0554  670 LEU A CB    
3019 C CG    . LEU A 378 ? 0.3643 0.3611 0.3451 -0.0039 -0.0523 0.0591  670 LEU A CG    
3020 C CD1   . LEU A 378 ? 0.3523 0.3531 0.3337 -0.0020 -0.0514 0.0577  670 LEU A CD1   
3021 C CD2   . LEU A 378 ? 0.3726 0.3779 0.3637 -0.0041 -0.0508 0.0636  670 LEU A CD2   
3022 N N     . TYR A 379 ? 0.3218 0.2990 0.2823 0.0021  -0.0504 0.0493  671 TYR A N     
3023 C CA    . TYR A 379 ? 0.3744 0.3512 0.3331 0.0053  -0.0486 0.0471  671 TYR A CA    
3024 C C     . TYR A 379 ? 0.4793 0.4490 0.4313 0.0051  -0.0489 0.0460  671 TYR A C     
3025 O O     . TYR A 379 ? 0.4524 0.4207 0.4008 0.0077  -0.0476 0.0438  671 TYR A O     
3026 C CB    . TYR A 379 ? 0.3948 0.3722 0.3499 0.0082  -0.0479 0.0437  671 TYR A CB    
3027 C CG    . TYR A 379 ? 0.5136 0.4988 0.4758 0.0085  -0.0475 0.0449  671 TYR A CG    
3028 C CD1   . TYR A 379 ? 0.6793 0.6726 0.6516 0.0090  -0.0454 0.0472  671 TYR A CD1   
3029 C CD2   . TYR A 379 ? 0.6512 0.6358 0.6101 0.0086  -0.0482 0.0434  671 TYR A CD2   
3030 C CE1   . TYR A 379 ? 0.5726 0.5734 0.5512 0.0098  -0.0442 0.0481  671 TYR A CE1   
3031 C CE2   . TYR A 379 ? 0.7089 0.7009 0.6742 0.0088  -0.0477 0.0445  671 TYR A CE2   
3032 C CZ    . TYR A 379 ? 0.7237 0.7239 0.6986 0.0094  -0.0460 0.0473  671 TYR A CZ    
3033 O OH    . TYR A 379 ? 0.7041 0.7122 0.6851 0.0102  -0.0449 0.0486  671 TYR A OH    
3034 N N     . GLY A 380 ? 0.4221 0.3876 0.3724 0.0020  -0.0506 0.0476  672 GLY A N     
3035 C CA    . GLY A 380 ? 0.4373 0.3978 0.3838 0.0015  -0.0506 0.0477  672 GLY A CA    
3036 C C     . GLY A 380 ? 0.4939 0.4450 0.4301 0.0005  -0.0521 0.0461  672 GLY A C     
3037 O O     . GLY A 380 ? 0.4293 0.3768 0.3618 0.0008  -0.0517 0.0459  672 GLY A O     
3038 N N     . MET A 381 ? 0.3764 0.3232 0.3076 -0.0006 -0.0540 0.0452  673 MET A N     
3039 C CA    . MET A 381 ? 0.4131 0.3498 0.3338 -0.0013 -0.0557 0.0435  673 MET A CA    
3040 C C     . MET A 381 ? 0.5059 0.4395 0.4271 -0.0052 -0.0578 0.0459  673 MET A C     
3041 O O     . MET A 381 ? 0.4529 0.3916 0.3824 -0.0085 -0.0590 0.0492  673 MET A O     
3042 C CB    . MET A 381 ? 0.4670 0.3993 0.3829 -0.0021 -0.0577 0.0422  673 MET A CB    
3043 C CG    . MET A 381 ? 0.5718 0.4919 0.4757 -0.0027 -0.0599 0.0403  673 MET A CG    
3044 S SD    . MET A 381 ? 0.6217 0.5364 0.5208 -0.0041 -0.0627 0.0391  673 MET A SD    
3045 C CE    . MET A 381 ? 0.5118 0.4379 0.4246 -0.0078 -0.0635 0.0431  673 MET A CE    
3046 N N     . SER A 382 ? 0.5951 0.5205 0.5073 -0.0048 -0.0582 0.0444  674 SER A N     
3047 C CA    . SER A 382 ? 0.5967 0.5185 0.5085 -0.0085 -0.0603 0.0465  674 SER A CA    
3048 C C     . SER A 382 ? 0.5277 0.4422 0.4346 -0.0126 -0.0645 0.0469  674 SER A C     
3049 O O     . SER A 382 ? 0.4840 0.3932 0.3847 -0.0120 -0.0657 0.0449  674 SER A O     
3050 C CB    . SER A 382 ? 0.6535 0.5697 0.5574 -0.0062 -0.0589 0.0448  674 SER A CB    
3051 O OG    . SER A 382 ? 0.7279 0.6345 0.6194 -0.0039 -0.0593 0.0416  674 SER A OG    
3052 N N     . ALA A 383 ? 0.6146 0.5285 0.5243 -0.0171 -0.0671 0.0497  675 ALA A N     
3053 C CA    . ALA A 383 ? 0.6147 0.5212 0.5198 -0.0219 -0.0718 0.0505  675 ALA A CA    
3054 C C     . ALA A 383 ? 0.6687 0.5614 0.5586 -0.0204 -0.0732 0.0468  675 ALA A C     
3055 O O     . ALA A 383 ? 0.6313 0.5165 0.5151 -0.0225 -0.0764 0.0460  675 ALA A O     
3056 C CB    . ALA A 383 ? 0.6418 0.5498 0.5517 -0.0267 -0.0742 0.0540  675 ALA A CB    
3057 N N     . HIS A 384 ? 0.7924 0.6816 0.6761 -0.0166 -0.0705 0.0447  676 HIS A N     
3058 C CA    . HIS A 384 ? 0.8926 0.7688 0.7614 -0.0140 -0.0710 0.0412  676 HIS A CA    
3059 C C     . HIS A 384 ? 0.8268 0.6993 0.6900 -0.0109 -0.0706 0.0383  676 HIS A C     
3060 O O     . HIS A 384 ? 0.9098 0.7711 0.7637 -0.0124 -0.0740 0.0369  676 HIS A O     
3061 C CB    . HIS A 384 ? 1.0730 0.9490 0.9377 -0.0095 -0.0672 0.0398  676 HIS A CB    
3062 C CG    . HIS A 384 ? 1.2830 1.1469 1.1324 -0.0054 -0.0667 0.0361  676 HIS A CG    
3063 N ND1   . HIS A 384 ? 1.3819 1.2319 1.2197 -0.0076 -0.0705 0.0351  676 HIS A ND1   
3064 C CD2   . HIS A 384 ? 1.3630 1.2262 1.2064 0.0010  -0.0628 0.0334  676 HIS A CD2   
3065 C CE1   . HIS A 384 ? 1.4395 1.2802 1.2644 -0.0022 -0.0687 0.0317  676 HIS A CE1   
3066 N NE2   . HIS A 384 ? 1.4335 1.2826 1.2619 0.0031  -0.0638 0.0307  676 HIS A NE2   
3067 N N     . ARG A 385 ? 0.7691 0.6505 0.6379 -0.0068 -0.0667 0.0376  677 ARG A N     
3068 C CA    . ARG A 385 ? 0.7461 0.6255 0.6108 -0.0035 -0.0659 0.0349  677 ARG A CA    
3069 C C     . ARG A 385 ? 0.6743 0.5526 0.5415 -0.0077 -0.0696 0.0361  677 ARG A C     
3070 O O     . ARG A 385 ? 0.7116 0.5806 0.5701 -0.0071 -0.0715 0.0339  677 ARG A O     
3071 C CB    . ARG A 385 ? 0.8700 0.7605 0.7418 0.0009  -0.0614 0.0344  677 ARG A CB    
3072 C CG    . ARG A 385 ? 1.0188 0.9096 0.8889 0.0037  -0.0606 0.0322  677 ARG A CG    
3073 C CD    . ARG A 385 ? 1.1912 1.0774 1.0517 0.0101  -0.0575 0.0286  677 ARG A CD    
3074 N NE    . ARG A 385 ? 1.3524 1.2434 1.2151 0.0133  -0.0557 0.0270  677 ARG A NE    
3075 C CZ    . ARG A 385 ? 1.4374 1.3383 1.3059 0.0166  -0.0521 0.0267  677 ARG A CZ    
3076 N NH1   . ARG A 385 ? 1.4398 1.3465 1.3124 0.0173  -0.0499 0.0279  677 ARG A NH1   
3077 N NH2   . ARG A 385 ? 1.4810 1.3855 1.3510 0.0191  -0.0508 0.0251  677 ARG A NH2   
3078 N N     . LEU A 386 ? 0.6244 0.5121 0.5036 -0.0120 -0.0707 0.0398  678 LEU A N     
3079 C CA    . LEU A 386 ? 0.6301 0.5188 0.5133 -0.0164 -0.0741 0.0417  678 LEU A CA    
3080 C C     . LEU A 386 ? 0.7037 0.5790 0.5772 -0.0208 -0.0794 0.0416  678 LEU A C     
3081 O O     . LEU A 386 ? 0.6685 0.5379 0.5376 -0.0225 -0.0822 0.0409  678 LEU A O     
3082 C CB    . LEU A 386 ? 0.5616 0.4631 0.4592 -0.0196 -0.0739 0.0461  678 LEU A CB    
3083 C CG    . LEU A 386 ? 0.5734 0.4792 0.4774 -0.0240 -0.0768 0.0489  678 LEU A CG    
3084 C CD1   . LEU A 386 ? 0.5383 0.4476 0.4433 -0.0209 -0.0750 0.0473  678 LEU A CD1   
3085 C CD2   . LEU A 386 ? 0.4917 0.4094 0.4090 -0.0268 -0.0764 0.0535  678 LEU A CD2   
3086 N N     . SER A 387 ? 0.8728 0.7429 0.7426 -0.0230 -0.0810 0.0423  679 SER A N     
3087 C CA    . SER A 387 ? 1.0306 0.8869 0.8903 -0.0275 -0.0865 0.0421  679 SER A CA    
3088 C C     . SER A 387 ? 1.0808 0.9219 0.9248 -0.0240 -0.0872 0.0376  679 SER A C     
3089 O O     . SER A 387 ? 1.0831 0.9134 0.9196 -0.0274 -0.0918 0.0372  679 SER A O     
3090 C CB    . SER A 387 ? 1.0725 0.9262 0.9308 -0.0299 -0.0876 0.0433  679 SER A CB    
3091 O OG    . SER A 387 ? 1.1082 0.9603 0.9612 -0.0241 -0.0834 0.0408  679 SER A OG    
3092 N N     . GLN A 388 ? 1.1368 0.9771 0.9757 -0.0171 -0.0826 0.0345  680 GLN A N     
3093 C CA    . GLN A 388 ? 1.2500 1.0764 1.0738 -0.0124 -0.0824 0.0303  680 GLN A CA    
3094 C C     . GLN A 388 ? 1.2452 1.0713 1.0690 -0.0113 -0.0828 0.0291  680 GLN A C     
3095 O O     . GLN A 388 ? 1.2719 1.0839 1.0843 -0.0118 -0.0862 0.0271  680 GLN A O     
3096 C CB    . GLN A 388 ? 1.3370 1.1648 1.1567 -0.0050 -0.0769 0.0278  680 GLN A CB    
3097 C CG    . GLN A 388 ? 1.4584 1.2805 1.2721 -0.0051 -0.0768 0.0279  680 GLN A CG    
3098 C CD    . GLN A 388 ? 1.5504 1.3708 1.3566 0.0027  -0.0718 0.0251  680 GLN A CD    
3099 O OE1   . GLN A 388 ? 1.5814 1.4079 1.3897 0.0079  -0.0679 0.0236  680 GLN A OE1   
3100 N NE2   . GLN A 388 ? 1.5773 1.3895 1.3747 0.0035  -0.0719 0.0245  680 GLN A NE2   
3101 N N     . GLU A 389 ? 1.2001 1.0413 1.0364 -0.0099 -0.0795 0.0303  681 GLU A N     
3102 C CA    . GLU A 389 ? 1.1658 1.0084 1.0032 -0.0087 -0.0795 0.0293  681 GLU A CA    
3103 C C     . GLU A 389 ? 1.1352 0.9751 0.9748 -0.0155 -0.0849 0.0317  681 GLU A C     
3104 O O     . GLU A 389 ? 1.1335 0.9665 0.9675 -0.0154 -0.0868 0.0303  681 GLU A O     
3105 C CB    . GLU A 389 ? 1.1358 0.9950 0.9857 -0.0056 -0.0747 0.0301  681 GLU A CB    
3106 C CG    . GLU A 389 ? 1.1100 0.9717 0.9572 0.0013  -0.0696 0.0276  681 GLU A CG    
3107 C CD    . GLU A 389 ? 1.0880 0.9633 0.9450 0.0043  -0.0657 0.0276  681 GLU A CD    
3108 O OE1   . GLU A 389 ? 1.0212 0.9041 0.8872 0.0013  -0.0668 0.0297  681 GLU A OE1   
3109 O OE2   . GLU A 389 ? 1.1092 0.9875 0.9647 0.0097  -0.0617 0.0257  681 GLU A OE2   
3110 N N     . LEU A 390 ? 1.1349 0.9802 0.9825 -0.0215 -0.0873 0.0356  682 LEU A N     
3111 C CA    . LEU A 390 ? 1.1985 1.0431 1.0496 -0.0285 -0.0925 0.0387  682 LEU A CA    
3112 C C     . LEU A 390 ? 1.3425 1.1702 1.1813 -0.0333 -0.0986 0.0383  682 LEU A C     
3113 O O     . LEU A 390 ? 1.3298 1.1546 1.1697 -0.0400 -0.1039 0.0410  682 LEU A O     
3114 C CB    . LEU A 390 ? 1.0986 0.9592 0.9656 -0.0325 -0.0920 0.0436  682 LEU A CB    
3115 C CG    . LEU A 390 ? 1.0054 0.8791 0.8842 -0.0327 -0.0904 0.0458  682 LEU A CG    
3116 C CD1   . LEU A 390 ? 0.9590 0.8355 0.8365 -0.0258 -0.0857 0.0424  682 LEU A CD1   
3117 C CD2   . LEU A 390 ? 0.9477 0.8369 0.8412 -0.0345 -0.0885 0.0501  682 LEU A CD2   
3118 N N     . ALA A 391 ? 1.4475 1.2633 1.2740 -0.0299 -0.0980 0.0351  683 ALA A N     
3119 C CA    . ALA A 391 ? 1.5098 1.3075 1.3225 -0.0337 -0.1035 0.0341  683 ALA A CA    
3120 C C     . ALA A 391 ? 1.4971 1.2980 1.3166 -0.0422 -0.1083 0.0387  683 ALA A C     
3121 O O     . ALA A 391 ? 1.5096 1.2986 1.3225 -0.0491 -0.1155 0.0398  683 ALA A O     
3122 C CB    . ALA A 391 ? 1.5381 1.3202 1.3385 -0.0341 -0.1074 0.0317  683 ALA A CB    
3123 N N     . ILE A 392 ? 1.4533 1.2688 1.2851 -0.0424 -0.1052 0.0414  684 ILE A N     
3124 C CA    . ILE A 392 ? 1.4109 1.2313 1.2505 -0.0500 -0.1093 0.0460  684 ILE A CA    
3125 C C     . ILE A 392 ? 1.3309 1.1533 1.1709 -0.0484 -0.1069 0.0460  684 ILE A C     
3126 O O     . ILE A 392 ? 1.2522 1.0765 1.0903 -0.0417 -0.1016 0.0433  684 ILE A O     
3127 C CB    . ILE A 392 ? 1.3958 1.2350 1.2534 -0.0525 -0.1080 0.0506  684 ILE A CB    
3128 C CG1   . ILE A 392 ? 1.3809 1.2351 1.2485 -0.0454 -0.1002 0.0500  684 ILE A CG1   
3129 C CG2   . ILE A 392 ? 1.3885 1.2258 1.2461 -0.0550 -0.1110 0.0511  684 ILE A CG2   
3130 C CD1   . ILE A 392 ? 1.3370 1.2089 1.2214 -0.0468 -0.0984 0.0542  684 ILE A CD1   
3131 N N     . PRO A 393 ? 1.3210 1.1416 1.1624 -0.0554 -0.1119 0.0492  685 PRO A N     
3132 C CA    . PRO A 393 ? 1.2623 1.0856 1.1050 -0.0544 -0.1098 0.0496  685 PRO A CA    
3133 C C     . PRO A 393 ? 1.1282 0.9697 0.9857 -0.0503 -0.1035 0.0513  685 PRO A C     
3134 O O     . PRO A 393 ? 1.0105 0.8650 0.8804 -0.0507 -0.1019 0.0538  685 PRO A O     
3135 C CB    . PRO A 393 ? 1.3182 1.1385 1.1626 -0.0641 -0.1172 0.0537  685 PRO A CB    
3136 C CG    . PRO A 393 ? 1.3529 1.1757 1.2026 -0.0699 -0.1218 0.0567  685 PRO A CG    
3137 C CD    . PRO A 393 ? 1.3735 1.1882 1.2144 -0.0651 -0.1202 0.0526  685 PRO A CD    
3138 N N     . TYR A 394 ? 1.1170 0.9586 0.9724 -0.0467 -0.1002 0.0500  686 TYR A N     
3139 C CA    . TYR A 394 ? 1.0732 0.9295 0.9403 -0.0426 -0.0944 0.0511  686 TYR A CA    
3140 C C     . TYR A 394 ? 1.1361 1.0070 1.0194 -0.0468 -0.0950 0.0562  686 TYR A C     
3141 O O     . TYR A 394 ? 1.1105 0.9940 1.0049 -0.0441 -0.0911 0.0574  686 TYR A O     
3142 C CB    . TYR A 394 ? 0.9868 0.8392 0.8481 -0.0396 -0.0920 0.0495  686 TYR A CB    
3143 C CG    . TYR A 394 ? 0.9221 0.7882 0.7947 -0.0360 -0.0866 0.0507  686 TYR A CG    
3144 C CD1   . TYR A 394 ? 0.8759 0.7514 0.7598 -0.0394 -0.0870 0.0546  686 TYR A CD1   
3145 C CD2   . TYR A 394 ? 0.9331 0.8020 0.8046 -0.0293 -0.0814 0.0481  686 TYR A CD2   
3146 C CE1   . TYR A 394 ? 0.8006 0.6871 0.6940 -0.0361 -0.0824 0.0557  686 TYR A CE1   
3147 C CE2   . TYR A 394 ? 0.8299 0.7101 0.7109 -0.0264 -0.0770 0.0492  686 TYR A CE2   
3148 C CZ    . TYR A 394 ? 0.8081 0.6964 0.6997 -0.0298 -0.0776 0.0529  686 TYR A CZ    
3149 O OH    . TYR A 394 ? 0.8279 0.7260 0.7283 -0.0271 -0.0735 0.0539  686 TYR A OH    
3150 N N     . GLU A 395 ? 1.1735 1.0423 1.0579 -0.0534 -0.1000 0.0592  687 GLU A N     
3151 C CA    . GLU A 395 ? 1.1401 1.0227 1.0397 -0.0574 -0.1007 0.0645  687 GLU A CA    
3152 C C     . GLU A 395 ? 0.9429 0.8340 0.8514 -0.0593 -0.1014 0.0671  687 GLU A C     
3153 O O     . GLU A 395 ? 0.7872 0.6923 0.7095 -0.0595 -0.0994 0.0709  687 GLU A O     
3154 C CB    . GLU A 395 ? 1.2880 1.1661 1.1862 -0.0645 -0.1065 0.0673  687 GLU A CB    
3155 C CG    . GLU A 395 ? 1.4244 1.2947 1.3144 -0.0632 -0.1061 0.0653  687 GLU A CG    
3156 C CD    . GLU A 395 ? 1.5296 1.3818 1.4011 -0.0613 -0.1075 0.0603  687 GLU A CD    
3157 O OE1   . GLU A 395 ? 1.5614 1.4044 1.4254 -0.0638 -0.1114 0.0592  687 GLU A OE1   
3158 O OE2   . GLU A 395 ? 1.5662 1.4130 1.4304 -0.0574 -0.1048 0.0576  687 GLU A OE2   
3159 N N     . GLU A 396 ? 1.0186 0.9005 0.9186 -0.0604 -0.1042 0.0652  688 GLU A N     
3160 C CA    . GLU A 396 ? 1.1025 0.9911 1.0097 -0.0626 -0.1054 0.0676  688 GLU A CA    
3161 C C     . GLU A 396 ? 0.9203 0.8185 0.8334 -0.0554 -0.0987 0.0659  688 GLU A C     
3162 O O     . GLU A 396 ? 0.7223 0.6332 0.6474 -0.0557 -0.0971 0.0692  688 GLU A O     
3163 C CB    . GLU A 396 ? 1.3472 1.2213 1.2425 -0.0668 -0.1113 0.0661  688 GLU A CB    
3164 C CG    . GLU A 396 ? 1.5785 1.4590 1.4815 -0.0714 -0.1142 0.0699  688 GLU A CG    
3165 C CD    . GLU A 396 ? 1.7720 1.6368 1.6629 -0.0767 -0.1211 0.0688  688 GLU A CD    
3166 O OE1   . GLU A 396 ? 1.8432 1.6912 1.7188 -0.0759 -0.1232 0.0646  688 GLU A OE1   
3167 O OE2   . GLU A 396 ? 1.8217 1.6904 1.7180 -0.0815 -0.1244 0.0722  688 GLU A OE2   
3168 N N     . ALA A 397 ? 0.8857 0.7775 0.7901 -0.0493 -0.0951 0.0610  689 ALA A N     
3169 C CA    . ALA A 397 ? 0.7764 0.6762 0.6854 -0.0428 -0.0893 0.0592  689 ALA A CA    
3170 C C     . ALA A 397 ? 0.6807 0.5938 0.6021 -0.0411 -0.0855 0.0619  689 ALA A C     
3171 O O     . ALA A 397 ? 0.6391 0.5631 0.5700 -0.0390 -0.0826 0.0633  689 ALA A O     
3172 C CB    . ALA A 397 ? 0.7650 0.6553 0.6620 -0.0370 -0.0867 0.0540  689 ALA A CB    
3173 N N     . GLN A 398 ? 0.5988 0.5104 0.5196 -0.0419 -0.0857 0.0625  690 GLN A N     
3174 C CA    . GLN A 398 ? 0.5774 0.5003 0.5096 -0.0407 -0.0826 0.0652  690 GLN A CA    
3175 C C     . GLN A 398 ? 0.5322 0.4667 0.4774 -0.0444 -0.0838 0.0705  690 GLN A C     
3176 O O     . GLN A 398 ? 0.5884 0.5339 0.5438 -0.0417 -0.0802 0.0723  690 GLN A O     
3177 C CB    . GLN A 398 ? 0.6909 0.6092 0.6198 -0.0421 -0.0836 0.0654  690 GLN A CB    
3178 C CG    . GLN A 398 ? 0.8405 0.7683 0.7788 -0.0397 -0.0798 0.0671  690 GLN A CG    
3179 C CD    . GLN A 398 ? 1.0106 0.9329 0.9443 -0.0406 -0.0805 0.0667  690 GLN A CD    
3180 O OE1   . GLN A 398 ? 1.0447 0.9572 0.9695 -0.0440 -0.0844 0.0660  690 GLN A OE1   
3181 N NE2   . GLN A 398 ? 1.0847 1.0127 1.0239 -0.0376 -0.0769 0.0671  690 GLN A NE2   
3182 N N     . ALA A 399 ? 0.5739 0.5056 0.5184 -0.0506 -0.0891 0.0730  691 ALA A N     
3183 C CA    . ALA A 399 ? 0.5985 0.5416 0.5554 -0.0547 -0.0907 0.0788  691 ALA A CA    
3184 C C     . ALA A 399 ? 0.6162 0.5661 0.5780 -0.0526 -0.0886 0.0792  691 ALA A C     
3185 O O     . ALA A 399 ? 0.5391 0.5019 0.5131 -0.0524 -0.0867 0.0833  691 ALA A O     
3186 C CB    . ALA A 399 ? 0.6264 0.5641 0.5806 -0.0626 -0.0975 0.0816  691 ALA A CB    
3187 N N     . PHE A 400 ? 0.5608 0.5023 0.5131 -0.0509 -0.0889 0.0751  692 PHE A N     
3188 C CA    . PHE A 400 ? 0.5528 0.4996 0.5083 -0.0485 -0.0868 0.0748  692 PHE A CA    
3189 C C     . PHE A 400 ? 0.4891 0.4454 0.4515 -0.0422 -0.0807 0.0741  692 PHE A C     
3190 O O     . PHE A 400 ? 0.4879 0.4550 0.4599 -0.0414 -0.0788 0.0769  692 PHE A O     
3191 C CB    . PHE A 400 ? 0.5387 0.4736 0.4817 -0.0470 -0.0879 0.0700  692 PHE A CB    
3192 C CG    . PHE A 400 ? 0.5674 0.5073 0.5130 -0.0442 -0.0857 0.0692  692 PHE A CG    
3193 C CD1   . PHE A 400 ? 0.6397 0.5840 0.5904 -0.0486 -0.0884 0.0727  692 PHE A CD1   
3194 C CD2   . PHE A 400 ? 0.5499 0.4905 0.4932 -0.0376 -0.0810 0.0652  692 PHE A CD2   
3195 C CE1   . PHE A 400 ? 0.6675 0.6164 0.6204 -0.0460 -0.0864 0.0721  692 PHE A CE1   
3196 C CE2   . PHE A 400 ? 0.6183 0.5635 0.5640 -0.0352 -0.0791 0.0645  692 PHE A CE2   
3197 C CZ    . PHE A 400 ? 0.6472 0.5965 0.5975 -0.0393 -0.0817 0.0678  692 PHE A CZ    
3198 N N     . ILE A 401 ? 0.5064 0.4584 0.4639 -0.0379 -0.0779 0.0705  693 ILE A N     
3199 C CA    . ILE A 401 ? 0.4706 0.4299 0.4335 -0.0322 -0.0727 0.0695  693 ILE A CA    
3200 C C     . ILE A 401 ? 0.5081 0.4795 0.4840 -0.0329 -0.0712 0.0744  693 ILE A C     
3201 O O     . ILE A 401 ? 0.4777 0.4579 0.4609 -0.0298 -0.0680 0.0755  693 ILE A O     
3202 C CB    . ILE A 401 ? 0.4463 0.3989 0.4017 -0.0284 -0.0705 0.0655  693 ILE A CB    
3203 C CG1   . ILE A 401 ? 0.5243 0.4678 0.4683 -0.0258 -0.0704 0.0607  693 ILE A CG1   
3204 C CG2   . ILE A 401 ? 0.4745 0.4350 0.4371 -0.0240 -0.0660 0.0656  693 ILE A CG2   
3205 C CD1   . ILE A 401 ? 0.5320 0.4674 0.4670 -0.0230 -0.0692 0.0572  693 ILE A CD1   
3206 N N     . GLU A 402 ? 0.5347 0.5066 0.5135 -0.0368 -0.0736 0.0776  694 GLU A N     
3207 C CA    . GLU A 402 ? 0.5026 0.4861 0.4940 -0.0375 -0.0723 0.0827  694 GLU A CA    
3208 C C     . GLU A 402 ? 0.4450 0.4382 0.4450 -0.0394 -0.0728 0.0871  694 GLU A C     
3209 O O     . GLU A 402 ? 0.5152 0.5191 0.5248 -0.0366 -0.0694 0.0899  694 GLU A O     
3210 C CB    . GLU A 402 ? 0.6431 0.6252 0.6358 -0.0417 -0.0752 0.0854  694 GLU A CB    
3211 C CG    . GLU A 402 ? 0.7252 0.7009 0.7123 -0.0391 -0.0736 0.0821  694 GLU A CG    
3212 C CD    . GLU A 402 ? 0.7746 0.7564 0.7673 -0.0333 -0.0684 0.0815  694 GLU A CD    
3213 O OE1   . GLU A 402 ? 0.7218 0.7136 0.7254 -0.0327 -0.0667 0.0857  694 GLU A OE1   
3214 O OE2   . GLU A 402 ? 0.7210 0.6974 0.7071 -0.0294 -0.0661 0.0770  694 GLU A OE2   
3215 N N     . ARG A 403 ? 0.4668 0.4562 0.4632 -0.0442 -0.0771 0.0879  695 ARG A N     
3216 C CA    . ARG A 403 ? 0.5356 0.5340 0.5398 -0.0469 -0.0780 0.0925  695 ARG A CA    
3217 C C     . ARG A 403 ? 0.5726 0.5753 0.5780 -0.0416 -0.0739 0.0904  695 ARG A C     
3218 O O     . ARG A 403 ? 0.5092 0.5235 0.5243 -0.0407 -0.0718 0.0944  695 ARG A O     
3219 C CB    . ARG A 403 ? 0.6665 0.6577 0.6649 -0.0533 -0.0838 0.0930  695 ARG A CB    
3220 C CG    . ARG A 403 ? 0.9073 0.9086 0.9155 -0.0586 -0.0864 0.0997  695 ARG A CG    
3221 C CD    . ARG A 403 ? 1.1151 1.1079 1.1160 -0.0642 -0.0919 0.0993  695 ARG A CD    
3222 N NE    . ARG A 403 ? 1.2202 1.1973 1.2081 -0.0659 -0.0954 0.0948  695 ARG A NE    
3223 C CZ    . ARG A 403 ? 1.2975 1.2624 1.2748 -0.0691 -0.0998 0.0922  695 ARG A CZ    
3224 N NH1   . ARG A 403 ? 1.3217 1.2886 1.3004 -0.0710 -0.1011 0.0935  695 ARG A NH1   
3225 N NH2   . ARG A 403 ? 1.2839 1.2343 1.2491 -0.0704 -0.1029 0.0884  695 ARG A NH2   
3226 N N     . TYR A 404 ? 0.4705 0.4641 0.4660 -0.0381 -0.0728 0.0843  696 TYR A N     
3227 C CA    . TYR A 404 ? 0.4629 0.4593 0.4583 -0.0332 -0.0693 0.0818  696 TYR A CA    
3228 C C     . TYR A 404 ? 0.4711 0.4778 0.4755 -0.0284 -0.0645 0.0833  696 TYR A C     
3229 O O     . TYR A 404 ? 0.5273 0.5432 0.5386 -0.0267 -0.0623 0.0856  696 TYR A O     
3230 C CB    . TYR A 404 ? 0.4184 0.4034 0.4016 -0.0302 -0.0690 0.0752  696 TYR A CB    
3231 C CG    . TYR A 404 ? 0.3890 0.3758 0.3709 -0.0260 -0.0665 0.0724  696 TYR A CG    
3232 C CD1   . TYR A 404 ? 0.4600 0.4533 0.4466 -0.0208 -0.0621 0.0715  696 TYR A CD1   
3233 C CD2   . TYR A 404 ? 0.3927 0.3742 0.3685 -0.0275 -0.0687 0.0706  696 TYR A CD2   
3234 C CE1   . TYR A 404 ? 0.4744 0.4694 0.4598 -0.0174 -0.0601 0.0689  696 TYR A CE1   
3235 C CE2   . TYR A 404 ? 0.3692 0.3527 0.3440 -0.0238 -0.0665 0.0681  696 TYR A CE2   
3236 C CZ    . TYR A 404 ? 0.4213 0.4116 0.4008 -0.0188 -0.0623 0.0672  696 TYR A CZ    
3237 O OH    . TYR A 404 ? 0.4269 0.4192 0.4053 -0.0155 -0.0604 0.0646  696 TYR A OH    
3238 N N     . PHE A 405 ? 0.4711 0.4762 0.4756 -0.0261 -0.0628 0.0823  697 PHE A N     
3239 C CA    . PHE A 405 ? 0.4332 0.4467 0.4456 -0.0215 -0.0583 0.0836  697 PHE A CA    
3240 C C     . PHE A 405 ? 0.5726 0.5977 0.5969 -0.0228 -0.0576 0.0903  697 PHE A C     
3241 O O     . PHE A 405 ? 0.5568 0.5905 0.5885 -0.0186 -0.0537 0.0922  697 PHE A O     
3242 C CB    . PHE A 405 ? 0.4470 0.4550 0.4558 -0.0187 -0.0568 0.0806  697 PHE A CB    
3243 C CG    . PHE A 405 ? 0.4481 0.4490 0.4483 -0.0153 -0.0556 0.0748  697 PHE A CG    
3244 C CD1   . PHE A 405 ? 0.4819 0.4871 0.4845 -0.0107 -0.0524 0.0733  697 PHE A CD1   
3245 C CD2   . PHE A 405 ? 0.4216 0.4117 0.4112 -0.0167 -0.0578 0.0712  697 PHE A CD2   
3246 C CE1   . PHE A 405 ? 0.4690 0.4685 0.4642 -0.0079 -0.0516 0.0684  697 PHE A CE1   
3247 C CE2   . PHE A 405 ? 0.4887 0.4732 0.4707 -0.0134 -0.0566 0.0664  697 PHE A CE2   
3248 C CZ    . PHE A 405 ? 0.4967 0.4862 0.4819 -0.0092 -0.0536 0.0651  697 PHE A CZ    
3249 N N     . GLN A 406 ? 0.5526 0.5783 0.5788 -0.0286 -0.0614 0.0940  698 GLN A N     
3250 C CA    . GLN A 406 ? 0.5731 0.6112 0.6111 -0.0303 -0.0608 0.1011  698 GLN A CA    
3251 C C     . GLN A 406 ? 0.5386 0.5858 0.5820 -0.0293 -0.0592 0.1037  698 GLN A C     
3252 O O     . GLN A 406 ? 0.5184 0.5777 0.5721 -0.0276 -0.0563 0.1090  698 GLN A O     
3253 C CB    . GLN A 406 ? 0.7341 0.7711 0.7732 -0.0374 -0.0659 0.1048  698 GLN A CB    
3254 C CG    . GLN A 406 ? 0.8478 0.8798 0.8851 -0.0382 -0.0668 0.1041  698 GLN A CG    
3255 C CD    . GLN A 406 ? 1.0066 1.0356 1.0430 -0.0456 -0.0725 0.1069  698 GLN A CD    
3256 O OE1   . GLN A 406 ? 1.0795 1.1117 1.1184 -0.0504 -0.0757 0.1104  698 GLN A OE1   
3257 N NE2   . GLN A 406 ? 1.0383 1.0609 1.0709 -0.0467 -0.0740 0.1055  698 GLN A NE2   
3258 N N     . SER A 407 ? 0.4627 0.5040 0.4990 -0.0301 -0.0607 0.1001  699 SER A N     
3259 C CA    . SER A 407 ? 0.5121 0.5611 0.5523 -0.0290 -0.0592 0.1019  699 SER A CA    
3260 C C     . SER A 407 ? 0.4891 0.5426 0.5314 -0.0216 -0.0537 0.0997  699 SER A C     
3261 O O     . SER A 407 ? 0.5129 0.5765 0.5618 -0.0194 -0.0509 0.1028  699 SER A O     
3262 C CB    . SER A 407 ? 0.6377 0.6782 0.6692 -0.0321 -0.0627 0.0985  699 SER A CB    
3263 O OG    . SER A 407 ? 0.7111 0.7475 0.7408 -0.0391 -0.0680 0.1008  699 SER A OG    
3264 N N     . PHE A 408 ? 0.4583 0.5044 0.4949 -0.0179 -0.0523 0.0946  700 PHE A N     
3265 C CA    . PHE A 408 ? 0.3962 0.4455 0.4344 -0.0111 -0.0476 0.0924  700 PHE A CA    
3266 C C     . PHE A 408 ? 0.4481 0.4960 0.4879 -0.0080 -0.0455 0.0919  700 PHE A C     
3267 O O     . PHE A 408 ? 0.3935 0.4337 0.4270 -0.0057 -0.0450 0.0869  700 PHE A O     
3268 C CB    . PHE A 408 ? 0.4500 0.4917 0.4793 -0.0093 -0.0479 0.0861  700 PHE A CB    
3269 C CG    . PHE A 408 ? 0.4456 0.4864 0.4718 -0.0125 -0.0504 0.0859  700 PHE A CG    
3270 C CD1   . PHE A 408 ? 0.4263 0.4768 0.4586 -0.0115 -0.0486 0.0890  700 PHE A CD1   
3271 C CD2   . PHE A 408 ? 0.4889 0.5191 0.5059 -0.0163 -0.0544 0.0828  700 PHE A CD2   
3272 C CE1   . PHE A 408 ? 0.3775 0.4271 0.4071 -0.0148 -0.0511 0.0890  700 PHE A CE1   
3273 C CE2   . PHE A 408 ? 0.4829 0.5116 0.4969 -0.0191 -0.0569 0.0827  700 PHE A CE2   
3274 C CZ    . PHE A 408 ? 0.4633 0.5016 0.4837 -0.0187 -0.0554 0.0858  700 PHE A CZ    
3275 N N     . PRO A 409 ? 0.4127 0.4682 0.4610 -0.0081 -0.0441 0.0973  701 PRO A N     
3276 C CA    . PRO A 409 ? 0.3999 0.4542 0.4504 -0.0059 -0.0426 0.0976  701 PRO A CA    
3277 C C     . PRO A 409 ? 0.4237 0.4763 0.4732 0.0008  -0.0385 0.0941  701 PRO A C     
3278 O O     . PRO A 409 ? 0.4454 0.4915 0.4919 0.0017  -0.0386 0.0916  701 PRO A O     
3279 C CB    . PRO A 409 ? 0.4299 0.4957 0.4912 -0.0058 -0.0408 0.1049  701 PRO A CB    
3280 C CG    . PRO A 409 ? 0.4426 0.5137 0.5063 -0.0107 -0.0433 0.1085  701 PRO A CG    
3281 C CD    . PRO A 409 ? 0.3698 0.4368 0.4269 -0.0099 -0.0437 0.1039  701 PRO A CD    
3282 N N     . LYS A 410 ? 0.3559 0.4144 0.4082 0.0055  -0.0351 0.0940  702 LYS A N     
3283 C CA    . LYS A 410 ? 0.3771 0.4342 0.4290 0.0121  -0.0312 0.0909  702 LYS A CA    
3284 C C     . LYS A 410 ? 0.3959 0.4438 0.4392 0.0122  -0.0326 0.0846  702 LYS A C     
3285 O O     . LYS A 410 ? 0.3514 0.3964 0.3937 0.0165  -0.0303 0.0819  702 LYS A O     
3286 C CB    . LYS A 410 ? 0.3537 0.4200 0.4110 0.0178  -0.0266 0.0928  702 LYS A CB    
3287 C CG    . LYS A 410 ? 0.4790 0.5536 0.5446 0.0211  -0.0230 0.0982  702 LYS A CG    
3288 C CD    . LYS A 410 ? 0.5949 0.6769 0.6637 0.0281  -0.0176 0.0991  702 LYS A CD    
3289 C CE    . LYS A 410 ? 0.7120 0.8011 0.7877 0.0330  -0.0132 0.1040  702 LYS A CE    
3290 N NZ    . LYS A 410 ? 0.7876 0.8822 0.8646 0.0408  -0.0074 0.1039  702 LYS A NZ    
3291 N N     . VAL A 411 ? 0.3750 0.4182 0.4120 0.0076  -0.0363 0.0825  703 VAL A N     
3292 C CA    . VAL A 411 ? 0.4163 0.4509 0.4449 0.0076  -0.0377 0.0770  703 VAL A CA    
3293 C C     . VAL A 411 ? 0.3938 0.4212 0.4192 0.0067  -0.0387 0.0757  703 VAL A C     
3294 O O     . VAL A 411 ? 0.3346 0.3586 0.3578 0.0095  -0.0373 0.0728  703 VAL A O     
3295 C CB    . VAL A 411 ? 0.3748 0.4048 0.3963 0.0034  -0.0413 0.0750  703 VAL A CB    
3296 C CG1   . VAL A 411 ? 0.3713 0.3921 0.3836 0.0036  -0.0426 0.0697  703 VAL A CG1   
3297 C CG2   . VAL A 411 ? 0.3758 0.4124 0.3999 0.0045  -0.0403 0.0757  703 VAL A CG2   
3298 N N     . ARG A 412 ? 0.3486 0.3741 0.3741 0.0025  -0.0411 0.0780  704 ARG A N     
3299 C CA    . ARG A 412 ? 0.3525 0.3718 0.3753 0.0014  -0.0419 0.0772  704 ARG A CA    
3300 C C     . ARG A 412 ? 0.4351 0.4569 0.4636 0.0058  -0.0385 0.0782  704 ARG A C     
3301 O O     . ARG A 412 ? 0.3403 0.3564 0.3656 0.0067  -0.0382 0.0758  704 ARG A O     
3302 C CB    . ARG A 412 ? 0.5387 0.5569 0.5617 -0.0037 -0.0450 0.0801  704 ARG A CB    
3303 C CG    . ARG A 412 ? 0.6419 0.6539 0.6622 -0.0052 -0.0460 0.0795  704 ARG A CG    
3304 C CD    . ARG A 412 ? 0.7656 0.7749 0.7837 -0.0109 -0.0498 0.0813  704 ARG A CD    
3305 N NE    . ARG A 412 ? 0.8445 0.8446 0.8519 -0.0133 -0.0525 0.0774  704 ARG A NE    
3306 C CZ    . ARG A 412 ? 0.8395 0.8354 0.8428 -0.0181 -0.0562 0.0781  704 ARG A CZ    
3307 N NH1   . ARG A 412 ? 0.7668 0.7677 0.7766 -0.0215 -0.0580 0.0827  704 ARG A NH1   
3308 N NH2   . ARG A 412 ? 0.8371 0.8239 0.8299 -0.0192 -0.0583 0.0743  704 ARG A NH2   
3309 N N     . ALA A 413 ? 0.3688 0.3991 0.4056 0.0089  -0.0357 0.0818  705 ALA A N     
3310 C CA    . ALA A 413 ? 0.3949 0.4269 0.4366 0.0140  -0.0320 0.0827  705 ALA A CA    
3311 C C     . ALA A 413 ? 0.3830 0.4119 0.4219 0.0184  -0.0298 0.0786  705 ALA A C     
3312 O O     . ALA A 413 ? 0.3575 0.3817 0.3956 0.0204  -0.0278 0.0757  705 ALA A O     
3313 C CB    . ALA A 413 ? 0.3720 0.4137 0.4221 0.0173  -0.0289 0.0873  705 ALA A CB    
3314 N N     . TRP A 414 ? 0.3293 0.3604 0.3662 0.0192  -0.0297 0.0767  706 TRP A N     
3315 C CA    . TRP A 414 ? 0.3661 0.3933 0.3984 0.0216  -0.0263 0.0687  706 TRP A CA    
3316 C C     . TRP A 414 ? 0.3502 0.3688 0.3752 0.0187  -0.0277 0.0634  706 TRP A C     
3317 O O     . TRP A 414 ? 0.3322 0.3470 0.3552 0.0203  -0.0249 0.0581  706 TRP A O     
3318 C CB    . TRP A 414 ? 0.3125 0.3438 0.3437 0.0224  -0.0260 0.0674  706 TRP A CB    
3319 C CG    . TRP A 414 ? 0.3352 0.3627 0.3615 0.0243  -0.0229 0.0594  706 TRP A CG    
3320 C CD1   . TRP A 414 ? 0.3177 0.3455 0.3448 0.0287  -0.0183 0.0559  706 TRP A CD1   
3321 C CD2   . TRP A 414 ? 0.3237 0.3460 0.3430 0.0218  -0.0244 0.0542  706 TRP A CD2   
3322 N NE1   . TRP A 414 ? 0.3261 0.3495 0.3476 0.0284  -0.0173 0.0492  706 TRP A NE1   
3323 C CE2   . TRP A 414 ? 0.3114 0.3323 0.3287 0.0244  -0.0207 0.0482  706 TRP A CE2   
3324 C CE3   . TRP A 414 ? 0.3744 0.3929 0.3886 0.0179  -0.0285 0.0543  706 TRP A CE3   
3325 C CZ2   . TRP A 414 ? 0.3395 0.3568 0.3510 0.0231  -0.0210 0.0428  706 TRP A CZ2   
3326 C CZ3   . TRP A 414 ? 0.4028 0.4174 0.4107 0.0174  -0.0283 0.0486  706 TRP A CZ3   
3327 C CH2   . TRP A 414 ? 0.3316 0.3464 0.3389 0.0199  -0.0245 0.0432  706 TRP A CH2   
3328 N N     . ILE A 415 ? 0.2840 0.2996 0.3047 0.0144  -0.0322 0.0649  707 ILE A N     
3329 C CA    . ILE A 415 ? 0.3094 0.3174 0.3228 0.0121  -0.0334 0.0606  707 ILE A CA    
3330 C C     . ILE A 415 ? 0.2992 0.3041 0.3141 0.0122  -0.0321 0.0604  707 ILE A C     
3331 O O     . ILE A 415 ? 0.3160 0.3170 0.3277 0.0126  -0.0302 0.0555  707 ILE A O     
3332 C CB    . ILE A 415 ? 0.2980 0.3018 0.3054 0.0079  -0.0387 0.0633  707 ILE A CB    
3333 C CG1   . ILE A 415 ? 0.3146 0.3196 0.3186 0.0077  -0.0402 0.0624  707 ILE A CG1   
3334 C CG2   . ILE A 415 ? 0.3422 0.3383 0.3422 0.0063  -0.0396 0.0599  707 ILE A CG2   
3335 C CD1   . ILE A 415 ? 0.3774 0.3777 0.3752 0.0035  -0.0440 0.0630  707 ILE A CD1   
3336 N N     . GLU A 416 ? 0.3107 0.3178 0.3309 0.0118  -0.0333 0.0663  708 GLU A N     
3337 C CA    . GLU A 416 ? 0.3576 0.3616 0.3794 0.0116  -0.0327 0.0669  708 GLU A CA    
3338 C C     . GLU A 416 ? 0.3324 0.3362 0.3565 0.0156  -0.0280 0.0630  708 GLU A C     
3339 O O     . GLU A 416 ? 0.3485 0.3474 0.3702 0.0150  -0.0272 0.0598  708 GLU A O     
3340 C CB    . GLU A 416 ? 0.4291 0.4361 0.4564 0.0102  -0.0353 0.0747  708 GLU A CB    
3341 C CG    . GLU A 416 ? 0.5871 0.5913 0.6091 0.0047  -0.0391 0.0749  708 GLU A CG    
3342 C CD    . GLU A 416 ? 0.7318 0.7279 0.7448 0.0025  -0.0410 0.0714  708 GLU A CD    
3343 O OE1   . GLU A 416 ? 0.7141 0.7065 0.7264 0.0029  -0.0404 0.0707  708 GLU A OE1   
3344 O OE2   . GLU A 416 ? 0.7709 0.7639 0.7771 0.0004  -0.0430 0.0693  708 GLU A OE2   
3345 N N     . LYS A 417 ? 0.3443 0.3529 0.3724 0.0196  -0.0252 0.0633  709 LYS A N     
3346 C CA    . LYS A 417 ? 0.3631 0.3700 0.3918 0.0238  -0.0210 0.0596  709 LYS A CA    
3347 C C     . LYS A 417 ? 0.2798 0.2822 0.3024 0.0230  -0.0199 0.0524  709 LYS A C     
3348 O O     . LYS A 417 ? 0.3034 0.3009 0.3240 0.0238  -0.0182 0.0490  709 LYS A O     
3349 C CB    . LYS A 417 ? 0.4643 0.4771 0.4971 0.0286  -0.0181 0.0614  709 LYS A CB    
3350 C CG    . LYS A 417 ? 0.6938 0.7030 0.7253 0.0333  -0.0139 0.0573  709 LYS A CG    
3351 C CD    . LYS A 417 ? 0.9280 0.9425 0.9615 0.0384  -0.0107 0.0580  709 LYS A CD    
3352 C CE    . LYS A 417 ? 1.0711 1.0795 1.1008 0.0432  -0.0068 0.0534  709 LYS A CE    
3353 N NZ    . LYS A 417 ? 1.1160 1.1286 1.1460 0.0485  -0.0034 0.0534  709 LYS A NZ    
3354 N N     . THR A 418 ? 0.2632 0.2673 0.2827 0.0213  -0.0211 0.0506  710 THR A N     
3355 C CA    . THR A 418 ? 0.2385 0.2397 0.2526 0.0205  -0.0203 0.0446  710 THR A CA    
3356 C C     . THR A 418 ? 0.3165 0.3131 0.3272 0.0174  -0.0216 0.0432  710 THR A C     
3357 O O     . THR A 418 ? 0.2782 0.2720 0.2866 0.0173  -0.0202 0.0393  710 THR A O     
3358 C CB    . THR A 418 ? 0.2983 0.3025 0.3098 0.0197  -0.0215 0.0437  710 THR A CB    
3359 O OG1   . THR A 418 ? 0.3290 0.3381 0.3439 0.0226  -0.0200 0.0450  710 THR A OG1   
3360 C CG2   . THR A 418 ? 0.3240 0.3261 0.3304 0.0189  -0.0207 0.0380  710 THR A CG2   
3361 N N     . LEU A 419 ? 0.3048 0.3004 0.3150 0.0149  -0.0244 0.0467  711 LEU A N     
3362 C CA    . LEU A 419 ? 0.2800 0.2715 0.2867 0.0122  -0.0255 0.0457  711 LEU A CA    
3363 C C     . LEU A 419 ? 0.3074 0.2963 0.3169 0.0126  -0.0243 0.0461  711 LEU A C     
3364 O O     . LEU A 419 ? 0.2806 0.2667 0.2876 0.0112  -0.0237 0.0435  711 LEU A O     
3365 C CB    . LEU A 419 ? 0.2977 0.2876 0.3017 0.0094  -0.0290 0.0492  711 LEU A CB    
3366 C CG    . LEU A 419 ? 0.3435 0.3336 0.3424 0.0088  -0.0308 0.0485  711 LEU A CG    
3367 C CD1   . LEU A 419 ? 0.3628 0.3490 0.3573 0.0059  -0.0348 0.0522  711 LEU A CD1   
3368 C CD2   . LEU A 419 ? 0.3517 0.3414 0.3458 0.0094  -0.0290 0.0432  711 LEU A CD2   
3369 N N     . GLU A 420 ? 0.3021 0.2920 0.3167 0.0145  -0.0239 0.0497  712 GLU A N     
3370 C CA    . GLU A 420 ? 0.3136 0.3001 0.3304 0.0153  -0.0229 0.0503  712 GLU A CA    
3371 C C     . GLU A 420 ? 0.3185 0.3017 0.3329 0.0169  -0.0204 0.0453  712 GLU A C     
3372 O O     . GLU A 420 ? 0.3057 0.2845 0.3181 0.0152  -0.0206 0.0437  712 GLU A O     
3373 C CB    . GLU A 420 ? 0.3653 0.3543 0.3881 0.0182  -0.0225 0.0554  712 GLU A CB    
3374 C CG    . GLU A 420 ? 0.3785 0.3633 0.4032 0.0200  -0.0213 0.0561  712 GLU A CG    
3375 C CD    . GLU A 420 ? 0.5802 0.5685 0.6112 0.0232  -0.0208 0.0621  712 GLU A CD    
3376 O OE1   . GLU A 420 ? 0.7430 0.7378 0.7775 0.0236  -0.0215 0.0659  712 GLU A OE1   
3377 O OE2   . GLU A 420 ? 0.6447 0.6295 0.6774 0.0253  -0.0198 0.0633  712 GLU A OE2   
3378 N N     . GLU A 421 ? 0.3139 0.2990 0.3282 0.0199  -0.0184 0.0431  713 GLU A N     
3379 C CA    . GLU A 421 ? 0.3255 0.3067 0.3364 0.0211  -0.0165 0.0384  713 GLU A CA    
3380 C C     . GLU A 421 ? 0.2856 0.2661 0.2922 0.0174  -0.0174 0.0348  713 GLU A C     
3381 O O     . GLU A 421 ? 0.3396 0.3156 0.3435 0.0162  -0.0173 0.0323  713 GLU A O     
3382 C CB    . GLU A 421 ? 0.3679 0.3515 0.3791 0.0252  -0.0142 0.0371  713 GLU A CB    
3383 C CG    . GLU A 421 ? 0.3978 0.3761 0.4044 0.0266  -0.0125 0.0324  713 GLU A CG    
3384 C CD    . GLU A 421 ? 0.6104 0.5903 0.6167 0.0313  -0.0099 0.0314  713 GLU A CD    
3385 O OE1   . GLU A 421 ? 0.6815 0.6680 0.6920 0.0333  -0.0094 0.0348  713 GLU A OE1   
3386 O OE2   . GLU A 421 ? 0.4948 0.4695 0.4962 0.0327  -0.0086 0.0276  713 GLU A OE2   
3387 N N     . GLY A 422 ? 0.2772 0.2619 0.2829 0.0156  -0.0186 0.0349  714 GLY A N     
3388 C CA    . GLY A 422 ? 0.2813 0.2666 0.2834 0.0128  -0.0191 0.0323  714 GLY A CA    
3389 C C     . GLY A 422 ? 0.2711 0.2539 0.2721 0.0097  -0.0203 0.0333  714 GLY A C     
3390 O O     . GLY A 422 ? 0.2829 0.2654 0.2817 0.0077  -0.0203 0.0314  714 GLY A O     
3391 N N     . ARG A 423 ? 0.2699 0.2515 0.2728 0.0091  -0.0216 0.0369  715 ARG A N     
3392 C CA    . ARG A 423 ? 0.3187 0.2977 0.3209 0.0063  -0.0228 0.0383  715 ARG A CA    
3393 C C     . ARG A 423 ? 0.3412 0.3156 0.3437 0.0061  -0.0222 0.0370  715 ARG A C     
3394 O O     . ARG A 423 ? 0.3301 0.3032 0.3309 0.0031  -0.0229 0.0365  715 ARG A O     
3395 C CB    . ARG A 423 ? 0.3440 0.3220 0.3482 0.0058  -0.0245 0.0426  715 ARG A CB    
3396 C CG    . ARG A 423 ? 0.3150 0.2951 0.3167 0.0049  -0.0260 0.0442  715 ARG A CG    
3397 C CD    . ARG A 423 ? 0.3608 0.3399 0.3649 0.0043  -0.0282 0.0491  715 ARG A CD    
3398 N NE    . ARG A 423 ? 0.3580 0.3377 0.3586 0.0034  -0.0303 0.0506  715 ARG A NE    
3399 C CZ    . ARG A 423 ? 0.3311 0.3120 0.3339 0.0037  -0.0320 0.0542  715 ARG A CZ    
3400 N NH1   . ARG A 423 ? 0.3669 0.3499 0.3762 0.0055  -0.0313 0.0568  715 ARG A NH1   
3401 N NH2   . ARG A 423 ? 0.4407 0.4206 0.4387 0.0024  -0.0346 0.0554  715 ARG A NH2   
3402 N N     . ARG A 424 ? 0.3458 0.3177 0.3500 0.0093  -0.0211 0.0367  716 ARG A N     
3403 C CA    . ARG A 424 ? 0.3616 0.3269 0.3644 0.0097  -0.0208 0.0352  716 ARG A CA    
3404 C C     . ARG A 424 ? 0.3859 0.3500 0.3847 0.0081  -0.0206 0.0314  716 ARG A C     
3405 O O     . ARG A 424 ? 0.3606 0.3208 0.3571 0.0051  -0.0219 0.0308  716 ARG A O     
3406 C CB    . ARG A 424 ? 0.3215 0.2837 0.3261 0.0145  -0.0192 0.0361  716 ARG A CB    
3407 C CG    . ARG A 424 ? 0.5123 0.4657 0.5128 0.0158  -0.0188 0.0336  716 ARG A CG    
3408 C CD    . ARG A 424 ? 0.5075 0.4568 0.5089 0.0217  -0.0168 0.0348  716 ARG A CD    
3409 N NE    . ARG A 424 ? 0.5206 0.4758 0.5246 0.0261  -0.0145 0.0355  716 ARG A NE    
3410 C CZ    . ARG A 424 ? 0.5174 0.4715 0.5184 0.0292  -0.0125 0.0325  716 ARG A CZ    
3411 N NH1   . ARG A 424 ? 0.4880 0.4347 0.4824 0.0283  -0.0128 0.0284  716 ARG A NH1   
3412 N NH2   . ARG A 424 ? 0.4820 0.4426 0.4861 0.0330  -0.0105 0.0340  716 ARG A NH2   
3413 N N     . ARG A 425 ? 0.3009 0.2687 0.2989 0.0098  -0.0193 0.0291  717 ARG A N     
3414 C CA    . ARG A 425 ? 0.3496 0.3163 0.3440 0.0086  -0.0192 0.0256  717 ARG A CA    
3415 C C     . ARG A 425 ? 0.3487 0.3211 0.3422 0.0047  -0.0202 0.0252  717 ARG A C     
3416 O O     . ARG A 425 ? 0.3586 0.3299 0.3496 0.0021  -0.0210 0.0236  717 ARG A O     
3417 C CB    . ARG A 425 ? 0.3893 0.3572 0.3831 0.0124  -0.0173 0.0235  717 ARG A CB    
3418 C CG    . ARG A 425 ? 0.3778 0.3403 0.3714 0.0171  -0.0158 0.0237  717 ARG A CG    
3419 C CD    . ARG A 425 ? 0.4141 0.3779 0.4061 0.0205  -0.0138 0.0212  717 ARG A CD    
3420 N NE    . ARG A 425 ? 0.5480 0.5099 0.5410 0.0261  -0.0116 0.0224  717 ARG A NE    
3421 C CZ    . ARG A 425 ? 0.5920 0.5454 0.5808 0.0294  -0.0105 0.0211  717 ARG A CZ    
3422 N NH1   . ARG A 425 ? 0.4693 0.4140 0.4520 0.0267  -0.0121 0.0184  717 ARG A NH1   
3423 N NH2   . ARG A 425 ? 0.3783 0.3314 0.3683 0.0354  -0.0079 0.0227  717 ARG A NH2   
3424 N N     . GLY A 426 ? 0.3180 0.2963 0.3133 0.0045  -0.0201 0.0269  718 GLY A N     
3425 C CA    . GLY A 426 ? 0.2831 0.2671 0.2771 0.0021  -0.0204 0.0268  718 GLY A CA    
3426 C C     . GLY A 426 ? 0.3282 0.3170 0.3214 0.0040  -0.0193 0.0247  718 GLY A C     
3427 O O     . GLY A 426 ? 0.2986 0.2927 0.2907 0.0031  -0.0192 0.0246  718 GLY A O     
3428 N N     . TYR A 427 ? 0.2819 0.2691 0.2757 0.0069  -0.0184 0.0234  719 TYR A N     
3429 C CA    . TYR A 427 ? 0.2783 0.2697 0.2714 0.0086  -0.0175 0.0215  719 TYR A CA    
3430 C C     . TYR A 427 ? 0.2647 0.2556 0.2594 0.0120  -0.0168 0.0219  719 TYR A C     
3431 O O     . TYR A 427 ? 0.2740 0.2614 0.2705 0.0134  -0.0166 0.0234  719 TYR A O     
3432 C CB    . TYR A 427 ? 0.2941 0.2851 0.2852 0.0075  -0.0173 0.0187  719 TYR A CB    
3433 C CG    . TYR A 427 ? 0.3147 0.2987 0.3045 0.0086  -0.0171 0.0172  719 TYR A CG    
3434 C CD1   . TYR A 427 ? 0.3207 0.3037 0.3104 0.0122  -0.0156 0.0159  719 TYR A CD1   
3435 C CD2   . TYR A 427 ? 0.4221 0.4000 0.4100 0.0061  -0.0183 0.0173  719 TYR A CD2   
3436 C CE1   . TYR A 427 ? 0.4304 0.4063 0.4176 0.0142  -0.0150 0.0145  719 TYR A CE1   
3437 C CE2   . TYR A 427 ? 0.4248 0.3945 0.4098 0.0077  -0.0181 0.0157  719 TYR A CE2   
3438 C CZ    . TYR A 427 ? 0.5119 0.4805 0.4963 0.0121  -0.0162 0.0143  719 TYR A CZ    
3439 O OH    . TYR A 427 ? 0.5692 0.5291 0.5495 0.0147  -0.0156 0.0127  719 TYR A OH    
3440 N N     . VAL A 428 ? 0.2633 0.2583 0.2576 0.0134  -0.0164 0.0211  720 VAL A N     
3441 C CA    . VAL A 428 ? 0.2474 0.2432 0.2434 0.0163  -0.0157 0.0216  720 VAL A CA    
3442 C C     . VAL A 428 ? 0.2338 0.2311 0.2283 0.0175  -0.0146 0.0186  720 VAL A C     
3443 O O     . VAL A 428 ? 0.2630 0.2611 0.2553 0.0157  -0.0147 0.0163  720 VAL A O     
3444 C CB    . VAL A 428 ? 0.2205 0.2192 0.2171 0.0166  -0.0170 0.0242  720 VAL A CB    
3445 C CG1   . VAL A 428 ? 0.2835 0.2798 0.2813 0.0155  -0.0183 0.0276  720 VAL A CG1   
3446 C CG2   . VAL A 428 ? 0.2545 0.2558 0.2477 0.0156  -0.0177 0.0229  720 VAL A CG2   
3447 N N     . GLU A 429 ? 0.2578 0.2557 0.2537 0.0204  -0.0135 0.0189  721 GLU A N     
3448 C CA    A GLU A 429 ? 0.2747 0.2731 0.2687 0.0219  -0.0122 0.0160  721 GLU A CA    
3449 C CA    B GLU A 429 ? 0.2724 0.2710 0.2664 0.0217  -0.0123 0.0160  721 GLU A CA    
3450 C C     . GLU A 429 ? 0.2802 0.2832 0.2759 0.0241  -0.0118 0.0172  721 GLU A C     
3451 O O     . GLU A 429 ? 0.3054 0.3102 0.3042 0.0254  -0.0121 0.0207  721 GLU A O     
3452 C CB    A GLU A 429 ? 0.2803 0.2728 0.2728 0.0238  -0.0107 0.0147  721 GLU A CB    
3453 C CB    B GLU A 429 ? 0.2880 0.2805 0.2800 0.0232  -0.0109 0.0143  721 GLU A CB    
3454 C CG    A GLU A 429 ? 0.2750 0.2616 0.2642 0.0211  -0.0116 0.0129  721 GLU A CG    
3455 C CG    B GLU A 429 ? 0.2371 0.2275 0.2314 0.0265  -0.0097 0.0170  721 GLU A CG    
3456 C CD    A GLU A 429 ? 0.4299 0.4087 0.4154 0.0233  -0.0105 0.0112  721 GLU A CD    
3457 C CD    B GLU A 429 ? 0.4239 0.4067 0.4146 0.0288  -0.0082 0.0151  721 GLU A CD    
3458 O OE1   A GLU A 429 ? 0.4901 0.4682 0.4760 0.0277  -0.0084 0.0118  721 GLU A OE1   
3459 O OE1   B GLU A 429 ? 0.4684 0.4459 0.4547 0.0263  -0.0092 0.0123  721 GLU A OE1   
3460 O OE2   A GLU A 429 ? 0.4116 0.3845 0.3930 0.0206  -0.0117 0.0093  721 GLU A OE2   
3461 O OE2   B GLU A 429 ? 0.4514 0.4334 0.4432 0.0332  -0.0062 0.0166  721 GLU A OE2   
3462 N N     . THR A 430 ? 0.2455 0.2506 0.2392 0.0244  -0.0113 0.0147  722 THR A N     
3463 C CA    . THR A 430 ? 0.2101 0.2195 0.2051 0.0266  -0.0108 0.0157  722 THR A CA    
3464 C C     . THR A 430 ? 0.3011 0.3088 0.2964 0.0302  -0.0084 0.0157  722 THR A C     
3465 O O     . THR A 430 ? 0.2960 0.2981 0.2896 0.0310  -0.0073 0.0145  722 THR A O     
3466 C CB    . THR A 430 ? 0.2164 0.2284 0.2089 0.0257  -0.0111 0.0128  722 THR A CB    
3467 O OG1   . THR A 430 ? 0.2576 0.2662 0.2470 0.0258  -0.0099 0.0095  722 THR A OG1   
3468 C CG2   . THR A 430 ? 0.2322 0.2456 0.2234 0.0230  -0.0130 0.0125  722 THR A CG2   
3469 N N     . LEU A 431 ? 0.2561 0.2684 0.2531 0.0325  -0.0075 0.0172  723 LEU A N     
3470 C CA    . LEU A 431 ? 0.2452 0.2571 0.2420 0.0369  -0.0046 0.0176  723 LEU A CA    
3471 C C     . LEU A 431 ? 0.3237 0.3289 0.3145 0.0377  -0.0031 0.0128  723 LEU A C     
3472 O O     . LEU A 431 ? 0.2976 0.2979 0.2862 0.0412  -0.0009 0.0125  723 LEU A O     
3473 C CB    . LEU A 431 ? 0.3008 0.3199 0.2999 0.0385  -0.0042 0.0198  723 LEU A CB    
3474 C CG    . LEU A 431 ? 0.3193 0.3401 0.3188 0.0437  -0.0008 0.0212  723 LEU A CG    
3475 C CD1   . LEU A 431 ? 0.4045 0.4255 0.4078 0.0467  0.0006  0.0255  723 LEU A CD1   
3476 C CD2   . LEU A 431 ? 0.3882 0.4172 0.3902 0.0443  -0.0009 0.0238  723 LEU A CD2   
3477 N N     . PHE A 432 ? 0.3036 0.3083 0.2913 0.0346  -0.0045 0.0095  724 PHE A N     
3478 C CA    . PHE A 432 ? 0.2434 0.2417 0.2249 0.0343  -0.0040 0.0054  724 PHE A CA    
3479 C C     . PHE A 432 ? 0.2986 0.2903 0.2776 0.0312  -0.0055 0.0039  724 PHE A C     
3480 O O     . PHE A 432 ? 0.3638 0.3490 0.3370 0.0301  -0.0058 0.0009  724 PHE A O     
3481 C CB    . PHE A 432 ? 0.2618 0.2636 0.2415 0.0321  -0.0049 0.0031  724 PHE A CB    
3482 C CG    . PHE A 432 ? 0.3536 0.3609 0.3345 0.0349  -0.0036 0.0040  724 PHE A CG    
3483 C CD1   . PHE A 432 ? 0.4109 0.4186 0.3925 0.0396  -0.0009 0.0059  724 PHE A CD1   
3484 C CD2   . PHE A 432 ? 0.5130 0.5253 0.4941 0.0330  -0.0048 0.0031  724 PHE A CD2   
3485 C CE1   . PHE A 432 ? 0.4556 0.4693 0.4385 0.0420  0.0003  0.0073  724 PHE A CE1   
3486 C CE2   . PHE A 432 ? 0.4939 0.5113 0.4759 0.0352  -0.0038 0.0042  724 PHE A CE2   
3487 C CZ    . PHE A 432 ? 0.4864 0.5048 0.4695 0.0395  -0.0013 0.0064  724 PHE A CZ    
3488 N N     . GLY A 433 ? 0.2671 0.2602 0.2499 0.0294  -0.0067 0.0062  725 GLY A N     
3489 C CA    . GLY A 433 ? 0.2764 0.2640 0.2573 0.0264  -0.0081 0.0055  725 GLY A CA    
3490 C C     . GLY A 433 ? 0.3228 0.3134 0.3039 0.0216  -0.0103 0.0049  725 GLY A C     
3491 O O     . GLY A 433 ? 0.2968 0.2834 0.2760 0.0186  -0.0117 0.0045  725 GLY A O     
3492 N N     . ARG A 434 ? 0.2875 0.2853 0.2706 0.0211  -0.0107 0.0052  726 ARG A N     
3493 C CA    . ARG A 434 ? 0.2576 0.2595 0.2414 0.0177  -0.0123 0.0054  726 ARG A CA    
3494 C C     . ARG A 434 ? 0.2869 0.2888 0.2731 0.0168  -0.0130 0.0080  726 ARG A C     
3495 O O     . ARG A 434 ? 0.2540 0.2563 0.2425 0.0188  -0.0126 0.0100  726 ARG A O     
3496 C CB    . ARG A 434 ? 0.2356 0.2442 0.2204 0.0183  -0.0125 0.0054  726 ARG A CB    
3497 C CG    . ARG A 434 ? 0.2903 0.3033 0.2752 0.0158  -0.0136 0.0056  726 ARG A CG    
3498 C CD    . ARG A 434 ? 0.2817 0.3002 0.2667 0.0170  -0.0138 0.0056  726 ARG A CD    
3499 N NE    . ARG A 434 ? 0.3056 0.3247 0.2894 0.0178  -0.0133 0.0037  726 ARG A NE    
3500 C CZ    . ARG A 434 ? 0.3447 0.3652 0.3269 0.0161  -0.0137 0.0020  726 ARG A CZ    
3501 N NH1   . ARG A 434 ? 0.3301 0.3522 0.3123 0.0133  -0.0146 0.0024  726 ARG A NH1   
3502 N NH2   . ARG A 434 ? 0.3324 0.3530 0.3131 0.0169  -0.0133 0.0003  726 ARG A NH2   
3503 N N     . ARG A 435 ? 0.2199 0.2217 0.2056 0.0136  -0.0141 0.0083  727 ARG A N     
3504 C CA    . ARG A 435 ? 0.2474 0.2484 0.2347 0.0124  -0.0147 0.0106  727 ARG A CA    
3505 C C     . ARG A 435 ? 0.3366 0.3433 0.3246 0.0114  -0.0152 0.0121  727 ARG A C     
3506 O O     . ARG A 435 ? 0.3414 0.3525 0.3287 0.0102  -0.0154 0.0114  727 ARG A O     
3507 C CB    . ARG A 435 ? 0.3152 0.3114 0.3010 0.0095  -0.0157 0.0105  727 ARG A CB    
3508 C CG    . ARG A 435 ? 0.4419 0.4301 0.4263 0.0108  -0.0154 0.0100  727 ARG A CG    
3509 C CD    . ARG A 435 ? 0.4211 0.4036 0.4027 0.0072  -0.0171 0.0098  727 ARG A CD    
3510 N NE    . ARG A 435 ? 0.5144 0.4873 0.4919 0.0091  -0.0168 0.0081  727 ARG A NE    
3511 C CZ    . ARG A 435 ? 0.5778 0.5428 0.5504 0.0064  -0.0187 0.0071  727 ARG A CZ    
3512 N NH1   . ARG A 435 ? 0.5325 0.4993 0.5049 0.0011  -0.0211 0.0082  727 ARG A NH1   
3513 N NH2   . ARG A 435 ? 0.5522 0.5074 0.5198 0.0091  -0.0182 0.0054  727 ARG A NH2   
3514 N N     . ARG A 436 ? 0.2487 0.2552 0.2378 0.0120  -0.0155 0.0143  728 ARG A N     
3515 C CA    . ARG A 436 ? 0.2420 0.2521 0.2303 0.0111  -0.0159 0.0158  728 ARG A CA    
3516 C C     . ARG A 436 ? 0.2536 0.2608 0.2426 0.0094  -0.0164 0.0179  728 ARG A C     
3517 O O     . ARG A 436 ? 0.2716 0.2748 0.2617 0.0102  -0.0167 0.0191  728 ARG A O     
3518 C CB    . ARG A 436 ? 0.2811 0.2925 0.2680 0.0135  -0.0161 0.0166  728 ARG A CB    
3519 C CG    . ARG A 436 ? 0.3506 0.3648 0.3349 0.0136  -0.0162 0.0178  728 ARG A CG    
3520 C CD    . ARG A 436 ? 0.3327 0.3460 0.3133 0.0159  -0.0169 0.0185  728 ARG A CD    
3521 N NE    . ARG A 436 ? 0.3682 0.3837 0.3451 0.0169  -0.0164 0.0192  728 ARG A NE    
3522 C CZ    . ARG A 436 ? 0.4071 0.4205 0.3786 0.0191  -0.0171 0.0199  728 ARG A CZ    
3523 N NH1   . ARG A 436 ? 0.3508 0.3597 0.3202 0.0199  -0.0189 0.0201  728 ARG A NH1   
3524 N NH2   . ARG A 436 ? 0.4268 0.4423 0.3944 0.0207  -0.0161 0.0205  728 ARG A NH2   
3525 N N     . TYR A 437 ? 0.3177 0.3277 0.3064 0.0071  -0.0166 0.0188  729 TYR A N     
3526 C CA    . TYR A 437 ? 0.2891 0.2969 0.2784 0.0051  -0.0173 0.0210  729 TYR A CA    
3527 C C     . TYR A 437 ? 0.2943 0.3028 0.2821 0.0064  -0.0173 0.0230  729 TYR A C     
3528 O O     . TYR A 437 ? 0.3540 0.3663 0.3395 0.0080  -0.0167 0.0231  729 TYR A O     
3529 C CB    . TYR A 437 ? 0.3014 0.3124 0.2910 0.0016  -0.0178 0.0219  729 TYR A CB    
3530 C CG    . TYR A 437 ? 0.2995 0.3062 0.2891 -0.0005 -0.0187 0.0204  729 TYR A CG    
3531 C CD1   . TYR A 437 ? 0.3976 0.4056 0.3863 -0.0004 -0.0187 0.0182  729 TYR A CD1   
3532 C CD2   . TYR A 437 ? 0.3520 0.3519 0.3415 -0.0024 -0.0199 0.0210  729 TYR A CD2   
3533 C CE1   . TYR A 437 ? 0.3489 0.3512 0.3360 -0.0023 -0.0198 0.0166  729 TYR A CE1   
3534 C CE2   . TYR A 437 ? 0.3923 0.3862 0.3801 -0.0040 -0.0211 0.0193  729 TYR A CE2   
3535 C CZ    . TYR A 437 ? 0.3986 0.3933 0.3847 -0.0039 -0.0210 0.0171  729 TYR A CZ    
3536 O OH    . TYR A 437 ? 0.4038 0.3908 0.3865 -0.0055 -0.0224 0.0154  729 TYR A OH    
3537 N N     . VAL A 438 ? 0.3039 0.3079 0.2924 0.0059  -0.0180 0.0246  730 VAL A N     
3538 C CA    . VAL A 438 ? 0.3453 0.3482 0.3315 0.0068  -0.0186 0.0267  730 VAL A CA    
3539 C C     . VAL A 438 ? 0.3395 0.3403 0.3263 0.0045  -0.0193 0.0290  730 VAL A C     
3540 O O     . VAL A 438 ? 0.3445 0.3409 0.3322 0.0043  -0.0203 0.0306  730 VAL A O     
3541 C CB    . VAL A 438 ? 0.3397 0.3393 0.3259 0.0088  -0.0194 0.0270  730 VAL A CB    
3542 C CG1   . VAL A 438 ? 0.3760 0.3779 0.3598 0.0110  -0.0192 0.0254  730 VAL A CG1   
3543 C CG2   . VAL A 438 ? 0.4219 0.4187 0.4121 0.0089  -0.0194 0.0268  730 VAL A CG2   
3544 N N     . PRO A 439 ? 0.3714 0.3759 0.3578 0.0026  -0.0188 0.0299  731 PRO A N     
3545 C CA    . PRO A 439 ? 0.3799 0.3831 0.3671 -0.0001 -0.0196 0.0323  731 PRO A CA    
3546 C C     . PRO A 439 ? 0.4053 0.4062 0.3895 0.0006  -0.0200 0.0344  731 PRO A C     
3547 O O     . PRO A 439 ? 0.4082 0.4060 0.3935 -0.0014 -0.0211 0.0364  731 PRO A O     
3548 C CB    . PRO A 439 ? 0.3889 0.3987 0.3763 -0.0021 -0.0189 0.0331  731 PRO A CB    
3549 C CG    . PRO A 439 ? 0.4434 0.4584 0.4286 0.0008  -0.0174 0.0319  731 PRO A CG    
3550 C CD    . PRO A 439 ? 0.3556 0.3668 0.3411 0.0029  -0.0176 0.0291  731 PRO A CD    
3551 N N     . ASP A 440 ? 0.3639 0.3653 0.3438 0.0033  -0.0196 0.0341  732 ASP A N     
3552 C CA    . ASP A 440 ? 0.3726 0.3704 0.3480 0.0039  -0.0205 0.0361  732 ASP A CA    
3553 C C     . ASP A 440 ? 0.3346 0.3260 0.3110 0.0034  -0.0227 0.0371  732 ASP A C     
3554 O O     . ASP A 440 ? 0.3787 0.3661 0.3511 0.0032  -0.0241 0.0391  732 ASP A O     
3555 C CB    . ASP A 440 ? 0.4580 0.4567 0.4264 0.0071  -0.0196 0.0355  732 ASP A CB    
3556 C CG    . ASP A 440 ? 0.5984 0.6037 0.5649 0.0079  -0.0174 0.0363  732 ASP A CG    
3557 O OD1   . ASP A 440 ? 0.5397 0.5488 0.5102 0.0051  -0.0170 0.0378  732 ASP A OD1   
3558 O OD2   . ASP A 440 ? 0.5432 0.5502 0.5041 0.0114  -0.0161 0.0357  732 ASP A OD2   
3559 N N     . LEU A 441 ? 0.3401 0.3307 0.3216 0.0033  -0.0229 0.0363  733 LEU A N     
3560 C CA    . LEU A 441 ? 0.3326 0.3188 0.3165 0.0029  -0.0247 0.0383  733 LEU A CA    
3561 C C     . LEU A 441 ? 0.3594 0.3429 0.3442 0.0005  -0.0257 0.0410  733 LEU A C     
3562 O O     . LEU A 441 ? 0.3525 0.3326 0.3376 -0.0001 -0.0276 0.0436  733 LEU A O     
3563 C CB    . LEU A 441 ? 0.2865 0.2730 0.2758 0.0038  -0.0241 0.0371  733 LEU A CB    
3564 C CG    . LEU A 441 ? 0.3178 0.3063 0.3068 0.0062  -0.0236 0.0353  733 LEU A CG    
3565 C CD1   . LEU A 441 ? 0.3722 0.3607 0.3661 0.0075  -0.0228 0.0348  733 LEU A CD1   
3566 C CD2   . LEU A 441 ? 0.3702 0.3571 0.3556 0.0067  -0.0255 0.0370  733 LEU A CD2   
3567 N N     . GLU A 442 ? 0.3437 0.3292 0.3291 -0.0012 -0.0248 0.0407  734 GLU A N     
3568 C CA    . GLU A 442 ? 0.3965 0.3796 0.3825 -0.0037 -0.0259 0.0434  734 GLU A CA    
3569 C C     . GLU A 442 ? 0.4735 0.4578 0.4541 -0.0045 -0.0258 0.0449  734 GLU A C     
3570 O O     . GLU A 442 ? 0.4538 0.4373 0.4346 -0.0068 -0.0264 0.0470  734 GLU A O     
3571 C CB    . GLU A 442 ? 0.5520 0.5351 0.5422 -0.0057 -0.0256 0.0430  734 GLU A CB    
3572 C CG    . GLU A 442 ? 0.6794 0.6591 0.6738 -0.0044 -0.0258 0.0421  734 GLU A CG    
3573 C CD    . GLU A 442 ? 0.8466 0.8242 0.8429 -0.0059 -0.0258 0.0411  734 GLU A CD    
3574 O OE1   . GLU A 442 ? 0.8425 0.8231 0.8375 -0.0076 -0.0253 0.0399  734 GLU A OE1   
3575 O OE2   . GLU A 442 ? 0.9384 0.9110 0.9370 -0.0054 -0.0264 0.0419  734 GLU A OE2   
3576 N N     . ALA A 443 ? 0.4171 0.4026 0.3921 -0.0021 -0.0251 0.0438  735 ALA A N     
3577 C CA    . ALA A 443 ? 0.4541 0.4401 0.4223 -0.0017 -0.0245 0.0451  735 ALA A CA    
3578 C C     . ALA A 443 ? 0.4944 0.4739 0.4588 -0.0029 -0.0269 0.0478  735 ALA A C     
3579 O O     . ALA A 443 ? 0.4670 0.4419 0.4323 -0.0032 -0.0291 0.0485  735 ALA A O     
3580 C CB    . ALA A 443 ? 0.4285 0.4161 0.3907 0.0019  -0.0232 0.0432  735 ALA A CB    
3581 N N     . ARG A 444 ? 0.5088 0.4885 0.4691 -0.0038 -0.0265 0.0497  736 ARG A N     
3582 C CA    . ARG A 444 ? 0.5267 0.4998 0.4826 -0.0052 -0.0290 0.0523  736 ARG A CA    
3583 C C     . ARG A 444 ? 0.4654 0.4331 0.4104 -0.0027 -0.0298 0.0520  736 ARG A C     
3584 O O     . ARG A 444 ? 0.5495 0.5100 0.4907 -0.0039 -0.0329 0.0538  736 ARG A O     
3585 C CB    . ARG A 444 ? 0.5685 0.5433 0.5245 -0.0077 -0.0285 0.0548  736 ARG A CB    
3586 C CG    . ARG A 444 ? 0.5695 0.5462 0.5349 -0.0110 -0.0291 0.0558  736 ARG A CG    
3587 C CD    . ARG A 444 ? 0.6738 0.6495 0.6386 -0.0140 -0.0301 0.0590  736 ARG A CD    
3588 N NE    . ARG A 444 ? 0.7397 0.7170 0.7123 -0.0170 -0.0306 0.0598  736 ARG A NE    
3589 C CZ    . ARG A 444 ? 0.9445 0.9216 0.9182 -0.0202 -0.0316 0.0627  736 ARG A CZ    
3590 N NH1   . ARG A 444 ? 1.0154 0.9912 0.9830 -0.0207 -0.0319 0.0649  736 ARG A NH1   
3591 N NH2   . ARG A 444 ? 1.0214 0.9987 1.0015 -0.0229 -0.0324 0.0632  736 ARG A NH2   
3592 N N     . VAL A 445 ? 0.5000 0.4706 0.4396 0.0008  -0.0272 0.0502  737 VAL A N     
3593 C CA    . VAL A 445 ? 0.5422 0.5062 0.4699 0.0040  -0.0279 0.0494  737 VAL A CA    
3594 C C     . VAL A 445 ? 0.5549 0.5143 0.4831 0.0041  -0.0306 0.0483  737 VAL A C     
3595 O O     . VAL A 445 ? 0.5166 0.4809 0.4512 0.0049  -0.0295 0.0463  737 VAL A O     
3596 C CB    . VAL A 445 ? 0.5389 0.5079 0.4614 0.0086  -0.0242 0.0477  737 VAL A CB    
3597 C CG1   . VAL A 445 ? 0.5712 0.5315 0.4803 0.0125  -0.0252 0.0466  737 VAL A CG1   
3598 C CG2   . VAL A 445 ? 0.5999 0.5743 0.5215 0.0087  -0.0216 0.0497  737 VAL A CG2   
3599 N N     . LYS A 446 ? 0.4924 0.4424 0.4134 0.0029  -0.0344 0.0500  738 LYS A N     
3600 C CA    . LYS A 446 ? 0.5287 0.4747 0.4511 0.0017  -0.0378 0.0503  738 LYS A CA    
3601 C C     . LYS A 446 ? 0.5318 0.4786 0.4515 0.0051  -0.0369 0.0474  738 LYS A C     
3602 O O     . LYS A 446 ? 0.4095 0.3600 0.3370 0.0046  -0.0372 0.0468  738 LYS A O     
3603 C CB    . LYS A 446 ? 0.4948 0.4299 0.4081 -0.0005 -0.0426 0.0533  738 LYS A CB    
3604 C CG    . LYS A 446 ? 0.4696 0.4035 0.3877 -0.0026 -0.0454 0.0537  738 LYS A CG    
3605 C CD    . LYS A 446 ? 0.5456 0.4737 0.4603 -0.0053 -0.0477 0.0542  738 LYS A CD    
3606 C CE    . LYS A 446 ? 0.6080 0.5367 0.5281 -0.0077 -0.0501 0.0546  738 LYS A CE    
3607 N NZ    . LYS A 446 ? 0.6134 0.5388 0.5270 -0.0056 -0.0505 0.0520  738 LYS A NZ    
3608 N N     . SER A 447 ? 0.4572 0.4004 0.3656 0.0088  -0.0356 0.0457  739 SER A N     
3609 C CA    . SER A 447 ? 0.4737 0.4170 0.3785 0.0124  -0.0348 0.0430  739 SER A CA    
3610 C C     . SER A 447 ? 0.4293 0.3843 0.3450 0.0136  -0.0309 0.0408  739 SER A C     
3611 O O     . SER A 447 ? 0.4466 0.4034 0.3649 0.0146  -0.0311 0.0391  739 SER A O     
3612 C CB    . SER A 447 ? 0.6081 0.5450 0.4979 0.0170  -0.0338 0.0418  739 SER A CB    
3613 O OG    . SER A 447 ? 0.5670 0.5111 0.4575 0.0196  -0.0292 0.0415  739 SER A OG    
3614 N N     . VAL A 448 ? 0.4738 0.4363 0.3954 0.0132  -0.0278 0.0411  740 VAL A N     
3615 C CA    . VAL A 448 ? 0.5011 0.4740 0.4322 0.0136  -0.0246 0.0395  740 VAL A CA    
3616 C C     . VAL A 448 ? 0.4131 0.3882 0.3550 0.0105  -0.0259 0.0394  740 VAL A C     
3617 O O     . VAL A 448 ? 0.3930 0.3725 0.3397 0.0113  -0.0249 0.0374  740 VAL A O     
3618 C CB    . VAL A 448 ? 0.4848 0.4648 0.4191 0.0131  -0.0217 0.0406  740 VAL A CB    
3619 C CG1   . VAL A 448 ? 0.4424 0.4320 0.3869 0.0120  -0.0196 0.0395  740 VAL A CG1   
3620 C CG2   . VAL A 448 ? 0.5243 0.5043 0.4485 0.0173  -0.0194 0.0409  740 VAL A CG2   
3621 N N     . ARG A 449 ? 0.3607 0.3328 0.3060 0.0072  -0.0280 0.0417  741 ARG A N     
3622 C CA    . ARG A 449 ? 0.3521 0.3259 0.3069 0.0050  -0.0290 0.0421  741 ARG A CA    
3623 C C     . ARG A 449 ? 0.3536 0.3248 0.3077 0.0058  -0.0310 0.0418  741 ARG A C     
3624 O O     . ARG A 449 ? 0.3323 0.3073 0.2931 0.0061  -0.0303 0.0407  741 ARG A O     
3625 C CB    . ARG A 449 ? 0.3696 0.3404 0.3275 0.0019  -0.0310 0.0453  741 ARG A CB    
3626 C CG    . ARG A 449 ? 0.3236 0.2957 0.2909 0.0005  -0.0317 0.0463  741 ARG A CG    
3627 C CD    . ARG A 449 ? 0.2907 0.2601 0.2609 -0.0023 -0.0335 0.0498  741 ARG A CD    
3628 N NE    . ARG A 449 ? 0.3966 0.3598 0.3604 -0.0037 -0.0369 0.0527  741 ARG A NE    
3629 C CZ    . ARG A 449 ? 0.4550 0.4142 0.4113 -0.0046 -0.0377 0.0538  741 ARG A CZ    
3630 N NH1   . ARG A 449 ? 0.3753 0.3372 0.3305 -0.0042 -0.0352 0.0526  741 ARG A NH1   
3631 N NH2   . ARG A 449 ? 0.4232 0.3755 0.3727 -0.0060 -0.0414 0.0564  741 ARG A NH2   
3632 N N     . GLU A 450 ? 0.3443 0.3085 0.2896 0.0060  -0.0338 0.0430  742 GLU A N     
3633 C CA    . GLU A 450 ? 0.4045 0.3658 0.3491 0.0058  -0.0367 0.0437  742 GLU A CA    
3634 C C     . GLU A 450 ? 0.3561 0.3205 0.2996 0.0087  -0.0350 0.0405  742 GLU A C     
3635 O O     . GLU A 450 ? 0.3483 0.3146 0.2961 0.0085  -0.0359 0.0405  742 GLU A O     
3636 C CB    . GLU A 450 ? 0.4628 0.4144 0.3974 0.0043  -0.0411 0.0464  742 GLU A CB    
3637 C CG    . GLU A 450 ? 0.3945 0.3439 0.3329 0.0005  -0.0439 0.0507  742 GLU A CG    
3638 C CD    . GLU A 450 ? 0.5961 0.5379 0.5272 -0.0015 -0.0471 0.0519  742 GLU A CD    
3639 O OE1   . GLU A 450 ? 0.6518 0.5886 0.5736 0.0002  -0.0474 0.0495  742 GLU A OE1   
3640 O OE2   . GLU A 450 ? 0.5986 0.5408 0.5348 -0.0047 -0.0484 0.0542  742 GLU A OE2   
3641 N N     . ALA A 451 ? 0.3645 0.3299 0.3024 0.0116  -0.0324 0.0381  743 ALA A N     
3642 C CA    . ALA A 451 ? 0.4411 0.4102 0.3784 0.0146  -0.0305 0.0352  743 ALA A CA    
3643 C C     . ALA A 451 ? 0.3751 0.3527 0.3238 0.0138  -0.0282 0.0338  743 ALA A C     
3644 O O     . ALA A 451 ? 0.3671 0.3470 0.3180 0.0148  -0.0281 0.0323  743 ALA A O     
3645 C CB    . ALA A 451 ? 0.4483 0.4184 0.3787 0.0180  -0.0278 0.0336  743 ALA A CB    
3646 N N     . ALA A 452 ? 0.3159 0.2971 0.2708 0.0121  -0.0267 0.0344  744 ALA A N     
3647 C CA    . ALA A 452 ? 0.3123 0.2995 0.2763 0.0113  -0.0249 0.0331  744 ALA A CA    
3648 C C     . ALA A 452 ? 0.3644 0.3506 0.3334 0.0105  -0.0265 0.0340  744 ALA A C     
3649 O O     . ALA A 452 ? 0.3153 0.3051 0.2887 0.0113  -0.0253 0.0322  744 ALA A O     
3650 C CB    . ALA A 452 ? 0.3755 0.3648 0.3438 0.0093  -0.0237 0.0339  744 ALA A CB    
3651 N N     . GLU A 453 ? 0.3263 0.3081 0.2948 0.0089  -0.0292 0.0371  745 GLU A N     
3652 C CA    . GLU A 453 ? 0.3129 0.2949 0.2865 0.0082  -0.0308 0.0391  745 GLU A CA    
3653 C C     . GLU A 453 ? 0.3237 0.3063 0.2952 0.0096  -0.0317 0.0383  745 GLU A C     
3654 O O     . GLU A 453 ? 0.3159 0.3023 0.2930 0.0103  -0.0309 0.0381  745 GLU A O     
3655 C CB    . GLU A 453 ? 0.2867 0.2641 0.2593 0.0059  -0.0340 0.0435  745 GLU A CB    
3656 C CG    . GLU A 453 ? 0.3043 0.2813 0.2799 0.0044  -0.0333 0.0448  745 GLU A CG    
3657 C CD    . GLU A 453 ? 0.4022 0.3749 0.3769 0.0020  -0.0367 0.0493  745 GLU A CD    
3658 O OE1   . GLU A 453 ? 0.4753 0.4441 0.4447 0.0010  -0.0401 0.0514  745 GLU A OE1   
3659 O OE2   . GLU A 453 ? 0.4291 0.4019 0.4080 0.0007  -0.0364 0.0511  745 GLU A OE2   
3660 N N     . ARG A 454 ? 0.3078 0.2861 0.2706 0.0102  -0.0334 0.0378  746 ARG A N     
3661 C CA    . ARG A 454 ? 0.3143 0.2921 0.2741 0.0112  -0.0348 0.0372  746 ARG A CA    
3662 C C     . ARG A 454 ? 0.3263 0.3102 0.2896 0.0134  -0.0316 0.0335  746 ARG A C     
3663 O O     . ARG A 454 ? 0.3613 0.3478 0.3275 0.0138  -0.0319 0.0334  746 ARG A O     
3664 C CB    . ARG A 454 ? 0.3376 0.3075 0.2856 0.0117  -0.0375 0.0374  746 ARG A CB    
3665 C CG    . ARG A 454 ? 0.3678 0.3307 0.3118 0.0088  -0.0417 0.0415  746 ARG A CG    
3666 C CD    . ARG A 454 ? 0.4076 0.3604 0.3379 0.0092  -0.0452 0.0417  746 ARG A CD    
3667 N NE    . ARG A 454 ? 0.4548 0.4060 0.3777 0.0129  -0.0423 0.0382  746 ARG A NE    
3668 C CZ    . ARG A 454 ? 0.4323 0.3797 0.3492 0.0135  -0.0415 0.0383  746 ARG A CZ    
3669 N NH1   . ARG A 454 ? 0.4535 0.3972 0.3705 0.0104  -0.0437 0.0414  746 ARG A NH1   
3670 N NH2   . ARG A 454 ? 0.4640 0.4117 0.3749 0.0175  -0.0384 0.0356  746 ARG A NH2   
3671 N N     . LYS A 455 ? 0.3052 0.2917 0.2681 0.0146  -0.0286 0.0309  747 LYS A N     
3672 C CA    . LYS A 455 ? 0.3087 0.3013 0.2756 0.0160  -0.0258 0.0279  747 LYS A CA    
3673 C C     . LYS A 455 ? 0.3518 0.3476 0.3270 0.0151  -0.0248 0.0280  747 LYS A C     
3674 O O     . LYS A 455 ? 0.3231 0.3220 0.3008 0.0160  -0.0241 0.0266  747 LYS A O     
3675 C CB    . LYS A 455 ? 0.3255 0.3213 0.2919 0.0165  -0.0232 0.0264  747 LYS A CB    
3676 C CG    . LYS A 455 ? 0.4049 0.3991 0.3632 0.0187  -0.0229 0.0260  747 LYS A CG    
3677 C CD    . LYS A 455 ? 0.4639 0.4640 0.4236 0.0192  -0.0200 0.0252  747 LYS A CD    
3678 C CE    . LYS A 455 ? 0.5618 0.5614 0.5134 0.0224  -0.0190 0.0252  747 LYS A CE    
3679 N NZ    . LYS A 455 ? 0.6519 0.6447 0.5968 0.0225  -0.0204 0.0271  747 LYS A NZ    
3680 N N     . ALA A 456 ? 0.3088 0.3035 0.2876 0.0136  -0.0248 0.0298  748 ALA A N     
3681 C CA    . ALA A 456 ? 0.2711 0.2678 0.2566 0.0135  -0.0235 0.0298  748 ALA A CA    
3682 C C     . ALA A 456 ? 0.3577 0.3557 0.3464 0.0144  -0.0242 0.0315  748 ALA A C     
3683 O O     . ALA A 456 ? 0.3773 0.3779 0.3695 0.0157  -0.0224 0.0300  748 ALA A O     
3684 C CB    . ALA A 456 ? 0.2787 0.2731 0.2668 0.0120  -0.0236 0.0319  748 ALA A CB    
3685 N N     . PHE A 457 ? 0.2885 0.2847 0.2757 0.0136  -0.0271 0.0348  749 PHE A N     
3686 C CA    . PHE A 457 ? 0.3088 0.3078 0.3001 0.0142  -0.0278 0.0373  749 PHE A CA    
3687 C C     . PHE A 457 ? 0.3173 0.3180 0.3058 0.0150  -0.0285 0.0360  749 PHE A C     
3688 O O     . PHE A 457 ? 0.3949 0.3993 0.3871 0.0158  -0.0284 0.0374  749 PHE A O     
3689 C CB    . PHE A 457 ? 0.3677 0.3656 0.3612 0.0125  -0.0306 0.0428  749 PHE A CB    
3690 C CG    . PHE A 457 ? 0.3820 0.3754 0.3691 0.0103  -0.0348 0.0452  749 PHE A CG    
3691 C CD1   . PHE A 457 ? 0.4254 0.4195 0.4108 0.0097  -0.0374 0.0471  749 PHE A CD1   
3692 C CD2   . PHE A 457 ? 0.4763 0.4642 0.4584 0.0086  -0.0365 0.0459  749 PHE A CD2   
3693 C CE1   . PHE A 457 ? 0.4882 0.4763 0.4662 0.0074  -0.0420 0.0493  749 PHE A CE1   
3694 C CE2   . PHE A 457 ? 0.5634 0.5454 0.5379 0.0066  -0.0406 0.0479  749 PHE A CE2   
3695 C CZ    . PHE A 457 ? 0.4465 0.4280 0.4186 0.0059  -0.0436 0.0496  749 PHE A CZ    
3696 N N     . ASN A 458 ? 0.2926 0.2908 0.2747 0.0150  -0.0290 0.0334  750 ASN A N     
3697 C CA    . ASN A 458 ? 0.3041 0.3035 0.2832 0.0160  -0.0296 0.0317  750 ASN A CA    
3698 C C     . ASN A 458 ? 0.3258 0.3300 0.3080 0.0178  -0.0262 0.0280  750 ASN A C     
3699 O O     . ASN A 458 ? 0.3153 0.3223 0.2985 0.0186  -0.0262 0.0275  750 ASN A O     
3700 C CB    . ASN A 458 ? 0.3459 0.3404 0.3161 0.0163  -0.0312 0.0305  750 ASN A CB    
3701 C CG    . ASN A 458 ? 0.5373 0.5260 0.5018 0.0147  -0.0358 0.0338  750 ASN A CG    
3702 O OD1   . ASN A 458 ? 0.6801 0.6682 0.6422 0.0147  -0.0379 0.0344  750 ASN A OD1   
3703 N ND2   . ASN A 458 ? 0.4017 0.3854 0.3634 0.0131  -0.0377 0.0363  750 ASN A ND2   
3704 N N     A MET A 459 ? 0.2578 0.2625 0.2413 0.0179  -0.0238 0.0257  751 MET A N     
3705 N N     B MET A 459 ? 0.2761 0.2807 0.2595 0.0179  -0.0238 0.0257  751 MET A N     
3706 C CA    A MET A 459 ? 0.2572 0.2654 0.2424 0.0189  -0.0212 0.0223  751 MET A CA    
3707 C CA    B MET A 459 ? 0.2804 0.2885 0.2658 0.0188  -0.0212 0.0223  751 MET A CA    
3708 C C     A MET A 459 ? 0.2666 0.2774 0.2562 0.0200  -0.0199 0.0221  751 MET A C     
3709 C C     B MET A 459 ? 0.2714 0.2820 0.2609 0.0199  -0.0199 0.0221  751 MET A C     
3710 O O     A MET A 459 ? 0.2726 0.2860 0.2618 0.0209  -0.0192 0.0201  751 MET A O     
3711 O O     B MET A 459 ? 0.2874 0.3006 0.2764 0.0208  -0.0192 0.0201  751 MET A O     
3712 C CB    A MET A 459 ? 0.2913 0.2994 0.2766 0.0181  -0.0196 0.0205  751 MET A CB    
3713 C CB    B MET A 459 ? 0.2989 0.3065 0.2850 0.0179  -0.0195 0.0210  751 MET A CB    
3714 C CG    A MET A 459 ? 0.2813 0.2925 0.2675 0.0183  -0.0177 0.0174  751 MET A CG    
3715 C CG    B MET A 459 ? 0.3270 0.3365 0.3152 0.0180  -0.0175 0.0182  751 MET A CG    
3716 S SD    A MET A 459 ? 0.2677 0.2774 0.2577 0.0183  -0.0161 0.0166  751 MET A SD    
3717 S SD    B MET A 459 ? 0.3689 0.3824 0.3547 0.0187  -0.0170 0.0155  751 MET A SD    
3718 C CE    A MET A 459 ? 0.2683 0.2804 0.2570 0.0177  -0.0150 0.0130  751 MET A CE    
3719 C CE    B MET A 459 ? 0.2875 0.3015 0.2750 0.0177  -0.0154 0.0129  751 MET A CE    
3720 N N     . PRO A 460 ? 0.2605 0.2707 0.2540 0.0203  -0.0195 0.0244  752 PRO A N     
3721 C CA    . PRO A 460 ? 0.2563 0.2691 0.2531 0.0223  -0.0177 0.0244  752 PRO A CA    
3722 C C     . PRO A 460 ? 0.2675 0.2839 0.2646 0.0230  -0.0187 0.0257  752 PRO A C     
3723 O O     . PRO A 460 ? 0.2885 0.3074 0.2865 0.0247  -0.0169 0.0241  752 PRO A O     
3724 C CB    . PRO A 460 ? 0.3046 0.3164 0.3053 0.0230  -0.0173 0.0278  752 PRO A CB    
3725 C CG    . PRO A 460 ? 0.3019 0.3098 0.3012 0.0211  -0.0181 0.0277  752 PRO A CG    
3726 C CD    . PRO A 460 ? 0.2666 0.2741 0.2617 0.0193  -0.0201 0.0271  752 PRO A CD    
3727 N N     . VAL A 461 ? 0.2543 0.2705 0.2501 0.0216  -0.0217 0.0287  753 VAL A N     
3728 C CA    . VAL A 461 ? 0.2642 0.2834 0.2599 0.0216  -0.0235 0.0306  753 VAL A CA    
3729 C C     . VAL A 461 ? 0.2755 0.2948 0.2670 0.0218  -0.0235 0.0268  753 VAL A C     
3730 O O     . VAL A 461 ? 0.2342 0.2571 0.2269 0.0229  -0.0223 0.0257  753 VAL A O     
3731 C CB    . VAL A 461 ? 0.2870 0.3044 0.2814 0.0193  -0.0276 0.0354  753 VAL A CB    
3732 C CG1   . VAL A 461 ? 0.3537 0.3739 0.3476 0.0187  -0.0301 0.0377  753 VAL A CG1   
3733 C CG2   . VAL A 461 ? 0.3038 0.3224 0.3033 0.0190  -0.0277 0.0400  753 VAL A CG2   
3734 N N     . GLN A 462 ? 0.2414 0.2570 0.2279 0.0210  -0.0246 0.0250  754 GLN A N     
3735 C CA    . GLN A 462 ? 0.2373 0.2534 0.2199 0.0216  -0.0245 0.0219  754 GLN A CA    
3736 C C     . GLN A 462 ? 0.2282 0.2475 0.2129 0.0226  -0.0214 0.0183  754 GLN A C     
3737 O O     . GLN A 462 ? 0.2708 0.2927 0.2548 0.0232  -0.0211 0.0166  754 GLN A O     
3738 C CB    . GLN A 462 ? 0.2822 0.2943 0.2590 0.0215  -0.0256 0.0209  754 GLN A CB    
3739 C CG    . GLN A 462 ? 0.4061 0.4128 0.3783 0.0204  -0.0291 0.0240  754 GLN A CG    
3740 C CD    . GLN A 462 ? 0.5710 0.5732 0.5361 0.0213  -0.0295 0.0226  754 GLN A CD    
3741 O OE1   . GLN A 462 ? 0.5181 0.5215 0.4839 0.0219  -0.0271 0.0209  754 GLN A OE1   
3742 N NE2   . GLN A 462 ? 0.5008 0.4976 0.4586 0.0216  -0.0327 0.0236  754 GLN A NE2   
3743 N N     . GLY A 463 ? 0.2409 0.2596 0.2277 0.0224  -0.0193 0.0172  755 GLY A N     
3744 C CA    . GLY A 463 ? 0.2410 0.2610 0.2285 0.0227  -0.0171 0.0140  755 GLY A CA    
3745 C C     . GLY A 463 ? 0.2356 0.2574 0.2253 0.0240  -0.0157 0.0137  755 GLY A C     
3746 O O     . GLY A 463 ? 0.2574 0.2806 0.2461 0.0243  -0.0146 0.0110  755 GLY A O     
3747 N N     . THR A 464 ? 0.2427 0.2648 0.2352 0.0251  -0.0156 0.0167  756 THR A N     
3748 C CA    . THR A 464 ? 0.2052 0.2299 0.1997 0.0272  -0.0138 0.0170  756 THR A CA    
3749 C C     . THR A 464 ? 0.2288 0.2573 0.2224 0.0272  -0.0149 0.0171  756 THR A C     
3750 O O     . THR A 464 ? 0.2343 0.2644 0.2272 0.0284  -0.0133 0.0151  756 THR A O     
3751 C CB    . THR A 464 ? 0.2420 0.2678 0.2405 0.0287  -0.0133 0.0212  756 THR A CB    
3752 O OG1   . THR A 464 ? 0.2322 0.2540 0.2313 0.0291  -0.0121 0.0210  756 THR A OG1   
3753 C CG2   . THR A 464 ? 0.2391 0.2686 0.2392 0.0317  -0.0111 0.0220  756 THR A CG2   
3754 N N     . ALA A 465 ? 0.1938 0.2228 0.1866 0.0258  -0.0178 0.0194  757 ALA A N     
3755 C CA    . ALA A 465 ? 0.2264 0.2579 0.2175 0.0255  -0.0195 0.0195  757 ALA A CA    
3756 C C     . ALA A 465 ? 0.2496 0.2812 0.2378 0.0255  -0.0186 0.0151  757 ALA A C     
3757 O O     . ALA A 465 ? 0.2300 0.2645 0.2179 0.0260  -0.0183 0.0141  757 ALA A O     
3758 C CB    . ALA A 465 ? 0.2639 0.2933 0.2526 0.0238  -0.0234 0.0223  757 ALA A CB    
3759 N N     . ALA A 466 ? 0.2434 0.2724 0.2296 0.0248  -0.0183 0.0129  758 ALA A N     
3760 C CA    . ALA A 466 ? 0.2851 0.3153 0.2692 0.0246  -0.0177 0.0096  758 ALA A CA    
3761 C C     . ALA A 466 ? 0.2437 0.2746 0.2288 0.0249  -0.0154 0.0072  758 ALA A C     
3762 O O     . ALA A 466 ? 0.2317 0.2647 0.2155 0.0247  -0.0152 0.0053  758 ALA A O     
3763 C CB    . ALA A 466 ? 0.3029 0.3313 0.2853 0.0238  -0.0178 0.0088  758 ALA A CB    
3764 N N     . ASP A 467 ? 0.2553 0.2837 0.2418 0.0253  -0.0139 0.0075  759 ASP A N     
3765 C CA    . ASP A 467 ? 0.2709 0.2977 0.2565 0.0259  -0.0118 0.0052  759 ASP A CA    
3766 C C     . ASP A 467 ? 0.2231 0.2527 0.2087 0.0277  -0.0110 0.0053  759 ASP A C     
3767 O O     . ASP A 467 ? 0.2396 0.2688 0.2227 0.0278  -0.0101 0.0027  759 ASP A O     
3768 C CB    . ASP A 467 ? 0.2472 0.2701 0.2339 0.0271  -0.0104 0.0061  759 ASP A CB    
3769 C CG    . ASP A 467 ? 0.3854 0.4045 0.3714 0.0251  -0.0108 0.0054  759 ASP A CG    
3770 O OD1   . ASP A 467 ? 0.3270 0.3467 0.3115 0.0229  -0.0117 0.0037  759 ASP A OD1   
3771 O OD2   . ASP A 467 ? 0.3315 0.3477 0.3189 0.0258  -0.0103 0.0068  759 ASP A OD2   
3772 N N     . LEU A 468 ? 0.2406 0.2731 0.2287 0.0289  -0.0115 0.0087  760 LEU A N     
3773 C CA    . LEU A 468 ? 0.2135 0.2499 0.2024 0.0306  -0.0108 0.0098  760 LEU A CA    
3774 C C     . LEU A 468 ? 0.2126 0.2515 0.1994 0.0293  -0.0122 0.0081  760 LEU A C     
3775 O O     . LEU A 468 ? 0.2200 0.2603 0.2054 0.0302  -0.0109 0.0066  760 LEU A O     
3776 C CB    . LEU A 468 ? 0.2490 0.2890 0.2416 0.0313  -0.0117 0.0149  760 LEU A CB    
3777 C CG    . LEU A 468 ? 0.2701 0.3089 0.2655 0.0333  -0.0098 0.0171  760 LEU A CG    
3778 C CD1   . LEU A 468 ? 0.2560 0.2988 0.2557 0.0331  -0.0115 0.0229  760 LEU A CD1   
3779 C CD2   . LEU A 468 ? 0.2880 0.3264 0.2823 0.0369  -0.0061 0.0158  760 LEU A CD2   
3780 N N     . MET A 469 ? 0.2235 0.2626 0.2097 0.0276  -0.0148 0.0085  761 MET A N     
3781 C CA    . MET A 469 ? 0.2154 0.2566 0.1994 0.0267  -0.0161 0.0070  761 MET A CA    
3782 C C     . MET A 469 ? 0.2382 0.2788 0.2202 0.0261  -0.0148 0.0032  761 MET A C     
3783 O O     . MET A 469 ? 0.2276 0.2702 0.2083 0.0260  -0.0147 0.0018  761 MET A O     
3784 C CB    . MET A 469 ? 0.2447 0.2848 0.2271 0.0258  -0.0189 0.0079  761 MET A CB    
3785 C CG    . MET A 469 ? 0.2913 0.3330 0.2712 0.0254  -0.0201 0.0062  761 MET A CG    
3786 S SD    . MET A 469 ? 0.3355 0.3808 0.3154 0.0255  -0.0214 0.0075  761 MET A SD    
3787 C CE    . MET A 469 ? 0.3377 0.3808 0.3161 0.0250  -0.0253 0.0115  761 MET A CE    
3788 N N     . LYS A 470 ? 0.2040 0.2416 0.1855 0.0252  -0.0141 0.0018  762 LYS A N     
3789 C CA    . LYS A 470 ? 0.1889 0.2256 0.1683 0.0238  -0.0136 -0.0011 762 LYS A CA    
3790 C C     . LYS A 470 ? 0.2149 0.2497 0.1922 0.0245  -0.0120 -0.0028 762 LYS A C     
3791 O O     . LYS A 470 ? 0.2468 0.2822 0.2216 0.0235  -0.0122 -0.0047 762 LYS A O     
3792 C CB    . LYS A 470 ? 0.2303 0.2641 0.2097 0.0223  -0.0135 -0.0015 762 LYS A CB    
3793 C CG    . LYS A 470 ? 0.2668 0.3029 0.2471 0.0216  -0.0148 -0.0003 762 LYS A CG    
3794 C CD    . LYS A 470 ? 0.3839 0.4176 0.3646 0.0200  -0.0144 -0.0002 762 LYS A CD    
3795 C CE    . LYS A 470 ? 0.5885 0.6251 0.5696 0.0194  -0.0152 0.0009  762 LYS A CE    
3796 N NZ    . LYS A 470 ? 0.4863 0.5208 0.4681 0.0179  -0.0149 0.0015  762 LYS A NZ    
3797 N N     . LEU A 471 ? 0.2298 0.2619 0.2075 0.0266  -0.0103 -0.0019 763 LEU A N     
3798 C CA    . LEU A 471 ? 0.2158 0.2452 0.1903 0.0285  -0.0082 -0.0034 763 LEU A CA    
3799 C C     . LEU A 471 ? 0.2471 0.2813 0.2216 0.0297  -0.0080 -0.0028 763 LEU A C     
3800 O O     . LEU A 471 ? 0.2489 0.2816 0.2194 0.0300  -0.0072 -0.0050 763 LEU A O     
3801 C CB    . LEU A 471 ? 0.2602 0.2867 0.2355 0.0316  -0.0060 -0.0018 763 LEU A CB    
3802 C CG    . LEU A 471 ? 0.3174 0.3397 0.2882 0.0347  -0.0033 -0.0033 763 LEU A CG    
3803 C CD1   . LEU A 471 ? 0.3013 0.3160 0.2654 0.0327  -0.0039 -0.0072 763 LEU A CD1   
3804 C CD2   . LEU A 471 ? 0.3556 0.3757 0.3278 0.0384  -0.0011 -0.0010 763 LEU A CD2   
3805 N N     . ALA A 472 ? 0.2182 0.2576 0.1965 0.0300  -0.0091 0.0002  764 ALA A N     
3806 C CA    . ALA A 472 ? 0.2203 0.2647 0.1988 0.0305  -0.0095 0.0012  764 ALA A CA    
3807 C C     . ALA A 472 ? 0.2280 0.2730 0.2039 0.0283  -0.0110 -0.0015 764 ALA A C     
3808 O O     . ALA A 472 ? 0.2588 0.3051 0.2324 0.0287  -0.0104 -0.0025 764 ALA A O     
3809 C CB    . ALA A 472 ? 0.2467 0.2955 0.2291 0.0303  -0.0115 0.0053  764 ALA A CB    
3810 N N     . MET A 473 ? 0.2053 0.2497 0.1814 0.0261  -0.0128 -0.0023 765 MET A N     
3811 C CA    . MET A 473 ? 0.2078 0.2538 0.1822 0.0241  -0.0142 -0.0042 765 MET A CA    
3812 C C     . MET A 473 ? 0.2330 0.2758 0.2035 0.0231  -0.0132 -0.0070 765 MET A C     
3813 O O     . MET A 473 ? 0.2293 0.2737 0.1977 0.0224  -0.0137 -0.0082 765 MET A O     
3814 C CB    . MET A 473 ? 0.2087 0.2552 0.1842 0.0227  -0.0158 -0.0040 765 MET A CB    
3815 C CG    . MET A 473 ? 0.1842 0.2323 0.1613 0.0237  -0.0173 -0.0015 765 MET A CG    
3816 S SD    . MET A 473 ? 0.2350 0.2823 0.2123 0.0234  -0.0183 -0.0010 765 MET A SD    
3817 C CE    . MET A 473 ? 0.2222 0.2737 0.1985 0.0224  -0.0191 -0.0022 765 MET A CE    
3818 N N     . VAL A 474 ? 0.2307 0.2682 0.1996 0.0230  -0.0121 -0.0080 766 VAL A N     
3819 C CA    . VAL A 474 ? 0.2044 0.2365 0.1680 0.0219  -0.0117 -0.0107 766 VAL A CA    
3820 C C     . VAL A 474 ? 0.2169 0.2476 0.1768 0.0244  -0.0098 -0.0115 766 VAL A C     
3821 O O     . VAL A 474 ? 0.2784 0.3068 0.2334 0.0232  -0.0102 -0.0136 766 VAL A O     
3822 C CB    . VAL A 474 ? 0.2251 0.2506 0.1872 0.0217  -0.0110 -0.0112 766 VAL A CB    
3823 C CG1   . VAL A 474 ? 0.2706 0.2878 0.2251 0.0212  -0.0106 -0.0139 766 VAL A CG1   
3824 C CG2   . VAL A 474 ? 0.2340 0.2613 0.1989 0.0185  -0.0130 -0.0105 766 VAL A CG2   
3825 N N     . LYS A 475 ? 0.2406 0.2731 0.2028 0.0280  -0.0078 -0.0095 767 LYS A N     
3826 C CA    . LYS A 475 ? 0.2484 0.2808 0.2074 0.0311  -0.0055 -0.0096 767 LYS A CA    
3827 C C     . LYS A 475 ? 0.3461 0.3847 0.3058 0.0303  -0.0066 -0.0091 767 LYS A C     
3828 O O     . LYS A 475 ? 0.2893 0.3269 0.2444 0.0313  -0.0055 -0.0104 767 LYS A O     
3829 C CB    . LYS A 475 ? 0.2710 0.3053 0.2332 0.0352  -0.0030 -0.0066 767 LYS A CB    
3830 C CG    . LYS A 475 ? 0.3574 0.3845 0.3175 0.0371  -0.0013 -0.0073 767 LYS A CG    
3831 C CD    . LYS A 475 ? 0.4637 0.4938 0.4272 0.0417  0.0015  -0.0037 767 LYS A CD    
3832 C CE    . LYS A 475 ? 0.5516 0.5738 0.5125 0.0440  0.0033  -0.0045 767 LYS A CE    
3833 N NZ    . LYS A 475 ? 0.6138 0.6395 0.5778 0.0492  0.0064  -0.0006 767 LYS A NZ    
3834 N N     . LEU A 476 ? 0.2635 0.3078 0.2283 0.0285  -0.0089 -0.0072 768 LEU A N     
3835 C CA    . LEU A 476 ? 0.2533 0.3034 0.2191 0.0278  -0.0103 -0.0062 768 LEU A CA    
3836 C C     . LEU A 476 ? 0.3144 0.3640 0.2771 0.0249  -0.0121 -0.0088 768 LEU A C     
3837 O O     . LEU A 476 ? 0.2563 0.3083 0.2170 0.0247  -0.0123 -0.0091 768 LEU A O     
3838 C CB    . LEU A 476 ? 0.2635 0.3183 0.2345 0.0273  -0.0124 -0.0030 768 LEU A CB    
3839 C CG    . LEU A 476 ? 0.3477 0.4077 0.3196 0.0264  -0.0146 -0.0014 768 LEU A CG    
3840 C CD1   . LEU A 476 ? 0.3163 0.3798 0.2876 0.0282  -0.0129 0.0001  768 LEU A CD1   
3841 C CD2   . LEU A 476 ? 0.3271 0.3888 0.3023 0.0259  -0.0172 0.0015  768 LEU A CD2   
3842 N N     . PHE A 477 ? 0.2913 0.3385 0.2538 0.0225  -0.0134 -0.0101 769 PHE A N     
3843 C CA    . PHE A 477 ? 0.3065 0.3553 0.2678 0.0194  -0.0156 -0.0114 769 PHE A CA    
3844 C C     . PHE A 477 ? 0.3264 0.3729 0.2820 0.0183  -0.0155 -0.0135 769 PHE A C     
3845 O O     . PHE A 477 ? 0.2744 0.3251 0.2302 0.0172  -0.0170 -0.0133 769 PHE A O     
3846 C CB    . PHE A 477 ? 0.2776 0.3249 0.2398 0.0170  -0.0168 -0.0117 769 PHE A CB    
3847 C CG    . PHE A 477 ? 0.2898 0.3400 0.2517 0.0139  -0.0190 -0.0120 769 PHE A CG    
3848 C CD1   . PHE A 477 ? 0.3073 0.3638 0.2723 0.0140  -0.0205 -0.0106 769 PHE A CD1   
3849 C CD2   . PHE A 477 ? 0.3917 0.4381 0.3498 0.0107  -0.0199 -0.0135 769 PHE A CD2   
3850 C CE1   . PHE A 477 ? 0.4256 0.4857 0.3907 0.0115  -0.0224 -0.0104 769 PHE A CE1   
3851 C CE2   . PHE A 477 ? 0.4777 0.5279 0.4361 0.0074  -0.0223 -0.0130 769 PHE A CE2   
3852 C CZ    . PHE A 477 ? 0.3701 0.4278 0.3325 0.0081  -0.0232 -0.0114 769 PHE A CZ    
3853 N N     . PRO A 478 ? 0.3162 0.3554 0.2660 0.0188  -0.0140 -0.0155 770 PRO A N     
3854 C CA    . PRO A 478 ? 0.3280 0.3636 0.2707 0.0178  -0.0142 -0.0177 770 PRO A CA    
3855 C C     . PRO A 478 ? 0.3302 0.3701 0.2726 0.0202  -0.0129 -0.0169 770 PRO A C     
3856 O O     . PRO A 478 ? 0.3729 0.4137 0.3122 0.0183  -0.0141 -0.0178 770 PRO A O     
3857 C CB    . PRO A 478 ? 0.3773 0.4027 0.3129 0.0192  -0.0123 -0.0198 770 PRO A CB    
3858 C CG    . PRO A 478 ? 0.3977 0.4218 0.3373 0.0191  -0.0123 -0.0189 770 PRO A CG    
3859 C CD    . PRO A 478 ? 0.3171 0.3500 0.2655 0.0204  -0.0123 -0.0160 770 PRO A CD    
3860 N N     . ARG A 479 ? 0.3319 0.3749 0.2777 0.0239  -0.0106 -0.0148 771 ARG A N     
3861 C CA    . ARG A 479 ? 0.4238 0.4722 0.3700 0.0259  -0.0096 -0.0132 771 ARG A CA    
3862 C C     . ARG A 479 ? 0.4066 0.4625 0.3578 0.0236  -0.0125 -0.0114 771 ARG A C     
3863 O O     . ARG A 479 ? 0.3441 0.4034 0.2938 0.0233  -0.0129 -0.0110 771 ARG A O     
3864 C CB    . ARG A 479 ? 0.4709 0.5214 0.4196 0.0304  -0.0065 -0.0106 771 ARG A CB    
3865 C CG    . ARG A 479 ? 0.5809 0.6259 0.5222 0.0342  -0.0028 -0.0121 771 ARG A CG    
3866 C CD    . ARG A 479 ? 0.5900 0.6376 0.5343 0.0390  0.0005  -0.0090 771 ARG A CD    
3867 N NE    . ARG A 479 ? 0.7327 0.7761 0.6792 0.0394  0.0008  -0.0091 771 ARG A NE    
3868 C CZ    . ARG A 479 ? 0.7009 0.7468 0.6516 0.0428  0.0029  -0.0059 771 ARG A CZ    
3869 N NH1   . ARG A 479 ? 0.5734 0.6269 0.5272 0.0461  0.0050  -0.0020 771 ARG A NH1   
3870 N NH2   . ARG A 479 ? 0.6012 0.6426 0.5534 0.0427  0.0028  -0.0063 771 ARG A NH2   
3871 N N     . LEU A 480 ? 0.3705 0.4284 0.3267 0.0222  -0.0145 -0.0102 772 LEU A N     
3872 C CA    . LEU A 480 ? 0.4129 0.4760 0.3724 0.0204  -0.0174 -0.0089 772 LEU A CA    
3873 C C     . LEU A 480 ? 0.3407 0.4039 0.2971 0.0176  -0.0191 -0.0108 772 LEU A C     
3874 O O     . LEU A 480 ? 0.3494 0.4164 0.3058 0.0168  -0.0206 -0.0101 772 LEU A O     
3875 C CB    . LEU A 480 ? 0.4019 0.4655 0.3655 0.0199  -0.0190 -0.0078 772 LEU A CB    
3876 C CG    . LEU A 480 ? 0.4342 0.4992 0.4015 0.0217  -0.0192 -0.0049 772 LEU A CG    
3877 C CD1   . LEU A 480 ? 0.3400 0.4044 0.3094 0.0211  -0.0209 -0.0045 772 LEU A CD1   
3878 C CD2   . LEU A 480 ? 0.3070 0.3765 0.2753 0.0219  -0.0207 -0.0024 772 LEU A CD2   
3879 N N     . GLU A 481 ? 0.3064 0.3653 0.2603 0.0156  -0.0193 -0.0129 773 GLU A N     
3880 C CA    . GLU A 481 ? 0.4240 0.4829 0.3752 0.0123  -0.0214 -0.0141 773 GLU A CA    
3881 C C     . GLU A 481 ? 0.4534 0.5110 0.3990 0.0121  -0.0209 -0.0154 773 GLU A C     
3882 O O     . GLU A 481 ? 0.4156 0.4763 0.3605 0.0098  -0.0230 -0.0153 773 GLU A O     
3883 C CB    . GLU A 481 ? 0.5544 0.6084 0.5033 0.0097  -0.0220 -0.0155 773 GLU A CB    
3884 C CG    . GLU A 481 ? 0.6098 0.6680 0.5642 0.0082  -0.0237 -0.0138 773 GLU A CG    
3885 C CD    . GLU A 481 ? 0.7481 0.8035 0.7003 0.0043  -0.0253 -0.0143 773 GLU A CD    
3886 O OE1   . GLU A 481 ? 0.6612 0.7089 0.6080 0.0034  -0.0247 -0.0161 773 GLU A OE1   
3887 O OE2   . GLU A 481 ? 0.8172 0.8782 0.7730 0.0022  -0.0273 -0.0125 773 GLU A OE2   
3888 N N     . GLU A 482 ? 0.4887 0.5421 0.4302 0.0149  -0.0181 -0.0163 774 GLU A N     
3889 C CA    . GLU A 482 ? 0.4910 0.5429 0.4265 0.0157  -0.0169 -0.0173 774 GLU A CA    
3890 C C     . GLU A 482 ? 0.5427 0.6026 0.4817 0.0163  -0.0175 -0.0150 774 GLU A C     
3891 O O     . GLU A 482 ? 0.5310 0.5915 0.4659 0.0157  -0.0177 -0.0155 774 GLU A O     
3892 C CB    . GLU A 482 ? 0.5223 0.5688 0.4531 0.0199  -0.0130 -0.0181 774 GLU A CB    
3893 C CG    . GLU A 482 ? 0.6550 0.6909 0.5786 0.0194  -0.0125 -0.0210 774 GLU A CG    
3894 C CD    . GLU A 482 ? 0.7971 0.8280 0.7172 0.0246  -0.0085 -0.0212 774 GLU A CD    
3895 O OE1   . GLU A 482 ? 0.7947 0.8311 0.7175 0.0285  -0.0058 -0.0190 774 GLU A OE1   
3896 O OE2   . GLU A 482 ? 0.8808 0.9025 0.7958 0.0247  -0.0081 -0.0233 774 GLU A OE2   
3897 N N     . MET A 483 ? 0.4173 0.4827 0.3634 0.0174  -0.0181 -0.0122 775 MET A N     
3898 C CA    . MET A 483 ? 0.3927 0.4649 0.3420 0.0176  -0.0194 -0.0095 775 MET A CA    
3899 C C     . MET A 483 ? 0.3960 0.4716 0.3483 0.0149  -0.0231 -0.0090 775 MET A C     
3900 O O     . MET A 483 ? 0.4502 0.5304 0.4049 0.0147  -0.0249 -0.0067 775 MET A O     
3901 C CB    . MET A 483 ? 0.4241 0.4997 0.3784 0.0201  -0.0185 -0.0062 775 MET A CB    
3902 C CG    . MET A 483 ? 0.6155 0.6894 0.5681 0.0236  -0.0146 -0.0058 775 MET A CG    
3903 S SD    . MET A 483 ? 0.6462 0.7251 0.6057 0.0256  -0.0144 -0.0009 775 MET A SD    
3904 C CE    . MET A 483 ? 0.5902 0.6771 0.5518 0.0245  -0.0166 0.0029  775 MET A CE    
3905 N N     . GLY A 484 ? 0.3417 0.3754 0.3110 0.0263  0.0189  0.0201  776 GLY A N     
3906 C CA    . GLY A 484 ? 0.3613 0.3911 0.3282 0.0255  0.0166  0.0195  776 GLY A CA    
3907 C C     . GLY A 484 ? 0.2759 0.3046 0.2462 0.0236  0.0143  0.0199  776 GLY A C     
3908 O O     . GLY A 484 ? 0.2844 0.3106 0.2538 0.0225  0.0125  0.0203  776 GLY A O     
3909 N N     . ALA A 485 ? 0.2752 0.3059 0.2493 0.0234  0.0143  0.0198  777 ALA A N     
3910 C CA    . ALA A 485 ? 0.3259 0.3560 0.3034 0.0218  0.0121  0.0200  777 ALA A CA    
3911 C C     . ALA A 485 ? 0.2579 0.2860 0.2350 0.0224  0.0105  0.0172  777 ALA A C     
3912 O O     . ALA A 485 ? 0.2723 0.3001 0.2471 0.0240  0.0113  0.0152  777 ALA A O     
3913 C CB    . ALA A 485 ? 0.2675 0.3012 0.2498 0.0208  0.0131  0.0219  777 ALA A CB    
3914 N N     . ARG A 486 ? 0.2392 0.2664 0.2187 0.0211  0.0083  0.0170  778 ARG A N     
3915 C CA    . ARG A 486 ? 0.2384 0.2638 0.2176 0.0215  0.0066  0.0145  778 ARG A CA    
3916 C C     . ARG A 486 ? 0.2716 0.2987 0.2551 0.0207  0.0058  0.0148  778 ARG A C     
3917 O O     . ARG A 486 ? 0.2356 0.2644 0.2223 0.0193  0.0057  0.0168  778 ARG A O     
3918 C CB    . ARG A 486 ? 0.2247 0.2466 0.2019 0.0207  0.0042  0.0136  778 ARG A CB    
3919 C CG    . ARG A 486 ? 0.2807 0.3005 0.2534 0.0215  0.0045  0.0131  778 ARG A CG    
3920 C CD    . ARG A 486 ? 0.2465 0.2636 0.2183 0.0203  0.0022  0.0132  778 ARG A CD    
3921 N NE    . ARG A 486 ? 0.2973 0.3122 0.2647 0.0211  0.0023  0.0126  778 ARG A NE    
3922 C CZ    . ARG A 486 ? 0.4102 0.4227 0.3761 0.0204  0.0006  0.0130  778 ARG A CZ    
3923 N NH1   . ARG A 486 ? 0.3524 0.3642 0.3210 0.0188  -0.0013 0.0140  778 ARG A NH1   
3924 N NH2   . ARG A 486 ? 0.3595 0.3701 0.3213 0.0213  0.0007  0.0124  778 ARG A NH2   
3925 N N     . MET A 487 ? 0.2601 0.2869 0.2437 0.0214  0.0053  0.0128  779 MET A N     
3926 C CA    . MET A 487 ? 0.2003 0.2283 0.1876 0.0207  0.0041  0.0128  779 MET A CA    
3927 C C     . MET A 487 ? 0.2397 0.2648 0.2260 0.0201  0.0014  0.0112  779 MET A C     
3928 O O     . MET A 487 ? 0.2264 0.2495 0.2095 0.0209  0.0011  0.0092  779 MET A O     
3929 C CB    . MET A 487 ? 0.2042 0.2337 0.1921 0.0221  0.0053  0.0119  779 MET A CB    
3930 C CG    . MET A 487 ? 0.1919 0.2230 0.1837 0.0216  0.0043  0.0120  779 MET A CG    
3931 S SD    . MET A 487 ? 0.2793 0.3122 0.2718 0.0234  0.0060  0.0112  779 MET A SD    
3932 C CE    . MET A 487 ? 0.2623 0.2986 0.2565 0.0239  0.0087  0.0133  779 MET A CE    
3933 N N     . LEU A 488 ? 0.2358 0.2611 0.2249 0.0186  -0.0005 0.0119  780 LEU A N     
3934 C CA    . LEU A 488 ? 0.2021 0.2248 0.1903 0.0179  -0.0031 0.0104  780 LEU A CA    
3935 C C     . LEU A 488 ? 0.2377 0.2609 0.2282 0.0177  -0.0047 0.0093  780 LEU A C     
3936 O O     . LEU A 488 ? 0.2400 0.2616 0.2286 0.0181  -0.0058 0.0072  780 LEU A O     
3937 C CB    . LEU A 488 ? 0.2045 0.2260 0.1934 0.0165  -0.0045 0.0117  780 LEU A CB    
3938 C CG    . LEU A 488 ? 0.2070 0.2275 0.1934 0.0165  -0.0034 0.0130  780 LEU A CG    
3939 C CD1   . LEU A 488 ? 0.2445 0.2630 0.2313 0.0150  -0.0055 0.0137  780 LEU A CD1   
3940 C CD2   . LEU A 488 ? 0.2498 0.2686 0.2317 0.0179  -0.0026 0.0112  780 LEU A CD2   
3941 N N     . LEU A 489 ? 0.2307 0.2564 0.2253 0.0169  -0.0048 0.0107  781 LEU A N     
3942 C CA    . LEU A 489 ? 0.2119 0.2382 0.2089 0.0165  -0.0065 0.0098  781 LEU A CA    
3943 C C     . LEU A 489 ? 0.2030 0.2323 0.2032 0.0168  -0.0054 0.0108  781 LEU A C     
3944 O O     . LEU A 489 ? 0.2031 0.2346 0.2052 0.0167  -0.0038 0.0126  781 LEU A O     
3945 C CB    . LEU A 489 ? 0.1951 0.2207 0.1942 0.0148  -0.0089 0.0104  781 LEU A CB    
3946 C CG    . LEU A 489 ? 0.2661 0.2887 0.2627 0.0143  -0.0104 0.0098  781 LEU A CG    
3947 C CD1   . LEU A 489 ? 0.2475 0.2700 0.2472 0.0126  -0.0125 0.0108  781 LEU A CD1   
3948 C CD2   . LEU A 489 ? 0.2684 0.2887 0.2618 0.0150  -0.0117 0.0071  781 LEU A CD2   
3949 N N     . GLN A 490 ? 0.1975 0.2272 0.1984 0.0172  -0.0063 0.0095  782 GLN A N     
3950 C CA    . GLN A 490 ? 0.1604 0.1930 0.1647 0.0175  -0.0058 0.0103  782 GLN A CA    
3951 C C     . GLN A 490 ? 0.2368 0.2694 0.2430 0.0168  -0.0083 0.0094  782 GLN A C     
3952 O O     . GLN A 490 ? 0.2233 0.2539 0.2272 0.0170  -0.0096 0.0076  782 GLN A O     
3953 C CB    . GLN A 490 ? 0.2222 0.2553 0.2252 0.0191  -0.0040 0.0096  782 GLN A CB    
3954 C CG    . GLN A 490 ? 0.2224 0.2587 0.2288 0.0196  -0.0029 0.0108  782 GLN A CG    
3955 C CD    . GLN A 490 ? 0.3147 0.3522 0.3238 0.0193  -0.0047 0.0105  782 GLN A CD    
3956 O OE1   . GLN A 490 ? 0.3389 0.3751 0.3465 0.0198  -0.0056 0.0090  782 GLN A OE1   
3957 N NE2   . GLN A 490 ? 0.2860 0.3261 0.2992 0.0184  -0.0051 0.0120  782 GLN A NE2   
3958 N N     . VAL A 491 ? 0.2138 0.2487 0.2241 0.0159  -0.0090 0.0107  783 VAL A N     
3959 C CA    . VAL A 491 ? 0.2257 0.2609 0.2379 0.0153  -0.0114 0.0099  783 VAL A CA    
3960 C C     . VAL A 491 ? 0.2773 0.3160 0.2941 0.0150  -0.0112 0.0113  783 VAL A C     
3961 O O     . VAL A 491 ? 0.2254 0.2657 0.2442 0.0145  -0.0100 0.0131  783 VAL A O     
3962 C CB    . VAL A 491 ? 0.2483 0.2816 0.2603 0.0139  -0.0137 0.0094  783 VAL A CB    
3963 C CG1   . VAL A 491 ? 0.2765 0.3104 0.2907 0.0127  -0.0134 0.0114  783 VAL A CG1   
3964 C CG2   . VAL A 491 ? 0.2983 0.3321 0.3124 0.0134  -0.0162 0.0084  783 VAL A CG2   
3965 N N     . HIS A 492 ? 0.3096 0.3493 0.3279 0.0152  -0.0125 0.0106  784 HIS A N     
3966 C CA    . HIS A 492 ? 0.3183 0.3614 0.3410 0.0151  -0.0125 0.0118  784 HIS A CA    
3967 C C     . HIS A 492 ? 0.4038 0.4488 0.4270 0.0161  -0.0097 0.0131  784 HIS A C     
3968 O O     . HIS A 492 ? 0.3363 0.3806 0.3570 0.0175  -0.0083 0.0124  784 HIS A O     
3969 C CB    . HIS A 492 ? 0.3620 0.4061 0.3882 0.0133  -0.0139 0.0129  784 HIS A CB    
3970 C CG    . HIS A 492 ? 0.3586 0.4006 0.3842 0.0124  -0.0166 0.0116  784 HIS A CG    
3971 N ND1   . HIS A 492 ? 0.4418 0.4827 0.4684 0.0108  -0.0178 0.0122  784 HIS A ND1   
3972 C CD2   . HIS A 492 ? 0.3667 0.4074 0.3906 0.0128  -0.0184 0.0097  784 HIS A CD2   
3973 C CE1   . HIS A 492 ? 0.3985 0.4377 0.4243 0.0104  -0.0202 0.0106  784 HIS A CE1   
3974 N NE2   . HIS A 492 ? 0.3313 0.3704 0.3554 0.0116  -0.0206 0.0091  784 HIS A NE2   
3975 N N     . ASP A 493 ? 0.2755 0.3230 0.3020 0.0153  -0.0089 0.0149  785 ASP A N     
3976 C CA    . ASP A 493 ? 0.2284 0.2781 0.2557 0.0162  -0.0062 0.0162  785 ASP A CA    
3977 C C     . ASP A 493 ? 0.2354 0.2844 0.2613 0.0155  -0.0047 0.0173  785 ASP A C     
3978 O O     . ASP A 493 ? 0.2248 0.2762 0.2523 0.0157  -0.0027 0.0188  785 ASP A O     
3979 C CB    . ASP A 493 ? 0.2741 0.3278 0.3064 0.0158  -0.0062 0.0175  785 ASP A CB    
3980 C CG    . ASP A 493 ? 0.3607 0.4154 0.3944 0.0166  -0.0076 0.0165  785 ASP A CG    
3981 O OD1   . ASP A 493 ? 0.4669 0.5199 0.4977 0.0179  -0.0075 0.0152  785 ASP A OD1   
3982 O OD2   . ASP A 493 ? 0.3928 0.4500 0.4306 0.0159  -0.0087 0.0171  785 ASP A OD2   
3983 N N     . GLU A 494 ? 0.2025 0.2483 0.2255 0.0149  -0.0057 0.0166  786 GLU A N     
3984 C CA    . GLU A 494 ? 0.1919 0.2367 0.2138 0.0140  -0.0049 0.0177  786 GLU A CA    
3985 C C     . GLU A 494 ? 0.2207 0.2627 0.2375 0.0151  -0.0037 0.0167  786 GLU A C     
3986 O O     . GLU A 494 ? 0.2237 0.2637 0.2378 0.0160  -0.0044 0.0149  786 GLU A O     
3987 C CB    . GLU A 494 ? 0.2355 0.2786 0.2583 0.0122  -0.0074 0.0178  786 GLU A CB    
3988 C CG    . GLU A 494 ? 0.3984 0.4403 0.4204 0.0111  -0.0069 0.0192  786 GLU A CG    
3989 C CD    . GLU A 494 ? 0.4543 0.4944 0.4774 0.0094  -0.0095 0.0192  786 GLU A CD    
3990 O OE1   . GLU A 494 ? 0.3971 0.4364 0.4207 0.0093  -0.0117 0.0176  786 GLU A OE1   
3991 O OE2   . GLU A 494 ? 0.4688 0.5083 0.4922 0.0081  -0.0093 0.0207  786 GLU A OE2   
3992 N N     . LEU A 495 ? 0.1994 0.2416 0.2151 0.0150  -0.0019 0.0180  787 LEU A N     
3993 C CA    . LEU A 495 ? 0.2227 0.2624 0.2338 0.0159  -0.0009 0.0172  787 LEU A CA    
3994 C C     . LEU A 495 ? 0.2601 0.2984 0.2704 0.0145  -0.0012 0.0185  787 LEU A C     
3995 O O     . LEU A 495 ? 0.2755 0.3158 0.2886 0.0134  -0.0006 0.0205  787 LEU A O     
3996 C CB    . LEU A 495 ? 0.2702 0.3116 0.2804 0.0175  0.0019  0.0175  787 LEU A CB    
3997 C CG    . LEU A 495 ? 0.3939 0.4335 0.3997 0.0190  0.0032  0.0162  787 LEU A CG    
3998 C CD1   . LEU A 495 ? 0.3118 0.3490 0.3154 0.0198  0.0019  0.0139  787 LEU A CD1   
3999 C CD2   . LEU A 495 ? 0.3248 0.3670 0.3311 0.0204  0.0058  0.0169  787 LEU A CD2   
4000 N N     . VAL A 496 ? 0.2174 0.2523 0.2240 0.0146  -0.0021 0.0173  788 VAL A N     
4001 C CA    . VAL A 496 ? 0.2055 0.2387 0.2108 0.0135  -0.0024 0.0184  788 VAL A CA    
4002 C C     . VAL A 496 ? 0.2175 0.2492 0.2183 0.0148  -0.0007 0.0180  788 VAL A C     
4003 O O     . VAL A 496 ? 0.2305 0.2604 0.2282 0.0160  -0.0009 0.0159  788 VAL A O     
4004 C CB    . VAL A 496 ? 0.2256 0.2559 0.2305 0.0125  -0.0053 0.0173  788 VAL A CB    
4005 C CG1   . VAL A 496 ? 0.2942 0.3225 0.2978 0.0114  -0.0058 0.0186  788 VAL A CG1   
4006 C CG2   . VAL A 496 ? 0.2801 0.3118 0.2892 0.0114  -0.0072 0.0175  788 VAL A CG2   
4007 N N     . LEU A 497 ? 0.1972 0.2300 0.1979 0.0144  0.0010  0.0200  789 LEU A N     
4008 C CA    . LEU A 497 ? 0.2282 0.2599 0.2249 0.0156  0.0027  0.0198  789 LEU A CA    
4009 C C     . LEU A 497 ? 0.2597 0.2891 0.2546 0.0145  0.0019  0.0209  789 LEU A C     
4010 O O     . LEU A 497 ? 0.2365 0.2656 0.2338 0.0128  0.0005  0.0222  789 LEU A O     
4011 C CB    . LEU A 497 ? 0.2046 0.2397 0.2023 0.0162  0.0056  0.0214  789 LEU A CB    
4012 C CG    . LEU A 497 ? 0.2237 0.2619 0.2243 0.0170  0.0065  0.0211  789 LEU A CG    
4013 C CD1   . LEU A 497 ? 0.2783 0.3199 0.2798 0.0177  0.0094  0.0227  789 LEU A CD1   
4014 C CD2   . LEU A 497 ? 0.2074 0.2441 0.2058 0.0187  0.0062  0.0185  789 LEU A CD2   
4015 N N     . GLU A 498 ? 0.1824 0.2101 0.1729 0.0155  0.0029  0.0203  790 GLU A N     
4016 C CA    . GLU A 498 ? 0.2180 0.2435 0.2065 0.0147  0.0023  0.0215  790 GLU A CA    
4017 C C     . GLU A 498 ? 0.2123 0.2390 0.1983 0.0157  0.0050  0.0227  790 GLU A C     
4018 O O     . GLU A 498 ? 0.2469 0.2738 0.2304 0.0174  0.0064  0.0212  790 GLU A O     
4019 C CB    . GLU A 498 ? 0.2280 0.2496 0.2130 0.0152  0.0002  0.0192  790 GLU A CB    
4020 C CG    . GLU A 498 ? 0.2494 0.2682 0.2328 0.0142  -0.0012 0.0202  790 GLU A CG    
4021 C CD    . GLU A 498 ? 0.3072 0.3225 0.2871 0.0149  -0.0032 0.0176  790 GLU A CD    
4022 O OE1   . GLU A 498 ? 0.2893 0.3044 0.2668 0.0164  -0.0026 0.0155  790 GLU A OE1   
4023 O OE2   . GLU A 498 ? 0.2831 0.2959 0.2627 0.0139  -0.0053 0.0178  790 GLU A OE2   
4024 N N     . ALA A 499 ? 0.2320 0.2595 0.2188 0.0145  0.0058  0.0253  791 ALA A N     
4025 C CA    . ALA A 499 ? 0.2622 0.2913 0.2468 0.0153  0.0085  0.0267  791 ALA A CA    
4026 C C     . ALA A 499 ? 0.2849 0.3118 0.2672 0.0144  0.0081  0.0284  791 ALA A C     
4027 O O     . ALA A 499 ? 0.2611 0.2866 0.2452 0.0126  0.0064  0.0296  791 ALA A O     
4028 C CB    . ALA A 499 ? 0.2351 0.2686 0.2234 0.0150  0.0106  0.0285  791 ALA A CB    
4029 N N     . PRO A 500 ? 0.2727 0.2993 0.2510 0.0156  0.0098  0.0286  792 PRO A N     
4030 C CA    . PRO A 500 ? 0.3057 0.3309 0.2821 0.0147  0.0098  0.0308  792 PRO A CA    
4031 C C     . PRO A 500 ? 0.2819 0.3095 0.2624 0.0127  0.0105  0.0340  792 PRO A C     
4032 O O     . PRO A 500 ? 0.2870 0.3185 0.2705 0.0127  0.0122  0.0346  792 PRO A O     
4033 C CB    . PRO A 500 ? 0.3555 0.3816 0.3278 0.0165  0.0122  0.0307  792 PRO A CB    
4034 C CG    . PRO A 500 ? 0.2944 0.3203 0.2652 0.0185  0.0123  0.0274  792 PRO A CG    
4035 C CD    . PRO A 500 ? 0.2520 0.2798 0.2275 0.0179  0.0117  0.0269  792 PRO A CD    
4036 N N     . LYS A 501 ? 0.2586 0.2841 0.2392 0.0110  0.0092  0.0359  793 LYS A N     
4037 C CA    . LYS A 501 ? 0.3236 0.3510 0.3084 0.0087  0.0095  0.0388  793 LYS A CA    
4038 C C     . LYS A 501 ? 0.3517 0.3835 0.3373 0.0089  0.0128  0.0409  793 LYS A C     
4039 O O     . LYS A 501 ? 0.3618 0.3970 0.3519 0.0077  0.0137  0.0424  793 LYS A O     
4040 C CB    . LYS A 501 ? 0.3777 0.4019 0.3615 0.0071  0.0080  0.0408  793 LYS A CB    
4041 C CG    . LYS A 501 ? 0.5594 0.5796 0.5439 0.0063  0.0045  0.0393  793 LYS A CG    
4042 C CD    . LYS A 501 ? 0.6360 0.6532 0.6199 0.0045  0.0032  0.0417  793 LYS A CD    
4043 C CE    . LYS A 501 ? 0.6668 0.6795 0.6500 0.0043  -0.0004 0.0399  793 LYS A CE    
4044 N NZ    . LYS A 501 ? 0.5338 0.5473 0.5209 0.0038  -0.0021 0.0380  793 LYS A NZ    
4045 N N     . GLU A 502 ? 0.3256 0.3575 0.3069 0.0105  0.0146  0.0409  794 GLU A N     
4046 C CA    . GLU A 502 ? 0.3732 0.4093 0.3546 0.0109  0.0179  0.0427  794 GLU A CA    
4047 C C     . GLU A 502 ? 0.3788 0.4190 0.3626 0.0122  0.0195  0.0414  794 GLU A C     
4048 O O     . GLU A 502 ? 0.3622 0.4065 0.3476 0.0122  0.0220  0.0431  794 GLU A O     
4049 C CB    . GLU A 502 ? 0.4467 0.4817 0.4224 0.0125  0.0192  0.0428  794 GLU A CB    
4050 C CG    . GLU A 502 ? 0.4949 0.5284 0.4669 0.0150  0.0190  0.0394  794 GLU A CG    
4051 C CD    . GLU A 502 ? 0.5282 0.5566 0.4972 0.0152  0.0162  0.0376  794 GLU A CD    
4052 O OE1   . GLU A 502 ? 0.4319 0.4578 0.4023 0.0134  0.0140  0.0386  794 GLU A OE1   
4053 O OE2   . GLU A 502 ? 0.5410 0.5679 0.5063 0.0172  0.0161  0.0350  794 GLU A OE2   
4054 N N     . ARG A 503 ? 0.3360 0.3749 0.3200 0.0133  0.0182  0.0385  795 ARG A N     
4055 C CA    . ARG A 503 ? 0.3102 0.3524 0.2962 0.0147  0.0195  0.0371  795 ARG A CA    
4056 C C     . ARG A 503 ? 0.3063 0.3496 0.2974 0.0136  0.0181  0.0367  795 ARG A C     
4057 O O     . ARG A 503 ? 0.3039 0.3502 0.2973 0.0145  0.0191  0.0358  795 ARG A O     
4058 C CB    . ARG A 503 ? 0.4267 0.4671 0.4089 0.0171  0.0194  0.0339  795 ARG A CB    
4059 C CG    . ARG A 503 ? 0.5471 0.5860 0.5240 0.0184  0.0204  0.0337  795 ARG A CG    
4060 C CD    . ARG A 503 ? 0.6743 0.7169 0.6506 0.0189  0.0235  0.0356  795 ARG A CD    
4061 N NE    . ARG A 503 ? 0.7471 0.7931 0.7247 0.0206  0.0253  0.0343  795 ARG A NE    
4062 C CZ    . ARG A 503 ? 0.7151 0.7608 0.6893 0.0230  0.0262  0.0320  795 ARG A CZ    
4063 N NH1   . ARG A 503 ? 0.6745 0.7169 0.6440 0.0238  0.0254  0.0308  795 ARG A NH1   
4064 N NH2   . ARG A 503 ? 0.7734 0.8221 0.7490 0.0245  0.0277  0.0309  795 ARG A NH2   
4065 N N     . ALA A 504 ? 0.2679 0.3089 0.2609 0.0117  0.0157  0.0373  796 ALA A N     
4066 C CA    . ALA A 504 ? 0.2938 0.3354 0.2912 0.0107  0.0139  0.0366  796 ALA A CA    
4067 C C     . ALA A 504 ? 0.3068 0.3533 0.3091 0.0102  0.0155  0.0380  796 ALA A C     
4068 O O     . ALA A 504 ? 0.2841 0.3321 0.2890 0.0108  0.0151  0.0366  796 ALA A O     
4069 C CB    . ALA A 504 ? 0.2594 0.2978 0.2580 0.0087  0.0111  0.0372  796 ALA A CB    
4070 N N     . GLU A 505 ? 0.2846 0.3336 0.2883 0.0090  0.0172  0.0408  797 GLU A N     
4071 C CA    . GLU A 505 ? 0.2685 0.3226 0.2770 0.0085  0.0188  0.0421  797 GLU A CA    
4072 C C     . GLU A 505 ? 0.3691 0.4263 0.3771 0.0109  0.0210  0.0407  797 GLU A C     
4073 O O     . GLU A 505 ? 0.3329 0.3930 0.3446 0.0112  0.0212  0.0401  797 GLU A O     
4074 C CB    . GLU A 505 ? 0.3948 0.4511 0.4050 0.0065  0.0202  0.0455  797 GLU A CB    
4075 C CG    . GLU A 505 ? 0.5599 0.6126 0.5704 0.0042  0.0179  0.0468  797 GLU A CG    
4076 C CD    . GLU A 505 ? 0.8114 0.8667 0.8259 0.0017  0.0186  0.0501  797 GLU A CD    
4077 O OE1   . GLU A 505 ? 0.8359 0.8939 0.8498 0.0016  0.0212  0.0522  797 GLU A OE1   
4078 O OE2   . GLU A 505 ? 0.9049 0.9594 0.9232 -0.0003 0.0166  0.0505  797 GLU A OE2   
4079 N N     . ALA A 506 ? 0.2965 0.3530 0.2998 0.0126  0.0225  0.0400  798 ALA A N     
4080 C CA    . ALA A 506 ? 0.2892 0.3481 0.2916 0.0151  0.0244  0.0384  798 ALA A CA    
4081 C C     . ALA A 506 ? 0.3057 0.3627 0.3081 0.0163  0.0227  0.0355  798 ALA A C     
4082 O O     . ALA A 506 ? 0.3217 0.3814 0.3262 0.0175  0.0235  0.0345  798 ALA A O     
4083 C CB    . ALA A 506 ? 0.3286 0.3869 0.3260 0.0167  0.0262  0.0381  798 ALA A CB    
4084 N N     . VAL A 507 ? 0.2650 0.3175 0.2651 0.0160  0.0204  0.0341  799 VAL A N     
4085 C CA    . VAL A 507 ? 0.2992 0.3497 0.2992 0.0170  0.0186  0.0314  799 VAL A CA    
4086 C C     . VAL A 507 ? 0.2700 0.3226 0.2753 0.0160  0.0175  0.0316  799 VAL A C     
4087 O O     . VAL A 507 ? 0.2763 0.3299 0.2827 0.0173  0.0176  0.0300  799 VAL A O     
4088 C CB    . VAL A 507 ? 0.3200 0.3654 0.3165 0.0167  0.0163  0.0300  799 VAL A CB    
4089 C CG1   . VAL A 507 ? 0.3094 0.3531 0.3070 0.0170  0.0140  0.0277  799 VAL A CG1   
4090 C CG2   . VAL A 507 ? 0.2853 0.3289 0.2765 0.0185  0.0174  0.0288  799 VAL A CG2   
4091 N N     . ALA A 508 ? 0.2710 0.3241 0.2794 0.0137  0.0166  0.0336  800 ALA A N     
4092 C CA    . ALA A 508 ? 0.3078 0.3630 0.3213 0.0127  0.0154  0.0339  800 ALA A CA    
4093 C C     . ALA A 508 ? 0.3767 0.4368 0.3933 0.0136  0.0176  0.0343  800 ALA A C     
4094 O O     . ALA A 508 ? 0.2765 0.3380 0.2958 0.0142  0.0169  0.0333  800 ALA A O     
4095 C CB    . ALA A 508 ? 0.2766 0.3316 0.2930 0.0100  0.0142  0.0360  800 ALA A CB    
4096 N N     . ARG A 509 ? 0.2820 0.3449 0.2982 0.0138  0.0202  0.0360  801 ARG A N     
4097 C CA    . ARG A 509 ? 0.2776 0.3453 0.2963 0.0149  0.0224  0.0364  801 ARG A CA    
4098 C C     . ARG A 509 ? 0.2554 0.3230 0.2723 0.0176  0.0230  0.0339  801 ARG A C     
4099 O O     . ARG A 509 ? 0.2791 0.3494 0.2991 0.0184  0.0232  0.0333  801 ARG A O     
4100 C CB    . ARG A 509 ? 0.3191 0.3897 0.3370 0.0148  0.0251  0.0385  801 ARG A CB    
4101 C CG    . ARG A 509 ? 0.3979 0.4704 0.4192 0.0122  0.0252  0.0413  801 ARG A CG    
4102 C CD    . ARG A 509 ? 0.5514 0.6280 0.5727 0.0124  0.0283  0.0433  801 ARG A CD    
4103 N NE    . ARG A 509 ? 0.6343 0.7088 0.6501 0.0134  0.0295  0.0433  801 ARG A NE    
4104 C CZ    . ARG A 509 ? 0.5902 0.6624 0.6038 0.0120  0.0292  0.0450  801 ARG A CZ    
4105 N NH1   . ARG A 509 ? 0.6473 0.7189 0.6638 0.0093  0.0279  0.0469  801 ARG A NH1   
4106 N NH2   . ARG A 509 ? 0.5415 0.6118 0.5499 0.0131  0.0303  0.0447  801 ARG A NH2   
4107 N N     . LEU A 510 ? 0.2863 0.3507 0.2982 0.0189  0.0231  0.0324  802 LEU A N     
4108 C CA    . LEU A 510 ? 0.3035 0.3672 0.3132 0.0214  0.0236  0.0300  802 LEU A CA    
4109 C C     . LEU A 510 ? 0.3230 0.3849 0.3341 0.0216  0.0214  0.0282  802 LEU A C     
4110 O O     . LEU A 510 ? 0.2649 0.3283 0.2772 0.0231  0.0218  0.0270  802 LEU A O     
4111 C CB    . LEU A 510 ? 0.3553 0.4156 0.3594 0.0226  0.0239  0.0288  802 LEU A CB    
4112 C CG    . LEU A 510 ? 0.4713 0.5296 0.4728 0.0247  0.0237  0.0259  802 LEU A CG    
4113 C CD1   . LEU A 510 ? 0.4550 0.5166 0.4569 0.0268  0.0261  0.0255  802 LEU A CD1   
4114 C CD2   . LEU A 510 ? 0.5064 0.5604 0.5027 0.0252  0.0230  0.0245  802 LEU A CD2   
4115 N N     . ALA A 511 ? 0.2736 0.3324 0.2845 0.0201  0.0190  0.0280  803 ALA A N     
4116 C CA    . ALA A 511 ? 0.2459 0.3028 0.2577 0.0202  0.0167  0.0262  803 ALA A CA    
4117 C C     . ALA A 511 ? 0.2555 0.3157 0.2725 0.0197  0.0164  0.0269  803 ALA A C     
4118 O O     . ALA A 511 ? 0.2367 0.2972 0.2546 0.0208  0.0158  0.0255  803 ALA A O     
4119 C CB    . ALA A 511 ? 0.2391 0.2921 0.2495 0.0187  0.0142  0.0259  803 ALA A CB    
4120 N N     . LYS A 512 ? 0.2634 0.3264 0.2839 0.0180  0.0167  0.0291  804 LYS A N     
4121 C CA    . LYS A 512 ? 0.2654 0.3319 0.2910 0.0175  0.0164  0.0298  804 LYS A CA    
4122 C C     . LYS A 512 ? 0.3123 0.3821 0.3388 0.0196  0.0184  0.0293  804 LYS A C     
4123 O O     . LYS A 512 ? 0.2914 0.3625 0.3204 0.0203  0.0177  0.0284  804 LYS A O     
4124 C CB    . LYS A 512 ? 0.2755 0.3445 0.3045 0.0153  0.0168  0.0324  804 LYS A CB    
4125 C CG    . LYS A 512 ? 0.3369 0.4100 0.3717 0.0145  0.0164  0.0332  804 LYS A CG    
4126 C CD    . LYS A 512 ? 0.3411 0.4167 0.3790 0.0122  0.0170  0.0359  804 LYS A CD    
4127 C CE    . LYS A 512 ? 0.4258 0.5064 0.4694 0.0117  0.0174  0.0368  804 LYS A CE    
4128 N NZ    . LYS A 512 ? 0.5524 0.6324 0.5988 0.0113  0.0148  0.0356  804 LYS A NZ    
4129 N N     . GLU A 513 ? 0.2735 0.3448 0.2981 0.0206  0.0209  0.0298  805 GLU A N     
4130 C CA    . GLU A 513 ? 0.3063 0.3807 0.3314 0.0228  0.0229  0.0293  805 GLU A CA    
4131 C C     . GLU A 513 ? 0.2821 0.3541 0.3051 0.0248  0.0222  0.0268  805 GLU A C     
4132 O O     . GLU A 513 ? 0.2769 0.3509 0.3022 0.0261  0.0224  0.0261  805 GLU A O     
4133 C CB    . GLU A 513 ? 0.3639 0.4397 0.3865 0.0236  0.0255  0.0301  805 GLU A CB    
4134 C CG    . GLU A 513 ? 0.6166 0.6955 0.6394 0.0260  0.0277  0.0292  805 GLU A CG    
4135 C CD    . GLU A 513 ? 0.9218 1.0013 0.9412 0.0272  0.0300  0.0294  805 GLU A CD    
4136 O OE1   . GLU A 513 ? 0.9744 1.0538 0.9926 0.0257  0.0306  0.0311  805 GLU A OE1   
4137 O OE2   . GLU A 513 ? 1.0550 1.1350 1.0726 0.0295  0.0313  0.0279  805 GLU A OE2   
4138 N N     . VAL A 514 ? 0.2586 0.3261 0.2771 0.0252  0.0214  0.0254  806 VAL A N     
4139 C CA    . VAL A 514 ? 0.2933 0.3582 0.3094 0.0270  0.0209  0.0231  806 VAL A CA    
4140 C C     . VAL A 514 ? 0.2991 0.3634 0.3177 0.0266  0.0187  0.0223  806 VAL A C     
4141 O O     . VAL A 514 ? 0.2748 0.3396 0.2941 0.0282  0.0187  0.0212  806 VAL A O     
4142 C CB    . VAL A 514 ? 0.2924 0.3529 0.3034 0.0272  0.0204  0.0218  806 VAL A CB    
4143 C CG1   . VAL A 514 ? 0.2552 0.3126 0.2640 0.0286  0.0193  0.0194  806 VAL A CG1   
4144 C CG2   . VAL A 514 ? 0.2712 0.3325 0.2794 0.0283  0.0227  0.0221  806 VAL A CG2   
4145 N N     . MET A 515 ? 0.2459 0.3090 0.2657 0.0246  0.0167  0.0230  807 MET A N     
4146 C CA    . MET A 515 ? 0.2367 0.2994 0.2589 0.0241  0.0145  0.0224  807 MET A CA    
4147 C C     . MET A 515 ? 0.2940 0.3610 0.3211 0.0244  0.0149  0.0232  807 MET A C     
4148 O O     . MET A 515 ? 0.2801 0.3472 0.3082 0.0253  0.0140  0.0222  807 MET A O     
4149 C CB    . MET A 515 ? 0.2532 0.3139 0.2759 0.0218  0.0123  0.0230  807 MET A CB    
4150 C CG    . MET A 515 ? 0.2751 0.3314 0.2932 0.0217  0.0115  0.0217  807 MET A CG    
4151 S SD    . MET A 515 ? 0.2766 0.3305 0.2951 0.0192  0.0090  0.0224  807 MET A SD    
4152 C CE    . MET A 515 ? 0.2888 0.3426 0.3101 0.0188  0.0064  0.0213  807 MET A CE    
4153 N N     . GLU A 516 ? 0.2445 0.3152 0.2745 0.0235  0.0162  0.0251  808 GLU A N     
4154 C CA    . GLU A 516 ? 0.2554 0.3306 0.2903 0.0238  0.0166  0.0259  808 GLU A CA    
4155 C C     . GLU A 516 ? 0.3131 0.3900 0.3476 0.0263  0.0182  0.0250  808 GLU A C     
4156 O O     . GLU A 516 ? 0.2841 0.3632 0.3216 0.0272  0.0178  0.0247  808 GLU A O     
4157 C CB    . GLU A 516 ? 0.2601 0.3391 0.2984 0.0221  0.0176  0.0282  808 GLU A CB    
4158 C CG    . GLU A 516 ? 0.2331 0.3107 0.2730 0.0194  0.0155  0.0291  808 GLU A CG    
4159 C CD    . GLU A 516 ? 0.4026 0.4842 0.4465 0.0176  0.0164  0.0314  808 GLU A CD    
4160 O OE1   . GLU A 516 ? 0.3767 0.4616 0.4213 0.0183  0.0188  0.0324  808 GLU A OE1   
4161 O OE2   . GLU A 516 ? 0.3507 0.4320 0.3972 0.0155  0.0146  0.0322  808 GLU A OE2   
4162 N N     . GLY A 517 ? 0.2648 0.3405 0.2955 0.0277  0.0200  0.0243  809 GLY A N     
4163 C CA    . GLY A 517 ? 0.2868 0.3639 0.3171 0.0303  0.0215  0.0233  809 GLY A CA    
4164 C C     . GLY A 517 ? 0.3152 0.3883 0.3419 0.0319  0.0208  0.0212  809 GLY A C     
4165 O O     . GLY A 517 ? 0.3398 0.4133 0.3653 0.0341  0.0222  0.0202  809 GLY A O     
4166 N N     . VAL A 518 ? 0.2640 0.3334 0.2893 0.0309  0.0186  0.0204  810 VAL A N     
4167 C CA    . VAL A 518 ? 0.2501 0.3154 0.2718 0.0321  0.0178  0.0184  810 VAL A CA    
4168 C C     . VAL A 518 ? 0.3106 0.3767 0.3333 0.0342  0.0180  0.0175  810 VAL A C     
4169 O O     . VAL A 518 ? 0.3010 0.3650 0.3207 0.0359  0.0188  0.0161  810 VAL A O     
4170 C CB    . VAL A 518 ? 0.2820 0.3438 0.3025 0.0306  0.0153  0.0178  810 VAL A CB    
4171 C CG1   . VAL A 518 ? 0.2653 0.3284 0.2895 0.0298  0.0135  0.0182  810 VAL A CG1   
4172 C CG2   . VAL A 518 ? 0.3598 0.4173 0.3760 0.0317  0.0149  0.0158  810 VAL A CG2   
4173 N N     . TYR A 519 ? 0.3064 0.3754 0.3333 0.0341  0.0174  0.0182  811 TYR A N     
4174 C CA    . TYR A 519 ? 0.2875 0.3575 0.3157 0.0361  0.0175  0.0175  811 TYR A CA    
4175 C C     . TYR A 519 ? 0.3048 0.3797 0.3382 0.0360  0.0176  0.0188  811 TYR A C     
4176 O O     . TYR A 519 ? 0.3152 0.3914 0.3512 0.0341  0.0163  0.0198  811 TYR A O     
4177 C CB    . TYR A 519 ? 0.2753 0.3417 0.3021 0.0362  0.0153  0.0163  811 TYR A CB    
4178 C CG    . TYR A 519 ? 0.2979 0.3639 0.3245 0.0385  0.0156  0.0153  811 TYR A CG    
4179 C CD1   . TYR A 519 ? 0.3290 0.3922 0.3520 0.0400  0.0166  0.0139  811 TYR A CD1   
4180 C CD2   . TYR A 519 ? 0.3560 0.4242 0.3860 0.0391  0.0147  0.0157  811 TYR A CD2   
4181 C CE1   . TYR A 519 ? 0.4165 0.4790 0.4392 0.0421  0.0168  0.0130  811 TYR A CE1   
4182 C CE2   . TYR A 519 ? 0.3764 0.4440 0.4061 0.0413  0.0149  0.0148  811 TYR A CE2   
4183 C CZ    . TYR A 519 ? 0.4891 0.5537 0.5151 0.0428  0.0159  0.0135  811 TYR A CZ    
4184 O OH    . TYR A 519 ? 0.5944 0.6581 0.6202 0.0449  0.0160  0.0127  811 TYR A OH    
4185 N N     . PRO A 520 ? 0.3085 0.3861 0.3434 0.0380  0.0190  0.0187  812 PRO A N     
4186 C CA    . PRO A 520 ? 0.3502 0.4329 0.3902 0.0380  0.0192  0.0198  812 PRO A CA    
4187 C C     . PRO A 520 ? 0.2865 0.3691 0.3288 0.0380  0.0170  0.0196  812 PRO A C     
4188 O O     . PRO A 520 ? 0.3628 0.4431 0.4036 0.0396  0.0164  0.0184  812 PRO A O     
4189 C CB    . PRO A 520 ? 0.3594 0.4444 0.3996 0.0405  0.0213  0.0194  812 PRO A CB    
4190 C CG    . PRO A 520 ? 0.4508 0.5313 0.4866 0.0421  0.0213  0.0176  812 PRO A CG    
4191 C CD    . PRO A 520 ? 0.4034 0.4797 0.4356 0.0404  0.0205  0.0174  812 PRO A CD    
4192 N N     . LEU A 521 ? 0.3297 0.4147 0.3756 0.0362  0.0159  0.0208  813 LEU A N     
4193 C CA    . LEU A 521 ? 0.3322 0.4179 0.3808 0.0361  0.0138  0.0207  813 LEU A CA    
4194 C C     . LEU A 521 ? 0.3464 0.4378 0.4004 0.0362  0.0143  0.0218  813 LEU A C     
4195 O O     . LEU A 521 ? 0.3527 0.4475 0.4082 0.0362  0.0163  0.0226  813 LEU A O     
4196 C CB    . LEU A 521 ? 0.2936 0.3771 0.3420 0.0337  0.0116  0.0209  813 LEU A CB    
4197 C CG    . LEU A 521 ? 0.2928 0.3709 0.3362 0.0333  0.0109  0.0198  813 LEU A CG    
4198 C CD1   . LEU A 521 ? 0.2835 0.3600 0.3272 0.0310  0.0087  0.0200  813 LEU A CD1   
4199 C CD2   . LEU A 521 ? 0.2735 0.3486 0.3143 0.0353  0.0104  0.0184  813 LEU A CD2   
4200 N N     . ALA A 522 ? 0.2734 0.3661 0.3303 0.0363  0.0125  0.0217  814 ALA A N     
4201 C CA    . ALA A 522 ? 0.3667 0.4648 0.4289 0.0365  0.0126  0.0226  814 ALA A CA    
4202 C C     . ALA A 522 ? 0.3827 0.4833 0.4481 0.0337  0.0122  0.0240  814 ALA A C     
4203 O O     . ALA A 522 ? 0.3269 0.4325 0.3971 0.0334  0.0126  0.0249  814 ALA A O     
4204 C CB    . ALA A 522 ? 0.3361 0.4344 0.4000 0.0376  0.0106  0.0220  814 ALA A CB    
4205 N N     . VAL A 523 ? 0.3078 0.4051 0.3709 0.0318  0.0114  0.0241  815 VAL A N     
4206 C CA    . VAL A 523 ? 0.2680 0.3668 0.3333 0.0291  0.0112  0.0254  815 VAL A CA    
4207 C C     . VAL A 523 ? 0.2543 0.3504 0.3158 0.0282  0.0125  0.0257  815 VAL A C     
4208 O O     . VAL A 523 ? 0.2983 0.3905 0.3552 0.0293  0.0129  0.0246  815 VAL A O     
4209 C CB    . VAL A 523 ? 0.2602 0.3575 0.3268 0.0273  0.0083  0.0253  815 VAL A CB    
4210 C CG1   . VAL A 523 ? 0.2707 0.3714 0.3416 0.0280  0.0070  0.0251  815 VAL A CG1   
4211 C CG2   . VAL A 523 ? 0.2633 0.3550 0.3251 0.0276  0.0069  0.0239  815 VAL A CG2   
4212 N N     . PRO A 524 ? 0.3272 0.4255 0.3906 0.0262  0.0134  0.0272  816 PRO A N     
4213 C CA    . PRO A 524 ? 0.2835 0.3790 0.3431 0.0253  0.0145  0.0276  816 PRO A CA    
4214 C C     . PRO A 524 ? 0.2708 0.3613 0.3275 0.0240  0.0123  0.0269  816 PRO A C     
4215 O O     . PRO A 524 ? 0.2875 0.3775 0.3461 0.0231  0.0100  0.0266  816 PRO A O     
4216 C CB    . PRO A 524 ? 0.3990 0.4983 0.4621 0.0233  0.0155  0.0296  816 PRO A CB    
4217 C CG    . PRO A 524 ? 0.4438 0.5462 0.5122 0.0223  0.0139  0.0300  816 PRO A CG    
4218 C CD    . PRO A 524 ? 0.3465 0.4498 0.4155 0.0247  0.0134  0.0287  816 PRO A CD    
4219 N N     . LEU A 525 ? 0.2281 0.3149 0.2801 0.0241  0.0129  0.0264  817 LEU A N     
4220 C CA    . LEU A 525 ? 0.2720 0.3545 0.3215 0.0226  0.0110  0.0260  817 LEU A CA    
4221 C C     . LEU A 525 ? 0.3476 0.4307 0.3981 0.0203  0.0114  0.0277  817 LEU A C     
4222 O O     . LEU A 525 ? 0.3760 0.4610 0.4262 0.0203  0.0136  0.0287  817 LEU A O     
4223 C CB    . LEU A 525 ? 0.2750 0.3530 0.3190 0.0239  0.0113  0.0245  817 LEU A CB    
4224 C CG    . LEU A 525 ? 0.3069 0.3835 0.3495 0.0259  0.0107  0.0229  817 LEU A CG    
4225 C CD1   . LEU A 525 ? 0.3055 0.3781 0.3429 0.0271  0.0113  0.0215  817 LEU A CD1   
4226 C CD2   . LEU A 525 ? 0.3563 0.4318 0.4003 0.0251  0.0079  0.0223  817 LEU A CD2   
4227 N N     . GLU A 526 ? 0.2674 0.3489 0.3190 0.0183  0.0091  0.0279  818 GLU A N     
4228 C CA    . GLU A 526 ? 0.2365 0.3180 0.2889 0.0160  0.0092  0.0295  818 GLU A CA    
4229 C C     . GLU A 526 ? 0.2320 0.3082 0.2802 0.0152  0.0077  0.0287  818 GLU A C     
4230 O O     . GLU A 526 ? 0.2422 0.3157 0.2892 0.0154  0.0056  0.0272  818 GLU A O     
4231 C CB    . GLU A 526 ? 0.3245 0.4089 0.3823 0.0140  0.0078  0.0306  818 GLU A CB    
4232 C CG    . GLU A 526 ? 0.5676 0.6576 0.6298 0.0142  0.0097  0.0319  818 GLU A CG    
4233 C CD    . GLU A 526 ? 0.8336 0.9264 0.9010 0.0118  0.0086  0.0334  818 GLU A CD    
4234 O OE1   . GLU A 526 ? 0.8585 0.9500 0.9274 0.0108  0.0060  0.0327  818 GLU A OE1   
4235 O OE2   . GLU A 526 ? 1.0067 1.1030 1.0766 0.0108  0.0104  0.0351  818 GLU A OE2   
4236 N N     . VAL A 527 ? 0.2194 0.2944 0.2654 0.0143  0.0088  0.0297  819 VAL A N     
4237 C CA    . VAL A 527 ? 0.2230 0.2933 0.2652 0.0135  0.0075  0.0291  819 VAL A CA    
4238 C C     . VAL A 527 ? 0.2304 0.3008 0.2742 0.0111  0.0072  0.0310  819 VAL A C     
4239 O O     . VAL A 527 ? 0.3077 0.3807 0.3528 0.0105  0.0092  0.0328  819 VAL A O     
4240 C CB    . VAL A 527 ? 0.2457 0.3137 0.2827 0.0152  0.0092  0.0283  819 VAL A CB    
4241 C CG1   . VAL A 527 ? 0.2533 0.3169 0.2864 0.0142  0.0082  0.0280  819 VAL A CG1   
4242 C CG2   . VAL A 527 ? 0.2427 0.3097 0.2779 0.0173  0.0091  0.0262  819 VAL A CG2   
4243 N N     . GLU A 528 ? 0.2381 0.3057 0.2820 0.0096  0.0046  0.0305  820 GLU A N     
4244 C CA    . GLU A 528 ? 0.2332 0.2998 0.2780 0.0073  0.0040  0.0322  820 GLU A CA    
4245 C C     . GLU A 528 ? 0.2558 0.3180 0.2953 0.0075  0.0041  0.0318  820 GLU A C     
4246 O O     . GLU A 528 ? 0.3091 0.3683 0.3452 0.0087  0.0031  0.0298  820 GLU A O     
4247 C CB    . GLU A 528 ? 0.3241 0.3900 0.3721 0.0057  0.0010  0.0318  820 GLU A CB    
4248 C CG    . GLU A 528 ? 0.4485 0.5189 0.5021 0.0053  0.0009  0.0324  820 GLU A CG    
4249 C CD    . GLU A 528 ? 0.6353 0.7050 0.6915 0.0043  -0.0022 0.0314  820 GLU A CD    
4250 O OE1   . GLU A 528 ? 0.5647 0.6305 0.6188 0.0037  -0.0043 0.0305  820 GLU A OE1   
4251 O OE2   . GLU A 528 ? 0.7983 0.8716 0.8590 0.0042  -0.0027 0.0315  820 GLU A OE2   
4252 N N     . VAL A 529 ? 0.2565 0.3186 0.2953 0.0064  0.0053  0.0336  821 VAL A N     
4253 C CA    . VAL A 529 ? 0.1994 0.2577 0.2330 0.0067  0.0056  0.0333  821 VAL A CA    
4254 C C     . VAL A 529 ? 0.2519 0.3084 0.2859 0.0044  0.0046  0.0351  821 VAL A C     
4255 O O     . VAL A 529 ? 0.2605 0.3196 0.2983 0.0028  0.0051  0.0371  821 VAL A O     
4256 C CB    . VAL A 529 ? 0.2664 0.3263 0.2973 0.0084  0.0087  0.0337  821 VAL A CB    
4257 C CG1   . VAL A 529 ? 0.4023 0.4665 0.4364 0.0075  0.0109  0.0362  821 VAL A CG1   
4258 C CG2   . VAL A 529 ? 0.2871 0.3431 0.3126 0.0089  0.0089  0.0333  821 VAL A CG2   
4259 N N     . GLY A 530 ? 0.2074 0.2594 0.2377 0.0043  0.0031  0.0342  822 GLY A N     
4260 C CA    . GLY A 530 ? 0.2683 0.3178 0.2984 0.0024  0.0020  0.0357  822 GLY A CA    
4261 C C     . GLY A 530 ? 0.3122 0.3577 0.3366 0.0032  0.0020  0.0350  822 GLY A C     
4262 O O     . GLY A 530 ? 0.2413 0.2855 0.2623 0.0051  0.0023  0.0330  822 GLY A O     
4263 N N     . ILE A 531 ? 0.2205 0.2643 0.2441 0.0017  0.0019  0.0368  823 ILE A N     
4264 C CA    . ILE A 531 ? 0.2155 0.2555 0.2337 0.0024  0.0019  0.0365  823 ILE A CA    
4265 C C     . ILE A 531 ? 0.2503 0.2865 0.2685 0.0007  -0.0007 0.0369  823 ILE A C     
4266 O O     . ILE A 531 ? 0.2801 0.3170 0.3019 -0.0014 -0.0014 0.0388  823 ILE A O     
4267 C CB    . ILE A 531 ? 0.2732 0.3150 0.2897 0.0026  0.0049  0.0386  823 ILE A CB    
4268 C CG1   . ILE A 531 ? 0.3310 0.3770 0.3483 0.0042  0.0076  0.0384  823 ILE A CG1   
4269 C CG2   . ILE A 531 ? 0.3317 0.3697 0.3424 0.0036  0.0050  0.0381  823 ILE A CG2   
4270 C CD1   . ILE A 531 ? 0.3339 0.3821 0.3495 0.0045  0.0107  0.0404  823 ILE A CD1   
4271 N N     . GLY A 532 ? 0.2252 0.2573 0.2394 0.0016  -0.0023 0.0351  824 GLY A N     
4272 C CA    . GLY A 532 ? 0.2490 0.2772 0.2627 0.0002  -0.0049 0.0353  824 GLY A CA    
4273 C C     . GLY A 532 ? 0.2588 0.2829 0.2674 0.0015  -0.0062 0.0333  824 GLY A C     
4274 O O     . GLY A 532 ? 0.2535 0.2776 0.2591 0.0034  -0.0053 0.0314  824 GLY A O     
4275 N N     . GLU A 533 ? 0.2243 0.2446 0.2319 0.0004  -0.0083 0.0337  825 GLU A N     
4276 C CA    . GLU A 533 ? 0.2439 0.2603 0.2469 0.0015  -0.0097 0.0318  825 GLU A CA    
4277 C C     . GLU A 533 ? 0.2304 0.2456 0.2335 0.0023  -0.0121 0.0287  825 GLU A C     
4278 O O     . GLU A 533 ? 0.2937 0.3065 0.2931 0.0037  -0.0129 0.0266  825 GLU A O     
4279 C CB    . GLU A 533 ? 0.3224 0.3352 0.3242 0.0002  -0.0112 0.0334  825 GLU A CB    
4280 C CG    . GLU A 533 ? 0.4183 0.4318 0.4184 -0.0001 -0.0087 0.0363  825 GLU A CG    
4281 C CD    . GLU A 533 ? 0.6224 0.6316 0.6191 -0.0004 -0.0099 0.0371  825 GLU A CD    
4282 O OE1   . GLU A 533 ? 0.5974 0.6033 0.5947 -0.0013 -0.0128 0.0364  825 GLU A OE1   
4283 O OE2   . GLU A 533 ? 0.6057 0.6146 0.5989 0.0002  -0.0080 0.0384  825 GLU A OE2   
4284 N N     . ASP A 534 ? 0.2578 0.2750 0.2654 0.0014  -0.0131 0.0285  826 ASP A N     
4285 C CA    . ASP A 534 ? 0.1979 0.2147 0.2059 0.0022  -0.0151 0.0256  826 ASP A CA    
4286 C C     . ASP A 534 ? 0.2344 0.2552 0.2460 0.0024  -0.0141 0.0254  826 ASP A C     
4287 O O     . ASP A 534 ? 0.2658 0.2896 0.2804 0.0015  -0.0124 0.0275  826 ASP A O     
4288 C CB    . ASP A 534 ? 0.2142 0.2281 0.2236 0.0010  -0.0185 0.0249  826 ASP A CB    
4289 C CG    . ASP A 534 ? 0.3258 0.3412 0.3404 -0.0012 -0.0192 0.0270  826 ASP A CG    
4290 O OD1   . ASP A 534 ? 0.3131 0.3308 0.3312 -0.0015 -0.0198 0.0263  826 ASP A OD1   
4291 O OD2   . ASP A 534 ? 0.4344 0.4484 0.4493 -0.0026 -0.0192 0.0292  826 ASP A OD2   
4292 N N     . TRP A 535 ? 0.2102 0.2311 0.2215 0.0035  -0.0152 0.0229  827 TRP A N     
4293 C CA    . TRP A 535 ? 0.2180 0.2424 0.2319 0.0040  -0.0142 0.0224  827 TRP A CA    
4294 C C     . TRP A 535 ? 0.2303 0.2571 0.2497 0.0023  -0.0151 0.0238  827 TRP A C     
4295 O O     . TRP A 535 ? 0.2337 0.2641 0.2558 0.0023  -0.0133 0.0250  827 TRP A O     
4296 C CB    . TRP A 535 ? 0.2013 0.2249 0.2135 0.0054  -0.0156 0.0194  827 TRP A CB    
4297 C CG    . TRP A 535 ? 0.2193 0.2460 0.2333 0.0063  -0.0146 0.0187  827 TRP A CG    
4298 C CD1   . TRP A 535 ? 0.2407 0.2710 0.2576 0.0062  -0.0127 0.0203  827 TRP A CD1   
4299 C CD2   . TRP A 535 ? 0.2073 0.2338 0.2203 0.0074  -0.0157 0.0163  827 TRP A CD2   
4300 N NE1   . TRP A 535 ? 0.2596 0.2918 0.2773 0.0074  -0.0125 0.0189  827 TRP A NE1   
4301 C CE2   . TRP A 535 ? 0.2762 0.3060 0.2915 0.0080  -0.0144 0.0165  827 TRP A CE2   
4302 C CE3   . TRP A 535 ? 0.2488 0.2727 0.2593 0.0080  -0.0177 0.0139  827 TRP A CE3   
4303 C CZ2   . TRP A 535 ? 0.3401 0.3705 0.3550 0.0091  -0.0149 0.0146  827 TRP A CZ2   
4304 C CZ3   . TRP A 535 ? 0.2801 0.3048 0.2902 0.0090  -0.0182 0.0119  827 TRP A CZ3   
4305 C CH2   . TRP A 535 ? 0.3081 0.3358 0.3203 0.0095  -0.0168 0.0124  827 TRP A CH2   
4306 N N     . LEU A 536 ? 0.2313 0.2561 0.2523 0.0009  -0.0178 0.0237  828 LEU A N     
4307 C CA    . LEU A 536 ? 0.2353 0.2622 0.2617 -0.0008 -0.0188 0.0249  828 LEU A CA    
4308 C C     . LEU A 536 ? 0.1782 0.2072 0.2068 -0.0021 -0.0167 0.0280  828 LEU A C     
4309 O O     . LEU A 536 ? 0.2101 0.2427 0.2427 -0.0027 -0.0157 0.0291  828 LEU A O     
4310 C CB    . LEU A 536 ? 0.2383 0.2623 0.2658 -0.0020 -0.0221 0.0242  828 LEU A CB    
4311 C CG    . LEU A 536 ? 0.2744 0.3003 0.3075 -0.0038 -0.0235 0.0252  828 LEU A CG    
4312 C CD1   . LEU A 536 ? 0.2642 0.2934 0.3000 -0.0031 -0.0237 0.0239  828 LEU A CD1   
4313 C CD2   . LEU A 536 ? 0.2877 0.3102 0.3214 -0.0050 -0.0268 0.0244  828 LEU A CD2   
4314 N N     . SER A 537 ? 0.2452 0.2719 0.2712 -0.0025 -0.0159 0.0295  829 SER A N     
4315 C CA    . SER A 537 ? 0.3019 0.3303 0.3294 -0.0038 -0.0138 0.0326  829 SER A CA    
4316 C C     . SER A 537 ? 0.3015 0.3339 0.3292 -0.0026 -0.0106 0.0332  829 SER A C     
4317 O O     . SER A 537 ? 0.2768 0.3125 0.3078 -0.0037 -0.0090 0.0354  829 SER A O     
4318 C CB    . SER A 537 ? 0.3761 0.4011 0.3998 -0.0041 -0.0135 0.0338  829 SER A CB    
4319 O OG    . SER A 537 ? 0.4057 0.4271 0.4299 -0.0054 -0.0164 0.0337  829 SER A OG    
4320 N N     . ALA A 538 ? 0.2130 0.2453 0.2372 -0.0005 -0.0097 0.0313  830 ALA A N     
4321 C CA    . ALA A 538 ? 0.2356 0.2714 0.2598 0.0009  -0.0068 0.0315  830 ALA A CA    
4322 C C     . ALA A 538 ? 0.3586 0.3979 0.3870 0.0010  -0.0070 0.0309  830 ALA A C     
4323 O O     . ALA A 538 ? 0.3654 0.4084 0.3953 0.0017  -0.0048 0.0317  830 ALA A O     
4324 C CB    . ALA A 538 ? 0.2531 0.2872 0.2721 0.0031  -0.0059 0.0296  830 ALA A CB    
4325 N N     . LYS A 539 ? 0.3853 0.4236 0.4156 0.0005  -0.0098 0.0295  831 LYS A N     
4326 C CA    . LYS A 539 ? 0.4496 0.4909 0.4832 0.0010  -0.0102 0.0284  831 LYS A CA    
4327 C C     . LYS A 539 ? 0.7189 0.7628 0.7581 -0.0009 -0.0108 0.0301  831 LYS A C     
4328 O O     . LYS A 539 ? 0.7145 0.7621 0.7571 -0.0007 -0.0105 0.0301  831 LYS A O     
4329 C CB    . LYS A 539 ? 0.4461 0.4850 0.4783 0.0018  -0.0128 0.0257  831 LYS A CB    
4330 C CG    . LYS A 539 ? 0.5990 0.6403 0.6322 0.0032  -0.0127 0.0242  831 LYS A CG    
4331 C CD    . LYS A 539 ? 0.6401 0.6797 0.6734 0.0033  -0.0157 0.0219  831 LYS A CD    
4332 C CE    . LYS A 539 ? 0.7473 0.7873 0.7786 0.0052  -0.0155 0.0199  831 LYS A CE    
4333 N NZ    . LYS A 539 ? 0.7349 0.7789 0.7690 0.0059  -0.0139 0.0205  831 LYS A NZ    
4334 N N     . GLU A 540 ? 0.9102 0.9525 0.9504 -0.0029 -0.0118 0.0316  832 GLU A N     
4335 C CA    . GLU A 540 ? 1.1283 1.1730 1.1737 -0.0050 -0.0119 0.0337  832 GLU A CA    
4336 C C     . GLU A 540 ? 1.1955 1.2425 1.2455 -0.0055 -0.0138 0.0327  832 GLU A C     
4337 O O     . GLU A 540 ? 1.1375 1.1877 1.1922 -0.0068 -0.0135 0.0342  832 GLU A O     
4338 C CB    . GLU A 540 ? 1.2011 1.2495 1.2475 -0.0050 -0.0085 0.0360  832 GLU A CB    
4339 C CG    . GLU A 540 ? 1.2504 1.2969 1.2923 -0.0046 -0.0066 0.0371  832 GLU A CG    
4340 C CD    . GLU A 540 ? 1.3175 1.3678 1.3594 -0.0039 -0.0031 0.0387  832 GLU A CD    
4341 O OE1   . GLU A 540 ? 1.3563 1.4104 1.4008 -0.0030 -0.0021 0.0382  832 GLU A OE1   
4342 O OE2   . GLU A 540 ? 1.3209 1.3704 1.3602 -0.0040 -0.0014 0.0403  832 GLU A OE2   
4343 O OXT   . GLU A 540 ? 1.2672 1.3128 1.3163 -0.0045 -0.0158 0.0304  832 GLU A OXT   
4344 P P     . DC  B 3   ? 1.8656 1.8230 1.8475 0.0489  0.0076  -0.0962 103 DC  B P     
4345 O OP1   . DC  B 3   ? 1.8795 1.8351 1.8619 0.0469  0.0091  -0.0969 103 DC  B OP1   
4346 O OP2   . DC  B 3   ? 1.8858 1.8338 1.8471 0.0459  0.0046  -0.0958 103 DC  B OP2   
4347 O "O5'" . DC  B 3   ? 1.6331 1.6110 1.6528 0.0519  0.0116  -0.0961 103 DC  B "O5'" 
4348 C "C5'" . DC  B 3   ? 1.6113 1.5991 1.6508 0.0501  0.0148  -0.0965 103 DC  B "C5'" 
4349 C "C4'" . DC  B 3   ? 1.5790 1.5853 1.6515 0.0515  0.0188  -0.0923 103 DC  B "C4'" 
4350 O "O4'" . DC  B 3   ? 1.5759 1.5773 1.6349 0.0556  0.0154  -0.0915 103 DC  B "O4'" 
4351 C "C3'" . DC  B 3   ? 1.5557 1.5730 1.6506 0.0489  0.0236  -0.0890 103 DC  B "C3'" 
4352 O "O3'" . DC  B 3   ? 1.5337 1.5676 1.6622 0.0434  0.0299  -0.0832 103 DC  B "O3'" 
4353 C "C2'" . DC  B 3   ? 1.5421 1.5664 1.6450 0.0521  0.0231  -0.0844 103 DC  B "C2'" 
4354 C "C1'" . DC  B 3   ? 1.5625 1.5715 1.6336 0.0568  0.0167  -0.0886 103 DC  B "C1'" 
4355 N N1    . DC  B 3   ? 1.5807 1.5729 1.6174 0.0591  0.0111  -0.0914 103 DC  B N1    
4356 C C2    . DC  B 3   ? 1.5743 1.5699 1.6133 0.0621  0.0103  -0.0892 103 DC  B C2    
4357 O O2    . DC  B 3   ? 1.5520 1.5656 1.6242 0.0620  0.0151  -0.0840 103 DC  B O2    
4358 N N3    . DC  B 3   ? 1.5701 1.5488 1.5715 0.0615  0.0038  -0.0872 103 DC  B N3    
4359 C C4    . DC  B 3   ? 1.5559 1.5158 1.5219 0.0600  -0.0013 -0.0906 103 DC  B C4    
4360 N N4    . DC  B 3   ? 1.5361 1.4809 1.4672 0.0582  -0.0074 -0.0868 103 DC  B N4    
4361 C C5    . DC  B 3   ? 1.5743 1.5324 1.5416 0.0564  0.0004  -0.0923 103 DC  B C5    
4362 C C6    . DC  B 3   ? 1.5822 1.5558 1.5838 0.0571  0.0062  -0.0937 103 DC  B C6    
4363 P P     . DC  B 4   ? 1.8539 1.8902 1.9840 0.0315  0.0320  -0.0703 104 DC  B P     
4364 O OP1   . DC  B 4   ? 1.8361 1.8888 2.0025 0.0292  0.0388  -0.0701 104 DC  B OP1   
4365 O OP2   . DC  B 4   ? 1.8835 1.8984 1.9703 0.0281  0.0257  -0.0708 104 DC  B OP2   
4366 O "O5'" . DC  B 4   ? 1.5075 1.5526 1.6466 0.0267  0.0328  -0.0564 104 DC  B "O5'" 
4367 C "C5'" . DC  B 4   ? 1.4673 1.5329 1.6461 0.0287  0.0385  -0.0535 104 DC  B "C5'" 
4368 C "C4'" . DC  B 4   ? 1.4434 1.5125 1.6211 0.0249  0.0376  -0.0413 104 DC  B "C4'" 
4369 O "O4'" . DC  B 4   ? 1.4227 1.4798 1.5750 0.0319  0.0321  -0.0471 104 DC  B "O4'" 
4370 C "C3'" . DC  B 4   ? 1.4666 1.5286 1.6240 0.0138  0.0354  -0.0279 104 DC  B "C3'" 
4371 O "O3'" . DC  B 4   ? 1.5009 1.5786 1.6880 0.0058  0.0412  -0.0178 104 DC  B "O3'" 
4372 C "C2'" . DC  B 4   ? 1.4223 1.4813 1.5672 0.0143  0.0322  -0.0215 104 DC  B "C2'" 
4373 C "C1'" . DC  B 4   ? 1.3882 1.4391 1.5206 0.0259  0.0288  -0.0355 104 DC  B "C1'" 
4374 N N1    . DC  B 4   ? 1.3285 1.3562 1.4146 0.0275  0.0212  -0.0401 104 DC  B N1    
4375 C C2    . DC  B 4   ? 1.3244 1.3429 1.3855 0.0250  0.0165  -0.0327 104 DC  B C2    
4376 O O2    . DC  B 4   ? 1.3085 1.3383 1.3864 0.0216  0.0188  -0.0223 104 DC  B O2    
4377 N N3    . DC  B 4   ? 1.3624 1.3596 1.3811 0.0265  0.0096  -0.0370 104 DC  B N3    
4378 C C4    . DC  B 4   ? 1.3564 1.3418 1.3579 0.0302  0.0073  -0.0483 104 DC  B C4    
4379 N N4    . DC  B 4   ? 1.3455 1.3099 1.3050 0.0315  0.0003  -0.0522 104 DC  B N4    
4380 C C5    . DC  B 4   ? 1.3403 1.3348 1.3669 0.0327  0.0119  -0.0560 104 DC  B C5    
4381 C C6    . DC  B 4   ? 1.3174 1.3329 1.3856 0.0312  0.0188  -0.0516 104 DC  B C6    
4382 P P     . DA  B 5   ? 1.9012 1.9728 2.0726 -0.0060 0.0404  -0.0066 105 DA  B P     
4383 O OP1   . DA  B 5   ? 1.8713 1.9615 2.0801 -0.0117 0.0473  0.0003  105 DA  B OP1   
4384 O OP2   . DA  B 5   ? 1.9195 1.9713 2.0552 -0.0048 0.0353  -0.0149 105 DA  B OP2   
4385 O "O5'" . DA  B 5   ? 1.2037 1.2705 1.3570 -0.0113 0.0370  0.0060  105 DA  B "O5'" 
4386 C "C5'" . DA  B 5   ? 1.1631 1.2458 1.3433 -0.0126 0.0405  0.0148  105 DA  B "C5'" 
4387 C "C4'" . DA  B 5   ? 1.1353 1.2088 1.2902 -0.0150 0.0357  0.0229  105 DA  B "C4'" 
4388 O "O4'" . DA  B 5   ? 1.1043 1.1636 1.2326 -0.0061 0.0303  0.0123  105 DA  B "O4'" 
4389 C "C3'" . DA  B 5   ? 1.1473 1.2076 1.2714 -0.0246 0.0319  0.0324  105 DA  B "C3'" 
4390 O "O3'" . DA  B 5   ? 1.1781 1.2514 1.3238 -0.0342 0.0363  0.0464  105 DA  B "O3'" 
4391 C "C2'" . DA  B 5   ? 1.0947 1.1422 1.1888 -0.0223 0.0260  0.0340  105 DA  B "C2'" 
4392 C "C1'" . DA  B 5   ? 1.0657 1.1092 1.1571 -0.0101 0.0243  0.0186  105 DA  B "C1'" 
4393 N N9    . DA  B 5   ? 1.0077 1.0307 1.0621 -0.0064 0.0185  0.0083  105 DA  B N9    
4394 C C8    . DA  B 5   ? 0.9723 0.9911 1.0258 -0.0018 0.0188  -0.0037 105 DA  B C8    
4395 N N7    . DA  B 5   ? 0.9352 0.9339 0.9506 0.0007  0.0127  -0.0110 105 DA  B N7    
4396 C C5    . DA  B 5   ? 0.8852 0.8741 0.8747 -0.0023 0.0080  -0.0031 105 DA  B C5    
4397 C C6    . DA  B 5   ? 0.8081 0.7756 0.7534 -0.0017 0.0006  -0.0051 105 DA  B C6    
4398 N N6    . DA  B 5   ? 0.6832 0.6346 0.6017 0.0024  -0.0035 -0.0161 105 DA  B N6    
4399 N N1    . DA  B 5   ? 0.8316 0.7948 0.7613 -0.0054 -0.0024 0.0048  105 DA  B N1    
4400 C C2    . DA  B 5   ? 0.8780 0.8572 0.8345 -0.0095 0.0017  0.0159  105 DA  B C2    
4401 N N3    . DA  B 5   ? 0.9208 0.9207 0.9192 -0.0105 0.0087  0.0188  105 DA  B N3    
4402 C C4    . DA  B 5   ? 0.9367 0.9404 0.9498 -0.0067 0.0115  0.0088  105 DA  B C4    
4403 P P     . DC  B 6   ? 1.3390 1.4064 1.4712 -0.0448 0.0359  0.0542  106 DC  B P     
4404 O OP1   . DC  B 6   ? 1.3218 1.4002 1.4719 -0.0485 0.0384  0.0604  106 DC  B OP1   
4405 O OP2   . DC  B 6   ? 1.3298 1.3882 1.4509 -0.0413 0.0349  0.0423  106 DC  B OP2   
4406 O "O5'" . DC  B 6   ? 1.1676 1.2166 1.2572 -0.0491 0.0290  0.0609  106 DC  B "O5'" 
4407 C "C5'" . DC  B 6   ? 1.1062 1.1585 1.1957 -0.0511 0.0281  0.0706  106 DC  B "C5'" 
4408 C "C4'" . DC  B 6   ? 1.0742 1.1057 1.1188 -0.0516 0.0205  0.0716  106 DC  B "C4'" 
4409 O "O4'" . DC  B 6   ? 1.0793 1.0993 1.1056 -0.0411 0.0165  0.0574  106 DC  B "O4'" 
4410 C "C3'" . DC  B 6   ? 1.0035 1.0199 1.0172 -0.0591 0.0169  0.0750  106 DC  B "C3'" 
4411 O "O3'" . DC  B 6   ? 0.9387 0.9595 0.9557 -0.0679 0.0181  0.0880  106 DC  B "O3'" 
4412 C "C2'" . DC  B 6   ? 1.0325 1.0278 1.0037 -0.0545 0.0093  0.0693  106 DC  B "C2'" 
4413 C "C1'" . DC  B 6   ? 1.0552 1.0532 1.0373 -0.0423 0.0097  0.0553  106 DC  B "C1'" 
4414 N N1    . DC  B 6   ? 1.0080 0.9969 0.9796 -0.0366 0.0084  0.0410  106 DC  B N1    
4415 C C2    . DC  B 6   ? 0.9975 0.9646 0.9271 -0.0338 0.0015  0.0341  106 DC  B C2    
4416 O O2    . DC  B 6   ? 1.0327 0.9884 0.9345 -0.0361 -0.0034 0.0399  106 DC  B O2    
4417 N N3    . DC  B 6   ? 0.9535 0.9125 0.8739 -0.0286 0.0003  0.0212  106 DC  B N3    
4418 C C4    . DC  B 6   ? 0.9159 0.8877 0.8671 -0.0262 0.0057  0.0153  106 DC  B C4    
4419 N N4    . DC  B 6   ? 0.8554 0.8184 0.7961 -0.0210 0.0043  0.0025  106 DC  B N4    
4420 C C5    . DC  B 6   ? 0.9660 0.9600 0.9602 -0.0289 0.0128  0.0222  106 DC  B C5    
4421 C C6    . DC  B 6   ? 0.9714 0.9733 0.9743 -0.0340 0.0139  0.0349  106 DC  B C6    
4422 P P     . DG  B 7   ? 1.0097 1.0238 1.0165 -0.0711 0.0177  0.0860  107 DG  B P     
4423 O OP1   . DG  B 7   ? 0.9754 0.9945 0.9921 -0.0696 0.0188  0.0870  107 DG  B OP1   
4424 O OP2   . DG  B 7   ? 0.9300 0.9502 0.9530 -0.0729 0.0215  0.0824  107 DG  B OP2   
4425 O "O5'" . DG  B 7   ? 0.6683 0.6606 0.6297 -0.0722 0.0103  0.0849  107 DG  B "O5'" 
4426 C "C5'" . DG  B 7   ? 0.6707 0.6551 0.6133 -0.0688 0.0058  0.0854  107 DG  B "C5'" 
4427 C "C4'" . DG  B 7   ? 0.6610 0.6265 0.5662 -0.0671 -0.0008 0.0795  107 DG  B "C4'" 
4428 O "O4'" . DG  B 7   ? 0.6722 0.6274 0.5591 -0.0658 -0.0030 0.0748  107 DG  B "O4'" 
4429 C "C3'" . DG  B 7   ? 0.6585 0.6203 0.5580 -0.0699 -0.0013 0.0771  107 DG  B "C3'" 
4430 O "O3'" . DG  B 7   ? 0.5633 0.5218 0.4545 -0.0682 -0.0040 0.0761  107 DG  B "O3'" 
4431 C "C2'" . DG  B 7   ? 0.7203 0.6668 0.5931 -0.0694 -0.0050 0.0695  107 DG  B "C2'" 
4432 C "C1'" . DG  B 7   ? 0.7501 0.6910 0.6125 -0.0653 -0.0066 0.0670  107 DG  B "C1'" 
4433 N N9    . DG  B 7   ? 0.7253 0.6654 0.5922 -0.0625 -0.0045 0.0586  107 DG  B N9    
4434 C C8    . DG  B 7   ? 0.6104 0.5696 0.5187 -0.0603 0.0023  0.0560  107 DG  B C8    
4435 N N7    . DG  B 7   ? 0.6482 0.6051 0.5595 -0.0527 0.0026  0.0422  107 DG  B N7    
4436 C C5    . DG  B 7   ? 0.6296 0.5648 0.4990 -0.0497 -0.0044 0.0352  107 DG  B C5    
4437 C C6    . DG  B 7   ? 0.5611 0.4843 0.4136 -0.0419 -0.0073 0.0203  107 DG  B C6    
4438 O O6    . DG  B 7   ? 0.5233 0.4532 0.3955 -0.0358 -0.0042 0.0098  107 DG  B O6    
4439 N N1    . DG  B 7   ? 0.6594 0.5608 0.4674 -0.0415 -0.0147 0.0180  107 DG  B N1    
4440 C C2    . DG  B 7   ? 0.6455 0.5404 0.4349 -0.0467 -0.0182 0.0280  107 DG  B C2    
4441 N N2    . DG  B 7   ? 0.6565 0.5461 0.4397 -0.0399 -0.0218 0.0205  107 DG  B N2    
4442 N N3    . DG  B 7   ? 0.6980 0.6046 0.5041 -0.0536 -0.0155 0.0413  107 DG  B N3    
4443 C C4    . DG  B 7   ? 0.6389 0.5635 0.4807 -0.0557 -0.0088 0.0452  107 DG  B C4    
4444 P P     . DG  B 8   ? 0.5691 0.5260 0.4576 -0.0709 -0.0046 0.0746  108 DG  B P     
4445 O OP1   . DG  B 8   ? 0.6733 0.6338 0.5662 -0.0706 -0.0052 0.0770  108 DG  B OP1   
4446 O OP2   . DG  B 8   ? 0.7099 0.6736 0.6137 -0.0749 -0.0005 0.0765  108 DG  B OP2   
4447 O "O5'" . DG  B 8   ? 0.5557 0.4971 0.4166 -0.0693 -0.0100 0.0664  108 DG  B "O5'" 
4448 C "C5'" . DG  B 8   ? 0.4889 0.4223 0.3352 -0.0641 -0.0136 0.0619  108 DG  B "C5'" 
4449 C "C4'" . DG  B 8   ? 0.5242 0.4448 0.3515 -0.0620 -0.0171 0.0532  108 DG  B "C4'" 
4450 O "O4'" . DG  B 8   ? 0.5440 0.4581 0.3626 -0.0607 -0.0174 0.0486  108 DG  B "O4'" 
4451 C "C3'" . DG  B 8   ? 0.5012 0.4184 0.3254 -0.0672 -0.0181 0.0520  108 DG  B "C3'" 
4452 O "O3'" . DG  B 8   ? 0.4683 0.3701 0.2738 -0.0686 -0.0229 0.0456  108 DG  B "O3'" 
4453 C "C2'" . DG  B 8   ? 0.4976 0.4135 0.3211 -0.0690 -0.0163 0.0504  108 DG  B "C2'" 
4454 C "C1'" . DG  B 8   ? 0.5213 0.4300 0.3340 -0.0636 -0.0175 0.0450  108 DG  B "C1'" 
4455 N N9    . DG  B 8   ? 0.4647 0.3737 0.2785 -0.0661 -0.0150 0.0452  108 DG  B N9    
4456 C C8    . DG  B 8   ? 0.5163 0.4381 0.3505 -0.0719 -0.0099 0.0541  108 DG  B C8    
4457 N N7    . DG  B 8   ? 0.5056 0.4259 0.3398 -0.0741 -0.0067 0.0528  108 DG  B N7    
4458 C C5    . DG  B 8   ? 0.4871 0.3907 0.2938 -0.0674 -0.0114 0.0402  108 DG  B C5    
4459 C C6    . DG  B 8   ? 0.5168 0.4177 0.3251 -0.0600 -0.0107 0.0269  108 DG  B C6    
4460 O O6    . DG  B 8   ? 0.4829 0.3994 0.3263 -0.0563 -0.0050 0.0222  108 DG  B O6    
4461 N N1    . DG  B 8   ? 0.5291 0.4126 0.3076 -0.0536 -0.0166 0.0162  108 DG  B N1    
4462 C C2    . DG  B 8   ? 0.4927 0.3744 0.2709 -0.0502 -0.0197 0.0166  108 DG  B C2    
4463 N N2    . DG  B 8   ? 0.5658 0.4419 0.3391 -0.0416 -0.0221 0.0072  108 DG  B N2    
4464 N N3    . DG  B 8   ? 0.4746 0.3624 0.2605 -0.0547 -0.0196 0.0258  108 DG  B N3    
4465 C C4    . DG  B 8   ? 0.4760 0.3743 0.2750 -0.0624 -0.0161 0.0361  108 DG  B C4    
4466 P P     . DC  B 9   ? 0.4815 0.3749 0.2791 -0.0762 -0.0254 0.0441  109 DC  B P     
4467 O OP1   . DC  B 9   ? 0.5184 0.3981 0.3021 -0.0785 -0.0295 0.0415  109 DC  B OP1   
4468 O OP2   . DC  B 9   ? 0.5205 0.4258 0.3313 -0.0816 -0.0237 0.0501  109 DC  B OP2   
4469 O "O5'" . DC  B 9   ? 0.4853 0.3708 0.2751 -0.0728 -0.0249 0.0376  109 DC  B "O5'" 
4470 C "C5'" . DC  B 9   ? 0.5074 0.3825 0.2865 -0.0663 -0.0261 0.0312  109 DC  B "C5'" 
4471 C "C4'" . DC  B 9   ? 0.5481 0.4220 0.3257 -0.0620 -0.0246 0.0259  109 DC  B "C4'" 
4472 O "O4'" . DC  B 9   ? 0.5293 0.4145 0.3164 -0.0606 -0.0216 0.0280  109 DC  B "O4'" 
4473 C "C3'" . DC  B 9   ? 0.5455 0.4150 0.3205 -0.0677 -0.0247 0.0256  109 DC  B "C3'" 
4474 O "O3'" . DC  B 9   ? 0.5179 0.3715 0.2795 -0.0657 -0.0267 0.0195  109 DC  B "O3'" 
4475 C "C2'" . DC  B 9   ? 0.5590 0.4395 0.3438 -0.0676 -0.0212 0.0267  109 DC  B "C2'" 
4476 C "C1'" . DC  B 9   ? 0.5603 0.4409 0.3432 -0.0630 -0.0207 0.0245  109 DC  B "C1'" 
4477 N N1    . DC  B 9   ? 0.4922 0.3786 0.2807 -0.0685 -0.0176 0.0286  109 DC  B N1    
4478 C C2    . DC  B 9   ? 0.5059 0.3872 0.2872 -0.0661 -0.0165 0.0218  109 DC  B C2    
4479 O O2    . DC  B 9   ? 0.4747 0.3481 0.2480 -0.0579 -0.0187 0.0121  109 DC  B O2    
4480 N N3    . DC  B 9   ? 0.4863 0.3744 0.2744 -0.0723 -0.0119 0.0266  109 DC  B N3    
4481 C C4    . DC  B 9   ? 0.5045 0.4069 0.3140 -0.0798 -0.0079 0.0394  109 DC  B C4    
4482 N N4    . DC  B 9   ? 0.4626 0.3817 0.3058 -0.0811 -0.0008 0.0418  109 DC  B N4    
4483 C C5    . DC  B 9   ? 0.4991 0.4079 0.3171 -0.0798 -0.0102 0.0446  109 DC  B C5    
4484 C C6    . DC  B 9   ? 0.4903 0.3895 0.2945 -0.0748 -0.0151 0.0386  109 DC  B C6    
4485 P P     . DG  B 10  ? 0.5151 0.3598 0.2706 -0.0712 -0.0273 0.0185  110 DG  B P     
4486 O OP1   . DG  B 10  ? 0.6250 0.4511 0.3657 -0.0702 -0.0300 0.0155  110 DG  B OP1   
4487 O OP2   . DG  B 10  ? 0.5407 0.3935 0.3037 -0.0794 -0.0267 0.0237  110 DG  B OP2   
4488 O "O5'" . DG  B 10  ? 0.5257 0.3760 0.2854 -0.0660 -0.0247 0.0141  110 DG  B "O5'" 
4489 C "C5'" . DG  B 10  ? 0.5387 0.3859 0.2948 -0.0572 -0.0250 0.0079  110 DG  B "C5'" 
4490 C "C4'" . DG  B 10  ? 0.5344 0.3865 0.2943 -0.0542 -0.0231 0.0030  110 DG  B "C4'" 
4491 O "O4'" . DG  B 10  ? 0.5401 0.4011 0.3062 -0.0543 -0.0208 0.0024  110 DG  B "O4'" 
4492 C "C3'" . DG  B 10  ? 0.6375 0.4873 0.3967 -0.0611 -0.0223 0.0052  110 DG  B "C3'" 
4493 O "O3'" . DG  B 10  ? 0.7538 0.6005 0.5105 -0.0567 -0.0219 -0.0010 110 DG  B "O3'" 
4494 C "C2'" . DG  B 10  ? 0.6046 0.4640 0.3714 -0.0676 -0.0197 0.0094  110 DG  B "C2'" 
4495 C "C1'" . DG  B 10  ? 0.5762 0.4365 0.3421 -0.0622 -0.0188 0.0040  110 DG  B "C1'" 
4496 N N9    . DG  B 10  ? 0.5264 0.3922 0.2956 -0.0694 -0.0162 0.0086  110 DG  B N9    
4497 C C8    . DG  B 10  ? 0.4944 0.3678 0.2709 -0.0753 -0.0158 0.0181  110 DG  B C8    
4498 N N7    . DG  B 10  ? 0.5225 0.4042 0.3066 -0.0812 -0.0118 0.0234  110 DG  B N7    
4499 C C5    . DG  B 10  ? 0.4895 0.3667 0.2665 -0.0801 -0.0095 0.0150  110 DG  B C5    
4500 C C6    . DG  B 10  ? 0.4419 0.3359 0.2531 -0.0786 -0.0028 0.0129  110 DG  B C6    
4501 O O6    . DG  B 10  ? 0.3953 0.3073 0.2389 -0.0811 0.0023  0.0213  110 DG  B O6    
4502 N N1    . DG  B 10  ? 0.3758 0.2673 0.1901 -0.0715 -0.0022 -0.0014 110 DG  B N1    
4503 C C2    . DG  B 10  ? 0.3539 0.2259 0.1337 -0.0682 -0.0077 -0.0115 110 DG  B C2    
4504 N N2    . DG  B 10  ? 0.4008 0.2736 0.1900 -0.0613 -0.0061 -0.0247 110 DG  B N2    
4505 N N3    . DG  B 10  ? 0.4651 0.3297 0.2331 -0.0657 -0.0124 -0.0070 110 DG  B N3    
4506 C C4    . DG  B 10  ? 0.4568 0.3245 0.2260 -0.0717 -0.0130 0.0046  110 DG  B C4    
4507 P P     . DC  B 11  ? 0.9836 0.8176 0.7311 -0.0612 -0.0227 -0.0008 111 DC  B P     
4508 O OP1   . DC  B 11  ? 1.0099 0.8273 0.7442 -0.0588 -0.0257 -0.0017 111 DC  B OP1   
4509 O OP2   . DC  B 11  ? 0.7646 0.6018 0.5157 -0.0707 -0.0219 0.0050  111 DC  B OP2   
4510 O "O5'" . DC  B 11  ? 0.6792 0.5200 0.4320 -0.0559 -0.0209 -0.0076 111 DC  B "O5'" 
4511 C "C5'" . DC  B 11  ? 0.5513 0.3996 0.3107 -0.0610 -0.0185 -0.0062 111 DC  B "C5'" 
4512 C "C4'" . DC  B 11  ? 0.4448 0.2975 0.2081 -0.0594 -0.0161 -0.0127 111 DC  B "C4'" 
4513 O "O4'" . DC  B 11  ? 0.4373 0.2930 0.2026 -0.0596 -0.0149 -0.0140 111 DC  B "O4'" 
4514 C "C3'" . DC  B 11  ? 0.4642 0.3154 0.2263 -0.0709 -0.0135 -0.0089 111 DC  B "C3'" 
4515 O "O3'" . DC  B 11  ? 0.4632 0.3117 0.2240 -0.0692 -0.0142 -0.0102 111 DC  B "O3'" 
4516 C "C2'" . DC  B 11  ? 0.3873 0.2429 0.1537 -0.0719 -0.0100 -0.0154 111 DC  B "C2'" 
4517 C "C1'" . DC  B 11  ? 0.4301 0.2877 0.1974 -0.0673 -0.0111 -0.0156 111 DC  B "C1'" 
4518 N N1    . DC  B 11  ? 0.4151 0.2757 0.1816 -0.0785 -0.0094 -0.0064 111 DC  B N1    
4519 C C2    . DC  B 11  ? 0.3901 0.2591 0.1656 -0.0850 -0.0041 -0.0079 111 DC  B C2    
4520 O O2    . DC  B 11  ? 0.3945 0.2680 0.1859 -0.0790 -0.0014 -0.0189 111 DC  B O2    
4521 N N3    . DC  B 11  ? 0.4337 0.3179 0.2332 -0.0902 -0.0002 0.0048  111 DC  B N3    
4522 C C4    . DC  B 11  ? 0.4399 0.3183 0.2209 -0.0963 -0.0035 0.0161  111 DC  B C4    
4523 N N4    . DC  B 11  ? 0.4658 0.3593 0.2706 -0.1016 0.0004  0.0286  111 DC  B N4    
4524 C C5    . DC  B 11  ? 0.4742 0.3432 0.2471 -0.0892 -0.0101 0.0122  111 DC  B C5    
4525 C C6    . DC  B 11  ? 0.4943 0.3549 0.2605 -0.0812 -0.0118 0.0029  111 DC  B C6    
4544 O "O5'" . A   C 1   ? 2.1565 2.3708 2.1713 -0.0713 0.0037  0.0471  1   A   G "O5'" 
4545 C "C5'" . A   C 1   ? 2.1355 2.3458 2.1545 -0.0696 0.0031  0.0485  1   A   G "C5'" 
4546 C "C4'" . A   C 1   ? 2.0988 2.3030 2.1168 -0.0656 0.0077  0.0429  1   A   G "C4'" 
4547 O "O4'" . A   C 1   ? 2.0553 2.2526 2.0704 -0.0629 0.0111  0.0392  1   A   G "O4'" 
4548 C "C3'" . A   C 1   ? 2.0818 2.2895 2.0968 -0.0654 0.0103  0.0391  1   A   G "C3'" 
4549 O "O3'" . A   C 1   ? 2.0837 2.2871 2.0996 -0.0622 0.0130  0.0362  1   A   G "O3'" 
4550 C "C2'" . A   C 1   ? 2.0442 2.2493 2.0546 -0.0644 0.0136  0.0346  1   A   G "C2'" 
4551 O "O2'" . A   C 1   ? 2.0455 2.2494 2.0528 -0.0626 0.0172  0.0295  1   A   G "O2'" 
4552 C "C1'" . A   C 1   ? 1.9919 2.1880 2.0025 -0.0614 0.0152  0.0337  1   A   G "C1'" 
4553 N N9    . A   C 1   ? 1.8657 2.0592 1.8731 -0.0612 0.0168  0.0316  1   A   G N9    
4554 C C8    . A   C 1   ? 1.8270 2.0166 1.8304 -0.0592 0.0208  0.0262  1   A   G C8    
4555 N N7    . A   C 1   ? 1.7887 1.9766 1.7901 -0.0596 0.0212  0.0254  1   A   G N7    
4556 C C5    . A   C 1   ? 1.7402 1.9312 1.7444 -0.0619 0.0172  0.0305  1   A   G C5    
4557 C C6    . A   C 1   ? 1.6592 1.8504 1.6630 -0.0632 0.0155  0.0323  1   A   G C6    
4558 N N6    . A   C 1   ? 1.6075 1.7959 1.6082 -0.0625 0.0178  0.0289  1   A   G N6    
4559 N N1    . A   C 1   ? 1.6573 1.8515 1.6641 -0.0653 0.0111  0.0378  1   A   G N1    
4560 C C2    . A   C 1   ? 1.6800 1.8766 1.6903 -0.0661 0.0086  0.0413  1   A   G C2    
4561 N N3    . A   C 1   ? 1.7176 1.9146 1.7289 -0.0651 0.0099  0.0401  1   A   G N3    
4562 C C4    . A   C 1   ? 1.7733 1.9676 1.7813 -0.0629 0.0143  0.0345  1   A   G C4    
4563 P P     . A   C 2   ? 2.6970 2.9014 2.7173 -0.0618 0.0106  0.0395  2   A   G P     
4564 O OP1   . A   C 2   ? 2.7005 2.9063 2.7203 -0.0600 0.0127  0.0367  2   A   G OP1   
4565 O OP2   . A   C 2   ? 2.7030 2.9036 2.7228 -0.0604 0.0110  0.0397  2   A   G OP2   
4566 O "O5'" . A   C 2   ? 2.0050 2.2165 2.0298 -0.0662 0.0046  0.0464  2   A   G "O5'" 
4567 C "C5'" . A   C 2   ? 2.0336 2.2472 2.0626 -0.0681 -0.0002 0.0524  2   A   G "C5'" 
4568 C "C4'" . A   C 2   ? 2.0754 2.2902 2.1072 -0.0665 -0.0008 0.0528  2   A   G "C4'" 
4569 O "O4'" . A   C 2   ? 2.0907 2.3101 2.1250 -0.0669 -0.0017 0.0533  2   A   G "O4'" 
4570 C "C3'" . A   C 2   ? 2.1048 2.3196 2.1421 -0.0679 -0.0064 0.0589  2   A   G "C3'" 
4571 O "O3'" . A   C 2   ? 2.1162 2.3298 2.1546 -0.0651 -0.0053 0.0572  2   A   G "O3'" 
4572 C "C2'" . A   C 2   ? 2.1121 2.3307 2.1552 -0.0702 -0.0113 0.0635  2   A   G "C2'" 
4573 O "O2'" . A   C 2   ? 2.1195 2.3366 2.1697 -0.0704 -0.0172 0.0679  2   A   G "O2'" 
4574 C "C1'" . A   C 2   ? 2.1021 2.3238 2.1433 -0.0684 -0.0075 0.0589  2   A   G "C1'" 
4575 N N9    . A   C 2   ? 2.1018 2.3275 2.1458 -0.0705 -0.0099 0.0611  2   A   G N9    
4576 C C8    . A   C 2   ? 2.1030 2.3305 2.1445 -0.0724 -0.0091 0.0611  2   A   G C8    
4577 N N7    . A   C 2   ? 2.1056 2.3367 2.1505 -0.0738 -0.0116 0.0634  2   A   G N7    
4578 C C5    . A   C 2   ? 2.1150 2.3462 2.1654 -0.0727 -0.0145 0.0646  2   A   G C5    
4579 C C6    . A   C 2   ? 2.1331 2.3664 2.1893 -0.0729 -0.0183 0.0666  2   A   G C6    
4580 N N6    . A   C 2   ? 2.1506 2.3870 2.2076 -0.0749 -0.0193 0.0680  2   A   G N6    
4581 N N1    . A   C 2   ? 2.1190 2.3504 2.1805 -0.0707 -0.0215 0.0667  2   A   G N1    
4582 C C2    . A   C 2   ? 2.1006 2.3292 2.1615 -0.0685 -0.0208 0.0653  2   A   G C2    
4583 N N3    . A   C 2   ? 2.0923 2.3191 2.1475 -0.0684 -0.0166 0.0637  2   A   G N3    
4584 C C4    . A   C 2   ? 2.1014 2.3295 2.1515 -0.0705 -0.0136 0.0633  2   A   G C4    
4585 P P     . A   C 3   ? 1.6708 1.8788 1.7035 -0.0619 -0.0002 0.0527  3   A   G P     
4586 O OP1   . A   C 3   ? 1.6807 1.8849 1.7062 -0.0593 0.0068  0.0453  3   A   G OP1   
4587 O OP2   . A   C 3   ? 1.6467 1.8522 1.6801 -0.0639 -0.0034 0.0565  3   A   G OP2   
4588 O "O5'" . A   C 3   ? 1.1757 1.3846 1.2117 -0.0588 -0.0003 0.0523  3   A   G "O5'" 
4589 C "C5'" . A   C 3   ? 1.1600 1.3737 1.2005 -0.0578 -0.0017 0.0521  3   A   G "C5'" 
4590 C "C4'" . A   C 3   ? 1.1860 1.3980 1.2186 -0.0536 0.0068  0.0445  3   A   G "C4'" 
4591 O "O4'" . A   C 3   ? 1.2934 1.5063 1.3234 -0.0555 0.0079  0.0428  3   A   G "O4'" 
4592 C "C3'" . A   C 3   ? 1.1459 1.3618 1.1816 -0.0496 0.0075  0.0426  3   A   G "C3'" 
4593 O "O3'" . A   C 3   ? 1.0788 1.2858 1.1020 -0.0432 0.0170  0.0345  3   A   G "O3'" 
4594 C "C2'" . A   C 3   ? 1.2596 1.4809 1.2982 -0.0520 0.0052  0.0433  3   A   G "C2'" 
4595 O "O2'" . A   C 3   ? 1.2783 1.5011 1.3156 -0.0475 0.0082  0.0388  3   A   G "O2'" 
4596 C "C1'" . A   C 3   ? 1.3646 1.5810 1.3950 -0.0535 0.0095  0.0403  3   A   G "C1'" 
4597 N N9    . A   C 3   ? 1.5125 1.7333 1.5448 -0.0570 0.0069  0.0423  3   A   G N9    
4598 C C8    . A   C 3   ? 1.5283 1.7465 1.5562 -0.0584 0.0089  0.0403  3   A   G C8    
4599 N N7    . A   C 3   ? 1.5650 1.7879 1.5950 -0.0611 0.0064  0.0426  3   A   G N7    
4600 C C5    . A   C 3   ? 1.6353 1.8635 1.6715 -0.0617 0.0024  0.0461  3   A   G C5    
4601 C C6    . A   C 3   ? 1.7068 1.9402 1.7476 -0.0640 -0.0016 0.0495  3   A   G C6    
4602 N N6    . A   C 3   ? 1.7234 1.9586 1.7624 -0.0663 -0.0016 0.0500  3   A   G N6    
4603 N N1    . A   C 3   ? 1.7231 1.9589 1.7711 -0.0634 -0.0061 0.0520  3   A   G N1    
4604 C C2    . A   C 3   ? 1.7035 1.9378 1.7543 -0.0606 -0.0069 0.0513  3   A   G C2    
4605 N N3    . A   C 3   ? 1.6643 1.8951 1.7108 -0.0584 -0.0028 0.0486  3   A   G N3    
4606 C C4    . A   C 3   ? 1.6117 1.8389 1.6503 -0.0592 0.0021  0.0460  3   A   G C4    
4607 P P     . G   C 4   ? 0.6824 0.8705 0.6952 -0.0354 0.0193  0.0297  4   G   G P     
4608 O OP1   . G   C 4   ? 0.8190 0.9974 0.8203 -0.0278 0.0272  0.0211  4   G   G OP1   
4609 O OP2   . G   C 4   ? 0.5913 0.7831 0.6042 -0.0404 0.0211  0.0325  4   G   G OP2   
4610 O "O5'" . G   C 4   ? 0.5257 0.6991 0.5421 -0.0299 0.0078  0.0317  4   G   G "O5'" 
4611 C "C5'" . G   C 4   ? 0.3848 0.5467 0.3991 -0.0222 0.0045  0.0278  4   G   G "C5'" 
4612 C "C4'" . G   C 4   ? 0.2473 0.3902 0.2598 -0.0148 -0.0028 0.0273  4   G   G "C4'" 
4613 O "O4'" . G   C 4   ? 0.2906 0.4205 0.2915 -0.0086 0.0037  0.0214  4   G   G "O4'" 
4614 C "C3'" . G   C 4   ? 0.2657 0.3966 0.2783 -0.0072 -0.0087 0.0248  4   G   G "C3'" 
4615 O "O3'" . G   C 4   ? 0.2363 0.3742 0.2606 -0.0115 -0.0185 0.0313  4   G   G "O3'" 
4616 C "C2'" . G   C 4   ? 0.2876 0.3978 0.2930 0.0017  -0.0107 0.0213  4   G   G "C2'" 
4617 O "O2'" . G   C 4   ? 0.3058 0.4138 0.3181 -0.0006 -0.0198 0.0276  4   G   G "O2'" 
4618 C "C1'" . G   C 4   ? 0.3480 0.4583 0.3439 0.0015  -0.0002 0.0172  4   G   G "C1'" 
4619 N N9    . G   C 4   ? 0.2912 0.3944 0.2761 0.0081  0.0087  0.0087  4   G   G N9    
4620 C C8    . G   C 4   ? 0.3794 0.4934 0.3597 0.0048  0.0189  0.0056  4   G   G C8    
4621 N N7    . G   C 4   ? 0.3570 0.4607 0.3270 0.0123  0.0253  -0.0022 4   G   G N7    
4622 C C5    . G   C 4   ? 0.3884 0.4736 0.3562 0.0211  0.0190  -0.0043 4   G   G C5    
4623 C C6    . G   C 4   ? 0.4143 0.4822 0.3723 0.0316  0.0216  -0.0120 4   G   G C6    
4624 O O6    . G   C 4   ? 0.3886 0.4541 0.3375 0.0353  0.0304  -0.0187 4   G   G O6    
4625 N N1    . G   C 4   ? 0.3313 0.3840 0.2910 0.0381  0.0128  -0.0114 4   G   G N1    
4626 C C2    . G   C 4   ? 0.3665 0.4199 0.3357 0.0350  0.0027  -0.0044 4   G   G C2    
4627 N N2    . G   C 4   ? 0.3139 0.3506 0.2828 0.0426  -0.0047 -0.0052 4   G   G N2    
4628 N N3    . G   C 4   ? 0.3041 0.3734 0.2822 0.0251  0.0002  0.0028  4   G   G N3    
4629 C C4    . G   C 4   ? 0.3058 0.3904 0.2828 0.0187  0.0087  0.0024  4   G   G C4    
4630 P P     . G   C 5   ? 0.3027 0.4394 0.3307 -0.0083 -0.0232 0.0303  5   G   G P     
4631 O OP1   . G   C 5   ? 0.3610 0.5094 0.4021 -0.0159 -0.0323 0.0386  5   G   G OP1   
4632 O OP2   . G   C 5   ? 0.4092 0.5509 0.4309 -0.0071 -0.0140 0.0245  5   G   G OP2   
4633 O "O5'" . G   C 5   ? 0.3155 0.4294 0.3382 0.0028  -0.0281 0.0262  5   G   G "O5'" 
4634 C "C5'" . G   C 5   ? 0.3063 0.4110 0.3333 0.0043  -0.0374 0.0305  5   G   G "C5'" 
4635 C "C4'" . G   C 5   ? 0.2862 0.3697 0.3070 0.0156  -0.0405 0.0254  5   G   G "C4'" 
4636 O "O4'" . G   C 5   ? 0.3051 0.3781 0.3137 0.0215  -0.0318 0.0185  5   G   G "O4'" 
4637 C "C3'" . G   C 5   ? 0.2908 0.3703 0.3111 0.0209  -0.0416 0.0215  5   G   G "C3'" 
4638 O "O3'" . G   C 5   ? 0.2703 0.3521 0.3009 0.0191  -0.0520 0.0268  5   G   G "O3'" 
4639 C "C2'" . G   C 5   ? 0.2639 0.3226 0.2735 0.0324  -0.0392 0.0141  5   G   G "C2'" 
4640 O "O2'" . G   C 5   ? 0.3546 0.3997 0.3669 0.0369  -0.0486 0.0165  5   G   G "O2'" 
4641 C "C1'" . G   C 5   ? 0.3250 0.3839 0.3265 0.0313  -0.0302 0.0115  5   G   G "C1'" 
4642 N N9    . G   C 5   ? 0.3076 0.3719 0.3013 0.0315  -0.0190 0.0056  5   G   G N9    
4643 C C8    . G   C 5   ? 0.3753 0.4574 0.3703 0.0231  -0.0123 0.0071  5   G   G C8    
4644 N N7    . G   C 5   ? 0.3327 0.4152 0.3191 0.0257  -0.0026 0.0007  5   G   G N7    
4645 C C5    . G   C 5   ? 0.3079 0.3716 0.2867 0.0365  -0.0029 -0.0056 5   G   G C5    
4646 C C6    . G   C 5   ? 0.2870 0.3422 0.2546 0.0437  0.0052  -0.0141 5   G   G C6    
4647 O O6    . G   C 5   ? 0.3454 0.4080 0.3072 0.0421  0.0146  -0.0179 5   G   G O6    
4648 N N1    . G   C 5   ? 0.3039 0.3396 0.2669 0.0541  0.0015  -0.0184 5   G   G N1    
4649 C C2    . G   C 5   ? 0.3026 0.3284 0.2710 0.0570  -0.0087 -0.0149 5   G   G C2    
4650 N N2    . G   C 5   ? 0.3622 0.3692 0.3247 0.0675  -0.0105 -0.0201 5   G   G N2    
4651 N N3    . G   C 5   ? 0.3255 0.3590 0.3042 0.0503  -0.0164 -0.0069 5   G   G N3    
4652 C C4    . G   C 5   ? 0.3025 0.3548 0.2857 0.0403  -0.0129 -0.0027 5   G   G C4    
4653 P P     . G   C 6   ? 0.2809 0.3686 0.3153 0.0195  -0.0535 0.0256  6   G   G P     
4654 O OP1   . G   C 6   ? 0.3155 0.4053 0.3611 0.0168  -0.0651 0.0322  6   G   G OP1   
4655 O OP2   . G   C 6   ? 0.3007 0.4050 0.3340 0.0134  -0.0448 0.0244  6   G   G OP2   
4656 O "O5'" . G   C 6   ? 0.2731 0.3422 0.2975 0.0316  -0.0509 0.0171  6   G   G "O5'" 
4657 C "C5'" . G   C 6   ? 0.2956 0.3463 0.3189 0.0397  -0.0578 0.0162  6   G   G "C5'" 
4658 C "C4'" . G   C 6   ? 0.2957 0.3307 0.3086 0.0506  -0.0533 0.0074  6   G   G "C4'" 
4659 O "O4'" . G   C 6   ? 0.2801 0.3116 0.2822 0.0528  -0.0430 0.0020  6   G   G "O4'" 
4660 C "C3'" . G   C 6   ? 0.2628 0.3029 0.2751 0.0520  -0.0504 0.0037  6   G   G "C3'" 
4661 O "O3'" . G   C 6   ? 0.2708 0.3081 0.2903 0.0541  -0.0597 0.0060  6   G   G "O3'" 
4662 C "C2'" . G   C 6   ? 0.2755 0.3022 0.2746 0.0613  -0.0419 -0.0056 6   G   G "C2'" 
4663 O "O2'" . G   C 6   ? 0.2912 0.2983 0.2873 0.0714  -0.0469 -0.0087 6   G   G "O2'" 
4664 C "C1'" . G   C 6   ? 0.2615 0.2889 0.2553 0.0586  -0.0356 -0.0057 6   G   G "C1'" 
4665 N N9    . G   C 6   ? 0.2583 0.3014 0.2495 0.0519  -0.0261 -0.0066 6   G   G N9    
4666 C C8    . G   C 6   ? 0.2632 0.3251 0.2615 0.0410  -0.0255 -0.0004 6   G   G C8    
4667 N N7    . G   C 6   ? 0.2586 0.3307 0.2520 0.0376  -0.0157 -0.0033 6   G   G N7    
4668 C C5    . G   C 6   ? 0.2342 0.2930 0.2165 0.0470  -0.0097 -0.0119 6   G   G C5    
4669 C C6    . G   C 6   ? 0.2906 0.3518 0.2633 0.0485  0.0013  -0.0183 6   G   G C6    
4670 O O6    . G   C 6   ? 0.2362 0.3122 0.2086 0.0416  0.0080  -0.0175 6   G   G O6    
4671 N N1    . G   C 6   ? 0.2616 0.3055 0.2244 0.0593  0.0042  -0.0262 6   G   G N1    
4672 C C2    . G   C 6   ? 0.3062 0.3330 0.2688 0.0676  -0.0028 -0.0276 6   G   G C2    
4673 N N2    . G   C 6   ? 0.3131 0.3248 0.2655 0.0775  0.0014  -0.0355 6   G   G N2    
4674 N N3    . G   C 6   ? 0.2501 0.2748 0.2218 0.0662  -0.0132 -0.0215 6   G   G N3    
4675 C C4    . G   C 6   ? 0.2557 0.2969 0.2367 0.0557  -0.0160 -0.0139 6   G   G C4    
4676 P P     . C   C 7   ? 0.2908 0.3429 0.3169 0.0493  -0.0608 0.0076  7   C   G P     
4677 O OP1   . C   C 7   ? 0.2872 0.3327 0.3204 0.0524  -0.0715 0.0103  7   C   G OP1   
4678 O OP2   . C   C 7   ? 0.2813 0.3544 0.3132 0.0377  -0.0581 0.0129  7   C   G OP2   
4679 O "O5'" . C   C 7   ? 0.3034 0.3513 0.3189 0.0558  -0.0515 -0.0014 7   C   G "O5'" 
4680 C "C5'" . C   C 7   ? 0.2757 0.3045 0.2841 0.0672  -0.0520 -0.0078 7   C   G "C5'" 
4681 C "C4'" . C   C 7   ? 0.2828 0.3083 0.2797 0.0725  -0.0413 -0.0163 7   C   G "C4'" 
4682 O "O4'" . C   C 7   ? 0.2680 0.2947 0.2576 0.0706  -0.0326 -0.0183 7   C   G "O4'" 
4683 C "C3'" . C   C 7   ? 0.2669 0.3070 0.2647 0.0684  -0.0369 -0.0175 7   C   G "C3'" 
4684 O "O3'" . C   C 7   ? 0.3141 0.3507 0.3152 0.0727  -0.0425 -0.0187 7   C   G "O3'" 
4685 C "C2'" . C   C 7   ? 0.3007 0.3374 0.2858 0.0723  -0.0249 -0.0252 7   C   G "C2'" 
4686 O "O2'" . C   C 7   ? 0.3054 0.3239 0.2819 0.0837  -0.0236 -0.0326 7   C   G "O2'" 
4687 C "C1'" . C   C 7   ? 0.2490 0.2827 0.2316 0.0701  -0.0226 -0.0234 7   C   G "C1'" 
4688 N N1    . C   C 7   ? 0.2642 0.3167 0.2502 0.0594  -0.0182 -0.0190 7   C   G N1    
4689 C C2    . C   C 7   ? 0.2857 0.3441 0.2633 0.0584  -0.0071 -0.0238 7   C   G C2    
4690 O O2    . C   C 7   ? 0.2733 0.3208 0.2407 0.0666  -0.0014 -0.0316 7   C   G O2    
4691 N N3    . C   C 7   ? 0.2519 0.3276 0.2324 0.0487  -0.0028 -0.0200 7   C   G N3    
4692 C C4    . C   C 7   ? 0.2542 0.3411 0.2458 0.0403  -0.0092 -0.0117 7   C   G C4    
4693 N N4    . C   C 7   ? 0.2752 0.3791 0.2695 0.0309  -0.0046 -0.0081 7   C   G N4    
4694 C C5    . C   C 7   ? 0.2094 0.2905 0.2095 0.0410  -0.0205 -0.0067 7   C   G C5    
4695 C C6    . C   C 7   ? 0.2437 0.3077 0.2407 0.0506  -0.0248 -0.0105 7   C   G C6    
4696 P P     . G   C 8   ? 0.3986 0.4522 0.4051 0.0670  -0.0424 -0.0172 8   G   G P     
4697 O OP1   . G   C 8   ? 0.4414 0.4880 0.4520 0.0723  -0.0502 -0.0176 8   G   G OP1   
4698 O OP2   . G   C 8   ? 0.4083 0.4818 0.4229 0.0550  -0.0427 -0.0100 8   G   G OP2   
4699 O "O5'" . G   C 8   ? 0.4386 0.4904 0.4329 0.0717  -0.0309 -0.0258 8   G   G "O5'" 
4700 C "C5'" . G   C 8   ? 0.3687 0.4375 0.3625 0.0650  -0.0243 -0.0258 8   G   G "C5'" 
4701 C "C4'" . G   C 8   ? 0.3249 0.3888 0.3056 0.0696  -0.0128 -0.0336 8   G   G "C4'" 
4702 O "O4'" . G   C 8   ? 0.3341 0.3963 0.3113 0.0673  -0.0086 -0.0326 8   G   G "O4'" 
4703 C "C3'" . G   C 8   ? 0.2698 0.3498 0.2485 0.0644  -0.0055 -0.0350 8   G   G "C3'" 
4704 O "O3'" . G   C 8   ? 0.2813 0.3580 0.2566 0.0702  -0.0051 -0.0401 8   G   G "O3'" 
4705 C "C2'" . G   C 8   ? 0.3324 0.4111 0.3008 0.0647  0.0052  -0.0392 8   G   G "C2'" 
4706 O "O2'" . G   C 8   ? 0.3538 0.4165 0.3099 0.0752  0.0109  -0.0481 8   G   G "O2'" 
4707 C "C1'" . G   C 8   ? 0.3669 0.4396 0.3382 0.0632  0.0016  -0.0350 8   G   G "C1'" 
4708 N N9    . G   C 8   ? 0.2933 0.3834 0.2733 0.0517  0.0004  -0.0273 8   G   G N9    
4709 C C8    . G   C 8   ? 0.3602 0.4555 0.3519 0.0461  -0.0090 -0.0192 8   G   G C8    
4710 N N7    . G   C 8   ? 0.3020 0.4128 0.2990 0.0363  -0.0076 -0.0137 8   G   G N7    
4711 C C5    . G   C 8   ? 0.2779 0.3942 0.2663 0.0355  0.0035  -0.0184 8   G   G C5    
4712 C C6    . G   C 8   ? 0.2684 0.4005 0.2573 0.0269  0.0100  -0.0159 8   G   G C6    
4713 O O6    . G   C 8   ? 0.2971 0.4423 0.2946 0.0179  0.0073  -0.0089 8   G   G O6    
4714 N N1    . G   C 8   ? 0.2764 0.4085 0.2543 0.0295  0.0209  -0.0227 8   G   G N1    
4715 C C2    . G   C 8   ? 0.3526 0.4709 0.3201 0.0393  0.0250  -0.0308 8   G   G C2    
4716 N N2    . G   C 8   ? 0.3497 0.4689 0.3075 0.0403  0.0352  -0.0363 8   G   G N2    
4717 N N3    . G   C 8   ? 0.2876 0.3911 0.2546 0.0474  0.0190  -0.0332 8   G   G N3    
4718 C C4    . G   C 8   ? 0.2947 0.3982 0.2724 0.0449  0.0085  -0.0267 8   G   G C4    
4719 P P     . C   C 9   ? 0.3646 0.4598 0.3459 0.0638  -0.0056 -0.0378 9   C   G P     
4720 O OP1   . C   C 9   ? 0.3965 0.4832 0.3746 0.0719  -0.0075 -0.0430 9   C   G OP1   
4721 O OP2   . C   C 9   ? 0.3824 0.4927 0.3769 0.0534  -0.0126 -0.0284 9   C   G OP2   
4722 O "O5'" . C   C 9   ? 0.4036 0.5084 0.3764 0.0607  0.0063  -0.0415 9   C   G "O5'" 
4723 C "C5'" . C   C 9   ? 0.3876 0.4806 0.3467 0.0689  0.0151  -0.0503 9   C   G "C5'" 
4724 C "C4'" . C   C 9   ? 0.4266 0.5272 0.3813 0.0620  0.0243  -0.0500 9   C   G "C4'" 
4725 O "O4'" . C   C 9   ? 0.4123 0.5178 0.3677 0.0588  0.0261  -0.0474 9   C   G "O4'" 
4726 C "C3'" . C   C 9   ? 0.4607 0.5847 0.4198 0.0542  0.0267  -0.0476 9   C   G "C3'" 
4727 O "O3'" . C   C 9   ? 0.5085 0.6257 0.4658 0.0543  0.0274  -0.0492 9   C   G "O3'" 
4728 C "C2'" . C   C 9   ? 0.4216 0.5471 0.3807 0.0452  0.0320  -0.0436 9   C   G "C2'" 
4729 O "O2'" . C   C 9   ? 0.4653 0.5679 0.4187 0.0433  0.0364  -0.0442 9   C   G "O2'" 
4730 C "C1'" . C   C 9   ? 0.3975 0.5188 0.3558 0.0484  0.0306  -0.0434 9   C   G "C1'" 
4731 N N1    . C   C 9   ? 0.3476 0.4836 0.3178 0.0402  0.0244  -0.0352 9   C   G N1    
4732 C C2    . C   C 9   ? 0.3826 0.5340 0.3554 0.0309  0.0290  -0.0312 9   C   G C2    
4733 O O2    . C   C 9   ? 0.3747 0.5224 0.3410 0.0293  0.0364  -0.0337 9   C   G O2    
4734 N N3    . C   C 9   ? 0.3792 0.5413 0.3636 0.0225  0.0226  -0.0227 9   C   G N3    
4735 C C4    . C   C 9   ? 0.3328 0.4903 0.3259 0.0231  0.0120  -0.0184 9   C   G C4    
4736 N N4    . C   C 9   ? 0.3151 0.4830 0.3193 0.0148  0.0058  -0.0102 9   C   G N4    
4737 C C5    . C   C 9   ? 0.3113 0.4531 0.3020 0.0324  0.0072  -0.0223 9   C   G C5    
4738 C C6    . C   C 9   ? 0.3342 0.4657 0.3135 0.0407  0.0136  -0.0306 9   C   G C6    
4739 P P     . C   C 10  ? 0.5711 0.7123 0.5337 0.0514  0.0259  -0.0487 10  C   G P     
4740 O OP1   . C   C 10  ? 0.7418 0.8682 0.7006 0.0546  0.0258  -0.0514 10  C   G OP1   
4741 O OP2   . C   C 10  ? 0.5019 0.6508 0.4770 0.0477  0.0157  -0.0420 10  C   G OP2   
4742 O "O5'" . C   C 10  ? 0.5180 0.6713 0.4835 0.0399  0.0304  -0.0437 10  C   G "O5'" 
4743 C "C5'" . C   C 10  ? 0.4771 0.6118 0.4377 0.0367  0.0353  -0.0432 10  C   G "C5'" 
4744 C "C4'" . C   C 10  ? 0.4977 0.6422 0.4616 0.0278  0.0380  -0.0387 10  C   G "C4'" 
4745 O "O4'" . C   C 10  ? 0.5200 0.6695 0.4860 0.0269  0.0375  -0.0368 10  C   G "O4'" 
4746 C "C3'" . C   C 10  ? 0.6485 0.8188 0.6203 0.0205  0.0363  -0.0351 10  C   G "C3'" 
4747 O "O3'" . C   C 10  ? 0.6969 0.8633 0.6672 0.0189  0.0377  -0.0356 10  C   G "O3'" 
4748 C "C2'" . C   C 10  ? 0.6414 0.8199 0.6174 0.0130  0.0373  -0.0303 10  C   G "C2'" 
4749 O "O2'" . C   C 10  ? 0.7184 0.8817 0.6905 0.0107  0.0411  -0.0299 10  C   G "O2'" 
4750 C "C1'" . C   C 10  ? 0.5843 0.7546 0.5576 0.0178  0.0372  -0.0315 10  C   G "C1'" 
4751 N N1    . C   C 10  ? 0.4747 0.6670 0.4552 0.0166  0.0335  -0.0284 10  C   G N1    
4752 C C2    . C   C 10  ? 0.5251 0.7328 0.5134 0.0074  0.0330  -0.0217 10  C   G C2    
4753 O O2    . C   C 10  ? 0.5549 0.7564 0.5421 0.0022  0.0352  -0.0202 10  C   G O2    
4754 N N3    . C   C 10  ? 0.4644 0.6746 0.4638 0.0039  0.0236  -0.0149 10  C   G N3    
4755 C C4    . C   C 10  ? 0.4296 0.6290 0.4321 0.0093  0.0153  -0.0150 10  C   G C4    
4756 N N4    . C   C 10  ? 0.3862 0.5872 0.3997 0.0053  0.0057  -0.0080 10  C   G N4    
4757 C C5    . C   C 10  ? 0.3834 0.5697 0.3777 0.0191  0.0166  -0.0223 10  C   G C5    
4758 C C6    . C   C 10  ? 0.4311 0.6162 0.4142 0.0226  0.0264  -0.0292 10  C   G C6    
4759 P P     . G   C 11  ? 0.8414 1.0316 0.8187 0.0136  0.0348  -0.0334 11  G   G P     
4760 O OP1   . G   C 11  ? 0.8345 1.0133 0.8077 0.0146  0.0368  -0.0353 11  G   G OP1   
4761 O OP2   . G   C 11  ? 0.8415 1.0492 0.8235 0.0159  0.0307  -0.0335 11  G   G OP2   
4762 O "O5'" . G   C 11  ? 0.9283 1.1331 0.9121 0.0037  0.0345  -0.0275 11  G   G "O5'" 
4763 C "C5'" . G   C 11  ? 0.9015 1.0941 0.8826 0.0009  0.0376  -0.0266 11  G   G "C5'" 
4764 C "C4'" . G   C 11  ? 0.9054 1.1113 0.8926 -0.0072 0.0361  -0.0214 11  G   G "C4'" 
4765 O "O4'" . G   C 11  ? 0.8385 1.0453 0.8269 -0.0068 0.0357  -0.0200 11  G   G "O4'" 
4766 C "C3'" . G   C 11  ? 0.9675 1.1973 0.9628 -0.0143 0.0314  -0.0168 11  G   G "C3'" 
4767 O "O3'" . G   C 11  ? 1.0351 1.2669 1.0304 -0.0172 0.0310  -0.0167 11  G   G "O3'" 
4768 C "C2'" . G   C 11  ? 0.9060 1.1434 0.9062 -0.0204 0.0295  -0.0115 11  G   G "C2'" 
4769 O "O2'" . G   C 11  ? 0.9446 1.1748 0.9432 -0.0237 0.0309  -0.0106 11  G   G "O2'" 
4770 C "C1'" . G   C 11  ? 0.7972 1.0236 0.7940 -0.0147 0.0320  -0.0139 11  G   G "C1'" 
4771 N N9    . G   C 11  ? 0.7040 0.9438 0.7063 -0.0138 0.0290  -0.0119 11  G   G N9    
4772 C C8    . G   C 11  ? 0.6848 0.9238 0.6851 -0.0062 0.0290  -0.0160 11  G   G C8    
4773 N N7    . G   C 11  ? 0.6231 0.8693 0.6321 -0.0065 0.0231  -0.0121 11  G   G N7    
4774 C C5    . G   C 11  ? 0.5612 0.8193 0.5791 -0.0158 0.0210  -0.0047 11  G   G C5    
4775 C C6    . G   C 11  ? 0.6105 0.8700 0.6397 -0.0202 0.0115  0.0027  11  G   G C6    
4776 O O6    . G   C 11  ? 0.5862 0.8363 0.6200 -0.0168 0.0028  0.0043  11  G   G O6    
4777 N N1    . G   C 11  ? 0.6336 0.9071 0.6690 -0.0296 0.0128  0.0087  11  G   G N1    
4778 C C2    . G   C 11  ? 0.6538 0.9212 0.6793 -0.0320 0.0182  0.0070  11  G   G C2    
4779 N N2    . G   C 11  ? 0.7185 0.9860 0.7461 -0.0386 0.0157  0.0125  11  G   G N2    
4780 N N3    . G   C 11  ? 0.5959 0.8528 0.6110 -0.0274 0.0233  0.0003  11  G   G N3    
4781 C C4    . G   C 11  ? 0.5620 0.8165 0.5740 -0.0199 0.0251  -0.0050 11  G   G C4    
4782 P P     . U   C 12  ? 1.2904 1.5413 1.2907 -0.0210 0.0267  -0.0144 12  U   G P     
4783 O OP1   . U   C 12  ? 1.3067 1.5536 1.3045 -0.0215 0.0276  -0.0161 12  U   G OP1   
4784 O OP2   . U   C 12  ? 1.3171 1.5740 1.3187 -0.0163 0.0255  -0.0161 12  U   G OP2   
4785 O "O5'" . U   C 12  ? 1.1496 1.4150 1.1563 -0.0296 0.0224  -0.0071 12  U   G "O5'" 
4786 C "C5'" . U   C 12  ? 1.2105 1.4712 1.2165 -0.0337 0.0228  -0.0049 12  U   G "C5'" 
4787 C "C4'" . U   C 12  ? 1.2486 1.5185 1.2596 -0.0399 0.0189  0.0019  12  U   G "C4'" 
4788 O "O4'" . U   C 12  ? 1.2180 1.4863 1.2313 -0.0381 0.0193  0.0027  12  U   G "O4'" 
4789 C "C3'" . U   C 12  ? 1.3126 1.5959 1.3286 -0.0443 0.0140  0.0072  12  U   G "C3'" 
4790 O "O3'" . U   C 12  ? 1.3609 1.6471 1.3750 -0.0480 0.0126  0.0088  12  U   G "O3'" 
4791 C "C2'" . U   C 12  ? 1.2853 1.5707 1.3071 -0.0479 0.0111  0.0135  12  U   G "C2'" 
4792 O "O2'" . U   C 12  ? 1.3239 1.6064 1.3444 -0.0523 0.0103  0.0169  12  U   G "O2'" 
4793 C "C1'" . U   C 12  ? 1.1918 1.4704 1.2124 -0.0429 0.0144  0.0096  12  U   G "C1'" 
4794 N N1    . U   C 12  ? 1.0407 1.3244 1.0669 -0.0392 0.0129  0.0091  12  U   G N1    
4795 C C2    . U   C 12  ? 0.9042 1.1923 0.9406 -0.0423 0.0071  0.0153  12  U   G C2    
4796 O O2    . U   C 12  ? 0.8902 1.1770 0.9290 -0.0477 0.0043  0.0211  12  U   G O2    
4797 N N3    . U   C 12  ? 0.7765 1.0676 0.8205 -0.0378 0.0034  0.0141  12  U   G N3    
4798 C C4    . U   C 12  ? 0.7980 1.0905 0.8398 -0.0301 0.0064  0.0070  12  U   G C4    
4799 O O4    . U   C 12  ? 0.7625 1.0426 0.8055 -0.0241 -0.0001 0.0060  12  U   G O4    
4800 C C5    . U   C 12  ? 0.8801 1.1664 0.9081 -0.0272 0.0147  0.0008  12  U   G C5    
4801 C C6    . U   C 12  ? 0.9662 1.2476 0.9884 -0.0321 0.0163  0.0023  12  U   G C6    
4802 P P     . G   C 13  ? 1.4124 1.7088 1.4292 -0.0505 0.0091  0.0120  13  G   G P     
4803 O OP1   . G   C 13  ? 1.4546 1.7513 1.4667 -0.0512 0.0096  0.0098  13  G   G OP1   
4804 O OP2   . G   C 13  ? 1.4162 1.7166 1.4367 -0.0466 0.0087  0.0101  13  G   G OP2   
4805 O "O5'" . G   C 13  ? 1.6622 1.9610 1.6843 -0.0563 0.0052  0.0202  13  G   G "O5'" 
4806 C "C5'" . G   C 13  ? 1.6793 1.9829 1.7086 -0.0584 0.0012  0.0250  13  G   G "C5'" 
4807 C "C4'" . G   C 13  ? 1.6804 1.9811 1.7173 -0.0608 -0.0023 0.0306  13  G   G "C4'" 
4808 O "O4'" . G   C 13  ? 1.6170 1.9147 1.6551 -0.0572 -0.0009 0.0279  13  G   G "O4'" 
4809 C "C3'" . G   C 13  ? 1.7184 2.0204 1.7653 -0.0622 -0.0080 0.0351  13  G   G "C3'" 
4810 O "O3'" . G   C 13  ? 1.7584 2.0615 1.8065 -0.0666 -0.0103 0.0397  13  G   G "O3'" 
4811 C "C2'" . G   C 13  ? 1.6753 1.9722 1.7288 -0.0619 -0.0112 0.0376  13  G   G "C2'" 
4812 O "O2'" . G   C 13  ? 1.7011 1.9948 1.7549 -0.0661 -0.0121 0.0425  13  G   G "O2'" 
4813 C "C1'" . G   C 13  ? 1.5725 1.8686 1.6204 -0.0577 -0.0062 0.0319  13  G   G "C1'" 
4814 N N9    . G   C 13  ? 1.4279 1.7253 1.4793 -0.0521 -0.0073 0.0277  13  G   G N9    
4815 C C8    . G   C 13  ? 1.3675 1.6680 1.4131 -0.0470 -0.0026 0.0206  13  G   G C8    
4816 N N7    . G   C 13  ? 1.3351 1.6358 1.3855 -0.0415 -0.0053 0.0175  13  G   G N7    
4817 C C5    . G   C 13  ? 1.3143 1.6103 1.3740 -0.0432 -0.0132 0.0231  13  G   G C5    
4818 C C6    . G   C 13  ? 1.2529 1.5438 1.3195 -0.0384 -0.0208 0.0227  13  G   G C6    
4819 O O6    . G   C 13  ? 1.2002 1.4905 1.2662 -0.0309 -0.0223 0.0172  13  G   G O6    
4820 N N1    . G   C 13  ? 1.2518 1.5359 1.3253 -0.0422 -0.0275 0.0293  13  G   G N1    
4821 C C2    . G   C 13  ? 1.2690 1.5527 1.3431 -0.0492 -0.0266 0.0351  13  G   G C2    
4822 N N2    . G   C 13  ? 1.2486 1.5254 1.3295 -0.0514 -0.0333 0.0402  13  G   G N2    
4823 N N3    . G   C 13  ? 1.3101 1.5988 1.3776 -0.0531 -0.0200 0.0353  13  G   G N3    
4824 C C4    . G   C 13  ? 1.3482 1.6423 1.4086 -0.0500 -0.0138 0.0293  13  G   G C4    
4825 P P     . G   C 14  ? 3.6674 3.9758 3.7136 -0.0671 -0.0103 0.0388  14  G   G P     
4826 O OP1   . G   C 14  ? 3.6760 3.9840 3.7275 -0.0713 -0.0144 0.0447  14  G   G OP1   
4827 O OP2   . G   C 14  ? 3.6706 3.9813 3.7063 -0.0659 -0.0053 0.0343  14  G   G OP2   
4828 O "O5'" . G   C 14  ? 2.1411 2.4510 2.1925 -0.0629 -0.0125 0.0357  14  G   G "O5'" 
4829 C "C5'" . G   C 14  ? 2.1621 2.4708 2.2226 -0.0636 -0.0186 0.0387  14  G   G "C5'" 
4830 C "C4'" . G   C 14  ? 2.1796 2.4817 2.2480 -0.0644 -0.0237 0.0426  14  G   G "C4'" 
4831 O "O4'" . G   C 14  ? 2.1617 2.4615 2.2288 -0.0610 -0.0219 0.0396  14  G   G "O4'" 
4832 C "C3'" . G   C 14  ? 2.1980 2.4962 2.2757 -0.0629 -0.0312 0.0438  14  G   G "C3'" 
4833 O "O3'" . G   C 14  ? 2.2128 2.5110 2.2944 -0.0668 -0.0346 0.0481  14  G   G "O3'" 
4834 C "C2'" . G   C 14  ? 2.1767 2.4680 2.2590 -0.0614 -0.0347 0.0450  14  G   G "C2'" 
4835 O "O2'" . G   C 14  ? 2.1824 2.4706 2.2668 -0.0660 -0.0360 0.0503  14  G   G "O2'" 
4836 C "C1'" . G   C 14  ? 2.1281 2.4218 2.2034 -0.0589 -0.0284 0.0408  14  G   G "C1'" 
4837 N N9    . G   C 14  ? 2.0313 2.3252 2.1062 -0.0523 -0.0288 0.0350  14  G   G N9    
4838 C C8    . G   C 14  ? 1.9831 2.2831 2.0509 -0.0490 -0.0230 0.0291  14  G   G C8    
4839 N N7    . G   C 14  ? 1.9530 2.2517 2.0217 -0.0422 -0.0249 0.0242  14  G   G N7    
4840 C C5    . G   C 14  ? 1.9519 2.2422 2.0283 -0.0412 -0.0329 0.0274  14  G   G C5    
4841 C C6    . G   C 14  ? 1.9295 2.2128 2.0087 -0.0342 -0.0390 0.0246  14  G   G C6    
4842 O O6    . G   C 14  ? 1.9164 2.2001 1.9917 -0.0267 -0.0382 0.0182  14  G   G O6    
4843 N N1    . G   C 14  ? 1.9296 2.2037 2.0158 -0.0356 -0.0465 0.0296  14  G   G N1    
4844 C C2    . G   C 14  ? 1.9335 2.2064 2.0237 -0.0426 -0.0477 0.0359  14  G   G C2    
4845 N N2    . G   C 14  ? 1.9247 2.1883 2.0210 -0.0425 -0.0549 0.0393  14  G   G N2    
4846 N N3    . G   C 14  ? 1.9550 2.2345 2.0424 -0.0487 -0.0421 0.0383  14  G   G N3    
4847 C C4    . G   C 14  ? 1.9804 2.2679 2.0608 -0.0477 -0.0351 0.0340  14  G   G C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   293 ?   ?   ?   A . n 
A 1 2   LEU 2   294 ?   ?   ?   A . n 
A 1 3   GLU 3   295 295 GLU GLU A . n 
A 1 4   GLU 4   296 296 GLU GLU A . n 
A 1 5   ALA 5   297 297 ALA ALA A . n 
A 1 6   PRO 6   298 298 PRO PRO A . n 
A 1 7   TRP 7   299 299 TRP TRP A . n 
A 1 8   PRO 8   300 300 PRO PRO A . n 
A 1 9   PRO 9   301 301 PRO PRO A . n 
A 1 10  PRO 10  302 302 PRO PRO A . n 
A 1 11  GLU 11  303 303 GLU GLU A . n 
A 1 12  GLY 12  304 304 GLY GLY A . n 
A 1 13  ALA 13  305 305 ALA ALA A . n 
A 1 14  PHE 14  306 306 PHE PHE A . n 
A 1 15  VAL 15  307 307 VAL VAL A . n 
A 1 16  GLY 16  308 308 GLY GLY A . n 
A 1 17  PHE 17  309 309 PHE PHE A . n 
A 1 18  VAL 18  310 310 VAL VAL A . n 
A 1 19  LEU 19  311 311 LEU LEU A . n 
A 1 20  SER 20  312 312 SER SER A . n 
A 1 21  ARG 21  313 313 ARG ARG A . n 
A 1 22  LYS 22  314 314 LYS LYS A . n 
A 1 23  GLU 23  315 315 GLU GLU A . n 
A 1 24  PRO 24  316 316 PRO PRO A . n 
A 1 25  MET 25  317 317 MET MET A . n 
A 1 26  TRP 26  318 318 TRP TRP A . n 
A 1 27  ALA 27  319 319 ALA ALA A . n 
A 1 28  ASP 28  320 320 ASP ASP A . n 
A 1 29  LEU 29  321 321 LEU LEU A . n 
A 1 30  LEU 30  322 322 LEU LEU A . n 
A 1 31  ALA 31  323 323 ALA ALA A . n 
A 1 32  LEU 32  324 324 LEU LEU A . n 
A 1 33  ALA 33  325 325 ALA ALA A . n 
A 1 34  ALA 34  326 326 ALA ALA A . n 
A 1 35  ALA 35  327 327 ALA ALA A . n 
A 1 36  ARG 36  328 328 ARG ARG A . n 
A 1 37  GLY 37  329 329 GLY GLY A . n 
A 1 38  GLY 38  330 330 GLY GLY A . n 
A 1 39  ARG 39  331 331 ARG ARG A . n 
A 1 40  VAL 40  332 332 VAL VAL A . n 
A 1 41  HIS 41  333 333 HIS HIS A . n 
A 1 42  ARG 42  334 334 ARG ARG A . n 
A 1 43  ALA 43  335 335 ALA ALA A . n 
A 1 44  PRO 44  336 336 PRO PRO A . n 
A 1 45  GLU 45  337 337 GLU GLU A . n 
A 1 46  PRO 46  338 338 PRO PRO A . n 
A 1 47  TYR 47  339 339 TYR TYR A . n 
A 1 48  LYS 48  340 340 LYS LYS A . n 
A 1 49  ALA 49  341 341 ALA ALA A . n 
A 1 50  LEU 50  342 342 LEU LEU A . n 
A 1 51  ARG 51  343 343 ARG ARG A . n 
A 1 52  ASP 52  344 344 ASP ASP A . n 
A 1 53  LEU 53  345 345 LEU LEU A . n 
A 1 54  LYS 54  346 346 LYS LYS A . n 
A 1 55  GLU 55  347 347 GLU GLU A . n 
A 1 56  ALA 56  348 348 ALA ALA A . n 
A 1 57  ARG 57  349 349 ARG ARG A . n 
A 1 58  GLY 58  350 350 GLY GLY A . n 
A 1 59  LEU 59  351 351 LEU LEU A . n 
A 1 60  LEU 60  352 352 LEU LEU A . n 
A 1 61  ALA 61  353 353 ALA ALA A . n 
A 1 62  LYS 62  354 354 LYS LYS A . n 
A 1 63  ASP 63  355 355 ASP ASP A . n 
A 1 64  LEU 64  356 356 LEU LEU A . n 
A 1 65  SER 65  357 357 SER SER A . n 
A 1 66  VAL 66  358 358 VAL VAL A . n 
A 1 67  LEU 67  359 359 LEU LEU A . n 
A 1 68  ALA 68  360 360 ALA ALA A . n 
A 1 69  LEU 69  361 361 LEU LEU A . n 
A 1 70  ARG 70  362 362 ARG ARG A . n 
A 1 71  GLU 71  363 363 GLU GLU A . n 
A 1 72  GLY 72  364 364 GLY GLY A . n 
A 1 73  LEU 73  365 365 LEU LEU A . n 
A 1 74  GLY 74  366 366 GLY GLY A . n 
A 1 75  LEU 75  367 367 LEU LEU A . n 
A 1 76  PRO 76  368 368 PRO PRO A . n 
A 1 77  PRO 77  369 369 PRO PRO A . n 
A 1 78  GLY 78  370 370 GLY GLY A . n 
A 1 79  ASP 79  371 371 ASP ASP A . n 
A 1 80  ASP 80  372 372 ASP ASP A . n 
A 1 81  PRO 81  373 373 PRO PRO A . n 
A 1 82  MET 82  374 374 MET MET A . n 
A 1 83  LEU 83  375 375 LEU LEU A . n 
A 1 84  LEU 84  376 376 LEU LEU A . n 
A 1 85  ALA 85  377 377 ALA ALA A . n 
A 1 86  TYR 86  378 378 TYR TYR A . n 
A 1 87  LEU 87  379 379 LEU LEU A . n 
A 1 88  LEU 88  380 380 LEU LEU A . n 
A 1 89  ASP 89  381 381 ASP ASP A . n 
A 1 90  PRO 90  382 382 PRO PRO A . n 
A 1 91  SER 91  383 383 SER SER A . n 
A 1 92  ASN 92  384 384 ASN ASN A . n 
A 1 93  THR 93  385 385 THR THR A . n 
A 1 94  THR 94  386 386 THR THR A . n 
A 1 95  PRO 95  387 387 PRO PRO A . n 
A 1 96  GLU 96  388 388 GLU GLU A . n 
A 1 97  GLY 97  389 389 GLY GLY A . n 
A 1 98  VAL 98  390 390 VAL VAL A . n 
A 1 99  ALA 99  391 391 ALA ALA A . n 
A 1 100 ARG 100 392 392 ARG ARG A . n 
A 1 101 ARG 101 393 393 ARG ARG A . n 
A 1 102 TYR 102 394 394 TYR TYR A . n 
A 1 103 GLY 103 395 395 GLY GLY A . n 
A 1 104 GLY 104 396 396 GLY GLY A . n 
A 1 105 GLU 105 397 397 GLU GLU A . n 
A 1 106 TRP 106 398 398 TRP TRP A . n 
A 1 107 THR 107 399 399 THR THR A . n 
A 1 108 GLU 108 400 400 GLU GLU A . n 
A 1 109 GLU 109 401 401 GLU GLU A . n 
A 1 110 ALA 110 402 402 ALA ALA A . n 
A 1 111 GLY 111 403 403 GLY GLY A . n 
A 1 112 GLU 112 404 404 GLU GLU A . n 
A 1 113 ARG 113 405 405 ARG ARG A . n 
A 1 114 ALA 114 406 406 ALA ALA A . n 
A 1 115 ALA 115 407 407 ALA ALA A . n 
A 1 116 LEU 116 408 408 LEU LEU A . n 
A 1 117 SER 117 409 409 SER SER A . n 
A 1 118 GLU 118 410 410 GLU GLU A . n 
A 1 119 ARG 119 411 411 ARG ARG A . n 
A 1 120 LEU 120 412 412 LEU LEU A . n 
A 1 121 PHE 121 413 413 PHE PHE A . n 
A 1 122 ALA 122 414 414 ALA ALA A . n 
A 1 123 ASN 123 415 415 ASN ASN A . n 
A 1 124 LEU 124 416 416 LEU LEU A . n 
A 1 125 TRP 125 417 417 TRP TRP A . n 
A 1 126 GLY 126 418 418 GLY GLY A . n 
A 1 127 ARG 127 419 419 ARG ARG A . n 
A 1 128 LEU 128 420 420 LEU LEU A . n 
A 1 129 GLU 129 421 421 GLU GLU A . n 
A 1 130 GLY 130 422 422 GLY GLY A . n 
A 1 131 GLU 131 423 423 GLU GLU A . n 
A 1 132 GLU 132 424 424 GLU GLU A . n 
A 1 133 ARG 133 425 425 ARG ARG A . n 
A 1 134 LEU 134 426 426 LEU LEU A . n 
A 1 135 LEU 135 427 427 LEU LEU A . n 
A 1 136 TRP 136 428 428 TRP TRP A . n 
A 1 137 LEU 137 429 429 LEU LEU A . n 
A 1 138 TYR 138 430 430 TYR TYR A . n 
A 1 139 ARG 139 431 431 ARG ARG A . n 
A 1 140 GLU 140 432 432 GLU GLU A . n 
A 1 141 VAL 141 433 433 VAL VAL A . n 
A 1 142 GLU 142 434 434 GLU GLU A . n 
A 1 143 ARG 143 435 435 ARG ARG A . n 
A 1 144 PRO 144 436 436 PRO PRO A . n 
A 1 145 LEU 145 437 437 LEU LEU A . n 
A 1 146 SER 146 438 438 SER SER A . n 
A 1 147 ALA 147 439 439 ALA ALA A . n 
A 1 148 VAL 148 440 440 VAL VAL A . n 
A 1 149 LEU 149 441 441 LEU LEU A . n 
A 1 150 ALA 150 442 442 ALA ALA A . n 
A 1 151 HIS 151 443 443 HIS HIS A . n 
A 1 152 MET 152 444 444 MET MET A . n 
A 1 153 GLU 153 445 445 GLU GLU A . n 
A 1 154 ALA 154 446 446 ALA ALA A . n 
A 1 155 THR 155 447 447 THR THR A . n 
A 1 156 GLY 156 448 448 GLY GLY A . n 
A 1 157 VAL 157 449 449 VAL VAL A . n 
A 1 158 ARG 158 450 450 ARG ARG A . n 
A 1 159 LEU 159 451 451 LEU LEU A . n 
A 1 160 ASP 160 452 452 ASP ASP A . n 
A 1 161 VAL 161 453 453 VAL VAL A . n 
A 1 162 ALA 162 454 454 ALA ALA A . n 
A 1 163 TYR 163 455 455 TYR TYR A . n 
A 1 164 LEU 164 456 456 LEU LEU A . n 
A 1 165 ARG 165 457 457 ARG ARG A . n 
A 1 166 ALA 166 458 458 ALA ALA A . n 
A 1 167 MET 167 459 459 MET MET A . n 
A 1 168 SER 168 460 460 SER SER A . n 
A 1 169 LEU 169 461 461 LEU LEU A . n 
A 1 170 GLU 170 462 462 GLU GLU A . n 
A 1 171 VAL 171 463 463 VAL VAL A . n 
A 1 172 ALA 172 464 464 ALA ALA A . n 
A 1 173 GLU 173 465 465 GLU GLU A . n 
A 1 174 GLU 174 466 466 GLU GLU A . n 
A 1 175 ILE 175 467 467 ILE ILE A . n 
A 1 176 ALA 176 468 468 ALA ALA A . n 
A 1 177 ARG 177 469 469 ARG ARG A . n 
A 1 178 LEU 178 470 470 LEU LEU A . n 
A 1 179 GLU 179 471 471 GLU GLU A . n 
A 1 180 ALA 180 472 472 ALA ALA A . n 
A 1 181 GLU 181 473 473 GLU GLU A . n 
A 1 182 VAL 182 474 474 VAL VAL A . n 
A 1 183 PHE 183 475 475 PHE PHE A . n 
A 1 184 ARG 184 476 476 ARG ARG A . n 
A 1 185 LEU 185 477 477 LEU LEU A . n 
A 1 186 ALA 186 478 478 ALA ALA A . n 
A 1 187 GLY 187 479 479 GLY GLY A . n 
A 1 188 HIS 188 480 480 HIS HIS A . n 
A 1 189 PRO 189 481 481 PRO PRO A . n 
A 1 190 PHE 190 482 482 PHE PHE A . n 
A 1 191 ASN 191 483 483 ASN ASN A . n 
A 1 192 LEU 192 484 484 LEU LEU A . n 
A 1 193 ASN 193 485 485 ASN ASN A . n 
A 1 194 SER 194 486 486 SER SER A . n 
A 1 195 ARG 195 487 487 ARG ARG A . n 
A 1 196 ASP 196 488 488 ASP ASP A . n 
A 1 197 GLN 197 489 489 GLN GLN A . n 
A 1 198 LEU 198 490 490 LEU LEU A . n 
A 1 199 GLU 199 491 491 GLU GLU A . n 
A 1 200 ARG 200 492 492 ARG ARG A . n 
A 1 201 VAL 201 493 493 VAL VAL A . n 
A 1 202 LEU 202 494 494 LEU LEU A . n 
A 1 203 PHE 203 495 495 PHE PHE A . n 
A 1 204 ASP 204 496 496 ASP ASP A . n 
A 1 205 GLU 205 497 497 GLU GLU A . n 
A 1 206 LEU 206 498 498 LEU LEU A . n 
A 1 207 GLY 207 499 499 GLY GLY A . n 
A 1 208 LEU 208 500 500 LEU LEU A . n 
A 1 209 PRO 209 501 501 PRO PRO A . n 
A 1 210 ALA 210 502 502 ALA ALA A . n 
A 1 211 ILE 211 503 503 ILE ILE A . n 
A 1 212 GLY 212 504 504 GLY GLY A . n 
A 1 213 LYS 213 505 505 LYS LYS A . n 
A 1 214 THR 214 506 506 THR THR A . n 
A 1 215 GLU 215 507 507 GLU GLU A . n 
A 1 216 LYS 216 508 508 LYS LYS A . n 
A 1 217 THR 217 509 509 THR THR A . n 
A 1 218 GLY 218 510 510 GLY GLY A . n 
A 1 219 LYS 219 511 511 LYS LYS A . n 
A 1 220 ARG 220 512 512 ARG ARG A . n 
A 1 221 SER 221 513 513 SER SER A . n 
A 1 222 THR 222 514 514 THR THR A . n 
A 1 223 ARG 223 515 515 ARG ARG A . n 
A 1 224 ALA 224 516 516 ALA ALA A . n 
A 1 225 ALA 225 517 517 ALA ALA A . n 
A 1 226 VAL 226 518 518 VAL VAL A . n 
A 1 227 LEU 227 519 519 LEU LEU A . n 
A 1 228 GLU 228 520 520 GLU GLU A . n 
A 1 229 ALA 229 521 521 ALA ALA A . n 
A 1 230 LEU 230 522 522 LEU LEU A . n 
A 1 231 ARG 231 523 523 ARG ARG A . n 
A 1 232 GLU 232 524 524 GLU GLU A . n 
A 1 233 ALA 233 525 525 ALA ALA A . n 
A 1 234 HIS 234 526 526 HIS HIS A . n 
A 1 235 PRO 235 527 527 PRO PRO A . n 
A 1 236 ILE 236 528 528 ILE ILE A . n 
A 1 237 VAL 237 529 529 VAL VAL A . n 
A 1 238 GLU 238 530 530 GLU GLU A . n 
A 1 239 LYS 239 531 531 LYS LYS A . n 
A 1 240 ILE 240 532 532 ILE ILE A . n 
A 1 241 LEU 241 533 533 LEU LEU A . n 
A 1 242 GLN 242 534 534 GLN GLN A . n 
A 1 243 TYR 243 535 535 TYR TYR A . n 
A 1 244 ARG 244 536 536 ARG ARG A . n 
A 1 245 GLU 245 537 537 GLU GLU A . n 
A 1 246 LEU 246 538 538 LEU LEU A . n 
A 1 247 THR 247 539 539 THR THR A . n 
A 1 248 LYS 248 540 540 LYS LYS A . n 
A 1 249 LEU 249 541 541 LEU LEU A . n 
A 1 250 LYS 250 542 542 LYS LYS A . n 
A 1 251 SER 251 543 543 SER SER A . n 
A 1 252 THR 252 544 544 THR THR A . n 
A 1 253 TYR 253 545 545 TYR TYR A . n 
A 1 254 ILE 254 546 546 ILE ILE A . n 
A 1 255 ASP 255 547 547 ASP ASP A . n 
A 1 256 PRO 256 548 548 PRO PRO A . n 
A 1 257 LEU 257 549 549 LEU LEU A . n 
A 1 258 PRO 258 550 550 PRO PRO A . n 
A 1 259 ASP 259 551 551 ASP ASP A . n 
A 1 260 LEU 260 552 552 LEU LEU A . n 
A 1 261 ILE 261 553 553 ILE ILE A . n 
A 1 262 HIS 262 554 554 HIS HIS A . n 
A 1 263 PRO 263 555 555 PRO PRO A . n 
A 1 264 ARG 264 556 556 ARG ARG A . n 
A 1 265 THR 265 557 557 THR THR A . n 
A 1 266 GLY 266 558 558 GLY GLY A . n 
A 1 267 ARG 267 559 559 ARG ARG A . n 
A 1 268 LEU 268 560 560 LEU LEU A . n 
A 1 269 HIS 269 561 561 HIS HIS A . n 
A 1 270 THR 270 562 562 THR THR A . n 
A 1 271 ARG 271 563 563 ARG ARG A . n 
A 1 272 PHE 272 564 564 PHE PHE A . n 
A 1 273 ASN 273 565 565 ASN ASN A . n 
A 1 274 GLN 274 566 566 GLN GLN A . n 
A 1 275 THR 275 567 567 THR THR A . n 
A 1 276 ALA 276 568 568 ALA ALA A . n 
A 1 277 THR 277 569 569 THR THR A . n 
A 1 278 ALA 278 570 570 ALA ALA A . n 
A 1 279 THR 279 571 571 THR THR A . n 
A 1 280 GLY 280 572 572 GLY GLY A . n 
A 1 281 ARG 281 573 573 ARG ARG A . n 
A 1 282 LEU 282 574 574 LEU LEU A . n 
A 1 283 SER 283 575 575 SER SER A . n 
A 1 284 SER 284 576 576 SER SER A . n 
A 1 285 SER 285 577 577 SER SER A . n 
A 1 286 ASP 286 578 578 ASP ASP A . n 
A 1 287 PRO 287 579 579 PRO PRO A . n 
A 1 288 ASN 288 580 580 ASN ASN A . n 
A 1 289 LEU 289 581 581 LEU LEU A . n 
A 1 290 GLN 290 582 582 GLN GLN A . n 
A 1 291 ASN 291 583 583 ASN ASN A . n 
A 1 292 ILE 292 584 584 ILE ILE A . n 
A 1 293 PRO 293 585 585 PRO PRO A . n 
A 1 294 VAL 294 586 586 VAL VAL A . n 
A 1 295 ARG 295 587 587 ARG ARG A . n 
A 1 296 THR 296 588 588 THR THR A . n 
A 1 297 PRO 297 589 589 PRO PRO A . n 
A 1 298 LEU 298 590 590 LEU LEU A . n 
A 1 299 GLY 299 591 591 GLY GLY A . n 
A 1 300 GLN 300 592 592 GLN GLN A . n 
A 1 301 ARG 301 593 593 ARG ARG A . n 
A 1 302 ILE 302 594 594 ILE ILE A . n 
A 1 303 ARG 303 595 595 ARG ARG A . n 
A 1 304 ARG 304 596 596 ARG ARG A . n 
A 1 305 ALA 305 597 597 ALA ALA A . n 
A 1 306 PHE 306 598 598 PHE PHE A . n 
A 1 307 ILE 307 599 599 ILE ILE A . n 
A 1 308 ALA 308 600 600 ALA ALA A . n 
A 1 309 GLU 309 601 601 GLU GLU A . n 
A 1 310 GLU 310 602 602 GLU GLU A . n 
A 1 311 GLY 311 603 603 GLY GLY A . n 
A 1 312 TRP 312 604 604 TRP TRP A . n 
A 1 313 LEU 313 605 605 LEU LEU A . n 
A 1 314 LEU 314 606 606 LEU LEU A . n 
A 1 315 VAL 315 607 607 VAL VAL A . n 
A 1 316 ALA 316 608 608 ALA ALA A . n 
A 1 317 LEU 317 609 609 LEU LEU A . n 
A 1 318 ASP 318 610 610 ASP ASP A . n 
A 1 319 TYR 319 611 611 TYR TYR A . n 
A 1 320 SER 320 612 612 SER SER A . n 
A 1 321 GLN 321 613 613 GLN GLN A . n 
A 1 322 ILE 322 614 614 ILE ILE A . n 
A 1 323 GLU 323 615 615 GLU GLU A . n 
A 1 324 LEU 324 616 616 LEU LEU A . n 
A 1 325 ARG 325 617 617 ARG ARG A . n 
A 1 326 VAL 326 618 618 VAL VAL A . n 
A 1 327 LEU 327 619 619 LEU LEU A . n 
A 1 328 ALA 328 620 620 ALA ALA A . n 
A 1 329 HIS 329 621 621 HIS HIS A . n 
A 1 330 LEU 330 622 622 LEU LEU A . n 
A 1 331 SER 331 623 623 SER SER A . n 
A 1 332 GLY 332 624 624 GLY GLY A . n 
A 1 333 ASP 333 625 625 ASP ASP A . n 
A 1 334 GLU 334 626 626 GLU GLU A . n 
A 1 335 ASN 335 627 627 ASN ASN A . n 
A 1 336 LEU 336 628 628 LEU LEU A . n 
A 1 337 ILE 337 629 629 ILE ILE A . n 
A 1 338 ARG 338 630 630 ARG ARG A . n 
A 1 339 VAL 339 631 631 VAL VAL A . n 
A 1 340 PHE 340 632 632 PHE PHE A . n 
A 1 341 GLN 341 633 633 GLN GLN A . n 
A 1 342 GLU 342 634 634 GLU GLU A . n 
A 1 343 GLY 343 635 635 GLY GLY A . n 
A 1 344 ARG 344 636 636 ARG ARG A . n 
A 1 345 ASP 345 637 637 ASP ASP A . n 
A 1 346 PHE 346 638 638 PHE PHE A . n 
A 1 347 HIS 347 639 639 HIS HIS A . n 
A 1 348 THR 348 640 640 THR THR A . n 
A 1 349 GLU 349 641 641 GLU GLU A . n 
A 1 350 THR 350 642 642 THR THR A . n 
A 1 351 ALA 351 643 643 ALA ALA A . n 
A 1 352 SER 352 644 644 SER SER A . n 
A 1 353 TRP 353 645 645 TRP TRP A . n 
A 1 354 MET 354 646 646 MET MET A . n 
A 1 355 PHE 355 647 647 PHE PHE A . n 
A 1 356 GLY 356 648 648 GLY GLY A . n 
A 1 357 VAL 357 649 649 VAL VAL A . n 
A 1 358 PRO 358 650 650 PRO PRO A . n 
A 1 359 ARG 359 651 651 ARG ARG A . n 
A 1 360 GLU 360 652 652 GLU GLU A . n 
A 1 361 ALA 361 653 653 ALA ALA A . n 
A 1 362 VAL 362 654 654 VAL VAL A . n 
A 1 363 ASP 363 655 655 ASP ASP A . n 
A 1 364 PRO 364 656 656 PRO PRO A . n 
A 1 365 LEU 365 657 657 LEU LEU A . n 
A 1 366 MET 366 658 658 MET MET A . n 
A 1 367 ARG 367 659 659 ARG ARG A . n 
A 1 368 ARG 368 660 660 ARG ARG A . n 
A 1 369 ALA 369 661 661 ALA ALA A . n 
A 1 370 ALA 370 662 662 ALA ALA A . n 
A 1 371 LYS 371 663 663 LYS LYS A . n 
A 1 372 THR 372 664 664 THR THR A . n 
A 1 373 ILE 373 665 665 ILE ILE A . n 
A 1 374 ASN 374 666 666 ASN ASN A . n 
A 1 375 PHE 375 667 667 PHE PHE A . n 
A 1 376 GLY 376 668 668 GLY GLY A . n 
A 1 377 VAL 377 669 669 VAL VAL A . n 
A 1 378 LEU 378 670 670 LEU LEU A . n 
A 1 379 TYR 379 671 671 TYR TYR A . n 
A 1 380 GLY 380 672 672 GLY GLY A . n 
A 1 381 MET 381 673 673 MET MET A . n 
A 1 382 SER 382 674 674 SER SER A . n 
A 1 383 ALA 383 675 675 ALA ALA A . n 
A 1 384 HIS 384 676 676 HIS HIS A . n 
A 1 385 ARG 385 677 677 ARG ARG A . n 
A 1 386 LEU 386 678 678 LEU LEU A . n 
A 1 387 SER 387 679 679 SER SER A . n 
A 1 388 GLN 388 680 680 GLN GLN A . n 
A 1 389 GLU 389 681 681 GLU GLU A . n 
A 1 390 LEU 390 682 682 LEU LEU A . n 
A 1 391 ALA 391 683 683 ALA ALA A . n 
A 1 392 ILE 392 684 684 ILE ILE A . n 
A 1 393 PRO 393 685 685 PRO PRO A . n 
A 1 394 TYR 394 686 686 TYR TYR A . n 
A 1 395 GLU 395 687 687 GLU GLU A . n 
A 1 396 GLU 396 688 688 GLU GLU A . n 
A 1 397 ALA 397 689 689 ALA ALA A . n 
A 1 398 GLN 398 690 690 GLN GLN A . n 
A 1 399 ALA 399 691 691 ALA ALA A . n 
A 1 400 PHE 400 692 692 PHE PHE A . n 
A 1 401 ILE 401 693 693 ILE ILE A . n 
A 1 402 GLU 402 694 694 GLU GLU A . n 
A 1 403 ARG 403 695 695 ARG ARG A . n 
A 1 404 TYR 404 696 696 TYR TYR A . n 
A 1 405 PHE 405 697 697 PHE PHE A . n 
A 1 406 GLN 406 698 698 GLN GLN A . n 
A 1 407 SER 407 699 699 SER SER A . n 
A 1 408 PHE 408 700 700 PHE PHE A . n 
A 1 409 PRO 409 701 701 PRO PRO A . n 
A 1 410 LYS 410 702 702 LYS LYS A . n 
A 1 411 VAL 411 703 703 VAL VAL A . n 
A 1 412 ARG 412 704 704 ARG ARG A . n 
A 1 413 ALA 413 705 705 ALA ALA A . n 
A 1 414 TRP 414 706 706 TRP TRP A . n 
A 1 415 ILE 415 707 707 ILE ILE A . n 
A 1 416 GLU 416 708 708 GLU GLU A . n 
A 1 417 LYS 417 709 709 LYS LYS A . n 
A 1 418 THR 418 710 710 THR THR A . n 
A 1 419 LEU 419 711 711 LEU LEU A . n 
A 1 420 GLU 420 712 712 GLU GLU A . n 
A 1 421 GLU 421 713 713 GLU GLU A . n 
A 1 422 GLY 422 714 714 GLY GLY A . n 
A 1 423 ARG 423 715 715 ARG ARG A . n 
A 1 424 ARG 424 716 716 ARG ARG A . n 
A 1 425 ARG 425 717 717 ARG ARG A . n 
A 1 426 GLY 426 718 718 GLY GLY A . n 
A 1 427 TYR 427 719 719 TYR TYR A . n 
A 1 428 VAL 428 720 720 VAL VAL A . n 
A 1 429 GLU 429 721 721 GLU GLU A . n 
A 1 430 THR 430 722 722 THR THR A . n 
A 1 431 LEU 431 723 723 LEU LEU A . n 
A 1 432 PHE 432 724 724 PHE PHE A . n 
A 1 433 GLY 433 725 725 GLY GLY A . n 
A 1 434 ARG 434 726 726 ARG ARG A . n 
A 1 435 ARG 435 727 727 ARG ARG A . n 
A 1 436 ARG 436 728 728 ARG ARG A . n 
A 1 437 TYR 437 729 729 TYR TYR A . n 
A 1 438 VAL 438 730 730 VAL VAL A . n 
A 1 439 PRO 439 731 731 PRO PRO A . n 
A 1 440 ASP 440 732 732 ASP ASP A . n 
A 1 441 LEU 441 733 733 LEU LEU A . n 
A 1 442 GLU 442 734 734 GLU GLU A . n 
A 1 443 ALA 443 735 735 ALA ALA A . n 
A 1 444 ARG 444 736 736 ARG ARG A . n 
A 1 445 VAL 445 737 737 VAL VAL A . n 
A 1 446 LYS 446 738 738 LYS LYS A . n 
A 1 447 SER 447 739 739 SER SER A . n 
A 1 448 VAL 448 740 740 VAL VAL A . n 
A 1 449 ARG 449 741 741 ARG ARG A . n 
A 1 450 GLU 450 742 742 GLU GLU A . n 
A 1 451 ALA 451 743 743 ALA ALA A . n 
A 1 452 ALA 452 744 744 ALA ALA A . n 
A 1 453 GLU 453 745 745 GLU GLU A . n 
A 1 454 ARG 454 746 746 ARG ARG A . n 
A 1 455 LYS 455 747 747 LYS LYS A . n 
A 1 456 ALA 456 748 748 ALA ALA A . n 
A 1 457 PHE 457 749 749 PHE PHE A . n 
A 1 458 ASN 458 750 750 ASN ASN A . n 
A 1 459 MET 459 751 751 MET MET A . n 
A 1 460 PRO 460 752 752 PRO PRO A . n 
A 1 461 VAL 461 753 753 VAL VAL A . n 
A 1 462 GLN 462 754 754 GLN GLN A . n 
A 1 463 GLY 463 755 755 GLY GLY A . n 
A 1 464 THR 464 756 756 THR THR A . n 
A 1 465 ALA 465 757 757 ALA ALA A . n 
A 1 466 ALA 466 758 758 ALA ALA A . n 
A 1 467 ASP 467 759 759 ASP ASP A . n 
A 1 468 LEU 468 760 760 LEU LEU A . n 
A 1 469 MET 469 761 761 MET MET A . n 
A 1 470 LYS 470 762 762 LYS LYS A . n 
A 1 471 LEU 471 763 763 LEU LEU A . n 
A 1 472 ALA 472 764 764 ALA ALA A . n 
A 1 473 MET 473 765 765 MET MET A . n 
A 1 474 VAL 474 766 766 VAL VAL A . n 
A 1 475 LYS 475 767 767 LYS LYS A . n 
A 1 476 LEU 476 768 768 LEU LEU A . n 
A 1 477 PHE 477 769 769 PHE PHE A . n 
A 1 478 PRO 478 770 770 PRO PRO A . n 
A 1 479 ARG 479 771 771 ARG ARG A . n 
A 1 480 LEU 480 772 772 LEU LEU A . n 
A 1 481 GLU 481 773 773 GLU GLU A . n 
A 1 482 GLU 482 774 774 GLU GLU A . n 
A 1 483 MET 483 775 775 MET MET A . n 
A 1 484 GLY 484 776 776 GLY GLY A . n 
A 1 485 ALA 485 777 777 ALA ALA A . n 
A 1 486 ARG 486 778 778 ARG ARG A . n 
A 1 487 MET 487 779 779 MET MET A . n 
A 1 488 LEU 488 780 780 LEU LEU A . n 
A 1 489 LEU 489 781 781 LEU LEU A . n 
A 1 490 GLN 490 782 782 GLN GLN A . n 
A 1 491 VAL 491 783 783 VAL VAL A . n 
A 1 492 HIS 492 784 784 HIS HIS A . n 
A 1 493 ASP 493 785 785 ASP ASP A . n 
A 1 494 GLU 494 786 786 GLU GLU A . n 
A 1 495 LEU 495 787 787 LEU LEU A . n 
A 1 496 VAL 496 788 788 VAL VAL A . n 
A 1 497 LEU 497 789 789 LEU LEU A . n 
A 1 498 GLU 498 790 790 GLU GLU A . n 
A 1 499 ALA 499 791 791 ALA ALA A . n 
A 1 500 PRO 500 792 792 PRO PRO A . n 
A 1 501 LYS 501 793 793 LYS LYS A . n 
A 1 502 GLU 502 794 794 GLU GLU A . n 
A 1 503 ARG 503 795 795 ARG ARG A . n 
A 1 504 ALA 504 796 796 ALA ALA A . n 
A 1 505 GLU 505 797 797 GLU GLU A . n 
A 1 506 ALA 506 798 798 ALA ALA A . n 
A 1 507 VAL 507 799 799 VAL VAL A . n 
A 1 508 ALA 508 800 800 ALA ALA A . n 
A 1 509 ARG 509 801 801 ARG ARG A . n 
A 1 510 LEU 510 802 802 LEU LEU A . n 
A 1 511 ALA 511 803 803 ALA ALA A . n 
A 1 512 LYS 512 804 804 LYS LYS A . n 
A 1 513 GLU 513 805 805 GLU GLU A . n 
A 1 514 VAL 514 806 806 VAL VAL A . n 
A 1 515 MET 515 807 807 MET MET A . n 
A 1 516 GLU 516 808 808 GLU GLU A . n 
A 1 517 GLY 517 809 809 GLY GLY A . n 
A 1 518 VAL 518 810 810 VAL VAL A . n 
A 1 519 TYR 519 811 811 TYR TYR A . n 
A 1 520 PRO 520 812 812 PRO PRO A . n 
A 1 521 LEU 521 813 813 LEU LEU A . n 
A 1 522 ALA 522 814 814 ALA ALA A . n 
A 1 523 VAL 523 815 815 VAL VAL A . n 
A 1 524 PRO 524 816 816 PRO PRO A . n 
A 1 525 LEU 525 817 817 LEU LEU A . n 
A 1 526 GLU 526 818 818 GLU GLU A . n 
A 1 527 VAL 527 819 819 VAL VAL A . n 
A 1 528 GLU 528 820 820 GLU GLU A . n 
A 1 529 VAL 529 821 821 VAL VAL A . n 
A 1 530 GLY 530 822 822 GLY GLY A . n 
A 1 531 ILE 531 823 823 ILE ILE A . n 
A 1 532 GLY 532 824 824 GLY GLY A . n 
A 1 533 GLU 533 825 825 GLU GLU A . n 
A 1 534 ASP 534 826 826 ASP ASP A . n 
A 1 535 TRP 535 827 827 TRP TRP A . n 
A 1 536 LEU 536 828 828 LEU LEU A . n 
A 1 537 SER 537 829 829 SER SER A . n 
A 1 538 ALA 538 830 830 ALA ALA A . n 
A 1 539 LYS 539 831 831 LYS LYS A . n 
A 1 540 GLU 540 832 832 GLU GLU A . n 
B 2 1   DG  1   101 ?   ?   ?   B . n 
B 2 2   DA  2   102 ?   ?   ?   B . n 
B 2 3   DC  3   103 103 DC  DC  B . n 
B 2 4   DC  4   104 104 DC  DC  B . n 
B 2 5   DA  5   105 105 DA  DA  B . n 
B 2 6   DC  6   106 106 DC  DC  B . n 
B 2 7   DG  7   107 107 DG  DG  B . n 
B 2 8   DG  8   108 108 DG  DG  B . n 
B 2 9   DC  9   109 109 DC  DC  B . n 
B 2 10  DG  10  110 110 DG  DG  B . n 
B 2 11  DC  11  111 111 DC  DC  B . n 
B 2 12  DOC 12  112 112 DOC DOC B . n 
C 3 1   A   1   1   1   A   A   G . n 
C 3 2   A   2   2   2   A   A   G . n 
C 3 3   A   3   3   3   A   A   G . n 
C 3 4   G   4   4   4   G   G   G . n 
C 3 5   G   5   5   5   G   G   G . n 
C 3 6   G   6   6   6   G   G   G . n 
C 3 7   C   7   7   7   C   C   G . n 
C 3 8   G   8   8   8   G   G   G . n 
C 3 9   C   9   9   9   C   C   G . n 
C 3 10  C   10  10  10  C   C   G . n 
C 3 11  G   11  11  11  G   G   G . n 
C 3 12  U   12  12  12  U   U   G . n 
C 3 13  G   13  13  13  G   G   G . n 
C 3 14  G   14  14  14  G   G   G . n 
C 3 15  U   15  15  ?   ?   ?   G . n 
C 3 16  C   16  16  ?   ?   ?   G . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DCT 1   1833 1833 DCT DCT A . 
E 5 CL  1   1834 1834 CL  CL  A . 
F 5 CL  1   1835 1835 CL  CL  A . 
G 6 MG  1   1836 1836 MG  MG  A . 
H 7 FMT 1   1837 1837 FMT FMT A . 
I 7 FMT 1   1838 1838 FMT FMT A . 
J 7 FMT 1   1839 1839 FMT FMT A . 
K 6 MG  1   1112 1112 MG  MG  B . 
L 6 MG  1   1113 1113 MG  MG  B . 
M 7 FMT 1   1015 1015 FMT FMT G . 
N 8 HOH 1   2001 2001 HOH HOH A . 
N 8 HOH 2   2002 2002 HOH HOH A . 
N 8 HOH 3   2003 2003 HOH HOH A . 
N 8 HOH 4   2004 2004 HOH HOH A . 
N 8 HOH 5   2005 2005 HOH HOH A . 
N 8 HOH 6   2006 2006 HOH HOH A . 
N 8 HOH 7   2007 2007 HOH HOH A . 
N 8 HOH 8   2008 2008 HOH HOH A . 
N 8 HOH 9   2009 2009 HOH HOH A . 
N 8 HOH 10  2010 2010 HOH HOH A . 
N 8 HOH 11  2011 2011 HOH HOH A . 
N 8 HOH 12  2012 2012 HOH HOH A . 
N 8 HOH 13  2013 2013 HOH HOH A . 
N 8 HOH 14  2014 2014 HOH HOH A . 
N 8 HOH 15  2015 2015 HOH HOH A . 
N 8 HOH 16  2016 2016 HOH HOH A . 
N 8 HOH 17  2017 2017 HOH HOH A . 
N 8 HOH 18  2018 2018 HOH HOH A . 
N 8 HOH 19  2019 2019 HOH HOH A . 
N 8 HOH 20  2020 2020 HOH HOH A . 
N 8 HOH 21  2021 2021 HOH HOH A . 
N 8 HOH 22  2022 2022 HOH HOH A . 
N 8 HOH 23  2023 2023 HOH HOH A . 
N 8 HOH 24  2024 2024 HOH HOH A . 
N 8 HOH 25  2025 2025 HOH HOH A . 
N 8 HOH 26  2026 2026 HOH HOH A . 
N 8 HOH 27  2027 2027 HOH HOH A . 
N 8 HOH 28  2028 2028 HOH HOH A . 
N 8 HOH 29  2029 2029 HOH HOH A . 
N 8 HOH 30  2030 2030 HOH HOH A . 
N 8 HOH 31  2031 2031 HOH HOH A . 
N 8 HOH 32  2032 2032 HOH HOH A . 
N 8 HOH 33  2033 2033 HOH HOH A . 
N 8 HOH 34  2034 2034 HOH HOH A . 
N 8 HOH 35  2035 2035 HOH HOH A . 
N 8 HOH 36  2036 2036 HOH HOH A . 
N 8 HOH 37  2037 2037 HOH HOH A . 
N 8 HOH 38  2038 2038 HOH HOH A . 
N 8 HOH 39  2039 2039 HOH HOH A . 
N 8 HOH 40  2040 2040 HOH HOH A . 
N 8 HOH 41  2041 2041 HOH HOH A . 
N 8 HOH 42  2042 2042 HOH HOH A . 
N 8 HOH 43  2043 2043 HOH HOH A . 
N 8 HOH 44  2044 2044 HOH HOH A . 
N 8 HOH 45  2045 2045 HOH HOH A . 
N 8 HOH 46  2046 2046 HOH HOH A . 
N 8 HOH 47  2047 2047 HOH HOH A . 
N 8 HOH 48  2048 2048 HOH HOH A . 
N 8 HOH 49  2049 2049 HOH HOH A . 
N 8 HOH 50  2050 2050 HOH HOH A . 
N 8 HOH 51  2051 2051 HOH HOH A . 
N 8 HOH 52  2052 2052 HOH HOH A . 
N 8 HOH 53  2053 2053 HOH HOH A . 
N 8 HOH 54  2054 2054 HOH HOH A . 
N 8 HOH 55  2055 2055 HOH HOH A . 
N 8 HOH 56  2056 2056 HOH HOH A . 
N 8 HOH 57  2057 2057 HOH HOH A . 
N 8 HOH 58  2058 2058 HOH HOH A . 
N 8 HOH 59  2059 2059 HOH HOH A . 
N 8 HOH 60  2060 2060 HOH HOH A . 
N 8 HOH 61  2061 2061 HOH HOH A . 
N 8 HOH 62  2062 2062 HOH HOH A . 
N 8 HOH 63  2063 2063 HOH HOH A . 
N 8 HOH 64  2064 2064 HOH HOH A . 
N 8 HOH 65  2065 2065 HOH HOH A . 
N 8 HOH 66  2066 2066 HOH HOH A . 
N 8 HOH 67  2067 2067 HOH HOH A . 
N 8 HOH 68  2068 2068 HOH HOH A . 
N 8 HOH 69  2069 2069 HOH HOH A . 
N 8 HOH 70  2070 2070 HOH HOH A . 
N 8 HOH 71  2071 2071 HOH HOH A . 
N 8 HOH 72  2072 2072 HOH HOH A . 
N 8 HOH 73  2073 2073 HOH HOH A . 
N 8 HOH 74  2074 2074 HOH HOH A . 
N 8 HOH 75  2075 2075 HOH HOH A . 
N 8 HOH 76  2076 2076 HOH HOH A . 
N 8 HOH 77  2077 2077 HOH HOH A . 
N 8 HOH 78  2078 2078 HOH HOH A . 
N 8 HOH 79  2079 2079 HOH HOH A . 
N 8 HOH 80  2080 2080 HOH HOH A . 
N 8 HOH 81  2081 2081 HOH HOH A . 
N 8 HOH 82  2082 2082 HOH HOH A . 
N 8 HOH 83  2083 2083 HOH HOH A . 
N 8 HOH 84  2084 2084 HOH HOH A . 
N 8 HOH 85  2085 2085 HOH HOH A . 
N 8 HOH 86  2086 2086 HOH HOH A . 
N 8 HOH 87  2087 2087 HOH HOH A . 
N 8 HOH 88  2088 2088 HOH HOH A . 
N 8 HOH 89  2089 2089 HOH HOH A . 
N 8 HOH 90  2090 2090 HOH HOH A . 
N 8 HOH 91  2091 2091 HOH HOH A . 
N 8 HOH 92  2092 2092 HOH HOH A . 
N 8 HOH 93  2093 2093 HOH HOH A . 
N 8 HOH 94  2094 2094 HOH HOH A . 
N 8 HOH 95  2095 2095 HOH HOH A . 
N 8 HOH 96  2096 2096 HOH HOH A . 
N 8 HOH 97  2097 2097 HOH HOH A . 
N 8 HOH 98  2098 2098 HOH HOH A . 
N 8 HOH 99  2099 2099 HOH HOH A . 
N 8 HOH 100 2100 2100 HOH HOH A . 
N 8 HOH 101 2101 2101 HOH HOH A . 
N 8 HOH 102 2102 2102 HOH HOH A . 
N 8 HOH 103 2103 2103 HOH HOH A . 
N 8 HOH 104 2104 2104 HOH HOH A . 
N 8 HOH 105 2105 2105 HOH HOH A . 
N 8 HOH 106 2106 2106 HOH HOH A . 
N 8 HOH 107 2107 2107 HOH HOH A . 
N 8 HOH 108 2108 2108 HOH HOH A . 
N 8 HOH 109 2109 2109 HOH HOH A . 
N 8 HOH 110 2110 2110 HOH HOH A . 
N 8 HOH 111 2111 2111 HOH HOH A . 
N 8 HOH 112 2112 2112 HOH HOH A . 
N 8 HOH 113 2113 2113 HOH HOH A . 
N 8 HOH 114 2114 2114 HOH HOH A . 
N 8 HOH 115 2115 2115 HOH HOH A . 
N 8 HOH 116 2116 2116 HOH HOH A . 
N 8 HOH 117 2117 2117 HOH HOH A . 
N 8 HOH 118 2118 2118 HOH HOH A . 
N 8 HOH 119 2119 2119 HOH HOH A . 
N 8 HOH 120 2120 2120 HOH HOH A . 
N 8 HOH 121 2121 2121 HOH HOH A . 
N 8 HOH 122 2122 2122 HOH HOH A . 
N 8 HOH 123 2123 2123 HOH HOH A . 
N 8 HOH 124 2124 2124 HOH HOH A . 
N 8 HOH 125 2125 2125 HOH HOH A . 
N 8 HOH 126 2126 2126 HOH HOH A . 
N 8 HOH 127 2127 2127 HOH HOH A . 
N 8 HOH 128 2128 2128 HOH HOH A . 
N 8 HOH 129 2129 2129 HOH HOH A . 
N 8 HOH 130 2130 2130 HOH HOH A . 
N 8 HOH 131 2131 2131 HOH HOH A . 
N 8 HOH 132 2132 2132 HOH HOH A . 
N 8 HOH 133 2133 2133 HOH HOH A . 
N 8 HOH 134 2134 2134 HOH HOH A . 
N 8 HOH 135 2135 2135 HOH HOH A . 
N 8 HOH 136 2136 2136 HOH HOH A . 
N 8 HOH 137 2137 2137 HOH HOH A . 
N 8 HOH 138 2138 2138 HOH HOH A . 
N 8 HOH 139 2139 2139 HOH HOH A . 
N 8 HOH 140 2140 2140 HOH HOH A . 
N 8 HOH 141 2141 2141 HOH HOH A . 
N 8 HOH 142 2142 2142 HOH HOH A . 
N 8 HOH 143 2143 2143 HOH HOH A . 
N 8 HOH 144 2144 2144 HOH HOH A . 
N 8 HOH 145 2145 2145 HOH HOH A . 
N 8 HOH 146 2146 2146 HOH HOH A . 
N 8 HOH 147 2147 2147 HOH HOH A . 
N 8 HOH 148 2148 2148 HOH HOH A . 
N 8 HOH 149 2149 2149 HOH HOH A . 
N 8 HOH 150 2150 2150 HOH HOH A . 
N 8 HOH 151 2151 2151 HOH HOH A . 
N 8 HOH 152 2152 2152 HOH HOH A . 
N 8 HOH 153 2153 2153 HOH HOH A . 
N 8 HOH 154 2154 2154 HOH HOH A . 
N 8 HOH 155 2155 2155 HOH HOH A . 
N 8 HOH 156 2156 2156 HOH HOH A . 
N 8 HOH 157 2157 2157 HOH HOH A . 
N 8 HOH 158 2158 2158 HOH HOH A . 
N 8 HOH 159 2159 2159 HOH HOH A . 
N 8 HOH 160 2160 2160 HOH HOH A . 
N 8 HOH 161 2161 2161 HOH HOH A . 
N 8 HOH 162 2162 2162 HOH HOH A . 
N 8 HOH 163 2163 2163 HOH HOH A . 
N 8 HOH 164 2164 2164 HOH HOH A . 
N 8 HOH 165 2165 2165 HOH HOH A . 
N 8 HOH 166 2166 2166 HOH HOH A . 
N 8 HOH 167 2167 2167 HOH HOH A . 
N 8 HOH 168 2168 2168 HOH HOH A . 
N 8 HOH 169 2169 2169 HOH HOH A . 
N 8 HOH 170 2170 2170 HOH HOH A . 
N 8 HOH 171 2171 2171 HOH HOH A . 
N 8 HOH 172 2172 2172 HOH HOH A . 
N 8 HOH 173 2173 2173 HOH HOH A . 
N 8 HOH 174 2174 2174 HOH HOH A . 
N 8 HOH 175 2175 2175 HOH HOH A . 
N 8 HOH 176 2176 2176 HOH HOH A . 
N 8 HOH 177 2177 2177 HOH HOH A . 
N 8 HOH 178 2178 2178 HOH HOH A . 
N 8 HOH 179 2179 2179 HOH HOH A . 
N 8 HOH 180 2180 2180 HOH HOH A . 
N 8 HOH 181 2181 2181 HOH HOH A . 
N 8 HOH 182 2182 2182 HOH HOH A . 
N 8 HOH 183 2183 2183 HOH HOH A . 
N 8 HOH 184 2184 2184 HOH HOH A . 
N 8 HOH 185 2185 2185 HOH HOH A . 
N 8 HOH 186 2186 2186 HOH HOH A . 
N 8 HOH 187 2187 2187 HOH HOH A . 
N 8 HOH 188 2188 2188 HOH HOH A . 
N 8 HOH 189 2189 2189 HOH HOH A . 
N 8 HOH 190 2190 2190 HOH HOH A . 
N 8 HOH 191 2191 2191 HOH HOH A . 
N 8 HOH 192 2192 2192 HOH HOH A . 
N 8 HOH 193 2193 2193 HOH HOH A . 
N 8 HOH 194 2194 2194 HOH HOH A . 
N 8 HOH 195 2195 2195 HOH HOH A . 
N 8 HOH 196 2196 2196 HOH HOH A . 
N 8 HOH 197 2197 2197 HOH HOH A . 
N 8 HOH 198 2198 2198 HOH HOH A . 
N 8 HOH 199 2199 2199 HOH HOH A . 
N 8 HOH 200 2200 2200 HOH HOH A . 
N 8 HOH 201 2201 2201 HOH HOH A . 
N 8 HOH 202 2202 2202 HOH HOH A . 
N 8 HOH 203 2203 2203 HOH HOH A . 
N 8 HOH 204 2204 2204 HOH HOH A . 
N 8 HOH 205 2205 2205 HOH HOH A . 
N 8 HOH 206 2206 2206 HOH HOH A . 
N 8 HOH 207 2207 2207 HOH HOH A . 
N 8 HOH 208 2208 2208 HOH HOH A . 
N 8 HOH 209 2209 2209 HOH HOH A . 
N 8 HOH 210 2210 2210 HOH HOH A . 
N 8 HOH 211 2211 2211 HOH HOH A . 
N 8 HOH 212 2212 2212 HOH HOH A . 
N 8 HOH 213 2213 2213 HOH HOH A . 
N 8 HOH 214 2214 2214 HOH HOH A . 
N 8 HOH 215 2215 2215 HOH HOH A . 
N 8 HOH 216 2216 2216 HOH HOH A . 
N 8 HOH 217 2217 2217 HOH HOH A . 
N 8 HOH 218 2218 2218 HOH HOH A . 
N 8 HOH 219 2219 2219 HOH HOH A . 
N 8 HOH 220 2220 2220 HOH HOH A . 
N 8 HOH 221 2221 2221 HOH HOH A . 
N 8 HOH 222 2222 2222 HOH HOH A . 
N 8 HOH 223 2223 2223 HOH HOH A . 
N 8 HOH 224 2224 2224 HOH HOH A . 
N 8 HOH 225 2225 2225 HOH HOH A . 
N 8 HOH 226 2226 2226 HOH HOH A . 
N 8 HOH 227 2227 2227 HOH HOH A . 
N 8 HOH 228 2228 2228 HOH HOH A . 
N 8 HOH 229 2229 2229 HOH HOH A . 
N 8 HOH 230 2230 2230 HOH HOH A . 
N 8 HOH 231 2231 2231 HOH HOH A . 
N 8 HOH 232 2232 2232 HOH HOH A . 
N 8 HOH 233 2233 2233 HOH HOH A . 
N 8 HOH 234 2234 2234 HOH HOH A . 
N 8 HOH 235 2235 2235 HOH HOH A . 
N 8 HOH 236 2236 2236 HOH HOH A . 
N 8 HOH 237 2237 2237 HOH HOH A . 
N 8 HOH 238 2238 2238 HOH HOH A . 
N 8 HOH 239 2239 2239 HOH HOH A . 
N 8 HOH 240 2240 2240 HOH HOH A . 
N 8 HOH 241 2241 2241 HOH HOH A . 
N 8 HOH 242 2242 2242 HOH HOH A . 
N 8 HOH 243 2243 2243 HOH HOH A . 
N 8 HOH 244 2244 2244 HOH HOH A . 
N 8 HOH 245 2245 2245 HOH HOH A . 
N 8 HOH 246 2246 2246 HOH HOH A . 
N 8 HOH 247 2247 2247 HOH HOH A . 
N 8 HOH 248 2248 2248 HOH HOH A . 
N 8 HOH 249 2249 2249 HOH HOH A . 
N 8 HOH 250 2250 2250 HOH HOH A . 
N 8 HOH 251 2251 2251 HOH HOH A . 
N 8 HOH 252 2252 2252 HOH HOH A . 
N 8 HOH 253 2253 2253 HOH HOH A . 
N 8 HOH 254 2254 2254 HOH HOH A . 
N 8 HOH 255 2255 2255 HOH HOH A . 
N 8 HOH 256 2256 2256 HOH HOH A . 
N 8 HOH 257 2257 2257 HOH HOH A . 
N 8 HOH 258 2258 2258 HOH HOH A . 
N 8 HOH 259 2259 2259 HOH HOH A . 
N 8 HOH 260 2260 2260 HOH HOH A . 
N 8 HOH 261 2261 2261 HOH HOH A . 
N 8 HOH 262 2262 2262 HOH HOH A . 
N 8 HOH 263 2263 2263 HOH HOH A . 
N 8 HOH 264 2264 2264 HOH HOH A . 
N 8 HOH 265 2265 2265 HOH HOH A . 
N 8 HOH 266 2266 2266 HOH HOH A . 
N 8 HOH 267 2267 2267 HOH HOH A . 
N 8 HOH 268 2268 2268 HOH HOH A . 
N 8 HOH 269 2269 2269 HOH HOH A . 
N 8 HOH 270 2270 2270 HOH HOH A . 
N 8 HOH 271 2271 2271 HOH HOH A . 
N 8 HOH 272 2272 2272 HOH HOH A . 
N 8 HOH 273 2273 2273 HOH HOH A . 
N 8 HOH 274 2274 2274 HOH HOH A . 
N 8 HOH 275 2275 2275 HOH HOH A . 
N 8 HOH 276 2276 2276 HOH HOH A . 
N 8 HOH 277 2277 2277 HOH HOH A . 
N 8 HOH 278 2278 2278 HOH HOH A . 
N 8 HOH 279 2279 2279 HOH HOH A . 
N 8 HOH 280 2280 2280 HOH HOH A . 
N 8 HOH 281 2281 2281 HOH HOH A . 
N 8 HOH 282 2282 2282 HOH HOH A . 
N 8 HOH 283 2283 2283 HOH HOH A . 
N 8 HOH 284 2284 2284 HOH HOH A . 
N 8 HOH 285 2285 2285 HOH HOH A . 
N 8 HOH 286 2286 2286 HOH HOH A . 
N 8 HOH 287 2287 2287 HOH HOH A . 
N 8 HOH 288 2288 2288 HOH HOH A . 
N 8 HOH 289 2289 2289 HOH HOH A . 
N 8 HOH 290 2290 2290 HOH HOH A . 
N 8 HOH 291 2291 2291 HOH HOH A . 
N 8 HOH 292 2292 2292 HOH HOH A . 
N 8 HOH 293 2293 2293 HOH HOH A . 
N 8 HOH 294 2294 2294 HOH HOH A . 
N 8 HOH 295 2295 2295 HOH HOH A . 
N 8 HOH 296 2296 2296 HOH HOH A . 
N 8 HOH 297 2297 2297 HOH HOH A . 
N 8 HOH 298 2298 2298 HOH HOH A . 
N 8 HOH 299 2299 2299 HOH HOH A . 
N 8 HOH 300 2300 2300 HOH HOH A . 
N 8 HOH 301 2301 2301 HOH HOH A . 
N 8 HOH 302 2302 2302 HOH HOH A . 
N 8 HOH 303 2303 2303 HOH HOH A . 
N 8 HOH 304 2304 2304 HOH HOH A . 
N 8 HOH 305 2305 2305 HOH HOH A . 
N 8 HOH 306 2306 2306 HOH HOH A . 
N 8 HOH 307 2307 2307 HOH HOH A . 
N 8 HOH 308 2308 2308 HOH HOH A . 
N 8 HOH 309 2309 2309 HOH HOH A . 
N 8 HOH 310 2310 2310 HOH HOH A . 
N 8 HOH 311 2311 2311 HOH HOH A . 
N 8 HOH 312 2312 2312 HOH HOH A . 
N 8 HOH 313 2313 2313 HOH HOH A . 
N 8 HOH 314 2314 2314 HOH HOH A . 
N 8 HOH 315 2315 2315 HOH HOH A . 
N 8 HOH 316 2316 2316 HOH HOH A . 
N 8 HOH 317 2317 2317 HOH HOH A . 
N 8 HOH 318 2318 2318 HOH HOH A . 
N 8 HOH 319 2319 2319 HOH HOH A . 
N 8 HOH 320 2320 2320 HOH HOH A . 
N 8 HOH 321 2321 2321 HOH HOH A . 
N 8 HOH 322 2322 2322 HOH HOH A . 
N 8 HOH 323 2323 2323 HOH HOH A . 
N 8 HOH 324 2324 2324 HOH HOH A . 
N 8 HOH 325 2325 2325 HOH HOH A . 
N 8 HOH 326 2326 2326 HOH HOH A . 
N 8 HOH 327 2327 2327 HOH HOH A . 
N 8 HOH 328 2328 2328 HOH HOH A . 
N 8 HOH 329 2329 2329 HOH HOH A . 
N 8 HOH 330 2330 2330 HOH HOH A . 
N 8 HOH 331 2331 2331 HOH HOH A . 
N 8 HOH 332 2332 2332 HOH HOH A . 
N 8 HOH 333 2333 2333 HOH HOH A . 
N 8 HOH 334 2334 2334 HOH HOH A . 
N 8 HOH 335 2335 2335 HOH HOH A . 
N 8 HOH 336 2336 2336 HOH HOH A . 
N 8 HOH 337 2337 2337 HOH HOH A . 
N 8 HOH 338 2338 2338 HOH HOH A . 
N 8 HOH 339 2339 2339 HOH HOH A . 
N 8 HOH 340 2340 2340 HOH HOH A . 
N 8 HOH 341 2341 2341 HOH HOH A . 
N 8 HOH 342 2342 2342 HOH HOH A . 
N 8 HOH 343 2343 2343 HOH HOH A . 
N 8 HOH 344 2344 2344 HOH HOH A . 
N 8 HOH 345 2345 2345 HOH HOH A . 
N 8 HOH 346 2346 2346 HOH HOH A . 
N 8 HOH 347 2347 2347 HOH HOH A . 
N 8 HOH 348 2348 2348 HOH HOH A . 
N 8 HOH 349 2349 2349 HOH HOH A . 
N 8 HOH 350 2350 2350 HOH HOH A . 
N 8 HOH 351 2351 2351 HOH HOH A . 
N 8 HOH 352 2352 2352 HOH HOH A . 
N 8 HOH 353 2353 2353 HOH HOH A . 
N 8 HOH 354 2354 2354 HOH HOH A . 
N 8 HOH 355 2355 2355 HOH HOH A . 
N 8 HOH 356 2356 2356 HOH HOH A . 
N 8 HOH 357 2357 2357 HOH HOH A . 
N 8 HOH 358 2358 2358 HOH HOH A . 
N 8 HOH 359 2359 2359 HOH HOH A . 
N 8 HOH 360 2360 2360 HOH HOH A . 
N 8 HOH 361 2361 2361 HOH HOH A . 
N 8 HOH 362 2362 2362 HOH HOH A . 
N 8 HOH 363 2363 2363 HOH HOH A . 
N 8 HOH 364 2364 2364 HOH HOH A . 
N 8 HOH 365 2365 2365 HOH HOH A . 
N 8 HOH 366 2366 2366 HOH HOH A . 
N 8 HOH 367 2367 2367 HOH HOH A . 
N 8 HOH 368 2368 2368 HOH HOH A . 
N 8 HOH 369 2369 2369 HOH HOH A . 
N 8 HOH 370 2370 2370 HOH HOH A . 
N 8 HOH 371 2371 2371 HOH HOH A . 
N 8 HOH 372 2372 2372 HOH HOH A . 
N 8 HOH 373 2373 2373 HOH HOH A . 
N 8 HOH 374 2374 2374 HOH HOH A . 
N 8 HOH 375 2375 2375 HOH HOH A . 
N 8 HOH 376 2376 2376 HOH HOH A . 
N 8 HOH 377 2377 2377 HOH HOH A . 
N 8 HOH 378 2378 2378 HOH HOH A . 
N 8 HOH 379 2379 2379 HOH HOH A . 
N 8 HOH 380 2380 2380 HOH HOH A . 
N 8 HOH 381 2381 2381 HOH HOH A . 
N 8 HOH 382 2382 2382 HOH HOH A . 
N 8 HOH 383 2383 2383 HOH HOH A . 
N 8 HOH 384 2384 2384 HOH HOH A . 
N 8 HOH 385 2385 2385 HOH HOH A . 
N 8 HOH 386 2386 2386 HOH HOH A . 
N 8 HOH 387 2387 2387 HOH HOH A . 
N 8 HOH 388 2388 2388 HOH HOH A . 
N 8 HOH 389 2389 2389 HOH HOH A . 
N 8 HOH 390 2390 2390 HOH HOH A . 
N 8 HOH 391 2391 2391 HOH HOH A . 
N 8 HOH 392 2392 2392 HOH HOH A . 
N 8 HOH 393 2393 2393 HOH HOH A . 
N 8 HOH 394 2394 2394 HOH HOH A . 
N 8 HOH 395 2395 2395 HOH HOH A . 
N 8 HOH 396 2396 2396 HOH HOH A . 
N 8 HOH 397 2397 2397 HOH HOH A . 
N 8 HOH 398 2398 2398 HOH HOH A . 
N 8 HOH 399 2399 2399 HOH HOH A . 
N 8 HOH 400 2400 2400 HOH HOH A . 
N 8 HOH 401 2401 2401 HOH HOH A . 
N 8 HOH 402 2402 2402 HOH HOH A . 
N 8 HOH 403 2403 2403 HOH HOH A . 
N 8 HOH 404 2404 2404 HOH HOH A . 
N 8 HOH 405 2405 2405 HOH HOH A . 
N 8 HOH 406 2406 2406 HOH HOH A . 
N 8 HOH 407 2407 2407 HOH HOH A . 
N 8 HOH 408 2408 2408 HOH HOH A . 
N 8 HOH 409 2409 2409 HOH HOH A . 
N 8 HOH 410 2410 2410 HOH HOH A . 
N 8 HOH 411 2411 2411 HOH HOH A . 
N 8 HOH 412 2412 2412 HOH HOH A . 
N 8 HOH 413 2413 2413 HOH HOH A . 
N 8 HOH 414 2414 2414 HOH HOH A . 
N 8 HOH 415 2415 2415 HOH HOH A . 
N 8 HOH 416 2416 2416 HOH HOH A . 
N 8 HOH 417 2417 2417 HOH HOH A . 
N 8 HOH 418 2418 2418 HOH HOH A . 
N 8 HOH 419 2419 2419 HOH HOH A . 
N 8 HOH 420 2420 2420 HOH HOH A . 
N 8 HOH 421 2421 2421 HOH HOH A . 
N 8 HOH 422 2422 2422 HOH HOH A . 
N 8 HOH 423 2423 2423 HOH HOH A . 
N 8 HOH 424 2424 2424 HOH HOH A . 
N 8 HOH 425 2425 2425 HOH HOH A . 
N 8 HOH 426 2426 2426 HOH HOH A . 
N 8 HOH 427 2427 2427 HOH HOH A . 
N 8 HOH 428 2428 2428 HOH HOH A . 
N 8 HOH 429 2429 2429 HOH HOH A . 
N 8 HOH 430 2430 2430 HOH HOH A . 
N 8 HOH 431 2431 2431 HOH HOH A . 
N 8 HOH 432 2432 2432 HOH HOH A . 
N 8 HOH 433 2433 2433 HOH HOH A . 
N 8 HOH 434 2434 2434 HOH HOH A . 
N 8 HOH 435 2435 2435 HOH HOH A . 
N 8 HOH 436 2436 2436 HOH HOH A . 
N 8 HOH 437 2437 2437 HOH HOH A . 
N 8 HOH 438 2438 2438 HOH HOH A . 
N 8 HOH 439 2439 2439 HOH HOH A . 
N 8 HOH 440 2440 2440 HOH HOH A . 
N 8 HOH 441 2441 2441 HOH HOH A . 
N 8 HOH 442 2442 2442 HOH HOH A . 
N 8 HOH 443 2443 2443 HOH HOH A . 
N 8 HOH 444 2444 2444 HOH HOH A . 
N 8 HOH 445 2445 2445 HOH HOH A . 
N 8 HOH 446 2446 2446 HOH HOH A . 
N 8 HOH 447 2447 2447 HOH HOH A . 
N 8 HOH 448 2448 2448 HOH HOH A . 
N 8 HOH 449 2449 2449 HOH HOH A . 
N 8 HOH 450 2450 2450 HOH HOH A . 
N 8 HOH 451 2451 2451 HOH HOH A . 
N 8 HOH 452 2452 2452 HOH HOH A . 
N 8 HOH 453 2453 2453 HOH HOH A . 
N 8 HOH 454 2454 2454 HOH HOH A . 
N 8 HOH 455 2455 2455 HOH HOH A . 
N 8 HOH 456 2456 2456 HOH HOH A . 
N 8 HOH 457 2457 2457 HOH HOH A . 
N 8 HOH 458 2458 2458 HOH HOH A . 
N 8 HOH 459 2459 2459 HOH HOH A . 
N 8 HOH 460 2460 2460 HOH HOH A . 
N 8 HOH 461 2461 2461 HOH HOH A . 
N 8 HOH 462 2462 2462 HOH HOH A . 
N 8 HOH 463 2463 2463 HOH HOH A . 
N 8 HOH 464 2464 2464 HOH HOH A . 
N 8 HOH 465 2465 2465 HOH HOH A . 
N 8 HOH 466 2466 2466 HOH HOH A . 
N 8 HOH 467 2467 2467 HOH HOH A . 
N 8 HOH 468 2468 2468 HOH HOH A . 
N 8 HOH 469 2469 2469 HOH HOH A . 
N 8 HOH 470 2470 2470 HOH HOH A . 
N 8 HOH 471 2471 2471 HOH HOH A . 
N 8 HOH 472 2472 2472 HOH HOH A . 
N 8 HOH 473 2473 2473 HOH HOH A . 
N 8 HOH 474 2474 2474 HOH HOH A . 
N 8 HOH 475 2475 2475 HOH HOH A . 
N 8 HOH 476 2476 2476 HOH HOH A . 
N 8 HOH 477 2477 2477 HOH HOH A . 
N 8 HOH 478 2478 2478 HOH HOH A . 
N 8 HOH 479 2479 2479 HOH HOH A . 
N 8 HOH 480 2480 2480 HOH HOH A . 
N 8 HOH 481 2481 2481 HOH HOH A . 
N 8 HOH 482 2482 2482 HOH HOH A . 
N 8 HOH 483 2483 2483 HOH HOH A . 
N 8 HOH 484 2484 2484 HOH HOH A . 
N 8 HOH 485 2485 2485 HOH HOH A . 
N 8 HOH 486 2486 2486 HOH HOH A . 
N 8 HOH 487 2487 2487 HOH HOH A . 
N 8 HOH 488 2488 2488 HOH HOH A . 
N 8 HOH 489 2489 2489 HOH HOH A . 
N 8 HOH 490 2490 2490 HOH HOH A . 
N 8 HOH 491 2491 2491 HOH HOH A . 
N 8 HOH 492 2492 2492 HOH HOH A . 
N 8 HOH 493 2493 2493 HOH HOH A . 
N 8 HOH 494 2494 2494 HOH HOH A . 
N 8 HOH 495 2495 2495 HOH HOH A . 
N 8 HOH 496 2496 2496 HOH HOH A . 
N 8 HOH 497 2497 2497 HOH HOH A . 
N 8 HOH 498 2498 2498 HOH HOH A . 
N 8 HOH 499 2499 2499 HOH HOH A . 
N 8 HOH 500 2500 2500 HOH HOH A . 
N 8 HOH 501 2501 2501 HOH HOH A . 
N 8 HOH 502 2502 2502 HOH HOH A . 
N 8 HOH 503 2503 2503 HOH HOH A . 
N 8 HOH 504 2504 2504 HOH HOH A . 
N 8 HOH 505 2505 2505 HOH HOH A . 
N 8 HOH 506 2506 2506 HOH HOH A . 
N 8 HOH 507 2507 2507 HOH HOH A . 
N 8 HOH 508 2508 2508 HOH HOH A . 
N 8 HOH 509 2509 2509 HOH HOH A . 
N 8 HOH 510 2510 2510 HOH HOH A . 
N 8 HOH 511 2511 2511 HOH HOH A . 
N 8 HOH 512 2512 2512 HOH HOH A . 
N 8 HOH 513 2513 2513 HOH HOH A . 
N 8 HOH 514 2514 2514 HOH HOH A . 
N 8 HOH 515 2515 2515 HOH HOH A . 
N 8 HOH 516 2516 2516 HOH HOH A . 
N 8 HOH 517 2517 2517 HOH HOH A . 
N 8 HOH 518 2518 2518 HOH HOH A . 
N 8 HOH 519 2519 2519 HOH HOH A . 
N 8 HOH 520 2520 2520 HOH HOH A . 
N 8 HOH 521 2521 2521 HOH HOH A . 
N 8 HOH 522 2522 2522 HOH HOH A . 
N 8 HOH 523 2523 2523 HOH HOH A . 
N 8 HOH 524 2524 2524 HOH HOH A . 
N 8 HOH 525 2525 2525 HOH HOH A . 
N 8 HOH 526 2526 2526 HOH HOH A . 
N 8 HOH 527 2527 2527 HOH HOH A . 
N 8 HOH 528 2528 2528 HOH HOH A . 
N 8 HOH 529 2529 2529 HOH HOH A . 
N 8 HOH 530 2530 2530 HOH HOH A . 
N 8 HOH 531 2531 2531 HOH HOH A .