data_4BY1
# 
_entry.id   4BY1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BY1         
PDBE  EBI-57703    
WWPDB D_1290057703 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BXX unspecified 'STRUCTURES OF RNA POLYMERASE II COMPLEXES WITH BYE1, A CHROMATIN-BINDING PHF3 DIDO HOMOLOGUE' 
PDB 4BXY unspecified 'ELONGATING RNA POLYMERASE II-BYE1 TLD COMPLEX'                                                
PDB 4BXZ unspecified 'RNA POLYMERASE II-BYE1 COMPLEX'                                                               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BY1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kinkelin, K.'     1 
'Wozniak, G.G.'    2 
'Rothbart, S.B.'   3 
'Lidschreiber, M.' 4 
'Strahl, B.D.'     5 
'Cramer, P.'       6 
# 
_citation.id                        primary 
_citation.title                     'Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            110 
_citation.page_first                15277 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24003114 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1311010110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kinkelin, K.'     1 ? 
primary 'Wozniak, G.G.'    2 ? 
primary 'Rothbart, S.B.'   3 ? 
primary 'Lidschreiber, M.' 4 ? 
primary 'Strahl, B.D.'     5 ? 
primary 'Cramer, P.'       6 ? 
# 
_cell.entry_id           4BY1 
_cell.length_a           222.240 
_cell.length_b           391.580 
_cell.length_c           281.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BY1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1'                                               191821.578 1 
2.7.7.6 ? ?                  ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                                               138951.328 1 
2.7.7.6 ? ?                  ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                                               35330.457  1 ? ? ? 
? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4'                                               25451.191  1 ? ? ? 
? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1'                               25117.094  1 ? ? ? 
? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2'                               17931.834  1 ? ? ? 
? 
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7'                                               19081.053  1 ? ? ? 
? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3'                               16525.363  1 ? ? ? 
? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                                               14308.161  1 ? ? ? 
? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5'                               8290.732   1 ? ? ? 
? 
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'                                              13633.493  1 ? ? ? 
? 
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4'                               7729.969   1 ? ? ? 
? 
13 polymer     syn "5'-D(*AP*AP*AP*GP*TP*AP*CP*TP*TP*GP*AP*GP*CP*TP)-3'"                                       4303.828   1 ? ? ? 
? 
14 polymer     syn "5'-R(*UP*UP*CP*GP*AP*CP*CP*AP*GP*GP*AP)-3'"                                                3506.154   1 ? ? ? 
? 
15 polymer     syn 
;5'-D(*AP*GP*CP*TP*CP*AP*AP*GP*TP*AP*CP*TP*TP*AP *TP*TP*CP*CP*BRUP*GP*GP*TP*CP*AP*AP*T)-3'
;
7983.981   1 ?       ? ?                  ? 
16 polymer     man 'TRANSCRIPTION FACTOR BYE1'                                                                 17094.592  1 ? ? 
'RESIDUES 225-370' ? 
17 non-polymer syn 'ZINC ION'                                                                                  65.409     8 ? ? ? 
? 
18 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     1 ? ? ? 
? 
19 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'                                             505.208    1 ? ? ? 
? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA POLYMERASE II SUBUNIT 1, RNA POLYMERASE II SUBUNIT B1, DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT, RNA POLYMERASE II SUBUNIT B220
;
2  'RNA POLYMERASE II SUBUNIT 2, B150, DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE' 
3  'RNA POLYMERASE II SUBUNIT 3, RNA POLYMERASE II SUBUNIT B3, B44.5, DNA-DIRECTED RNA POLYMERASE II 45 KDA POLYPEPTIDE' 
4  'RNA POLYMERASE II SUBUNIT B4, B32, DNA-DIRECTED RNA POLYMERASE II 32 KDA POLYPEPTIDE' 
5  'RNA POLYMERASES I, II, AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I, II, AND III 27 KDA POLYPEPTIDE' 
6  'RNA POLYMERASES I, II, AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I, II, AND III 23 KDA POLYPEPTIDE' 
7  'RNA POLYMERASE II SUBUNIT B7, B16' 
8  
'RNA POLYMERASES I, II, AND III SUBUNIT ABC3, ABC14.4, ABC14.5, DNA-DIRECTED RNA POLYMERASES I, II, AND III 14.5 KDA POLYPEPTIDE' 
9  
'RNA POLYMERASE II SUBUNIT B9, B12.6, DNA-DIRECTED RNA POLYMERASE II 14.2 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBUNIT 9' 
10 
'RNA POLYMERASES I, II, AND III SUBUNIT ABC5, ABC10-BETA, ABC8, DNA-DIRECTED RNA POLYMERASES I, II, AND III 8.3 KDA POLYPEPTIDE' 
11 'RNA POLYMERASE II SUBUNIT B11, B13.6, DNA-DIRECTED RNA POLYMERASE II 13.6 KDA POLYPEPTIDE' 
12 'RNA POLYMERASES I, II, AND III SUBUNIT ABC4, ABC10-ALPHA' 
13 'DNA NON-TEMPLATE STRAND' 
14 'RNA PRODUCT STRAND' 
15 'DNA TEMPLATE STRAND' 
16 'BYPASS OF ESS1 PROTEIN 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWEQKKAMSSRAAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWEQKKAMSSRAAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 polydeoxyribonucleotide no no  '(DA)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)(DG)(DC)(DT)' AAAGTACTTGAGCT N ? 
14 polyribonucleotide      no no  UUCGACCAGGA UUCGACCAGGA P ? 
15 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DC)(BRU)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)
;
AGCTCAAGTACTTTTTCCUGGTCATT T ? 
16 'polypeptide(L)'        no no  
;TRKDFESEKEHKLRYNAEKMFSTLFSKFIVPETIEAKLYELPDGKDVISISQEFAHNLEEELYKACLNVEFGTLDKIYTE
KVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIVEVPDK
;
;TRKDFESEKEHKLRYNAEKMFSTLFSKFIVPETIEAKLYELPDGKDVISISQEFAHNLEEELYKACLNVEFGTLDKIYTE
KVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIVEVPDK
;
X ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLU n 
2  468  GLN n 
2  469  LYS n 
2  470  LYS n 
2  471  ALA n 
2  472  MET n 
2  473  SER n 
2  474  SER n 
2  475  ARG n 
2  476  ALA n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DA  n 
13 2    DA  n 
13 3    DA  n 
13 4    DG  n 
13 5    DT  n 
13 6    DA  n 
13 7    DC  n 
13 8    DT  n 
13 9    DT  n 
13 10   DG  n 
13 11   DA  n 
13 12   DG  n 
13 13   DC  n 
13 14   DT  n 
14 1    U   n 
14 2    U   n 
14 3    C   n 
14 4    G   n 
14 5    A   n 
14 6    C   n 
14 7    C   n 
14 8    A   n 
14 9    G   n 
14 10   G   n 
14 11   A   n 
15 1    DA  n 
15 2    DG  n 
15 3    DC  n 
15 4    DT  n 
15 5    DC  n 
15 6    DA  n 
15 7    DA  n 
15 8    DG  n 
15 9    DT  n 
15 10   DA  n 
15 11   DC  n 
15 12   DT  n 
15 13   DT  n 
15 14   DT  n 
15 15   DT  n 
15 16   DT  n 
15 17   DC  n 
15 18   DC  n 
15 19   BRU n 
15 20   DG  n 
15 21   DG  n 
15 22   DT  n 
15 23   DC  n 
15 24   DA  n 
15 25   DT  n 
15 26   DT  n 
16 1    THR n 
16 2    ARG n 
16 3    LYS n 
16 4    ASP n 
16 5    PHE n 
16 6    GLU n 
16 7    SER n 
16 8    GLU n 
16 9    LYS n 
16 10   GLU n 
16 11   HIS n 
16 12   LYS n 
16 13   LEU n 
16 14   ARG n 
16 15   TYR n 
16 16   ASN n 
16 17   ALA n 
16 18   GLU n 
16 19   LYS n 
16 20   MET n 
16 21   PHE n 
16 22   SER n 
16 23   THR n 
16 24   LEU n 
16 25   PHE n 
16 26   SER n 
16 27   LYS n 
16 28   PHE n 
16 29   ILE n 
16 30   VAL n 
16 31   PRO n 
16 32   GLU n 
16 33   THR n 
16 34   ILE n 
16 35   GLU n 
16 36   ALA n 
16 37   LYS n 
16 38   LEU n 
16 39   TYR n 
16 40   GLU n 
16 41   LEU n 
16 42   PRO n 
16 43   ASP n 
16 44   GLY n 
16 45   LYS n 
16 46   ASP n 
16 47   VAL n 
16 48   ILE n 
16 49   SER n 
16 50   ILE n 
16 51   SER n 
16 52   GLN n 
16 53   GLU n 
16 54   PHE n 
16 55   ALA n 
16 56   HIS n 
16 57   ASN n 
16 58   LEU n 
16 59   GLU n 
16 60   GLU n 
16 61   GLU n 
16 62   LEU n 
16 63   TYR n 
16 64   LYS n 
16 65   ALA n 
16 66   CYS n 
16 67   LEU n 
16 68   ASN n 
16 69   VAL n 
16 70   GLU n 
16 71   PHE n 
16 72   GLY n 
16 73   THR n 
16 74   LEU n 
16 75   ASP n 
16 76   LYS n 
16 77   ILE n 
16 78   TYR n 
16 79   THR n 
16 80   GLU n 
16 81   LYS n 
16 82   VAL n 
16 83   ARG n 
16 84   SER n 
16 85   LEU n 
16 86   TYR n 
16 87   SER n 
16 88   ASN n 
16 89   LEU n 
16 90   LYS n 
16 91   ASP n 
16 92   LYS n 
16 93   LYS n 
16 94   ASN n 
16 95   LEU n 
16 96   GLU n 
16 97   LEU n 
16 98   LYS n 
16 99   ALA n 
16 100  HIS n 
16 101  VAL n 
16 102  VAL n 
16 103  GLU n 
16 104  GLY n 
16 105  LYS n 
16 106  LEU n 
16 107  PRO n 
16 108  LEU n 
16 109  ASN n 
16 110  LYS n 
16 111  LEU n 
16 112  VAL n 
16 113  ASN n 
16 114  MET n 
16 115  ASN n 
16 116  ALA n 
16 117  SER n 
16 118  GLU n 
16 119  LEU n 
16 120  ALA n 
16 121  ASN n 
16 122  PRO n 
16 123  ASP n 
16 124  LEU n 
16 125  GLN n 
16 126  GLU n 
16 127  PHE n 
16 128  LYS n 
16 129  GLU n 
16 130  LYS n 
16 131  ARG n 
16 132  ASP n 
16 133  LYS n 
16 134  ILE n 
16 135  ILE n 
16 136  LEU n 
16 137  GLU n 
16 138  ASN n 
16 139  PHE n 
16 140  ILE n 
16 141  VAL n 
16 142  GLU n 
16 143  VAL n 
16 144  PRO n 
16 145  ASP n 
16 146  LYS n 
# 
_entity_src_gen.entity_id                          16 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;BAKER'S YEAST
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SACCHAROMYCES CEREVISIAE' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              RIL 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       POPINF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
14 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
15 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  1  ? ? P04050 ? 
2  UNP RPB2_YEAST  2  ? ? P08518 ? 
3  UNP RPB3_YEAST  3  ? ? P16370 ? 
4  UNP RPB4_YEAST  4  ? ? P20433 ? 
5  UNP RPAB1_YEAST 5  ? ? P20434 ? 
6  UNP RPAB2_YEAST 6  ? ? P20435 ? 
7  UNP RPB7_YEAST  7  ? ? P34087 ? 
8  UNP RPAB3_YEAST 8  ? ? P20436 ? 
9  UNP RPB9_YEAST  9  ? ? P27999 ? 
10 UNP RPAB5_YEAST 10 ? ? P22139 ? 
11 UNP RPB11_YEAST 11 ? ? P38902 ? 
12 UNP RPAB4_YEAST 12 ? ? P40422 ? 
13 PDB 4BY1        13 ? ? 4BY1   ? 
14 PDB 4BY1        14 ? ? 4BY1   ? 
15 PDB 4BY1        15 ? ? 4BY1   ? 
16 UNP BYE1_YEAST  16 ? ? P36106 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4BY1 A 1 ? 1733 ? P04050 1   ? 1733 ? 1   1733 
2  2  4BY1 B 1 ? 1224 ? P08518 1   ? 1224 ? 1   1224 
3  3  4BY1 C 1 ? 318  ? P16370 1   ? 318  ? 1   318  
4  4  4BY1 D 1 ? 221  ? P20433 1   ? 221  ? 1   221  
5  5  4BY1 E 1 ? 215  ? P20434 1   ? 215  ? 1   215  
6  6  4BY1 F 1 ? 155  ? P20435 1   ? 155  ? 1   155  
7  7  4BY1 G 1 ? 171  ? P34087 1   ? 171  ? 1   171  
8  8  4BY1 H 1 ? 146  ? P20436 1   ? 146  ? 1   146  
9  9  4BY1 I 1 ? 122  ? P27999 1   ? 122  ? 1   122  
10 10 4BY1 J 1 ? 70   ? P22139 1   ? 70   ? 1   70   
11 11 4BY1 K 1 ? 120  ? P38902 1   ? 120  ? 1   120  
12 12 4BY1 L 1 ? 70   ? P40422 1   ? 70   ? 1   70   
13 13 4BY1 N 1 ? 14   ? 4BY1   3   ? 16   ? 3   16   
14 14 4BY1 P 1 ? 11   ? 4BY1   1   ? 11   ? 1   11   
15 15 4BY1 T 1 ? 26   ? 4BY1   4   ? 29   ? 4   29   
16 16 4BY1 X 1 ? 146  ? P36106 225 ? 370  ? 225 370  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"      ?                                               
'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"             ?                                               
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ?                                               
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                      ?                                               'Zn 2' 
65.409  
# 
_exptl.entry_id          4BY1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.2 
_exptl_crystal.density_percent_sol   76 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;5-7% PEG6000, 50 MM HEPES PH 7.0, 200 MM AMMONIUM ACETATE, 300 MM SODIUM ACETATE, 5 MM TCEP, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 293 K
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-04-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'FIXED-EXIT LN2 COOLED DOUBLE CRYSTAL MONOCHROMATOR SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91887 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.91887 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BY1 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.95 
_reflns.d_resolution_high            3.60 
_reflns.number_obs                   141065 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.21 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.95 
_reflns.B_iso_Wilson_estimate        79.08 
_reflns.pdbx_redundancy              7.62 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.60 
_reflns_shell.d_res_low              3.69 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.57 
_reflns_shell.pdbx_redundancy        7.61 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BY1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     141062 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.95 
_refine.ls_d_res_high                            3.60 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1755 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1749 
_refine.ls_R_factor_R_free                       0.2062 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.97 
_refine.ls_number_reflns_R_free                  2784 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9427 
_refine.correlation_coeff_Fo_to_Fc_free          0.9210 
_refine.B_iso_mean                               125.34 
_refine.aniso_B[1][1]                            -11.2902 
_refine.aniso_B[2][2]                            4.7097 
_refine.aniso_B[3][3]                            6.5805 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;IDEAL-DIST CONTACT TERM CONTACT SETUP. RESIDUE TYPES WITHOUT CCP4 ATOM TYPE IN LIBRARY=ZN MG. NUMBER OF ATOMS WITH PROPER CCP4 ATOM TYPE=33017. NUMBER WITH APPROX DEFAULT CCP4 ATOM TYPE=0. NUMBER TREATED BY BAD NON-BONDED CONTACTS=9.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1WCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             1.205 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.358 
_refine.pdbx_overall_SU_R_Blow_DPI               0.936 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.345 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4BY1 
_refine_analyze.Luzzati_coordinate_error_obs    0.854 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        32061 
_refine_hist.pdbx_number_atoms_nucleic_acid   925 
_refine_hist.pdbx_number_atoms_ligand         40 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               33026 
_refine_hist.d_res_high                       3.60 
_refine_hist.d_res_low                        48.95 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  33695 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.29  ? 2.00  45687 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  12010 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  891   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  4688  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 33695 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  2     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.78  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           24.56 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  4454  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  82    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  39557 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.60 
_refine_ls_shell.d_res_low                        3.69 
_refine_ls_shell.number_reflns_R_work             10172 
_refine_ls_shell.R_factor_R_work                  0.2371 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.R_factor_R_free                  0.2645 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            1.97 
_refine_ls_shell.number_reflns_R_free             204 
_refine_ls_shell.number_reflns_all                10376 
_refine_ls_shell.R_factor_all                     0.2377 
# 
_struct.entry_id                  4BY1 
_struct.title                     'elongating RNA Polymerase II-Bye1 TLD complex soaked with AMPCPP' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4, TRANSCRIPTION FACTOR BYE1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BY1 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 17 ? 
R N N 17 ? 
S N N 18 ? 
T N N 17 ? 
U N N 17 ? 
V N N 17 ? 
W N N 17 ? 
X N N 17 ? 
Y N N 17 ? 
Z N N 19 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? GLU A 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   3   ASN A 119  ? ALA A 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   4   ASP A 130  ? LYS A 145  ? ASP A 130  LYS A 145  1 ? 16 
HELX_P HELX_P5   5   SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P9   9   ALA A 288  ? ASP A 305  ? ALA A 288  ASP A 305  1 ? 18 
HELX_P HELX_P10  10  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P11  11  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P12  12  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P13  13  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P14  14  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P15  15  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P16  16  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P17  17  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P18  18  VAL A 524  ? LEU A 536  ? VAL A 524  LEU A 536  1 ? 13 
HELX_P HELX_P19  19  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P20  20  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P21  21  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P22  22  GLY A 628  ? LYS A 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P23  23  GLY A 638  ? HIS A 659  ? GLY A 638  HIS A 659  1 ? 22 
HELX_P HELX_P24  24  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P25  25  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P26  26  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P27  27  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P28  28  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P29  29  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P30  30  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P31  31  ASP A 874  ? ILE A 878  ? ASP A 874  ILE A 878  5 ? 5  
HELX_P HELX_P32  32  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P33  33  GLU A 914  ? SER A 917  ? GLU A 914  SER A 917  5 ? 4  
HELX_P HELX_P34  34  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P35  35  ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P36  36  THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P37  37  GLU A 1005 ? LEU A 1026 ? GLU A 1005 LEU A 1026 1 ? 22 
HELX_P HELX_P38  38  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P39  39  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P40  40  MET A 1063 ? ASN A 1082 ? MET A 1063 ASN A 1082 1 ? 20 
HELX_P HELX_P41  41  GLY A 1097 ? ASN A 1106 ? GLY A 1097 ASN A 1106 1 ? 10 
HELX_P HELX_P42  42  GLU A 1121 ? ALA A 1125 ? GLU A 1121 ALA A 1125 5 ? 5  
HELX_P HELX_P43  43  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  44  LEU A 1143 ? VAL A 1146 ? LEU A 1143 VAL A 1146 1 ? 4  
HELX_P HELX_P45  45  ILE A 1163 ? GLU A 1165 ? ILE A 1163 GLU A 1165 5 ? 3  
HELX_P HELX_P46  46  ASP A 1166 ? SER A 1175 ? ASP A 1166 SER A 1175 1 ? 10 
HELX_P HELX_P47  47  ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P48  48  THR A 1208 ? PHE A 1220 ? THR A 1208 PHE A 1220 1 ? 13 
HELX_P HELX_P49  49  GLU A 1255 ? GLU A 1269 ? GLU A 1255 GLU A 1269 1 ? 15 
HELX_P HELX_P50  50  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P51  51  SER A 1331 ? LEU A 1339 ? SER A 1331 LEU A 1339 1 ? 9  
HELX_P HELX_P52  52  LEU A 1339 ? ASP A 1359 ? LEU A 1339 ASP A 1359 1 ? 21 
HELX_P HELX_P53  53  ASN A 1364 ? GLN A 1378 ? ASN A 1364 GLN A 1378 1 ? 15 
HELX_P HELX_P54  54  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P55  55  GLY A 1395 ? CYS A 1400 ? GLY A 1395 CYS A 1400 1 ? 6  
HELX_P HELX_P56  56  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P57  57  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P58  58  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P59  59  ASP A 1446 ? TYR A 1453 ? ASP A 1446 TYR A 1453 1 ? 8  
HELX_P HELX_P60  60  ASP B 29   ? GLY B 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P61  61  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P62  62  TYR B 57   ? ASP B 66   ? TYR B 57   ASP B 66   1 ? 10 
HELX_P HELX_P63  63  TYR B 113  ? ASN B 121  ? TYR B 113  ASN B 121  1 ? 9  
HELX_P HELX_P64  64  CYS B 179  ? ALA B 184  ? CYS B 179  ALA B 184  5 ? 6  
HELX_P HELX_P65  65  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P66  66  ILE B 282  ? GLY B 290  ? ILE B 282  GLY B 290  1 ? 9  
HELX_P HELX_P67  67  GLU B 296  ? CYS B 302  ? GLU B 296  CYS B 302  1 ? 7  
HELX_P HELX_P68  68  ASP B 307  ? MET B 313  ? ASP B 307  MET B 313  1 ? 7  
HELX_P HELX_P69  69  LEU B 314  ? PHE B 322  ? LEU B 314  PHE B 322  1 ? 9  
HELX_P HELX_P70  70  ASP B 326  ? PHE B 333  ? ASP B 326  PHE B 333  1 ? 8  
HELX_P HELX_P71  71  GLU B 346  ? GLU B 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P72  72  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P73  73  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P74  74  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P75  75  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P76  76  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P77  77  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P78  78  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P79  79  GLU B 567  ? TYR B 569  ? GLU B 567  TYR B 569  5 ? 3  
HELX_P HELX_P80  80  ASN B 592  ? LYS B 606  ? ASN B 592  LYS B 606  1 ? 15 
HELX_P HELX_P81  81  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P82  82  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P83  83  GLU B 696  ? ILE B 701  ? GLU B 696  ILE B 701  5 ? 6  
HELX_P HELX_P84  84  PRO B 707  ? GLU B 711  ? PRO B 707  GLU B 711  5 ? 5  
HELX_P HELX_P85  85  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P86  86  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P87  87  PHE B 758  ? HIS B 761  ? PHE B 758  HIS B 761  5 ? 4  
HELX_P HELX_P88  88  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P89  89  LEU B 782  ? ARG B 788  ? LEU B 782  ARG B 788  5 ? 7  
HELX_P HELX_P90  90  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P91  91  HIS B 1015 ? MET B 1021 ? HIS B 1015 MET B 1021 1 ? 7  
HELX_P HELX_P92  92  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P93  93  THR B 1051 ? GLU B 1061 ? THR B 1051 GLU B 1061 1 ? 11 
HELX_P HELX_P94  94  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P95  95  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P96  96  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P97  97  TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P98  98  ASP C 26   ? ALA C 39   ? ASP C 26   ALA C 39   1 ? 14 
HELX_P HELX_P99  99  ALA C 59   ? LEU C 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P100 100 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P101 101 TYR C 82   ? CYS C 86   ? TYR C 82   CYS C 86   5 ? 5  
HELX_P HELX_P102 102 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P103 103 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P104 104 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P105 105 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P106 106 PRO C 239  ? ASP C 268  ? PRO C 239  ASP C 268  1 ? 30 
HELX_P HELX_P107 107 SER D 53   ? GLN D 74   ? SER D 53   GLN D 74   1 ? 22 
HELX_P HELX_P108 108 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P109 109 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P110 110 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P111 111 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P112 112 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P113 113 SER D 197  ? LYS D 201  ? SER D 197  LYS D 201  5 ? 5  
HELX_P HELX_P114 114 SER D 203  ? ASN D 216  ? SER D 203  ASN D 216  1 ? 14 
HELX_P HELX_P115 115 ASN E 5    ? GLY E 27   ? ASN E 5    GLY E 27   1 ? 23 
HELX_P HELX_P116 116 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P117 117 PRO E 38   ? CYS E 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P118 118 GLN E 54   ? SER E 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P119 119 THR E 65   ? PHE E 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P120 120 GLY E 89   ? ASN E 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P121 121 THR E 117  ? LYS E 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P122 122 ALA E 138  ? VAL E 142  ? ALA E 138  VAL E 142  5 ? 5  
HELX_P HELX_P123 123 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P124 124 SER E 157  ? TYR E 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P125 125 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P126 126 PRO F 75   ? ARG F 79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P127 127 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P128 128 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P129 129 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P130 130 MET G 22   ? GLU G 35   ? MET G 22   GLU G 35   1 ? 14 
HELX_P HELX_P131 131 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P132 132 VAL I 59   ? ASP I 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P133 133 ASP J 16   ? GLU J 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P134 134 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P135 135 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P136 136 LEU J 56   ? ARG J 62   ? LEU J 56   ARG J 62   1 ? 7  
HELX_P HELX_P137 137 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P138 138 ASP K 39   ? ASP K 53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P139 139 ASP K 82   ? LEU K 111  ? ASP K 82   LEU K 111  1 ? 30 
HELX_P HELX_P140 140 LYS P 9    ? SER P 22   ? LYS X 233  SER X 246  1 ? 14 
HELX_P HELX_P141 141 ILE P 29   ? THR P 33   ? ILE X 253  THR X 257  5 ? 5  
HELX_P HELX_P142 142 SER P 49   ? CYS P 66   ? SER X 273  CYS X 290  1 ? 18 
HELX_P HELX_P143 143 ILE P 77   ? ASP P 91   ? ILE X 301  ASP X 315  1 ? 15 
HELX_P HELX_P144 144 LEU P 95   ? VAL P 101  ? LEU X 319  VAL X 325  1 ? 7  
HELX_P HELX_P145 145 LYS P 110  ? ASN P 115  ? LYS X 334  ASN X 339  1 ? 6  
HELX_P HELX_P146 146 GLU P 126  ? LEU P 136  ? GLU X 350  LEU X 360  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 110  SG    ? ? A ZN  2456 A CYS 110  1_555 ? ? ? ? ? ? ?               2.339 
? 
metalc2  metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 148  SG    ? ? A ZN  2456 A CYS 148  1_555 ? ? ? ? ? ? ?               2.382 
? 
metalc3  metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 167  SG    ? ? A ZN  2456 A CYS 167  1_555 ? ? ? ? ? ? ?               2.305 
? 
metalc4  metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 A CYS 107  SG    ? ? A ZN  2456 A CYS 107  1_555 ? ? ? ? ? ? ?               2.291 
? 
metalc5  metalc ? ? R ZN  .  ZN    ? ? ? 1_555 A CYS 67   SG    ? ? A ZN  2457 A CYS 67   1_555 ? ? ? ? ? ? ?               2.409 
? 
metalc6  metalc ? ? R ZN  .  ZN    ? ? ? 1_555 A CYS 70   SG    ? ? A ZN  2457 A CYS 70   1_555 ? ? ? ? ? ? ?               2.427 
? 
metalc7  metalc ? ? R ZN  .  ZN    ? ? ? 1_555 A CYS 77   SG    ? ? A ZN  2457 A CYS 77   1_555 ? ? ? ? ? ? ?               2.336 
? 
metalc8  metalc ? ? R ZN  .  ZN    ? ? ? 1_555 A HIS 80   NE2   ? ? A ZN  2457 A HIS 80   1_555 ? ? ? ? ? ? ?               2.192 
? 
metalc9  metalc ? ? S MG  .  MG    ? ? ? 1_555 A ASP 481  OD2   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?               2.168 
? 
metalc10 metalc ? ? S MG  .  MG    ? ? ? 1_555 A ASP 481  OD1   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?               2.410 
? 
metalc11 metalc ? ? S MG  .  MG    ? ? ? 1_555 N A   11   "O3'" ? ? A MG  2458 P A   11   1_555 ? ? ? ? ? ? ?               1.934 
? 
metalc12 metalc ? ? S MG  .  MG    ? ? ? 1_555 A ASP 483  OD1   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?               2.126 
? 
metalc13 metalc ? ? S MG  .  MG    ? ? ? 1_555 A ASP 485  OD1   ? ? A MG  2458 A ASP 485  1_555 ? ? ? ? ? ? ?               2.047 
? 
metalc14 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 B CYS 1163 SG    ? ? B ZN  2225 B CYS 1163 1_555 ? ? ? ? ? ? ?               2.408 
? 
metalc15 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 B CYS 1166 SG    ? ? B ZN  2225 B CYS 1166 1_555 ? ? ? ? ? ? ?               2.267 
? 
metalc16 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 B CYS 1185 SG    ? ? B ZN  2225 B CYS 1185 1_555 ? ? ? ? ? ? ?               2.296 
? 
metalc17 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 B CYS 1182 SG    ? ? B ZN  2225 B CYS 1182 1_555 ? ? ? ? ? ? ?               2.342 
? 
metalc18 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 C CYS 95   SG    ? ? C ZN  1269 C CYS 95   1_555 ? ? ? ? ? ? ?               2.363 
? 
metalc19 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 C CYS 92   SG    ? ? C ZN  1269 C CYS 92   1_555 ? ? ? ? ? ? ?               2.308 
? 
metalc20 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 C CYS 88   SG    ? ? C ZN  1269 C CYS 88   1_555 ? ? ? ? ? ? ?               2.214 
? 
metalc21 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 C CYS 86   SG    ? ? C ZN  1269 C CYS 86   1_555 ? ? ? ? ? ? ?               2.351 
? 
metalc22 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 I CYS 7    SG    ? ? I ZN  1121 I CYS 7    1_555 ? ? ? ? ? ? ?               2.295 
? 
metalc23 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 I CYS 29   SG    ? ? I ZN  1121 I CYS 29   1_555 ? ? ? ? ? ? ?               2.341 
? 
metalc24 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 I CYS 32   SG    ? ? I ZN  1121 I CYS 32   1_555 ? ? ? ? ? ? ?               2.301 
? 
metalc25 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 I CYS 10   SG    ? ? I ZN  1121 I CYS 10   1_555 ? ? ? ? ? ? ?               2.155 
? 
metalc26 metalc ? ? W ZN  .  ZN    ? ? ? 1_555 I CYS 75   SG    ? ? I ZN  1122 I CYS 75   1_555 ? ? ? ? ? ? ?               2.334 
? 
metalc27 metalc ? ? W ZN  .  ZN    ? ? ? 1_555 I CYS 103  SG    ? ? I ZN  1122 I CYS 103  1_555 ? ? ? ? ? ? ?               2.514 
? 
metalc28 metalc ? ? W ZN  .  ZN    ? ? ? 1_555 I CYS 78   SG    ? ? I ZN  1122 I CYS 78   1_555 ? ? ? ? ? ? ?               2.312 
? 
metalc29 metalc ? ? W ZN  .  ZN    ? ? ? 1_555 I CYS 106  SG    ? ? I ZN  1122 I CYS 106  1_555 ? ? ? ? ? ? ?               2.350 
? 
metalc30 metalc ? ? X ZN  .  ZN    ? ? ? 1_555 J CYS 45   SG    ? ? J ZN  1066 J CYS 45   1_555 ? ? ? ? ? ? ?               2.460 
? 
metalc31 metalc ? ? X ZN  .  ZN    ? ? ? 1_555 J CYS 46   SG    ? ? J ZN  1066 J CYS 46   1_555 ? ? ? ? ? ? ?               2.399 
? 
metalc32 metalc ? ? X ZN  .  ZN    ? ? ? 1_555 J CYS 10   SG    ? ? J ZN  1066 J CYS 10   1_555 ? ? ? ? ? ? ?               2.396 
? 
metalc33 metalc ? ? X ZN  .  ZN    ? ? ? 1_555 J CYS 7    SG    ? ? J ZN  1066 J CYS 7    1_555 ? ? ? ? ? ? ?               2.281 
? 
metalc34 metalc ? ? Y ZN  .  ZN    ? ? ? 1_555 L CYS 34   SG    ? ? L ZN  1071 L CYS 34   1_555 ? ? ? ? ? ? ?               2.360 
? 
metalc35 metalc ? ? Y ZN  .  ZN    ? ? ? 1_555 L CYS 51   SG    ? ? L ZN  1071 L CYS 51   1_555 ? ? ? ? ? ? ?               2.372 
? 
metalc36 metalc ? ? Y ZN  .  ZN    ? ? ? 1_555 L CYS 48   SG    ? ? L ZN  1071 L CYS 48   1_555 ? ? ? ? ? ? ?               2.298 
? 
metalc37 metalc ? ? Y ZN  .  ZN    ? ? ? 1_555 L CYS 31   SG    ? ? L ZN  1071 L CYS 31   1_555 ? ? ? ? ? ? ?               2.510 
? 
metalc38 metalc ? ? Z APC .  O2A   ? ? ? 1_555 S MG  .    MG    ? ? P APC 12   A MG  2458 1_555 ? ? ? ? ? ? ?               2.949 
? 
covale1  covale ? ? O BRU 19 "O3'" ? ? ? 1_555 O DG  20   P     ? ? T BRU 22   T DG  23   1_555 ? ? ? ? ? ? ?               1.589 
? 
covale2  covale ? ? O BRU 19 P     ? ? ? 1_555 O DC  18   "O3'" ? ? T BRU 22   T DC  21   1_555 ? ? ? ? ? ? ?               1.593 
? 
hydrog1  hydrog ? ? M DA  2  N1    ? ? ? 1_555 O DT  12   N3    ? ? N DA  4    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog2  hydrog ? ? M DA  2  N6    ? ? ? 1_555 O DT  12   O4    ? ? N DA  4    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog3  hydrog ? ? M DA  2  N1    ? ? ? 1_555 O DT  13   N3    ? ? N DA  4    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog4  hydrog ? ? M DA  2  N6    ? ? ? 1_555 O DT  13   O4    ? ? N DA  4    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog5  hydrog ? ? M DA  3  N1    ? ? ? 1_555 O DT  12   N3    ? ? N DA  5    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog6  hydrog ? ? M DA  3  N6    ? ? ? 1_555 O DT  12   O4    ? ? N DA  5    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog7  hydrog ? ? M DG  4  N1    ? ? ? 1_555 O DA  10   N1    ? ? N DG  6    T DA  13   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     
? 
hydrog8  hydrog ? ? M DG  4  O6    ? ? ? 1_555 O DA  10   N6    ? ? N DG  6    T DA  13   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     
? 
hydrog9  hydrog ? ? M DG  4  N1    ? ? ? 1_555 O DC  11   N3    ? ? N DG  6    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog10 hydrog ? ? M DG  4  N2    ? ? ? 1_555 O DC  11   O2    ? ? N DG  6    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog11 hydrog ? ? M DG  4  O6    ? ? ? 1_555 O DC  11   N4    ? ? N DG  6    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog12 hydrog ? ? M DT  5  N3    ? ? ? 1_555 O DA  10   N1    ? ? N DT  7    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog13 hydrog ? ? M DT  5  O4    ? ? ? 1_555 O DA  10   N6    ? ? N DT  7    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog14 hydrog ? ? M DA  6  N1    ? ? ? 1_555 O DT  9    N3    ? ? N DA  8    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog15 hydrog ? ? M DA  6  N6    ? ? ? 1_555 O DT  9    O4    ? ? N DA  8    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog16 hydrog ? ? M DC  7  N3    ? ? ? 1_555 O DG  8    N1    ? ? N DC  9    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog17 hydrog ? ? M DC  7  N4    ? ? ? 1_555 O DG  8    O6    ? ? N DC  9    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog18 hydrog ? ? M DC  7  O2    ? ? ? 1_555 O DG  8    N2    ? ? N DC  9    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog19 hydrog ? ? M DT  8  N3    ? ? ? 1_555 O DA  7    N1    ? ? N DT  10   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog20 hydrog ? ? M DT  8  O4    ? ? ? 1_555 O DA  7    N6    ? ? N DT  10   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog21 hydrog ? ? M DT  9  N3    ? ? ? 1_555 O DA  6    N1    ? ? N DT  11   T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog22 hydrog ? ? M DT  9  O4    ? ? ? 1_555 O DA  6    N6    ? ? N DT  11   T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog23 hydrog ? ? M DG  10 N1    ? ? ? 1_555 O DC  5    N3    ? ? N DG  12   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog24 hydrog ? ? M DG  10 N2    ? ? ? 1_555 O DC  5    O2    ? ? N DG  12   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog25 hydrog ? ? M DG  10 O6    ? ? ? 1_555 O DC  5    N4    ? ? N DG  12   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog26 hydrog ? ? M DA  11 N6    ? ? ? 1_555 O DC  3    N3    ? ? N DA  13   T DC  6    1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     
? 
hydrog27 hydrog ? ? M DA  11 N1    ? ? ? 1_555 O DT  4    N3    ? ? N DA  13   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog28 hydrog ? ? M DA  11 N6    ? ? ? 1_555 O DT  4    O4    ? ? N DA  13   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog29 hydrog ? ? M DG  12 N1    ? ? ? 1_555 O DC  3    N3    ? ? N DG  14   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog30 hydrog ? ? M DG  12 N2    ? ? ? 1_555 O DC  3    O2    ? ? N DG  14   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog31 hydrog ? ? M DG  12 O6    ? ? ? 1_555 O DC  3    N4    ? ? N DG  14   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog32 hydrog ? ? N C   3  N3    ? ? ? 1_555 O DT  25   N3    ? ? P C   3    T DT  28   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     
? 
hydrog33 hydrog ? ? N C   3  N4    ? ? ? 1_555 O DT  25   O4    ? ? P C   3    T DT  28   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     
? 
hydrog34 hydrog ? ? N G   4  N1    ? ? ? 1_555 O DC  23   N3    ? ? P G   4    T DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog35 hydrog ? ? N G   4  N2    ? ? ? 1_555 O DC  23   O2    ? ? P G   4    T DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog36 hydrog ? ? N G   4  O6    ? ? ? 1_555 O DC  23   N4    ? ? P G   4    T DC  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog37 hydrog ? ? N G   4  N1    ? ? ? 1_555 O DA  24   N7    ? ? P G   4    T DA  27   1_555 ? ? ? ? ? ? TYPE_9_PAIR     ?     
? 
hydrog38 hydrog ? ? N G   4  O6    ? ? ? 1_555 O DA  24   N6    ? ? P G   4    T DA  27   1_555 ? ? ? ? ? ? TYPE_9_PAIR     ?     
? 
hydrog39 hydrog ? ? N A   5  N1    ? ? ? 1_555 O DT  22   N3    ? ? P A   5    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog40 hydrog ? ? N A   5  N6    ? ? ? 1_555 O DT  22   O4    ? ? P A   5    T DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog41 hydrog ? ? N C   6  N3    ? ? ? 1_555 O DG  21   N1    ? ? P C   6    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog42 hydrog ? ? N C   6  N4    ? ? ? 1_555 O DG  21   O6    ? ? P C   6    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog43 hydrog ? ? N C   6  O2    ? ? ? 1_555 O DG  21   N2    ? ? P C   6    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog44 hydrog ? ? N C   7  N3    ? ? ? 1_555 O DG  20   N1    ? ? P C   7    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog45 hydrog ? ? N C   7  N4    ? ? ? 1_555 O DG  20   O6    ? ? P C   7    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog46 hydrog ? ? N C   7  O2    ? ? ? 1_555 O DG  20   N2    ? ? P C   7    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog47 hydrog ? ? N A   8  N1    ? ? ? 1_555 O BRU 19   N3    ? ? P A   8    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog48 hydrog ? ? N A   8  N6    ? ? ? 1_555 O BRU 19   O4    ? ? P A   8    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog49 hydrog ? ? N G   9  N1    ? ? ? 1_555 O DC  18   N3    ? ? P G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog50 hydrog ? ? N G   9  N2    ? ? ? 1_555 O DC  18   O2    ? ? P G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog51 hydrog ? ? N G   9  O6    ? ? ? 1_555 O DC  18   N4    ? ? P G   9    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog52 hydrog ? ? N G   10 N1    ? ? ? 1_555 O DC  17   N3    ? ? P G   10   T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog53 hydrog ? ? N G   10 N2    ? ? ? 1_555 O DC  17   O2    ? ? P G   10   T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog54 hydrog ? ? N G   10 O6    ? ? ? 1_555 O DC  17   N4    ? ? P G   10   T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog55 hydrog ? ? N A   11 N1    ? ? ? 1_555 O DT  16   N3    ? ? P A   11   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog56 hydrog ? ? N A   11 N6    ? ? ? 1_555 O DT  16   O4    ? ? P A   11   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 447  A . ? GLN 447  A PRO 448  A ? PRO 448  A 1 0.45 
2 SER 1184 A . ? SER 1184 A PHE 1185 A ? PHE 1185 A 1 4.05 
3 GLN 1187 A . ? GLN 1187 A GLN 1188 A ? GLN 1188 A 1 4.39 
4 GLU 467  B . ? GLU 467  B GLN 468  B ? GLN 468  B 1 2.08 
5 LYS 470  B . ? LYS 470  B ALA 471  B ? ALA 471  B 1 5.46 
6 PRO 128  E . ? PRO 128  E PRO 129  E ? PRO 129  E 1 2.18 
7 ASN 126  G . ? ASN 126  G PRO 127  G ? PRO 127  G 1 6.40 
8 LYS 92   P . ? LYS 316  X LYS 93   P ? LYS 317  X 1 0.13 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 2  ? 
AE ? 3  ? 
AF ? 2  ? 
AG ? 14 ? 
AH ? 4  ? 
AI ? 2  ? 
AJ ? 2  ? 
AK ? 3  ? 
AL ? 2  ? 
AM ? 2  ? 
AN ? 3  ? 
AO ? 2  ? 
AP ? 4  ? 
AQ ? 2  ? 
AR ? 5  ? 
AS ? 2  ? 
FA ? 6  ? 
BA ? 3  ? 
BB ? 2  ? 
BC ? 3  ? 
BD ? 4  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 2  ? 
BH ? 2  ? 
BI ? 4  ? 
BJ ? 4  ? 
BK ? 5  ? 
BL ? 5  ? 
BM ? 2  ? 
BN ? 8  ? 
BO ? 2  ? 
BP ? 2  ? 
BQ ? 2  ? 
BR ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
DA ? 2  ? 
DB ? 5  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 3  ? 
GA ? 7  ? 
GB ? 3  ? 
HA ? 9  ? 
IA ? 2  ? 
IB ? 3  ? 
IC ? 3  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 3 4 ? parallel      
AG 4 5 ? anti-parallel 
AG 5 6 ? anti-parallel 
AG 6 7 ? anti-parallel 
AG 7 8 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AR 4 5 ? anti-parallel 
AS 1 2 ? anti-parallel 
FA 1 2 ? anti-parallel 
FA 2 3 ? anti-parallel 
FA 3 4 ? anti-parallel 
FA 4 5 ? anti-parallel 
FA 5 6 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? parallel      
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? parallel      
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BJ 1 2 ? parallel      
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? parallel      
BK 4 5 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BM 1 2 ? parallel      
BN 1 2 ? anti-parallel 
BN 3 4 ? parallel      
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BN 7 8 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? parallel      
EC 2 3 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 6 7 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
HA 1 2 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 8 9 ? anti-parallel 
IA 1 2 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IC 1 2 ? anti-parallel 
IC 2 3 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA 2 GLU A 16   ? LEU A 21   ? GLU A 16   LEU A 21   
AA 3 ILE B 1212 ? TYR B 1217 ? ILE B 1212 TYR B 1217 
AB 1 MET A 41   ? GLU A 43   ? MET A 41   GLU A 43   
AB 2 THR A 46   ? LYS A 49   ? THR A 46   LYS A 49   
AC 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AC 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AD 1 ASP A 151  ? PRO A 153  ? ASP A 151  PRO A 153  
AD 2 LEU A 161  ? SER A 163  ? LEU A 161  SER A 163  
AE 1 ARG A 175  ? ASP A 177  ? ARG A 175  ASP A 177  
AE 2 LYS A 180  ? VAL A 182  ? LYS A 180  VAL A 182  
AE 3 VAL A 201  ? LEU A 202  ? VAL A 201  LEU A 202  
AF 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AF 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AG 1 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AG 2 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AG 3 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AG 4 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AG 5 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AG 6 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AG 7 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AG 8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AH 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AH 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AH 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AH 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AI 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AI 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AJ 1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
AJ 2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
AK 1 LEU A 588  ? GLN A 589  ? LEU A 588  GLN A 589  
AK 2 LEU A 606  ? ILE A 607  ? LEU A 606  ILE A 607  
AK 3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
AL 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AL 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AM 1 SER A 769  ? VAL A 770  ? SER A 769  VAL A 770  
AM 2 LYS A 773  ? ARG A 774  ? LYS A 773  ARG A 774  
AN 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AN 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AN 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AO 1 GLU A 879  ? GLN A 881  ? GLU A 879  GLN A 881  
AO 2 TRP A 954  ? LEU A 956  ? TRP A 954  LEU A 956  
AP 1 VAL A 1283 ? TYR A 1287 ? VAL A 1283 TYR A 1287 
AP 2 GLU A 1303 ? GLU A 1307 ? GLU A 1303 GLU A 1307 
AP 3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AP 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AQ 1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
AQ 2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
AR 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AR 2 LEU A 1236 ? VAL A 1242 ? LEU A 1236 VAL A 1242 
AR 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AR 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AR 5 LEU I 42   ? ARG I 45   ? LEU I 42   ARG I 45   
AS 1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AS 2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
FA 1 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
FA 2 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
FA 3 ASP A 1442 ? ILE A 1445 ? ASP A 1442 ILE A 1445 
FA 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
FA 5 ALA G 68   ? ASN G 71   ? ALA G 68   ASN G 71   
FA 6 ASN G 10   ? LEU G 13   ? ASN G 10   LEU G 13   
BA 1 SER B 91   ? VAL B 97   ? SER B 91   VAL B 97   
BA 2 SER B 125  ? LYS B 133  ? SER B 125  LYS B 133  
BA 3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
BB 1 MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
BB 2 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
BC 1 PHE B 203  ? ILE B 204  ? PHE B 203  ILE B 204  
BC 2 GLU B 209  ? LEU B 212  ? GLU B 209  LEU B 212  
BC 3 SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
BD 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
BD 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
BD 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
BD 4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
BE 1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
BE 2 ILE B 234  ? ILE B 240  ? ILE B 234  ILE B 240  
BE 3 LEU B 254  ? TYR B 259  ? LEU B 254  TYR B 259  
BE 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
BE 5 ASP B 279  ? PRO B 281  ? ASP B 279  PRO B 281  
BF 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
BF 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BG 1 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BG 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BH 1 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BH 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BI 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BI 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 4 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BJ 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BJ 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BJ 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BJ 4 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BK 1 MET B 563  ? PRO B 565  ? MET B 563  PRO B 565  
BK 2 TRP B 586  ? HIS B 590  ? TRP B 586  HIS B 590  
BK 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
BK 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
BK 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
BL 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
BL 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
BL 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
BL 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
BL 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
BM 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
BM 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
BN 1 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BN 2 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
BN 3 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
BN 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
BN 5 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
BN 6 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
BN 7 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
BN 8 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BO 1 LYS B 865  ? TYR B 866  ? LYS B 865  TYR B 866  
BO 2 ILE B 870  ? THR B 871  ? ILE B 870  THR B 871  
BP 1 THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
BP 2 LYS B 914  ? THR B 915  ? LYS B 914  THR B 915  
BQ 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
BQ 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
BR 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
BR 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
CA 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
CA 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
CA 3 PHE C 228  ? GLU C 233  ? PHE C 228  GLU C 233  
CA 4 GLU C 177  ? TYR C 180  ? GLU C 177  TYR C 180  
CB 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
CB 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
CB 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
CB 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
CB 5 VAL L 65   ? PHE L 67   ? VAL L 65   PHE L 67   
CC 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
CC 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
DA 1 LYS D 36   ? ILE D 38   ? LYS D 36   ILE D 38   
DA 2 GLU D 44   ? GLU D 46   ? GLU D 44   GLU D 46   
DB 1 ILE D 48   ? LEU D 50   ? ILE D 48   LEU D 50   
DB 2 PHE G 2    ? LEU G 7    ? PHE G 2    LEU G 7    
DB 3 TYR G 74   ? PHE G 79   ? TYR G 74   PHE G 79   
DB 4 GLY G 43   ? VAL G 48   ? GLY G 43   VAL G 48   
DB 5 SER G 37   ? THR G 39   ? SER G 37   THR G 39   
EA 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
EA 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
EA 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
EA 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
EB 1 SER E 87   ? VAL E 88   ? SER E 87   VAL E 88   
EB 2 ASN E 115  ? ILE E 116  ? ASN E 115  ILE E 116  
EC 1 ARG E 177  ? ILE E 178  ? ARG E 177  ILE E 178  
EC 2 GLY E 206  ? CYS E 214  ? GLY E 206  CYS E 214  
EC 3 VAL E 195  ? SER E 202  ? VAL E 195  SER E 202  
GA 1 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
GA 2 ARG G 142  ? ILE G 151  ? ARG G 142  ILE G 151  
GA 3 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
GA 4 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
GA 5 HIS G 158  ? SER G 162  ? HIS G 158  SER G 162  
GA 6 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
GA 7 ARG G 142  ? ILE G 151  ? ARG G 142  ILE G 151  
GB 1 THR G 120  ? ASN G 122  ? THR G 120  ASN G 122  
GB 2 SER G 129  ? GLN G 131  ? SER G 129  GLN G 131  
GB 3 VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
HA 1 ASP H 7    ? ASP H 16   ? ASP H 7    ASP H 16   
HA 2 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
HA 3 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
HA 4 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
HA 5 TYR H 95   ? GLU H 105  ? TYR H 95   GLU H 105  
HA 6 ALA H 140  ? ARG H 145  ? ALA H 140  ARG H 145  
HA 7 ILE H 112  ? PHE H 118  ? ILE H 112  PHE H 118  
HA 8 LEU H 121  ? GLY H 127  ? LEU H 121  GLY H 127  
HA 9 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
IA 1 PHE I 6    ? CYS I 7    ? PHE I 6    CYS I 7    
IA 2 ASN I 12   ? MET I 13   ? ASN I 12   MET I 13   
IB 1 TYR I 15   ? ASP I 19   ? TYR I 15   ASP I 19   
IB 2 ARG I 24   ? GLU I 28   ? ARG I 24   GLU I 28   
IB 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
IC 1 ASN I 83   ? GLN I 87   ? ASN I 83   GLN I 87   
IC 2 LEU I 99   ? CYS I 103  ? LEU I 99   CYS I 103  
IC 3 ILE I 109  ? THR I 111  ? ILE I 109  THR I 111  
KA 1 LEU K 19   ? PRO K 23   ? LEU K 19   PRO K 23   
KA 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
KA 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
KA 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1419 ? N ASP A 1419 O VAL A 17   ? O VAL A 17   
AA 2 3 O GLY A 20   ? O GLY A 20   N THR B 1213 ? N THR B 1213 
AB 1 2 N GLU A 43   ? N GLU A 43   O THR A 46   ? O THR A 46   
AC 1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AD 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AE 1 2 N ASP A 177  ? N ASP A 177  O LYS A 180  ? O LYS A 180  
AE 2 3 N LEU A 181  ? N LEU A 181  O LEU A 202  ? O LEU A 202  
AF 1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
AG 1 2 N ARG A 350  ? N ARG A 350  O HIS B 1104 ? O HIS B 1104 
AG 3 4 N VAL A 364  ? N VAL A 364  O ARG A 459  ? O ARG A 459  
AG 4 5 N HIS A 458  ? N HIS A 458  O VAL A 442  ? O VAL A 442  
AG 5 6 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AG 6 7 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AG 7 8 N ARG B 1106 ? N ARG B 1106 O SER A 348  ? O SER A 348  
AH 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AH 2 3 O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AH 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AI 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AJ 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AK 1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
AK 2 3 O LEU A 606  ? O LEU A 606  N ILE A 613  ? N ILE A 613  
AL 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AM 1 2 N VAL A 770  ? N VAL A 770  O LYS A 773  ? O LYS A 773  
AN 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AN 2 3 O THR A 856  ? O THR A 856  N ILE A 864  ? N ILE A 864  
AO 1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AP 1 2 N TYR A 1287 ? N TYR A 1287 O GLU A 1303 ? O GLU A 1303 
AP 2 3 N LEU A 1306 ? N LEU A 1306 O VAL A 1118 ? O VAL A 1118 
AP 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AQ 1 2 O THR A 1141 ? O THR A 1141 N LEU A 1273 ? N LEU A 1273 
AR 1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AR 2 3 N CYS A 1240 ? N CYS A 1240 O LEU A 1193 ? O LEU A 1193 
AR 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AR 4 5 O ILE A 1152 ? O ILE A 1152 N VAL I 43   ? N VAL I 43   
AS 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
FA 1 2 N TRP F 146  ? N TRP F 146  O ILE F 134  ? O ILE F 134  
FA 2 3 N ARG F 135  ? N ARG F 135  O ASP A 1442 ? O ASP A 1442 
FA 3 4 N ILE A 1445 ? N ILE A 1445 O GLY G 59   ? O GLY G 59   
FA 4 5 N ARG G 60   ? N ARG G 60   O GLU G 69   ? O GLU G 69   
FA 5 6 N PHE G 70   ? N PHE G 70   O ILE G 11   ? O ILE G 11   
BA 1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
BA 2 3 N VAL B 130  ? N VAL B 130  O VAL B 165  ? O VAL B 165  
BB 1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
BC 1 2 N PHE B 203  ? N PHE B 203  O LYS B 210  ? O LYS B 210  
BC 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
BD 1 2 N ASP B 407  ? N ASP B 407  O GLN B 215  ? O GLN B 215  
BD 2 3 N ALA B 214  ? N ALA B 214  O ARG B 497  ? O ARG B 497  
BD 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
BE 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
BE 2 3 N ILE B 240  ? N ILE B 240  O LEU B 254  ? O LEU B 254  
BE 3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
BE 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
BF 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
BG 1 2 N GLU B 650  ? N GLU B 650  O GLU B 641  ? O GLU B 641  
BH 1 2 N ILE B 693  ? N ILE B 693  O ARG B 635  ? O ARG B 635  
BI 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BI 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BI 3 4 N GLU B 641  ? N GLU B 641  O GLU B 650  ? O GLU B 650  
BJ 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BJ 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BJ 3 4 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
BK 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
BK 2 3 N HIS B 590  ? N HIS B 590  O THR B 578  ? O THR B 578  
BK 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
BK 4 5 N PHE B 627  ? N PHE B 627  O SER B 614  ? O SER B 614  
BL 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
BL 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
BL 3 4 N ARG B 969  ? N ARG B 969  O ILE B 948  ? O ILE B 948  
BL 4 5 N GLY B 947  ? N GLY B 947  O VAL B 905  ? O VAL B 905  
BM 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
BN 1 2 N ILE B 827  ? N ILE B 827  O PHE B 1086 ? O PHE B 1086 
BN 3 4 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
BN 4 5 N GLY B 988  ? N GLY B 988  O PHE B 980  ? O PHE B 980  
BN 5 6 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
BN 7 8 N TYR B 1092 ? N TYR B 1092 O GLN B 821  ? O GLN B 821  
BO 1 2 N TYR B 866  ? N TYR B 866  O ILE B 870  ? O ILE B 870  
BP 1 2 N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
BQ 1 2 N ILE B 911  ? N ILE B 911  O THR B 939  ? O THR B 939  
BR 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
CA 1 2 N ARG C 11   ? N ARG C 11   O ASP C 19   ? O ASP C 19   
CA 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
CA 3 4 N ASN C 231  ? N ASN C 231  O GLU C 177  ? O GLU C 177  
CB 1 2 N VAL C 119  ? N VAL C 119  O THR C 100  ? O THR C 100  
CB 2 3 N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
CB 3 4 N GLY C 162  ? N GLY C 162  O THR C 43   ? O THR C 43   
CB 4 5 N VAL C 51   ? N VAL C 51   O VAL L 65   ? O VAL L 65   
CC 1 2 O VAL C 113  ? O VAL C 113  N ILE C 144  ? N ILE C 144  
DA 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
DB 1 2 N LEU D 50   ? N LEU D 50   O PHE G 2    ? O PHE G 2    
DB 2 3 N LEU G 7    ? N LEU G 7    O TYR G 74   ? O TYR G 74   
DB 3 4 N PHE G 79   ? N PHE G 79   O TYR G 44   ? O TYR G 44   
DB 4 5 N ILE G 45   ? N ILE G 45   O SER G 37   ? O SER G 37   
EA 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
EA 2 3 N TRP E 79   ? N TRP E 79   O THR E 107  ? O THR E 107  
EA 3 4 N GLY E 108  ? N GLY E 108  O THR E 131  ? O THR E 131  
EB 1 2 N VAL E 88   ? N VAL E 88   O ASN E 115  ? O ASN E 115  
EC 1 2 N ILE E 178  ? N ILE E 178  O ILE E 213  ? O ILE E 213  
EC 2 3 N ARG E 212  ? N ARG E 212  O VAL E 196  ? O VAL E 196  
GA 1 2 N GLY G 89   ? N GLY G 89   O ILE G 143  ? O ILE G 143  
GA 6 7 N GLY G 169  ? N GLY G 169  O ARG G 144  ? O ARG G 144  
GB 1 2 N ASN G 122  ? N ASN G 122  O SER G 129  ? O SER G 129  
GB 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
HA 1 2 N PHE H 10   ? N PHE H 10   O LEU H 55   ? O LEU H 55   
HA 5 6 N GLY H 99   ? N GLY H 99   O ALA H 140  ? O ALA H 140  
HA 8 9 N ARG H 145  ? N ARG H 145  O THR H 56   ? O THR H 56   
IA 1 2 N CYS I 7    ? N CYS I 7    O ASN I 12   ? O ASN I 12   
IB 1 2 N ASP I 19   ? N ASP I 19   O ARG I 24   ? O ARG I 24   
IB 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
IC 1 2 N PHE I 86   ? N PHE I 86   O PHE I 100  ? O PHE I 100  
IC 2 3 N PHE I 101  ? N PHE I 101  O PHE I 110  ? O PHE I 110  
KA 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
KA 2 3 N PHE K 35   ? N PHE K 35   O PHE K 71   ? O PHE K 71   
KA 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2456' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2457' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 2458' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 2225' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 1269' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 1121' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 1122' 
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN J 1066' 
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN L 1071' 
BC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE APC P 12'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4  CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4  CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4  CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4  CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4  CYS A 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4  CYS A 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4  HIS A 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 5  ASP A 481  ? ASP A 481  . ? 1_555 ? 
10 AC3 5  ASP A 483  ? ASP A 483  . ? 1_555 ? 
11 AC3 5  ASP A 485  ? ASP A 485  . ? 1_555 ? 
12 AC3 5  A   N 11   ? A   P 11   . ? 1_555 ? 
13 AC3 5  APC Z .    ? APC P 12   . ? 1_555 ? 
14 AC4 4  CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
15 AC4 4  CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
16 AC4 4  CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
17 AC4 4  CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
18 AC5 4  CYS C 86   ? CYS C 86   . ? 1_555 ? 
19 AC5 4  CYS C 88   ? CYS C 88   . ? 1_555 ? 
20 AC5 4  CYS C 92   ? CYS C 92   . ? 1_555 ? 
21 AC5 4  CYS C 95   ? CYS C 95   . ? 1_555 ? 
22 AC6 4  CYS I 7    ? CYS I 7    . ? 1_555 ? 
23 AC6 4  CYS I 10   ? CYS I 10   . ? 1_555 ? 
24 AC6 4  CYS I 29   ? CYS I 29   . ? 1_555 ? 
25 AC6 4  CYS I 32   ? CYS I 32   . ? 1_555 ? 
26 AC7 4  CYS I 75   ? CYS I 75   . ? 1_555 ? 
27 AC7 4  CYS I 78   ? CYS I 78   . ? 1_555 ? 
28 AC7 4  CYS I 103  ? CYS I 103  . ? 1_555 ? 
29 AC7 4  CYS I 106  ? CYS I 106  . ? 1_555 ? 
30 AC8 4  CYS J 7    ? CYS J 7    . ? 1_555 ? 
31 AC8 4  CYS J 10   ? CYS J 10   . ? 1_555 ? 
32 AC8 4  CYS J 45   ? CYS J 45   . ? 1_555 ? 
33 AC8 4  CYS J 46   ? CYS J 46   . ? 1_555 ? 
34 AC9 4  CYS L 31   ? CYS L 31   . ? 1_555 ? 
35 AC9 4  CYS L 34   ? CYS L 34   . ? 1_555 ? 
36 AC9 4  CYS L 48   ? CYS L 48   . ? 1_555 ? 
37 AC9 4  CYS L 51   ? CYS L 51   . ? 1_555 ? 
38 BC1 13 ARG A 446  ? ARG A 446  . ? 1_555 ? 
39 BC1 13 PRO A 448  ? PRO A 448  . ? 1_555 ? 
40 BC1 13 ASN A 479  ? ASN A 479  . ? 1_555 ? 
41 BC1 13 ASP A 481  ? ASP A 481  . ? 1_555 ? 
42 BC1 13 ASP A 483  ? ASP A 483  . ? 1_555 ? 
43 BC1 13 GLN A 1078 ? GLN A 1078 . ? 1_555 ? 
44 BC1 13 MG  S .    ? MG  A 2458 . ? 1_555 ? 
45 BC1 13 ARG B 766  ? ARG B 766  . ? 1_555 ? 
46 BC1 13 ASP B 837  ? ASP B 837  . ? 1_555 ? 
47 BC1 13 ARG B 1020 ? ARG B 1020 . ? 1_555 ? 
48 BC1 13 A   N 11   ? A   P 11   . ? 1_555 ? 
49 BC1 13 DT  O 15   ? DT  T 18   . ? 1_555 ? 
50 BC1 13 DT  O 16   ? DT  T 19   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BY1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BY1 
_atom_sites.fract_transf_matrix[1][1]   0.004500 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002554 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003558 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . VAL A 1  2    ? 112.060 27.488  -24.562 1.00 142.89 ? 2    VAL A N     1 
ATOM   2     C  CA    . VAL A 1  2    ? 111.988 28.811  -25.206 1.00 142.39 ? 2    VAL A CA    1 
ATOM   3     C  C     . VAL A 1  2    ? 111.555 28.655  -26.709 1.00 142.98 ? 2    VAL A C     1 
ATOM   4     O  O     . VAL A 1  2    ? 112.412 28.454  -27.589 1.00 144.34 ? 2    VAL A O     1 
ATOM   5     C  CB    . VAL A 1  2    ? 113.278 29.697  -24.978 1.00 146.53 ? 2    VAL A CB    1 
ATOM   6     C  CG1   . VAL A 1  2    ? 114.578 28.979  -25.361 1.00 146.38 ? 2    VAL A CG1   1 
ATOM   7     C  CG2   . VAL A 1  2    ? 113.172 31.061  -25.663 1.00 146.29 ? 2    VAL A CG2   1 
ATOM   8     N  N     . GLY A 1  3    ? 110.228 28.697  -26.956 1.00 129.11 ? 3    GLY A N     1 
ATOM   9     C  CA    . GLY A 1  3    ? 109.636 28.528  -28.281 1.00 124.33 ? 3    GLY A CA    1 
ATOM   10    C  C     . GLY A 1  3    ? 109.587 27.087  -28.753 1.00 123.64 ? 3    GLY A C     1 
ATOM   11    O  O     . GLY A 1  3    ? 108.817 26.807  -29.666 1.00 122.33 ? 3    GLY A O     1 
ATOM   12    N  N     . GLN A 1  4    ? 110.456 26.175  -28.139 1.00 118.30 ? 4    GLN A N     1 
ATOM   13    C  CA    . GLN A 1  4    ? 110.721 24.706  -28.252 1.00 118.14 ? 4    GLN A CA    1 
ATOM   14    C  C     . GLN A 1  4    ? 111.032 24.140  -29.647 1.00 116.29 ? 4    GLN A C     1 
ATOM   15    O  O     . GLN A 1  4    ? 110.405 24.553  -30.618 1.00 115.15 ? 4    GLN A O     1 
ATOM   16    C  CB    . GLN A 1  4    ? 109.575 23.881  -27.648 1.00 121.09 ? 4    GLN A CB    1 
ATOM   17    C  CG    . GLN A 1  4    ? 109.629 23.770  -26.139 1.00 133.91 ? 4    GLN A CG    1 
ATOM   18    C  CD    . GLN A 1  4    ? 110.733 22.857  -25.702 1.00 155.18 ? 4    GLN A CD    1 
ATOM   19    O  OE1   . GLN A 1  4    ? 111.923 23.204  -25.766 1.00 149.06 ? 4    GLN A OE1   1 
ATOM   20    N  NE2   . GLN A 1  4    ? 110.355 21.667  -25.257 1.00 151.51 ? 4    GLN A NE2   1 
ATOM   21    N  N     . GLN A 1  5    ? 111.932 23.131  -29.731 1.00 110.27 ? 5    GLN A N     1 
ATOM   22    C  CA    . GLN A 1  5    ? 112.334 22.430  -30.982 1.00 110.01 ? 5    GLN A CA    1 
ATOM   23    C  C     . GLN A 1  5    ? 113.403 23.196  -31.791 1.00 108.65 ? 5    GLN A C     1 
ATOM   24    O  O     . GLN A 1  5    ? 113.377 24.421  -31.816 1.00 105.36 ? 5    GLN A O     1 
ATOM   25    C  CB    . GLN A 1  5    ? 111.118 22.060  -31.867 1.00 111.29 ? 5    GLN A CB    1 
ATOM   26    C  CG    . GLN A 1  5    ? 111.405 21.106  -33.038 1.00 134.73 ? 5    GLN A CG    1 
ATOM   27    C  CD    . GLN A 1  5    ? 110.266 20.994  -34.042 1.00 152.51 ? 5    GLN A CD    1 
ATOM   28    O  OE1   . GLN A 1  5    ? 109.159 21.533  -33.855 1.00 146.59 ? 5    GLN A OE1   1 
ATOM   29    N  NE2   . GLN A 1  5    ? 110.516 20.270  -35.132 1.00 141.77 ? 5    GLN A NE2   1 
ATOM   30    N  N     . TYR A 1  6    ? 114.348 22.469  -32.440 1.00 104.82 ? 6    TYR A N     1 
ATOM   31    C  CA    . TYR A 1  6    ? 115.443 23.081  -33.199 1.00 102.98 ? 6    TYR A CA    1 
ATOM   32    C  C     . TYR A 1  6    ? 115.025 23.647  -34.511 1.00 100.33 ? 6    TYR A C     1 
ATOM   33    O  O     . TYR A 1  6    ? 114.432 22.932  -35.321 1.00 101.47 ? 6    TYR A O     1 
ATOM   34    C  CB    . TYR A 1  6    ? 116.616 22.106  -33.429 1.00 108.71 ? 6    TYR A CB    1 
ATOM   35    C  CG    . TYR A 1  6    ? 117.599 22.542  -34.507 1.00 112.31 ? 6    TYR A CG    1 
ATOM   36    C  CD1   . TYR A 1  6    ? 118.505 23.576  -34.280 1.00 113.71 ? 6    TYR A CD1   1 
ATOM   37    C  CD2   . TYR A 1  6    ? 117.632 21.912  -35.747 1.00 115.66 ? 6    TYR A CD2   1 
ATOM   38    C  CE1   . TYR A 1  6    ? 119.412 23.977  -35.264 1.00 116.42 ? 6    TYR A CE1   1 
ATOM   39    C  CE2   . TYR A 1  6    ? 118.534 22.306  -36.739 1.00 117.98 ? 6    TYR A CE2   1 
ATOM   40    C  CZ    . TYR A 1  6    ? 119.424 23.337  -36.493 1.00 124.09 ? 6    TYR A CZ    1 
ATOM   41    O  OH    . TYR A 1  6    ? 120.318 23.725  -37.465 1.00 126.13 ? 6    TYR A OH    1 
ATOM   42    N  N     . SER A 1  7    ? 115.478 24.883  -34.778 1.00 90.77  ? 7    SER A N     1 
ATOM   43    C  CA    . SER A 1  7    ? 115.252 25.569  -36.038 1.00 87.81  ? 7    SER A CA    1 
ATOM   44    C  C     . SER A 1  7    ? 116.570 25.927  -36.693 1.00 91.95  ? 7    SER A C     1 
ATOM   45    O  O     . SER A 1  7    ? 117.453 26.488  -36.030 1.00 91.43  ? 7    SER A O     1 
ATOM   46    C  CB    . SER A 1  7    ? 114.414 26.816  -35.824 1.00 85.58  ? 7    SER A CB    1 
ATOM   47    O  OG    . SER A 1  7    ? 114.275 27.472  -37.070 1.00 87.81  ? 7    SER A OG    1 
ATOM   48    N  N     . SER A 1  8    ? 116.693 25.617  -38.002 1.00 89.36  ? 8    SER A N     1 
ATOM   49    C  CA    . SER A 1  8    ? 117.902 25.873  -38.796 1.00 91.14  ? 8    SER A CA    1 
ATOM   50    C  C     . SER A 1  8    ? 118.172 27.359  -39.045 1.00 92.66  ? 8    SER A C     1 
ATOM   51    O  O     . SER A 1  8    ? 119.315 27.713  -39.352 1.00 94.42  ? 8    SER A O     1 
ATOM   52    C  CB    . SER A 1  8    ? 117.840 25.137  -40.126 1.00 97.47  ? 8    SER A CB    1 
ATOM   53    O  OG    . SER A 1  8    ? 116.986 25.825  -41.024 1.00 105.18 ? 8    SER A OG    1 
ATOM   54    N  N     . ALA A 1  9    ? 117.120 28.215  -38.950 1.00 85.07  ? 9    ALA A N     1 
ATOM   55    C  CA    . ALA A 1  9    ? 117.197 29.669  -39.134 1.00 82.77  ? 9    ALA A CA    1 
ATOM   56    C  C     . ALA A 1  9    ? 118.227 30.269  -38.164 1.00 86.13  ? 9    ALA A C     1 
ATOM   57    O  O     . ALA A 1  9    ? 118.311 29.792  -37.029 1.00 86.19  ? 9    ALA A O     1 
ATOM   58    C  CB    . ALA A 1  9    ? 115.833 30.311  -38.903 1.00 80.15  ? 9    ALA A CB    1 
ATOM   59    N  N     . PRO A 1  10   ? 119.039 31.273  -38.596 1.00 81.76  ? 10   PRO A N     1 
ATOM   60    C  CA    . PRO A 1  10   ? 120.061 31.845  -37.702 1.00 81.68  ? 10   PRO A CA    1 
ATOM   61    C  C     . PRO A 1  10   ? 119.499 32.622  -36.532 1.00 85.39  ? 10   PRO A C     1 
ATOM   62    O  O     . PRO A 1  10   ? 118.498 33.322  -36.689 1.00 84.52  ? 10   PRO A O     1 
ATOM   63    C  CB    . PRO A 1  10   ? 120.841 32.779  -38.616 1.00 84.74  ? 10   PRO A CB    1 
ATOM   64    C  CG    . PRO A 1  10   ? 119.920 33.104  -39.691 1.00 88.20  ? 10   PRO A CG    1 
ATOM   65    C  CD    . PRO A 1  10   ? 119.079 31.918  -39.920 1.00 83.85  ? 10   PRO A CD    1 
ATOM   66    N  N     . LEU A 1  11   ? 120.148 32.521  -35.368 1.00 82.85  ? 11   LEU A N     1 
ATOM   67    C  CA    . LEU A 1  11   ? 119.678 33.249  -34.200 1.00 81.15  ? 11   LEU A CA    1 
ATOM   68    C  C     . LEU A 1  11   ? 120.297 34.634  -34.093 1.00 86.67  ? 11   LEU A C     1 
ATOM   69    O  O     . LEU A 1  11   ? 121.530 34.782  -34.028 1.00 89.43  ? 11   LEU A O     1 
ATOM   70    C  CB    . LEU A 1  11   ? 119.846 32.449  -32.913 1.00 81.75  ? 11   LEU A CB    1 
ATOM   71    C  CG    . LEU A 1  11   ? 119.514 33.197  -31.634 1.00 85.00  ? 11   LEU A CG    1 
ATOM   72    C  CD1   . LEU A 1  11   ? 118.366 32.552  -30.925 1.00 84.10  ? 11   LEU A CD1   1 
ATOM   73    C  CD2   . LEU A 1  11   ? 120.757 33.327  -30.739 1.00 90.76  ? 11   LEU A CD2   1 
ATOM   74    N  N     . ARG A 1  12   ? 119.425 35.654  -34.072 1.00 80.23  ? 12   ARG A N     1 
ATOM   75    C  CA    . ARG A 1  12   ? 119.875 37.029  -33.952 1.00 79.50  ? 12   ARG A CA    1 
ATOM   76    C  C     . ARG A 1  12   ? 119.125 37.767  -32.856 1.00 78.22  ? 12   ARG A C     1 
ATOM   77    O  O     . ARG A 1  12   ? 118.199 37.216  -32.247 1.00 76.45  ? 12   ARG A O     1 
ATOM   78    C  CB    . ARG A 1  12   ? 119.838 37.752  -35.306 1.00 82.39  ? 12   ARG A CB    1 
ATOM   79    C  CG    . ARG A 1  12   ? 120.988 37.361  -36.244 1.00 98.23  ? 12   ARG A CG    1 
ATOM   80    C  CD    . ARG A 1  12   ? 120.896 38.129  -37.540 1.00 106.34 ? 12   ARG A CD    1 
ATOM   81    N  NE    . ARG A 1  12   ? 121.714 37.555  -38.603 1.00 116.71 ? 12   ARG A NE    1 
ATOM   82    C  CZ    . ARG A 1  12   ? 122.018 38.191  -39.732 1.00 137.03 ? 12   ARG A CZ    1 
ATOM   83    N  NH1   . ARG A 1  12   ? 121.596 39.435  -39.939 1.00 122.32 ? 12   ARG A NH1   1 
ATOM   84    N  NH2   . ARG A 1  12   ? 122.758 37.595  -40.657 1.00 130.42 ? 12   ARG A NH2   1 
ATOM   85    N  N     . THR A 1  13   ? 119.616 38.966  -32.542 1.00 72.97  ? 13   THR A N     1 
ATOM   86    C  CA    . THR A 1  13   ? 119.109 39.881  -31.526 1.00 71.21  ? 13   THR A CA    1 
ATOM   87    C  C     . THR A 1  13   ? 118.497 41.044  -32.262 1.00 73.61  ? 13   THR A C     1 
ATOM   88    O  O     . THR A 1  13   ? 119.039 41.429  -33.299 1.00 75.70  ? 13   THR A O     1 
ATOM   89    C  CB    . THR A 1  13   ? 120.290 40.403  -30.697 1.00 85.56  ? 13   THR A CB    1 
ATOM   90    O  OG1   . THR A 1  13   ? 121.464 40.425  -31.518 1.00 92.49  ? 13   THR A OG1   1 
ATOM   91    C  CG2   . THR A 1  13   ? 120.565 39.557  -29.481 1.00 86.42  ? 13   THR A CG2   1 
ATOM   92    N  N     . VAL A 1  14   ? 117.378 41.605  -31.766 1.00 66.76  ? 14   VAL A N     1 
ATOM   93    C  CA    . VAL A 1  14   ? 116.758 42.780  -32.392 1.00 65.58  ? 14   VAL A CA    1 
ATOM   94    C  C     . VAL A 1  14   ? 117.649 43.963  -32.071 1.00 72.51  ? 14   VAL A C     1 
ATOM   95    O  O     . VAL A 1  14   ? 118.093 44.117  -30.931 1.00 72.93  ? 14   VAL A O     1 
ATOM   96    C  CB    . VAL A 1  14   ? 115.298 43.049  -31.976 1.00 66.93  ? 14   VAL A CB    1 
ATOM   97    C  CG1   . VAL A 1  14   ? 114.763 44.281  -32.686 1.00 67.06  ? 14   VAL A CG1   1 
ATOM   98    C  CG2   . VAL A 1  14   ? 114.406 41.841  -32.251 1.00 65.17  ? 14   VAL A CG2   1 
ATOM   99    N  N     . LYS A 1  15   ? 117.977 44.748  -33.090 1.00 71.08  ? 15   LYS A N     1 
ATOM   100   C  CA    . LYS A 1  15   ? 118.878 45.884  -32.923 1.00 72.74  ? 15   LYS A CA    1 
ATOM   101   C  C     . LYS A 1  15   ? 118.160 47.191  -33.252 1.00 76.91  ? 15   LYS A C     1 
ATOM   102   O  O     . LYS A 1  15   ? 118.586 48.248  -32.796 1.00 78.99  ? 15   LYS A O     1 
ATOM   103   C  CB    . LYS A 1  15   ? 120.156 45.705  -33.771 1.00 76.54  ? 15   LYS A CB    1 
ATOM   104   C  CG    . LYS A 1  15   ? 120.702 44.273  -33.809 1.00 85.55  ? 15   LYS A CG    1 
ATOM   105   C  CD    . LYS A 1  15   ? 122.166 44.142  -33.462 1.00 100.21 ? 15   LYS A CD    1 
ATOM   106   C  CE    . LYS A 1  15   ? 122.348 43.654  -32.047 1.00 116.90 ? 15   LYS A CE    1 
ATOM   107   N  NZ    . LYS A 1  15   ? 123.257 42.482  -31.990 1.00 131.94 ? 15   LYS A NZ    1 
ATOM   108   N  N     . GLU A 1  16   ? 117.060 47.116  -34.011 1.00 71.07  ? 16   GLU A N     1 
ATOM   109   C  CA    . GLU A 1  16   ? 116.280 48.279  -34.418 1.00 71.41  ? 16   GLU A CA    1 
ATOM   110   C  C     . GLU A 1  16   ? 114.811 47.922  -34.456 1.00 72.46  ? 16   GLU A C     1 
ATOM   111   O  O     . GLU A 1  16   ? 114.457 46.812  -34.861 1.00 70.68  ? 16   GLU A O     1 
ATOM   112   C  CB    . GLU A 1  16   ? 116.656 48.691  -35.850 1.00 75.00  ? 16   GLU A CB    1 
ATOM   113   C  CG    . GLU A 1  16   ? 117.909 49.517  -36.050 1.00 87.80  ? 16   GLU A CG    1 
ATOM   114   C  CD    . GLU A 1  16   ? 118.201 49.818  -37.513 1.00 114.30 ? 16   GLU A CD    1 
ATOM   115   O  OE1   . GLU A 1  16   ? 117.625 49.160  -38.420 1.00 105.59 ? 16   GLU A OE1   1 
ATOM   116   O  OE2   . GLU A 1  16   ? 119.027 50.730  -37.744 1.00 109.44 ? 16   GLU A OE2   1 
ATOM   117   N  N     . VAL A 1  17   ? 113.947 48.872  -34.103 1.00 68.27  ? 17   VAL A N     1 
ATOM   118   C  CA    . VAL A 1  17   ? 112.524 48.641  -34.241 1.00 66.21  ? 17   VAL A CA    1 
ATOM   119   C  C     . VAL A 1  17   ? 111.994 49.747  -35.122 1.00 73.53  ? 17   VAL A C     1 
ATOM   120   O  O     . VAL A 1  17   ? 112.037 50.914  -34.736 1.00 74.97  ? 17   VAL A O     1 
ATOM   121   C  CB    . VAL A 1  17   ? 111.699 48.438  -32.945 1.00 68.17  ? 17   VAL A CB    1 
ATOM   122   C  CG1   . VAL A 1  17   ? 110.244 48.136  -33.280 1.00 67.11  ? 17   VAL A CG1   1 
ATOM   123   C  CG2   . VAL A 1  17   ? 112.267 47.317  -32.092 1.00 66.32  ? 17   VAL A CG2   1 
ATOM   124   N  N     . GLN A 1  18   ? 111.551 49.371  -36.334 1.00 71.36  ? 18   GLN A N     1 
ATOM   125   C  CA    . GLN A 1  18   ? 110.979 50.255  -37.342 1.00 73.38  ? 18   GLN A CA    1 
ATOM   126   C  C     . GLN A 1  18   ? 109.472 50.353  -37.263 1.00 77.69  ? 18   GLN A C     1 
ATOM   127   O  O     . GLN A 1  18   ? 108.736 49.498  -37.782 1.00 74.71  ? 18   GLN A O     1 
ATOM   128   C  CB    . GLN A 1  18   ? 111.395 49.850  -38.762 1.00 75.64  ? 18   GLN A CB    1 
ATOM   129   C  CG    . GLN A 1  18   ? 112.222 50.907  -39.499 1.00 84.46  ? 18   GLN A CG    1 
ATOM   130   C  CD    . GLN A 1  18   ? 111.718 52.329  -39.409 1.00 92.26  ? 18   GLN A CD    1 
ATOM   131   O  OE1   . GLN A 1  18   ? 110.509 52.607  -39.333 1.00 76.53  ? 18   GLN A OE1   1 
ATOM   132   N  NE2   . GLN A 1  18   ? 112.659 53.267  -39.469 1.00 93.01  ? 18   GLN A NE2   1 
ATOM   133   N  N     . PHE A 1  19   ? 109.016 51.430  -36.635 1.00 78.22  ? 19   PHE A N     1 
ATOM   134   C  CA    . PHE A 1  19   ? 107.592 51.716  -36.522 1.00 79.32  ? 19   PHE A CA    1 
ATOM   135   C  C     . PHE A 1  19   ? 107.045 52.299  -37.838 1.00 86.29  ? 19   PHE A C     1 
ATOM   136   O  O     . PHE A 1  19   ? 107.727 53.054  -38.536 1.00 89.49  ? 19   PHE A O     1 
ATOM   137   C  CB    . PHE A 1  19   ? 107.299 52.633  -35.315 1.00 82.34  ? 19   PHE A CB    1 
ATOM   138   C  CG    . PHE A 1  19   ? 107.541 51.946  -33.998 1.00 82.23  ? 19   PHE A CG    1 
ATOM   139   C  CD1   . PHE A 1  19   ? 106.598 51.071  -33.468 1.00 83.41  ? 19   PHE A CD1   1 
ATOM   140   C  CD2   . PHE A 1  19   ? 108.739 52.116  -33.320 1.00 85.73  ? 19   PHE A CD2   1 
ATOM   141   C  CE1   . PHE A 1  19   ? 106.845 50.388  -32.270 1.00 85.20  ? 19   PHE A CE1   1 
ATOM   142   C  CE2   . PHE A 1  19   ? 108.988 51.435  -32.120 1.00 85.68  ? 19   PHE A CE2   1 
ATOM   143   C  CZ    . PHE A 1  19   ? 108.039 50.580  -31.601 1.00 83.60  ? 19   PHE A CZ    1 
ATOM   144   N  N     . GLY A 1  20   ? 105.844 51.899  -38.182 1.00 80.44  ? 20   GLY A N     1 
ATOM   145   C  CA    . GLY A 1  20   ? 105.186 52.387  -39.371 1.00 82.17  ? 20   GLY A CA    1 
ATOM   146   C  C     . GLY A 1  20   ? 103.727 52.043  -39.266 1.00 86.76  ? 20   GLY A C     1 
ATOM   147   O  O     . GLY A 1  20   ? 103.259 51.644  -38.191 1.00 85.14  ? 20   GLY A O     1 
ATOM   148   N  N     . LEU A 1  21   ? 103.010 52.173  -40.392 1.00 84.73  ? 21   LEU A N     1 
ATOM   149   C  CA    . LEU A 1  21   ? 101.597 51.820  -40.516 1.00 83.06  ? 21   LEU A CA    1 
ATOM   150   C  C     . LEU A 1  21   ? 101.431 50.696  -41.535 1.00 89.05  ? 21   LEU A C     1 
ATOM   151   O  O     . LEU A 1  21   ? 102.229 50.544  -42.466 1.00 90.29  ? 21   LEU A O     1 
ATOM   152   C  CB    . LEU A 1  21   ? 100.735 53.033  -40.924 1.00 85.07  ? 21   LEU A CB    1 
ATOM   153   C  CG    . LEU A 1  21   ? 100.842 54.297  -40.086 1.00 89.80  ? 21   LEU A CG    1 
ATOM   154   C  CD1   . LEU A 1  21   ? 99.877  55.313  -40.568 1.00 93.48  ? 21   LEU A CD1   1 
ATOM   155   C  CD2   . LEU A 1  21   ? 100.575 54.036  -38.626 1.00 87.83  ? 21   LEU A CD2   1 
ATOM   156   N  N     . PHE A 1  22   ? 100.403 49.902  -41.358 1.00 86.15  ? 22   PHE A N     1 
ATOM   157   C  CA    . PHE A 1  22   ? 100.105 48.869  -42.319 1.00 87.06  ? 22   PHE A CA    1 
ATOM   158   C  C     . PHE A 1  22   ? 99.359  49.503  -43.517 1.00 94.54  ? 22   PHE A C     1 
ATOM   159   O  O     . PHE A 1  22   ? 98.394  50.259  -43.334 1.00 96.21  ? 22   PHE A O     1 
ATOM   160   C  CB    . PHE A 1  22   ? 99.226  47.801  -41.671 1.00 87.64  ? 22   PHE A CB    1 
ATOM   161   C  CG    . PHE A 1  22   ? 99.888  46.508  -41.266 1.00 87.98  ? 22   PHE A CG    1 
ATOM   162   C  CD1   . PHE A 1  22   ? 100.616 45.759  -42.187 1.00 91.22  ? 22   PHE A CD1   1 
ATOM   163   C  CD2   . PHE A 1  22   ? 99.735  46.005  -39.977 1.00 90.19  ? 22   PHE A CD2   1 
ATOM   164   C  CE1   . PHE A 1  22   ? 101.205 44.547  -41.817 1.00 92.80  ? 22   PHE A CE1   1 
ATOM   165   C  CE2   . PHE A 1  22   ? 100.318 44.791  -39.606 1.00 89.68  ? 22   PHE A CE2   1 
ATOM   166   C  CZ    . PHE A 1  22   ? 101.043 44.064  -40.532 1.00 89.30  ? 22   PHE A CZ    1 
ATOM   167   N  N     . SER A 1  23   ? 99.836  49.223  -44.730 1.00 91.54  ? 23   SER A N     1 
ATOM   168   C  CA    . SER A 1  23   ? 99.212  49.649  -45.975 1.00 94.17  ? 23   SER A CA    1 
ATOM   169   C  C     . SER A 1  23   ? 98.184  48.574  -46.270 1.00 98.44  ? 23   SER A C     1 
ATOM   170   O  O     . SER A 1  23   ? 98.485  47.414  -45.986 1.00 95.36  ? 23   SER A O     1 
ATOM   171   C  CB    . SER A 1  23   ? 100.242 49.622  -47.085 1.00 99.51  ? 23   SER A CB    1 
ATOM   172   O  OG    . SER A 1  23   ? 100.989 48.420  -47.033 1.00 106.18 ? 23   SER A OG    1 
ATOM   173   N  N     . PRO A 1  24   ? 96.986  48.869  -46.829 1.00 99.27  ? 24   PRO A N     1 
ATOM   174   C  CA    . PRO A 1  24   ? 96.016  47.781  -47.079 1.00 98.67  ? 24   PRO A CA    1 
ATOM   175   C  C     . PRO A 1  24   ? 96.658  46.619  -47.829 1.00 102.35 ? 24   PRO A C     1 
ATOM   176   O  O     . PRO A 1  24   ? 96.639  45.493  -47.334 1.00 99.65  ? 24   PRO A O     1 
ATOM   177   C  CB    . PRO A 1  24   ? 94.898  48.463  -47.880 1.00 103.96 ? 24   PRO A CB    1 
ATOM   178   C  CG    . PRO A 1  24   ? 94.975  49.883  -47.488 1.00 110.46 ? 24   PRO A CG    1 
ATOM   179   C  CD    . PRO A 1  24   ? 96.431  50.181  -47.219 1.00 105.03 ? 24   PRO A CD    1 
ATOM   180   N  N     . GLU A 1  25   ? 97.340  46.933  -48.948 1.00 101.12 ? 25   GLU A N     1 
ATOM   181   C  CA    . GLU A 1  25   ? 98.073  46.031  -49.838 1.00 101.42 ? 25   GLU A CA    1 
ATOM   182   C  C     . GLU A 1  25   ? 98.864  44.965  -49.062 1.00 101.32 ? 25   GLU A C     1 
ATOM   183   O  O     . GLU A 1  25   ? 98.761  43.779  -49.401 1.00 100.58 ? 25   GLU A O     1 
ATOM   184   C  CB    . GLU A 1  25   ? 99.005  46.847  -50.749 1.00 106.31 ? 25   GLU A CB    1 
ATOM   185   C  CG    . GLU A 1  25   ? 98.322  47.994  -51.495 1.00 125.51 ? 25   GLU A CG    1 
ATOM   186   C  CD    . GLU A 1  25   ? 98.344  49.375  -50.851 1.00 155.14 ? 25   GLU A CD    1 
ATOM   187   O  OE1   . GLU A 1  25   ? 98.235  49.458  -49.606 1.00 139.51 ? 25   GLU A OE1   1 
ATOM   188   O  OE2   . GLU A 1  25   ? 98.430  50.379  -51.597 1.00 160.30 ? 25   GLU A OE2   1 
ATOM   189   N  N     . GLU A 1  26   ? 99.602  45.399  -47.985 1.00 94.66  ? 26   GLU A N     1 
ATOM   190   C  CA    . GLU A 1  26   ? 100.416 44.578  -47.064 1.00 90.13  ? 26   GLU A CA    1 
ATOM   191   C  C     . GLU A 1  26   ? 99.531  43.678  -46.208 1.00 87.83  ? 26   GLU A C     1 
ATOM   192   O  O     . GLU A 1  26   ? 99.791  42.479  -46.127 1.00 84.41  ? 26   GLU A O     1 
ATOM   193   C  CB    . GLU A 1  26   ? 101.323 45.462  -46.171 1.00 90.71  ? 26   GLU A CB    1 
ATOM   194   C  CG    . GLU A 1  26   ? 102.276 44.693  -45.258 1.00 102.85 ? 26   GLU A CG    1 
ATOM   195   C  CD    . GLU A 1  26   ? 103.503 45.389  -44.680 1.00 131.38 ? 26   GLU A CD    1 
ATOM   196   O  OE1   . GLU A 1  26   ? 103.496 46.638  -44.549 1.00 140.06 ? 26   GLU A OE1   1 
ATOM   197   O  OE2   . GLU A 1  26   ? 104.466 44.666  -44.323 1.00 114.05 ? 26   GLU A OE2   1 
ATOM   198   N  N     . VAL A 1  27   ? 98.477  44.256  -45.592 1.00 83.72  ? 27   VAL A N     1 
ATOM   199   C  CA    . VAL A 1  27   ? 97.508  43.563  -44.729 1.00 81.63  ? 27   VAL A CA    1 
ATOM   200   C  C     . VAL A 1  27   ? 96.968  42.326  -45.450 1.00 85.05  ? 27   VAL A C     1 
ATOM   201   O  O     . VAL A 1  27   ? 96.841  41.257  -44.837 1.00 82.52  ? 27   VAL A O     1 
ATOM   202   C  CB    . VAL A 1  27   ? 96.374  44.520  -44.277 1.00 86.49  ? 27   VAL A CB    1 
ATOM   203   C  CG1   . VAL A 1  27   ? 95.296  43.786  -43.483 1.00 85.25  ? 27   VAL A CG1   1 
ATOM   204   C  CG2   . VAL A 1  27   ? 96.927  45.693  -43.481 1.00 86.24  ? 27   VAL A CG2   1 
ATOM   205   N  N     . ARG A 1  28   ? 96.694  42.480  -46.763 1.00 83.69  ? 28   ARG A N     1 
ATOM   206   C  CA    . ARG A 1  28   ? 96.231  41.417  -47.632 1.00 84.83  ? 28   ARG A CA    1 
ATOM   207   C  C     . ARG A 1  28   ? 97.355  40.397  -47.821 1.00 90.79  ? 28   ARG A C     1 
ATOM   208   O  O     . ARG A 1  28   ? 97.102  39.211  -47.628 1.00 91.87  ? 28   ARG A O     1 
ATOM   209   C  CB    . ARG A 1  28   ? 95.767  41.969  -48.985 1.00 88.01  ? 28   ARG A CB    1 
ATOM   210   C  CG    . ARG A 1  28   ? 94.270  42.234  -49.093 1.00 98.93  ? 28   ARG A CG    1 
ATOM   211   C  CD    . ARG A 1  28   ? 94.015  43.488  -49.911 1.00 122.53 ? 28   ARG A CD    1 
ATOM   212   N  NE    . ARG A 1  28   ? 92.650  43.577  -50.436 1.00 151.58 ? 28   ARG A NE    1 
ATOM   213   C  CZ    . ARG A 1  28   ? 92.256  43.099  -51.617 1.00 182.39 ? 28   ARG A CZ    1 
ATOM   214   N  NH1   . ARG A 1  28   ? 93.118  42.458  -52.404 1.00 176.08 ? 28   ARG A NH1   1 
ATOM   215   N  NH2   . ARG A 1  28   ? 90.997  43.247  -52.017 1.00 174.19 ? 28   ARG A NH2   1 
ATOM   216   N  N     . ALA A 1  29   ? 98.593  40.833  -48.138 1.00 87.28  ? 29   ALA A N     1 
ATOM   217   C  CA    . ALA A 1  29   ? 99.712  39.904  -48.339 1.00 87.09  ? 29   ALA A CA    1 
ATOM   218   C  C     . ALA A 1  29   ? 100.109 39.084  -47.089 1.00 88.38  ? 29   ALA A C     1 
ATOM   219   O  O     . ALA A 1  29   ? 100.288 37.865  -47.188 1.00 86.76  ? 29   ALA A O     1 
ATOM   220   C  CB    . ALA A 1  29   ? 100.899 40.642  -48.893 1.00 89.62  ? 29   ALA A CB    1 
ATOM   221   N  N     . ILE A 1  30   ? 100.185 39.748  -45.922 1.00 85.42  ? 30   ILE A N     1 
ATOM   222   C  CA    . ILE A 1  30   ? 100.472 39.162  -44.602 1.00 84.62  ? 30   ILE A CA    1 
ATOM   223   C  C     . ILE A 1  30   ? 99.411  38.060  -44.196 1.00 92.13  ? 30   ILE A C     1 
ATOM   224   O  O     . ILE A 1  30   ? 99.785  37.050  -43.581 1.00 92.31  ? 30   ILE A O     1 
ATOM   225   C  CB    . ILE A 1  30   ? 100.634 40.319  -43.529 1.00 86.40  ? 30   ILE A CB    1 
ATOM   226   C  CG1   . ILE A 1  30   ? 101.896 40.159  -42.695 1.00 85.35  ? 30   ILE A CG1   1 
ATOM   227   C  CG2   . ILE A 1  30   ? 99.415  40.560  -42.618 1.00 86.42  ? 30   ILE A CG2   1 
ATOM   228   C  CD1   . ILE A 1  30   ? 103.091 40.659  -43.415 1.00 99.57  ? 30   ILE A CD1   1 
ATOM   229   N  N     . SER A 1  31   ? 98.105  38.272  -44.566 1.00 89.26  ? 31   SER A N     1 
ATOM   230   C  CA    . SER A 1  31   ? 96.949  37.406  -44.288 1.00 88.14  ? 31   SER A CA    1 
ATOM   231   C  C     . SER A 1  31   ? 97.056  35.989  -44.848 1.00 92.90  ? 31   SER A C     1 
ATOM   232   O  O     . SER A 1  31   ? 97.520  35.802  -45.989 1.00 95.71  ? 31   SER A O     1 
ATOM   233   C  CB    . SER A 1  31   ? 95.664  38.052  -44.793 1.00 91.53  ? 31   SER A CB    1 
ATOM   234   O  OG    . SER A 1  31   ? 94.553  37.178  -44.671 1.00 95.93  ? 31   SER A OG    1 
ATOM   235   N  N     . VAL A 1  32   ? 96.570  34.998  -44.040 1.00 86.81  ? 32   VAL A N     1 
ATOM   236   C  CA    . VAL A 1  32   ? 96.524  33.561  -44.366 1.00 86.77  ? 32   VAL A CA    1 
ATOM   237   C  C     . VAL A 1  32   ? 95.108  33.113  -44.680 1.00 89.28  ? 32   VAL A C     1 
ATOM   238   O  O     . VAL A 1  32   ? 94.936  32.130  -45.398 1.00 91.38  ? 32   VAL A O     1 
ATOM   239   C  CB    . VAL A 1  32   ? 97.215  32.613  -43.344 1.00 89.90  ? 32   VAL A CB    1 
ATOM   240   C  CG1   . VAL A 1  32   ? 98.619  33.112  -42.992 1.00 89.01  ? 32   VAL A CG1   1 
ATOM   241   C  CG2   . VAL A 1  32   ? 96.366  32.369  -42.089 1.00 88.57  ? 32   VAL A CG2   1 
ATOM   242   N  N     . ALA A 1  33   ? 94.108  33.838  -44.157 1.00 82.41  ? 33   ALA A N     1 
ATOM   243   C  CA    . ALA A 1  33   ? 92.704  33.540  -44.365 1.00 82.36  ? 33   ALA A CA    1 
ATOM   244   C  C     . ALA A 1  33   ? 91.905  34.795  -44.678 1.00 85.90  ? 33   ALA A C     1 
ATOM   245   O  O     . ALA A 1  33   ? 92.235  35.891  -44.219 1.00 84.38  ? 33   ALA A O     1 
ATOM   246   C  CB    . ALA A 1  33   ? 92.153  32.843  -43.158 1.00 82.33  ? 33   ALA A CB    1 
ATOM   247   N  N     . LYS A 1  34   ? 90.841  34.615  -45.465 1.00 84.28  ? 34   LYS A N     1 
ATOM   248   C  CA    . LYS A 1  34   ? 89.999  35.662  -46.043 1.00 85.22  ? 34   LYS A CA    1 
ATOM   249   C  C     . LYS A 1  34   ? 88.923  36.218  -45.133 1.00 88.81  ? 34   LYS A C     1 
ATOM   250   O  O     . LYS A 1  34   ? 88.304  37.189  -45.553 1.00 90.95  ? 34   LYS A O     1 
ATOM   251   C  CB    . LYS A 1  34   ? 89.360  35.219  -47.400 1.00 90.44  ? 34   LYS A CB    1 
ATOM   252   C  CG    . LYS A 1  34   ? 89.925  33.923  -48.073 1.00 89.93  ? 34   LYS A CG    1 
ATOM   253   C  CD    . LYS A 1  34   ? 91.315  34.043  -48.767 1.00 75.17  ? 34   LYS A CD    1 
ATOM   254   C  CE    . LYS A 1  34   ? 92.090  32.769  -48.699 1.00 36.94  ? 34   LYS A CE    1 
ATOM   255   N  NZ    . LYS A 1  34   ? 91.268  31.686  -49.241 1.00 29.00  ? 34   LYS A NZ    1 
ATOM   256   N  N     . ILE A 1  35   ? 88.718  35.649  -43.911 1.00 83.54  ? 35   ILE A N     1 
ATOM   257   C  CA    . ILE A 1  35   ? 87.733  35.995  -42.830 1.00 83.49  ? 35   ILE A CA    1 
ATOM   258   C  C     . ILE A 1  35   ? 86.446  36.765  -43.309 1.00 87.50  ? 35   ILE A C     1 
ATOM   259   O  O     . ILE A 1  35   ? 86.432  37.996  -43.393 1.00 85.99  ? 35   ILE A O     1 
ATOM   260   C  CB    . ILE A 1  35   ? 88.379  36.706  -41.600 1.00 84.32  ? 35   ILE A CB    1 
ATOM   261   C  CG1   . ILE A 1  35   ? 89.305  35.755  -40.866 1.00 82.88  ? 35   ILE A CG1   1 
ATOM   262   C  CG2   . ILE A 1  35   ? 87.332  37.212  -40.607 1.00 85.55  ? 35   ILE A CG2   1 
ATOM   263   C  CD1   . ILE A 1  35   ? 90.639  35.772  -41.362 1.00 93.62  ? 35   ILE A CD1   1 
ATOM   264   N  N     . ARG A 1  36   ? 85.362  36.010  -43.524 1.00 85.88  ? 36   ARG A N     1 
ATOM   265   C  CA    . ARG A 1  36   ? 84.109  36.537  -44.031 1.00 89.33  ? 36   ARG A CA    1 
ATOM   266   C  C     . ARG A 1  36   ? 82.854  36.128  -43.238 1.00 100.24 ? 36   ARG A C     1 
ATOM   267   O  O     . ARG A 1  36   ? 81.778  36.678  -43.495 1.00 102.93 ? 36   ARG A O     1 
ATOM   268   C  CB    . ARG A 1  36   ? 83.953  36.182  -45.513 1.00 90.07  ? 36   ARG A CB    1 
ATOM   269   C  CG    . ARG A 1  36   ? 84.579  34.849  -45.911 1.00 102.30 ? 36   ARG A CG    1 
ATOM   270   C  CD    . ARG A 1  36   ? 85.012  34.873  -47.363 1.00 118.31 ? 36   ARG A CD    1 
ATOM   271   N  NE    . ARG A 1  36   ? 86.231  34.096  -47.578 1.00 127.54 ? 36   ARG A NE    1 
ATOM   272   C  CZ    . ARG A 1  36   ? 86.267  32.932  -48.213 1.00 145.55 ? 36   ARG A CZ    1 
ATOM   273   N  NH1   . ARG A 1  36   ? 85.151  32.401  -48.706 1.00 140.95 ? 36   ARG A NH1   1 
ATOM   274   N  NH2   . ARG A 1  36   ? 87.417  32.281  -48.352 1.00 123.76 ? 36   ARG A NH2   1 
ATOM   275   N  N     . PHE A 1  37   ? 82.966  35.211  -42.269 1.00 98.82  ? 37   PHE A N     1 
ATOM   276   C  CA    . PHE A 1  37   ? 81.773  34.841  -41.512 1.00 102.11 ? 37   PHE A CA    1 
ATOM   277   C  C     . PHE A 1  37   ? 81.864  35.216  -40.062 1.00 107.04 ? 37   PHE A C     1 
ATOM   278   O  O     . PHE A 1  37   ? 82.811  34.812  -39.398 1.00 104.74 ? 37   PHE A O     1 
ATOM   279   C  CB    . PHE A 1  37   ? 81.419  33.360  -41.678 1.00 105.93 ? 37   PHE A CB    1 
ATOM   280   C  CG    . PHE A 1  37   ? 81.570  32.914  -43.100 1.00 109.10 ? 37   PHE A CG    1 
ATOM   281   C  CD1   . PHE A 1  37   ? 80.757  33.435  -44.097 1.00 114.50 ? 37   PHE A CD1   1 
ATOM   282   C  CD2   . PHE A 1  37   ? 82.583  32.043  -43.462 1.00 112.07 ? 37   PHE A CD2   1 
ATOM   283   C  CE1   . PHE A 1  37   ? 80.941  33.070  -45.429 1.00 119.16 ? 37   PHE A CE1   1 
ATOM   284   C  CE2   . PHE A 1  37   ? 82.775  31.680  -44.794 1.00 114.59 ? 37   PHE A CE2   1 
ATOM   285   C  CZ    . PHE A 1  37   ? 81.954  32.196  -45.770 1.00 116.40 ? 37   PHE A CZ    1 
ATOM   286   N  N     . PRO A 1  38   ? 80.869  35.942  -39.524 1.00 107.39 ? 38   PRO A N     1 
ATOM   287   C  CA    . PRO A 1  38   ? 80.912  36.291  -38.093 1.00 108.30 ? 38   PRO A CA    1 
ATOM   288   C  C     . PRO A 1  38   ? 80.916  35.088  -37.137 1.00 117.13 ? 38   PRO A C     1 
ATOM   289   O  O     . PRO A 1  38   ? 81.254  35.241  -35.966 1.00 116.81 ? 38   PRO A O     1 
ATOM   290   C  CB    . PRO A 1  38   ? 79.692  37.196  -37.903 1.00 112.82 ? 38   PRO A CB    1 
ATOM   291   C  CG    . PRO A 1  38   ? 78.820  36.938  -39.064 1.00 119.08 ? 38   PRO A CG    1 
ATOM   292   C  CD    . PRO A 1  38   ? 79.682  36.508  -40.191 1.00 112.24 ? 38   PRO A CD    1 
ATOM   293   N  N     . GLU A 1  39   ? 80.586  33.891  -37.644 1.00 118.27 ? 39   GLU A N     1 
ATOM   294   C  CA    . GLU A 1  39   ? 80.577  32.637  -36.889 1.00 120.74 ? 39   GLU A CA    1 
ATOM   295   C  C     . GLU A 1  39   ? 82.014  32.123  -36.739 1.00 125.98 ? 39   GLU A C     1 
ATOM   296   O  O     . GLU A 1  39   ? 82.761  32.056  -37.724 1.00 123.74 ? 39   GLU A O     1 
ATOM   297   C  CB    . GLU A 1  39   ? 79.681  31.604  -37.583 1.00 124.85 ? 39   GLU A CB    1 
ATOM   298   C  CG    . GLU A 1  39   ? 78.193  31.957  -37.565 1.00 143.73 ? 39   GLU A CG    1 
ATOM   299   C  CD    . GLU A 1  39   ? 77.658  33.065  -38.466 1.00 168.20 ? 39   GLU A CD    1 
ATOM   300   O  OE1   . GLU A 1  39   ? 78.230  33.293  -39.558 1.00 154.99 ? 39   GLU A OE1   1 
ATOM   301   O  OE2   . GLU A 1  39   ? 76.627  33.674  -38.092 1.00 166.30 ? 39   GLU A OE2   1 
ATOM   302   N  N     . THR A 1  40   ? 82.408  31.815  -35.491 1.00 125.66 ? 40   THR A N     1 
ATOM   303   C  CA    . THR A 1  40   ? 83.756  31.361  -35.109 1.00 124.31 ? 40   THR A CA    1 
ATOM   304   C  C     . THR A 1  40   ? 84.059  30.032  -35.713 1.00 131.68 ? 40   THR A C     1 
ATOM   305   O  O     . THR A 1  40   ? 84.855  29.889  -36.646 1.00 128.61 ? 40   THR A O     1 
ATOM   306   C  CB    . THR A 1  40   ? 83.840  31.191  -33.580 1.00 133.03 ? 40   THR A CB    1 
ATOM   307   O  OG1   . THR A 1  40   ? 82.578  30.731  -33.074 1.00 134.23 ? 40   THR A OG1   1 
ATOM   308   C  CG2   . THR A 1  40   ? 84.245  32.450  -32.892 1.00 132.46 ? 40   THR A CG2   1 
ATOM   309   N  N     . MET A 1  41   ? 83.394  29.053  -35.151 1.00 134.98 ? 41   MET A N     1 
ATOM   310   C  CA    . MET A 1  41   ? 83.507  27.673  -35.516 1.00 137.93 ? 41   MET A CA    1 
ATOM   311   C  C     . MET A 1  41   ? 82.125  27.048  -35.559 1.00 146.22 ? 41   MET A C     1 
ATOM   312   O  O     . MET A 1  41   ? 81.135  27.763  -35.778 1.00 146.09 ? 41   MET A O     1 
ATOM   313   C  CB    . MET A 1  41   ? 84.518  26.936  -34.602 1.00 140.48 ? 41   MET A CB    1 
ATOM   314   C  CG    . MET A 1  41   ? 84.522  27.377  -33.169 1.00 145.53 ? 41   MET A CG    1 
ATOM   315   S  SD    . MET A 1  41   ? 83.289  26.422  -32.286 1.00 155.55 ? 41   MET A SD    1 
ATOM   316   C  CE    . MET A 1  41   ? 82.015  27.696  -32.004 1.00 153.99 ? 41   MET A CE    1 
ATOM   317   N  N     . ASP A 1  42   ? 82.065  25.723  -35.342 1.00 146.70 ? 42   ASP A N     1 
ATOM   318   C  CA    . ASP A 1  42   ? 80.865  24.885  -35.388 1.00 151.34 ? 42   ASP A CA    1 
ATOM   319   C  C     . ASP A 1  42   ? 80.272  24.966  -36.797 1.00 157.41 ? 42   ASP A C     1 
ATOM   320   O  O     . ASP A 1  42   ? 79.396  25.794  -37.085 1.00 157.45 ? 42   ASP A O     1 
ATOM   321   C  CB    . ASP A 1  42   ? 79.853  25.151  -34.224 1.00 155.17 ? 42   ASP A CB    1 
ATOM   322   C  CG    . ASP A 1  42   ? 79.259  23.925  -33.520 1.00 152.71 ? 42   ASP A CG    1 
ATOM   323   O  OD1   . ASP A 1  42   ? 80.032  23.148  -32.903 1.00 149.67 ? 42   ASP A OD1   1 
ATOM   324   O  OD2   . ASP A 1  42   ? 78.030  23.832  -33.454 1.00 156.13 ? 42   ASP A OD2   1 
ATOM   325   N  N     . GLU A 1  43   ? 80.880  24.163  -37.693 1.00 154.55 ? 43   GLU A N     1 
ATOM   326   C  CA    . GLU A 1  43   ? 80.498  23.974  -39.086 1.00 155.71 ? 43   GLU A CA    1 
ATOM   327   C  C     . GLU A 1  43   ? 79.146  23.270  -39.016 1.00 164.74 ? 43   GLU A C     1 
ATOM   328   O  O     . GLU A 1  43   ? 79.029  22.078  -39.301 1.00 167.06 ? 43   GLU A O     1 
ATOM   329   C  CB    . GLU A 1  43   ? 81.574  23.156  -39.852 1.00 156.29 ? 43   GLU A CB    1 
ATOM   330   C  CG    . GLU A 1  43   ? 82.289  22.085  -39.032 1.00 169.03 ? 43   GLU A CG    1 
ATOM   331   C  CD    . GLU A 1  43   ? 83.283  21.200  -39.765 1.00 194.43 ? 43   GLU A CD    1 
ATOM   332   O  OE1   . GLU A 1  43   ? 84.317  21.725  -40.239 1.00 185.02 ? 43   GLU A OE1   1 
ATOM   333   O  OE2   . GLU A 1  43   ? 83.074  19.965  -39.781 1.00 196.65 ? 43   GLU A OE2   1 
ATOM   334   N  N     . THR A 1  44   ? 78.140  24.040  -38.556 1.00 162.89 ? 44   THR A N     1 
ATOM   335   C  CA    . THR A 1  44   ? 76.762  23.689  -38.255 1.00 167.63 ? 44   THR A CA    1 
ATOM   336   C  C     . THR A 1  44   ? 76.746  22.396  -37.419 1.00 174.44 ? 44   THR A C     1 
ATOM   337   O  O     . THR A 1  44   ? 76.724  21.286  -37.962 1.00 176.40 ? 44   THR A O     1 
ATOM   338   C  CB    . THR A 1  44   ? 75.875  23.714  -39.516 1.00 181.61 ? 44   THR A CB    1 
ATOM   339   O  OG1   . THR A 1  44   ? 76.028  24.994  -40.143 1.00 179.84 ? 44   THR A OG1   1 
ATOM   340   C  CG2   . THR A 1  44   ? 74.384  23.475  -39.201 1.00 185.59 ? 44   THR A CG2   1 
ATOM   341   N  N     . GLN A 1  45   ? 76.811  22.577  -36.084 1.00 170.76 ? 45   GLN A N     1 
ATOM   342   C  CA    . GLN A 1  45   ? 76.779  21.556  -35.026 1.00 173.30 ? 45   GLN A CA    1 
ATOM   343   C  C     . GLN A 1  45   ? 78.141  20.912  -34.779 1.00 173.30 ? 45   GLN A C     1 
ATOM   344   O  O     . GLN A 1  45   ? 78.559  20.845  -33.623 1.00 172.96 ? 45   GLN A O     1 
ATOM   345   C  CB    . GLN A 1  45   ? 75.670  20.491  -35.224 1.00 179.99 ? 45   GLN A CB    1 
ATOM   346   C  CG    . GLN A 1  45   ? 74.260  21.032  -34.981 1.00 189.61 ? 45   GLN A CG    1 
ATOM   347   C  CD    . GLN A 1  45   ? 73.208  20.190  -35.646 1.00 204.91 ? 45   GLN A CD    1 
ATOM   348   O  OE1   . GLN A 1  45   ? 72.824  19.128  -35.148 1.00 201.54 ? 45   GLN A OE1   1 
ATOM   349   N  NE2   . GLN A 1  45   ? 72.705  20.659  -36.779 1.00 195.52 ? 45   GLN A NE2   1 
ATOM   350   N  N     . THR A 1  46   ? 78.833  20.451  -35.836 1.00 167.12 ? 46   THR A N     1 
ATOM   351   C  CA    . THR A 1  46   ? 80.138  19.800  -35.700 1.00 165.05 ? 46   THR A CA    1 
ATOM   352   C  C     . THR A 1  46   ? 81.082  20.693  -34.909 1.00 162.64 ? 46   THR A C     1 
ATOM   353   O  O     . THR A 1  46   ? 81.211  21.864  -35.228 1.00 159.06 ? 46   THR A O     1 
ATOM   354   C  CB    . THR A 1  46   ? 80.702  19.391  -37.075 1.00 177.30 ? 46   THR A CB    1 
ATOM   355   O  OG1   . THR A 1  46   ? 79.698  18.688  -37.809 1.00 183.72 ? 46   THR A OG1   1 
ATOM   356   C  CG2   . THR A 1  46   ? 81.969  18.526  -36.970 1.00 176.21 ? 46   THR A CG2   1 
ATOM   357   N  N     . ARG A 1  47   ? 81.716  20.136  -33.872 1.00 158.07 ? 47   ARG A N     1 
ATOM   358   C  CA    . ARG A 1  47   ? 82.661  20.803  -32.972 1.00 154.23 ? 47   ARG A CA    1 
ATOM   359   C  C     . ARG A 1  47   ? 83.996  21.215  -33.693 1.00 149.84 ? 47   ARG A C     1 
ATOM   360   O  O     . ARG A 1  47   ? 85.024  21.431  -33.038 1.00 147.10 ? 47   ARG A O     1 
ATOM   361   C  CB    . ARG A 1  47   ? 82.912  19.875  -31.760 1.00 160.33 ? 47   ARG A CB    1 
ATOM   362   C  CG    . ARG A 1  47   ? 83.331  20.556  -30.453 1.00 177.97 ? 47   ARG A CG    1 
ATOM   363   C  CD    . ARG A 1  47   ? 84.413  19.740  -29.742 1.00 195.19 ? 47   ARG A CD    1 
ATOM   364   N  NE    . ARG A 1  47   ? 84.869  20.358  -28.493 1.00 203.45 ? 47   ARG A NE    1 
ATOM   365   C  CZ    . ARG A 1  47   ? 85.874  19.904  -27.748 1.00 212.93 ? 47   ARG A CZ    1 
ATOM   366   N  NH1   . ARG A 1  47   ? 86.547  18.820  -28.117 1.00 198.66 ? 47   ARG A NH1   1 
ATOM   367   N  NH2   . ARG A 1  47   ? 86.208  20.525  -26.624 1.00 195.75 ? 47   ARG A NH2   1 
ATOM   368   N  N     . ALA A 1  48   ? 83.964  21.347  -35.037 1.00 142.48 ? 48   ALA A N     1 
ATOM   369   C  CA    . ALA A 1  48   ? 85.111  21.762  -35.846 1.00 137.24 ? 48   ALA A CA    1 
ATOM   370   C  C     . ALA A 1  48   ? 84.961  23.241  -36.300 1.00 135.20 ? 48   ALA A C     1 
ATOM   371   O  O     . ALA A 1  48   ? 83.841  23.690  -36.551 1.00 135.48 ? 48   ALA A O     1 
ATOM   372   C  CB    . ALA A 1  48   ? 85.275  20.828  -37.036 1.00 139.08 ? 48   ALA A CB    1 
ATOM   373   N  N     . LYS A 1  49   ? 86.085  23.992  -36.365 1.00 126.30 ? 49   LYS A N     1 
ATOM   374   C  CA    . LYS A 1  49   ? 86.144  25.419  -36.738 1.00 122.66 ? 49   LYS A CA    1 
ATOM   375   C  C     . LYS A 1  49   ? 85.658  25.757  -38.138 1.00 123.79 ? 49   LYS A C     1 
ATOM   376   O  O     . LYS A 1  49   ? 86.023  25.052  -39.076 1.00 124.64 ? 49   LYS A O     1 
ATOM   377   C  CB    . LYS A 1  49   ? 87.540  26.019  -36.551 1.00 123.23 ? 49   LYS A CB    1 
ATOM   378   C  CG    . LYS A 1  49   ? 88.543  25.172  -35.781 1.00 151.10 ? 49   LYS A CG    1 
ATOM   379   C  CD    . LYS A 1  49   ? 89.781  26.006  -35.570 1.00 161.82 ? 49   LYS A CD    1 
ATOM   380   C  CE    . LYS A 1  49   ? 90.985  25.289  -35.029 1.00 170.02 ? 49   LYS A CE    1 
ATOM   381   N  NZ    . LYS A 1  49   ? 92.092  26.250  -34.817 1.00 169.25 ? 49   LYS A NZ    1 
ATOM   382   N  N     . ILE A 1  50   ? 84.885  26.869  -38.294 1.00 117.23 ? 50   ILE A N     1 
ATOM   383   C  CA    . ILE A 1  50   ? 84.333  27.315  -39.591 1.00 116.31 ? 50   ILE A CA    1 
ATOM   384   C  C     . ILE A 1  50   ? 85.437  27.923  -40.407 1.00 111.94 ? 50   ILE A C     1 
ATOM   385   O  O     . ILE A 1  50   ? 86.184  28.723  -39.845 1.00 109.11 ? 50   ILE A O     1 
ATOM   386   C  CB    . ILE A 1  50   ? 83.070  28.256  -39.453 1.00 121.40 ? 50   ILE A CB    1 
ATOM   387   C  CG1   . ILE A 1  50   ? 81.794  27.418  -39.122 1.00 126.28 ? 50   ILE A CG1   1 
ATOM   388   C  CG2   . ILE A 1  50   ? 82.830  29.171  -40.699 1.00 121.40 ? 50   ILE A CG2   1 
ATOM   389   C  CD1   . ILE A 1  50   ? 80.421  28.193  -38.989 1.00 138.35 ? 50   ILE A CD1   1 
ATOM   390   N  N     . GLY A 1  51   ? 85.525  27.544  -41.698 1.00 105.12 ? 51   GLY A N     1 
ATOM   391   C  CA    . GLY A 1  51   ? 86.508  28.052  -42.651 1.00 101.47 ? 51   GLY A CA    1 
ATOM   392   C  C     . GLY A 1  51   ? 86.314  29.523  -42.997 1.00 101.55 ? 51   GLY A C     1 
ATOM   393   O  O     . GLY A 1  51   ? 86.776  29.951  -44.050 1.00 100.98 ? 51   GLY A O     1 
ATOM   394   N  N     . GLY A 1  52   ? 85.726  30.312  -42.071 1.00 95.51  ? 52   GLY A N     1 
ATOM   395   C  CA    . GLY A 1  52   ? 85.399  31.726  -42.227 1.00 93.64  ? 52   GLY A CA    1 
ATOM   396   C  C     . GLY A 1  52   ? 85.773  32.766  -41.185 1.00 94.80  ? 52   GLY A C     1 
ATOM   397   O  O     . GLY A 1  52   ? 85.711  33.933  -41.534 1.00 94.60  ? 52   GLY A O     1 
ATOM   398   N  N     . LEU A 1  53   ? 86.078  32.409  -39.901 1.00 91.14  ? 53   LEU A N     1 
ATOM   399   C  CA    . LEU A 1  53   ? 86.617  33.256  -38.759 1.00 89.91  ? 53   LEU A CA    1 
ATOM   400   C  C     . LEU A 1  53   ? 87.366  32.272  -37.851 1.00 94.86  ? 53   LEU A C     1 
ATOM   401   O  O     . LEU A 1  53   ? 87.211  31.067  -38.090 1.00 98.38  ? 53   LEU A O     1 
ATOM   402   C  CB    . LEU A 1  53   ? 85.526  33.962  -37.880 1.00 91.34  ? 53   LEU A CB    1 
ATOM   403   C  CG    . LEU A 1  53   ? 85.911  35.287  -37.081 1.00 93.65  ? 53   LEU A CG    1 
ATOM   404   C  CD1   . LEU A 1  53   ? 84.658  36.104  -36.666 1.00 95.32  ? 53   LEU A CD1   1 
ATOM   405   C  CD2   . LEU A 1  53   ? 86.748  35.023  -35.840 1.00 92.19  ? 53   LEU A CD2   1 
ATOM   406   N  N     . ASN A 1  54   ? 88.125  32.735  -36.802 1.00 86.85  ? 54   ASN A N     1 
ATOM   407   C  CA    . ASN A 1  54   ? 88.752  31.836  -35.811 1.00 85.58  ? 54   ASN A CA    1 
ATOM   408   C  C     . ASN A 1  54   ? 89.148  30.442  -36.494 1.00 88.29  ? 54   ASN A C     1 
ATOM   409   O  O     . ASN A 1  54   ? 88.441  29.418  -36.438 1.00 89.18  ? 54   ASN A O     1 
ATOM   410   C  CB    . ASN A 1  54   ? 87.766  31.711  -34.613 1.00 87.41  ? 54   ASN A CB    1 
ATOM   411   C  CG    . ASN A 1  54   ? 88.269  31.178  -33.285 1.00 106.28 ? 54   ASN A CG    1 
ATOM   412   O  OD1   . ASN A 1  54   ? 87.777  30.151  -32.789 1.00 106.83 ? 54   ASN A OD1   1 
ATOM   413   N  ND2   . ASN A 1  54   ? 89.119  31.938  -32.596 1.00 90.23  ? 54   ASN A ND2   1 
ATOM   414   N  N     . ASP A 1  55   ? 90.281  30.500  -37.191 1.00 82.30  ? 55   ASP A N     1 
ATOM   415   C  CA    . ASP A 1  55   ? 90.927  29.531  -38.063 1.00 81.96  ? 55   ASP A CA    1 
ATOM   416   C  C     . ASP A 1  55   ? 90.139  29.255  -39.269 1.00 89.87  ? 55   ASP A C     1 
ATOM   417   O  O     . ASP A 1  55   ? 89.820  28.105  -39.548 1.00 91.25  ? 55   ASP A O     1 
ATOM   418   C  CB    . ASP A 1  55   ? 91.445  28.209  -37.468 1.00 83.79  ? 55   ASP A CB    1 
ATOM   419   C  CG    . ASP A 1  55   ? 92.057  27.265  -38.543 1.00 80.65  ? 55   ASP A CG    1 
ATOM   420   O  OD1   . ASP A 1  55   ? 93.266  27.418  -38.863 1.00 75.35  ? 55   ASP A OD1   1 
ATOM   421   O  OD2   . ASP A 1  55   ? 91.304  26.403  -39.089 1.00 79.59  ? 55   ASP A OD2   1 
ATOM   422   N  N     . PRO A 1  56   ? 90.042  30.241  -40.152 1.00 89.82  ? 56   PRO A N     1 
ATOM   423   C  CA    . PRO A 1  56   ? 89.593  29.942  -41.516 1.00 92.75  ? 56   PRO A CA    1 
ATOM   424   C  C     . PRO A 1  56   ? 90.852  29.470  -42.299 1.00 96.23  ? 56   PRO A C     1 
ATOM   425   O  O     . PRO A 1  56   ? 90.777  29.323  -43.521 1.00 95.49  ? 56   PRO A O     1 
ATOM   426   C  CB    . PRO A 1  56   ? 89.072  31.299  -42.024 1.00 95.00  ? 56   PRO A CB    1 
ATOM   427   C  CG    . PRO A 1  56   ? 89.386  32.308  -40.889 1.00 97.75  ? 56   PRO A CG    1 
ATOM   428   C  CD    . PRO A 1  56   ? 90.409  31.660  -40.028 1.00 91.04  ? 56   PRO A CD    1 
ATOM   429   N  N     . ARG A 1  57   ? 92.014  29.249  -41.522 1.00 92.40  ? 57   ARG A N     1 
ATOM   430   C  CA    . ARG A 1  57   ? 93.432  28.821  -41.727 1.00 90.98  ? 57   ARG A CA    1 
ATOM   431   C  C     . ARG A 1  57   ? 94.378  29.240  -40.529 1.00 91.79  ? 57   ARG A C     1 
ATOM   432   O  O     . ARG A 1  57   ? 95.186  28.424  -40.144 1.00 89.12  ? 57   ARG A O     1 
ATOM   433   C  CB    . ARG A 1  57   ? 94.032  29.253  -43.087 1.00 89.97  ? 57   ARG A CB    1 
ATOM   434   C  CG    . ARG A 1  57   ? 93.556  28.421  -44.281 1.00 95.77  ? 57   ARG A CG    1 
ATOM   435   C  CD    . ARG A 1  57   ? 93.416  29.246  -45.555 1.00 104.64 ? 57   ARG A CD    1 
ATOM   436   N  NE    . ARG A 1  57   ? 92.273  30.169  -45.533 1.00 106.01 ? 57   ARG A NE    1 
ATOM   437   C  CZ    . ARG A 1  57   ? 91.296  30.171  -46.433 1.00 122.68 ? 57   ARG A CZ    1 
ATOM   438   N  NH1   . ARG A 1  57   ? 91.320  29.321  -47.448 1.00 123.72 ? 57   ARG A NH1   1 
ATOM   439   N  NH2   . ARG A 1  57   ? 90.296  31.032  -46.332 1.00 104.38 ? 57   ARG A NH2   1 
ATOM   440   N  N     . LEU A 1  58   ? 94.182  30.463  -39.907 1.00 89.74  ? 58   LEU A N     1 
ATOM   441   C  CA    . LEU A 1  58   ? 94.888  31.215  -38.812 1.00 88.45  ? 58   LEU A CA    1 
ATOM   442   C  C     . LEU A 1  58   ? 95.832  30.428  -37.945 1.00 97.45  ? 58   LEU A C     1 
ATOM   443   O  O     . LEU A 1  58   ? 96.788  29.874  -38.471 1.00 99.89  ? 58   LEU A O     1 
ATOM   444   C  CB    . LEU A 1  58   ? 93.921  31.961  -37.877 1.00 87.55  ? 58   LEU A CB    1 
ATOM   445   C  CG    . LEU A 1  58   ? 92.902  32.903  -38.471 1.00 91.70  ? 58   LEU A CG    1 
ATOM   446   C  CD1   . LEU A 1  58   ? 92.155  33.609  -37.393 1.00 91.91  ? 58   LEU A CD1   1 
ATOM   447   C  CD2   . LEU A 1  58   ? 93.519  33.896  -39.438 1.00 92.81  ? 58   LEU A CD2   1 
ATOM   448   N  N     . GLY A 1  59   ? 95.613  30.454  -36.630 1.00 95.09  ? 59   GLY A N     1 
ATOM   449   C  CA    . GLY A 1  59   ? 96.373  29.664  -35.669 1.00 96.51  ? 59   GLY A CA    1 
ATOM   450   C  C     . GLY A 1  59   ? 95.719  28.302  -35.429 1.00 105.78 ? 59   GLY A C     1 
ATOM   451   O  O     . GLY A 1  59   ? 95.226  27.671  -36.371 1.00 105.53 ? 59   GLY A O     1 
ATOM   452   N  N     . SER A 1  60   ? 95.673  27.846  -34.156 1.00 107.09 ? 60   SER A N     1 
ATOM   453   C  CA    . SER A 1  60   ? 95.068  26.568  -33.774 1.00 111.52 ? 60   SER A CA    1 
ATOM   454   C  C     . SER A 1  60   ? 94.325  26.565  -32.414 1.00 119.71 ? 60   SER A C     1 
ATOM   455   O  O     . SER A 1  60   ? 94.550  27.438  -31.574 1.00 119.06 ? 60   SER A O     1 
ATOM   456   C  CB    . SER A 1  60   ? 96.114  25.457  -33.802 1.00 118.64 ? 60   SER A CB    1 
ATOM   457   O  OG    . SER A 1  60   ? 95.533  24.166  -33.663 1.00 136.03 ? 60   SER A OG    1 
ATOM   458   N  N     . ILE A 1  61   ? 93.438  25.556  -32.224 1.00 120.53 ? 61   ILE A N     1 
ATOM   459   C  CA    . ILE A 1  61   ? 92.631  25.219  -31.030 1.00 123.60 ? 61   ILE A CA    1 
ATOM   460   C  C     . ILE A 1  61   ? 92.800  23.659  -30.811 1.00 134.90 ? 61   ILE A C     1 
ATOM   461   O  O     . ILE A 1  61   ? 93.600  23.033  -31.523 1.00 134.28 ? 61   ILE A O     1 
ATOM   462   C  CB    . ILE A 1  61   ? 91.124  25.648  -31.231 1.00 126.88 ? 61   ILE A CB    1 
ATOM   463   C  CG1   . ILE A 1  61   ? 90.991  27.123  -31.675 1.00 123.67 ? 61   ILE A CG1   1 
ATOM   464   C  CG2   . ILE A 1  61   ? 90.239  25.351  -29.987 1.00 130.16 ? 61   ILE A CG2   1 
ATOM   465   C  CD1   . ILE A 1  61   ? 89.645  27.491  -32.211 1.00 127.74 ? 61   ILE A CD1   1 
ATOM   466   N  N     . ASP A 1  62   ? 92.089  23.060  -29.807 1.00 137.44 ? 62   ASP A N     1 
ATOM   467   C  CA    . ASP A 1  62   ? 91.996  21.619  -29.470 1.00 142.11 ? 62   ASP A CA    1 
ATOM   468   C  C     . ASP A 1  62   ? 93.344  20.841  -29.391 1.00 147.21 ? 62   ASP A C     1 
ATOM   469   O  O     . ASP A 1  62   ? 93.324  19.598  -29.356 1.00 150.73 ? 62   ASP A O     1 
ATOM   470   C  CB    . ASP A 1  62   ? 91.040  20.917  -30.474 1.00 146.23 ? 62   ASP A CB    1 
ATOM   471   C  CG    . ASP A 1  62   ? 90.104  19.857  -29.897 1.00 167.03 ? 62   ASP A CG    1 
ATOM   472   O  OD1   . ASP A 1  62   ? 90.600  18.764  -29.511 1.00 171.24 ? 62   ASP A OD1   1 
ATOM   473   O  OD2   . ASP A 1  62   ? 88.863  20.075  -29.927 1.00 175.70 ? 62   ASP A OD2   1 
ATOM   474   N  N     . ARG A 1  63   ? 94.495  21.560  -29.317 1.00 140.42 ? 63   ARG A N     1 
ATOM   475   C  CA    . ARG A 1  63   ? 95.844  20.975  -29.311 1.00 140.36 ? 63   ARG A CA    1 
ATOM   476   C  C     . ARG A 1  63   ? 95.965  19.920  -30.450 1.00 147.54 ? 63   ARG A C     1 
ATOM   477   O  O     . ARG A 1  63   ? 95.995  18.694  -30.226 1.00 150.15 ? 63   ARG A O     1 
ATOM   478   C  CB    . ARG A 1  63   ? 96.295  20.449  -27.929 1.00 141.39 ? 63   ARG A CB    1 
ATOM   479   C  CG    . ARG A 1  63   ? 96.217  21.449  -26.774 1.00 147.79 ? 63   ARG A CG    1 
ATOM   480   C  CD    . ARG A 1  63   ? 94.919  21.318  -25.968 1.00 168.57 ? 63   ARG A CD    1 
ATOM   481   N  NE    . ARG A 1  63   ? 94.745  19.989  -25.355 1.00 187.54 ? 63   ARG A NE    1 
ATOM   482   C  CZ    . ARG A 1  63   ? 93.583  19.482  -24.938 1.00 200.48 ? 63   ARG A CZ    1 
ATOM   483   N  NH1   . ARG A 1  63   ? 92.461  20.184  -25.056 1.00 184.32 ? 63   ARG A NH1   1 
ATOM   484   N  NH2   . ARG A 1  63   ? 93.536  18.268  -24.403 1.00 186.10 ? 63   ARG A NH2   1 
ATOM   485   N  N     . ASN A 1  64   ? 95.885  20.449  -31.684 1.00 143.11 ? 64   ASN A N     1 
ATOM   486   C  CA    . ASN A 1  64   ? 96.031  19.750  -32.954 1.00 144.07 ? 64   ASN A CA    1 
ATOM   487   C  C     . ASN A 1  64   ? 97.215  20.384  -33.645 1.00 149.22 ? 64   ASN A C     1 
ATOM   488   O  O     . ASN A 1  64   ? 97.194  21.609  -33.877 1.00 145.68 ? 64   ASN A O     1 
ATOM   489   C  CB    . ASN A 1  64   ? 94.799  19.938  -33.825 1.00 138.63 ? 64   ASN A CB    1 
ATOM   490   C  CG    . ASN A 1  64   ? 93.628  19.141  -33.369 1.00 144.93 ? 64   ASN A CG    1 
ATOM   491   O  OD1   . ASN A 1  64   ? 93.738  18.282  -32.485 1.00 143.69 ? 64   ASN A OD1   1 
ATOM   492   N  ND2   . ASN A 1  64   ? 92.479  19.410  -33.967 1.00 127.84 ? 64   ASN A ND2   1 
ATOM   493   N  N     . LEU A 1  65   ? 98.276  19.556  -33.956 1.00 149.51 ? 65   LEU A N     1 
ATOM   494   C  CA    . LEU A 1  65   ? 99.493  19.984  -34.689 1.00 147.55 ? 65   LEU A CA    1 
ATOM   495   C  C     . LEU A 1  65   ? 98.919  20.700  -35.896 1.00 149.04 ? 65   LEU A C     1 
ATOM   496   O  O     . LEU A 1  65   ? 99.333  21.819  -36.233 1.00 146.19 ? 65   LEU A O     1 
ATOM   497   C  CB    . LEU A 1  65   ? 100.360 18.774  -35.130 1.00 150.45 ? 65   LEU A CB    1 
ATOM   498   C  CG    . LEU A 1  65   ? 101.675 18.558  -34.368 1.00 155.33 ? 65   LEU A CG    1 
ATOM   499   C  CD1   . LEU A 1  65   ? 101.701 17.191  -33.693 1.00 159.72 ? 65   LEU A CD1   1 
ATOM   500   C  CD2   . LEU A 1  65   ? 102.881 18.735  -35.286 1.00 156.39 ? 65   LEU A CD2   1 
ATOM   501   N  N     . LYS A 1  66   ? 97.810  20.094  -36.405 1.00 145.84 ? 66   LYS A N     1 
ATOM   502   C  CA    . LYS A 1  66   ? 96.953  20.565  -37.467 1.00 143.95 ? 66   LYS A CA    1 
ATOM   503   C  C     . LYS A 1  66   ? 96.728  22.072  -37.250 1.00 140.55 ? 66   LYS A C     1 
ATOM   504   O  O     . LYS A 1  66   ? 96.065  22.497  -36.295 1.00 140.13 ? 66   LYS A O     1 
ATOM   505   C  CB    . LYS A 1  66   ? 95.632  19.751  -37.495 1.00 149.41 ? 66   LYS A CB    1 
ATOM   506   C  CG    . LYS A 1  66   ? 94.908  19.747  -38.851 1.00 164.39 ? 66   LYS A CG    1 
ATOM   507   C  CD    . LYS A 1  66   ? 94.888  18.366  -39.537 1.00 175.99 ? 66   LYS A CD    1 
ATOM   508   C  CE    . LYS A 1  66   ? 93.964  18.345  -40.740 1.00 181.72 ? 66   LYS A CE    1 
ATOM   509   N  NZ    . LYS A 1  66   ? 93.889  17.003  -41.377 1.00 189.95 ? 66   LYS A NZ    1 
ATOM   510   N  N     . CYS A 1  67   ? 97.460  22.849  -38.058 1.00 130.61 ? 67   CYS A N     1 
ATOM   511   C  CA    . CYS A 1  67   ? 97.433  24.283  -38.155 1.00 125.29 ? 67   CYS A CA    1 
ATOM   512   C  C     . CYS A 1  67   ? 97.843  24.599  -39.572 1.00 127.62 ? 67   CYS A C     1 
ATOM   513   O  O     . CYS A 1  67   ? 99.028  24.793  -39.817 1.00 125.36 ? 67   CYS A O     1 
ATOM   514   C  CB    . CYS A 1  67   ? 98.372  24.921  -37.141 1.00 123.10 ? 67   CYS A CB    1 
ATOM   515   S  SG    . CYS A 1  67   ? 98.808  26.637  -37.529 1.00 123.90 ? 67   CYS A SG    1 
ATOM   516   N  N     . GLN A 1  68   ? 96.873  24.599  -40.522 1.00 127.13 ? 68   GLN A N     1 
ATOM   517   C  CA    . GLN A 1  68   ? 97.055  24.952  -41.948 1.00 129.12 ? 68   GLN A CA    1 
ATOM   518   C  C     . GLN A 1  68   ? 98.362  24.441  -42.620 1.00 139.80 ? 68   GLN A C     1 
ATOM   519   O  O     . GLN A 1  68   ? 99.022  25.200  -43.356 1.00 139.61 ? 68   GLN A O     1 
ATOM   520   C  CB    . GLN A 1  68   ? 96.943  26.485  -42.139 1.00 127.98 ? 68   GLN A CB    1 
ATOM   521   C  CG    . GLN A 1  68   ? 97.735  27.326  -41.120 1.00 124.02 ? 68   GLN A CG    1 
ATOM   522   C  CD    . GLN A 1  68   ? 99.006  27.950  -41.605 1.00 110.50 ? 68   GLN A CD    1 
ATOM   523   O  OE1   . GLN A 1  68   ? 100.001 27.283  -41.996 1.00 91.50  ? 68   GLN A OE1   1 
ATOM   524   N  NE2   . GLN A 1  68   ? 98.998  29.263  -41.475 1.00 95.21  ? 68   GLN A NE2   1 
ATOM   525   N  N     . THR A 1  69   ? 98.727  23.145  -42.355 1.00 140.98 ? 69   THR A N     1 
ATOM   526   C  CA    . THR A 1  69   ? 99.936  22.377  -42.804 1.00 142.49 ? 69   THR A CA    1 
ATOM   527   C  C     . THR A 1  69   ? 101.248 22.905  -42.066 1.00 140.66 ? 69   THR A C     1 
ATOM   528   O  O     . THR A 1  69   ? 102.173 22.086  -41.904 1.00 142.38 ? 69   THR A O     1 
ATOM   529   C  CB    . THR A 1  69   ? 100.058 22.238  -44.383 1.00 153.77 ? 69   THR A CB    1 
ATOM   530   O  OG1   . THR A 1  69   ? 98.913  21.531  -44.895 1.00 155.00 ? 69   THR A OG1   1 
ATOM   531   C  CG2   . THR A 1  69   ? 101.332 21.485  -44.841 1.00 153.81 ? 69   THR A CG2   1 
ATOM   532   N  N     . CYS A 1  70   ? 101.289 24.222  -41.562 1.00 128.53 ? 70   CYS A N     1 
ATOM   533   C  CA    . CYS A 1  70   ? 102.399 24.829  -40.789 1.00 122.81 ? 70   CYS A CA    1 
ATOM   534   C  C     . CYS A 1  70   ? 102.794 23.916  -39.608 1.00 126.19 ? 70   CYS A C     1 
ATOM   535   O  O     . CYS A 1  70   ? 103.854 24.119  -39.019 1.00 124.87 ? 70   CYS A O     1 
ATOM   536   C  CB    . CYS A 1  70   ? 102.049 26.246  -40.327 1.00 118.19 ? 70   CYS A CB    1 
ATOM   537   S  SG    . CYS A 1  70   ? 102.469 26.624  -38.595 1.00 119.35 ? 70   CYS A SG    1 
ATOM   538   N  N     . GLN A 1  71   ? 101.963 22.862  -39.328 1.00 123.93 ? 71   GLN A N     1 
ATOM   539   C  CA    . GLN A 1  71   ? 102.095 21.863  -38.274 1.00 125.47 ? 71   GLN A CA    1 
ATOM   540   C  C     . GLN A 1  71   ? 102.365 22.581  -36.955 1.00 127.71 ? 71   GLN A C     1 
ATOM   541   O  O     . GLN A 1  71   ? 101.708 23.584  -36.676 1.00 125.88 ? 71   GLN A O     1 
ATOM   542   C  CB    . GLN A 1  71   ? 103.108 20.733  -38.632 1.00 130.34 ? 71   GLN A CB    1 
ATOM   543   C  CG    . GLN A 1  71   ? 104.509 21.181  -39.143 1.00 157.64 ? 71   GLN A CG    1 
ATOM   544   C  CD    . GLN A 1  71   ? 105.532 20.105  -39.478 1.00 183.66 ? 71   GLN A CD    1 
ATOM   545   O  OE1   . GLN A 1  71   ? 105.434 18.937  -39.068 1.00 185.58 ? 71   GLN A OE1   1 
ATOM   546   N  NE2   . GLN A 1  71   ? 106.580 20.501  -40.199 1.00 169.74 ? 71   GLN A NE2   1 
ATOM   547   N  N     . GLU A 1  72   ? 103.336 22.117  -36.176 1.00 125.06 ? 72   GLU A N     1 
ATOM   548   C  CA    . GLU A 1  72   ? 103.782 22.713  -34.916 1.00 123.03 ? 72   GLU A CA    1 
ATOM   549   C  C     . GLU A 1  72   ? 102.665 22.727  -33.844 1.00 125.14 ? 72   GLU A C     1 
ATOM   550   O  O     . GLU A 1  72   ? 102.682 21.848  -32.988 1.00 128.32 ? 72   GLU A O     1 
ATOM   551   C  CB    . GLU A 1  72   ? 104.453 24.099  -35.128 1.00 121.46 ? 72   GLU A CB    1 
ATOM   552   C  CG    . GLU A 1  72   ? 105.538 24.187  -36.217 1.00 127.64 ? 72   GLU A CG    1 
ATOM   553   C  CD    . GLU A 1  72   ? 106.509 23.045  -36.508 1.00 127.05 ? 72   GLU A CD    1 
ATOM   554   O  OE1   . GLU A 1  72   ? 106.870 22.285  -35.577 1.00 100.95 ? 72   GLU A OE1   1 
ATOM   555   O  OE2   . GLU A 1  72   ? 106.951 22.951  -37.678 1.00 109.28 ? 72   GLU A OE2   1 
ATOM   556   N  N     . GLY A 1  73   ? 101.719 23.659  -33.897 1.00 117.16 ? 73   GLY A N     1 
ATOM   557   C  CA    . GLY A 1  73   ? 100.631 23.686  -32.929 1.00 117.34 ? 73   GLY A CA    1 
ATOM   558   C  C     . GLY A 1  73   ? 101.015 24.147  -31.535 1.00 122.32 ? 73   GLY A C     1 
ATOM   559   O  O     . GLY A 1  73   ? 102.086 23.817  -31.018 1.00 121.73 ? 73   GLY A O     1 
ATOM   560   N  N     . MET A 1  74   ? 100.096 24.909  -30.914 1.00 120.55 ? 74   MET A N     1 
ATOM   561   C  CA    . MET A 1  74   ? 100.158 25.543  -29.587 1.00 120.96 ? 74   MET A CA    1 
ATOM   562   C  C     . MET A 1  74   ? 101.579 26.026  -29.258 1.00 122.77 ? 74   MET A C     1 
ATOM   563   O  O     . MET A 1  74   ? 102.048 26.925  -29.958 1.00 119.68 ? 74   MET A O     1 
ATOM   564   C  CB    . MET A 1  74   ? 99.536  24.670  -28.471 1.00 127.02 ? 74   MET A CB    1 
ATOM   565   C  CG    . MET A 1  74   ? 98.057  24.263  -28.705 1.00 132.51 ? 74   MET A CG    1 
ATOM   566   S  SD    . MET A 1  74   ? 96.833  25.595  -28.884 1.00 134.83 ? 74   MET A SD    1 
ATOM   567   C  CE    . MET A 1  74   ? 95.348  24.714  -28.501 1.00 134.86 ? 74   MET A CE    1 
ATOM   568   N  N     . ASN A 1  75   ? 102.275 25.445  -28.252 1.00 121.52 ? 75   ASN A N     1 
ATOM   569   C  CA    . ASN A 1  75   ? 103.633 25.913  -27.954 1.00 120.70 ? 75   ASN A CA    1 
ATOM   570   C  C     . ASN A 1  75   ? 104.592 25.496  -29.058 1.00 121.48 ? 75   ASN A C     1 
ATOM   571   O  O     . ASN A 1  75   ? 105.120 24.369  -29.075 1.00 124.12 ? 75   ASN A O     1 
ATOM   572   C  CB    . ASN A 1  75   ? 104.152 25.551  -26.533 1.00 127.63 ? 75   ASN A CB    1 
ATOM   573   C  CG    . ASN A 1  75   ? 105.559 26.082  -26.204 1.00 150.68 ? 75   ASN A CG    1 
ATOM   574   O  OD1   . ASN A 1  75   ? 106.451 25.322  -25.798 1.00 149.13 ? 75   ASN A OD1   1 
ATOM   575   N  ND2   . ASN A 1  75   ? 105.805 27.390  -26.365 1.00 134.70 ? 75   ASN A ND2   1 
ATOM   576   N  N     . GLU A 1  76   ? 104.737 26.431  -30.012 1.00 111.36 ? 76   GLU A N     1 
ATOM   577   C  CA    . GLU A 1  76   ? 105.583 26.447  -31.193 1.00 108.61 ? 76   GLU A CA    1 
ATOM   578   C  C     . GLU A 1  76   ? 104.991 27.427  -32.157 1.00 106.13 ? 76   GLU A C     1 
ATOM   579   O  O     . GLU A 1  76   ? 105.557 28.499  -32.317 1.00 104.47 ? 76   GLU A O     1 
ATOM   580   C  CB    . GLU A 1  76   ? 105.814 25.065  -31.846 1.00 112.37 ? 76   GLU A CB    1 
ATOM   581   C  CG    . GLU A 1  76   ? 107.266 24.796  -32.229 1.00 122.51 ? 76   GLU A CG    1 
ATOM   582   C  CD    . GLU A 1  76   ? 107.961 25.944  -32.941 1.00 141.21 ? 76   GLU A CD    1 
ATOM   583   O  OE1   . GLU A 1  76   ? 107.468 26.382  -34.005 1.00 139.98 ? 76   GLU A OE1   1 
ATOM   584   O  OE2   . GLU A 1  76   ? 108.945 26.472  -32.380 1.00 126.86 ? 76   GLU A OE2   1 
ATOM   585   N  N     . CYS A 1  77   ? 103.835 27.108  -32.756 1.00 100.55 ? 77   CYS A N     1 
ATOM   586   C  CA    . CYS A 1  77   ? 103.190 28.004  -33.719 1.00 97.83  ? 77   CYS A CA    1 
ATOM   587   C  C     . CYS A 1  77   ? 102.661 29.271  -33.071 1.00 98.94  ? 77   CYS A C     1 
ATOM   588   O  O     . CYS A 1  77   ? 101.768 29.200  -32.216 1.00 99.47  ? 77   CYS A O     1 
ATOM   589   C  CB    . CYS A 1  77   ? 102.114 27.293  -34.544 1.00 98.80  ? 77   CYS A CB    1 
ATOM   590   S  SG    . CYS A 1  77   ? 100.820 28.388  -35.200 1.00 100.86 ? 77   CYS A SG    1 
ATOM   591   N  N     . PRO A 1  78   ? 103.174 30.448  -33.506 1.00 92.78  ? 78   PRO A N     1 
ATOM   592   C  CA    . PRO A 1  78   ? 102.630 31.716  -33.004 1.00 91.37  ? 78   PRO A CA    1 
ATOM   593   C  C     . PRO A 1  78   ? 101.289 31.893  -33.680 1.00 95.03  ? 78   PRO A C     1 
ATOM   594   O  O     . PRO A 1  78   ? 100.786 30.964  -34.310 1.00 96.21  ? 78   PRO A O     1 
ATOM   595   C  CB    . PRO A 1  78   ? 103.617 32.746  -33.562 1.00 92.07  ? 78   PRO A CB    1 
ATOM   596   C  CG    . PRO A 1  78   ? 104.085 32.163  -34.832 1.00 96.87  ? 78   PRO A CG    1 
ATOM   597   C  CD    . PRO A 1  78   ? 104.195 30.686  -34.549 1.00 93.86  ? 78   PRO A CD    1 
ATOM   598   N  N     . GLY A 1  79   ? 100.752 33.082  -33.668 1.00 90.07  ? 79   GLY A N     1 
ATOM   599   C  CA    . GLY A 1  79   ? 99.531  33.205  -34.434 1.00 90.59  ? 79   GLY A CA    1 
ATOM   600   C  C     . GLY A 1  79   ? 99.801  33.377  -35.919 1.00 95.35  ? 79   GLY A C     1 
ATOM   601   O  O     . GLY A 1  79   ? 100.958 33.561  -36.335 1.00 95.77  ? 79   GLY A O     1 
ATOM   602   N  N     . HIS A 1  80   ? 98.729  33.296  -36.733 1.00 91.08  ? 80   HIS A N     1 
ATOM   603   C  CA    . HIS A 1  80   ? 98.768  33.617  -38.159 1.00 90.01  ? 80   HIS A CA    1 
ATOM   604   C  C     . HIS A 1  80   ? 97.661  34.577  -38.437 1.00 95.06  ? 80   HIS A C     1 
ATOM   605   O  O     . HIS A 1  80   ? 96.500  34.290  -38.116 1.00 96.37  ? 80   HIS A O     1 
ATOM   606   C  CB    . HIS A 1  80   ? 98.681  32.400  -39.053 1.00 90.96  ? 80   HIS A CB    1 
ATOM   607   C  CG    . HIS A 1  80   ? 99.861  31.535  -38.887 1.00 93.13  ? 80   HIS A CG    1 
ATOM   608   N  ND1   . HIS A 1  80   ? 101.114 31.983  -39.210 1.00 93.55  ? 80   HIS A ND1   1 
ATOM   609   C  CD2   . HIS A 1  80   ? 99.946  30.303  -38.341 1.00 94.93  ? 80   HIS A CD2   1 
ATOM   610   C  CE1   . HIS A 1  80   ? 101.923 30.998  -38.887 1.00 93.57  ? 80   HIS A CE1   1 
ATOM   611   N  NE2   . HIS A 1  80   ? 101.256 29.965  -38.358 1.00 94.73  ? 80   HIS A NE2   1 
ATOM   612   N  N     . PHE A 1  81   ? 98.035  35.755  -38.961 1.00 90.41  ? 81   PHE A N     1 
ATOM   613   C  CA    . PHE A 1  81   ? 97.107  36.839  -39.244 1.00 90.27  ? 81   PHE A CA    1 
ATOM   614   C  C     . PHE A 1  81   ? 96.181  36.548  -40.429 1.00 96.24  ? 81   PHE A C     1 
ATOM   615   O  O     . PHE A 1  81   ? 96.522  35.769  -41.326 1.00 97.88  ? 81   PHE A O     1 
ATOM   616   C  CB    . PHE A 1  81   ? 97.876  38.155  -39.444 1.00 91.14  ? 81   PHE A CB    1 
ATOM   617   C  CG    . PHE A 1  81   ? 97.880  39.039  -38.220 1.00 91.17  ? 81   PHE A CG    1 
ATOM   618   C  CD1   . PHE A 1  81   ? 98.846  38.883  -37.232 1.00 92.60  ? 81   PHE A CD1   1 
ATOM   619   C  CD2   . PHE A 1  81   ? 96.929  40.038  -38.062 1.00 93.05  ? 81   PHE A CD2   1 
ATOM   620   C  CE1   . PHE A 1  81   ? 98.844  39.695  -36.098 1.00 92.95  ? 81   PHE A CE1   1 
ATOM   621   C  CE2   . PHE A 1  81   ? 96.942  40.864  -36.940 1.00 95.38  ? 81   PHE A CE2   1 
ATOM   622   C  CZ    . PHE A 1  81   ? 97.890  40.677  -35.959 1.00 92.53  ? 81   PHE A CZ    1 
ATOM   623   N  N     . GLY A 1  82   ? 95.005  37.159  -40.390 1.00 94.50  ? 82   GLY A N     1 
ATOM   624   C  CA    . GLY A 1  82   ? 94.014  37.095  -41.452 1.00 93.97  ? 82   GLY A CA    1 
ATOM   625   C  C     . GLY A 1  82   ? 93.645  38.505  -41.855 1.00 94.10  ? 82   GLY A C     1 
ATOM   626   O  O     . GLY A 1  82   ? 94.328  39.466  -41.468 1.00 92.42  ? 82   GLY A O     1 
ATOM   627   N  N     . HIS A 1  83   ? 92.576  38.651  -42.634 1.00 89.32  ? 83   HIS A N     1 
ATOM   628   C  CA    . HIS A 1  83   ? 92.138  39.986  -43.032 1.00 87.19  ? 83   HIS A CA    1 
ATOM   629   C  C     . HIS A 1  83   ? 90.641  40.045  -43.226 1.00 92.86  ? 83   HIS A C     1 
ATOM   630   O  O     . HIS A 1  83   ? 89.981  39.005  -43.322 1.00 93.58  ? 83   HIS A O     1 
ATOM   631   C  CB    . HIS A 1  83   ? 92.880  40.477  -44.299 1.00 87.12  ? 83   HIS A CB    1 
ATOM   632   C  CG    . HIS A 1  83   ? 92.361  39.896  -45.577 1.00 91.55  ? 83   HIS A CG    1 
ATOM   633   N  ND1   . HIS A 1  83   ? 91.953  40.703  -46.612 1.00 93.37  ? 83   HIS A ND1   1 
ATOM   634   C  CD2   . HIS A 1  83   ? 92.159  38.606  -45.926 1.00 94.41  ? 83   HIS A CD2   1 
ATOM   635   C  CE1   . HIS A 1  83   ? 91.528  39.887  -47.562 1.00 94.64  ? 83   HIS A CE1   1 
ATOM   636   N  NE2   . HIS A 1  83   ? 91.629  38.617  -47.191 1.00 95.79  ? 83   HIS A NE2   1 
ATOM   637   N  N     . ILE A 1  84   ? 90.110  41.270  -43.276 1.00 89.46  ? 84   ILE A N     1 
ATOM   638   C  CA    . ILE A 1  84   ? 88.713  41.522  -43.569 1.00 90.73  ? 84   ILE A CA    1 
ATOM   639   C  C     . ILE A 1  84   ? 88.620  42.888  -44.276 1.00 93.80  ? 84   ILE A C     1 
ATOM   640   O  O     . ILE A 1  84   ? 88.900  43.945  -43.693 1.00 91.25  ? 84   ILE A O     1 
ATOM   641   C  CB    . ILE A 1  84   ? 87.678  41.283  -42.408 1.00 94.43  ? 84   ILE A CB    1 
ATOM   642   C  CG1   . ILE A 1  84   ? 86.220  41.627  -42.832 1.00 97.92  ? 84   ILE A CG1   1 
ATOM   643   C  CG2   . ILE A 1  84   ? 88.042  41.970  -41.103 1.00 91.82  ? 84   ILE A CG2   1 
ATOM   644   C  CD1   . ILE A 1  84   ? 85.635  41.072  -44.388 1.00 112.90 ? 84   ILE A CD1   1 
ATOM   645   N  N     . ASP A 1  85   ? 88.276  42.812  -45.580 1.00 92.49  ? 85   ASP A N     1 
ATOM   646   C  CA    . ASP A 1  85   ? 88.087  43.938  -46.494 1.00 92.95  ? 85   ASP A CA    1 
ATOM   647   C  C     . ASP A 1  85   ? 86.798  44.697  -46.112 1.00 95.65  ? 85   ASP A C     1 
ATOM   648   O  O     . ASP A 1  85   ? 85.691  44.151  -46.229 1.00 96.59  ? 85   ASP A O     1 
ATOM   649   C  CB    . ASP A 1  85   ? 88.004  43.438  -47.964 1.00 97.39  ? 85   ASP A CB    1 
ATOM   650   C  CG    . ASP A 1  85   ? 89.296  42.935  -48.603 1.00 105.59 ? 85   ASP A CG    1 
ATOM   651   O  OD1   . ASP A 1  85   ? 90.266  43.721  -48.677 1.00 105.68 ? 85   ASP A OD1   1 
ATOM   652   O  OD2   . ASP A 1  85   ? 89.297  41.792  -49.127 1.00 109.33 ? 85   ASP A OD2   1 
ATOM   653   N  N     . LEU A 1  86   ? 86.955  45.942  -45.629 1.00 89.60  ? 86   LEU A N     1 
ATOM   654   C  CA    . LEU A 1  86   ? 85.842  46.799  -45.211 1.00 89.25  ? 86   LEU A CA    1 
ATOM   655   C  C     . LEU A 1  86   ? 85.096  47.311  -46.420 1.00 97.66  ? 86   LEU A C     1 
ATOM   656   O  O     . LEU A 1  86   ? 85.721  47.617  -47.440 1.00 98.30  ? 86   LEU A O     1 
ATOM   657   C  CB    . LEU A 1  86   ? 86.336  47.984  -44.381 1.00 86.67  ? 86   LEU A CB    1 
ATOM   658   C  CG    . LEU A 1  86   ? 87.278  47.648  -43.261 1.00 87.93  ? 86   LEU A CG    1 
ATOM   659   C  CD1   . LEU A 1  86   ? 88.170  48.818  -42.945 1.00 85.49  ? 86   LEU A CD1   1 
ATOM   660   C  CD2   . LEU A 1  86   ? 86.515  47.138  -42.056 1.00 90.89  ? 86   LEU A CD2   1 
ATOM   661   N  N     . ALA A 1  87   ? 83.760  47.418  -46.300 1.00 96.99  ? 87   ALA A N     1 
ATOM   662   C  CA    . ALA A 1  87   ? 82.857  47.866  -47.364 1.00 99.80  ? 87   ALA A CA    1 
ATOM   663   C  C     . ALA A 1  87   ? 83.091  49.325  -47.770 1.00 104.73 ? 87   ALA A C     1 
ATOM   664   O  O     . ALA A 1  87   ? 82.909  49.662  -48.940 1.00 107.08 ? 87   ALA A O     1 
ATOM   665   C  CB    . ALA A 1  87   ? 81.406  47.633  -46.967 1.00 102.42 ? 87   ALA A CB    1 
ATOM   666   N  N     . LYS A 1  88   ? 83.519  50.172  -46.817 1.00 98.94  ? 88   LYS A N     1 
ATOM   667   C  CA    . LYS A 1  88   ? 83.832  51.588  -47.019 1.00 98.48  ? 88   LYS A CA    1 
ATOM   668   C  C     . LYS A 1  88   ? 85.080  51.886  -46.222 1.00 101.78 ? 88   LYS A C     1 
ATOM   669   O  O     . LYS A 1  88   ? 85.351  51.142  -45.280 1.00 100.46 ? 88   LYS A O     1 
ATOM   670   C  CB    . LYS A 1  88   ? 82.688  52.474  -46.499 1.00 101.34 ? 88   LYS A CB    1 
ATOM   671   C  CG    . LYS A 1  88   ? 81.522  52.623  -47.473 1.00 117.68 ? 88   LYS A CG    1 
ATOM   672   C  CD    . LYS A 1  88   ? 81.513  53.985  -48.164 1.00 126.43 ? 88   LYS A CD    1 
ATOM   673   C  CE    . LYS A 1  88   ? 80.130  54.391  -48.631 1.00 131.24 ? 88   LYS A CE    1 
ATOM   674   N  NZ    . LYS A 1  88   ? 79.323  55.043  -47.558 1.00 131.00 ? 88   LYS A NZ    1 
ATOM   675   N  N     . PRO A 1  89   ? 85.861  52.950  -46.522 1.00 99.26  ? 89   PRO A N     1 
ATOM   676   C  CA    . PRO A 1  89   ? 87.009  53.256  -45.654 1.00 96.79  ? 89   PRO A CA    1 
ATOM   677   C  C     . PRO A 1  89   ? 86.503  53.843  -44.333 1.00 98.98  ? 89   PRO A C     1 
ATOM   678   O  O     . PRO A 1  89   ? 85.426  54.449  -44.282 1.00 100.98 ? 89   PRO A O     1 
ATOM   679   C  CB    . PRO A 1  89   ? 87.820  54.264  -46.466 1.00 99.03  ? 89   PRO A CB    1 
ATOM   680   C  CG    . PRO A 1  89   ? 86.824  54.954  -47.316 1.00 106.13 ? 89   PRO A CG    1 
ATOM   681   C  CD    . PRO A 1  89   ? 85.702  53.970  -47.581 1.00 103.09 ? 89   PRO A CD    1 
ATOM   682   N  N     . VAL A 1  90   ? 87.233  53.592  -43.261 1.00 91.28  ? 90   VAL A N     1 
ATOM   683   C  CA    . VAL A 1  90   ? 86.858  54.045  -41.938 1.00 89.92  ? 90   VAL A CA    1 
ATOM   684   C  C     . VAL A 1  90   ? 88.121  54.597  -41.292 1.00 94.61  ? 90   VAL A C     1 
ATOM   685   O  O     . VAL A 1  90   ? 89.209  54.087  -41.552 1.00 92.97  ? 90   VAL A O     1 
ATOM   686   C  CB    . VAL A 1  90   ? 86.252  52.850  -41.166 1.00 92.45  ? 90   VAL A CB    1 
ATOM   687   C  CG1   . VAL A 1  90   ? 86.332  53.039  -39.667 1.00 91.49  ? 90   VAL A CG1   1 
ATOM   688   C  CG2   . VAL A 1  90   ? 84.819  52.580  -41.587 1.00 93.94  ? 90   VAL A CG2   1 
ATOM   689   N  N     . PHE A 1  91   ? 87.991  55.631  -40.457 1.00 93.28  ? 91   PHE A N     1 
ATOM   690   C  CA    . PHE A 1  91   ? 89.145  56.204  -39.757 1.00 92.51  ? 91   PHE A CA    1 
ATOM   691   C  C     . PHE A 1  91   ? 89.669  55.289  -38.652 1.00 95.10  ? 91   PHE A C     1 
ATOM   692   O  O     . PHE A 1  91   ? 88.895  54.568  -38.026 1.00 95.69  ? 91   PHE A O     1 
ATOM   693   C  CB    . PHE A 1  91   ? 88.769  57.545  -39.092 1.00 95.47  ? 91   PHE A CB    1 
ATOM   694   C  CG    . PHE A 1  91   ? 88.296  58.684  -39.964 1.00 98.41  ? 91   PHE A CG    1 
ATOM   695   C  CD1   . PHE A 1  91   ? 89.003  59.051  -41.102 1.00 101.12 ? 91   PHE A CD1   1 
ATOM   696   C  CD2   . PHE A 1  91   ? 87.202  59.451  -39.592 1.00 102.28 ? 91   PHE A CD2   1 
ATOM   697   C  CE1   . PHE A 1  91   ? 88.584  60.120  -41.889 1.00 103.92 ? 91   PHE A CE1   1 
ATOM   698   C  CE2   . PHE A 1  91   ? 86.790  60.529  -40.373 1.00 107.28 ? 91   PHE A CE2   1 
ATOM   699   C  CZ    . PHE A 1  91   ? 87.486  60.857  -41.517 1.00 105.36 ? 91   PHE A CZ    1 
ATOM   700   N  N     . HIS A 1  92   ? 90.965  55.379  -38.361 1.00 90.20  ? 92   HIS A N     1 
ATOM   701   C  CA    . HIS A 1  92   ? 91.581  54.667  -37.239 1.00 89.52  ? 92   HIS A CA    1 
ATOM   702   C  C     . HIS A 1  92   ? 91.407  55.621  -36.049 1.00 96.70  ? 92   HIS A C     1 
ATOM   703   O  O     . HIS A 1  92   ? 91.846  56.775  -36.134 1.00 96.86  ? 92   HIS A O     1 
ATOM   704   C  CB    . HIS A 1  92   ? 93.078  54.424  -37.539 1.00 88.62  ? 92   HIS A CB    1 
ATOM   705   C  CG    . HIS A 1  92   ? 93.877  53.755  -36.458 1.00 90.26  ? 92   HIS A CG    1 
ATOM   706   N  ND1   . HIS A 1  92   ? 94.552  52.572  -36.695 1.00 90.88  ? 92   HIS A ND1   1 
ATOM   707   C  CD2   . HIS A 1  92   ? 94.170  54.177  -35.208 1.00 91.17  ? 92   HIS A CD2   1 
ATOM   708   C  CE1   . HIS A 1  92   ? 95.188  52.292  -35.574 1.00 89.54  ? 92   HIS A CE1   1 
ATOM   709   N  NE2   . HIS A 1  92   ? 94.993  53.231  -34.654 1.00 90.19  ? 92   HIS A NE2   1 
ATOM   710   N  N     . VAL A 1  93   ? 90.753  55.162  -34.962 1.00 95.25  ? 93   VAL A N     1 
ATOM   711   C  CA    . VAL A 1  93   ? 90.502  55.981  -33.760 1.00 96.83  ? 93   VAL A CA    1 
ATOM   712   C  C     . VAL A 1  93   ? 91.655  56.874  -33.350 1.00 103.31 ? 93   VAL A C     1 
ATOM   713   O  O     . VAL A 1  93   ? 91.430  58.042  -33.036 1.00 104.94 ? 93   VAL A O     1 
ATOM   714   C  CB    . VAL A 1  93   ? 90.038  55.195  -32.522 1.00 101.05 ? 93   VAL A CB    1 
ATOM   715   C  CG1   . VAL A 1  93   ? 88.622  55.570  -32.141 1.00 102.45 ? 93   VAL A CG1   1 
ATOM   716   C  CG2   . VAL A 1  93   ? 90.215  53.694  -32.693 1.00 100.21 ? 93   VAL A CG2   1 
ATOM   717   N  N     . GLY A 1  94   ? 92.860  56.294  -33.299 1.00 99.04  ? 94   GLY A N     1 
ATOM   718   C  CA    . GLY A 1  94   ? 94.087  56.967  -32.887 1.00 98.24  ? 94   GLY A CA    1 
ATOM   719   C  C     . GLY A 1  94   ? 94.482  58.117  -33.780 1.00 100.96 ? 94   GLY A C     1 
ATOM   720   O  O     . GLY A 1  94   ? 94.850  59.183  -33.288 1.00 102.05 ? 94   GLY A O     1 
ATOM   721   N  N     . PHE A 1  95   ? 94.362  57.935  -35.088 1.00 95.46  ? 95   PHE A N     1 
ATOM   722   C  CA    . PHE A 1  95   ? 94.803  58.972  -35.998 1.00 95.50  ? 95   PHE A CA    1 
ATOM   723   C  C     . PHE A 1  95   ? 93.732  59.971  -36.329 1.00 100.41 ? 95   PHE A C     1 
ATOM   724   O  O     . PHE A 1  95   ? 94.030  60.942  -37.010 1.00 101.33 ? 95   PHE A O     1 
ATOM   725   C  CB    . PHE A 1  95   ? 95.445  58.351  -37.248 1.00 96.68  ? 95   PHE A CB    1 
ATOM   726   C  CG    . PHE A 1  95   ? 96.573  57.448  -36.815 1.00 97.50  ? 95   PHE A CG    1 
ATOM   727   C  CD1   . PHE A 1  95   ? 97.605  57.932  -36.015 1.00 99.64  ? 95   PHE A CD1   1 
ATOM   728   C  CD2   . PHE A 1  95   ? 96.518  56.084  -37.049 1.00 100.69 ? 95   PHE A CD2   1 
ATOM   729   C  CE1   . PHE A 1  95   ? 98.583  57.078  -35.503 1.00 101.83 ? 95   PHE A CE1   1 
ATOM   730   C  CE2   . PHE A 1  95   ? 97.513  55.231  -36.550 1.00 101.11 ? 95   PHE A CE2   1 
ATOM   731   C  CZ    . PHE A 1  95   ? 98.546  55.738  -35.793 1.00 99.49  ? 95   PHE A CZ    1 
ATOM   732   N  N     . ILE A 1  96   ? 92.532  59.817  -35.761 1.00 97.14  ? 96   ILE A N     1 
ATOM   733   C  CA    . ILE A 1  96   ? 91.397  60.710  -35.998 1.00 98.72  ? 96   ILE A CA    1 
ATOM   734   C  C     . ILE A 1  96   ? 91.778  62.198  -35.921 1.00 102.74 ? 96   ILE A C     1 
ATOM   735   O  O     . ILE A 1  96   ? 91.396  62.970  -36.796 1.00 103.24 ? 96   ILE A O     1 
ATOM   736   C  CB    . ILE A 1  96   ? 90.206  60.347  -35.074 1.00 102.96 ? 96   ILE A CB    1 
ATOM   737   C  CG1   . ILE A 1  96   ? 88.864  60.717  -35.726 1.00 104.63 ? 96   ILE A CG1   1 
ATOM   738   C  CG2   . ILE A 1  96   ? 90.337  60.901  -33.629 1.00 105.31 ? 96   ILE A CG2   1 
ATOM   739   C  CD1   . ILE A 1  96   ? 88.080  59.544  -36.136 1.00 107.93 ? 96   ILE A CD1   1 
ATOM   740   N  N     . ALA A 1  97   ? 92.577  62.579  -34.924 1.00 99.00  ? 97   ALA A N     1 
ATOM   741   C  CA    . ALA A 1  97   ? 92.996  63.968  -34.775 1.00 100.14 ? 97   ALA A CA    1 
ATOM   742   C  C     . ALA A 1  97   ? 94.058  64.374  -35.794 1.00 99.75  ? 97   ALA A C     1 
ATOM   743   O  O     . ALA A 1  97   ? 93.945  65.471  -36.356 1.00 99.00  ? 97   ALA A O     1 
ATOM   744   C  CB    . ALA A 1  97   ? 93.498  64.208  -33.366 1.00 101.73 ? 97   ALA A CB    1 
ATOM   745   N  N     . LYS A 1  98   ? 95.100  63.495  -36.015 1.00 93.03  ? 98   LYS A N     1 
ATOM   746   C  CA    . LYS A 1  98   ? 96.181  63.759  -36.975 1.00 91.60  ? 98   LYS A CA    1 
ATOM   747   C  C     . LYS A 1  98   ? 95.630  63.826  -38.409 1.00 94.39  ? 98   LYS A C     1 
ATOM   748   O  O     . LYS A 1  98   ? 96.162  64.580  -39.221 1.00 95.70  ? 98   LYS A O     1 
ATOM   749   C  CB    . LYS A 1  98   ? 97.401  62.807  -36.832 1.00 91.51  ? 98   LYS A CB    1 
ATOM   750   C  CG    . LYS A 1  98   ? 98.722  63.462  -37.317 1.00 97.44  ? 98   LYS A CG    1 
ATOM   751   C  CD    . LYS A 1  98   ? 100.001 62.594  -37.236 1.00 104.87 ? 98   LYS A CD    1 
ATOM   752   C  CE    . LYS A 1  98   ? 101.232 63.378  -37.693 1.00 117.86 ? 98   LYS A CE    1 
ATOM   753   N  NZ    . LYS A 1  98   ? 102.514 62.594  -37.692 1.00 119.71 ? 98   LYS A NZ    1 
ATOM   754   N  N     . ILE A 1  99   ? 94.524  63.110  -38.694 1.00 88.53  ? 99   ILE A N     1 
ATOM   755   C  CA    . ILE A 1  99   ? 93.859  63.166  -39.990 1.00 88.63  ? 99   ILE A CA    1 
ATOM   756   C  C     . ILE A 1  99   ? 93.313  64.584  -40.109 1.00 94.55  ? 99   ILE A C     1 
ATOM   757   O  O     . ILE A 1  99   ? 93.639  65.263  -41.088 1.00 95.85  ? 99   ILE A O     1 
ATOM   758   C  CB    . ILE A 1  99   ? 92.754  62.086  -40.128 1.00 91.21  ? 99   ILE A CB    1 
ATOM   759   C  CG1   . ILE A 1  99   ? 93.361  60.683  -40.285 1.00 90.10  ? 99   ILE A CG1   1 
ATOM   760   C  CG2   . ILE A 1  99   ? 91.845  62.389  -41.311 1.00 93.65  ? 99   ILE A CG2   1 
ATOM   761   C  CD1   . ILE A 1  99   ? 92.523  59.555  -39.699 1.00 96.30  ? 99   ILE A CD1   1 
ATOM   762   N  N     . LYS A 1  100  ? 92.557  65.054  -39.068 1.00 90.65  ? 100  LYS A N     1 
ATOM   763   C  CA    . LYS A 1  100  ? 92.002  66.410  -38.995 1.00 91.87  ? 100  LYS A CA    1 
ATOM   764   C  C     . LYS A 1  100  ? 93.126  67.408  -39.217 1.00 95.92  ? 100  LYS A C     1 
ATOM   765   O  O     . LYS A 1  100  ? 93.032  68.176  -40.168 1.00 97.76  ? 100  LYS A O     1 
ATOM   766   C  CB    . LYS A 1  100  ? 91.308  66.675  -37.648 1.00 94.15  ? 100  LYS A CB    1 
ATOM   767   C  CG    . LYS A 1  100  ? 90.476  67.957  -37.619 1.00 100.00 ? 100  LYS A CG    1 
ATOM   768   C  CD    . LYS A 1  100  ? 90.679  68.751  -36.343 1.00 107.17 ? 100  LYS A CD    1 
ATOM   769   C  CE    . LYS A 1  100  ? 89.518  69.679  -36.099 1.00 120.46 ? 100  LYS A CE    1 
ATOM   770   N  NZ    . LYS A 1  100  ? 89.815  70.697  -35.052 1.00 134.92 ? 100  LYS A NZ    1 
ATOM   771   N  N     . LYS A 1  101  ? 94.228  67.329  -38.422 1.00 90.20  ? 101  LYS A N     1 
ATOM   772   C  CA    . LYS A 1  101  ? 95.389  68.224  -38.561 1.00 90.19  ? 101  LYS A CA    1 
ATOM   773   C  C     . LYS A 1  101  ? 96.045  68.181  -39.939 1.00 93.57  ? 101  LYS A C     1 
ATOM   774   O  O     . LYS A 1  101  ? 96.556  69.207  -40.373 1.00 94.66  ? 101  LYS A O     1 
ATOM   775   C  CB    . LYS A 1  101  ? 96.434  68.019  -37.459 1.00 90.90  ? 101  LYS A CB    1 
ATOM   776   C  CG    . LYS A 1  101  ? 95.992  68.608  -36.130 1.00 105.17 ? 101  LYS A CG    1 
ATOM   777   C  CD    . LYS A 1  101  ? 97.158  69.078  -35.274 1.00 112.82 ? 101  LYS A CD    1 
ATOM   778   C  CE    . LYS A 1  101  ? 96.689  69.517  -33.907 1.00 119.49 ? 101  LYS A CE    1 
ATOM   779   N  NZ    . LYS A 1  101  ? 97.802  70.045  -33.085 1.00 124.71 ? 101  LYS A NZ    1 
ATOM   780   N  N     . VAL A 1  102  ? 96.002  67.038  -40.644 1.00 89.07  ? 102  VAL A N     1 
ATOM   781   C  CA    . VAL A 1  102  ? 96.580  66.967  -41.987 1.00 90.24  ? 102  VAL A CA    1 
ATOM   782   C  C     . VAL A 1  102  ? 95.636  67.686  -42.988 1.00 99.84  ? 102  VAL A C     1 
ATOM   783   O  O     . VAL A 1  102  ? 96.110  68.415  -43.871 1.00 101.16 ? 102  VAL A O     1 
ATOM   784   C  CB    . VAL A 1  102  ? 97.015  65.528  -42.398 1.00 91.67  ? 102  VAL A CB    1 
ATOM   785   C  CG1   . VAL A 1  102  ? 97.351  65.436  -43.887 1.00 92.39  ? 102  VAL A CG1   1 
ATOM   786   C  CG2   . VAL A 1  102  ? 98.216  65.074  -41.567 1.00 89.83  ? 102  VAL A CG2   1 
ATOM   787   N  N     . CYS A 1  103  ? 94.308  67.560  -42.771 1.00 99.11  ? 103  CYS A N     1 
ATOM   788   C  CA    . CYS A 1  103  ? 93.264  68.220  -43.569 1.00 102.16 ? 103  CYS A CA    1 
ATOM   789   C  C     . CYS A 1  103  ? 93.356  69.723  -43.409 1.00 109.02 ? 103  CYS A C     1 
ATOM   790   O  O     . CYS A 1  103  ? 93.117  70.463  -44.358 1.00 110.89 ? 103  CYS A O     1 
ATOM   791   C  CB    . CYS A 1  103  ? 91.886  67.711  -43.168 1.00 102.84 ? 103  CYS A CB    1 
ATOM   792   S  SG    . CYS A 1  103  ? 91.554  66.009  -43.674 1.00 105.00 ? 103  CYS A SG    1 
ATOM   793   N  N     . GLU A 1  104  ? 93.733  70.161  -42.201 1.00 106.57 ? 104  GLU A N     1 
ATOM   794   C  CA    . GLU A 1  104  ? 93.925  71.556  -41.814 1.00 109.65 ? 104  GLU A CA    1 
ATOM   795   C  C     . GLU A 1  104  ? 95.218  72.154  -42.427 1.00 117.45 ? 104  GLU A C     1 
ATOM   796   O  O     . GLU A 1  104  ? 95.440  73.366  -42.326 1.00 119.54 ? 104  GLU A O     1 
ATOM   797   C  CB    . GLU A 1  104  ? 93.895  71.682  -40.270 1.00 110.26 ? 104  GLU A CB    1 
ATOM   798   C  CG    . GLU A 1  104  ? 92.511  71.389  -39.695 1.00 120.81 ? 104  GLU A CG    1 
ATOM   799   C  CD    . GLU A 1  104  ? 92.299  71.439  -38.191 1.00 139.42 ? 104  GLU A CD    1 
ATOM   800   O  OE1   . GLU A 1  104  ? 93.067  70.784  -37.446 1.00 102.39 ? 104  GLU A OE1   1 
ATOM   801   O  OE2   . GLU A 1  104  ? 91.296  72.063  -37.770 1.00 145.39 ? 104  GLU A OE2   1 
ATOM   802   N  N     . CYS A 1  105  ? 96.037  71.309  -43.100 1.00 114.34 ? 105  CYS A N     1 
ATOM   803   C  CA    . CYS A 1  105  ? 97.308  71.694  -43.715 1.00 115.75 ? 105  CYS A CA    1 
ATOM   804   C  C     . CYS A 1  105  ? 97.309  71.655  -45.219 1.00 123.31 ? 105  CYS A C     1 
ATOM   805   O  O     . CYS A 1  105  ? 97.952  72.490  -45.848 1.00 124.87 ? 105  CYS A O     1 
ATOM   806   C  CB    . CYS A 1  105  ? 98.444  70.852  -43.154 1.00 113.70 ? 105  CYS A CB    1 
ATOM   807   S  SG    . CYS A 1  105  ? 98.889  71.267  -41.454 1.00 117.36 ? 105  CYS A SG    1 
ATOM   808   N  N     . VAL A 1  106  ? 96.666  70.653  -45.796 1.00 121.35 ? 106  VAL A N     1 
ATOM   809   C  CA    . VAL A 1  106  ? 96.639  70.488  -47.238 1.00 123.89 ? 106  VAL A CA    1 
ATOM   810   C  C     . VAL A 1  106  ? 95.294  70.982  -47.822 1.00 132.06 ? 106  VAL A C     1 
ATOM   811   O  O     . VAL A 1  106  ? 94.271  70.946  -47.126 1.00 132.11 ? 106  VAL A O     1 
ATOM   812   C  CB    . VAL A 1  106  ? 97.025  69.015  -47.585 1.00 126.01 ? 106  VAL A CB    1 
ATOM   813   C  CG1   . VAL A 1  106  ? 96.003  68.311  -48.481 1.00 125.88 ? 106  VAL A CG1   1 
ATOM   814   C  CG2   . VAL A 1  106  ? 98.432  68.939  -48.172 1.00 126.54 ? 106  VAL A CG2   1 
ATOM   815   N  N     . CYS A 1  107  ? 95.317  71.493  -49.077 1.00 131.73 ? 107  CYS A N     1 
ATOM   816   C  CA    . CYS A 1  107  ? 94.119  71.946  -49.789 1.00 134.36 ? 107  CYS A CA    1 
ATOM   817   C  C     . CYS A 1  107  ? 93.210  70.743  -50.003 1.00 137.05 ? 107  CYS A C     1 
ATOM   818   O  O     . CYS A 1  107  ? 93.611  69.754  -50.628 1.00 135.62 ? 107  CYS A O     1 
ATOM   819   C  CB    . CYS A 1  107  ? 94.482  72.609  -51.113 1.00 137.78 ? 107  CYS A CB    1 
ATOM   820   S  SG    . CYS A 1  107  ? 93.142  72.603  -52.334 1.00 144.64 ? 107  CYS A SG    1 
ATOM   821   N  N     . MET A 1  108  ? 91.987  70.835  -49.494 1.00 133.90 ? 108  MET A N     1 
ATOM   822   C  CA    . MET A 1  108  ? 91.013  69.756  -49.565 1.00 132.97 ? 108  MET A CA    1 
ATOM   823   C  C     . MET A 1  108  ? 90.452  69.495  -50.973 1.00 138.06 ? 108  MET A C     1 
ATOM   824   O  O     . MET A 1  108  ? 89.387  68.890  -51.106 1.00 137.95 ? 108  MET A O     1 
ATOM   825   C  CB    . MET A 1  108  ? 89.892  70.011  -48.549 1.00 135.99 ? 108  MET A CB    1 
ATOM   826   C  CG    . MET A 1  108  ? 90.351  69.903  -47.108 1.00 137.90 ? 108  MET A CG    1 
ATOM   827   S  SD    . MET A 1  108  ? 91.087  68.291  -46.708 1.00 138.91 ? 108  MET A SD    1 
ATOM   828   C  CE    . MET A 1  108  ? 89.615  67.239  -46.714 1.00 135.22 ? 108  MET A CE    1 
ATOM   829   N  N     . HIS A 1  109  ? 91.186  69.892  -52.020 1.00 135.69 ? 109  HIS A N     1 
ATOM   830   C  CA    . HIS A 1  109  ? 90.726  69.696  -53.388 1.00 137.71 ? 109  HIS A CA    1 
ATOM   831   C  C     . HIS A 1  109  ? 91.812  69.213  -54.336 1.00 138.46 ? 109  HIS A C     1 
ATOM   832   O  O     . HIS A 1  109  ? 91.526  68.339  -55.157 1.00 137.92 ? 109  HIS A O     1 
ATOM   833   C  CB    . HIS A 1  109  ? 90.049  70.961  -53.919 1.00 143.17 ? 109  HIS A CB    1 
ATOM   834   C  CG    . HIS A 1  109  ? 89.480  70.790  -55.285 1.00 149.98 ? 109  HIS A CG    1 
ATOM   835   N  ND1   . HIS A 1  109  ? 90.212  71.112  -56.414 1.00 154.34 ? 109  HIS A ND1   1 
ATOM   836   C  CD2   . HIS A 1  109  ? 88.281  70.293  -55.665 1.00 153.29 ? 109  HIS A CD2   1 
ATOM   837   C  CE1   . HIS A 1  109  ? 89.429  70.824  -57.442 1.00 156.48 ? 109  HIS A CE1   1 
ATOM   838   N  NE2   . HIS A 1  109  ? 88.255  70.331  -57.041 1.00 156.27 ? 109  HIS A NE2   1 
ATOM   839   N  N     . CYS A 1  110  ? 93.032  69.797  -54.265 1.00 133.13 ? 110  CYS A N     1 
ATOM   840   C  CA    . CYS A 1  110  ? 94.146  69.380  -55.129 1.00 132.08 ? 110  CYS A CA    1 
ATOM   841   C  C     . CYS A 1  110  ? 95.273  68.637  -54.351 1.00 130.44 ? 110  CYS A C     1 
ATOM   842   O  O     . CYS A 1  110  ? 96.105  67.969  -54.971 1.00 129.01 ? 110  CYS A O     1 
ATOM   843   C  CB    . CYS A 1  110  ? 94.684  70.531  -55.987 1.00 135.61 ? 110  CYS A CB    1 
ATOM   844   S  SG    . CYS A 1  110  ? 95.511  71.858  -55.071 1.00 139.54 ? 110  CYS A SG    1 
ATOM   845   N  N     . GLY A 1  111  ? 95.225  68.693  -53.018 1.00 124.00 ? 111  GLY A N     1 
ATOM   846   C  CA    . GLY A 1  111  ? 96.171  68.008  -52.145 1.00 120.85 ? 111  GLY A CA    1 
ATOM   847   C  C     . GLY A 1  111  ? 97.532  68.663  -52.032 1.00 126.64 ? 111  GLY A C     1 
ATOM   848   O  O     . GLY A 1  111  ? 98.517  68.005  -51.673 1.00 125.28 ? 111  GLY A O     1 
ATOM   849   N  N     . LYS A 1  112  ? 97.609  69.959  -52.339 1.00 126.00 ? 112  LYS A N     1 
ATOM   850   C  CA    . LYS A 1  112  ? 98.870  70.685  -52.251 1.00 126.96 ? 112  LYS A CA    1 
ATOM   851   C  C     . LYS A 1  112  ? 98.911  71.413  -50.927 1.00 130.43 ? 112  LYS A C     1 
ATOM   852   O  O     . LYS A 1  112  ? 97.882  71.945  -50.505 1.00 130.83 ? 112  LYS A O     1 
ATOM   853   C  CB    . LYS A 1  112  ? 99.018  71.670  -53.428 1.00 133.50 ? 112  LYS A CB    1 
ATOM   854   C  CG    . LYS A 1  112  ? 100.461 72.126  -53.679 1.00 147.82 ? 112  LYS A CG    1 
ATOM   855   C  CD    . LYS A 1  112  ? 100.717 72.540  -55.126 1.00 156.84 ? 112  LYS A CD    1 
ATOM   856   C  CE    . LYS A 1  112  ? 102.162 72.920  -55.341 1.00 166.18 ? 112  LYS A CE    1 
ATOM   857   N  NZ    . LYS A 1  112  ? 102.506 73.027  -56.783 1.00 178.52 ? 112  LYS A NZ    1 
ATOM   858   N  N     . LEU A 1  113  ? 100.090 71.433  -50.268 1.00 126.06 ? 113  LEU A N     1 
ATOM   859   C  CA    . LEU A 1  113  ? 100.282 72.136  -49.000 1.00 125.72 ? 113  LEU A CA    1 
ATOM   860   C  C     . LEU A 1  113  ? 99.842  73.594  -49.124 1.00 133.63 ? 113  LEU A C     1 
ATOM   861   O  O     . LEU A 1  113  ? 100.326 74.314  -50.002 1.00 135.71 ? 113  LEU A O     1 
ATOM   862   C  CB    . LEU A 1  113  ? 101.742 72.074  -48.541 1.00 125.09 ? 113  LEU A CB    1 
ATOM   863   C  CG    . LEU A 1  113  ? 102.056 71.159  -47.364 1.00 126.73 ? 113  LEU A CG    1 
ATOM   864   C  CD1   . LEU A 1  113  ? 103.544 71.143  -47.099 1.00 127.01 ? 113  LEU A CD1   1 
ATOM   865   C  CD2   . LEU A 1  113  ? 101.315 71.580  -46.089 1.00 128.17 ? 113  LEU A CD2   1 
ATOM   866   N  N     . LEU A 1  114  ? 98.891  74.006  -48.263 1.00 130.78 ? 114  LEU A N     1 
ATOM   867   C  CA    . LEU A 1  114  ? 98.332  75.353  -48.228 1.00 134.28 ? 114  LEU A CA    1 
ATOM   868   C  C     . LEU A 1  114  ? 99.401  76.432  -48.189 1.00 141.28 ? 114  LEU A C     1 
ATOM   869   O  O     . LEU A 1  114  ? 99.175  77.526  -48.718 1.00 145.35 ? 114  LEU A O     1 
ATOM   870   C  CB    . LEU A 1  114  ? 97.334  75.503  -47.083 1.00 134.03 ? 114  LEU A CB    1 
ATOM   871   C  CG    . LEU A 1  114  ? 95.890  75.161  -47.454 1.00 139.85 ? 114  LEU A CG    1 
ATOM   872   C  CD1   . LEU A 1  114  ? 95.186  74.417  -46.333 1.00 137.93 ? 114  LEU A CD1   1 
ATOM   873   C  CD2   . LEU A 1  114  ? 95.113  76.408  -47.807 1.00 146.75 ? 114  LEU A CD2   1 
ATOM   874   N  N     . LEU A 1  115  ? 100.583 76.107  -47.618 1.00 135.65 ? 115  LEU A N     1 
ATOM   875   C  CA    . LEU A 1  115  ? 101.736 77.002  -47.598 1.00 137.45 ? 115  LEU A CA    1 
ATOM   876   C  C     . LEU A 1  115  ? 102.940 76.387  -48.316 1.00 142.22 ? 115  LEU A C     1 
ATOM   877   O  O     . LEU A 1  115  ? 103.167 75.175  -48.293 1.00 138.01 ? 115  LEU A O     1 
ATOM   878   C  CB    . LEU A 1  115  ? 102.085 77.540  -46.211 1.00 136.78 ? 115  LEU A CB    1 
ATOM   879   C  CG    . LEU A 1  115  ? 101.185 78.673  -45.738 1.00 142.97 ? 115  LEU A CG    1 
ATOM   880   C  CD1   . LEU A 1  115  ? 101.272 78.847  -44.264 1.00 141.78 ? 115  LEU A CD1   1 
ATOM   881   C  CD2   . LEU A 1  115  ? 101.508 79.973  -46.438 1.00 149.08 ? 115  LEU A CD2   1 
ATOM   882   N  N     . ASP A 1  116  ? 103.658 77.262  -49.012 1.00 144.18 ? 116  ASP A N     1 
ATOM   883   C  CA    . ASP A 1  116  ? 104.754 76.982  -49.917 1.00 145.69 ? 116  ASP A CA    1 
ATOM   884   C  C     . ASP A 1  116  ? 106.070 77.533  -49.417 1.00 152.37 ? 116  ASP A C     1 
ATOM   885   O  O     . ASP A 1  116  ? 106.107 78.249  -48.415 1.00 152.33 ? 116  ASP A O     1 
ATOM   886   C  CB    . ASP A 1  116  ? 104.419 77.689  -51.247 1.00 151.30 ? 116  ASP A CB    1 
ATOM   887   C  CG    . ASP A 1  116  ? 104.726 76.900  -52.497 1.00 163.64 ? 116  ASP A CG    1 
ATOM   888   O  OD1   . ASP A 1  116  ? 105.848 76.359  -52.596 1.00 164.51 ? 116  ASP A OD1   1 
ATOM   889   O  OD2   . ASP A 1  116  ? 103.871 76.880  -53.409 1.00 170.24 ? 116  ASP A OD2   1 
ATOM   890   N  N     . GLU A 1  117  ? 107.143 77.274  -50.202 1.00 151.31 ? 117  GLU A N     1 
ATOM   891   C  CA    . GLU A 1  117  ? 108.525 77.752  -50.018 1.00 153.18 ? 117  GLU A CA    1 
ATOM   892   C  C     . GLU A 1  117  ? 108.579 79.279  -50.195 1.00 159.47 ? 117  GLU A C     1 
ATOM   893   O  O     . GLU A 1  117  ? 109.599 79.908  -49.898 1.00 160.73 ? 117  GLU A O     1 
ATOM   894   C  CB    . GLU A 1  117  ? 109.462 77.100  -51.061 1.00 155.67 ? 117  GLU A CB    1 
ATOM   895   C  CG    . GLU A 1  117  ? 109.572 75.582  -50.991 1.00 165.80 ? 117  GLU A CG    1 
ATOM   896   C  CD    . GLU A 1  117  ? 108.940 74.832  -52.150 1.00 190.44 ? 117  GLU A CD    1 
ATOM   897   O  OE1   . GLU A 1  117  ? 109.360 75.047  -53.313 1.00 184.11 ? 117  GLU A OE1   1 
ATOM   898   O  OE2   . GLU A 1  117  ? 108.042 74.000  -51.886 1.00 185.13 ? 117  GLU A OE2   1 
ATOM   899   N  N     . HIS A 1  118  ? 107.484 79.859  -50.711 1.00 156.68 ? 118  HIS A N     1 
ATOM   900   C  CA    . HIS A 1  118  ? 107.343 81.286  -50.942 1.00 160.40 ? 118  HIS A CA    1 
ATOM   901   C  C     . HIS A 1  118  ? 107.163 82.055  -49.625 1.00 164.45 ? 118  HIS A C     1 
ATOM   902   O  O     . HIS A 1  118  ? 107.863 83.050  -49.422 1.00 167.59 ? 118  HIS A O     1 
ATOM   903   C  CB    . HIS A 1  118  ? 106.223 81.564  -51.956 1.00 162.76 ? 118  HIS A CB    1 
ATOM   904   C  CG    . HIS A 1  118  ? 106.452 80.913  -53.289 1.00 165.92 ? 118  HIS A CG    1 
ATOM   905   N  ND1   . HIS A 1  118  ? 107.441 81.354  -54.146 1.00 170.37 ? 118  HIS A ND1   1 
ATOM   906   C  CD2   . HIS A 1  118  ? 105.816 79.866  -53.862 1.00 165.11 ? 118  HIS A CD2   1 
ATOM   907   C  CE1   . HIS A 1  118  ? 107.373 80.570  -55.209 1.00 169.09 ? 118  HIS A CE1   1 
ATOM   908   N  NE2   . HIS A 1  118  ? 106.408 79.663  -55.086 1.00 166.33 ? 118  HIS A NE2   1 
ATOM   909   N  N     . ASN A 1  119  ? 106.276 81.572  -48.713 1.00 157.10 ? 119  ASN A N     1 
ATOM   910   C  CA    . ASN A 1  119  ? 106.049 82.195  -47.400 1.00 156.66 ? 119  ASN A CA    1 
ATOM   911   C  C     . ASN A 1  119  ? 107.311 82.040  -46.538 1.00 159.29 ? 119  ASN A C     1 
ATOM   912   O  O     . ASN A 1  119  ? 107.792 80.918  -46.362 1.00 155.88 ? 119  ASN A O     1 
ATOM   913   C  CB    . ASN A 1  119  ? 104.817 81.595  -46.713 1.00 152.99 ? 119  ASN A CB    1 
ATOM   914   C  CG    . ASN A 1  119  ? 104.377 82.323  -45.463 1.00 171.87 ? 119  ASN A CG    1 
ATOM   915   O  OD1   . ASN A 1  119  ? 105.060 82.315  -44.438 1.00 164.56 ? 119  ASN A OD1   1 
ATOM   916   N  ND2   . ASN A 1  119  ? 103.201 82.935  -45.503 1.00 165.20 ? 119  ASN A ND2   1 
ATOM   917   N  N     . GLU A 1  120  ? 107.863 83.172  -46.049 1.00 158.49 ? 120  GLU A N     1 
ATOM   918   C  CA    . GLU A 1  120  ? 109.104 83.229  -45.267 1.00 158.56 ? 120  GLU A CA    1 
ATOM   919   C  C     . GLU A 1  120  ? 109.041 82.506  -43.917 1.00 158.13 ? 120  GLU A C     1 
ATOM   920   O  O     . GLU A 1  120  ? 110.032 81.880  -43.528 1.00 157.14 ? 120  GLU A O     1 
ATOM   921   C  CB    . GLU A 1  120  ? 109.580 84.672  -45.088 1.00 164.90 ? 120  GLU A CB    1 
ATOM   922   C  CG    . GLU A 1  120  ? 111.014 84.878  -45.549 1.00 179.93 ? 120  GLU A CG    1 
ATOM   923   C  CD    . GLU A 1  120  ? 112.069 84.897  -44.459 1.00 204.54 ? 120  GLU A CD    1 
ATOM   924   O  OE1   . GLU A 1  120  ? 112.241 83.865  -43.768 1.00 191.15 ? 120  GLU A OE1   1 
ATOM   925   O  OE2   . GLU A 1  120  ? 112.759 85.935  -44.331 1.00 205.64 ? 120  GLU A OE2   1 
ATOM   926   N  N     . LEU A 1  121  ? 107.892 82.574  -43.210 1.00 151.65 ? 121  LEU A N     1 
ATOM   927   C  CA    . LEU A 1  121  ? 107.698 81.872  -41.930 1.00 147.61 ? 121  LEU A CA    1 
ATOM   928   C  C     . LEU A 1  121  ? 107.653 80.368  -42.198 1.00 145.63 ? 121  LEU A C     1 
ATOM   929   O  O     . LEU A 1  121  ? 108.098 79.576  -41.365 1.00 142.52 ? 121  LEU A O     1 
ATOM   930   C  CB    . LEU A 1  121  ? 106.388 82.296  -41.258 1.00 147.69 ? 121  LEU A CB    1 
ATOM   931   C  CG    . LEU A 1  121  ? 106.249 83.759  -40.883 1.00 156.55 ? 121  LEU A CG    1 
ATOM   932   C  CD1   . LEU A 1  121  ? 105.318 84.482  -41.850 1.00 159.19 ? 121  LEU A CD1   1 
ATOM   933   C  CD2   . LEU A 1  121  ? 105.730 83.894  -39.470 1.00 158.66 ? 121  LEU A CD2   1 
ATOM   934   N  N     . MET A 1  122  ? 107.111 79.995  -43.380 1.00 140.66 ? 122  MET A N     1 
ATOM   935   C  CA    . MET A 1  122  ? 106.990 78.631  -43.872 1.00 136.70 ? 122  MET A CA    1 
ATOM   936   C  C     . MET A 1  122  ? 108.366 78.018  -44.142 1.00 137.57 ? 122  MET A C     1 
ATOM   937   O  O     . MET A 1  122  ? 108.586 76.869  -43.744 1.00 134.74 ? 122  MET A O     1 
ATOM   938   C  CB    . MET A 1  122  ? 106.067 78.574  -45.102 1.00 139.73 ? 122  MET A CB    1 
ATOM   939   C  CG    . MET A 1  122  ? 105.718 77.171  -45.561 1.00 140.97 ? 122  MET A CG    1 
ATOM   940   S  SD    . MET A 1  122  ? 105.242 76.018  -44.242 1.00 142.19 ? 122  MET A SD    1 
ATOM   941   C  CE    . MET A 1  122  ? 104.625 74.664  -45.216 1.00 136.70 ? 122  MET A CE    1 
ATOM   942   N  N     . ARG A 1  123  ? 109.299 78.792  -44.764 1.00 134.11 ? 123  ARG A N     1 
ATOM   943   C  CA    . ARG A 1  123  ? 110.677 78.366  -45.050 1.00 132.89 ? 123  ARG A CA    1 
ATOM   944   C  C     . ARG A 1  123  ? 111.362 77.983  -43.756 1.00 133.94 ? 123  ARG A C     1 
ATOM   945   O  O     . ARG A 1  123  ? 112.074 76.976  -43.717 1.00 131.74 ? 123  ARG A O     1 
ATOM   946   C  CB    . ARG A 1  123  ? 111.489 79.496  -45.673 1.00 136.70 ? 123  ARG A CB    1 
ATOM   947   C  CG    . ARG A 1  123  ? 110.981 80.014  -46.989 1.00 149.78 ? 123  ARG A CG    1 
ATOM   948   C  CD    . ARG A 1  123  ? 111.958 81.030  -47.528 1.00 163.40 ? 123  ARG A CD    1 
ATOM   949   N  NE    . ARG A 1  123  ? 111.280 82.175  -48.118 1.00 174.66 ? 123  ARG A NE    1 
ATOM   950   C  CZ    . ARG A 1  123  ? 111.910 83.213  -48.649 1.00 201.33 ? 123  ARG A CZ    1 
ATOM   951   N  NH1   . ARG A 1  123  ? 113.237 83.254  -48.665 1.00 193.33 ? 123  ARG A NH1   1 
ATOM   952   N  NH2   . ARG A 1  123  ? 111.222 84.221  -49.166 1.00 197.35 ? 123  ARG A NH2   1 
ATOM   953   N  N     . GLN A 1  124  ? 111.134 78.804  -42.696 1.00 130.93 ? 124  GLN A N     1 
ATOM   954   C  CA    . GLN A 1  124  ? 111.664 78.655  -41.335 1.00 129.95 ? 124  GLN A CA    1 
ATOM   955   C  C     . GLN A 1  124  ? 111.129 77.403  -40.640 1.00 128.10 ? 124  GLN A C     1 
ATOM   956   O  O     . GLN A 1  124  ? 111.890 76.696  -39.973 1.00 125.80 ? 124  GLN A O     1 
ATOM   957   C  CB    . GLN A 1  124  ? 111.378 79.916  -40.494 1.00 134.08 ? 124  GLN A CB    1 
ATOM   958   C  CG    . GLN A 1  124  ? 112.384 81.053  -40.709 1.00 159.25 ? 124  GLN A CG    1 
ATOM   959   C  CD    . GLN A 1  124  ? 113.660 80.882  -39.908 1.00 180.32 ? 124  GLN A CD    1 
ATOM   960   O  OE1   . GLN A 1  124  ? 113.787 81.377  -38.783 1.00 179.34 ? 124  GLN A OE1   1 
ATOM   961   N  NE2   . GLN A 1  124  ? 114.648 80.203  -40.480 1.00 167.99 ? 124  GLN A NE2   1 
ATOM   962   N  N     . ALA A 1  125  ? 109.818 77.140  -40.797 1.00 122.33 ? 125  ALA A N     1 
ATOM   963   C  CA    . ALA A 1  125  ? 109.140 75.967  -40.254 1.00 118.10 ? 125  ALA A CA    1 
ATOM   964   C  C     . ALA A 1  125  ? 109.686 74.700  -40.946 1.00 119.18 ? 125  ALA A C     1 
ATOM   965   O  O     . ALA A 1  125  ? 109.976 73.713  -40.274 1.00 116.03 ? 125  ALA A O     1 
ATOM   966   C  CB    . ALA A 1  125  ? 107.637 76.094  -40.473 1.00 117.90 ? 125  ALA A CB    1 
ATOM   967   N  N     . LEU A 1  126  ? 109.879 74.761  -42.283 1.00 116.68 ? 126  LEU A N     1 
ATOM   968   C  CA    . LEU A 1  126  ? 110.412 73.666  -43.099 1.00 115.09 ? 126  LEU A CA    1 
ATOM   969   C  C     . LEU A 1  126  ? 111.865 73.338  -42.781 1.00 121.67 ? 126  LEU A C     1 
ATOM   970   O  O     . LEU A 1  126  ? 112.294 72.198  -42.982 1.00 120.13 ? 126  LEU A O     1 
ATOM   971   C  CB    . LEU A 1  126  ? 110.245 73.982  -44.578 1.00 116.27 ? 126  LEU A CB    1 
ATOM   972   C  CG    . LEU A 1  126  ? 108.844 73.767  -45.096 1.00 118.82 ? 126  LEU A CG    1 
ATOM   973   C  CD1   . LEU A 1  126  ? 108.540 74.717  -46.197 1.00 121.77 ? 126  LEU A CD1   1 
ATOM   974   C  CD2   . LEU A 1  126  ? 108.657 72.351  -45.574 1.00 118.46 ? 126  LEU A CD2   1 
ATOM   975   N  N     . ALA A 1  127  ? 112.602 74.329  -42.243 1.00 121.50 ? 127  ALA A N     1 
ATOM   976   C  CA    . ALA A 1  127  ? 113.999 74.230  -41.811 1.00 122.97 ? 127  ALA A CA    1 
ATOM   977   C  C     . ALA A 1  127  ? 114.195 73.394  -40.517 1.00 124.10 ? 127  ALA A C     1 
ATOM   978   O  O     . ALA A 1  127  ? 115.335 73.040  -40.178 1.00 123.76 ? 127  ALA A O     1 
ATOM   979   C  CB    . ALA A 1  127  ? 114.567 75.624  -41.616 1.00 127.57 ? 127  ALA A CB    1 
ATOM   980   N  N     . ILE A 1  128  ? 113.084 73.108  -39.792 1.00 118.13 ? 128  ILE A N     1 
ATOM   981   C  CA    . ILE A 1  128  ? 113.089 72.316  -38.562 1.00 115.30 ? 128  ILE A CA    1 
ATOM   982   C  C     . ILE A 1  128  ? 113.515 70.910  -38.919 1.00 118.53 ? 128  ILE A C     1 
ATOM   983   O  O     . ILE A 1  128  ? 112.962 70.315  -39.851 1.00 115.92 ? 128  ILE A O     1 
ATOM   984   C  CB    . ILE A 1  128  ? 111.729 72.348  -37.810 1.00 115.63 ? 128  ILE A CB    1 
ATOM   985   C  CG1   . ILE A 1  128  ? 111.390 73.774  -37.352 1.00 117.53 ? 128  ILE A CG1   1 
ATOM   986   C  CG2   . ILE A 1  128  ? 111.734 71.379  -36.614 1.00 114.21 ? 128  ILE A CG2   1 
ATOM   987   C  CD1   . ILE A 1  128  ? 109.984 74.003  -37.089 1.00 117.06 ? 128  ILE A CD1   1 
ATOM   988   N  N     . LYS A 1  129  ? 114.540 70.414  -38.198 1.00 117.07 ? 129  LYS A N     1 
ATOM   989   C  CA    . LYS A 1  129  ? 115.133 69.086  -38.358 1.00 115.85 ? 129  LYS A CA    1 
ATOM   990   C  C     . LYS A 1  129  ? 114.209 68.020  -37.781 1.00 117.57 ? 129  LYS A C     1 
ATOM   991   O  O     . LYS A 1  129  ? 113.956 67.011  -38.448 1.00 115.16 ? 129  LYS A O     1 
ATOM   992   C  CB    . LYS A 1  129  ? 116.524 69.033  -37.695 1.00 120.10 ? 129  LYS A CB    1 
ATOM   993   C  CG    . LYS A 1  129  ? 117.468 70.178  -38.088 1.00 136.79 ? 129  LYS A CG    1 
ATOM   994   C  CD    . LYS A 1  129  ? 118.002 70.049  -39.515 1.00 149.90 ? 129  LYS A CD    1 
ATOM   995   C  CE    . LYS A 1  129  ? 118.611 71.337  -40.000 1.00 170.12 ? 129  LYS A CE    1 
ATOM   996   N  NZ    . LYS A 1  129  ? 119.257 71.173  -41.329 1.00 184.47 ? 129  LYS A NZ    1 
ATOM   997   N  N     . ASP A 1  130  ? 113.668 68.281  -36.563 1.00 114.91 ? 130  ASP A N     1 
ATOM   998   C  CA    . ASP A 1  130  ? 112.760 67.403  -35.812 1.00 112.92 ? 130  ASP A CA    1 
ATOM   999   C  C     . ASP A 1  130  ? 111.410 67.179  -36.512 1.00 112.23 ? 130  ASP A C     1 
ATOM   1000  O  O     . ASP A 1  130  ? 110.625 68.118  -36.654 1.00 112.15 ? 130  ASP A O     1 
ATOM   1001  C  CB    . ASP A 1  130  ? 112.564 67.935  -34.371 1.00 116.76 ? 130  ASP A CB    1 
ATOM   1002  C  CG    . ASP A 1  130  ? 111.953 66.940  -33.379 1.00 133.63 ? 130  ASP A CG    1 
ATOM   1003  O  OD1   . ASP A 1  130  ? 110.738 66.616  -33.521 1.00 131.83 ? 130  ASP A OD1   1 
ATOM   1004  O  OD2   . ASP A 1  130  ? 112.661 66.553  -32.408 1.00 144.25 ? 130  ASP A OD2   1 
ATOM   1005  N  N     . SER A 1  131  ? 111.133 65.918  -36.892 1.00 105.11 ? 131  SER A N     1 
ATOM   1006  C  CA    . SER A 1  131  ? 109.913 65.499  -37.579 1.00 102.96 ? 131  SER A CA    1 
ATOM   1007  C  C     . SER A 1  131  ? 108.590 65.927  -36.913 1.00 104.40 ? 131  SER A C     1 
ATOM   1008  O  O     . SER A 1  131  ? 107.637 66.241  -37.625 1.00 103.71 ? 131  SER A O     1 
ATOM   1009  C  CB    . SER A 1  131  ? 109.915 63.991  -37.811 1.00 106.43 ? 131  SER A CB    1 
ATOM   1010  O  OG    . SER A 1  131  ? 110.025 63.238  -36.612 1.00 117.30 ? 131  SER A OG    1 
ATOM   1011  N  N     . LYS A 1  132  ? 108.516 65.935  -35.573 1.00 99.80  ? 132  LYS A N     1 
ATOM   1012  C  CA    . LYS A 1  132  ? 107.268 66.295  -34.874 1.00 98.29  ? 132  LYS A CA    1 
ATOM   1013  C  C     . LYS A 1  132  ? 107.118 67.787  -34.690 1.00 100.58 ? 132  LYS A C     1 
ATOM   1014  O  O     . LYS A 1  132  ? 106.000 68.298  -34.748 1.00 99.50  ? 132  LYS A O     1 
ATOM   1015  C  CB    . LYS A 1  132  ? 107.130 65.567  -33.519 1.00 100.34 ? 132  LYS A CB    1 
ATOM   1016  C  CG    . LYS A 1  132  ? 106.875 64.054  -33.620 1.00 110.71 ? 132  LYS A CG    1 
ATOM   1017  C  CD    . LYS A 1  132  ? 108.151 63.228  -33.369 1.00 116.75 ? 132  LYS A CD    1 
ATOM   1018  C  CE    . LYS A 1  132  ? 107.912 61.738  -33.343 1.00 118.81 ? 132  LYS A CE    1 
ATOM   1019  N  NZ    . LYS A 1  132  ? 107.283 61.297  -32.067 1.00 126.94 ? 132  LYS A NZ    1 
ATOM   1020  N  N     . LYS A 1  133  ? 108.246 68.475  -34.441 1.00 97.11  ? 133  LYS A N     1 
ATOM   1021  C  CA    . LYS A 1  133  ? 108.295 69.915  -34.236 1.00 98.76  ? 133  LYS A CA    1 
ATOM   1022  C  C     . LYS A 1  133  ? 108.071 70.646  -35.557 1.00 104.66 ? 133  LYS A C     1 
ATOM   1023  O  O     . LYS A 1  133  ? 107.451 71.724  -35.566 1.00 106.33 ? 133  LYS A O     1 
ATOM   1024  C  CB    . LYS A 1  133  ? 109.608 70.319  -33.559 1.00 102.15 ? 133  LYS A CB    1 
ATOM   1025  C  CG    . LYS A 1  133  ? 109.604 69.998  -32.072 1.00 112.17 ? 133  LYS A CG    1 
ATOM   1026  C  CD    . LYS A 1  133  ? 110.999 69.848  -31.490 1.00 127.09 ? 133  LYS A CD    1 
ATOM   1027  C  CE    . LYS A 1  133  ? 111.015 68.890  -30.316 1.00 141.54 ? 133  LYS A CE    1 
ATOM   1028  N  NZ    . LYS A 1  133  ? 112.380 68.348  -30.051 1.00 156.14 ? 133  LYS A NZ    1 
ATOM   1029  N  N     . ARG A 1  134  ? 108.534 70.030  -36.677 1.00 99.78  ? 134  ARG A N     1 
ATOM   1030  C  CA    . ARG A 1  134  ? 108.358 70.548  -38.032 1.00 100.14 ? 134  ARG A CA    1 
ATOM   1031  C  C     . ARG A 1  134  ? 106.904 70.454  -38.388 1.00 103.38 ? 134  ARG A C     1 
ATOM   1032  O  O     . ARG A 1  134  ? 106.389 71.391  -38.986 1.00 104.81 ? 134  ARG A O     1 
ATOM   1033  C  CB    . ARG A 1  134  ? 109.173 69.745  -39.039 1.00 99.37  ? 134  ARG A CB    1 
ATOM   1034  C  CG    . ARG A 1  134  ? 109.326 70.404  -40.404 1.00 110.86 ? 134  ARG A CG    1 
ATOM   1035  C  CD    . ARG A 1  134  ? 109.764 69.430  -41.490 1.00 119.78 ? 134  ARG A CD    1 
ATOM   1036  N  NE    . ARG A 1  134  ? 110.786 68.481  -41.038 1.00 128.72 ? 134  ARG A NE    1 
ATOM   1037  C  CZ    . ARG A 1  134  ? 110.584 67.173  -40.895 1.00 135.19 ? 134  ARG A CZ    1 
ATOM   1038  N  NH1   . ARG A 1  134  ? 109.402 66.643  -41.184 1.00 113.90 ? 134  ARG A NH1   1 
ATOM   1039  N  NH2   . ARG A 1  134  ? 111.566 66.386  -40.465 1.00 118.82 ? 134  ARG A NH2   1 
ATOM   1040  N  N     . PHE A 1  135  ? 106.229 69.338  -38.011 1.00 98.20  ? 135  PHE A N     1 
ATOM   1041  C  CA    . PHE A 1  135  ? 104.801 69.169  -38.276 1.00 97.58  ? 135  PHE A CA    1 
ATOM   1042  C  C     . PHE A 1  135  ? 104.012 70.257  -37.523 1.00 101.99 ? 135  PHE A C     1 
ATOM   1043  O  O     . PHE A 1  135  ? 103.189 70.954  -38.121 1.00 101.77 ? 135  PHE A O     1 
ATOM   1044  C  CB    . PHE A 1  135  ? 104.307 67.748  -37.920 1.00 97.40  ? 135  PHE A CB    1 
ATOM   1045  C  CG    . PHE A 1  135  ? 102.852 67.513  -38.283 1.00 99.38  ? 135  PHE A CG    1 
ATOM   1046  C  CD1   . PHE A 1  135  ? 101.821 67.988  -37.466 1.00 102.21 ? 135  PHE A CD1   1 
ATOM   1047  C  CD2   . PHE A 1  135  ? 102.509 66.859  -39.457 1.00 102.88 ? 135  PHE A CD2   1 
ATOM   1048  C  CE1   . PHE A 1  135  ? 100.475 67.815  -37.823 1.00 104.49 ? 135  PHE A CE1   1 
ATOM   1049  C  CE2   . PHE A 1  135  ? 101.156 66.671  -39.802 1.00 103.69 ? 135  PHE A CE2   1 
ATOM   1050  C  CZ    . PHE A 1  135  ? 100.151 67.139  -38.975 1.00 102.12 ? 135  PHE A CZ    1 
ATOM   1051  N  N     . ALA A 1  136  ? 104.304 70.414  -36.225 1.00 99.50  ? 136  ALA A N     1 
ATOM   1052  C  CA    . ALA A 1  136  ? 103.674 71.391  -35.346 1.00 101.27 ? 136  ALA A CA    1 
ATOM   1053  C  C     . ALA A 1  136  ? 103.736 72.795  -35.937 1.00 108.23 ? 136  ALA A C     1 
ATOM   1054  O  O     . ALA A 1  136  ? 102.689 73.426  -36.082 1.00 109.58 ? 136  ALA A O     1 
ATOM   1055  C  CB    . ALA A 1  136  ? 104.334 71.363  -33.972 1.00 102.60 ? 136  ALA A CB    1 
ATOM   1056  N  N     . ALA A 1  137  ? 104.937 73.263  -36.326 1.00 105.35 ? 137  ALA A N     1 
ATOM   1057  C  CA    . ALA A 1  137  ? 105.098 74.598  -36.889 1.00 107.85 ? 137  ALA A CA    1 
ATOM   1058  C  C     . ALA A 1  137  ? 104.346 74.774  -38.187 1.00 111.06 ? 137  ALA A C     1 
ATOM   1059  O  O     . ALA A 1  137  ? 103.703 75.805  -38.357 1.00 112.35 ? 137  ALA A O     1 
ATOM   1060  C  CB    . ALA A 1  137  ? 106.558 74.916  -37.080 1.00 110.30 ? 137  ALA A CB    1 
ATOM   1061  N  N     . ILE A 1  138  ? 104.368 73.753  -39.068 1.00 106.28 ? 138  ILE A N     1 
ATOM   1062  C  CA    . ILE A 1  138  ? 103.658 73.770  -40.355 1.00 107.04 ? 138  ILE A CA    1 
ATOM   1063  C  C     . ILE A 1  138  ? 102.143 73.789  -40.135 1.00 112.41 ? 138  ILE A C     1 
ATOM   1064  O  O     . ILE A 1  138  ? 101.437 74.450  -40.896 1.00 114.06 ? 138  ILE A O     1 
ATOM   1065  C  CB    . ILE A 1  138  ? 104.133 72.649  -41.336 1.00 108.36 ? 138  ILE A CB    1 
ATOM   1066  C  CG1   . ILE A 1  138  ? 105.532 72.985  -41.893 1.00 110.74 ? 138  ILE A CG1   1 
ATOM   1067  C  CG2   . ILE A 1  138  ? 103.135 72.404  -42.500 1.00 108.28 ? 138  ILE A CG2   1 
ATOM   1068  C  CD1   . ILE A 1  138  ? 106.305 71.797  -42.461 1.00 117.98 ? 138  ILE A CD1   1 
ATOM   1069  N  N     . TRP A 1  139  ? 101.647 73.115  -39.086 1.00 108.26 ? 139  TRP A N     1 
ATOM   1070  C  CA    . TRP A 1  139  ? 100.213 73.131  -38.821 1.00 108.82 ? 139  TRP A CA    1 
ATOM   1071  C  C     . TRP A 1  139  ? 99.740  74.498  -38.377 1.00 114.84 ? 139  TRP A C     1 
ATOM   1072  O  O     . TRP A 1  139  ? 98.860  75.064  -39.024 1.00 116.41 ? 139  TRP A O     1 
ATOM   1073  C  CB    . TRP A 1  139  ? 99.778  72.031  -37.850 1.00 106.03 ? 139  TRP A CB    1 
ATOM   1074  C  CG    . TRP A 1  139  ? 98.326  72.112  -37.477 1.00 107.99 ? 139  TRP A CG    1 
ATOM   1075  C  CD1   . TRP A 1  139  ? 97.254  71.892  -38.293 1.00 111.13 ? 139  TRP A CD1   1 
ATOM   1076  C  CD2   . TRP A 1  139  ? 97.792  72.494  -36.205 1.00 108.82 ? 139  TRP A CD2   1 
ATOM   1077  N  NE1   . TRP A 1  139  ? 96.083  72.097  -37.603 1.00 111.62 ? 139  TRP A NE1   1 
ATOM   1078  C  CE2   . TRP A 1  139  ? 96.383  72.447  -36.311 1.00 113.58 ? 139  TRP A CE2   1 
ATOM   1079  C  CE3   . TRP A 1  139  ? 98.366  72.831  -34.970 1.00 110.81 ? 139  TRP A CE3   1 
ATOM   1080  C  CZ2   . TRP A 1  139  ? 95.541  72.721  -35.226 1.00 114.03 ? 139  TRP A CZ2   1 
ATOM   1081  C  CZ3   . TRP A 1  139  ? 97.531  73.124  -33.905 1.00 113.57 ? 139  TRP A CZ3   1 
ATOM   1082  C  CH2   . TRP A 1  139  ? 96.136  73.062  -34.036 1.00 114.72 ? 139  TRP A CH2   1 
ATOM   1083  N  N     . THR A 1  140  ? 100.371 75.057  -37.331 1.00 111.76 ? 140  THR A N     1 
ATOM   1084  C  CA    . THR A 1  140  ? 100.065 76.379  -36.791 1.00 114.72 ? 140  THR A CA    1 
ATOM   1085  C  C     . THR A 1  140  ? 100.000 77.412  -37.917 1.00 123.03 ? 140  THR A C     1 
ATOM   1086  O  O     . THR A 1  140  ? 99.161  78.316  -37.883 1.00 125.81 ? 140  THR A O     1 
ATOM   1087  C  CB    . THR A 1  140  ? 101.094 76.749  -35.735 1.00 120.68 ? 140  THR A CB    1 
ATOM   1088  O  OG1   . THR A 1  140  ? 101.289 75.624  -34.885 1.00 118.08 ? 140  THR A OG1   1 
ATOM   1089  C  CG2   . THR A 1  140  ? 100.672 77.941  -34.902 1.00 121.92 ? 140  THR A CG2   1 
ATOM   1090  N  N     . LEU A 1  141  ? 100.847 77.231  -38.940 1.00 119.65 ? 141  LEU A N     1 
ATOM   1091  C  CA    . LEU A 1  141  ? 100.910 78.108  -40.097 1.00 122.42 ? 141  LEU A CA    1 
ATOM   1092  C  C     . LEU A 1  141  ? 99.779  77.933  -41.106 1.00 127.19 ? 141  LEU A C     1 
ATOM   1093  O  O     . LEU A 1  141  ? 99.222  78.937  -41.545 1.00 130.01 ? 141  LEU A O     1 
ATOM   1094  C  CB    . LEU A 1  141  ? 102.267 77.969  -40.798 1.00 122.59 ? 141  LEU A CB    1 
ATOM   1095  C  CG    . LEU A 1  141  ? 103.366 78.907  -40.321 1.00 129.57 ? 141  LEU A CG    1 
ATOM   1096  C  CD1   . LEU A 1  141  ? 104.694 78.529  -40.924 1.00 129.88 ? 141  LEU A CD1   1 
ATOM   1097  C  CD2   . LEU A 1  141  ? 103.060 80.348  -40.681 1.00 136.90 ? 141  LEU A CD2   1 
ATOM   1098  N  N     . CYS A 1  142  ? 99.468  76.685  -41.499 1.00 121.33 ? 142  CYS A N     1 
ATOM   1099  C  CA    . CYS A 1  142  ? 98.485  76.366  -42.537 1.00 121.86 ? 142  CYS A CA    1 
ATOM   1100  C  C     . CYS A 1  142  ? 97.055  76.322  -42.066 1.00 124.56 ? 142  CYS A C     1 
ATOM   1101  O  O     . CYS A 1  142  ? 96.144  76.396  -42.902 1.00 125.11 ? 142  CYS A O     1 
ATOM   1102  C  CB    . CYS A 1  142  ? 98.859  75.075  -43.246 1.00 120.60 ? 142  CYS A CB    1 
ATOM   1103  S  SG    . CYS A 1  142  ? 100.471 75.129  -44.060 1.00 125.88 ? 142  CYS A SG    1 
ATOM   1104  N  N     . LYS A 1  143  ? 96.838  76.185  -40.749 1.00 119.59 ? 143  LYS A N     1 
ATOM   1105  C  CA    . LYS A 1  143  ? 95.478  76.169  -40.210 1.00 119.59 ? 143  LYS A CA    1 
ATOM   1106  C  C     . LYS A 1  143  ? 94.759  77.502  -40.523 1.00 129.09 ? 143  LYS A C     1 
ATOM   1107  O  O     . LYS A 1  143  ? 93.596  77.495  -40.921 1.00 129.28 ? 143  LYS A O     1 
ATOM   1108  C  CB    . LYS A 1  143  ? 95.452  75.780  -38.716 1.00 119.14 ? 143  LYS A CB    1 
ATOM   1109  C  CG    . LYS A 1  143  ? 96.279  76.642  -37.762 1.00 117.96 ? 143  LYS A CG    1 
ATOM   1110  C  CD    . LYS A 1  143  ? 96.209  76.062  -36.360 1.00 116.27 ? 143  LYS A CD    1 
ATOM   1111  C  CE    . LYS A 1  143  ? 96.679  76.989  -35.275 1.00 115.01 ? 143  LYS A CE    1 
ATOM   1112  N  NZ    . LYS A 1  143  ? 96.290  76.473  -33.941 1.00 113.26 ? 143  LYS A NZ    1 
ATOM   1113  N  N     . THR A 1  144  ? 95.518  78.616  -40.451 1.00 129.76 ? 144  THR A N     1 
ATOM   1114  C  CA    . THR A 1  144  ? 95.136  79.999  -40.738 1.00 134.51 ? 144  THR A CA    1 
ATOM   1115  C  C     . THR A 1  144  ? 94.732  80.144  -42.220 1.00 140.85 ? 144  THR A C     1 
ATOM   1116  O  O     . THR A 1  144  ? 93.677  80.724  -42.494 1.00 143.61 ? 144  THR A O     1 
ATOM   1117  C  CB    . THR A 1  144  ? 96.327  80.948  -40.406 1.00 149.24 ? 144  THR A CB    1 
ATOM   1118  O  OG1   . THR A 1  144  ? 97.022  80.520  -39.225 1.00 148.08 ? 144  THR A OG1   1 
ATOM   1119  C  CG2   . THR A 1  144  ? 95.910  82.421  -40.291 1.00 154.23 ? 144  THR A CG2   1 
ATOM   1120  N  N     . LYS A 1  145  ? 95.582  79.641  -43.166 1.00 136.33 ? 145  LYS A N     1 
ATOM   1121  C  CA    . LYS A 1  145  ? 95.364  79.709  -44.622 1.00 137.67 ? 145  LYS A CA    1 
ATOM   1122  C  C     . LYS A 1  145  ? 94.058  79.038  -44.993 1.00 142.27 ? 145  LYS A C     1 
ATOM   1123  O  O     . LYS A 1  145  ? 93.895  77.829  -44.777 1.00 139.04 ? 145  LYS A O     1 
ATOM   1124  C  CB    . LYS A 1  145  ? 96.529  79.080  -45.414 1.00 137.55 ? 145  LYS A CB    1 
ATOM   1125  C  CG    . LYS A 1  145  ? 97.620  80.058  -45.828 1.00 144.68 ? 145  LYS A CG    1 
ATOM   1126  C  CD    . LYS A 1  145  ? 97.462  80.548  -47.260 1.00 151.29 ? 145  LYS A CD    1 
ATOM   1127  C  CE    . LYS A 1  145  ? 97.343  82.049  -47.279 1.00 165.26 ? 145  LYS A CE    1 
ATOM   1128  N  NZ    . LYS A 1  145  ? 96.037  82.507  -46.722 1.00 176.56 ? 145  LYS A NZ    1 
ATOM   1129  N  N     . MET A 1  146  ? 93.112  79.841  -45.500 1.00 142.12 ? 146  MET A N     1 
ATOM   1130  C  CA    . MET A 1  146  ? 91.799  79.352  -45.876 1.00 142.11 ? 146  MET A CA    1 
ATOM   1131  C  C     . MET A 1  146  ? 91.577  79.334  -47.374 1.00 147.88 ? 146  MET A C     1 
ATOM   1132  O  O     . MET A 1  146  ? 90.438  79.241  -47.830 1.00 149.37 ? 146  MET A O     1 
ATOM   1133  C  CB    . MET A 1  146  ? 90.716  80.141  -45.148 1.00 147.29 ? 146  MET A CB    1 
ATOM   1134  C  CG    . MET A 1  146  ? 89.886  79.278  -44.249 1.00 148.74 ? 146  MET A CG    1 
ATOM   1135  S  SD    . MET A 1  146  ? 90.835  78.676  -42.842 1.00 149.07 ? 146  MET A SD    1 
ATOM   1136  C  CE    . MET A 1  146  ? 90.452  79.922  -41.627 1.00 149.03 ? 146  MET A CE    1 
ATOM   1137  N  N     . VAL A 1  147  ? 92.665  79.407  -48.144 1.00 144.46 ? 147  VAL A N     1 
ATOM   1138  C  CA    . VAL A 1  147  ? 92.593  79.365  -49.597 1.00 146.21 ? 147  VAL A CA    1 
ATOM   1139  C  C     . VAL A 1  147  ? 93.900  78.822  -50.214 1.00 150.02 ? 147  VAL A C     1 
ATOM   1140  O  O     . VAL A 1  147  ? 95.015  79.203  -49.823 1.00 149.35 ? 147  VAL A O     1 
ATOM   1141  C  CB    . VAL A 1  147  ? 92.128  80.708  -50.213 1.00 154.91 ? 147  VAL A CB    1 
ATOM   1142  C  CG1   . VAL A 1  147  ? 93.095  81.851  -49.911 1.00 156.77 ? 147  VAL A CG1   1 
ATOM   1143  C  CG2   . VAL A 1  147  ? 91.849  80.574  -51.705 1.00 156.90 ? 147  VAL A CG2   1 
ATOM   1144  N  N     . CYS A 1  148  ? 93.728  77.877  -51.151 1.00 146.42 ? 148  CYS A N     1 
ATOM   1145  C  CA    . CYS A 1  148  ? 94.789  77.239  -51.917 1.00 145.25 ? 148  CYS A CA    1 
ATOM   1146  C  C     . CYS A 1  148  ? 95.170  78.289  -52.960 1.00 156.62 ? 148  CYS A C     1 
ATOM   1147  O  O     . CYS A 1  148  ? 94.468  78.449  -53.958 1.00 159.17 ? 148  CYS A O     1 
ATOM   1148  C  CB    . CYS A 1  148  ? 94.250  75.962  -52.556 1.00 142.91 ? 148  CYS A CB    1 
ATOM   1149  S  SG    . CYS A 1  148  ? 95.396  75.143  -53.685 1.00 145.96 ? 148  CYS A SG    1 
ATOM   1150  N  N     . GLU A 1  149  ? 96.205  79.093  -52.667 1.00 156.16 ? 149  GLU A N     1 
ATOM   1151  C  CA    . GLU A 1  149  ? 96.605  80.193  -53.546 1.00 161.03 ? 149  GLU A CA    1 
ATOM   1152  C  C     . GLU A 1  149  ? 97.126  79.761  -54.898 1.00 166.14 ? 149  GLU A C     1 
ATOM   1153  O  O     . GLU A 1  149  ? 97.910  78.824  -54.997 1.00 162.53 ? 149  GLU A O     1 
ATOM   1154  C  CB    . GLU A 1  149  ? 97.617  81.120  -52.862 1.00 163.97 ? 149  GLU A CB    1 
ATOM   1155  C  CG    . GLU A 1  149  ? 97.080  82.522  -52.612 1.00 181.15 ? 149  GLU A CG    1 
ATOM   1156  C  CD    . GLU A 1  149  ? 96.308  82.731  -51.322 1.00 202.97 ? 149  GLU A CD    1 
ATOM   1157  O  OE1   . GLU A 1  149  ? 96.430  81.889  -50.401 1.00 199.33 ? 149  GLU A OE1   1 
ATOM   1158  O  OE2   . GLU A 1  149  ? 95.603  83.762  -51.222 1.00 197.48 ? 149  GLU A OE2   1 
ATOM   1159  N  N     . THR A 1  150  ? 96.685  80.458  -55.935 1.00 167.95 ? 150  THR A N     1 
ATOM   1160  C  CA    . THR A 1  150  ? 97.140  80.235  -57.298 1.00 170.49 ? 150  THR A CA    1 
ATOM   1161  C  C     . THR A 1  150  ? 98.436  81.013  -57.509 1.00 179.13 ? 150  THR A C     1 
ATOM   1162  O  O     . THR A 1  150  ? 99.323  80.539  -58.222 1.00 179.10 ? 150  THR A O     1 
ATOM   1163  C  CB    . THR A 1  150  ? 96.081  80.694  -58.297 1.00 180.22 ? 150  THR A CB    1 
ATOM   1164  O  OG1   . THR A 1  150  ? 95.449  81.888  -57.823 1.00 179.06 ? 150  THR A OG1   1 
ATOM   1165  C  CG2   . THR A 1  150  ? 95.058  79.630  -58.577 1.00 177.93 ? 150  THR A CG2   1 
ATOM   1166  N  N     . ASP A 1  151  ? 98.525  82.228  -56.904 1.00 179.82 ? 151  ASP A N     1 
ATOM   1167  C  CA    . ASP A 1  151  ? 99.664  83.145  -57.017 1.00 183.21 ? 151  ASP A CA    1 
ATOM   1168  C  C     . ASP A 1  151  ? 99.947  83.902  -55.713 1.00 187.21 ? 151  ASP A C     1 
ATOM   1169  O  O     . ASP A 1  151  ? 99.022  84.370  -55.043 1.00 186.13 ? 151  ASP A O     1 
ATOM   1170  C  CB    . ASP A 1  151  ? 99.459  84.143  -58.174 1.00 191.32 ? 151  ASP A CB    1 
ATOM   1171  C  CG    . ASP A 1  151  ? 98.448  83.710  -59.222 1.00 206.57 ? 151  ASP A CG    1 
ATOM   1172  O  OD1   . ASP A 1  151  ? 97.230  83.818  -58.953 1.00 212.65 ? 151  ASP A OD1   1 
ATOM   1173  O  OD2   . ASP A 1  151  ? 98.873  83.199  -60.281 1.00 207.14 ? 151  ASP A OD2   1 
ATOM   1174  N  N     . VAL A 1  152  ? 101.244 84.039  -55.392 1.00 184.70 ? 152  VAL A N     1 
ATOM   1175  C  CA    . VAL A 1  152  ? 101.798 84.694  -54.200 1.00 184.96 ? 152  VAL A CA    1 
ATOM   1176  C  C     . VAL A 1  152  ? 102.883 85.719  -54.628 1.00 194.70 ? 152  VAL A C     1 
ATOM   1177  O  O     . VAL A 1  152  ? 103.561 85.467  -55.628 1.00 195.84 ? 152  VAL A O     1 
ATOM   1178  C  CB    . VAL A 1  152  ? 102.333 83.593  -53.231 1.00 183.72 ? 152  VAL A CB    1 
ATOM   1179  C  CG1   . VAL A 1  152  ? 103.512 84.061  -52.372 1.00 183.47 ? 152  VAL A CG1   1 
ATOM   1180  C  CG2   . VAL A 1  152  ? 101.209 83.039  -52.361 1.00 180.55 ? 152  VAL A CG2   1 
ATOM   1181  N  N     . PRO A 1  153  ? 103.072 86.867  -53.916 1.00 195.21 ? 153  PRO A N     1 
ATOM   1182  C  CA    . PRO A 1  153  ? 104.119 87.826  -54.328 1.00 200.15 ? 153  PRO A CA    1 
ATOM   1183  C  C     . PRO A 1  153  ? 105.532 87.241  -54.347 1.00 204.47 ? 153  PRO A C     1 
ATOM   1184  O  O     . PRO A 1  153  ? 105.893 86.464  -53.459 1.00 199.70 ? 153  PRO A O     1 
ATOM   1185  C  CB    . PRO A 1  153  ? 103.989 88.959  -53.304 1.00 203.93 ? 153  PRO A CB    1 
ATOM   1186  C  CG    . PRO A 1  153  ? 103.326 88.330  -52.129 1.00 203.37 ? 153  PRO A CG    1 
ATOM   1187  C  CD    . PRO A 1  153  ? 102.361 87.350  -52.715 1.00 196.04 ? 153  PRO A CD    1 
ATOM   1188  N  N     . SER A 1  154  ? 106.312 87.604  -55.385 1.00 203.75 ? 154  SER A N     1 
ATOM   1189  C  CA    . SER A 1  154  ? 107.691 87.160  -55.606 1.00 203.53 ? 154  SER A CA    1 
ATOM   1190  C  C     . SER A 1  154  ? 108.659 87.690  -54.547 1.00 208.68 ? 154  SER A C     1 
ATOM   1191  O  O     . SER A 1  154  ? 108.447 88.782  -54.011 1.00 209.49 ? 154  SER A O     1 
ATOM   1192  C  CB    . SER A 1  154  ? 108.168 87.580  -56.993 1.00 207.64 ? 154  SER A CB    1 
ATOM   1193  O  OG    . SER A 1  154  ? 108.107 88.985  -57.172 1.00 213.67 ? 154  SER A OG    1 
ATOM   1194  N  N     . GLU A 1  155  ? 109.744 86.921  -54.283 1.00 206.40 ? 155  GLU A N     1 
ATOM   1195  C  CA    . GLU A 1  155  ? 110.811 87.228  -53.319 1.00 206.76 ? 155  GLU A CA    1 
ATOM   1196  C  C     . GLU A 1  155  ? 111.475 88.588  -53.532 1.00 214.21 ? 155  GLU A C     1 
ATOM   1197  O  O     . GLU A 1  155  ? 111.944 89.192  -52.565 1.00 214.89 ? 155  GLU A O     1 
ATOM   1198  C  CB    . GLU A 1  155  ? 111.875 86.136  -53.329 1.00 205.95 ? 155  GLU A CB    1 
ATOM   1199  C  CG    . GLU A 1  155  ? 111.452 84.892  -52.588 1.00 208.65 ? 155  GLU A CG    1 
ATOM   1200  C  CD    . GLU A 1  155  ? 112.465 83.785  -52.748 1.00 224.17 ? 155  GLU A CD    1 
ATOM   1201  O  OE1   . GLU A 1  155  ? 113.436 83.749  -51.958 1.00 219.48 ? 155  GLU A OE1   1 
ATOM   1202  O  OE2   . GLU A 1  155  ? 112.325 82.991  -53.704 1.00 221.75 ? 155  GLU A OE2   1 
ATOM   1203  N  N     . ASP A 1  156  ? 111.529 89.058  -54.792 1.00 214.84 ? 156  ASP A N     1 
ATOM   1204  C  CA    . ASP A 1  156  ? 112.105 90.354  -55.140 1.00 217.99 ? 156  ASP A CA    1 
ATOM   1205  C  C     . ASP A 1  156  ? 111.109 91.469  -54.758 1.00 222.94 ? 156  ASP A C     1 
ATOM   1206  O  O     . ASP A 1  156  ? 111.062 91.863  -53.588 1.00 222.59 ? 156  ASP A O     1 
ATOM   1207  C  CB    . ASP A 1  156  ? 112.487 90.399  -56.639 1.00 220.65 ? 156  ASP A CB    1 
ATOM   1208  C  CG    . ASP A 1  156  ? 113.598 89.448  -57.049 1.00 227.03 ? 156  ASP A CG    1 
ATOM   1209  O  OD1   . ASP A 1  156  ? 113.479 88.231  -56.761 1.00 228.38 ? 156  ASP A OD1   1 
ATOM   1210  O  OD2   . ASP A 1  156  ? 114.574 89.914  -57.683 1.00 230.12 ? 156  ASP A OD2   1 
ATOM   1211  N  N     . ASP A 1  157  ? 110.296 91.943  -55.729 1.00 222.18 ? 157  ASP A N     1 
ATOM   1212  C  CA    . ASP A 1  157  ? 109.289 92.985  -55.527 1.00 224.03 ? 157  ASP A CA    1 
ATOM   1213  C  C     . ASP A 1  157  ? 107.957 92.341  -55.113 1.00 223.95 ? 157  ASP A C     1 
ATOM   1214  O  O     . ASP A 1  157  ? 107.567 91.332  -55.713 1.00 222.84 ? 157  ASP A O     1 
ATOM   1215  C  CB    . ASP A 1  157  ? 109.055 93.798  -56.826 1.00 229.45 ? 157  ASP A CB    1 
ATOM   1216  C  CG    . ASP A 1  157  ? 110.287 94.304  -57.559 1.00 241.78 ? 157  ASP A CG    1 
ATOM   1217  O  OD1   . ASP A 1  157  ? 111.146 93.470  -57.927 1.00 244.43 ? 157  ASP A OD1   1 
ATOM   1218  O  OD2   . ASP A 1  157  ? 110.347 95.520  -57.849 1.00 245.22 ? 157  ASP A OD2   1 
ATOM   1219  N  N     . PRO A 1  158  ? 107.207 92.915  -54.140 1.00 220.44 ? 158  PRO A N     1 
ATOM   1220  C  CA    . PRO A 1  158  ? 105.881 92.349  -53.827 1.00 218.95 ? 158  PRO A CA    1 
ATOM   1221  C  C     . PRO A 1  158  ? 104.823 92.836  -54.838 1.00 220.39 ? 158  PRO A C     1 
ATOM   1222  O  O     . PRO A 1  158  ? 103.687 92.354  -54.827 1.00 219.80 ? 158  PRO A O     1 
ATOM   1223  C  CB    . PRO A 1  158  ? 105.617 92.825  -52.396 1.00 220.54 ? 158  PRO A CB    1 
ATOM   1224  C  CG    . PRO A 1  158  ? 106.468 94.058  -52.228 1.00 226.83 ? 158  PRO A CG    1 
ATOM   1225  C  CD    . PRO A 1  158  ? 107.479 94.132  -53.343 1.00 224.20 ? 158  PRO A CD    1 
ATOM   1226  N  N     . THR A 1  159  ? 105.228 93.778  -55.733 1.00 219.06 ? 159  THR A N     1 
ATOM   1227  C  CA    . THR A 1  159  ? 104.451 94.400  -56.809 1.00 221.23 ? 159  THR A CA    1 
ATOM   1228  C  C     . THR A 1  159  ? 104.094 93.377  -57.893 1.00 219.95 ? 159  THR A C     1 
ATOM   1229  O  O     . THR A 1  159  ? 102.984 93.427  -58.423 1.00 220.60 ? 159  THR A O     1 
ATOM   1230  C  CB    . THR A 1  159  ? 105.243 95.572  -57.408 1.00 230.74 ? 159  THR A CB    1 
ATOM   1231  O  OG1   . THR A 1  159  ? 106.057 96.170  -56.400 1.00 229.22 ? 159  THR A OG1   1 
ATOM   1232  C  CG2   . THR A 1  159  ? 104.346 96.620  -58.049 1.00 234.89 ? 159  THR A CG2   1 
ATOM   1233  N  N     . GLN A 1  160  ? 105.042 92.471  -58.234 1.00 213.53 ? 160  GLN A N     1 
ATOM   1234  C  CA    . GLN A 1  160  ? 104.851 91.412  -59.234 1.00 211.73 ? 160  GLN A CA    1 
ATOM   1235  C  C     . GLN A 1  160  ? 104.641 90.064  -58.539 1.00 209.72 ? 160  GLN A C     1 
ATOM   1236  O  O     . GLN A 1  160  ? 105.507 89.619  -57.781 1.00 208.16 ? 160  GLN A O     1 
ATOM   1237  C  CB    . GLN A 1  160  ? 106.035 91.331  -60.216 1.00 213.32 ? 160  GLN A CB    1 
ATOM   1238  C  CG    . GLN A 1  160  ? 106.273 92.602  -61.028 1.00 227.48 ? 160  GLN A CG    1 
ATOM   1239  C  CD    . GLN A 1  160  ? 107.477 93.383  -60.552 1.00 237.83 ? 160  GLN A CD    1 
ATOM   1240  O  OE1   . GLN A 1  160  ? 108.405 92.848  -59.930 1.00 235.45 ? 160  GLN A OE1   1 
ATOM   1241  N  NE2   . GLN A 1  160  ? 107.514 94.666  -60.884 1.00 235.64 ? 160  GLN A NE2   1 
ATOM   1242  N  N     . LEU A 1  161  ? 103.480 89.431  -58.787 1.00 205.08 ? 161  LEU A N     1 
ATOM   1243  C  CA    . LEU A 1  161  ? 103.106 88.141  -58.205 1.00 200.96 ? 161  LEU A CA    1 
ATOM   1244  C  C     . LEU A 1  161  ? 103.544 86.964  -59.066 1.00 201.67 ? 161  LEU A C     1 
ATOM   1245  O  O     . LEU A 1  161  ? 103.488 87.039  -60.296 1.00 203.10 ? 161  LEU A O     1 
ATOM   1246  C  CB    . LEU A 1  161  ? 101.592 88.085  -57.961 1.00 200.44 ? 161  LEU A CB    1 
ATOM   1247  C  CG    . LEU A 1  161  ? 101.146 88.293  -56.521 1.00 202.51 ? 161  LEU A CG    1 
ATOM   1248  C  CD1   . LEU A 1  161  ? 101.130 89.768  -56.146 1.00 205.03 ? 161  LEU A CD1   1 
ATOM   1249  C  CD2   . LEU A 1  161  ? 99.793  87.668  -56.280 1.00 202.62 ? 161  LEU A CD2   1 
ATOM   1250  N  N     . VAL A 1  162  ? 103.971 85.872  -58.413 1.00 195.42 ? 162  VAL A N     1 
ATOM   1251  C  CA    . VAL A 1  162  ? 104.417 84.653  -59.087 1.00 192.52 ? 162  VAL A CA    1 
ATOM   1252  C  C     . VAL A 1  162  ? 103.471 83.490  -58.769 1.00 191.29 ? 162  VAL A C     1 
ATOM   1253  O  O     . VAL A 1  162  ? 103.152 83.253  -57.602 1.00 187.72 ? 162  VAL A O     1 
ATOM   1254  C  CB    . VAL A 1  162  ? 105.911 84.351  -58.788 1.00 194.96 ? 162  VAL A CB    1 
ATOM   1255  C  CG1   . VAL A 1  162  ? 106.287 82.912  -59.135 1.00 191.94 ? 162  VAL A CG1   1 
ATOM   1256  C  CG2   . VAL A 1  162  ? 106.815 85.326  -59.530 1.00 199.43 ? 162  VAL A CG2   1 
ATOM   1257  N  N     . SER A 1  163  ? 103.018 82.782  -59.819 1.00 186.97 ? 163  SER A N     1 
ATOM   1258  C  CA    . SER A 1  163  ? 102.101 81.645  -59.717 1.00 182.85 ? 163  SER A CA    1 
ATOM   1259  C  C     . SER A 1  163  ? 102.752 80.388  -59.141 1.00 180.71 ? 163  SER A C     1 
ATOM   1260  O  O     . SER A 1  163  ? 103.850 80.011  -59.556 1.00 180.12 ? 163  SER A O     1 
ATOM   1261  C  CB    . SER A 1  163  ? 101.470 81.339  -61.071 1.00 189.29 ? 163  SER A CB    1 
ATOM   1262  O  OG    . SER A 1  163  ? 102.444 81.282  -62.100 1.00 202.08 ? 163  SER A OG    1 
ATOM   1263  N  N     . ARG A 1  164  ? 102.060 79.745  -58.183 1.00 172.32 ? 164  ARG A N     1 
ATOM   1264  C  CA    . ARG A 1  164  ? 102.476 78.500  -57.525 1.00 166.70 ? 164  ARG A CA    1 
ATOM   1265  C  C     . ARG A 1  164  ? 101.524 77.381  -57.980 1.00 168.62 ? 164  ARG A C     1 
ATOM   1266  O  O     . ARG A 1  164  ? 101.154 77.359  -59.157 1.00 170.31 ? 164  ARG A O     1 
ATOM   1267  C  CB    . ARG A 1  164  ? 102.537 78.666  -55.980 1.00 162.16 ? 164  ARG A CB    1 
ATOM   1268  C  CG    . ARG A 1  164  ? 101.352 79.399  -55.323 1.00 166.46 ? 164  ARG A CG    1 
ATOM   1269  C  CD    . ARG A 1  164  ? 101.477 79.488  -53.800 1.00 165.42 ? 164  ARG A CD    1 
ATOM   1270  N  NE    . ARG A 1  164  ? 100.953 78.297  -53.122 1.00 157.68 ? 164  ARG A NE    1 
ATOM   1271  C  CZ    . ARG A 1  164  ? 100.420 78.286  -51.901 1.00 159.04 ? 164  ARG A CZ    1 
ATOM   1272  N  NH1   . ARG A 1  164  ? 100.335 79.408  -51.193 1.00 144.51 ? 164  ARG A NH1   1 
ATOM   1273  N  NH2   . ARG A 1  164  ? 99.960  77.155  -51.383 1.00 136.16 ? 164  ARG A NH2   1 
ATOM   1274  N  N     . GLY A 1  165  ? 101.139 76.482  -57.069 1.00 161.81 ? 165  GLY A N     1 
ATOM   1275  C  CA    . GLY A 1  165  ? 100.185 75.410  -57.336 1.00 159.93 ? 165  GLY A CA    1 
ATOM   1276  C  C     . GLY A 1  165  ? 98.806  75.976  -57.606 1.00 166.93 ? 165  GLY A C     1 
ATOM   1277  O  O     . GLY A 1  165  ? 98.324  76.828  -56.856 1.00 167.08 ? 165  GLY A O     1 
ATOM   1278  N  N     . GLY A 1  166  ? 98.200  75.523  -58.698 1.00 166.03 ? 166  GLY A N     1 
ATOM   1279  C  CA    . GLY A 1  166  ? 96.908  75.995  -59.192 1.00 168.91 ? 166  GLY A CA    1 
ATOM   1280  C  C     . GLY A 1  166  ? 95.705  75.864  -58.280 1.00 171.51 ? 166  GLY A C     1 
ATOM   1281  O  O     . GLY A 1  166  ? 95.836  75.502  -57.108 1.00 167.63 ? 166  GLY A O     1 
ATOM   1282  N  N     . CYS A 1  167  ? 94.514  76.174  -58.855 1.00 171.27 ? 167  CYS A N     1 
ATOM   1283  C  CA    . CYS A 1  167  ? 93.145  76.186  -58.297 1.00 170.92 ? 167  CYS A CA    1 
ATOM   1284  C  C     . CYS A 1  167  ? 92.987  77.155  -57.106 1.00 173.21 ? 167  CYS A C     1 
ATOM   1285  O  O     . CYS A 1  167  ? 93.936  77.389  -56.359 1.00 171.35 ? 167  CYS A O     1 
ATOM   1286  C  CB    . CYS A 1  167  ? 92.608  74.782  -57.988 1.00 167.97 ? 167  CYS A CB    1 
ATOM   1287  S  SG    . CYS A 1  167  ? 93.053  74.105  -56.359 1.00 166.39 ? 167  CYS A SG    1 
ATOM   1288  N  N     . GLY A 1  168  ? 91.811  77.773  -57.011 1.00 170.63 ? 168  GLY A N     1 
ATOM   1289  C  CA    . GLY A 1  168  ? 91.487  78.717  -55.949 1.00 170.35 ? 168  GLY A CA    1 
ATOM   1290  C  C     . GLY A 1  168  ? 90.969  77.958  -54.752 1.00 168.80 ? 168  GLY A C     1 
ATOM   1291  O  O     . GLY A 1  168  ? 91.753  77.454  -53.946 1.00 164.70 ? 168  GLY A O     1 
ATOM   1292  N  N     . ASN A 1  169  ? 89.635  77.824  -54.679 1.00 165.00 ? 169  ASN A N     1 
ATOM   1293  C  CA    . ASN A 1  169  ? 88.868  77.077  -53.673 1.00 160.94 ? 169  ASN A CA    1 
ATOM   1294  C  C     . ASN A 1  169  ? 89.105  77.506  -52.221 1.00 160.04 ? 169  ASN A C     1 
ATOM   1295  O  O     . ASN A 1  169  ? 90.243  77.522  -51.742 1.00 156.99 ? 169  ASN A O     1 
ATOM   1296  C  CB    . ASN A 1  169  ? 89.084  75.554  -53.813 1.00 157.74 ? 169  ASN A CB    1 
ATOM   1297  C  CG    . ASN A 1  169  ? 89.261  75.044  -55.231 1.00 176.68 ? 169  ASN A CG    1 
ATOM   1298  O  OD1   . ASN A 1  169  ? 88.611  75.491  -56.195 1.00 173.10 ? 169  ASN A OD1   1 
ATOM   1299  N  ND2   . ASN A 1  169  ? 90.140  74.072  -55.377 1.00 162.63 ? 169  ASN A ND2   1 
ATOM   1300  N  N     . THR A 1  170  ? 88.008  77.823  -51.513 1.00 155.76 ? 170  THR A N     1 
ATOM   1301  C  CA    . THR A 1  170  ? 88.079  78.168  -50.099 1.00 153.34 ? 170  THR A CA    1 
ATOM   1302  C  C     . THR A 1  170  ? 88.216  76.857  -49.323 1.00 151.98 ? 170  THR A C     1 
ATOM   1303  O  O     . THR A 1  170  ? 87.640  75.825  -49.695 1.00 150.31 ? 170  THR A O     1 
ATOM   1304  C  CB    . THR A 1  170  ? 86.870  78.989  -49.637 1.00 158.83 ? 170  THR A CB    1 
ATOM   1305  O  OG1   . THR A 1  170  ? 86.482  79.894  -50.667 1.00 162.12 ? 170  THR A OG1   1 
ATOM   1306  C  CG2   . THR A 1  170  ? 87.140  79.754  -48.341 1.00 154.69 ? 170  THR A CG2   1 
ATOM   1307  N  N     . GLN A 1  171  ? 89.027  76.893  -48.282 1.00 145.20 ? 171  GLN A N     1 
ATOM   1308  C  CA    . GLN A 1  171  ? 89.251  75.731  -47.458 1.00 140.01 ? 171  GLN A CA    1 
ATOM   1309  C  C     . GLN A 1  171  ? 88.278  75.720  -46.270 1.00 141.22 ? 171  GLN A C     1 
ATOM   1310  O  O     . GLN A 1  171  ? 87.919  76.791  -45.766 1.00 143.35 ? 171  GLN A O     1 
ATOM   1311  C  CB    . GLN A 1  171  ? 90.742  75.610  -47.076 1.00 138.98 ? 171  GLN A CB    1 
ATOM   1312  C  CG    . GLN A 1  171  ? 91.513  74.567  -47.916 1.00 155.14 ? 171  GLN A CG    1 
ATOM   1313  C  CD    . GLN A 1  171  ? 91.198  74.610  -49.403 1.00 182.07 ? 171  GLN A CD    1 
ATOM   1314  O  OE1   . GLN A 1  171  ? 91.645  75.495  -50.134 1.00 181.65 ? 171  GLN A OE1   1 
ATOM   1315  N  NE2   . GLN A 1  171  ? 90.399  73.664  -49.883 1.00 175.78 ? 171  GLN A NE2   1 
ATOM   1316  N  N     . PRO A 1  172  ? 87.751  74.532  -45.884 1.00 133.11 ? 172  PRO A N     1 
ATOM   1317  C  CA    . PRO A 1  172  ? 86.798  74.489  -44.769 1.00 132.15 ? 172  PRO A CA    1 
ATOM   1318  C  C     . PRO A 1  172  ? 87.447  74.705  -43.422 1.00 131.74 ? 172  PRO A C     1 
ATOM   1319  O  O     . PRO A 1  172  ? 88.644  74.462  -43.260 1.00 128.93 ? 172  PRO A O     1 
ATOM   1320  C  CB    . PRO A 1  172  ? 86.272  73.057  -44.818 1.00 131.54 ? 172  PRO A CB    1 
ATOM   1321  C  CG    . PRO A 1  172  ? 87.356  72.264  -45.429 1.00 133.45 ? 172  PRO A CG    1 
ATOM   1322  C  CD    . PRO A 1  172  ? 88.030  73.174  -46.404 1.00 131.42 ? 172  PRO A CD    1 
ATOM   1323  N  N     . THR A 1  173  ? 86.636  75.101  -42.445 1.00 128.16 ? 173  THR A N     1 
ATOM   1324  C  CA    . THR A 1  173  ? 87.077  75.200  -41.071 1.00 126.53 ? 173  THR A CA    1 
ATOM   1325  C  C     . THR A 1  173  ? 86.571  73.898  -40.475 1.00 128.47 ? 173  THR A C     1 
ATOM   1326  O  O     . THR A 1  173  ? 85.380  73.767  -40.170 1.00 129.54 ? 173  THR A O     1 
ATOM   1327  C  CB    . THR A 1  173  ? 86.628  76.496  -40.409 1.00 136.25 ? 173  THR A CB    1 
ATOM   1328  O  OG1   . THR A 1  173  ? 85.520  77.038  -41.130 1.00 143.63 ? 173  THR A OG1   1 
ATOM   1329  C  CG2   . THR A 1  173  ? 87.752  77.520  -40.336 1.00 133.36 ? 173  THR A CG2   1 
ATOM   1330  N  N     . ILE A 1  174  ? 87.467  72.883  -40.468 1.00 121.35 ? 174  ILE A N     1 
ATOM   1331  C  CA    . ILE A 1  174  ? 87.191  71.516  -40.029 1.00 117.63 ? 174  ILE A CA    1 
ATOM   1332  C  C     . ILE A 1  174  ? 87.060  71.446  -38.513 1.00 120.32 ? 174  ILE A C     1 
ATOM   1333  O  O     . ILE A 1  174  ? 87.905  71.988  -37.790 1.00 120.33 ? 174  ILE A O     1 
ATOM   1334  C  CB    . ILE A 1  174  ? 88.244  70.498  -40.588 1.00 117.16 ? 174  ILE A CB    1 
ATOM   1335  C  CG1   . ILE A 1  174  ? 88.407  70.611  -42.110 1.00 118.17 ? 174  ILE A CG1   1 
ATOM   1336  C  CG2   . ILE A 1  174  ? 87.893  69.057  -40.224 1.00 115.39 ? 174  ILE A CG2   1 
ATOM   1337  C  CD1   . ILE A 1  174  ? 89.805  70.609  -42.559 1.00 123.26 ? 174  ILE A CD1   1 
ATOM   1338  N  N     . ARG A 1  175  ? 85.984  70.788  -38.048 1.00 115.55 ? 175  ARG A N     1 
ATOM   1339  C  CA    . ARG A 1  175  ? 85.713  70.523  -36.640 1.00 114.77 ? 175  ARG A CA    1 
ATOM   1340  C  C     . ARG A 1  175  ? 85.226  69.075  -36.441 1.00 116.28 ? 175  ARG A C     1 
ATOM   1341  O  O     . ARG A 1  175  ? 84.614  68.497  -37.341 1.00 116.00 ? 175  ARG A O     1 
ATOM   1342  C  CB    . ARG A 1  175  ? 84.780  71.572  -36.004 1.00 119.29 ? 175  ARG A CB    1 
ATOM   1343  C  CG    . ARG A 1  175  ? 83.399  71.724  -36.642 1.00 138.54 ? 175  ARG A CG    1 
ATOM   1344  C  CD    . ARG A 1  175  ? 82.408  72.401  -35.699 1.00 161.08 ? 175  ARG A CD    1 
ATOM   1345  N  NE    . ARG A 1  175  ? 81.986  71.522  -34.598 1.00 176.30 ? 175  ARG A NE    1 
ATOM   1346  C  CZ    . ARG A 1  175  ? 80.782  70.958  -34.486 1.00 193.98 ? 175  ARG A CZ    1 
ATOM   1347  N  NH1   . ARG A 1  175  ? 79.845  71.185  -35.402 1.00 183.46 ? 175  ARG A NH1   1 
ATOM   1348  N  NH2   . ARG A 1  175  ? 80.504  70.174  -33.452 1.00 179.14 ? 175  ARG A NH2   1 
ATOM   1349  N  N     . LYS A 1  176  ? 85.545  68.481  -35.284 1.00 110.69 ? 176  LYS A N     1 
ATOM   1350  C  CA    . LYS A 1  176  ? 85.160  67.115  -34.937 1.00 108.41 ? 176  LYS A CA    1 
ATOM   1351  C  C     . LYS A 1  176  ? 83.739  67.097  -34.408 1.00 116.25 ? 176  LYS A C     1 
ATOM   1352  O  O     . LYS A 1  176  ? 83.316  68.027  -33.714 1.00 118.18 ? 176  LYS A O     1 
ATOM   1353  C  CB    . LYS A 1  176  ? 86.095  66.574  -33.851 1.00 108.15 ? 176  LYS A CB    1 
ATOM   1354  C  CG    . LYS A 1  176  ? 86.108  65.061  -33.692 1.00 117.02 ? 176  LYS A CG    1 
ATOM   1355  C  CD    . LYS A 1  176  ? 86.999  64.647  -32.516 1.00 124.98 ? 176  LYS A CD    1 
ATOM   1356  C  CE    . LYS A 1  176  ? 87.507  63.233  -32.661 1.00 134.67 ? 176  LYS A CE    1 
ATOM   1357  N  NZ    . LYS A 1  176  ? 88.082  62.698  -31.394 1.00 143.63 ? 176  LYS A NZ    1 
ATOM   1358  N  N     . ASP A 1  177  ? 83.013  66.025  -34.731 1.00 113.83 ? 177  ASP A N     1 
ATOM   1359  C  CA    . ASP A 1  177  ? 81.652  65.744  -34.272 1.00 116.30 ? 177  ASP A CA    1 
ATOM   1360  C  C     . ASP A 1  177  ? 81.593  64.220  -34.135 1.00 118.00 ? 177  ASP A C     1 
ATOM   1361  O  O     . ASP A 1  177  ? 81.303  63.499  -35.098 1.00 117.78 ? 177  ASP A O     1 
ATOM   1362  C  CB    . ASP A 1  177  ? 80.580  66.305  -35.242 1.00 121.46 ? 177  ASP A CB    1 
ATOM   1363  C  CG    . ASP A 1  177  ? 79.150  66.241  -34.720 1.00 137.21 ? 177  ASP A CG    1 
ATOM   1364  O  OD1   . ASP A 1  177  ? 78.560  65.132  -34.725 1.00 136.63 ? 177  ASP A OD1   1 
ATOM   1365  O  OD2   . ASP A 1  177  ? 78.605  67.305  -34.348 1.00 148.88 ? 177  ASP A OD2   1 
ATOM   1366  N  N     . GLY A 1  178  ? 81.980  63.743  -32.958 1.00 112.12 ? 178  GLY A N     1 
ATOM   1367  C  CA    . GLY A 1  178  ? 82.031  62.316  -32.679 1.00 109.32 ? 178  GLY A CA    1 
ATOM   1368  C  C     . GLY A 1  178  ? 83.213  61.692  -33.376 1.00 107.84 ? 178  GLY A C     1 
ATOM   1369  O  O     . GLY A 1  178  ? 84.348  61.967  -32.992 1.00 106.05 ? 178  GLY A O     1 
ATOM   1370  N  N     . LEU A 1  179  ? 82.953  60.885  -34.426 1.00 102.09 ? 179  LEU A N     1 
ATOM   1371  C  CA    . LEU A 1  179  ? 83.985  60.208  -35.235 1.00 98.56  ? 179  LEU A CA    1 
ATOM   1372  C  C     . LEU A 1  179  ? 83.943  60.709  -36.684 1.00 102.09 ? 179  LEU A C     1 
ATOM   1373  O  O     . LEU A 1  179  ? 84.386  60.008  -37.613 1.00 99.52  ? 179  LEU A O     1 
ATOM   1374  C  CB    . LEU A 1  179  ? 83.811  58.671  -35.188 1.00 97.09  ? 179  LEU A CB    1 
ATOM   1375  C  CG    . LEU A 1  179  ? 83.838  58.001  -33.812 1.00 100.79 ? 179  LEU A CG    1 
ATOM   1376  C  CD1   . LEU A 1  179  ? 83.427  56.549  -33.912 1.00 100.52 ? 179  LEU A CD1   1 
ATOM   1377  C  CD2   . LEU A 1  179  ? 85.199  58.132  -33.141 1.00 100.40 ? 179  LEU A CD2   1 
ATOM   1378  N  N     . LYS A 1  180  ? 83.399  61.938  -36.859 1.00 100.81 ? 180  LYS A N     1 
ATOM   1379  C  CA    . LYS A 1  180  ? 83.198  62.592  -38.151 1.00 101.87 ? 180  LYS A CA    1 
ATOM   1380  C  C     . LYS A 1  180  ? 83.888  63.942  -38.242 1.00 107.51 ? 180  LYS A C     1 
ATOM   1381  O  O     . LYS A 1  180  ? 84.119  64.607  -37.225 1.00 107.22 ? 180  LYS A O     1 
ATOM   1382  C  CB    . LYS A 1  180  ? 81.693  62.751  -38.439 1.00 106.36 ? 180  LYS A CB    1 
ATOM   1383  C  CG    . LYS A 1  180  ? 80.994  61.461  -38.841 1.00 116.25 ? 180  LYS A CG    1 
ATOM   1384  C  CD    . LYS A 1  180  ? 79.508  61.667  -39.053 1.00 127.46 ? 180  LYS A CD    1 
ATOM   1385  C  CE    . LYS A 1  180  ? 78.862  60.479  -39.726 1.00 138.93 ? 180  LYS A CE    1 
ATOM   1386  N  NZ    . LYS A 1  180  ? 77.399  60.682  -39.923 1.00 153.63 ? 180  LYS A NZ    1 
ATOM   1387  N  N     . LEU A 1  181  ? 84.205  64.349  -39.475 1.00 105.83 ? 181  LEU A N     1 
ATOM   1388  C  CA    . LEU A 1  181  ? 84.823  65.641  -39.719 1.00 107.93 ? 181  LEU A CA    1 
ATOM   1389  C  C     . LEU A 1  181  ? 83.904  66.528  -40.568 1.00 119.68 ? 181  LEU A C     1 
ATOM   1390  O  O     . LEU A 1  181  ? 83.514  66.138  -41.673 1.00 121.15 ? 181  LEU A O     1 
ATOM   1391  C  CB    . LEU A 1  181  ? 86.213  65.480  -40.341 1.00 105.80 ? 181  LEU A CB    1 
ATOM   1392  C  CG    . LEU A 1  181  ? 87.320  64.977  -39.410 1.00 107.48 ? 181  LEU A CG    1 
ATOM   1393  C  CD1   . LEU A 1  181  ? 88.654  64.860  -40.152 1.00 105.83 ? 181  LEU A CD1   1 
ATOM   1394  C  CD2   . LEU A 1  181  ? 87.466  65.874  -38.183 1.00 110.57 ? 181  LEU A CD2   1 
ATOM   1395  N  N     . VAL A 1  182  ? 83.523  67.706  -40.022 1.00 120.02 ? 182  VAL A N     1 
ATOM   1396  C  CA    . VAL A 1  182  ? 82.609  68.673  -40.647 1.00 123.77 ? 182  VAL A CA    1 
ATOM   1397  C  C     . VAL A 1  182  ? 83.321  70.007  -40.928 1.00 129.66 ? 182  VAL A C     1 
ATOM   1398  O  O     . VAL A 1  182  ? 84.042  70.518  -40.063 1.00 128.37 ? 182  VAL A O     1 
ATOM   1399  C  CB    . VAL A 1  182  ? 81.358  68.869  -39.746 1.00 130.30 ? 182  VAL A CB    1 
ATOM   1400  C  CG1   . VAL A 1  182  ? 80.420  69.949  -40.288 1.00 134.67 ? 182  VAL A CG1   1 
ATOM   1401  C  CG2   . VAL A 1  182  ? 80.608  67.558  -39.552 1.00 128.86 ? 182  VAL A CG2   1 
ATOM   1402  N  N     . GLY A 1  183  ? 83.081  70.558  -42.120 1.00 128.93 ? 183  GLY A N     1 
ATOM   1403  C  CA    . GLY A 1  183  ? 83.640  71.837  -42.541 1.00 131.04 ? 183  GLY A CA    1 
ATOM   1404  C  C     . GLY A 1  183  ? 82.666  73.001  -42.475 1.00 139.51 ? 183  GLY A C     1 
ATOM   1405  O  O     . GLY A 1  183  ? 81.483  72.818  -42.173 1.00 139.95 ? 183  GLY A O     1 
ATOM   1406  N  N     . SER A 1  184  ? 83.177  74.218  -42.751 1.00 139.21 ? 184  SER A N     1 
ATOM   1407  C  CA    . SER A 1  184  ? 82.413  75.468  -42.775 1.00 143.96 ? 184  SER A CA    1 
ATOM   1408  C  C     . SER A 1  184  ? 83.018  76.478  -43.767 1.00 151.71 ? 184  SER A C     1 
ATOM   1409  O  O     . SER A 1  184  ? 83.789  77.373  -43.396 1.00 152.03 ? 184  SER A O     1 
ATOM   1410  C  CB    . SER A 1  184  ? 82.267  76.063  -41.375 1.00 147.85 ? 184  SER A CB    1 
ATOM   1411  O  OG    . SER A 1  184  ? 81.481  77.245  -41.385 1.00 158.74 ? 184  SER A OG    1 
ATOM   1412  N  N     . TRP A 1  185  ? 82.656  76.307  -45.042 1.00 150.77 ? 185  TRP A N     1 
ATOM   1413  C  CA    . TRP A 1  185  ? 83.067  77.161  -46.152 1.00 153.78 ? 185  TRP A CA    1 
ATOM   1414  C  C     . TRP A 1  185  ? 82.098  78.361  -46.273 1.00 159.54 ? 185  TRP A C     1 
ATOM   1415  O  O     . TRP A 1  185  ? 80.921  78.248  -45.925 1.00 160.23 ? 185  TRP A O     1 
ATOM   1416  C  CB    . TRP A 1  185  ? 83.005  76.374  -47.477 1.00 153.18 ? 185  TRP A CB    1 
ATOM   1417  C  CG    . TRP A 1  185  ? 83.782  75.091  -47.548 1.00 150.57 ? 185  TRP A CG    1 
ATOM   1418  C  CD1   . TRP A 1  185  ? 84.950  74.880  -48.224 1.00 152.09 ? 185  TRP A CD1   1 
ATOM   1419  C  CD2   . TRP A 1  185  ? 83.360  73.806  -47.068 1.00 148.02 ? 185  TRP A CD2   1 
ATOM   1420  N  NE1   . TRP A 1  185  ? 85.307  73.552  -48.156 1.00 148.12 ? 185  TRP A NE1   1 
ATOM   1421  C  CE2   . TRP A 1  185  ? 84.346  72.867  -47.454 1.00 148.96 ? 185  TRP A CE2   1 
ATOM   1422  C  CE3   . TRP A 1  185  ? 82.256  73.357  -46.319 1.00 149.76 ? 185  TRP A CE3   1 
ATOM   1423  C  CZ2   . TRP A 1  185  ? 84.271  71.508  -47.097 1.00 145.17 ? 185  TRP A CZ2   1 
ATOM   1424  C  CZ3   . TRP A 1  185  ? 82.190  72.017  -45.953 1.00 148.22 ? 185  TRP A CZ3   1 
ATOM   1425  C  CH2   . TRP A 1  185  ? 83.193  71.111  -46.330 1.00 145.48 ? 185  TRP A CH2   1 
ATOM   1426  N  N     . LYS A 1  186  ? 82.588  79.487  -46.803 1.00 156.97 ? 186  LYS A N     1 
ATOM   1427  C  CA    . LYS A 1  186  ? 81.792  80.678  -47.095 1.00 174.02 ? 186  LYS A CA    1 
ATOM   1428  C  C     . LYS A 1  186  ? 82.521  81.544  -48.111 1.00 197.10 ? 186  LYS A C     1 
ATOM   1429  O  O     . LYS A 1  186  ? 83.602  81.167  -48.562 1.00 150.43 ? 186  LYS A O     1 
ATOM   1430  C  CB    . LYS A 1  186  ? 81.426  81.473  -45.837 1.00 177.90 ? 186  LYS A CB    1 
ATOM   1431  C  CG    . LYS A 1  186  ? 80.298  82.468  -46.088 1.00 193.45 ? 186  LYS A CG    1 
ATOM   1432  C  CD    . LYS A 1  186  ? 79.715  82.959  -44.784 1.00 202.11 ? 186  LYS A CD    1 
ATOM   1433  C  CE    . LYS A 1  186  ? 79.528  84.450  -44.758 1.00 206.91 ? 186  LYS A CE    1 
ATOM   1434  N  NZ    . LYS A 1  186  ? 78.868  84.889  -43.501 1.00 212.07 ? 186  LYS A NZ    1 
ATOM   1435  N  N     . ASP A 1  195  ? 77.114  86.167  -46.430 1.00 200.97 ? 195  ASP A N     1 
ATOM   1436  C  CA    . ASP A 1  195  ? 76.127  85.907  -45.387 1.00 201.41 ? 195  ASP A CA    1 
ATOM   1437  C  C     . ASP A 1  195  ? 75.735  84.419  -45.367 1.00 203.26 ? 195  ASP A C     1 
ATOM   1438  O  O     . ASP A 1  195  ? 75.214  83.917  -46.367 1.00 203.84 ? 195  ASP A O     1 
ATOM   1439  C  CB    . ASP A 1  195  ? 74.880  86.800  -45.578 1.00 206.72 ? 195  ASP A CB    1 
ATOM   1440  C  CG    . ASP A 1  195  ? 75.152  88.264  -45.910 1.00 220.09 ? 195  ASP A CG    1 
ATOM   1441  O  OD1   . ASP A 1  195  ? 76.291  88.730  -45.671 1.00 220.51 ? 195  ASP A OD1   1 
ATOM   1442  O  OD2   . ASP A 1  195  ? 74.219  88.947  -46.399 1.00 227.65 ? 195  ASP A OD2   1 
ATOM   1443  N  N     . GLU A 1  196  ? 76.005  83.721  -44.225 1.00 197.30 ? 196  GLU A N     1 
ATOM   1444  C  CA    . GLU A 1  196  ? 75.715  82.304  -43.905 1.00 192.31 ? 196  GLU A CA    1 
ATOM   1445  C  C     . GLU A 1  196  ? 76.613  81.289  -44.619 1.00 190.70 ? 196  GLU A C     1 
ATOM   1446  O  O     . GLU A 1  196  ? 76.850  81.419  -45.824 1.00 190.75 ? 196  GLU A O     1 
ATOM   1447  C  CB    . GLU A 1  196  ? 74.235  81.931  -44.109 1.00 196.61 ? 196  GLU A CB    1 
ATOM   1448  C  CG    . GLU A 1  196  ? 73.549  81.495  -42.829 1.00 205.32 ? 196  GLU A CG    1 
ATOM   1449  C  CD    . GLU A 1  196  ? 72.681  80.263  -42.972 1.00 216.85 ? 196  GLU A CD    1 
ATOM   1450  O  OE1   . GLU A 1  196  ? 73.242  79.142  -43.002 1.00 205.86 ? 196  GLU A OE1   1 
ATOM   1451  O  OE2   . GLU A 1  196  ? 71.440  80.419  -43.035 1.00 209.97 ? 196  GLU A OE2   1 
ATOM   1452  N  N     . PRO A 1  197  ? 77.074  80.233  -43.899 1.00 182.37 ? 197  PRO A N     1 
ATOM   1453  C  CA    . PRO A 1  197  ? 77.982  79.257  -44.521 1.00 177.10 ? 197  PRO A CA    1 
ATOM   1454  C  C     . PRO A 1  197  ? 77.339  77.935  -44.968 1.00 178.16 ? 197  PRO A C     1 
ATOM   1455  O  O     . PRO A 1  197  ? 76.185  77.634  -44.626 1.00 179.56 ? 197  PRO A O     1 
ATOM   1456  C  CB    . PRO A 1  197  ? 79.017  79.021  -43.414 1.00 174.64 ? 197  PRO A CB    1 
ATOM   1457  C  CG    . PRO A 1  197  ? 78.259  79.288  -42.115 1.00 181.14 ? 197  PRO A CG    1 
ATOM   1458  C  CD    . PRO A 1  197  ? 76.935  79.949  -42.456 1.00 182.43 ? 197  PRO A CD    1 
ATOM   1459  N  N     . GLU A 1  198  ? 78.124  77.143  -45.738 1.00 169.92 ? 198  GLU A N     1 
ATOM   1460  C  CA    . GLU A 1  198  ? 77.805  75.801  -46.247 1.00 166.75 ? 198  GLU A CA    1 
ATOM   1461  C  C     . GLU A 1  198  ? 78.512  74.799  -45.298 1.00 160.92 ? 198  GLU A C     1 
ATOM   1462  O  O     . GLU A 1  198  ? 79.741  74.821  -45.179 1.00 157.34 ? 198  GLU A O     1 
ATOM   1463  C  CB    . GLU A 1  198  ? 78.287  75.658  -47.715 1.00 168.69 ? 198  GLU A CB    1 
ATOM   1464  C  CG    . GLU A 1  198  ? 78.014  74.309  -48.370 1.00 180.69 ? 198  GLU A CG    1 
ATOM   1465  C  CD    . GLU A 1  198  ? 78.665  74.100  -49.727 1.00 201.99 ? 198  GLU A CD    1 
ATOM   1466  O  OE1   . GLU A 1  198  ? 78.155  74.675  -50.717 1.00 199.08 ? 198  GLU A OE1   1 
ATOM   1467  O  OE2   . GLU A 1  198  ? 79.669  73.349  -49.805 1.00 181.80 ? 198  GLU A OE2   1 
ATOM   1468  N  N     . LEU A 1  199  ? 77.731  73.979  -44.575 1.00 153.12 ? 199  LEU A N     1 
ATOM   1469  C  CA    . LEU A 1  199  ? 78.284  73.061  -43.584 1.00 147.07 ? 199  LEU A CA    1 
ATOM   1470  C  C     . LEU A 1  199  ? 77.959  71.618  -43.874 1.00 145.77 ? 199  LEU A C     1 
ATOM   1471  O  O     . LEU A 1  199  ? 76.817  71.193  -43.715 1.00 146.69 ? 199  LEU A O     1 
ATOM   1472  C  CB    . LEU A 1  199  ? 77.833  73.451  -42.171 1.00 148.02 ? 199  LEU A CB    1 
ATOM   1473  C  CG    . LEU A 1  199  ? 78.204  74.861  -41.725 1.00 155.18 ? 199  LEU A CG    1 
ATOM   1474  C  CD1   . LEU A 1  199  ? 76.987  75.787  -41.757 1.00 160.77 ? 199  LEU A CD1   1 
ATOM   1475  C  CD2   . LEU A 1  199  ? 78.837  74.841  -40.361 1.00 155.82 ? 199  LEU A CD2   1 
ATOM   1476  N  N     . ARG A 1  200  ? 78.973  70.859  -44.295 1.00 137.43 ? 200  ARG A N     1 
ATOM   1477  C  CA    . ARG A 1  200  ? 78.822  69.448  -44.619 1.00 134.42 ? 200  ARG A CA    1 
ATOM   1478  C  C     . ARG A 1  200  ? 79.947  68.573  -44.075 1.00 133.22 ? 200  ARG A C     1 
ATOM   1479  O  O     . ARG A 1  200  ? 81.071  69.034  -43.818 1.00 131.05 ? 200  ARG A O     1 
ATOM   1480  C  CB    . ARG A 1  200  ? 78.635  69.240  -46.131 1.00 135.65 ? 200  ARG A CB    1 
ATOM   1481  C  CG    . ARG A 1  200  ? 79.918  69.305  -46.949 1.00 142.76 ? 200  ARG A CG    1 
ATOM   1482  C  CD    . ARG A 1  200  ? 80.111  68.032  -47.747 1.00 149.70 ? 200  ARG A CD    1 
ATOM   1483  N  NE    . ARG A 1  200  ? 81.472  67.903  -48.267 1.00 157.02 ? 200  ARG A NE    1 
ATOM   1484  C  CZ    . ARG A 1  200  ? 81.937  68.544  -49.336 1.00 175.97 ? 200  ARG A CZ    1 
ATOM   1485  N  NH1   . ARG A 1  200  ? 81.160  69.393  -50.004 1.00 166.88 ? 200  ARG A NH1   1 
ATOM   1486  N  NH2   . ARG A 1  200  ? 83.189  68.358  -49.733 1.00 162.25 ? 200  ARG A NH2   1 
ATOM   1487  N  N     . VAL A 1  201  ? 79.628  67.291  -43.939 1.00 127.39 ? 201  VAL A N     1 
ATOM   1488  C  CA    . VAL A 1  201  ? 80.538  66.278  -43.449 1.00 122.71 ? 201  VAL A CA    1 
ATOM   1489  C  C     . VAL A 1  201  ? 81.414  65.826  -44.587 1.00 123.52 ? 201  VAL A C     1 
ATOM   1490  O  O     . VAL A 1  201  ? 80.918  65.480  -45.668 1.00 123.98 ? 201  VAL A O     1 
ATOM   1491  C  CB    . VAL A 1  201  ? 79.774  65.081  -42.847 1.00 126.30 ? 201  VAL A CB    1 
ATOM   1492  C  CG1   . VAL A 1  201  ? 80.721  64.140  -42.106 1.00 122.47 ? 201  VAL A CG1   1 
ATOM   1493  C  CG2   . VAL A 1  201  ? 78.643  65.546  -41.934 1.00 128.85 ? 201  VAL A CG2   1 
ATOM   1494  N  N     . LEU A 1  202  ? 82.723  65.820  -44.323 1.00 117.13 ? 202  LEU A N     1 
ATOM   1495  C  CA    . LEU A 1  202  ? 83.762  65.347  -45.230 1.00 115.03 ? 202  LEU A CA    1 
ATOM   1496  C  C     . LEU A 1  202  ? 83.786  63.825  -45.082 1.00 115.69 ? 202  LEU A C     1 
ATOM   1497  O  O     . LEU A 1  202  ? 83.910  63.312  -43.956 1.00 113.13 ? 202  LEU A O     1 
ATOM   1498  C  CB    . LEU A 1  202  ? 85.133  65.938  -44.855 1.00 113.45 ? 202  LEU A CB    1 
ATOM   1499  C  CG    . LEU A 1  202  ? 85.212  67.440  -44.608 1.00 120.47 ? 202  LEU A CG    1 
ATOM   1500  C  CD1   . LEU A 1  202  ? 86.327  67.766  -43.643 1.00 118.73 ? 202  LEU A CD1   1 
ATOM   1501  C  CD2   . LEU A 1  202  ? 85.414  68.198  -45.898 1.00 126.67 ? 202  LEU A CD2   1 
ATOM   1502  N  N     . SER A 1  203  ? 83.600  63.107  -46.205 1.00 112.13 ? 203  SER A N     1 
ATOM   1503  C  CA    . SER A 1  203  ? 83.562  61.647  -46.192 1.00 109.99 ? 203  SER A CA    1 
ATOM   1504  C  C     . SER A 1  203  ? 84.934  61.022  -46.033 1.00 111.15 ? 203  SER A C     1 
ATOM   1505  O  O     . SER A 1  203  ? 85.942  61.635  -46.392 1.00 109.84 ? 203  SER A O     1 
ATOM   1506  C  CB    . SER A 1  203  ? 82.829  61.090  -47.410 1.00 114.59 ? 203  SER A CB    1 
ATOM   1507  O  OG    . SER A 1  203  ? 83.285  61.615  -48.645 1.00 121.79 ? 203  SER A OG    1 
ATOM   1508  N  N     . THR A 1  204  ? 84.966  59.802  -45.473 1.00 106.15 ? 204  THR A N     1 
ATOM   1509  C  CA    . THR A 1  204  ? 86.193  59.035  -45.261 1.00 103.56 ? 204  THR A CA    1 
ATOM   1510  C  C     . THR A 1  204  ? 86.907  58.808  -46.603 1.00 108.06 ? 204  THR A C     1 
ATOM   1511  O  O     . THR A 1  204  ? 88.129  58.897  -46.670 1.00 107.17 ? 204  THR A O     1 
ATOM   1512  C  CB    . THR A 1  204  ? 85.879  57.713  -44.549 1.00 110.97 ? 204  THR A CB    1 
ATOM   1513  O  OG1   . THR A 1  204  ? 84.586  57.773  -43.928 1.00 113.33 ? 204  THR A OG1   1 
ATOM   1514  C  CG2   . THR A 1  204  ? 86.960  57.318  -43.550 1.00 104.60 ? 204  THR A CG2   1 
ATOM   1515  N  N     . GLU A 1  205  ? 86.127  58.569  -47.669 1.00 106.02 ? 205  GLU A N     1 
ATOM   1516  C  CA    . GLU A 1  205  ? 86.576  58.365  -49.045 1.00 106.84 ? 205  GLU A CA    1 
ATOM   1517  C  C     . GLU A 1  205  ? 87.167  59.672  -49.594 1.00 109.92 ? 205  GLU A C     1 
ATOM   1518  O  O     . GLU A 1  205  ? 88.195  59.635  -50.273 1.00 108.91 ? 205  GLU A O     1 
ATOM   1519  C  CB    . GLU A 1  205  ? 85.392  57.929  -49.940 1.00 111.34 ? 205  GLU A CB    1 
ATOM   1520  C  CG    . GLU A 1  205  ? 84.449  56.878  -49.361 1.00 126.82 ? 205  GLU A CG    1 
ATOM   1521  C  CD    . GLU A 1  205  ? 83.246  57.385  -48.581 1.00 157.51 ? 205  GLU A CD    1 
ATOM   1522  O  OE1   . GLU A 1  205  ? 83.368  57.594  -47.350 1.00 150.19 ? 205  GLU A OE1   1 
ATOM   1523  O  OE2   . GLU A 1  205  ? 82.166  57.532  -49.198 1.00 161.63 ? 205  GLU A OE2   1 
ATOM   1524  N  N     . GLU A 1  206  ? 86.495  60.821  -49.298 1.00 107.38 ? 206  GLU A N     1 
ATOM   1525  C  CA    . GLU A 1  206  ? 86.843  62.198  -49.703 1.00 108.45 ? 206  GLU A CA    1 
ATOM   1526  C  C     . GLU A 1  206  ? 88.242  62.522  -49.212 1.00 108.16 ? 206  GLU A C     1 
ATOM   1527  O  O     . GLU A 1  206  ? 89.131  62.805  -50.021 1.00 107.71 ? 206  GLU A O     1 
ATOM   1528  C  CB    . GLU A 1  206  ? 85.839  63.200  -49.089 1.00 111.69 ? 206  GLU A CB    1 
ATOM   1529  C  CG    . GLU A 1  206  ? 85.524  64.427  -49.922 1.00 126.75 ? 206  GLU A CG    1 
ATOM   1530  C  CD    . GLU A 1  206  ? 84.490  65.345  -49.292 1.00 150.90 ? 206  GLU A CD    1 
ATOM   1531  O  OE1   . GLU A 1  206  ? 84.867  66.136  -48.398 1.00 141.15 ? 206  GLU A OE1   1 
ATOM   1532  O  OE2   . GLU A 1  206  ? 83.305  65.285  -49.696 1.00 150.37 ? 206  GLU A OE2   1 
ATOM   1533  N  N     . ILE A 1  207  ? 88.434  62.416  -47.874 1.00 101.20 ? 207  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1  207  ? 89.695  62.642  -47.163 1.00 97.79  ? 207  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1  207  ? 90.773  61.781  -47.804 1.00 96.91  ? 207  ILE A C     1 
ATOM   1536  O  O     . ILE A 1  207  ? 91.842  62.290  -48.126 1.00 96.26  ? 207  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1  207  ? 89.570  62.297  -45.649 1.00 98.82  ? 207  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1  207  ? 88.304  62.921  -44.966 1.00 100.00 ? 207  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1  207  ? 90.856  62.652  -44.915 1.00 98.56  ? 207  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1  207  ? 88.392  64.304  -44.395 1.00 103.59 ? 207  ILE A CD1   1 
ATOM   1541  N  N     . LEU A 1  208  ? 90.466  60.485  -48.001 1.00 90.94  ? 208  LEU A N     1 
ATOM   1542  C  CA    . LEU A 1  208  ? 91.359  59.507  -48.586 1.00 89.54  ? 208  LEU A CA    1 
ATOM   1543  C  C     . LEU A 1  208  ? 91.898  59.893  -49.927 1.00 97.12  ? 208  LEU A C     1 
ATOM   1544  O  O     . LEU A 1  208  ? 93.118  59.954  -50.055 1.00 96.82  ? 208  LEU A O     1 
ATOM   1545  C  CB    . LEU A 1  208  ? 90.739  58.126  -48.662 1.00 88.74  ? 208  LEU A CB    1 
ATOM   1546  C  CG    . LEU A 1  208  ? 91.470  57.054  -47.893 1.00 91.17  ? 208  LEU A CG    1 
ATOM   1547  C  CD1   . LEU A 1  208  ? 91.031  55.702  -48.350 1.00 91.94  ? 208  LEU A CD1   1 
ATOM   1548  C  CD2   . LEU A 1  208  ? 92.986  57.173  -48.032 1.00 92.61  ? 208  LEU A CD2   1 
ATOM   1549  N  N     . ASN A 1  209  ? 91.026  60.169  -50.922 1.00 96.53  ? 209  ASN A N     1 
ATOM   1550  C  CA    . ASN A 1  209  ? 91.491  60.550  -52.255 1.00 98.75  ? 209  ASN A CA    1 
ATOM   1551  C  C     . ASN A 1  209  ? 92.308  61.853  -52.223 1.00 103.74 ? 209  ASN A C     1 
ATOM   1552  O  O     . ASN A 1  209  ? 93.195  62.020  -53.059 1.00 104.38 ? 209  ASN A O     1 
ATOM   1553  C  CB    . ASN A 1  209  ? 90.356  60.579  -53.266 1.00 102.95 ? 209  ASN A CB    1 
ATOM   1554  C  CG    . ASN A 1  209  ? 90.177  61.891  -53.985 1.00 135.05 ? 209  ASN A CG    1 
ATOM   1555  O  OD1   . ASN A 1  209  ? 89.460  62.790  -53.522 1.00 132.22 ? 209  ASN A OD1   1 
ATOM   1556  N  ND2   . ASN A 1  209  ? 90.844  62.031  -55.124 1.00 128.90 ? 209  ASN A ND2   1 
ATOM   1557  N  N     . ILE A 1  210  ? 92.042  62.744  -51.235 1.00 100.24 ? 210  ILE A N     1 
ATOM   1558  C  CA    . ILE A 1  210  ? 92.809  63.983  -51.038 1.00 100.88 ? 210  ILE A CA    1 
ATOM   1559  C  C     . ILE A 1  210  ? 94.215  63.623  -50.494 1.00 103.44 ? 210  ILE A C     1 
ATOM   1560  O  O     . ILE A 1  210  ? 95.218  64.158  -50.979 1.00 104.20 ? 210  ILE A O     1 
ATOM   1561  C  CB    . ILE A 1  210  ? 92.023  65.063  -50.201 1.00 104.50 ? 210  ILE A CB    1 
ATOM   1562  C  CG1   . ILE A 1  210  ? 91.226  66.024  -51.124 1.00 108.58 ? 210  ILE A CG1   1 
ATOM   1563  C  CG2   . ILE A 1  210  ? 92.927  65.894  -49.280 1.00 103.49 ? 210  ILE A CG2   1 
ATOM   1564  C  CD1   . ILE A 1  210  ? 89.796  65.581  -51.561 1.00 117.50 ? 210  ILE A CD1   1 
ATOM   1565  N  N     . PHE A 1  211  ? 94.272  62.668  -49.540 1.00 97.46  ? 211  PHE A N     1 
ATOM   1566  C  CA    . PHE A 1  211  ? 95.506  62.177  -48.924 1.00 95.24  ? 211  PHE A CA    1 
ATOM   1567  C  C     . PHE A 1  211  ? 96.347  61.429  -49.930 1.00 103.43 ? 211  PHE A C     1 
ATOM   1568  O  O     . PHE A 1  211  ? 97.578  61.564  -49.937 1.00 103.84 ? 211  PHE A O     1 
ATOM   1569  C  CB    . PHE A 1  211  ? 95.198  61.286  -47.713 1.00 93.74  ? 211  PHE A CB    1 
ATOM   1570  C  CG    . PHE A 1  211  ? 94.933  62.016  -46.419 1.00 93.83  ? 211  PHE A CG    1 
ATOM   1571  C  CD1   . PHE A 1  211  ? 94.512  63.343  -46.419 1.00 97.80  ? 211  PHE A CD1   1 
ATOM   1572  C  CD2   . PHE A 1  211  ? 95.061  61.367  -45.202 1.00 93.96  ? 211  PHE A CD2   1 
ATOM   1573  C  CE1   . PHE A 1  211  ? 94.258  64.016  -45.224 1.00 98.32  ? 211  PHE A CE1   1 
ATOM   1574  C  CE2   . PHE A 1  211  ? 94.787  62.036  -44.004 1.00 96.64  ? 211  PHE A CE2   1 
ATOM   1575  C  CZ    . PHE A 1  211  ? 94.389  63.358  -44.024 1.00 96.12  ? 211  PHE A CZ    1 
ATOM   1576  N  N     . LYS A 1  212  ? 95.672  60.667  -50.811 1.00 102.81 ? 212  LYS A N     1 
ATOM   1577  C  CA    . LYS A 1  212  ? 96.289  59.877  -51.874 1.00 104.68 ? 212  LYS A CA    1 
ATOM   1578  C  C     . LYS A 1  212  ? 96.957  60.783  -52.907 1.00 112.07 ? 212  LYS A C     1 
ATOM   1579  O  O     . LYS A 1  212  ? 97.926  60.377  -53.560 1.00 112.18 ? 212  LYS A O     1 
ATOM   1580  C  CB    . LYS A 1  212  ? 95.253  58.939  -52.511 1.00 108.54 ? 212  LYS A CB    1 
ATOM   1581  C  CG    . LYS A 1  212  ? 94.972  57.681  -51.678 1.00 125.41 ? 212  LYS A CG    1 
ATOM   1582  C  CD    . LYS A 1  212  ? 93.531  57.221  -51.849 1.00 141.02 ? 212  LYS A CD    1 
ATOM   1583  C  CE    . LYS A 1  212  ? 93.319  55.777  -51.473 1.00 155.78 ? 212  LYS A CE    1 
ATOM   1584  N  NZ    . LYS A 1  212  ? 91.913  55.355  -51.716 1.00 169.29 ? 212  LYS A NZ    1 
ATOM   1585  N  N     . HIS A 1  213  ? 96.461  62.034  -52.992 1.00 111.02 ? 213  HIS A N     1 
ATOM   1586  C  CA    . HIS A 1  213  ? 96.969  63.084  -53.857 1.00 113.82 ? 213  HIS A CA    1 
ATOM   1587  C  C     . HIS A 1  213  ? 98.057  63.923  -53.191 1.00 116.57 ? 213  HIS A C     1 
ATOM   1588  O  O     . HIS A 1  213  ? 98.743  64.649  -53.910 1.00 119.02 ? 213  HIS A O     1 
ATOM   1589  C  CB    . HIS A 1  213  ? 95.827  63.955  -54.403 1.00 117.59 ? 213  HIS A CB    1 
ATOM   1590  C  CG    . HIS A 1  213  ? 94.966  63.264  -55.421 1.00 123.28 ? 213  HIS A CG    1 
ATOM   1591  N  ND1   . HIS A 1  213  ? 95.200  61.948  -55.806 1.00 124.71 ? 213  HIS A ND1   1 
ATOM   1592  C  CD2   . HIS A 1  213  ? 93.891  63.731  -56.099 1.00 128.17 ? 213  HIS A CD2   1 
ATOM   1593  C  CE1   . HIS A 1  213  ? 94.265  61.664  -56.699 1.00 126.47 ? 213  HIS A CE1   1 
ATOM   1594  N  NE2   . HIS A 1  213  ? 93.454  62.706  -56.910 1.00 128.88 ? 213  HIS A NE2   1 
ATOM   1595  N  N     . ILE A 1  214  ? 98.255  63.817  -51.843 1.00 109.43 ? 214  ILE A N     1 
ATOM   1596  C  CA    . ILE A 1  214  ? 99.332  64.568  -51.168 1.00 108.40 ? 214  ILE A CA    1 
ATOM   1597  C  C     . ILE A 1  214  ? 100.685 64.029  -51.646 1.00 112.56 ? 214  ILE A C     1 
ATOM   1598  O  O     . ILE A 1  214  ? 100.947 62.820  -51.533 1.00 110.92 ? 214  ILE A O     1 
ATOM   1599  C  CB    . ILE A 1  214  ? 99.257  64.648  -49.612 1.00 108.60 ? 214  ILE A CB    1 
ATOM   1600  C  CG1   . ILE A 1  214  ? 97.856  65.024  -49.110 1.00 108.39 ? 214  ILE A CG1   1 
ATOM   1601  C  CG2   . ILE A 1  214  ? 100.302 65.649  -49.090 1.00 109.72 ? 214  ILE A CG2   1 
ATOM   1602  C  CD1   . ILE A 1  214  ? 97.665  64.867  -47.603 1.00 110.67 ? 214  ILE A CD1   1 
ATOM   1603  N  N     . SER A 1  215  ? 101.515 64.933  -52.208 1.00 110.61 ? 215  SER A N     1 
ATOM   1604  C  CA    . SER A 1  215  ? 102.832 64.616  -52.759 1.00 111.16 ? 215  SER A CA    1 
ATOM   1605  C  C     . SER A 1  215  ? 103.818 64.191  -51.696 1.00 111.04 ? 215  SER A C     1 
ATOM   1606  O  O     . SER A 1  215  ? 103.699 64.620  -50.547 1.00 109.14 ? 215  SER A O     1 
ATOM   1607  C  CB    . SER A 1  215  ? 103.387 65.797  -53.550 1.00 119.75 ? 215  SER A CB    1 
ATOM   1608  O  OG    . SER A 1  215  ? 103.894 66.829  -52.722 1.00 132.08 ? 215  SER A OG    1 
ATOM   1609  N  N     . VAL A 1  216  ? 104.803 63.357  -52.089 1.00 106.40 ? 216  VAL A N     1 
ATOM   1610  C  CA    . VAL A 1  216  ? 105.837 62.843  -51.190 1.00 104.06 ? 216  VAL A CA    1 
ATOM   1611  C  C     . VAL A 1  216  ? 106.551 64.006  -50.533 1.00 108.87 ? 216  VAL A C     1 
ATOM   1612  O  O     . VAL A 1  216  ? 106.540 64.094  -49.310 1.00 105.89 ? 216  VAL A O     1 
ATOM   1613  C  CB    . VAL A 1  216  ? 106.800 61.839  -51.867 1.00 107.99 ? 216  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1  216  ? 107.822 61.313  -50.872 1.00 106.53 ? 216  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1  216  ? 106.031 60.679  -52.481 1.00 107.13 ? 216  VAL A CG2   1 
ATOM   1616  N  N     . LYS A 1  217  ? 107.061 64.951  -51.346 1.00 109.69 ? 217  LYS A N     1 
ATOM   1617  C  CA    . LYS A 1  217  ? 107.736 66.159  -50.876 1.00 111.78 ? 217  LYS A CA    1 
ATOM   1618  C  C     . LYS A 1  217  ? 106.941 66.832  -49.756 1.00 115.53 ? 217  LYS A C     1 
ATOM   1619  O  O     . LYS A 1  217  ? 107.493 67.059  -48.680 1.00 114.87 ? 217  LYS A O     1 
ATOM   1620  C  CB    . LYS A 1  217  ? 107.971 67.142  -52.038 1.00 118.45 ? 217  LYS A CB    1 
ATOM   1621  C  CG    . LYS A 1  217  ? 109.211 66.823  -52.873 1.00 139.36 ? 217  LYS A CG    1 
ATOM   1622  C  CD    . LYS A 1  217  ? 110.212 67.992  -52.910 1.00 149.28 ? 217  LYS A CD    1 
ATOM   1623  C  CE    . LYS A 1  217  ? 111.466 67.649  -53.683 1.00 154.39 ? 217  LYS A CE    1 
ATOM   1624  N  NZ    . LYS A 1  217  ? 112.510 68.696  -53.542 1.00 162.51 ? 217  LYS A NZ    1 
ATOM   1625  N  N     . ASP A 1  218  ? 105.629 67.074  -49.993 1.00 112.31 ? 218  ASP A N     1 
ATOM   1626  C  CA    . ASP A 1  218  ? 104.699 67.704  -49.053 1.00 111.37 ? 218  ASP A CA    1 
ATOM   1627  C  C     . ASP A 1  218  ? 104.446 66.853  -47.797 1.00 110.11 ? 218  ASP A C     1 
ATOM   1628  O  O     . ASP A 1  218  ? 104.505 67.404  -46.694 1.00 109.07 ? 218  ASP A O     1 
ATOM   1629  C  CB    . ASP A 1  218  ? 103.340 68.035  -49.732 1.00 114.94 ? 218  ASP A CB    1 
ATOM   1630  C  CG    . ASP A 1  218  ? 103.252 69.239  -50.676 1.00 133.92 ? 218  ASP A CG    1 
ATOM   1631  O  OD1   . ASP A 1  218  ? 104.199 70.070  -50.686 1.00 136.42 ? 218  ASP A OD1   1 
ATOM   1632  O  OD2   . ASP A 1  218  ? 102.213 69.372  -51.373 1.00 142.56 ? 218  ASP A OD2   1 
ATOM   1633  N  N     . PHE A 1  219  ? 104.126 65.533  -47.948 1.00 102.96 ? 219  PHE A N     1 
ATOM   1634  C  CA    . PHE A 1  219  ? 103.799 64.717  -46.776 1.00 98.99  ? 219  PHE A CA    1 
ATOM   1635  C  C     . PHE A 1  219  ? 105.015 64.348  -45.967 1.00 101.94 ? 219  PHE A C     1 
ATOM   1636  O  O     . PHE A 1  219  ? 104.858 64.075  -44.783 1.00 99.80  ? 219  PHE A O     1 
ATOM   1637  C  CB    . PHE A 1  219  ? 102.911 63.492  -47.071 1.00 98.66  ? 219  PHE A CB    1 
ATOM   1638  C  CG    . PHE A 1  219  ? 103.449 62.296  -47.815 1.00 99.21  ? 219  PHE A CG    1 
ATOM   1639  C  CD1   . PHE A 1  219  ? 104.404 61.469  -47.237 1.00 100.69 ? 219  PHE A CD1   1 
ATOM   1640  C  CD2   . PHE A 1  219  ? 102.864 61.883  -49.002 1.00 102.02 ? 219  PHE A CD2   1 
ATOM   1641  C  CE1   . PHE A 1  219  ? 104.868 60.333  -47.902 1.00 101.49 ? 219  PHE A CE1   1 
ATOM   1642  C  CE2   . PHE A 1  219  ? 103.309 60.733  -49.656 1.00 104.96 ? 219  PHE A CE2   1 
ATOM   1643  C  CZ    . PHE A 1  219  ? 104.321 59.973  -49.108 1.00 101.86 ? 219  PHE A CZ    1 
ATOM   1644  N  N     . THR A 1  220  ? 106.221 64.372  -46.574 1.00 100.22 ? 220  THR A N     1 
ATOM   1645  C  CA    . THR A 1  220  ? 107.464 64.107  -45.848 1.00 100.23 ? 220  THR A CA    1 
ATOM   1646  C  C     . THR A 1  220  ? 107.885 65.396  -45.170 1.00 106.33 ? 220  THR A C     1 
ATOM   1647  O  O     . THR A 1  220  ? 108.664 65.355  -44.220 1.00 106.38 ? 220  THR A O     1 
ATOM   1648  C  CB    . THR A 1  220  ? 108.537 63.439  -46.714 1.00 111.90 ? 220  THR A CB    1 
ATOM   1649  O  OG1   . THR A 1  220  ? 107.918 62.503  -47.596 1.00 113.53 ? 220  THR A OG1   1 
ATOM   1650  C  CG2   . THR A 1  220  ? 109.566 62.691  -45.880 1.00 111.01 ? 220  THR A CG2   1 
ATOM   1651  N  N     . SER A 1  221  ? 107.302 66.542  -45.610 1.00 104.45 ? 221  SER A N     1 
ATOM   1652  C  CA    . SER A 1  221  ? 107.482 67.852  -44.985 1.00 105.68 ? 221  SER A CA    1 
ATOM   1653  C  C     . SER A 1  221  ? 106.663 67.850  -43.697 1.00 107.02 ? 221  SER A C     1 
ATOM   1654  O  O     . SER A 1  221  ? 107.026 68.535  -42.745 1.00 106.99 ? 221  SER A O     1 
ATOM   1655  C  CB    . SER A 1  221  ? 107.043 68.972  -45.916 1.00 112.42 ? 221  SER A CB    1 
ATOM   1656  O  OG    . SER A 1  221  ? 107.977 69.130  -46.973 1.00 125.52 ? 221  SER A OG    1 
ATOM   1657  N  N     . LEU A 1  222  ? 105.580 67.025  -43.670 1.00 101.39 ? 222  LEU A N     1 
ATOM   1658  C  CA    . LEU A 1  222  ? 104.725 66.683  -42.520 1.00 98.91  ? 222  LEU A CA    1 
ATOM   1659  C  C     . LEU A 1  222  ? 105.381 65.394  -41.934 1.00 103.63 ? 222  LEU A C     1 
ATOM   1660  O  O     . LEU A 1  222  ? 106.279 64.840  -42.585 1.00 103.90 ? 222  LEU A O     1 
ATOM   1661  C  CB    . LEU A 1  222  ? 103.281 66.414  -42.989 1.00 97.40  ? 222  LEU A CB    1 
ATOM   1662  C  CG    . LEU A 1  222  ? 102.694 67.377  -44.033 1.00 102.55 ? 222  LEU A CG    1 
ATOM   1663  C  CD1   . LEU A 1  222  ? 101.459 66.808  -44.668 1.00 101.36 ? 222  LEU A CD1   1 
ATOM   1664  C  CD2   . LEU A 1  222  ? 102.422 68.738  -43.452 1.00 105.59 ? 222  LEU A CD2   1 
ATOM   1665  N  N     . GLY A 1  223  ? 104.989 64.950  -40.730 1.00 100.16 ? 223  GLY A N     1 
ATOM   1666  C  CA    . GLY A 1  223  ? 105.601 63.790  -40.044 1.00 98.94  ? 223  GLY A CA    1 
ATOM   1667  C  C     . GLY A 1  223  ? 106.080 62.562  -40.835 1.00 99.81  ? 223  GLY A C     1 
ATOM   1668  O  O     . GLY A 1  223  ? 107.184 62.050  -40.614 1.00 98.28  ? 223  GLY A O     1 
ATOM   1669  N  N     . PHE A 1  224  ? 105.242 62.150  -41.812 1.00 94.52  ? 224  PHE A N     1 
ATOM   1670  C  CA    . PHE A 1  224  ? 105.166 60.980  -42.702 1.00 92.13  ? 224  PHE A CA    1 
ATOM   1671  C  C     . PHE A 1  224  ? 106.438 60.582  -43.418 1.00 96.67  ? 224  PHE A C     1 
ATOM   1672  O  O     . PHE A 1  224  ? 107.353 61.390  -43.604 1.00 97.73  ? 224  PHE A O     1 
ATOM   1673  C  CB    . PHE A 1  224  ? 104.002 61.164  -43.710 1.00 93.24  ? 224  PHE A CB    1 
ATOM   1674  C  CG    . PHE A 1  224  ? 102.760 61.431  -42.901 1.00 92.94  ? 224  PHE A CG    1 
ATOM   1675  C  CD1   . PHE A 1  224  ? 102.069 60.385  -42.303 1.00 93.12  ? 224  PHE A CD1   1 
ATOM   1676  C  CD2   . PHE A 1  224  ? 102.417 62.727  -42.540 1.00 96.11  ? 224  PHE A CD2   1 
ATOM   1677  C  CE1   . PHE A 1  224  ? 101.027 60.631  -41.412 1.00 95.12  ? 224  PHE A CE1   1 
ATOM   1678  C  CE2   . PHE A 1  224  ? 101.380 62.969  -41.644 1.00 96.40  ? 224  PHE A CE2   1 
ATOM   1679  C  CZ    . PHE A 1  224  ? 100.682 61.921  -41.097 1.00 94.00  ? 224  PHE A CZ    1 
ATOM   1680  N  N     . ASN A 1  225  ? 106.475 59.268  -43.762 1.00 92.94  ? 225  ASN A N     1 
ATOM   1681  C  CA    . ASN A 1  225  ? 107.538 58.504  -44.425 1.00 93.77  ? 225  ASN A CA    1 
ATOM   1682  C  C     . ASN A 1  225  ? 106.991 57.686  -45.608 1.00 98.12  ? 225  ASN A C     1 
ATOM   1683  O  O     . ASN A 1  225  ? 106.182 56.761  -45.420 1.00 95.99  ? 225  ASN A O     1 
ATOM   1684  C  CB    . ASN A 1  225  ? 108.202 57.550  -43.434 1.00 91.09  ? 225  ASN A CB    1 
ATOM   1685  C  CG    . ASN A 1  225  ? 109.426 56.888  -43.988 1.00 105.69 ? 225  ASN A CG    1 
ATOM   1686  O  OD1   . ASN A 1  225  ? 110.529 57.392  -43.838 1.00 108.19 ? 225  ASN A OD1   1 
ATOM   1687  N  ND2   . ASN A 1  225  ? 109.270 55.764  -44.662 1.00 90.29  ? 225  ASN A ND2   1 
ATOM   1688  N  N     . GLU A 1  226  ? 107.528 57.986  -46.810 1.00 96.12  ? 226  GLU A N     1 
ATOM   1689  C  CA    . GLU A 1  226  ? 107.214 57.396  -48.113 1.00 96.01  ? 226  GLU A CA    1 
ATOM   1690  C  C     . GLU A 1  226  ? 107.025 55.880  -48.103 1.00 96.05  ? 226  GLU A C     1 
ATOM   1691  O  O     . GLU A 1  226  ? 106.165 55.375  -48.831 1.00 95.86  ? 226  GLU A O     1 
ATOM   1692  C  CB    . GLU A 1  226  ? 108.323 57.764  -49.105 1.00 100.07 ? 226  GLU A CB    1 
ATOM   1693  C  CG    . GLU A 1  226  ? 107.927 57.557  -50.555 1.00 117.10 ? 226  GLU A CG    1 
ATOM   1694  C  CD    . GLU A 1  226  ? 109.036 57.717  -51.575 1.00 158.87 ? 226  GLU A CD    1 
ATOM   1695  O  OE1   . GLU A 1  226  ? 110.140 58.184  -51.205 1.00 165.84 ? 226  GLU A OE1   1 
ATOM   1696  O  OE2   . GLU A 1  226  ? 108.794 57.378  -52.757 1.00 162.27 ? 226  GLU A OE2   1 
ATOM   1697  N  N     . VAL A 1  227  ? 107.831 55.170  -47.284 1.00 89.68  ? 227  VAL A N     1 
ATOM   1698  C  CA    . VAL A 1  227  ? 107.881 53.709  -47.178 1.00 88.09  ? 227  VAL A CA    1 
ATOM   1699  C  C     . VAL A 1  227  ? 107.131 53.109  -45.981 1.00 89.50  ? 227  VAL A C     1 
ATOM   1700  O  O     . VAL A 1  227  ? 106.413 52.108  -46.140 1.00 88.16  ? 227  VAL A O     1 
ATOM   1701  C  CB    . VAL A 1  227  ? 109.362 53.276  -47.174 1.00 92.82  ? 227  VAL A CB    1 
ATOM   1702  C  CG1   . VAL A 1  227  ? 109.561 51.910  -46.526 1.00 91.95  ? 227  VAL A CG1   1 
ATOM   1703  C  CG2   . VAL A 1  227  ? 109.929 53.295  -48.585 1.00 95.13  ? 227  VAL A CG2   1 
ATOM   1704  N  N     . PHE A 1  228  ? 107.339 53.685  -44.785 1.00 84.86  ? 228  PHE A N     1 
ATOM   1705  C  CA    . PHE A 1  228  ? 106.803 53.144  -43.548 1.00 82.37  ? 228  PHE A CA    1 
ATOM   1706  C  C     . PHE A 1  228  ? 105.494 53.750  -43.097 1.00 85.35  ? 228  PHE A C     1 
ATOM   1707  O  O     . PHE A 1  228  ? 104.693 52.988  -42.552 1.00 83.60  ? 228  PHE A O     1 
ATOM   1708  C  CB    . PHE A 1  228  ? 107.852 53.203  -42.441 1.00 83.57  ? 228  PHE A CB    1 
ATOM   1709  C  CG    . PHE A 1  228  ? 109.053 52.349  -42.772 1.00 85.54  ? 228  PHE A CG    1 
ATOM   1710  C  CD1   . PHE A 1  228  ? 108.926 50.978  -42.951 1.00 87.43  ? 228  PHE A CD1   1 
ATOM   1711  C  CD2   . PHE A 1  228  ? 110.292 52.920  -42.972 1.00 89.16  ? 228  PHE A CD2   1 
ATOM   1712  C  CE1   . PHE A 1  228  ? 110.025 50.191  -43.278 1.00 90.73  ? 228  PHE A CE1   1 
ATOM   1713  C  CE2   . PHE A 1  228  ? 111.393 52.129  -43.285 1.00 91.41  ? 228  PHE A CE2   1 
ATOM   1714  C  CZ    . PHE A 1  228  ? 111.247 50.772  -43.440 1.00 90.12  ? 228  PHE A CZ    1 
ATOM   1715  N  N     . SER A 1  229  ? 105.240 55.073  -43.326 1.00 82.56  ? 229  SER A N     1 
ATOM   1716  C  CA    . SER A 1  229  ? 103.945 55.654  -42.930 1.00 81.91  ? 229  SER A CA    1 
ATOM   1717  C  C     . SER A 1  229  ? 103.436 56.819  -43.795 1.00 86.11  ? 229  SER A C     1 
ATOM   1718  O  O     . SER A 1  229  ? 103.682 57.986  -43.501 1.00 86.14  ? 229  SER A O     1 
ATOM   1719  C  CB    . SER A 1  229  ? 103.932 56.060  -41.462 1.00 85.93  ? 229  SER A CB    1 
ATOM   1720  O  OG    . SER A 1  229  ? 104.833 57.121  -41.206 1.00 100.10 ? 229  SER A OG    1 
ATOM   1721  N  N     . ARG A 1  230  ? 102.657 56.489  -44.822 1.00 82.78  ? 230  ARG A N     1 
ATOM   1722  C  CA    . ARG A 1  230  ? 102.029 57.472  -45.690 1.00 83.68  ? 230  ARG A CA    1 
ATOM   1723  C  C     . ARG A 1  230  ? 100.777 57.999  -44.989 1.00 87.94  ? 230  ARG A C     1 
ATOM   1724  O  O     . ARG A 1  230  ? 100.113 57.226  -44.296 1.00 86.77  ? 230  ARG A O     1 
ATOM   1725  C  CB    . ARG A 1  230  ? 101.650 56.838  -47.036 1.00 83.61  ? 230  ARG A CB    1 
ATOM   1726  C  CG    . ARG A 1  230  ? 102.847 56.495  -47.894 1.00 93.41  ? 230  ARG A CG    1 
ATOM   1727  C  CD    . ARG A 1  230  ? 102.439 55.775  -49.154 1.00 105.30 ? 230  ARG A CD    1 
ATOM   1728  N  NE    . ARG A 1  230  ? 103.465 55.920  -50.175 1.00 124.19 ? 230  ARG A NE    1 
ATOM   1729  C  CZ    . ARG A 1  230  ? 103.463 56.884  -51.087 1.00 154.95 ? 230  ARG A CZ    1 
ATOM   1730  N  NH1   . ARG A 1  230  ? 102.468 57.765  -51.131 1.00 145.56 ? 230  ARG A NH1   1 
ATOM   1731  N  NH2   . ARG A 1  230  ? 104.448 56.969  -51.971 1.00 154.93 ? 230  ARG A NH2   1 
ATOM   1732  N  N     . PRO A 1  231  ? 100.419 59.289  -45.170 1.00 85.96  ? 231  PRO A N     1 
ATOM   1733  C  CA    . PRO A 1  231  ? 99.188  59.821  -44.549 1.00 86.00  ? 231  PRO A CA    1 
ATOM   1734  C  C     . PRO A 1  231  ? 97.918  59.025  -44.858 1.00 91.55  ? 231  PRO A C     1 
ATOM   1735  O  O     . PRO A 1  231  ? 97.062  58.880  -43.991 1.00 90.30  ? 231  PRO A O     1 
ATOM   1736  C  CB    . PRO A 1  231  ? 99.094  61.231  -45.125 1.00 89.51  ? 231  PRO A CB    1 
ATOM   1737  C  CG    . PRO A 1  231  ? 99.946  61.187  -46.369 1.00 95.31  ? 231  PRO A CG    1 
ATOM   1738  C  CD    . PRO A 1  231  ? 101.085 60.324  -45.974 1.00 89.52  ? 231  PRO A CD    1 
ATOM   1739  N  N     . GLU A 1  232  ? 97.820  58.480  -46.080 1.00 90.63  ? 232  GLU A N     1 
ATOM   1740  C  CA    . GLU A 1  232  ? 96.695  57.659  -46.526 1.00 91.12  ? 232  GLU A CA    1 
ATOM   1741  C  C     . GLU A 1  232  ? 96.491  56.396  -45.667 1.00 93.58  ? 232  GLU A C     1 
ATOM   1742  O  O     . GLU A 1  232  ? 95.359  55.934  -45.542 1.00 93.52  ? 232  GLU A O     1 
ATOM   1743  C  CB    . GLU A 1  232  ? 96.807  57.317  -48.033 1.00 94.18  ? 232  GLU A CB    1 
ATOM   1744  C  CG    . GLU A 1  232  ? 98.133  56.709  -48.469 1.00 106.14 ? 232  GLU A CG    1 
ATOM   1745  C  CD    . GLU A 1  232  ? 98.846  57.470  -49.572 1.00 138.67 ? 232  GLU A CD    1 
ATOM   1746  O  OE1   . GLU A 1  232  ? 99.439  58.538  -49.289 1.00 132.90 ? 232  GLU A OE1   1 
ATOM   1747  O  OE2   . GLU A 1  232  ? 98.821  56.982  -50.725 1.00 141.35 ? 232  GLU A OE2   1 
ATOM   1748  N  N     . TRP A 1  233  ? 97.558  55.872  -45.041 1.00 89.10  ? 233  TRP A N     1 
ATOM   1749  C  CA    . TRP A 1  233  ? 97.451  54.658  -44.223 1.00 88.36  ? 233  TRP A CA    1 
ATOM   1750  C  C     . TRP A 1  233  ? 96.833  54.879  -42.833 1.00 91.00  ? 233  TRP A C     1 
ATOM   1751  O  O     . TRP A 1  233  ? 96.562  53.892  -42.111 1.00 89.61  ? 233  TRP A O     1 
ATOM   1752  C  CB    . TRP A 1  233  ? 98.792  53.928  -44.119 1.00 86.96  ? 233  TRP A CB    1 
ATOM   1753  C  CG    . TRP A 1  233  ? 99.349  53.508  -45.443 1.00 89.07  ? 233  TRP A CG    1 
ATOM   1754  C  CD1   . TRP A 1  233  ? 98.653  53.218  -46.579 1.00 93.00  ? 233  TRP A CD1   1 
ATOM   1755  C  CD2   . TRP A 1  233  ? 100.725 53.291  -45.747 1.00 89.57  ? 233  TRP A CD2   1 
ATOM   1756  N  NE1   . TRP A 1  233  ? 99.515  52.868  -47.584 1.00 93.61  ? 233  TRP A NE1   1 
ATOM   1757  C  CE2   . TRP A 1  233  ? 100.799 52.919  -47.106 1.00 94.94  ? 233  TRP A CE2   1 
ATOM   1758  C  CE3   . TRP A 1  233  ? 101.913 53.389  -45.006 1.00 90.64  ? 233  TRP A CE3   1 
ATOM   1759  C  CZ2   . TRP A 1  233  ? 102.018 52.637  -47.738 1.00 95.59  ? 233  TRP A CZ2   1 
ATOM   1760  C  CZ3   . TRP A 1  233  ? 103.122 53.131  -45.637 1.00 93.34  ? 233  TRP A CZ3   1 
ATOM   1761  C  CH2   . TRP A 1  233  ? 103.168 52.762  -46.987 1.00 95.43  ? 233  TRP A CH2   1 
ATOM   1762  N  N     . MET A 1  234  ? 96.576  56.166  -42.478 1.00 86.56  ? 234  MET A N     1 
ATOM   1763  C  CA    . MET A 1  234  ? 95.917  56.509  -41.222 1.00 85.34  ? 234  MET A CA    1 
ATOM   1764  C  C     . MET A 1  234  ? 94.432  56.162  -41.345 1.00 90.15  ? 234  MET A C     1 
ATOM   1765  O  O     . MET A 1  234  ? 93.771  56.032  -40.319 1.00 91.05  ? 234  MET A O     1 
ATOM   1766  C  CB    . MET A 1  234  ? 96.091  57.983  -40.856 1.00 87.98  ? 234  MET A CB    1 
ATOM   1767  C  CG    . MET A 1  234  ? 97.495  58.368  -40.479 1.00 91.02  ? 234  MET A CG    1 
ATOM   1768  S  SD    . MET A 1  234  ? 97.638  60.096  -39.903 1.00 96.17  ? 234  MET A SD    1 
ATOM   1769  C  CE    . MET A 1  234  ? 97.198  61.035  -41.401 1.00 94.16  ? 234  MET A CE    1 
ATOM   1770  N  N     . ILE A 1  235  ? 93.909  55.998  -42.589 1.00 85.87  ? 235  ILE A N     1 
ATOM   1771  C  CA    . ILE A 1  235  ? 92.523  55.588  -42.853 1.00 85.82  ? 235  ILE A CA    1 
ATOM   1772  C  C     . ILE A 1  235  ? 92.524  54.103  -43.205 1.00 90.60  ? 235  ILE A C     1 
ATOM   1773  O  O     . ILE A 1  235  ? 93.355  53.668  -44.001 1.00 91.19  ? 235  ILE A O     1 
ATOM   1774  C  CB    . ILE A 1  235  ? 91.850  56.477  -43.916 1.00 90.13  ? 235  ILE A CB    1 
ATOM   1775  C  CG1   . ILE A 1  235  ? 91.699  57.903  -43.365 1.00 91.19  ? 235  ILE A CG1   1 
ATOM   1776  C  CG2   . ILE A 1  235  ? 90.488  55.919  -44.322 1.00 91.56  ? 235  ILE A CG2   1 
ATOM   1777  C  CD1   . ILE A 1  235  ? 91.687  58.984  -44.380 1.00 102.77 ? 235  ILE A CD1   1 
ATOM   1778  N  N     . LEU A 1  236  ? 91.618  53.328  -42.588 1.00 87.17  ? 236  LEU A N     1 
ATOM   1779  C  CA    . LEU A 1  236  ? 91.511  51.871  -42.737 1.00 87.00  ? 236  LEU A CA    1 
ATOM   1780  C  C     . LEU A 1  236  ? 90.573  51.387  -43.856 1.00 94.30  ? 236  LEU A C     1 
ATOM   1781  O  O     . LEU A 1  236  ? 89.403  51.776  -43.928 1.00 95.16  ? 236  LEU A O     1 
ATOM   1782  C  CB    . LEU A 1  236  ? 91.115  51.241  -41.403 1.00 85.97  ? 236  LEU A CB    1 
ATOM   1783  C  CG    . LEU A 1  236  ? 91.949  51.658  -40.201 1.00 88.66  ? 236  LEU A CG    1 
ATOM   1784  C  CD1   . LEU A 1  236  ? 91.419  51.043  -38.951 1.00 88.27  ? 236  LEU A CD1   1 
ATOM   1785  C  CD2   . LEU A 1  236  ? 93.402  51.297  -40.387 1.00 90.40  ? 236  LEU A CD2   1 
ATOM   1786  N  N     . THR A 1  237  ? 91.108  50.486  -44.693 1.00 91.76  ? 237  THR A N     1 
ATOM   1787  C  CA    . THR A 1  237  ? 90.474  49.910  -45.880 1.00 93.43  ? 237  THR A CA    1 
ATOM   1788  C  C     . THR A 1  237  ? 90.396  48.389  -45.740 1.00 96.56  ? 237  THR A C     1 
ATOM   1789  O  O     . THR A 1  237  ? 89.383  47.758  -46.060 1.00 96.98  ? 237  THR A O     1 
ATOM   1790  C  CB    . THR A 1  237  ? 91.362  50.303  -47.085 1.00 106.20 ? 237  THR A CB    1 
ATOM   1791  O  OG1   . THR A 1  237  ? 91.418  51.729  -47.186 1.00 108.80 ? 237  THR A OG1   1 
ATOM   1792  C  CG2   . THR A 1  237  ? 90.933  49.662  -48.413 1.00 107.19 ? 237  THR A CG2   1 
ATOM   1793  N  N     . CYS A 1  238  ? 91.507  47.815  -45.294 1.00 91.86  ? 238  CYS A N     1 
ATOM   1794  C  CA    . CYS A 1  238  ? 91.701  46.391  -45.131 1.00 91.42  ? 238  CYS A CA    1 
ATOM   1795  C  C     . CYS A 1  238  ? 92.077  46.160  -43.679 1.00 91.63  ? 238  CYS A C     1 
ATOM   1796  O  O     . CYS A 1  238  ? 93.139  46.617  -43.243 1.00 90.57  ? 238  CYS A O     1 
ATOM   1797  C  CB    . CYS A 1  238  ? 92.803  45.929  -46.077 1.00 92.40  ? 238  CYS A CB    1 
ATOM   1798  S  SG    . CYS A 1  238  ? 92.814  44.156  -46.382 1.00 97.48  ? 238  CYS A SG    1 
ATOM   1799  N  N     . LEU A 1  239  ? 91.185  45.519  -42.911 1.00 85.70  ? 239  LEU A N     1 
ATOM   1800  C  CA    . LEU A 1  239  ? 91.455  45.294  -41.500 1.00 83.32  ? 239  LEU A CA    1 
ATOM   1801  C  C     . LEU A 1  239  ? 92.253  44.005  -41.218 1.00 90.00  ? 239  LEU A C     1 
ATOM   1802  O  O     . LEU A 1  239  ? 91.858  42.925  -41.687 1.00 91.14  ? 239  LEU A O     1 
ATOM   1803  C  CB    . LEU A 1  239  ? 90.165  45.320  -40.681 1.00 82.78  ? 239  LEU A CB    1 
ATOM   1804  C  CG    . LEU A 1  239  ? 90.317  45.859  -39.273 1.00 85.20  ? 239  LEU A CG    1 
ATOM   1805  C  CD1   . LEU A 1  239  ? 89.116  46.622  -38.870 1.00 86.20  ? 239  LEU A CD1   1 
ATOM   1806  C  CD2   . LEU A 1  239  ? 90.544  44.758  -38.271 1.00 86.83  ? 239  LEU A CD2   1 
ATOM   1807  N  N     . PRO A 1  240  ? 93.353  44.081  -40.411 1.00 86.03  ? 240  PRO A N     1 
ATOM   1808  C  CA    . PRO A 1  240  ? 94.068  42.843  -40.063 1.00 85.72  ? 240  PRO A CA    1 
ATOM   1809  C  C     . PRO A 1  240  ? 93.363  42.113  -38.909 1.00 87.82  ? 240  PRO A C     1 
ATOM   1810  O  O     . PRO A 1  240  ? 93.016  42.714  -37.870 1.00 85.92  ? 240  PRO A O     1 
ATOM   1811  C  CB    . PRO A 1  240  ? 95.490  43.324  -39.716 1.00 86.46  ? 240  PRO A CB    1 
ATOM   1812  C  CG    . PRO A 1  240  ? 95.343  44.781  -39.349 1.00 89.79  ? 240  PRO A CG    1 
ATOM   1813  C  CD    . PRO A 1  240  ? 93.965  45.262  -39.752 1.00 85.96  ? 240  PRO A CD    1 
ATOM   1814  N  N     . VAL A 1  241  ? 93.114  40.811  -39.123 1.00 84.31  ? 241  VAL A N     1 
ATOM   1815  C  CA    . VAL A 1  241  ? 92.481  39.947  -38.125 1.00 83.67  ? 241  VAL A CA    1 
ATOM   1816  C  C     . VAL A 1  241  ? 93.549  39.241  -37.265 1.00 87.91  ? 241  VAL A C     1 
ATOM   1817  O  O     . VAL A 1  241  ? 94.244  38.337  -37.759 1.00 89.08  ? 241  VAL A O     1 
ATOM   1818  C  CB    . VAL A 1  241  ? 91.489  38.936  -38.728 1.00 87.46  ? 241  VAL A CB    1 
ATOM   1819  C  CG1   . VAL A 1  241  ? 90.875  38.077  -37.636 1.00 87.61  ? 241  VAL A CG1   1 
ATOM   1820  C  CG2   . VAL A 1  241  ? 90.413  39.644  -39.532 1.00 87.39  ? 241  VAL A CG2   1 
ATOM   1821  N  N     . PRO A 1  242  ? 93.682  39.622  -35.975 1.00 82.15  ? 242  PRO A N     1 
ATOM   1822  C  CA    . PRO A 1  242  ? 94.646  38.927  -35.115 1.00 81.47  ? 242  PRO A CA    1 
ATOM   1823  C  C     . PRO A 1  242  ? 94.243  37.463  -34.900 1.00 84.15  ? 242  PRO A C     1 
ATOM   1824  O  O     . PRO A 1  242  ? 93.044  37.132  -34.899 1.00 84.69  ? 242  PRO A O     1 
ATOM   1825  C  CB    . PRO A 1  242  ? 94.643  39.746  -33.826 1.00 82.47  ? 242  PRO A CB    1 
ATOM   1826  C  CG    . PRO A 1  242  ? 93.334  40.398  -33.807 1.00 87.31  ? 242  PRO A CG    1 
ATOM   1827  C  CD    . PRO A 1  242  ? 92.950  40.661  -35.229 1.00 82.88  ? 242  PRO A CD    1 
ATOM   1828  N  N     . PRO A 1  243  ? 95.254  36.575  -34.805 1.00 77.90  ? 243  PRO A N     1 
ATOM   1829  C  CA    . PRO A 1  243  ? 94.984  35.144  -34.650 1.00 79.17  ? 243  PRO A CA    1 
ATOM   1830  C  C     . PRO A 1  243  ? 94.473  34.752  -33.265 1.00 84.48  ? 243  PRO A C     1 
ATOM   1831  O  O     . PRO A 1  243  ? 94.648  35.527  -32.330 1.00 83.98  ? 243  PRO A O     1 
ATOM   1832  C  CB    . PRO A 1  243  ? 96.358  34.556  -34.855 1.00 81.28  ? 243  PRO A CB    1 
ATOM   1833  C  CG    . PRO A 1  243  ? 97.245  35.585  -34.258 1.00 83.73  ? 243  PRO A CG    1 
ATOM   1834  C  CD    . PRO A 1  243  ? 96.704  36.827  -34.820 1.00 77.76  ? 243  PRO A CD    1 
ATOM   1835  N  N     . PRO A 1  244  ? 93.953  33.517  -33.078 1.00 82.58  ? 244  PRO A N     1 
ATOM   1836  C  CA    . PRO A 1  244  ? 93.506  33.106  -31.743 1.00 83.84  ? 244  PRO A CA    1 
ATOM   1837  C  C     . PRO A 1  244  ? 94.487  33.355  -30.572 1.00 89.61  ? 244  PRO A C     1 
ATOM   1838  O  O     . PRO A 1  244  ? 93.989  33.852  -29.565 1.00 89.13  ? 244  PRO A O     1 
ATOM   1839  C  CB    . PRO A 1  244  ? 93.204  31.624  -31.931 1.00 88.05  ? 244  PRO A CB    1 
ATOM   1840  C  CG    . PRO A 1  244  ? 92.789  31.524  -33.341 1.00 91.85  ? 244  PRO A CG    1 
ATOM   1841  C  CD    . PRO A 1  244  ? 93.698  32.448  -34.068 1.00 85.52  ? 244  PRO A CD    1 
ATOM   1842  N  N     . PRO A 1  245  ? 95.838  33.117  -30.638 1.00 87.47  ? 245  PRO A N     1 
ATOM   1843  C  CA    . PRO A 1  245  ? 96.700  33.372  -29.451 1.00 87.18  ? 245  PRO A CA    1 
ATOM   1844  C  C     . PRO A 1  245  ? 96.574  34.736  -28.776 1.00 86.35  ? 245  PRO A C     1 
ATOM   1845  O  O     . PRO A 1  245  ? 96.909  34.873  -27.588 1.00 86.68  ? 245  PRO A O     1 
ATOM   1846  C  CB    . PRO A 1  245  ? 98.111  33.168  -29.990 1.00 89.66  ? 245  PRO A CB    1 
ATOM   1847  C  CG    . PRO A 1  245  ? 97.939  32.182  -31.067 1.00 95.92  ? 245  PRO A CG    1 
ATOM   1848  C  CD    . PRO A 1  245  ? 96.630  32.507  -31.727 1.00 90.25  ? 245  PRO A CD    1 
ATOM   1849  N  N     . VAL A 1  246  ? 96.101  35.728  -29.550 1.00 78.23  ? 246  VAL A N     1 
ATOM   1850  C  CA    . VAL A 1  246  ? 95.843  37.101  -29.143 1.00 75.24  ? 246  VAL A CA    1 
ATOM   1851  C  C     . VAL A 1  246  ? 94.481  37.140  -28.436 1.00 82.08  ? 246  VAL A C     1 
ATOM   1852  O  O     . VAL A 1  246  ? 94.378  37.699  -27.349 1.00 83.00  ? 246  VAL A O     1 
ATOM   1853  C  CB    . VAL A 1  246  ? 95.868  38.022  -30.388 1.00 75.68  ? 246  VAL A CB    1 
ATOM   1854  C  CG1   . VAL A 1  246  ? 95.244  39.376  -30.107 1.00 73.75  ? 246  VAL A CG1   1 
ATOM   1855  C  CG2   . VAL A 1  246  ? 97.275  38.182  -30.920 1.00 74.97  ? 246  VAL A CG2   1 
ATOM   1856  N  N     . ARG A 1  247  ? 93.445  36.531  -29.048 1.00 79.53  ? 247  ARG A N     1 
ATOM   1857  C  CA    . ARG A 1  247  ? 92.057  36.503  -28.567 1.00 80.16  ? 247  ARG A CA    1 
ATOM   1858  C  C     . ARG A 1  247  ? 91.579  35.055  -28.228 1.00 87.79  ? 247  ARG A C     1 
ATOM   1859  O  O     . ARG A 1  247  ? 90.628  34.537  -28.861 1.00 88.10  ? 247  ARG A O     1 
ATOM   1860  C  CB    . ARG A 1  247  ? 91.139  37.210  -29.597 1.00 77.01  ? 247  ARG A CB    1 
ATOM   1861  C  CG    . ARG A 1  247  ? 91.519  36.894  -31.041 1.00 77.77  ? 247  ARG A CG    1 
ATOM   1862  C  CD    . ARG A 1  247  ? 90.557  37.444  -32.057 1.00 76.02  ? 247  ARG A CD    1 
ATOM   1863  N  NE    . ARG A 1  247  ? 90.754  36.795  -33.355 1.00 82.99  ? 247  ARG A NE    1 
ATOM   1864  C  CZ    . ARG A 1  247  ? 90.206  35.633  -33.707 1.00 104.60 ? 247  ARG A CZ    1 
ATOM   1865  N  NH1   . ARG A 1  247  ? 89.430  34.971  -32.856 1.00 105.02 ? 247  ARG A NH1   1 
ATOM   1866  N  NH2   . ARG A 1  247  ? 90.422  35.129  -34.914 1.00 85.11  ? 247  ARG A NH2   1 
ATOM   1867  N  N     . PRO A 1  248  ? 92.229  34.390  -27.221 1.00 86.18  ? 248  PRO A N     1 
ATOM   1868  C  CA    . PRO A 1  248  ? 91.865  33.007  -26.903 1.00 89.74  ? 248  PRO A CA    1 
ATOM   1869  C  C     . PRO A 1  248  ? 90.418  32.755  -26.479 1.00 100.92 ? 248  PRO A C     1 
ATOM   1870  O  O     . PRO A 1  248  ? 89.807  33.556  -25.766 1.00 99.84  ? 248  PRO A O     1 
ATOM   1871  C  CB    . PRO A 1  248  ? 92.847  32.631  -25.789 1.00 91.78  ? 248  PRO A CB    1 
ATOM   1872  C  CG    . PRO A 1  248  ? 93.281  33.897  -25.224 1.00 93.49  ? 248  PRO A CG    1 
ATOM   1873  C  CD    . PRO A 1  248  ? 93.361  34.816  -26.378 1.00 86.30  ? 248  PRO A CD    1 
ATOM   1874  N  N     . SER A 1  249  ? 89.890  31.608  -26.954 1.00 103.74 ? 249  SER A N     1 
ATOM   1875  C  CA    . SER A 1  249  ? 88.582  31.047  -26.648 1.00 107.52 ? 249  SER A CA    1 
ATOM   1876  C  C     . SER A 1  249  ? 88.705  30.352  -25.298 1.00 119.63 ? 249  SER A C     1 
ATOM   1877  O  O     . SER A 1  249  ? 89.543  29.448  -25.133 1.00 120.25 ? 249  SER A O     1 
ATOM   1878  C  CB    . SER A 1  249  ? 88.176  30.034  -27.714 1.00 111.60 ? 249  SER A CB    1 
ATOM   1879  O  OG    . SER A 1  249  ? 87.887  28.744  -27.196 1.00 121.72 ? 249  SER A OG    1 
ATOM   1880  N  N     . ILE A 1  250  ? 87.876  30.790  -24.336 1.00 122.01 ? 250  ILE A N     1 
ATOM   1881  C  CA    . ILE A 1  250  ? 87.826  30.262  -22.972 1.00 127.03 ? 250  ILE A CA    1 
ATOM   1882  C  C     . ILE A 1  250  ? 86.870  29.054  -22.925 1.00 139.33 ? 250  ILE A C     1 
ATOM   1883  O  O     . ILE A 1  250  ? 85.654  29.228  -22.805 1.00 141.06 ? 250  ILE A O     1 
ATOM   1884  C  CB    . ILE A 1  250  ? 87.505  31.405  -21.941 1.00 130.11 ? 250  ILE A CB    1 
ATOM   1885  C  CG1   . ILE A 1  250  ? 88.723  32.358  -21.762 1.00 128.85 ? 250  ILE A CG1   1 
ATOM   1886  C  CG2   . ILE A 1  250  ? 87.033  30.870  -20.564 1.00 134.24 ? 250  ILE A CG2   1 
ATOM   1887  C  CD1   . ILE A 1  250  ? 88.790  33.617  -22.695 1.00 135.17 ? 250  ILE A CD1   1 
ATOM   1888  N  N     . SER A 1  251  ? 87.412  27.832  -23.079 1.00 140.47 ? 251  SER A N     1 
ATOM   1889  C  CA    . SER A 1  251  ? 86.580  26.629  -23.044 1.00 145.09 ? 251  SER A CA    1 
ATOM   1890  C  C     . SER A 1  251  ? 86.437  26.134  -21.604 1.00 154.92 ? 251  SER A C     1 
ATOM   1891  O  O     . SER A 1  251  ? 87.438  25.923  -20.909 1.00 155.41 ? 251  SER A O     1 
ATOM   1892  C  CB    . SER A 1  251  ? 87.120  25.553  -23.981 1.00 149.94 ? 251  SER A CB    1 
ATOM   1893  O  OG    . SER A 1  251  ? 86.979  25.938  -25.341 1.00 157.04 ? 251  SER A OG    1 
ATOM   1894  N  N     . PHE A 1  252  ? 85.187  26.021  -21.138 1.00 155.31 ? 252  PHE A N     1 
ATOM   1895  C  CA    . PHE A 1  252  ? 84.883  25.600  -19.775 1.00 159.30 ? 252  PHE A CA    1 
ATOM   1896  C  C     . PHE A 1  252  ? 84.130  24.243  -19.763 1.00 169.59 ? 252  PHE A C     1 
ATOM   1897  O  O     . PHE A 1  252  ? 83.077  24.123  -19.133 1.00 171.54 ? 252  PHE A O     1 
ATOM   1898  C  CB    . PHE A 1  252  ? 84.176  26.736  -18.983 1.00 160.50 ? 252  PHE A CB    1 
ATOM   1899  C  CG    . PHE A 1  252  ? 82.962  27.423  -19.584 1.00 161.06 ? 252  PHE A CG    1 
ATOM   1900  C  CD1   . PHE A 1  252  ? 83.064  28.151  -20.765 1.00 159.50 ? 252  PHE A CD1   1 
ATOM   1901  C  CD2   . PHE A 1  252  ? 81.741  27.426  -18.916 1.00 167.03 ? 252  PHE A CD2   1 
ATOM   1902  C  CE1   . PHE A 1  252  ? 81.944  28.784  -21.316 1.00 161.64 ? 252  PHE A CE1   1 
ATOM   1903  C  CE2   . PHE A 1  252  ? 80.629  28.093  -19.451 1.00 167.09 ? 252  PHE A CE2   1 
ATOM   1904  C  CZ    . PHE A 1  252  ? 80.742  28.775  -20.641 1.00 162.48 ? 252  PHE A CZ    1 
ATOM   1905  N  N     . ASN A 1  253  ? 84.745  23.218  -20.454 1.00 168.69 ? 253  ASN A N     1 
ATOM   1906  C  CA    . ASN A 1  253  ? 84.396  21.794  -20.741 1.00 172.65 ? 253  ASN A CA    1 
ATOM   1907  C  C     . ASN A 1  253  ? 84.451  21.506  -22.274 1.00 175.89 ? 253  ASN A C     1 
ATOM   1908  O  O     . ASN A 1  253  ? 85.314  22.065  -22.966 1.00 172.31 ? 253  ASN A O     1 
ATOM   1909  C  CB    . ASN A 1  253  ? 83.057  21.328  -20.123 1.00 176.49 ? 253  ASN A CB    1 
ATOM   1910  C  CG    . ASN A 1  253  ? 83.083  21.152  -18.626 1.00 207.50 ? 253  ASN A CG    1 
ATOM   1911  O  OD1   . ASN A 1  253  ? 83.932  20.448  -18.066 1.00 207.00 ? 253  ASN A OD1   1 
ATOM   1912  N  ND2   . ASN A 1  253  ? 82.141  21.786  -17.941 1.00 200.32 ? 253  ASN A ND2   1 
ATOM   1913  N  N     . GLU A 1  254  ? 83.549  20.639  -22.798 1.00 175.16 ? 254  GLU A N     1 
ATOM   1914  C  CA    . GLU A 1  254  ? 83.463  20.358  -24.235 1.00 174.15 ? 254  GLU A CA    1 
ATOM   1915  C  C     . GLU A 1  254  ? 82.478  21.385  -24.809 1.00 175.04 ? 254  GLU A C     1 
ATOM   1916  O  O     . GLU A 1  254  ? 82.905  22.397  -25.377 1.00 170.70 ? 254  GLU A O     1 
ATOM   1917  C  CB    . GLU A 1  254  ? 82.952  18.922  -24.502 1.00 180.12 ? 254  GLU A CB    1 
ATOM   1918  C  CG    . GLU A 1  254  ? 83.203  18.396  -25.911 1.00 190.65 ? 254  GLU A CG    1 
ATOM   1919  C  CD    . GLU A 1  254  ? 82.002  17.932  -26.721 1.00 212.91 ? 254  GLU A CD    1 
ATOM   1920  O  OE1   . GLU A 1  254  ? 81.035  17.394  -26.131 1.00 210.07 ? 254  GLU A OE1   1 
ATOM   1921  O  OE2   . GLU A 1  254  ? 82.043  18.082  -27.964 1.00 200.27 ? 254  GLU A OE2   1 
ATOM   1922  N  N     . SER A 1  255  ? 81.157  21.133  -24.576 1.00 173.29 ? 255  SER A N     1 
ATOM   1923  C  CA    . SER A 1  255  ? 79.949  21.879  -24.986 1.00 171.45 ? 255  SER A CA    1 
ATOM   1924  C  C     . SER A 1  255  ? 79.971  23.405  -24.700 1.00 168.80 ? 255  SER A C     1 
ATOM   1925  O  O     . SER A 1  255  ? 79.356  24.197  -25.428 1.00 166.01 ? 255  SER A O     1 
ATOM   1926  C  CB    . SER A 1  255  ? 78.714  21.242  -24.350 1.00 178.98 ? 255  SER A CB    1 
ATOM   1927  O  OG    . SER A 1  255  ? 78.979  20.766  -23.038 1.00 187.90 ? 255  SER A OG    1 
ATOM   1928  N  N     . GLN A 1  256  ? 80.668  23.792  -23.627 1.00 162.57 ? 256  GLN A N     1 
ATOM   1929  C  CA    . GLN A 1  256  ? 80.830  25.166  -23.177 1.00 157.97 ? 256  GLN A CA    1 
ATOM   1930  C  C     . GLN A 1  256  ? 81.956  25.814  -24.011 1.00 154.58 ? 256  GLN A C     1 
ATOM   1931  O  O     . GLN A 1  256  ? 83.153  25.691  -23.717 1.00 152.00 ? 256  GLN A O     1 
ATOM   1932  C  CB    . GLN A 1  256  ? 81.064  25.200  -21.646 1.00 160.63 ? 256  GLN A CB    1 
ATOM   1933  C  CG    . GLN A 1  256  ? 79.813  24.841  -20.800 1.00 163.42 ? 256  GLN A CG    1 
ATOM   1934  C  CD    . GLN A 1  256  ? 80.057  23.818  -19.704 1.00 162.77 ? 256  GLN A CD    1 
ATOM   1935  O  OE1   . GLN A 1  256  ? 80.212  24.154  -18.520 1.00 153.03 ? 256  GLN A OE1   1 
ATOM   1936  N  NE2   . GLN A 1  256  ? 80.040  22.541  -20.070 1.00 148.26 ? 256  GLN A NE2   1 
ATOM   1937  N  N     . ARG A 1  257  ? 81.519  26.425  -25.125 1.00 148.20 ? 257  ARG A N     1 
ATOM   1938  C  CA    . ARG A 1  257  ? 82.290  27.116  -26.174 1.00 143.44 ? 257  ARG A CA    1 
ATOM   1939  C  C     . ARG A 1  257  ? 83.164  28.237  -25.625 1.00 137.47 ? 257  ARG A C     1 
ATOM   1940  O  O     . ARG A 1  257  ? 84.356  28.025  -25.472 1.00 135.80 ? 257  ARG A O     1 
ATOM   1941  C  CB    . ARG A 1  257  ? 81.350  27.610  -27.311 1.00 147.64 ? 257  ARG A CB    1 
ATOM   1942  C  CG    . ARG A 1  257  ? 79.881  27.865  -26.873 1.00 168.82 ? 257  ARG A CG    1 
ATOM   1943  C  CD    . ARG A 1  257  ? 78.881  27.902  -28.022 1.00 184.20 ? 257  ARG A CD    1 
ATOM   1944  N  NE    . ARG A 1  257  ? 77.564  28.365  -27.576 1.00 195.20 ? 257  ARG A NE    1 
ATOM   1945  C  CZ    . ARG A 1  257  ? 76.548  28.650  -28.386 1.00 209.89 ? 257  ARG A CZ    1 
ATOM   1946  N  NH1   . ARG A 1  257  ? 76.679  28.516  -29.701 1.00 195.46 ? 257  ARG A NH1   1 
ATOM   1947  N  NH2   . ARG A 1  257  ? 75.393  29.072  -27.888 1.00 198.91 ? 257  ARG A NH2   1 
ATOM   1948  N  N     . GLY A 1  258  ? 82.555  29.385  -25.325 1.00 128.91 ? 258  GLY A N     1 
ATOM   1949  C  CA    . GLY A 1  258  ? 83.175  30.564  -24.733 1.00 125.01 ? 258  GLY A CA    1 
ATOM   1950  C  C     . GLY A 1  258  ? 84.250  31.263  -25.539 1.00 122.91 ? 258  GLY A C     1 
ATOM   1951  O  O     . GLY A 1  258  ? 85.395  30.811  -25.567 1.00 122.57 ? 258  GLY A O     1 
ATOM   1952  N  N     . GLU A 1  259  ? 83.926  32.405  -26.141 1.00 114.32 ? 259  GLU A N     1 
ATOM   1953  C  CA    . GLU A 1  259  ? 84.933  33.114  -26.914 1.00 109.66 ? 259  GLU A CA    1 
ATOM   1954  C  C     . GLU A 1  259  ? 85.359  34.388  -26.251 1.00 110.55 ? 259  GLU A C     1 
ATOM   1955  O  O     . GLU A 1  259  ? 84.712  34.825  -25.302 1.00 110.87 ? 259  GLU A O     1 
ATOM   1956  C  CB    . GLU A 1  259  ? 84.467  33.338  -28.347 1.00 109.96 ? 259  GLU A CB    1 
ATOM   1957  C  CG    . GLU A 1  259  ? 84.393  32.046  -29.146 1.00 121.55 ? 259  GLU A CG    1 
ATOM   1958  C  CD    . GLU A 1  259  ? 85.672  31.521  -29.774 1.00 140.38 ? 259  GLU A CD    1 
ATOM   1959  O  OE1   . GLU A 1  259  ? 86.734  32.172  -29.627 1.00 150.88 ? 259  GLU A OE1   1 
ATOM   1960  O  OE2   . GLU A 1  259  ? 85.592  30.476  -30.462 1.00 123.58 ? 259  GLU A OE2   1 
ATOM   1961  N  N     . ASP A 1  260  ? 86.471  34.967  -26.725 1.00 104.78 ? 260  ASP A N     1 
ATOM   1962  C  CA    . ASP A 1  260  ? 87.043  36.198  -26.191 1.00 103.00 ? 260  ASP A CA    1 
ATOM   1963  C  C     . ASP A 1  260  ? 86.250  37.432  -26.593 1.00 104.85 ? 260  ASP A C     1 
ATOM   1964  O  O     . ASP A 1  260  ? 85.474  37.381  -27.540 1.00 104.07 ? 260  ASP A O     1 
ATOM   1965  C  CB    . ASP A 1  260  ? 88.491  36.345  -26.669 1.00 103.59 ? 260  ASP A CB    1 
ATOM   1966  C  CG    . ASP A 1  260  ? 89.283  37.362  -25.872 1.00 117.69 ? 260  ASP A CG    1 
ATOM   1967  O  OD1   . ASP A 1  260  ? 89.816  36.986  -24.802 1.00 128.11 ? 260  ASP A OD1   1 
ATOM   1968  O  OD2   . ASP A 1  260  ? 89.332  38.552  -26.299 1.00 115.78 ? 260  ASP A OD2   1 
ATOM   1969  N  N     . ASP A 1  261  ? 86.485  38.547  -25.890 1.00 101.21 ? 261  ASP A N     1 
ATOM   1970  C  CA    . ASP A 1  261  ? 85.900  39.868  -26.128 1.00 101.01 ? 261  ASP A CA    1 
ATOM   1971  C  C     . ASP A 1  261  ? 86.262  40.407  -27.523 1.00 100.62 ? 261  ASP A C     1 
ATOM   1972  O  O     . ASP A 1  261  ? 85.397  40.953  -28.218 1.00 99.59  ? 261  ASP A O     1 
ATOM   1973  C  CB    . ASP A 1  261  ? 86.444  40.851  -25.074 1.00 103.91 ? 261  ASP A CB    1 
ATOM   1974  C  CG    . ASP A 1  261  ? 85.411  41.489  -24.169 1.00 126.84 ? 261  ASP A CG    1 
ATOM   1975  O  OD1   . ASP A 1  261  ? 84.265  41.720  -24.636 1.00 131.55 ? 261  ASP A OD1   1 
ATOM   1976  O  OD2   . ASP A 1  261  ? 85.756  41.795  -23.002 1.00 133.79 ? 261  ASP A OD2   1 
ATOM   1977  N  N     . LEU A 1  262  ? 87.554  40.277  -27.908 1.00 94.55  ? 262  LEU A N     1 
ATOM   1978  C  CA    . LEU A 1  262  ? 88.062  40.729  -29.200 1.00 92.00  ? 262  LEU A CA    1 
ATOM   1979  C  C     . LEU A 1  262  ? 87.444  39.937  -30.348 1.00 94.93  ? 262  LEU A C     1 
ATOM   1980  O  O     . LEU A 1  262  ? 87.214  40.504  -31.415 1.00 94.09  ? 262  LEU A O     1 
ATOM   1981  C  CB    . LEU A 1  262  ? 89.600  40.691  -29.255 1.00 90.66  ? 262  LEU A CB    1 
ATOM   1982  C  CG    . LEU A 1  262  ? 90.394  41.868  -28.635 1.00 93.53  ? 262  LEU A CG    1 
ATOM   1983  C  CD1   . LEU A 1  262  ? 91.752  41.949  -29.254 1.00 92.18  ? 262  LEU A CD1   1 
ATOM   1984  C  CD2   . LEU A 1  262  ? 89.729  43.222  -28.866 1.00 94.07  ? 262  LEU A CD2   1 
ATOM   1985  N  N     . THR A 1  263  ? 87.134  38.644  -30.108 1.00 91.36  ? 263  THR A N     1 
ATOM   1986  C  CA    . THR A 1  263  ? 86.453  37.778  -31.067 1.00 91.43  ? 263  THR A CA    1 
ATOM   1987  C  C     . THR A 1  263  ? 85.019  38.328  -31.293 1.00 96.66  ? 263  THR A C     1 
ATOM   1988  O  O     . THR A 1  263  ? 84.577  38.406  -32.440 1.00 96.66  ? 263  THR A O     1 
ATOM   1989  C  CB    . THR A 1  263  ? 86.483  36.302  -30.617 1.00 93.88  ? 263  THR A CB    1 
ATOM   1990  O  OG1   . THR A 1  263  ? 87.811  35.900  -30.272 1.00 91.87  ? 263  THR A OG1   1 
ATOM   1991  C  CG2   . THR A 1  263  ? 85.970  35.372  -31.680 1.00 91.37  ? 263  THR A CG2   1 
ATOM   1992  N  N     . PHE A 1  264  ? 84.325  38.762  -30.215 1.00 94.12  ? 264  PHE A N     1 
ATOM   1993  C  CA    . PHE A 1  264  ? 82.976  39.328  -30.318 1.00 95.07  ? 264  PHE A CA    1 
ATOM   1994  C  C     . PHE A 1  264  ? 82.960  40.600  -31.102 1.00 94.56  ? 264  PHE A C     1 
ATOM   1995  O  O     . PHE A 1  264  ? 82.125  40.725  -31.987 1.00 93.64  ? 264  PHE A O     1 
ATOM   1996  C  CB    . PHE A 1  264  ? 82.301  39.512  -28.945 1.00 99.45  ? 264  PHE A CB    1 
ATOM   1997  C  CG    . PHE A 1  264  ? 81.984  38.194  -28.263 1.00 104.93 ? 264  PHE A CG    1 
ATOM   1998  C  CD1   . PHE A 1  264  ? 81.317  37.174  -28.946 1.00 109.30 ? 264  PHE A CD1   1 
ATOM   1999  C  CD2   . PHE A 1  264  ? 82.379  37.957  -26.950 1.00 110.21 ? 264  PHE A CD2   1 
ATOM   2000  C  CE1   . PHE A 1  264  ? 81.044  35.947  -28.322 1.00 114.55 ? 264  PHE A CE1   1 
ATOM   2001  C  CE2   . PHE A 1  264  ? 82.095  36.727  -26.323 1.00 113.68 ? 264  PHE A CE2   1 
ATOM   2002  C  CZ    . PHE A 1  264  ? 81.429  35.733  -27.015 1.00 113.65 ? 264  PHE A CZ    1 
ATOM   2003  N  N     . LYS A 1  265  ? 83.926  41.511  -30.842 1.00 89.25  ? 265  LYS A N     1 
ATOM   2004  C  CA    . LYS A 1  265  ? 83.998  42.797  -31.536 1.00 87.81  ? 265  LYS A CA    1 
ATOM   2005  C  C     . LYS A 1  265  ? 84.273  42.638  -33.009 1.00 90.74  ? 265  LYS A C     1 
ATOM   2006  O  O     . LYS A 1  265  ? 83.624  43.319  -33.809 1.00 91.02  ? 265  LYS A O     1 
ATOM   2007  C  CB    . LYS A 1  265  ? 84.959  43.811  -30.874 1.00 88.74  ? 265  LYS A CB    1 
ATOM   2008  C  CG    . LYS A 1  265  ? 84.396  45.256  -30.898 1.00 112.12 ? 265  LYS A CG    1 
ATOM   2009  C  CD    . LYS A 1  265  ? 83.400  45.621  -29.755 1.00 138.15 ? 265  LYS A CD    1 
ATOM   2010  C  CE    . LYS A 1  265  ? 82.022  44.949  -29.734 1.00 172.89 ? 265  LYS A CE    1 
ATOM   2011  N  NZ    . LYS A 1  265  ? 82.029  43.598  -29.064 1.00 194.46 ? 265  LYS A NZ    1 
ATOM   2012  N  N     . LEU A 1  266  ? 85.168  41.703  -33.380 1.00 85.85  ? 266  LEU A N     1 
ATOM   2013  C  CA    . LEU A 1  266  ? 85.474  41.456  -34.791 1.00 84.84  ? 266  LEU A CA    1 
ATOM   2014  C  C     . LEU A 1  266  ? 84.245  40.915  -35.508 1.00 91.36  ? 266  LEU A C     1 
ATOM   2015  O  O     . LEU A 1  266  ? 83.852  41.465  -36.539 1.00 92.07  ? 266  LEU A O     1 
ATOM   2016  C  CB    . LEU A 1  266  ? 86.711  40.567  -34.977 1.00 83.76  ? 266  LEU A CB    1 
ATOM   2017  C  CG    . LEU A 1  266  ? 88.027  41.257  -34.662 1.00 85.55  ? 266  LEU A CG    1 
ATOM   2018  C  CD1   . LEU A 1  266  ? 89.107  40.262  -34.380 1.00 85.51  ? 266  LEU A CD1   1 
ATOM   2019  C  CD2   . LEU A 1  266  ? 88.426  42.218  -35.755 1.00 85.52  ? 266  LEU A CD2   1 
ATOM   2020  N  N     . ALA A 1  267  ? 83.559  39.938  -34.886 1.00 88.24  ? 267  ALA A N     1 
ATOM   2021  C  CA    . ALA A 1  267  ? 82.310  39.384  -35.392 1.00 89.48  ? 267  ALA A CA    1 
ATOM   2022  C  C     . ALA A 1  267  ? 81.296  40.502  -35.619 1.00 90.43  ? 267  ALA A C     1 
ATOM   2023  O  O     . ALA A 1  267  ? 80.585  40.462  -36.609 1.00 90.09  ? 267  ALA A O     1 
ATOM   2024  C  CB    . ALA A 1  267  ? 81.754  38.392  -34.393 1.00 92.41  ? 267  ALA A CB    1 
ATOM   2025  N  N     . ASP A 1  268  ? 81.270  41.514  -34.725 1.00 85.65  ? 268  ASP A N     1 
ATOM   2026  C  CA    . ASP A 1  268  ? 80.369  42.661  -34.803 1.00 85.99  ? 268  ASP A CA    1 
ATOM   2027  C  C     . ASP A 1  268  ? 80.710  43.587  -35.937 1.00 85.39  ? 268  ASP A C     1 
ATOM   2028  O  O     . ASP A 1  268  ? 79.793  44.152  -36.541 1.00 85.28  ? 268  ASP A O     1 
ATOM   2029  C  CB    . ASP A 1  268  ? 80.301  43.410  -33.468 1.00 88.82  ? 268  ASP A CB    1 
ATOM   2030  C  CG    . ASP A 1  268  ? 79.531  42.657  -32.388 1.00 117.44 ? 268  ASP A CG    1 
ATOM   2031  O  OD1   . ASP A 1  268  ? 78.381  42.204  -32.670 1.00 122.86 ? 268  ASP A OD1   1 
ATOM   2032  O  OD2   . ASP A 1  268  ? 80.054  42.549  -31.247 1.00 129.14 ? 268  ASP A OD2   1 
ATOM   2033  N  N     . ILE A 1  269  ? 82.030  43.738  -36.232 1.00 78.51  ? 269  ILE A N     1 
ATOM   2034  C  CA    . ILE A 1  269  ? 82.553  44.556  -37.339 1.00 76.68  ? 269  ILE A CA    1 
ATOM   2035  C  C     . ILE A 1  269  ? 82.118  43.854  -38.617 1.00 83.60  ? 269  ILE A C     1 
ATOM   2036  O  O     . ILE A 1  269  ? 81.535  44.461  -39.510 1.00 83.64  ? 269  ILE A O     1 
ATOM   2037  C  CB    . ILE A 1  269  ? 84.106  44.726  -37.274 1.00 76.35  ? 269  ILE A CB    1 
ATOM   2038  C  CG1   . ILE A 1  269  ? 84.545  45.501  -36.032 1.00 75.11  ? 269  ILE A CG1   1 
ATOM   2039  C  CG2   . ILE A 1  269  ? 84.675  45.371  -38.552 1.00 75.50  ? 269  ILE A CG2   1 
ATOM   2040  C  CD1   . ILE A 1  269  ? 85.943  45.180  -35.604 1.00 80.92  ? 269  ILE A CD1   1 
ATOM   2041  N  N     . LEU A 1  270  ? 82.362  42.558  -38.659 1.00 83.18  ? 270  LEU A N     1 
ATOM   2042  C  CA    . LEU A 1  270  ? 82.024  41.681  -39.761 1.00 86.35  ? 270  LEU A CA    1 
ATOM   2043  C  C     . LEU A 1  270  ? 80.487  41.644  -39.971 1.00 95.55  ? 270  LEU A C     1 
ATOM   2044  O  O     . LEU A 1  270  ? 80.032  41.609  -41.115 1.00 97.11  ? 270  LEU A O     1 
ATOM   2045  C  CB    . LEU A 1  270  ? 82.632  40.294  -39.446 1.00 86.80  ? 270  LEU A CB    1 
ATOM   2046  C  CG    . LEU A 1  270  ? 82.791  39.241  -40.547 1.00 92.88  ? 270  LEU A CG    1 
ATOM   2047  C  CD1   . LEU A 1  270  ? 83.155  39.857  -41.889 1.00 92.77  ? 270  LEU A CD1   1 
ATOM   2048  C  CD2   . LEU A 1  270  ? 83.789  38.177  -40.121 1.00 93.99  ? 270  LEU A CD2   1 
ATOM   2049  N  N     . LYS A 1  271  ? 79.703  41.734  -38.877 1.00 94.35  ? 271  LYS A N     1 
ATOM   2050  C  CA    . LYS A 1  271  ? 78.242  41.786  -38.924 1.00 97.97  ? 271  LYS A CA    1 
ATOM   2051  C  C     . LYS A 1  271  ? 77.825  43.117  -39.601 1.00 103.71 ? 271  LYS A C     1 
ATOM   2052  O  O     . LYS A 1  271  ? 77.011  43.108  -40.537 1.00 105.58 ? 271  LYS A O     1 
ATOM   2053  C  CB    . LYS A 1  271  ? 77.661  41.732  -37.494 1.00 101.82 ? 271  LYS A CB    1 
ATOM   2054  C  CG    . LYS A 1  271  ? 77.428  40.338  -36.905 1.00 119.85 ? 271  LYS A CG    1 
ATOM   2055  C  CD    . LYS A 1  271  ? 77.123  40.445  -35.394 1.00 128.57 ? 271  LYS A CD    1 
ATOM   2056  C  CE    . LYS A 1  271  ? 76.768  39.137  -34.725 1.00 137.01 ? 271  LYS A CE    1 
ATOM   2057  N  NZ    . LYS A 1  271  ? 76.578  39.306  -33.258 1.00 143.54 ? 271  LYS A NZ    1 
ATOM   2058  N  N     . ALA A 1  272  ? 78.427  44.248  -39.129 1.00 98.33  ? 272  ALA A N     1 
ATOM   2059  C  CA    . ALA A 1  272  ? 78.211  45.632  -39.582 1.00 97.89  ? 272  ALA A CA    1 
ATOM   2060  C  C     . ALA A 1  272  ? 78.605  45.865  -41.037 1.00 101.00 ? 272  ALA A C     1 
ATOM   2061  O  O     . ALA A 1  272  ? 78.005  46.707  -41.716 1.00 101.20 ? 272  ALA A O     1 
ATOM   2062  C  CB    . ALA A 1  272  ? 78.995  46.582  -38.692 1.00 96.35  ? 272  ALA A CB    1 
ATOM   2063  N  N     . ASN A 1  273  ? 79.661  45.155  -41.477 1.00 96.53  ? 273  ASN A N     1 
ATOM   2064  C  CA    . ASN A 1  273  ? 80.254  45.206  -42.806 1.00 96.51  ? 273  ASN A CA    1 
ATOM   2065  C  C     . ASN A 1  273  ? 79.310  44.566  -43.798 1.00 103.65 ? 273  ASN A C     1 
ATOM   2066  O  O     . ASN A 1  273  ? 78.911  45.190  -44.783 1.00 104.79 ? 273  ASN A O     1 
ATOM   2067  C  CB    . ASN A 1  273  ? 81.597  44.458  -42.793 1.00 96.14  ? 273  ASN A CB    1 
ATOM   2068  C  CG    . ASN A 1  273  ? 82.419  44.614  -44.045 1.00 122.26 ? 273  ASN A CG    1 
ATOM   2069  O  OD1   . ASN A 1  273  ? 82.774  45.729  -44.431 1.00 114.83 ? 273  ASN A OD1   1 
ATOM   2070  N  ND2   . ASN A 1  273  ? 82.784  43.490  -44.673 1.00 114.71 ? 273  ASN A ND2   1 
ATOM   2071  N  N     . ILE A 1  274  ? 78.930  43.328  -43.509 1.00 101.72 ? 274  ILE A N     1 
ATOM   2072  C  CA    . ILE A 1  274  ? 78.047  42.524  -44.313 1.00 105.36 ? 274  ILE A CA    1 
ATOM   2073  C  C     . ILE A 1  274  ? 76.751  43.288  -44.623 1.00 114.72 ? 274  ILE A C     1 
ATOM   2074  O  O     . ILE A 1  274  ? 76.253  43.181  -45.741 1.00 116.77 ? 274  ILE A O     1 
ATOM   2075  C  CB    . ILE A 1  274  ? 77.894  41.165  -43.579 1.00 109.48 ? 274  ILE A CB    1 
ATOM   2076  C  CG1   . ILE A 1  274  ? 78.680  40.056  -44.301 1.00 110.08 ? 274  ILE A CG1   1 
ATOM   2077  C  CG2   . ILE A 1  274  ? 76.453  40.747  -43.280 1.00 114.36 ? 274  ILE A CG2   1 
ATOM   2078  C  CD1   . ILE A 1  274  ? 80.252  40.159  -44.224 1.00 117.05 ? 274  ILE A CD1   1 
ATOM   2079  N  N     . SER A 1  275  ? 76.270  44.130  -43.674 1.00 113.38 ? 275  SER A N     1 
ATOM   2080  C  CA    . SER A 1  275  ? 75.063  44.955  -43.839 1.00 116.71 ? 275  SER A CA    1 
ATOM   2081  C  C     . SER A 1  275  ? 75.311  46.088  -44.832 1.00 120.40 ? 275  SER A C     1 
ATOM   2082  O  O     . SER A 1  275  ? 74.518  46.267  -45.763 1.00 122.74 ? 275  SER A O     1 
ATOM   2083  C  CB    . SER A 1  275  ? 74.585  45.516  -42.494 1.00 121.77 ? 275  SER A CB    1 
ATOM   2084  O  OG    . SER A 1  275  ? 75.280  46.677  -42.057 1.00 131.70 ? 275  SER A OG    1 
ATOM   2085  N  N     . LEU A 1  276  ? 76.420  46.843  -44.620 1.00 113.78 ? 276  LEU A N     1 
ATOM   2086  C  CA    . LEU A 1  276  ? 76.849  47.978  -45.435 1.00 113.00 ? 276  LEU A CA    1 
ATOM   2087  C  C     . LEU A 1  276  ? 77.089  47.555  -46.877 1.00 119.27 ? 276  LEU A C     1 
ATOM   2088  O  O     . LEU A 1  276  ? 76.617  48.231  -47.794 1.00 121.52 ? 276  LEU A O     1 
ATOM   2089  C  CB    . LEU A 1  276  ? 78.096  48.642  -44.828 1.00 109.27 ? 276  LEU A CB    1 
ATOM   2090  C  CG    . LEU A 1  276  ? 78.633  49.887  -45.533 1.00 112.92 ? 276  LEU A CG    1 
ATOM   2091  C  CD1   . LEU A 1  276  ? 77.614  51.013  -45.539 1.00 115.25 ? 276  LEU A CD1   1 
ATOM   2092  C  CD2   . LEU A 1  276  ? 79.898  50.356  -44.884 1.00 111.57 ? 276  LEU A CD2   1 
ATOM   2093  N  N     . GLU A 1  277  ? 77.773  46.416  -47.069 1.00 115.17 ? 277  GLU A N     1 
ATOM   2094  C  CA    . GLU A 1  277  ? 78.036  45.837  -48.382 1.00 116.68 ? 277  GLU A CA    1 
ATOM   2095  C  C     . GLU A 1  277  ? 76.700  45.458  -49.073 1.00 124.04 ? 277  GLU A C     1 
ATOM   2096  O  O     . GLU A 1  277  ? 76.500  45.859  -50.215 1.00 125.37 ? 277  GLU A O     1 
ATOM   2097  C  CB    . GLU A 1  277  ? 79.019  44.653  -48.252 1.00 116.74 ? 277  GLU A CB    1 
ATOM   2098  C  CG    . GLU A 1  277  ? 79.254  43.818  -49.505 1.00 131.74 ? 277  GLU A CG    1 
ATOM   2099  C  CD    . GLU A 1  277  ? 78.512  42.490  -49.560 1.00 163.77 ? 277  GLU A CD    1 
ATOM   2100  O  OE1   . GLU A 1  277  ? 78.568  41.725  -48.568 1.00 159.90 ? 277  GLU A OE1   1 
ATOM   2101  O  OE2   . GLU A 1  277  ? 77.907  42.195  -50.617 1.00 164.04 ? 277  GLU A OE2   1 
ATOM   2102  N  N     . THR A 1  278  ? 75.768  44.769  -48.369 1.00 122.14 ? 278  THR A N     1 
ATOM   2103  C  CA    . THR A 1  278  ? 74.473  44.397  -48.947 1.00 126.32 ? 278  THR A CA    1 
ATOM   2104  C  C     . THR A 1  278  ? 73.709  45.649  -49.382 1.00 134.50 ? 278  THR A C     1 
ATOM   2105  O  O     . THR A 1  278  ? 73.185  45.648  -50.487 1.00 138.01 ? 278  THR A O     1 
ATOM   2106  C  CB    . THR A 1  278  ? 73.668  43.443  -48.036 1.00 133.88 ? 278  THR A CB    1 
ATOM   2107  O  OG1   . THR A 1  278  ? 74.389  42.220  -47.889 1.00 131.83 ? 278  THR A OG1   1 
ATOM   2108  C  CG2   . THR A 1  278  ? 72.283  43.103  -48.601 1.00 136.17 ? 278  THR A CG2   1 
ATOM   2109  N  N     . LEU A 1  279  ? 73.703  46.729  -48.574 1.00 130.52 ? 279  LEU A N     1 
ATOM   2110  C  CA    . LEU A 1  279  ? 73.007  47.965  -48.954 1.00 133.03 ? 279  LEU A CA    1 
ATOM   2111  C  C     . LEU A 1  279  ? 73.544  48.562  -50.237 1.00 141.76 ? 279  LEU A C     1 
ATOM   2112  O  O     . LEU A 1  279  ? 72.756  48.993  -51.076 1.00 144.54 ? 279  LEU A O     1 
ATOM   2113  C  CB    . LEU A 1  279  ? 73.018  49.003  -47.839 1.00 130.98 ? 279  LEU A CB    1 
ATOM   2114  C  CG    . LEU A 1  279  ? 72.179  48.684  -46.619 1.00 135.80 ? 279  LEU A CG    1 
ATOM   2115  C  CD1   . LEU A 1  279  ? 72.256  49.804  -45.619 1.00 134.60 ? 279  LEU A CD1   1 
ATOM   2116  C  CD2   . LEU A 1  279  ? 70.730  48.441  -46.989 1.00 142.49 ? 279  LEU A CD2   1 
ATOM   2117  N  N     . GLU A 1  280  ? 74.877  48.531  -50.412 1.00 139.30 ? 280  GLU A N     1 
ATOM   2118  C  CA    . GLU A 1  280  ? 75.559  49.029  -51.605 1.00 141.65 ? 280  GLU A CA    1 
ATOM   2119  C  C     . GLU A 1  280  ? 75.339  48.095  -52.818 1.00 153.65 ? 280  GLU A C     1 
ATOM   2120  O  O     . GLU A 1  280  ? 74.685  48.509  -53.777 1.00 156.94 ? 280  GLU A O     1 
ATOM   2121  C  CB    . GLU A 1  280  ? 77.059  49.250  -51.341 1.00 139.19 ? 280  GLU A CB    1 
ATOM   2122  C  CG    . GLU A 1  280  ? 77.368  50.381  -50.376 1.00 149.91 ? 280  GLU A CG    1 
ATOM   2123  C  CD    . GLU A 1  280  ? 78.783  50.358  -49.824 1.00 176.67 ? 280  GLU A CD    1 
ATOM   2124  O  OE1   . GLU A 1  280  ? 79.142  49.370  -49.142 1.00 181.82 ? 280  GLU A OE1   1 
ATOM   2125  O  OE2   . GLU A 1  280  ? 79.528  51.339  -50.051 1.00 169.30 ? 280  GLU A OE2   1 
ATOM   2126  N  N     . HIS A 1  281  ? 75.857  46.833  -52.762 1.00 152.52 ? 281  HIS A N     1 
ATOM   2127  C  CA    . HIS A 1  281  ? 75.755  45.810  -53.826 1.00 156.34 ? 281  HIS A CA    1 
ATOM   2128  C  C     . HIS A 1  281  ? 74.305  45.521  -54.251 1.00 163.96 ? 281  HIS A C     1 
ATOM   2129  O  O     . HIS A 1  281  ? 74.095  44.951  -55.321 1.00 166.29 ? 281  HIS A O     1 
ATOM   2130  C  CB    . HIS A 1  281  ? 76.491  44.500  -53.441 1.00 156.51 ? 281  HIS A CB    1 
ATOM   2131  C  CG    . HIS A 1  281  ? 78.004  44.562  -53.463 1.00 157.82 ? 281  HIS A CG    1 
ATOM   2132  N  ND1   . HIS A 1  281  ? 78.749  43.831  -54.386 1.00 160.64 ? 281  HIS A ND1   1 
ATOM   2133  C  CD2   . HIS A 1  281  ? 78.864  45.216  -52.639 1.00 156.68 ? 281  HIS A CD2   1 
ATOM   2134  C  CE1   . HIS A 1  281  ? 80.023  44.076  -54.103 1.00 157.10 ? 281  HIS A CE1   1 
ATOM   2135  N  NE2   . HIS A 1  281  ? 80.145  44.899  -53.059 1.00 154.90 ? 281  HIS A NE2   1 
ATOM   2136  N  N     . ASN A 1  282  ? 73.318  45.924  -53.415 1.00 161.42 ? 282  ASN A N     1 
ATOM   2137  C  CA    . ASN A 1  282  ? 71.878  45.802  -53.662 1.00 165.81 ? 282  ASN A CA    1 
ATOM   2138  C  C     . ASN A 1  282  ? 71.233  47.184  -53.742 1.00 172.16 ? 282  ASN A C     1 
ATOM   2139  O  O     . ASN A 1  282  ? 71.942  48.190  -53.810 1.00 169.42 ? 282  ASN A O     1 
ATOM   2140  C  CB    . ASN A 1  282  ? 71.188  44.975  -52.570 1.00 166.94 ? 282  ASN A CB    1 
ATOM   2141  C  CG    . ASN A 1  282  ? 71.022  43.506  -52.859 1.00 195.97 ? 282  ASN A CG    1 
ATOM   2142  O  OD1   . ASN A 1  282  ? 71.001  42.689  -51.934 1.00 192.14 ? 282  ASN A OD1   1 
ATOM   2143  N  ND2   . ASN A 1  282  ? 70.836  43.131  -54.127 1.00 190.40 ? 282  ASN A ND2   1 
ATOM   2144  N  N     . GLY A 1  283  ? 69.895  47.204  -53.744 1.00 173.73 ? 283  GLY A N     1 
ATOM   2145  C  CA    . GLY A 1  283  ? 69.069  48.404  -53.818 1.00 176.60 ? 283  GLY A CA    1 
ATOM   2146  C  C     . GLY A 1  283  ? 69.465  49.427  -52.785 1.00 178.57 ? 283  GLY A C     1 
ATOM   2147  O  O     . GLY A 1  283  ? 69.027  49.350  -51.637 1.00 177.58 ? 283  GLY A O     1 
ATOM   2148  N  N     . ALA A 1  284  ? 70.343  50.354  -53.195 1.00 174.24 ? 284  ALA A N     1 
ATOM   2149  C  CA    . ALA A 1  284  ? 70.913  51.419  -52.383 1.00 171.81 ? 284  ALA A CA    1 
ATOM   2150  C  C     . ALA A 1  284  ? 69.844  52.384  -51.821 1.00 180.85 ? 284  ALA A C     1 
ATOM   2151  O  O     . ALA A 1  284  ? 69.326  53.198  -52.587 1.00 184.20 ? 284  ALA A O     1 
ATOM   2152  C  CB    . ALA A 1  284  ? 71.943  52.181  -53.206 1.00 171.28 ? 284  ALA A CB    1 
ATOM   2153  N  N     . PRO A 1  285  ? 69.483  52.336  -50.506 1.00 177.53 ? 285  PRO A N     1 
ATOM   2154  C  CA    . PRO A 1  285  ? 68.465  53.277  -49.995 1.00 180.26 ? 285  PRO A CA    1 
ATOM   2155  C  C     . PRO A 1  285  ? 69.026  54.657  -49.623 1.00 182.87 ? 285  PRO A C     1 
ATOM   2156  O  O     . PRO A 1  285  ? 68.307  55.462  -49.026 1.00 184.26 ? 285  PRO A O     1 
ATOM   2157  C  CB    . PRO A 1  285  ? 67.831  52.527  -48.812 1.00 181.91 ? 285  PRO A CB    1 
ATOM   2158  C  CG    . PRO A 1  285  ? 68.720  51.314  -48.567 1.00 183.12 ? 285  PRO A CG    1 
ATOM   2159  C  CD    . PRO A 1  285  ? 69.947  51.446  -49.426 1.00 176.02 ? 285  PRO A CD    1 
ATOM   2160  N  N     . HIS A 1  286  ? 70.306  54.928  -50.025 1.00 176.51 ? 286  HIS A N     1 
ATOM   2161  C  CA    . HIS A 1  286  ? 71.138  56.149  -49.964 1.00 174.63 ? 286  HIS A CA    1 
ATOM   2162  C  C     . HIS A 1  286  ? 71.333  56.812  -48.579 1.00 174.22 ? 286  HIS A C     1 
ATOM   2163  O  O     . HIS A 1  286  ? 72.437  57.281  -48.313 1.00 170.07 ? 286  HIS A O     1 
ATOM   2164  C  CB    . HIS A 1  286  ? 70.683  57.229  -50.974 1.00 180.09 ? 286  HIS A CB    1 
ATOM   2165  C  CG    . HIS A 1  286  ? 69.356  56.989  -51.655 1.00 189.45 ? 286  HIS A CG    1 
ATOM   2166  N  ND1   . HIS A 1  286  ? 69.215  56.038  -52.659 1.00 192.98 ? 286  HIS A ND1   1 
ATOM   2167  C  CD2   . HIS A 1  286  ? 68.159  57.601  -51.468 1.00 195.92 ? 286  HIS A CD2   1 
ATOM   2168  C  CE1   . HIS A 1  286  ? 67.946  56.101  -53.042 1.00 197.25 ? 286  HIS A CE1   1 
ATOM   2169  N  NE2   . HIS A 1  286  ? 67.271  57.026  -52.356 1.00 199.48 ? 286  HIS A NE2   1 
ATOM   2170  N  N     . HIS A 1  287  ? 70.283  56.919  -47.749 1.00 172.46 ? 287  HIS A N     1 
ATOM   2171  C  CA    . HIS A 1  287  ? 70.341  57.553  -46.426 1.00 170.69 ? 287  HIS A CA    1 
ATOM   2172  C  C     . HIS A 1  287  ? 70.293  56.560  -45.276 1.00 168.32 ? 287  HIS A C     1 
ATOM   2173  O  O     . HIS A 1  287  ? 70.220  56.955  -44.110 1.00 166.77 ? 287  HIS A O     1 
ATOM   2174  C  CB    . HIS A 1  287  ? 69.258  58.635  -46.271 1.00 176.55 ? 287  HIS A CB    1 
ATOM   2175  C  CG    . HIS A 1  287  ? 69.456  59.835  -47.151 1.00 182.48 ? 287  HIS A CG    1 
ATOM   2176  N  ND1   . HIS A 1  287  ? 70.726  60.331  -47.435 1.00 181.62 ? 287  HIS A ND1   1 
ATOM   2177  C  CD2   . HIS A 1  287  ? 68.533  60.622  -47.758 1.00 189.53 ? 287  HIS A CD2   1 
ATOM   2178  C  CE1   . HIS A 1  287  ? 70.532  61.383  -48.216 1.00 184.25 ? 287  HIS A CE1   1 
ATOM   2179  N  NE2   . HIS A 1  287  ? 69.228  61.600  -48.436 1.00 189.26 ? 287  HIS A NE2   1 
ATOM   2180  N  N     . ALA A 1  288  ? 70.324  55.270  -45.621 1.00 161.41 ? 288  ALA A N     1 
ATOM   2181  C  CA    . ALA A 1  288  ? 70.340  54.134  -44.706 1.00 158.23 ? 288  ALA A CA    1 
ATOM   2182  C  C     . ALA A 1  288  ? 71.738  53.602  -44.754 1.00 153.80 ? 288  ALA A C     1 
ATOM   2183  O  O     . ALA A 1  288  ? 72.186  52.916  -43.835 1.00 150.20 ? 288  ALA A O     1 
ATOM   2184  C  CB    . ALA A 1  288  ? 69.380  53.068  -45.195 1.00 161.92 ? 288  ALA A CB    1 
ATOM   2185  N  N     . ILE A 1  289  ? 72.417  53.921  -45.862 1.00 148.03 ? 289  ILE A N     1 
ATOM   2186  C  CA    . ILE A 1  289  ? 73.793  53.556  -46.152 1.00 143.77 ? 289  ILE A CA    1 
ATOM   2187  C  C     . ILE A 1  289  ? 74.716  54.329  -45.210 1.00 143.83 ? 289  ILE A C     1 
ATOM   2188  O  O     . ILE A 1  289  ? 75.642  53.740  -44.644 1.00 140.38 ? 289  ILE A O     1 
ATOM   2189  C  CB    . ILE A 1  289  ? 74.107  53.768  -47.661 1.00 147.77 ? 289  ILE A CB    1 
ATOM   2190  C  CG1   . ILE A 1  289  ? 73.135  52.937  -48.531 1.00 151.09 ? 289  ILE A CG1   1 
ATOM   2191  C  CG2   . ILE A 1  289  ? 75.582  53.438  -47.991 1.00 145.13 ? 289  ILE A CG2   1 
ATOM   2192  C  CD1   . ILE A 1  289  ? 73.269  53.100  -49.980 1.00 159.47 ? 289  ILE A CD1   1 
ATOM   2193  N  N     . GLU A 1  290  ? 74.427  55.629  -44.997 1.00 140.74 ? 290  GLU A N     1 
ATOM   2194  C  CA    . GLU A 1  290  ? 75.204  56.468  -44.084 1.00 137.92 ? 290  GLU A CA    1 
ATOM   2195  C  C     . GLU A 1  290  ? 75.079  55.968  -42.659 1.00 138.55 ? 290  GLU A C     1 
ATOM   2196  O  O     . GLU A 1  290  ? 76.047  56.059  -41.905 1.00 135.61 ? 290  GLU A O     1 
ATOM   2197  C  CB    . GLU A 1  290  ? 74.839  57.956  -44.199 1.00 141.71 ? 290  GLU A CB    1 
ATOM   2198  C  CG    . GLU A 1  290  ? 73.356  58.262  -44.280 1.00 159.45 ? 290  GLU A CG    1 
ATOM   2199  C  CD    . GLU A 1  290  ? 73.044  59.467  -45.145 1.00 194.07 ? 290  GLU A CD    1 
ATOM   2200  O  OE1   . GLU A 1  290  ? 73.210  59.376  -46.384 1.00 194.48 ? 290  GLU A OE1   1 
ATOM   2201  O  OE2   . GLU A 1  290  ? 72.621  60.503  -44.583 1.00 195.26 ? 290  GLU A OE2   1 
ATOM   2202  N  N     . GLU A 1  291  ? 73.910  55.377  -42.320 1.00 135.35 ? 291  GLU A N     1 
ATOM   2203  C  CA    . GLU A 1  291  ? 73.620  54.784  -41.012 1.00 133.76 ? 291  GLU A CA    1 
ATOM   2204  C  C     . GLU A 1  291  ? 74.501  53.545  -40.785 1.00 131.47 ? 291  GLU A C     1 
ATOM   2205  O  O     . GLU A 1  291  ? 75.244  53.501  -39.799 1.00 127.89 ? 291  GLU A O     1 
ATOM   2206  C  CB    . GLU A 1  291  ? 72.125  54.442  -40.884 1.00 139.07 ? 291  GLU A CB    1 
ATOM   2207  C  CG    . GLU A 1  291  ? 71.225  55.662  -41.012 1.00 158.25 ? 291  GLU A CG    1 
ATOM   2208  C  CD    . GLU A 1  291  ? 69.729  55.413  -41.042 1.00 198.47 ? 291  GLU A CD    1 
ATOM   2209  O  OE1   . GLU A 1  291  ? 69.281  54.418  -40.426 1.00 205.98 ? 291  GLU A OE1   1 
ATOM   2210  O  OE2   . GLU A 1  291  ? 68.998  56.241  -41.638 1.00 196.74 ? 291  GLU A OE2   1 
ATOM   2211  N  N     . ALA A 1  292  ? 74.462  52.576  -41.738 1.00 126.57 ? 292  ALA A N     1 
ATOM   2212  C  CA    . ALA A 1  292  ? 75.248  51.336  -41.705 1.00 122.92 ? 292  ALA A CA    1 
ATOM   2213  C  C     . ALA A 1  292  ? 76.734  51.597  -41.848 1.00 120.35 ? 292  ALA A C     1 
ATOM   2214  O  O     . ALA A 1  292  ? 77.526  50.777  -41.368 1.00 117.39 ? 292  ALA A O     1 
ATOM   2215  C  CB    . ALA A 1  292  ? 74.778  50.373  -42.779 1.00 125.45 ? 292  ALA A CB    1 
ATOM   2216  N  N     . GLU A 1  293  ? 77.111  52.741  -42.495 1.00 115.06 ? 293  GLU A N     1 
ATOM   2217  C  CA    . GLU A 1  293  ? 78.508  53.156  -42.657 1.00 111.62 ? 293  GLU A CA    1 
ATOM   2218  C  C     . GLU A 1  293  ? 79.063  53.634  -41.325 1.00 111.94 ? 293  GLU A C     1 
ATOM   2219  O  O     . GLU A 1  293  ? 80.118  53.163  -40.907 1.00 109.17 ? 293  GLU A O     1 
ATOM   2220  C  CB    . GLU A 1  293  ? 78.717  54.233  -43.749 1.00 114.09 ? 293  GLU A CB    1 
ATOM   2221  C  CG    . GLU A 1  293  ? 80.152  54.203  -44.285 1.00 127.31 ? 293  GLU A CG    1 
ATOM   2222  C  CD    . GLU A 1  293  ? 80.895  55.479  -44.670 1.00 152.35 ? 293  GLU A CD    1 
ATOM   2223  O  OE1   . GLU A 1  293  ? 80.257  56.390  -45.250 1.00 160.20 ? 293  GLU A OE1   1 
ATOM   2224  O  OE2   . GLU A 1  293  ? 82.135  55.529  -44.467 1.00 114.20 ? 293  GLU A OE2   1 
ATOM   2225  N  N     . SER A 1  294  ? 78.341  54.542  -40.647 1.00 108.54 ? 294  SER A N     1 
ATOM   2226  C  CA    . SER A 1  294  ? 78.733  55.109  -39.356 1.00 106.51 ? 294  SER A CA    1 
ATOM   2227  C  C     . SER A 1  294  ? 78.829  54.043  -38.266 1.00 106.15 ? 294  SER A C     1 
ATOM   2228  O  O     . SER A 1  294  ? 79.659  54.161  -37.362 1.00 103.69 ? 294  SER A O     1 
ATOM   2229  C  CB    . SER A 1  294  ? 77.775  56.223  -38.956 1.00 114.02 ? 294  SER A CB    1 
ATOM   2230  O  OG    . SER A 1  294  ? 77.790  57.276  -39.908 1.00 126.11 ? 294  SER A OG    1 
ATOM   2231  N  N     . LEU A 1  295  ? 78.004  52.987  -38.381 1.00 102.03 ? 295  LEU A N     1 
ATOM   2232  C  CA    . LEU A 1  295  ? 78.012  51.834  -37.486 1.00 100.17 ? 295  LEU A CA    1 
ATOM   2233  C  C     . LEU A 1  295  ? 79.325  51.068  -37.662 1.00 98.88  ? 295  LEU A C     1 
ATOM   2234  O  O     . LEU A 1  295  ? 79.932  50.681  -36.661 1.00 96.90  ? 295  LEU A O     1 
ATOM   2235  C  CB    . LEU A 1  295  ? 76.805  50.932  -37.780 1.00 102.56 ? 295  LEU A CB    1 
ATOM   2236  C  CG    . LEU A 1  295  ? 76.885  49.471  -37.349 1.00 106.46 ? 295  LEU A CG    1 
ATOM   2237  C  CD1   . LEU A 1  295  ? 76.674  49.310  -35.848 1.00 106.56 ? 295  LEU A CD1   1 
ATOM   2238  C  CD2   . LEU A 1  295  ? 75.899  48.634  -38.128 1.00 112.30 ? 295  LEU A CD2   1 
ATOM   2239  N  N     . LEU A 1  296  ? 79.765  50.862  -38.927 1.00 93.44  ? 296  LEU A N     1 
ATOM   2240  C  CA    . LEU A 1  296  ? 81.036  50.202  -39.213 1.00 90.63  ? 296  LEU A CA    1 
ATOM   2241  C  C     . LEU A 1  296  ? 82.177  51.036  -38.581 1.00 94.84  ? 296  LEU A C     1 
ATOM   2242  O  O     . LEU A 1  296  ? 83.011  50.473  -37.856 1.00 93.38  ? 296  LEU A O     1 
ATOM   2243  C  CB    . LEU A 1  296  ? 81.243  50.000  -40.732 1.00 90.44  ? 296  LEU A CB    1 
ATOM   2244  C  CG    . LEU A 1  296  ? 82.412  49.088  -41.150 1.00 92.76  ? 296  LEU A CG    1 
ATOM   2245  C  CD1   . LEU A 1  296  ? 82.158  47.659  -40.773 1.00 93.34  ? 296  LEU A CD1   1 
ATOM   2246  C  CD2   . LEU A 1  296  ? 82.642  49.126  -42.627 1.00 95.02  ? 296  LEU A CD2   1 
ATOM   2247  N  N     . GLN A 1  297  ? 82.136  52.391  -38.776 1.00 92.24  ? 297  GLN A N     1 
ATOM   2248  C  CA    . GLN A 1  297  ? 83.092  53.369  -38.229 1.00 90.44  ? 297  GLN A CA    1 
ATOM   2249  C  C     . GLN A 1  297  ? 83.170  53.213  -36.745 1.00 93.76  ? 297  GLN A C     1 
ATOM   2250  O  O     . GLN A 1  297  ? 84.262  53.135  -36.196 1.00 90.45  ? 297  GLN A O     1 
ATOM   2251  C  CB    . GLN A 1  297  ? 82.718  54.829  -38.607 1.00 93.14  ? 297  GLN A CB    1 
ATOM   2252  C  CG    . GLN A 1  297  ? 83.521  55.959  -37.900 1.00 101.26 ? 297  GLN A CG    1 
ATOM   2253  C  CD    . GLN A 1  297  ? 85.027  55.942  -38.133 1.00 101.31 ? 297  GLN A CD    1 
ATOM   2254  O  OE1   . GLN A 1  297  ? 85.563  56.557  -39.061 1.00 92.02  ? 297  GLN A OE1   1 
ATOM   2255  N  NE2   . GLN A 1  297  ? 85.751  55.273  -37.261 1.00 84.72  ? 297  GLN A NE2   1 
ATOM   2256  N  N     . PHE A 1  298  ? 82.007  53.108  -36.111 1.00 94.38  ? 298  PHE A N     1 
ATOM   2257  C  CA    . PHE A 1  298  ? 81.894  52.930  -34.679 1.00 95.61  ? 298  PHE A CA    1 
ATOM   2258  C  C     . PHE A 1  298  ? 82.586  51.669  -34.201 1.00 99.07  ? 298  PHE A C     1 
ATOM   2259  O  O     . PHE A 1  298  ? 83.361  51.732  -33.255 1.00 97.50  ? 298  PHE A O     1 
ATOM   2260  C  CB    . PHE A 1  298  ? 80.421  52.905  -34.250 1.00 100.34 ? 298  PHE A CB    1 
ATOM   2261  C  CG    . PHE A 1  298  ? 80.236  52.486  -32.813 1.00 102.63 ? 298  PHE A CG    1 
ATOM   2262  C  CD1   . PHE A 1  298  ? 80.103  51.144  -32.473 1.00 104.85 ? 298  PHE A CD1   1 
ATOM   2263  C  CD2   . PHE A 1  298  ? 80.226  53.430  -31.793 1.00 107.07 ? 298  PHE A CD2   1 
ATOM   2264  C  CE1   . PHE A 1  298  ? 79.966  50.758  -31.142 1.00 108.81 ? 298  PHE A CE1   1 
ATOM   2265  C  CE2   . PHE A 1  298  ? 80.060  53.044  -30.460 1.00 108.87 ? 298  PHE A CE2   1 
ATOM   2266  C  CZ    . PHE A 1  298  ? 79.917  51.714  -30.147 1.00 107.87 ? 298  PHE A CZ    1 
ATOM   2267  N  N     . HIS A 1  299  ? 82.251  50.530  -34.795 1.00 96.90  ? 299  HIS A N     1 
ATOM   2268  C  CA    . HIS A 1  299  ? 82.803  49.265  -34.358 1.00 96.63  ? 299  HIS A CA    1 
ATOM   2269  C  C     . HIS A 1  299  ? 84.303  49.152  -34.529 1.00 100.05 ? 299  HIS A C     1 
ATOM   2270  O  O     . HIS A 1  299  ? 84.983  48.747  -33.579 1.00 100.55 ? 299  HIS A O     1 
ATOM   2271  C  CB    . HIS A 1  299  ? 82.086  48.109  -35.018 1.00 98.53  ? 299  HIS A CB    1 
ATOM   2272  C  CG    . HIS A 1  299  ? 80.930  47.651  -34.213 1.00 103.76 ? 299  HIS A CG    1 
ATOM   2273  N  ND1   . HIS A 1  299  ? 79.652  47.650  -34.730 1.00 107.62 ? 299  HIS A ND1   1 
ATOM   2274  C  CD2   . HIS A 1  299  ? 80.893  47.237  -32.928 1.00 105.75 ? 299  HIS A CD2   1 
ATOM   2275  C  CE1   . HIS A 1  299  ? 78.881  47.198  -33.762 1.00 108.77 ? 299  HIS A CE1   1 
ATOM   2276  N  NE2   . HIS A 1  299  ? 79.588  46.937  -32.658 1.00 108.14 ? 299  HIS A NE2   1 
ATOM   2277  N  N     . VAL A 1  300  ? 84.828  49.537  -35.709 1.00 93.88  ? 300  VAL A N     1 
ATOM   2278  C  CA    . VAL A 1  300  ? 86.264  49.505  -35.988 1.00 90.76  ? 300  VAL A CA    1 
ATOM   2279  C  C     . VAL A 1  300  ? 87.004  50.388  -34.957 1.00 93.98  ? 300  VAL A C     1 
ATOM   2280  O  O     . VAL A 1  300  ? 88.053  49.993  -34.430 1.00 92.00  ? 300  VAL A O     1 
ATOM   2281  C  CB    . VAL A 1  300  ? 86.507  49.915  -37.452 1.00 93.41  ? 300  VAL A CB    1 
ATOM   2282  C  CG1   . VAL A 1  300  ? 87.982  50.192  -37.726 1.00 91.55  ? 300  VAL A CG1   1 
ATOM   2283  C  CG2   . VAL A 1  300  ? 85.970  48.849  -38.394 1.00 93.85  ? 300  VAL A CG2   1 
ATOM   2284  N  N     . ALA A 1  301  ? 86.380  51.545  -34.617 1.00 91.44  ? 301  ALA A N     1 
ATOM   2285  C  CA    . ALA A 1  301  ? 86.856  52.498  -33.617 1.00 90.28  ? 301  ALA A CA    1 
ATOM   2286  C  C     . ALA A 1  301  ? 86.859  51.816  -32.261 1.00 92.65  ? 301  ALA A C     1 
ATOM   2287  O  O     . ALA A 1  301  ? 87.921  51.583  -31.682 1.00 91.56  ? 301  ALA A O     1 
ATOM   2288  C  CB    . ALA A 1  301  ? 85.944  53.722  -33.578 1.00 92.26  ? 301  ALA A CB    1 
ATOM   2289  N  N     . THR A 1  302  ? 85.667  51.401  -31.827 1.00 88.60  ? 302  THR A N     1 
ATOM   2290  C  CA    . THR A 1  302  ? 85.366  50.789  -30.558 1.00 88.55  ? 302  THR A CA    1 
ATOM   2291  C  C     . THR A 1  302  ? 86.255  49.536  -30.273 1.00 92.20  ? 302  THR A C     1 
ATOM   2292  O  O     . THR A 1  302  ? 86.650  49.347  -29.118 1.00 91.47  ? 302  THR A O     1 
ATOM   2293  C  CB    . THR A 1  302  ? 83.861  50.607  -30.478 1.00 94.13  ? 302  THR A CB    1 
ATOM   2294  O  OG1   . THR A 1  302  ? 83.430  51.343  -29.344 1.00 94.91  ? 302  THR A OG1   1 
ATOM   2295  C  CG2   . THR A 1  302  ? 83.358  49.137  -30.523 1.00 91.71  ? 302  THR A CG2   1 
ATOM   2296  N  N     . TYR A 1  303  ? 86.640  48.758  -31.313 1.00 88.95  ? 303  TYR A N     1 
ATOM   2297  C  CA    . TYR A 1  303  ? 87.498  47.567  -31.167 1.00 88.11  ? 303  TYR A CA    1 
ATOM   2298  C  C     . TYR A 1  303  ? 88.941  47.974  -30.768 1.00 89.92  ? 303  TYR A C     1 
ATOM   2299  O  O     . TYR A 1  303  ? 89.486  47.393  -29.819 1.00 89.48  ? 303  TYR A O     1 
ATOM   2300  C  CB    . TYR A 1  303  ? 87.392  46.674  -32.431 1.00 88.76  ? 303  TYR A CB    1 
ATOM   2301  C  CG    . TYR A 1  303  ? 88.602  45.886  -32.887 1.00 88.48  ? 303  TYR A CG    1 
ATOM   2302  C  CD1   . TYR A 1  303  ? 88.819  44.581  -32.444 1.00 90.32  ? 303  TYR A CD1   1 
ATOM   2303  C  CD2   . TYR A 1  303  ? 89.419  46.365  -33.903 1.00 88.49  ? 303  TYR A CD2   1 
ATOM   2304  C  CE1   . TYR A 1  303  ? 89.891  43.820  -32.921 1.00 89.90  ? 303  TYR A CE1   1 
ATOM   2305  C  CE2   . TYR A 1  303  ? 90.479  45.609  -34.403 1.00 89.15  ? 303  TYR A CE2   1 
ATOM   2306  C  CZ    . TYR A 1  303  ? 90.710  44.333  -33.919 1.00 95.80  ? 303  TYR A CZ    1 
ATOM   2307  O  OH    . TYR A 1  303  ? 91.790  43.636  -34.431 1.00 93.26  ? 303  TYR A OH    1 
ATOM   2308  N  N     . MET A 1  304  ? 89.496  49.042  -31.402 1.00 84.22  ? 304  MET A N     1 
ATOM   2309  C  CA    . MET A 1  304  ? 90.830  49.542  -31.061 1.00 82.22  ? 304  MET A CA    1 
ATOM   2310  C  C     . MET A 1  304  ? 90.825  50.425  -29.818 1.00 88.58  ? 304  MET A C     1 
ATOM   2311  O  O     . MET A 1  304  ? 91.753  50.317  -29.022 1.00 89.13  ? 304  MET A O     1 
ATOM   2312  C  CB    . MET A 1  304  ? 91.519  50.210  -32.238 1.00 82.89  ? 304  MET A CB    1 
ATOM   2313  C  CG    . MET A 1  304  ? 91.913  49.215  -33.289 1.00 85.63  ? 304  MET A CG    1 
ATOM   2314  S  SD    . MET A 1  304  ? 92.556  49.914  -34.809 1.00 88.99  ? 304  MET A SD    1 
ATOM   2315  C  CE    . MET A 1  304  ? 91.152  51.135  -35.243 1.00 86.58  ? 304  MET A CE    1 
ATOM   2316  N  N     . ASP A 1  305  ? 89.790  51.266  -29.623 1.00 86.24  ? 305  ASP A N     1 
ATOM   2317  C  CA    . ASP A 1  305  ? 89.652  52.097  -28.419 1.00 87.41  ? 305  ASP A CA    1 
ATOM   2318  C  C     . ASP A 1  305  ? 88.208  52.095  -27.950 1.00 94.20  ? 305  ASP A C     1 
ATOM   2319  O  O     . ASP A 1  305  ? 87.317  52.272  -28.767 1.00 94.93  ? 305  ASP A O     1 
ATOM   2320  C  CB    . ASP A 1  305  ? 90.159  53.539  -28.624 1.00 89.24  ? 305  ASP A CB    1 
ATOM   2321  C  CG    . ASP A 1  305  ? 90.240  54.360  -27.334 1.00 104.11 ? 305  ASP A CG    1 
ATOM   2322  O  OD1   . ASP A 1  305  ? 90.034  53.777  -26.234 1.00 106.46 ? 305  ASP A OD1   1 
ATOM   2323  O  OD2   . ASP A 1  305  ? 90.535  55.583  -27.419 1.00 109.41 ? 305  ASP A OD2   1 
ATOM   2324  N  N     . ASN A 1  306  ? 87.968  51.889  -26.648 1.00 92.38  ? 306  ASN A N     1 
ATOM   2325  C  CA    . ASN A 1  306  ? 86.603  51.882  -26.116 1.00 94.40  ? 306  ASN A CA    1 
ATOM   2326  C  C     . ASN A 1  306  ? 86.434  52.833  -24.960 1.00 101.64 ? 306  ASN A C     1 
ATOM   2327  O  O     . ASN A 1  306  ? 85.370  52.900  -24.339 1.00 103.95 ? 306  ASN A O     1 
ATOM   2328  C  CB    . ASN A 1  306  ? 86.115  50.483  -25.752 1.00 93.31  ? 306  ASN A CB    1 
ATOM   2329  C  CG    . ASN A 1  306  ? 84.605  50.399  -25.681 1.00 107.51 ? 306  ASN A CG    1 
ATOM   2330  O  OD1   . ASN A 1  306  ? 83.873  51.319  -26.075 1.00 102.83 ? 306  ASN A OD1   1 
ATOM   2331  N  ND2   . ASN A 1  306  ? 84.101  49.294  -25.183 1.00 97.00  ? 306  ASN A ND2   1 
ATOM   2332  N  N     . ASP A 1  307  ? 87.474  53.598  -24.694 1.00 98.15  ? 307  ASP A N     1 
ATOM   2333  C  CA    . ASP A 1  307  ? 87.447  54.589  -23.641 1.00 100.41 ? 307  ASP A CA    1 
ATOM   2334  C  C     . ASP A 1  307  ? 87.458  55.943  -24.376 1.00 101.84 ? 307  ASP A C     1 
ATOM   2335  O  O     . ASP A 1  307  ? 88.240  56.832  -24.044 1.00 102.03 ? 307  ASP A O     1 
ATOM   2336  C  CB    . ASP A 1  307  ? 88.655  54.378  -22.693 1.00 103.80 ? 307  ASP A CB    1 
ATOM   2337  C  CG    . ASP A 1  307  ? 89.075  52.915  -22.491 1.00 125.46 ? 307  ASP A CG    1 
ATOM   2338  O  OD1   . ASP A 1  307  ? 88.314  52.159  -21.836 1.00 129.14 ? 307  ASP A OD1   1 
ATOM   2339  O  OD2   . ASP A 1  307  ? 90.160  52.525  -23.008 1.00 132.60 ? 307  ASP A OD2   1 
ATOM   2340  N  N     . ILE A 1  308  ? 86.598  56.067  -25.418 1.00 96.31  ? 308  ILE A N     1 
ATOM   2341  C  CA    . ILE A 1  308  ? 86.483  57.250  -26.276 1.00 95.29  ? 308  ILE A CA    1 
ATOM   2342  C  C     . ILE A 1  308  ? 85.630  58.294  -25.612 1.00 104.48 ? 308  ILE A C     1 
ATOM   2343  O  O     . ILE A 1  308  ? 84.651  57.936  -24.952 1.00 105.83 ? 308  ILE A O     1 
ATOM   2344  C  CB    . ILE A 1  308  ? 85.968  56.921  -27.702 1.00 96.36  ? 308  ILE A CB    1 
ATOM   2345  C  CG1   . ILE A 1  308  ? 86.692  55.715  -28.317 1.00 94.37  ? 308  ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A 1  308  ? 86.097  58.126  -28.618 1.00 96.21  ? 308  ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A 1  308  ? 85.980  55.089  -29.533 1.00 103.68 ? 308  ILE A CD1   1 
ATOM   2348  N  N     . ALA A 1  309  ? 86.010  59.587  -25.820 1.00 104.64 ? 309  ALA A N     1 
ATOM   2349  C  CA    . ALA A 1  309  ? 85.404  60.841  -25.350 1.00 109.15 ? 309  ALA A CA    1 
ATOM   2350  C  C     . ALA A 1  309  ? 83.845  60.887  -25.466 1.00 121.33 ? 309  ALA A C     1 
ATOM   2351  O  O     . ALA A 1  309  ? 83.150  61.134  -24.461 1.00 123.57 ? 309  ALA A O     1 
ATOM   2352  C  CB    . ALA A 1  309  ? 86.030  62.006  -26.101 1.00 109.45 ? 309  ALA A CB    1 
ATOM   2353  N  N     . GLY A 1  310  ? 83.338  60.628  -26.685 1.00 120.27 ? 310  GLY A N     1 
ATOM   2354  C  CA    . GLY A 1  310  ? 81.916  60.539  -27.010 1.00 122.68 ? 310  GLY A CA    1 
ATOM   2355  C  C     . GLY A 1  310  ? 81.295  59.324  -26.353 1.00 128.49 ? 310  GLY A C     1 
ATOM   2356  O  O     . GLY A 1  310  ? 81.486  58.189  -26.810 1.00 124.57 ? 310  GLY A O     1 
ATOM   2357  N  N     . GLN A 1  311  ? 80.601  59.602  -25.231 1.00 131.49 ? 311  GLN A N     1 
ATOM   2358  C  CA    . GLN A 1  311  ? 79.841  58.790  -24.259 1.00 135.27 ? 311  GLN A CA    1 
ATOM   2359  C  C     . GLN A 1  311  ? 79.600  57.261  -24.572 1.00 139.81 ? 311  GLN A C     1 
ATOM   2360  O  O     . GLN A 1  311  ? 79.881  56.484  -23.656 1.00 139.85 ? 311  GLN A O     1 
ATOM   2361  C  CB    . GLN A 1  311  ? 78.473  59.466  -23.957 1.00 141.25 ? 311  GLN A CB    1 
ATOM   2362  C  CG    . GLN A 1  311  ? 77.849  59.118  -22.581 1.00 163.29 ? 311  GLN A CG    1 
ATOM   2363  C  CD    . GLN A 1  311  ? 76.455  59.686  -22.357 1.00 180.40 ? 311  GLN A CD    1 
ATOM   2364  O  OE1   . GLN A 1  311  ? 76.224  60.902  -22.405 1.00 177.46 ? 311  GLN A OE1   1 
ATOM   2365  N  NE2   . GLN A 1  311  ? 75.504  58.819  -22.029 1.00 169.86 ? 311  GLN A NE2   1 
ATOM   2366  N  N     . PRO A 1  312  ? 79.006  56.785  -25.714 1.00 136.39 ? 312  PRO A N     1 
ATOM   2367  C  CA    . PRO A 1  312  ? 78.802  55.331  -25.893 1.00 135.19 ? 312  PRO A CA    1 
ATOM   2368  C  C     . PRO A 1  312  ? 80.021  54.466  -25.589 1.00 134.95 ? 312  PRO A C     1 
ATOM   2369  O  O     . PRO A 1  312  ? 81.068  54.540  -26.265 1.00 132.67 ? 312  PRO A O     1 
ATOM   2370  C  CB    . PRO A 1  312  ? 78.392  55.211  -27.366 1.00 136.76 ? 312  PRO A CB    1 
ATOM   2371  C  CG    . PRO A 1  312  ? 78.841  56.503  -27.996 1.00 141.14 ? 312  PRO A CG    1 
ATOM   2372  C  CD    . PRO A 1  312  ? 78.539  57.496  -26.918 1.00 138.88 ? 312  PRO A CD    1 
ATOM   2373  N  N     . GLN A 1  313  ? 79.881  53.664  -24.530 1.00 129.93 ? 313  GLN A N     1 
ATOM   2374  C  CA    . GLN A 1  313  ? 80.946  52.792  -24.061 1.00 126.86 ? 313  GLN A CA    1 
ATOM   2375  C  C     . GLN A 1  313  ? 80.963  51.441  -24.776 1.00 126.99 ? 313  GLN A C     1 
ATOM   2376  O  O     . GLN A 1  313  ? 81.748  50.573  -24.392 1.00 125.71 ? 313  GLN A O     1 
ATOM   2377  C  CB    . GLN A 1  313  ? 80.865  52.628  -22.531 1.00 130.01 ? 313  GLN A CB    1 
ATOM   2378  C  CG    . GLN A 1  313  ? 81.781  53.569  -21.761 1.00 132.64 ? 313  GLN A CG    1 
ATOM   2379  C  CD    . GLN A 1  313  ? 83.032  52.885  -21.269 1.00 130.95 ? 313  GLN A CD    1 
ATOM   2380  O  OE1   . GLN A 1  313  ? 83.017  52.151  -20.279 1.00 122.74 ? 313  GLN A OE1   1 
ATOM   2381  N  NE2   . GLN A 1  313  ? 84.154  53.172  -21.899 1.00 114.14 ? 313  GLN A NE2   1 
ATOM   2382  N  N     . ALA A 1  314  ? 80.118  51.265  -25.824 1.00 121.57 ? 314  ALA A N     1 
ATOM   2383  C  CA    . ALA A 1  314  ? 79.990  50.026  -26.600 1.00 119.74 ? 314  ALA A CA    1 
ATOM   2384  C  C     . ALA A 1  314  ? 79.885  48.832  -25.663 1.00 124.19 ? 314  ALA A C     1 
ATOM   2385  O  O     . ALA A 1  314  ? 80.645  47.877  -25.806 1.00 122.78 ? 314  ALA A O     1 
ATOM   2386  C  CB    . ALA A 1  314  ? 81.185  49.855  -27.523 1.00 117.25 ? 314  ALA A CB    1 
ATOM   2387  N  N     . LEU A 1  315  ? 78.985  48.914  -24.669 1.00 122.59 ? 315  LEU A N     1 
ATOM   2388  C  CA    . LEU A 1  315  ? 78.803  47.896  -23.636 1.00 123.45 ? 315  LEU A CA    1 
ATOM   2389  C  C     . LEU A 1  315  ? 78.345  46.553  -24.174 1.00 129.66 ? 315  LEU A C     1 
ATOM   2390  O  O     . LEU A 1  315  ? 77.457  46.509  -25.025 1.00 131.00 ? 315  LEU A O     1 
ATOM   2391  C  CB    . LEU A 1  315  ? 77.808  48.374  -22.574 1.00 126.17 ? 315  LEU A CB    1 
ATOM   2392  C  CG    . LEU A 1  315  ? 78.218  49.584  -21.779 1.00 130.54 ? 315  LEU A CG    1 
ATOM   2393  C  CD1   . LEU A 1  315  ? 77.537  50.836  -22.304 1.00 131.32 ? 315  LEU A CD1   1 
ATOM   2394  C  CD2   . LEU A 1  315  ? 77.906  49.389  -20.324 1.00 135.82 ? 315  LEU A CD2   1 
ATOM   2395  N  N     . GLN A 1  316  ? 78.954  45.460  -23.674 1.00 126.31 ? 316  GLN A N     1 
ATOM   2396  C  CA    . GLN A 1  316  ? 78.572  44.081  -23.968 1.00 127.54 ? 316  GLN A CA    1 
ATOM   2397  C  C     . GLN A 1  316  ? 77.253  43.902  -23.238 1.00 136.12 ? 316  GLN A C     1 
ATOM   2398  O  O     . GLN A 1  316  ? 77.138  44.419  -22.118 1.00 137.86 ? 316  GLN A O     1 
ATOM   2399  C  CB    . GLN A 1  316  ? 79.594  43.100  -23.362 1.00 128.20 ? 316  GLN A CB    1 
ATOM   2400  C  CG    . GLN A 1  316  ? 79.479  41.678  -23.906 1.00 152.28 ? 316  GLN A CG    1 
ATOM   2401  C  CD    . GLN A 1  316  ? 80.679  41.301  -24.753 1.00 177.13 ? 316  GLN A CD    1 
ATOM   2402  O  OE1   . GLN A 1  316  ? 80.734  41.524  -25.982 1.00 170.19 ? 316  GLN A OE1   1 
ATOM   2403  N  NE2   . GLN A 1  316  ? 81.671  40.710  -24.109 1.00 171.95 ? 316  GLN A NE2   1 
ATOM   2404  N  N     . LYS A 1  317  ? 76.245  43.222  -23.849 1.00 134.25 ? 317  LYS A N     1 
ATOM   2405  C  CA    . LYS A 1  317  ? 74.992  43.019  -23.120 1.00 137.74 ? 317  LYS A CA    1 
ATOM   2406  C  C     . LYS A 1  317  ? 75.342  42.098  -21.968 1.00 143.34 ? 317  LYS A C     1 
ATOM   2407  O  O     . LYS A 1  317  ? 75.736  40.944  -22.172 1.00 142.76 ? 317  LYS A O     1 
ATOM   2408  C  CB    . LYS A 1  317  ? 73.835  42.485  -23.974 1.00 141.62 ? 317  LYS A CB    1 
ATOM   2409  C  CG    . LYS A 1  317  ? 72.482  42.817  -23.344 1.00 150.59 ? 317  LYS A CG    1 
ATOM   2410  C  CD    . LYS A 1  317  ? 71.415  41.779  -23.645 1.00 160.97 ? 317  LYS A CD    1 
ATOM   2411  C  CE    . LYS A 1  317  ? 70.162  42.047  -22.847 1.00 176.51 ? 317  LYS A CE    1 
ATOM   2412  N  NZ    . LYS A 1  317  ? 69.110  41.018  -23.074 1.00 188.53 ? 317  LYS A NZ    1 
ATOM   2413  N  N     . SER A 1  318  ? 75.386  42.725  -20.781 1.00 140.69 ? 318  SER A N     1 
ATOM   2414  C  CA    . SER A 1  318  ? 75.759  42.253  -19.447 1.00 141.58 ? 318  SER A CA    1 
ATOM   2415  C  C     . SER A 1  318  ? 75.721  43.503  -18.549 1.00 145.95 ? 318  SER A C     1 
ATOM   2416  O  O     . SER A 1  318  ? 75.073  43.507  -17.494 1.00 149.01 ? 318  SER A O     1 
ATOM   2417  C  CB    . SER A 1  318  ? 77.170  41.640  -19.436 1.00 141.52 ? 318  SER A CB    1 
ATOM   2418  O  OG    . SER A 1  318  ? 78.106  42.258  -20.307 1.00 142.94 ? 318  SER A OG    1 
ATOM   2419  N  N     . GLY A 1  319  ? 76.355  44.567  -19.050 1.00 138.87 ? 319  GLY A N     1 
ATOM   2420  C  CA    . GLY A 1  319  ? 76.510  45.863  -18.404 1.00 138.46 ? 319  GLY A CA    1 
ATOM   2421  C  C     . GLY A 1  319  ? 77.978  46.221  -18.336 1.00 137.82 ? 319  GLY A C     1 
ATOM   2422  O  O     . GLY A 1  319  ? 78.351  47.228  -17.725 1.00 137.69 ? 319  GLY A O     1 
ATOM   2423  N  N     . ARG A 1  320  ? 78.815  45.355  -18.959 1.00 130.53 ? 320  ARG A N     1 
ATOM   2424  C  CA    . ARG A 1  320  ? 80.276  45.410  -19.057 1.00 126.70 ? 320  ARG A CA    1 
ATOM   2425  C  C     . ARG A 1  320  ? 80.678  46.217  -20.301 1.00 124.21 ? 320  ARG A C     1 
ATOM   2426  O  O     . ARG A 1  320  ? 80.098  45.993  -21.357 1.00 123.55 ? 320  ARG A O     1 
ATOM   2427  C  CB    . ARG A 1  320  ? 80.838  43.970  -19.117 1.00 128.66 ? 320  ARG A CB    1 
ATOM   2428  C  CG    . ARG A 1  320  ? 82.299  43.828  -19.562 1.00 142.44 ? 320  ARG A CG    1 
ATOM   2429  C  CD    . ARG A 1  320  ? 82.409  43.416  -21.022 1.00 154.50 ? 320  ARG A CD    1 
ATOM   2430  N  NE    . ARG A 1  320  ? 83.416  42.376  -21.212 1.00 164.98 ? 320  ARG A NE    1 
ATOM   2431  C  CZ    . ARG A 1  320  ? 83.170  41.072  -21.161 1.00 183.52 ? 320  ARG A CZ    1 
ATOM   2432  N  NH1   . ARG A 1  320  ? 81.936  40.628  -20.945 1.00 175.31 ? 320  ARG A NH1   1 
ATOM   2433  N  NH2   . ARG A 1  320  ? 84.154  40.199  -21.331 1.00 171.13 ? 320  ARG A NH2   1 
ATOM   2434  N  N     . PRO A 1  321  ? 81.724  47.071  -20.232 1.00 115.42 ? 321  PRO A N     1 
ATOM   2435  C  CA    . PRO A 1  321  ? 82.067  47.905  -21.388 1.00 111.25 ? 321  PRO A CA    1 
ATOM   2436  C  C     . PRO A 1  321  ? 82.711  47.245  -22.604 1.00 109.33 ? 321  PRO A C     1 
ATOM   2437  O  O     . PRO A 1  321  ? 82.413  47.730  -23.681 1.00 108.83 ? 321  PRO A O     1 
ATOM   2438  C  CB    . PRO A 1  321  ? 83.007  48.948  -20.799 1.00 112.26 ? 321  PRO A CB    1 
ATOM   2439  C  CG    . PRO A 1  321  ? 82.740  48.926  -19.341 1.00 120.02 ? 321  PRO A CG    1 
ATOM   2440  C  CD    . PRO A 1  321  ? 82.496  47.493  -19.052 1.00 117.10 ? 321  PRO A CD    1 
ATOM   2441  N  N     . VAL A 1  322  ? 83.590  46.221  -22.476 1.00 101.58 ? 322  VAL A N     1 
ATOM   2442  C  CA    . VAL A 1  322  ? 84.321  45.566  -23.601 1.00 98.17  ? 322  VAL A CA    1 
ATOM   2443  C  C     . VAL A 1  322  ? 85.748  46.073  -23.662 1.00 102.80 ? 322  VAL A C     1 
ATOM   2444  O  O     . VAL A 1  322  ? 85.976  47.264  -23.900 1.00 102.95 ? 322  VAL A O     1 
ATOM   2445  C  CB    . VAL A 1  322  ? 83.655  45.595  -25.010 1.00 99.30  ? 322  VAL A CB    1 
ATOM   2446  C  CG1   . VAL A 1  322  ? 84.662  45.317  -26.127 1.00 95.74  ? 322  VAL A CG1   1 
ATOM   2447  C  CG2   . VAL A 1  322  ? 82.492  44.623  -25.080 1.00 101.05 ? 322  VAL A CG2   1 
ATOM   2448  N  N     . LYS A 1  323  ? 86.713  45.163  -23.495 1.00 98.96  ? 323  LYS A N     1 
ATOM   2449  C  CA    . LYS A 1  323  ? 88.124  45.520  -23.476 1.00 97.29  ? 323  LYS A CA    1 
ATOM   2450  C  C     . LYS A 1  323  ? 88.628  45.816  -24.875 1.00 98.56  ? 323  LYS A C     1 
ATOM   2451  O  O     . LYS A 1  323  ? 88.670  44.922  -25.722 1.00 99.36  ? 323  LYS A O     1 
ATOM   2452  C  CB    . LYS A 1  323  ? 88.972  44.447  -22.754 1.00 101.00 ? 323  LYS A CB    1 
ATOM   2453  C  CG    . LYS A 1  323  ? 88.746  44.383  -21.227 1.00 127.04 ? 323  LYS A CG    1 
ATOM   2454  C  CD    . LYS A 1  323  ? 87.609  43.399  -20.734 1.00 139.30 ? 323  LYS A CD    1 
ATOM   2455  C  CE    . LYS A 1  323  ? 86.188  43.961  -20.637 1.00 142.05 ? 323  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A 1  323  ? 85.882  44.658  -19.358 1.00 146.63 ? 323  LYS A NZ    1 
ATOM   2457  N  N     . SER A 1  324  ? 88.961  47.092  -25.135 1.00 98.83  ? 324  SER A N     1 
ATOM   2458  C  CA    . SER A 1  324  ? 89.519  47.514  -26.419 1.00 96.98  ? 324  SER A CA    1 
ATOM   2459  C  C     . SER A 1  324  ? 90.964  47.001  -26.516 1.00 95.73  ? 324  SER A C     1 
ATOM   2460  O  O     . SER A 1  324  ? 91.484  46.452  -25.536 1.00 94.96  ? 324  SER A O     1 
ATOM   2461  C  CB    . SER A 1  324  ? 89.503  49.035  -26.518 1.00 100.76 ? 324  SER A CB    1 
ATOM   2462  O  OG    . SER A 1  324  ? 90.012  49.690  -25.365 1.00 106.56 ? 324  SER A OG    1 
ATOM   2463  N  N     . ILE A 1  325  ? 91.620  47.159  -27.673 1.00 88.36  ? 325  ILE A N     1 
ATOM   2464  C  CA    . ILE A 1  325  ? 93.018  46.733  -27.747 1.00 85.34  ? 325  ILE A CA    1 
ATOM   2465  C  C     . ILE A 1  325  ? 93.877  47.737  -26.939 1.00 90.26  ? 325  ILE A C     1 
ATOM   2466  O  O     . ILE A 1  325  ? 94.801  47.317  -26.240 1.00 89.48  ? 325  ILE A O     1 
ATOM   2467  C  CB    . ILE A 1  325  ? 93.537  46.444  -29.182 1.00 86.92  ? 325  ILE A CB    1 
ATOM   2468  C  CG1   . ILE A 1  325  ? 92.603  45.483  -29.921 1.00 86.65  ? 325  ILE A CG1   1 
ATOM   2469  C  CG2   . ILE A 1  325  ? 94.961  45.886  -29.150 1.00 85.98  ? 325  ILE A CG2   1 
ATOM   2470  C  CD1   . ILE A 1  325  ? 92.991  45.190  -31.329 1.00 89.53  ? 325  ILE A CD1   1 
ATOM   2471  N  N     . ARG A 1  326  ? 93.512  49.042  -26.968 1.00 88.30  ? 326  ARG A N     1 
ATOM   2472  C  CA    . ARG A 1  326  ? 94.201  50.099  -26.217 1.00 88.43  ? 326  ARG A CA    1 
ATOM   2473  C  C     . ARG A 1  326  ? 94.245  49.714  -24.743 1.00 91.77  ? 326  ARG A C     1 
ATOM   2474  O  O     . ARG A 1  326  ? 95.323  49.607  -24.162 1.00 90.14  ? 326  ARG A O     1 
ATOM   2475  C  CB    . ARG A 1  326  ? 93.514  51.477  -26.415 1.00 90.80  ? 326  ARG A CB    1 
ATOM   2476  C  CG    . ARG A 1  326  ? 94.132  52.611  -25.592 1.00 103.73 ? 326  ARG A CG    1 
ATOM   2477  C  CD    . ARG A 1  326  ? 93.676  53.984  -26.031 1.00 122.09 ? 326  ARG A CD    1 
ATOM   2478  N  NE    . ARG A 1  326  ? 94.158  55.039  -25.133 1.00 136.58 ? 326  ARG A NE    1 
ATOM   2479  C  CZ    . ARG A 1  326  ? 93.468  55.540  -24.109 1.00 150.89 ? 326  ARG A CZ    1 
ATOM   2480  N  NH1   . ARG A 1  326  ? 92.256  55.077  -23.824 1.00 134.01 ? 326  ARG A NH1   1 
ATOM   2481  N  NH2   . ARG A 1  326  ? 93.990  56.497  -23.355 1.00 139.09 ? 326  ARG A NH2   1 
ATOM   2482  N  N     . ALA A 1  327  ? 93.078  49.418  -24.180 1.00 89.82  ? 327  ALA A N     1 
ATOM   2483  C  CA    . ALA A 1  327  ? 92.910  49.044  -22.784 1.00 90.08  ? 327  ALA A CA    1 
ATOM   2484  C  C     . ALA A 1  327  ? 93.821  47.918  -22.303 1.00 92.57  ? 327  ALA A C     1 
ATOM   2485  O  O     . ALA A 1  327  ? 94.202  47.922  -21.125 1.00 92.17  ? 327  ALA A O     1 
ATOM   2486  C  CB    . ALA A 1  327  ? 91.459  48.696  -22.524 1.00 92.09  ? 327  ALA A CB    1 
ATOM   2487  N  N     . ARG A 1  328  ? 94.172  46.971  -23.215 1.00 88.06  ? 328  ARG A N     1 
ATOM   2488  C  CA    . ARG A 1  328  ? 95.034  45.809  -22.961 1.00 86.22  ? 328  ARG A CA    1 
ATOM   2489  C  C     . ARG A 1  328  ? 96.439  46.207  -22.589 1.00 89.28  ? 328  ARG A C     1 
ATOM   2490  O  O     . ARG A 1  328  ? 97.026  45.568  -21.719 1.00 88.34  ? 328  ARG A O     1 
ATOM   2491  C  CB    . ARG A 1  328  ? 95.131  44.913  -24.198 1.00 85.12  ? 328  ARG A CB    1 
ATOM   2492  C  CG    . ARG A 1  328  ? 93.927  44.052  -24.471 1.00 94.86  ? 328  ARG A CG    1 
ATOM   2493  C  CD    . ARG A 1  328  ? 94.394  42.802  -25.183 1.00 103.91 ? 328  ARG A CD    1 
ATOM   2494  N  NE    . ARG A 1  328  ? 93.291  41.921  -25.573 1.00 109.14 ? 328  ARG A NE    1 
ATOM   2495  C  CZ    . ARG A 1  328  ? 93.457  40.759  -26.196 1.00 105.18 ? 328  ARG A CZ    1 
ATOM   2496  N  NH1   . ARG A 1  328  ? 94.678  40.327  -26.493 1.00 66.30  ? 328  ARG A NH1   1 
ATOM   2497  N  NH2   . ARG A 1  328  ? 92.404  40.017  -26.522 1.00 94.06  ? 328  ARG A NH2   1 
ATOM   2498  N  N     . LEU A 1  329  ? 96.986  47.239  -23.259 1.00 86.25  ? 329  LEU A N     1 
ATOM   2499  C  CA    . LEU A 1  329  ? 98.365  47.707  -23.077 1.00 86.50  ? 329  LEU A CA    1 
ATOM   2500  C  C     . LEU A 1  329  ? 98.558  48.834  -22.024 1.00 95.97  ? 329  LEU A C     1 
ATOM   2501  O  O     . LEU A 1  329  ? 99.674  48.977  -21.482 1.00 96.66  ? 329  LEU A O     1 
ATOM   2502  C  CB    . LEU A 1  329  ? 98.977  48.134  -24.427 1.00 86.06  ? 329  LEU A CB    1 
ATOM   2503  C  CG    . LEU A 1  329  ? 98.409  47.501  -25.688 1.00 89.38  ? 329  LEU A CG    1 
ATOM   2504  C  CD1   . LEU A 1  329  ? 98.945  48.184  -26.890 1.00 90.06  ? 329  LEU A CD1   1 
ATOM   2505  C  CD2   . LEU A 1  329  ? 98.718  46.030  -25.764 1.00 89.41  ? 329  LEU A CD2   1 
ATOM   2506  N  N     . LYS A 1  330  ? 97.480  49.627  -21.754 1.00 94.30  ? 330  LYS A N     1 
ATOM   2507  C  CA    . LYS A 1  330  ? 97.443  50.751  -20.812 1.00 95.12  ? 330  LYS A CA    1 
ATOM   2508  C  C     . LYS A 1  330  ? 97.952  50.344  -19.417 1.00 101.66 ? 330  LYS A C     1 
ATOM   2509  O  O     . LYS A 1  330  ? 97.305  49.565  -18.718 1.00 101.85 ? 330  LYS A O     1 
ATOM   2510  C  CB    . LYS A 1  330  ? 96.027  51.337  -20.755 1.00 98.27  ? 330  LYS A CB    1 
ATOM   2511  C  CG    . LYS A 1  330  ? 95.904  52.734  -21.364 1.00 111.23 ? 330  LYS A CG    1 
ATOM   2512  C  CD    . LYS A 1  330  ? 94.461  53.079  -21.763 1.00 122.84 ? 330  LYS A CD    1 
ATOM   2513  C  CE    . LYS A 1  330  ? 93.501  53.272  -20.603 1.00 138.65 ? 330  LYS A CE    1 
ATOM   2514  N  NZ    . LYS A 1  330  ? 92.074  53.192  -21.031 1.00 149.17 ? 330  LYS A NZ    1 
ATOM   2515  N  N     . GLY A 1  331  ? 99.129  50.872  -19.075 1.00 99.61  ? 331  GLY A N     1 
ATOM   2516  C  CA    . GLY A 1  331  ? 99.950  50.653  -17.874 1.00 98.98  ? 331  GLY A CA    1 
ATOM   2517  C  C     . GLY A 1  331  ? 99.461  50.148  -16.518 1.00 100.38 ? 331  GLY A C     1 
ATOM   2518  O  O     . GLY A 1  331  ? 98.419  50.578  -15.998 1.00 98.92  ? 331  GLY A O     1 
ATOM   2519  N  N     . LYS A 1  332  ? 100.366 49.339  -15.877 1.00 95.88  ? 332  LYS A N     1 
ATOM   2520  C  CA    . LYS A 1  332  ? 100.296 48.639  -14.591 1.00 95.37  ? 332  LYS A CA    1 
ATOM   2521  C  C     . LYS A 1  332  ? 99.142  47.742  -14.763 1.00 101.90 ? 332  LYS A C     1 
ATOM   2522  O  O     . LYS A 1  332  ? 97.999  48.203  -14.715 1.00 104.20 ? 332  LYS A O     1 
ATOM   2523  C  CB    . LYS A 1  332  ? 100.114 49.593  -13.401 1.00 98.17  ? 332  LYS A CB    1 
ATOM   2524  C  CG    . LYS A 1  332  ? 100.429 48.947  -12.054 1.00 116.04 ? 332  LYS A CG    1 
ATOM   2525  C  CD    . LYS A 1  332  ? 100.188 49.937  -10.910 1.00 132.56 ? 332  LYS A CD    1 
ATOM   2526  C  CE    . LYS A 1  332  ? 99.441  49.366  -9.719  1.00 148.98 ? 332  LYS A CE    1 
ATOM   2527  N  NZ    . LYS A 1  332  ? 100.288 48.476  -8.874  1.00 159.81 ? 332  LYS A NZ    1 
ATOM   2528  N  N     . GLU A 1  333  ? 99.422  46.482  -15.087 1.00 97.82  ? 333  GLU A N     1 
ATOM   2529  C  CA    . GLU A 1  333  ? 98.430  45.458  -15.463 1.00 98.23  ? 333  GLU A CA    1 
ATOM   2530  C  C     . GLU A 1  333  ? 98.363  45.402  -17.019 1.00 101.53 ? 333  GLU A C     1 
ATOM   2531  O  O     . GLU A 1  333  ? 98.089  44.344  -17.604 1.00 101.30 ? 333  GLU A O     1 
ATOM   2532  C  CB    . GLU A 1  333  ? 97.027  45.661  -14.813 1.00 100.75 ? 333  GLU A CB    1 
ATOM   2533  C  CG    . GLU A 1  333  ? 96.996  45.495  -13.290 1.00 117.32 ? 333  GLU A CG    1 
ATOM   2534  C  CD    . GLU A 1  333  ? 96.115  44.412  -12.679 1.00 161.72 ? 333  GLU A CD    1 
ATOM   2535  O  OE1   . GLU A 1  333  ? 95.384  43.714  -13.423 1.00 170.61 ? 333  GLU A OE1   1 
ATOM   2536  O  OE2   . GLU A 1  333  ? 96.158  44.271  -11.433 1.00 162.32 ? 333  GLU A OE2   1 
ATOM   2537  N  N     . GLY A 1  334  ? 98.703  46.527  -17.661 1.00 96.76  ? 334  GLY A N     1 
ATOM   2538  C  CA    . GLY A 1  334  ? 98.792  46.644  -19.111 1.00 95.40  ? 334  GLY A CA    1 
ATOM   2539  C  C     . GLY A 1  334  ? 99.928  45.798  -19.629 1.00 95.16  ? 334  GLY A C     1 
ATOM   2540  O  O     . GLY A 1  334  ? 100.856 45.487  -18.883 1.00 94.52  ? 334  GLY A O     1 
ATOM   2541  N  N     . ARG A 1  335  ? 99.861  45.392  -20.888 1.00 89.54  ? 335  ARG A N     1 
ATOM   2542  C  CA    . ARG A 1  335  ? 100.902 44.547  -21.477 1.00 88.17  ? 335  ARG A CA    1 
ATOM   2543  C  C     . ARG A 1  335  ? 102.336 45.098  -21.257 1.00 91.56  ? 335  ARG A C     1 
ATOM   2544  O  O     . ARG A 1  335  ? 103.236 44.291  -21.002 1.00 92.57  ? 335  ARG A O     1 
ATOM   2545  C  CB    . ARG A 1  335  ? 100.628 44.257  -22.977 1.00 85.82  ? 335  ARG A CB    1 
ATOM   2546  C  CG    . ARG A 1  335  ? 101.061 42.861  -23.462 1.00 79.94  ? 335  ARG A CG    1 
ATOM   2547  C  CD    . ARG A 1  335  ? 99.887  41.938  -23.713 1.00 68.27  ? 335  ARG A CD    1 
ATOM   2548  N  NE    . ARG A 1  335  ? 99.195  41.641  -22.469 1.00 80.03  ? 335  ARG A NE    1 
ATOM   2549  C  CZ    . ARG A 1  335  ? 97.894  41.397  -22.364 1.00 109.82 ? 335  ARG A CZ    1 
ATOM   2550  N  NH1   . ARG A 1  335  ? 97.126  41.371  -23.446 1.00 96.45  ? 335  ARG A NH1   1 
ATOM   2551  N  NH2   . ARG A 1  335  ? 97.351  41.164  -21.174 1.00 109.04 ? 335  ARG A NH2   1 
ATOM   2552  N  N     . ILE A 1  336  ? 102.552 46.446  -21.306 1.00 84.55  ? 336  ILE A N     1 
ATOM   2553  C  CA    . ILE A 1  336  ? 103.911 46.983  -21.145 1.00 82.09  ? 336  ILE A CA    1 
ATOM   2554  C  C     . ILE A 1  336  ? 104.381 46.883  -19.699 1.00 82.78  ? 336  ILE A C     1 
ATOM   2555  O  O     . ILE A 1  336  ? 105.300 46.116  -19.398 1.00 80.50  ? 336  ILE A O     1 
ATOM   2556  C  CB    . ILE A 1  336  ? 104.076 48.412  -21.736 1.00 85.25  ? 336  ILE A CB    1 
ATOM   2557  C  CG1   . ILE A 1  336  ? 103.551 48.477  -23.195 1.00 86.15  ? 336  ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A 1  336  ? 105.526 48.965  -21.584 1.00 83.94  ? 336  ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A 1  336  ? 104.559 48.544  -24.299 1.00 90.96  ? 336  ILE A CD1   1 
ATOM   2560  N  N     . ARG A 1  337  ? 103.731 47.641  -18.816 1.00 79.15  ? 337  ARG A N     1 
ATOM   2561  C  CA    . ARG A 1  337  ? 104.095 47.724  -17.408 1.00 78.29  ? 337  ARG A CA    1 
ATOM   2562  C  C     . ARG A 1  337  ? 103.873 46.439  -16.600 1.00 81.23  ? 337  ARG A C     1 
ATOM   2563  O  O     . ARG A 1  337  ? 104.711 46.098  -15.767 1.00 80.69  ? 337  ARG A O     1 
ATOM   2564  C  CB    . ARG A 1  337  ? 103.360 48.894  -16.768 1.00 77.67  ? 337  ARG A CB    1 
ATOM   2565  C  CG    . ARG A 1  337  ? 104.253 50.019  -16.292 1.00 79.95  ? 337  ARG A CG    1 
ATOM   2566  C  CD    . ARG A 1  337  ? 103.738 50.522  -14.965 1.00 79.54  ? 337  ARG A CD    1 
ATOM   2567  N  NE    . ARG A 1  337  ? 103.014 51.790  -15.027 1.00 82.08  ? 337  ARG A NE    1 
ATOM   2568  C  CZ    . ARG A 1  337  ? 102.654 52.483  -13.951 1.00 101.94 ? 337  ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A 1  337  ? 102.963 52.044  -12.733 1.00 91.83  ? 337  ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A 1  337  ? 101.997 53.629  -14.083 1.00 93.31  ? 337  ARG A NH2   1 
ATOM   2571  N  N     . GLY A 1  338  ? 102.759 45.754  -16.844 1.00 76.77  ? 338  GLY A N     1 
ATOM   2572  C  CA    . GLY A 1  338  ? 102.388 44.543  -16.126 1.00 75.47  ? 338  GLY A CA    1 
ATOM   2573  C  C     . GLY A 1  338  ? 102.893 43.229  -16.688 1.00 78.05  ? 338  GLY A C     1 
ATOM   2574  O  O     . GLY A 1  338  ? 102.953 42.229  -15.956 1.00 78.89  ? 338  GLY A O     1 
ATOM   2575  N  N     . ASN A 1  339  ? 103.247 43.190  -17.977 1.00 72.08  ? 339  ASN A N     1 
ATOM   2576  C  CA    . ASN A 1  339  ? 103.721 41.930  -18.550 1.00 70.44  ? 339  ASN A CA    1 
ATOM   2577  C  C     . ASN A 1  339  ? 105.179 41.925  -19.013 1.00 73.76  ? 339  ASN A C     1 
ATOM   2578  O  O     . ASN A 1  339  ? 105.782 40.852  -19.071 1.00 72.22  ? 339  ASN A O     1 
ATOM   2579  C  CB    . ASN A 1  339  ? 102.808 41.497  -19.673 1.00 66.53  ? 339  ASN A CB    1 
ATOM   2580  C  CG    . ASN A 1  339  ? 101.527 40.991  -19.135 1.00 78.61  ? 339  ASN A CG    1 
ATOM   2581  O  OD1   . ASN A 1  339  ? 101.526 40.101  -18.294 1.00 64.24  ? 339  ASN A OD1   1 
ATOM   2582  N  ND2   . ASN A 1  339  ? 100.419 41.601  -19.536 1.00 76.69  ? 339  ASN A ND2   1 
ATOM   2583  N  N     . LEU A 1  340  ? 105.744 43.103  -19.332 1.00 70.59  ? 340  LEU A N     1 
ATOM   2584  C  CA    . LEU A 1  340  ? 107.097 43.195  -19.857 1.00 70.23  ? 340  LEU A CA    1 
ATOM   2585  C  C     . LEU A 1  340  ? 108.109 43.905  -18.952 1.00 77.52  ? 340  LEU A C     1 
ATOM   2586  O  O     . LEU A 1  340  ? 109.276 43.491  -18.924 1.00 77.86  ? 340  LEU A O     1 
ATOM   2587  C  CB    . LEU A 1  340  ? 107.062 43.841  -21.241 1.00 69.97  ? 340  LEU A CB    1 
ATOM   2588  C  CG    . LEU A 1  340  ? 106.383 43.027  -22.326 1.00 73.21  ? 340  LEU A CG    1 
ATOM   2589  C  CD1   . LEU A 1  340  ? 106.140 43.874  -23.536 1.00 74.20  ? 340  LEU A CD1   1 
ATOM   2590  C  CD2   . LEU A 1  340  ? 107.205 41.806  -22.698 1.00 73.07  ? 340  LEU A CD2   1 
ATOM   2591  N  N     . MET A 1  341  ? 107.686 44.967  -18.234 1.00 75.46  ? 341  MET A N     1 
ATOM   2592  C  CA    . MET A 1  341  ? 108.568 45.722  -17.325 1.00 76.07  ? 341  MET A CA    1 
ATOM   2593  C  C     . MET A 1  341  ? 108.709 45.020  -15.969 1.00 78.09  ? 341  MET A C     1 
ATOM   2594  O  O     . MET A 1  341  ? 109.591 45.359  -15.168 1.00 77.70  ? 341  MET A O     1 
ATOM   2595  C  CB    . MET A 1  341  ? 108.062 47.170  -17.127 1.00 79.56  ? 341  MET A CB    1 
ATOM   2596  C  CG    . MET A 1  341  ? 108.091 47.999  -18.379 1.00 84.18  ? 341  MET A CG    1 
ATOM   2597  S  SD    . MET A 1  341  ? 109.722 47.988  -19.141 1.00 88.84  ? 341  MET A SD    1 
ATOM   2598  C  CE    . MET A 1  341  ? 110.352 49.498  -18.480 1.00 86.38  ? 341  MET A CE    1 
ATOM   2599  N  N     . GLY A 1  342  ? 107.804 44.073  -15.740 1.00 72.66  ? 342  GLY A N     1 
ATOM   2600  C  CA    . GLY A 1  342  ? 107.693 43.255  -14.545 1.00 71.46  ? 342  GLY A CA    1 
ATOM   2601  C  C     . GLY A 1  342  ? 106.853 42.049  -14.885 1.00 74.21  ? 342  GLY A C     1 
ATOM   2602  O  O     . GLY A 1  342  ? 105.860 42.174  -15.603 1.00 74.01  ? 342  GLY A O     1 
ATOM   2603  N  N     . LYS A 1  343  ? 107.266 40.873  -14.407 1.00 69.84  ? 343  LYS A N     1 
ATOM   2604  C  CA    . LYS A 1  343  ? 106.627 39.585  -14.701 1.00 68.78  ? 343  LYS A CA    1 
ATOM   2605  C  C     . LYS A 1  343  ? 106.470 38.774  -13.444 1.00 72.63  ? 343  LYS A C     1 
ATOM   2606  O  O     . LYS A 1  343  ? 107.251 38.944  -12.506 1.00 72.43  ? 343  LYS A O     1 
ATOM   2607  C  CB    . LYS A 1  343  ? 107.565 38.744  -15.634 1.00 69.28  ? 343  LYS A CB    1 
ATOM   2608  C  CG    . LYS A 1  343  ? 107.653 39.192  -17.087 1.00 61.36  ? 343  LYS A CG    1 
ATOM   2609  C  CD    . LYS A 1  343  ? 108.778 38.528  -17.861 1.00 60.50  ? 343  LYS A CD    1 
ATOM   2610  C  CE    . LYS A 1  343  ? 108.911 39.093  -19.278 1.00 68.51  ? 343  LYS A CE    1 
ATOM   2611  N  NZ    . LYS A 1  343  ? 109.829 40.280  -19.444 1.00 68.43  ? 343  LYS A NZ    1 
ATOM   2612  N  N     . ARG A 1  344  ? 105.567 37.784  -13.479 1.00 68.77  ? 344  ARG A N     1 
ATOM   2613  C  CA    . ARG A 1  344  ? 105.507 36.754  -12.443 1.00 68.26  ? 344  ARG A CA    1 
ATOM   2614  C  C     . ARG A 1  344  ? 106.690 35.788  -12.812 1.00 69.84  ? 344  ARG A C     1 
ATOM   2615  O  O     . ARG A 1  344  ? 107.003 35.653  -13.998 1.00 70.01  ? 344  ARG A O     1 
ATOM   2616  C  CB    . ARG A 1  344  ? 104.162 36.038  -12.494 1.00 69.61  ? 344  ARG A CB    1 
ATOM   2617  C  CG    . ARG A 1  344  ? 103.505 35.913  -11.148 1.00 76.86  ? 344  ARG A CG    1 
ATOM   2618  C  CD    . ARG A 1  344  ? 102.006 36.156  -11.243 1.00 85.38  ? 344  ARG A CD    1 
ATOM   2619  N  NE    . ARG A 1  344  ? 101.613 37.370  -10.528 1.00 96.27  ? 344  ARG A NE    1 
ATOM   2620  C  CZ    . ARG A 1  344  ? 101.563 37.497  -9.201  1.00 117.52 ? 344  ARG A CZ    1 
ATOM   2621  N  NH1   . ARG A 1  344  ? 101.849 36.464  -8.413  1.00 110.18 ? 344  ARG A NH1   1 
ATOM   2622  N  NH2   . ARG A 1  344  ? 101.199 38.647  -8.653  1.00 106.99 ? 344  ARG A NH2   1 
ATOM   2623  N  N     . VAL A 1  345  ? 107.414 35.216  -11.841 1.00 64.12  ? 345  VAL A N     1 
ATOM   2624  C  CA    . VAL A 1  345  ? 108.594 34.411  -12.198 1.00 63.16  ? 345  VAL A CA    1 
ATOM   2625  C  C     . VAL A 1  345  ? 108.626 33.022  -11.533 1.00 69.72  ? 345  VAL A C     1 
ATOM   2626  O  O     . VAL A 1  345  ? 108.067 32.848  -10.452 1.00 70.48  ? 345  VAL A O     1 
ATOM   2627  C  CB    . VAL A 1  345  ? 109.947 35.169  -11.971 1.00 65.23  ? 345  VAL A CB    1 
ATOM   2628  C  CG1   . VAL A 1  345  ? 110.005 36.471  -12.752 1.00 64.50  ? 345  VAL A CG1   1 
ATOM   2629  C  CG2   . VAL A 1  345  ? 110.248 35.406  -10.491 1.00 64.66  ? 345  VAL A CG2   1 
ATOM   2630  N  N     . ASP A 1  346  ? 109.311 32.042  -12.183 1.00 66.92  ? 346  ASP A N     1 
ATOM   2631  C  CA    . ASP A 1  346  ? 109.548 30.679  -11.675 1.00 67.09  ? 346  ASP A CA    1 
ATOM   2632  C  C     . ASP A 1  346  ? 110.801 30.776  -10.804 1.00 70.15  ? 346  ASP A C     1 
ATOM   2633  O  O     . ASP A 1  346  ? 111.443 31.827  -10.781 1.00 69.01  ? 346  ASP A O     1 
ATOM   2634  C  CB    . ASP A 1  346  ? 109.824 29.693  -12.833 1.00 69.87  ? 346  ASP A CB    1 
ATOM   2635  C  CG    . ASP A 1  346  ? 108.691 29.436  -13.822 1.00 86.63  ? 346  ASP A CG    1 
ATOM   2636  O  OD1   . ASP A 1  346  ? 107.516 29.449  -13.396 1.00 87.85  ? 346  ASP A OD1   1 
ATOM   2637  O  OD2   . ASP A 1  346  ? 108.991 29.088  -15.002 1.00 94.42  ? 346  ASP A OD2   1 
ATOM   2638  N  N     . PHE A 1  347  ? 111.172 29.693  -10.107 1.00 67.45  ? 347  PHE A N     1 
ATOM   2639  C  CA    . PHE A 1  347  ? 112.368 29.646  -9.236  1.00 67.53  ? 347  PHE A CA    1 
ATOM   2640  C  C     . PHE A 1  347  ? 112.329 30.744  -8.170  1.00 70.81  ? 347  PHE A C     1 
ATOM   2641  O  O     . PHE A 1  347  ? 113.343 31.363  -7.831  1.00 70.87  ? 347  PHE A O     1 
ATOM   2642  C  CB    . PHE A 1  347  ? 113.676 29.626  -10.056 1.00 69.43  ? 347  PHE A CB    1 
ATOM   2643  C  CG    . PHE A 1  347  ? 113.694 28.411  -10.940 1.00 71.62  ? 347  PHE A CG    1 
ATOM   2644  C  CD1   . PHE A 1  347  ? 114.045 27.169  -10.430 1.00 74.74  ? 347  PHE A CD1   1 
ATOM   2645  C  CD2   . PHE A 1  347  ? 113.247 28.482  -12.252 1.00 75.75  ? 347  PHE A CD2   1 
ATOM   2646  C  CE1   . PHE A 1  347  ? 113.987 26.021  -11.229 1.00 78.78  ? 347  PHE A CE1   1 
ATOM   2647  C  CE2   . PHE A 1  347  ? 113.193 27.341  -13.053 1.00 77.84  ? 347  PHE A CE2   1 
ATOM   2648  C  CZ    . PHE A 1  347  ? 113.569 26.115  -12.536 1.00 77.62  ? 347  PHE A CZ    1 
ATOM   2649  N  N     . SER A 1  348  ? 111.127 30.940  -7.628  1.00 66.34  ? 348  SER A N     1 
ATOM   2650  C  CA    . SER A 1  348  ? 110.820 31.940  -6.629  1.00 66.42  ? 348  SER A CA    1 
ATOM   2651  C  C     . SER A 1  348  ? 110.209 31.278  -5.407  1.00 68.78  ? 348  SER A C     1 
ATOM   2652  O  O     . SER A 1  348  ? 109.541 30.259  -5.530  1.00 68.71  ? 348  SER A O     1 
ATOM   2653  C  CB    . SER A 1  348  ? 109.842 32.961  -7.207  1.00 72.50  ? 348  SER A CB    1 
ATOM   2654  O  OG    . SER A 1  348  ? 108.585 32.356  -7.489  1.00 87.56  ? 348  SER A OG    1 
ATOM   2655  N  N     . ALA A 1  349  ? 110.411 31.878  -4.234  1.00 63.82  ? 349  ALA A N     1 
ATOM   2656  C  CA    . ALA A 1  349  ? 109.862 31.412  -2.969  1.00 62.59  ? 349  ALA A CA    1 
ATOM   2657  C  C     . ALA A 1  349  ? 109.603 32.589  -2.034  1.00 64.91  ? 349  ALA A C     1 
ATOM   2658  O  O     . ALA A 1  349  ? 110.269 33.625  -2.123  1.00 64.85  ? 349  ALA A O     1 
ATOM   2659  C  CB    . ALA A 1  349  ? 110.819 30.438  -2.317  1.00 63.32  ? 349  ALA A CB    1 
ATOM   2660  N  N     . ARG A 1  350  ? 108.642 32.434  -1.134  1.00 59.98  ? 350  ARG A N     1 
ATOM   2661  C  CA    . ARG A 1  350  ? 108.319 33.462  -0.156  1.00 59.73  ? 350  ARG A CA    1 
ATOM   2662  C  C     . ARG A 1  350  ? 107.654 32.843  1.052   1.00 62.45  ? 350  ARG A C     1 
ATOM   2663  O  O     . ARG A 1  350  ? 106.781 31.995  0.913   1.00 60.69  ? 350  ARG A O     1 
ATOM   2664  C  CB    . ARG A 1  350  ? 107.498 34.616  -0.794  1.00 60.68  ? 350  ARG A CB    1 
ATOM   2665  C  CG    . ARG A 1  350  ? 106.781 35.603  0.144   1.00 65.44  ? 350  ARG A CG    1 
ATOM   2666  C  CD    . ARG A 1  350  ? 105.784 36.412  -0.658  1.00 58.74  ? 350  ARG A CD    1 
ATOM   2667  N  NE    . ARG A 1  350  ? 105.068 37.399  0.140   1.00 64.12  ? 350  ARG A NE    1 
ATOM   2668  C  CZ    . ARG A 1  350  ? 105.229 38.714  0.029   1.00 87.05  ? 350  ARG A CZ    1 
ATOM   2669  N  NH1   . ARG A 1  350  ? 106.104 39.214  -0.835  1.00 73.00  ? 350  ARG A NH1   1 
ATOM   2670  N  NH2   . ARG A 1  350  ? 104.511 39.543  0.781   1.00 83.14  ? 350  ARG A NH2   1 
ATOM   2671  N  N     . THR A 1  351  ? 108.134 33.231  2.233   1.00 60.41  ? 351  THR A N     1 
ATOM   2672  C  CA    . THR A 1  351  ? 107.618 32.822  3.527   1.00 61.57  ? 351  THR A CA    1 
ATOM   2673  C  C     . THR A 1  351  ? 107.926 33.886  4.547   1.00 69.04  ? 351  THR A C     1 
ATOM   2674  O  O     . THR A 1  351  ? 108.682 34.827  4.246   1.00 68.45  ? 351  THR A O     1 
ATOM   2675  C  CB    . THR A 1  351  ? 108.151 31.455  3.971   1.00 69.51  ? 351  THR A CB    1 
ATOM   2676  O  OG1   . THR A 1  351  ? 107.376 31.070  5.106   1.00 75.90  ? 351  THR A OG1   1 
ATOM   2677  C  CG2   . THR A 1  351  ? 109.633 31.461  4.350   1.00 62.97  ? 351  THR A CG2   1 
ATOM   2678  N  N     . VAL A 1  352  ? 107.361 33.708  5.775   1.00 67.79  ? 352  VAL A N     1 
ATOM   2679  C  CA    . VAL A 1  352  ? 107.580 34.558  6.948   1.00 68.34  ? 352  VAL A CA    1 
ATOM   2680  C  C     . VAL A 1  352  ? 109.086 34.548  7.308   1.00 75.08  ? 352  VAL A C     1 
ATOM   2681  O  O     . VAL A 1  352  ? 109.748 33.512  7.186   1.00 75.33  ? 352  VAL A O     1 
ATOM   2682  C  CB    . VAL A 1  352  ? 106.713 34.114  8.144   1.00 71.36  ? 352  VAL A CB    1 
ATOM   2683  C  CG1   . VAL A 1  352  ? 106.836 35.106  9.299   1.00 71.77  ? 352  VAL A CG1   1 
ATOM   2684  C  CG2   . VAL A 1  352  ? 105.264 33.955  7.727   1.00 70.90  ? 352  VAL A CG2   1 
ATOM   2685  N  N     . ILE A 1  353  ? 109.620 35.709  7.701   1.00 72.25  ? 353  ILE A N     1 
ATOM   2686  C  CA    . ILE A 1  353  ? 111.020 35.843  8.082   1.00 72.28  ? 353  ILE A CA    1 
ATOM   2687  C  C     . ILE A 1  353  ? 111.168 35.896  9.575   1.00 80.13  ? 353  ILE A C     1 
ATOM   2688  O  O     . ILE A 1  353  ? 110.263 36.398  10.266  1.00 82.10  ? 353  ILE A O     1 
ATOM   2689  C  CB    . ILE A 1  353  ? 111.725 37.015  7.380   1.00 74.58  ? 353  ILE A CB    1 
ATOM   2690  C  CG1   . ILE A 1  353  ? 110.955 38.345  7.529   1.00 74.36  ? 353  ILE A CG1   1 
ATOM   2691  C  CG2   . ILE A 1  353  ? 111.919 36.656  5.937   1.00 75.30  ? 353  ILE A CG2   1 
ATOM   2692  C  CD1   . ILE A 1  353  ? 111.667 39.383  8.078   1.00 72.70  ? 353  ILE A CD1   1 
ATOM   2693  N  N     . SER A 1  354  ? 112.298 35.352  10.072  1.00 76.46  ? 354  SER A N     1 
ATOM   2694  C  CA    . SER A 1  354  ? 112.658 35.329  11.489  1.00 76.98  ? 354  SER A CA    1 
ATOM   2695  C  C     . SER A 1  354  ? 114.150 35.685  11.649  1.00 80.35  ? 354  SER A C     1 
ATOM   2696  O  O     . SER A 1  354  ? 114.945 35.444  10.736  1.00 79.03  ? 354  SER A O     1 
ATOM   2697  C  CB    . SER A 1  354  ? 112.302 33.987  12.126  1.00 80.96  ? 354  SER A CB    1 
ATOM   2698  O  OG    . SER A 1  354  ? 110.913 33.860  12.403  1.00 88.54  ? 354  SER A OG    1 
ATOM   2699  N  N     . GLY A 1  355  ? 114.489 36.336  12.760  1.00 77.00  ? 355  GLY A N     1 
ATOM   2700  C  CA    . GLY A 1  355  ? 115.853 36.766  13.035  1.00 76.39  ? 355  GLY A CA    1 
ATOM   2701  C  C     . GLY A 1  355  ? 116.634 35.700  13.743  1.00 79.33  ? 355  GLY A C     1 
ATOM   2702  O  O     . GLY A 1  355  ? 116.099 35.081  14.667  1.00 79.80  ? 355  GLY A O     1 
ATOM   2703  N  N     . ASP A 1  356  ? 117.888 35.462  13.276  1.00 74.66  ? 356  ASP A N     1 
ATOM   2704  C  CA    . ASP A 1  356  ? 118.834 34.467  13.802  1.00 74.41  ? 356  ASP A CA    1 
ATOM   2705  C  C     . ASP A 1  356  ? 120.189 35.082  14.124  1.00 78.08  ? 356  ASP A C     1 
ATOM   2706  O  O     . ASP A 1  356  ? 120.856 35.575  13.223  1.00 76.44  ? 356  ASP A O     1 
ATOM   2707  C  CB    . ASP A 1  356  ? 119.027 33.299  12.818  1.00 75.54  ? 356  ASP A CB    1 
ATOM   2708  C  CG    . ASP A 1  356  ? 119.466 31.970  13.433  1.00 83.64  ? 356  ASP A CG    1 
ATOM   2709  O  OD1   . ASP A 1  356  ? 120.333 31.983  14.339  1.00 84.56  ? 356  ASP A OD1   1 
ATOM   2710  O  OD2   . ASP A 1  356  ? 119.004 30.914  12.948  1.00 85.53  ? 356  ASP A OD2   1 
ATOM   2711  N  N     . PRO A 1  357  ? 120.637 35.027  15.394  1.00 77.25  ? 357  PRO A N     1 
ATOM   2712  C  CA    . PRO A 1  357  ? 121.958 35.591  15.728  1.00 79.05  ? 357  PRO A CA    1 
ATOM   2713  C  C     . PRO A 1  357  ? 123.121 34.620  15.425  1.00 84.76  ? 357  PRO A C     1 
ATOM   2714  O  O     . PRO A 1  357  ? 124.313 35.007  15.440  1.00 85.28  ? 357  PRO A O     1 
ATOM   2715  C  CB    . PRO A 1  357  ? 121.837 35.859  17.229  1.00 81.77  ? 357  PRO A CB    1 
ATOM   2716  C  CG    . PRO A 1  357  ? 120.886 34.790  17.729  1.00 84.92  ? 357  PRO A CG    1 
ATOM   2717  C  CD    . PRO A 1  357  ? 119.957 34.484  16.593  1.00 79.13  ? 357  PRO A CD    1 
ATOM   2718  N  N     . ASN A 1  358  ? 122.761 33.338  15.171  1.00 80.26  ? 358  ASN A N     1 
ATOM   2719  C  CA    . ASN A 1  358  ? 123.707 32.271  14.893  1.00 79.45  ? 358  ASN A CA    1 
ATOM   2720  C  C     . ASN A 1  358  ? 123.855 32.041  13.409  1.00 83.79  ? 358  ASN A C     1 
ATOM   2721  O  O     . ASN A 1  358  ? 124.398 31.019  12.989  1.00 84.71  ? 358  ASN A O     1 
ATOM   2722  C  CB    . ASN A 1  358  ? 123.370 31.014  15.677  1.00 74.41  ? 358  ASN A CB    1 
ATOM   2723  C  CG    . ASN A 1  358  ? 123.517 31.228  17.157  1.00 85.77  ? 358  ASN A CG    1 
ATOM   2724  O  OD1   . ASN A 1  358  ? 124.484 31.828  17.628  1.00 76.66  ? 358  ASN A OD1   1 
ATOM   2725  N  ND2   . ASN A 1  358  ? 122.514 30.836  17.922  1.00 80.31  ? 358  ASN A ND2   1 
ATOM   2726  N  N     . LEU A 1  359  ? 123.432 33.037  12.609  1.00 79.24  ? 359  LEU A N     1 
ATOM   2727  C  CA    . LEU A 1  359  ? 123.631 33.045  11.163  1.00 77.78  ? 359  LEU A CA    1 
ATOM   2728  C  C     . LEU A 1  359  ? 124.708 34.067  10.803  1.00 82.71  ? 359  LEU A C     1 
ATOM   2729  O  O     . LEU A 1  359  ? 124.948 35.025  11.561  1.00 82.10  ? 359  LEU A O     1 
ATOM   2730  C  CB    . LEU A 1  359  ? 122.338 33.316  10.375  1.00 76.18  ? 359  LEU A CB    1 
ATOM   2731  C  CG    . LEU A 1  359  ? 121.474 32.109  10.022  1.00 79.43  ? 359  LEU A CG    1 
ATOM   2732  C  CD1   . LEU A 1  359  ? 120.485 32.464  8.951   1.00 78.31  ? 359  LEU A CD1   1 
ATOM   2733  C  CD2   . LEU A 1  359  ? 122.306 30.920  9.570   1.00 81.04  ? 359  LEU A CD2   1 
ATOM   2734  N  N     . GLU A 1  360  ? 125.387 33.834  9.666   1.00 80.18  ? 360  GLU A N     1 
ATOM   2735  C  CA    . GLU A 1  360  ? 126.412 34.746  9.173   1.00 80.94  ? 360  GLU A CA    1 
ATOM   2736  C  C     . GLU A 1  360  ? 125.753 35.953  8.545   1.00 82.41  ? 360  GLU A C     1 
ATOM   2737  O  O     . GLU A 1  360  ? 124.584 35.853  8.177   1.00 82.94  ? 360  GLU A O     1 
ATOM   2738  C  CB    . GLU A 1  360  ? 127.373 34.041  8.212   1.00 82.98  ? 360  GLU A CB    1 
ATOM   2739  C  CG    . GLU A 1  360  ? 128.582 33.461  8.930   1.00 102.16 ? 360  GLU A CG    1 
ATOM   2740  C  CD    . GLU A 1  360  ? 129.258 34.385  9.935   1.00 143.04 ? 360  GLU A CD    1 
ATOM   2741  O  OE1   . GLU A 1  360  ? 129.592 35.543  9.573   1.00 145.70 ? 360  GLU A OE1   1 
ATOM   2742  O  OE2   . GLU A 1  360  ? 129.419 33.953  11.101  1.00 140.90 ? 360  GLU A OE2   1 
ATOM   2743  N  N     . LEU A 1  361  ? 126.436 37.107  8.461   1.00 76.18  ? 361  LEU A N     1 
ATOM   2744  C  CA    . LEU A 1  361  ? 125.755 38.278  7.897   1.00 74.42  ? 361  LEU A CA    1 
ATOM   2745  C  C     . LEU A 1  361  ? 125.121 37.942  6.531   1.00 77.34  ? 361  LEU A C     1 
ATOM   2746  O  O     . LEU A 1  361  ? 123.900 38.133  6.333   1.00 75.43  ? 361  LEU A O     1 
ATOM   2747  C  CB    . LEU A 1  361  ? 126.700 39.504  7.842   1.00 74.45  ? 361  LEU A CB    1 
ATOM   2748  C  CG    . LEU A 1  361  ? 126.230 40.769  7.112   1.00 77.02  ? 361  LEU A CG    1 
ATOM   2749  C  CD1   . LEU A 1  361  ? 125.153 41.467  7.858   1.00 76.92  ? 361  LEU A CD1   1 
ATOM   2750  C  CD2   . LEU A 1  361  ? 127.355 41.724  6.959   1.00 78.87  ? 361  LEU A CD2   1 
ATOM   2751  N  N     . ASP A 1  362  ? 125.947 37.282  5.674   1.00 74.26  ? 362  ASP A N     1 
ATOM   2752  C  CA    . ASP A 1  362  ? 125.648 36.909  4.293   1.00 73.45  ? 362  ASP A CA    1 
ATOM   2753  C  C     . ASP A 1  362  ? 124.923 35.569  4.128   1.00 73.35  ? 362  ASP A C     1 
ATOM   2754  O  O     . ASP A 1  362  ? 124.779 35.110  2.997   1.00 74.14  ? 362  ASP A O     1 
ATOM   2755  C  CB    . ASP A 1  362  ? 126.909 36.973  3.386   1.00 76.74  ? 362  ASP A CB    1 
ATOM   2756  C  CG    . ASP A 1  362  ? 128.115 36.088  3.722   1.00 91.69  ? 362  ASP A CG    1 
ATOM   2757  O  OD1   . ASP A 1  362  ? 128.489 36.001  4.932   1.00 99.20  ? 362  ASP A OD1   1 
ATOM   2758  O  OD2   . ASP A 1  362  ? 128.766 35.596  2.769   1.00 91.83  ? 362  ASP A OD2   1 
ATOM   2759  N  N     . GLN A 1  363  ? 124.410 34.974  5.201   1.00 64.86  ? 363  GLN A N     1 
ATOM   2760  C  CA    . GLN A 1  363  ? 123.618 33.764  5.030   1.00 61.64  ? 363  GLN A CA    1 
ATOM   2761  C  C     . GLN A 1  363  ? 122.134 34.099  5.101   1.00 61.93  ? 363  GLN A C     1 
ATOM   2762  O  O     . GLN A 1  363  ? 121.716 35.220  5.510   1.00 59.82  ? 363  GLN A O     1 
ATOM   2763  C  CB    . GLN A 1  363  ? 123.954 32.695  6.071   1.00 63.13  ? 363  GLN A CB    1 
ATOM   2764  C  CG    . GLN A 1  363  ? 125.282 32.025  5.854   1.00 80.04  ? 363  GLN A CG    1 
ATOM   2765  C  CD    . GLN A 1  363  ? 125.509 30.884  6.810   1.00 93.90  ? 363  GLN A CD    1 
ATOM   2766  O  OE1   . GLN A 1  363  ? 125.614 31.063  8.044   1.00 82.33  ? 363  GLN A OE1   1 
ATOM   2767  N  NE2   . GLN A 1  363  ? 125.638 29.686  6.237   1.00 87.61  ? 363  GLN A NE2   1 
ATOM   2768  N  N     . VAL A 1  364  ? 121.351 33.089  4.671   1.00 56.97  ? 364  VAL A N     1 
ATOM   2769  C  CA    . VAL A 1  364  ? 119.896 33.021  4.683   1.00 55.57  ? 364  VAL A CA    1 
ATOM   2770  C  C     . VAL A 1  364  ? 119.479 31.598  4.988   1.00 61.27  ? 364  VAL A C     1 
ATOM   2771  O  O     . VAL A 1  364  ? 119.974 30.634  4.392   1.00 60.80  ? 364  VAL A O     1 
ATOM   2772  C  CB    . VAL A 1  364  ? 119.160 33.633  3.460   1.00 57.08  ? 364  VAL A CB    1 
ATOM   2773  C  CG1   . VAL A 1  364  ? 119.566 32.959  2.154   1.00 56.35  ? 364  VAL A CG1   1 
ATOM   2774  C  CG2   . VAL A 1  364  ? 117.642 33.595  3.653   1.00 55.97  ? 364  VAL A CG2   1 
ATOM   2775  N  N     . GLY A 1  365  ? 118.597 31.503  5.959   1.00 59.60  ? 365  GLY A N     1 
ATOM   2776  C  CA    . GLY A 1  365  ? 118.024 30.260  6.432   1.00 60.34  ? 365  GLY A CA    1 
ATOM   2777  C  C     . GLY A 1  365  ? 116.926 29.809  5.504   1.00 64.24  ? 365  GLY A C     1 
ATOM   2778  O  O     . GLY A 1  365  ? 115.890 30.477  5.372   1.00 63.07  ? 365  GLY A O     1 
ATOM   2779  N  N     . VAL A 1  366  ? 117.167 28.687  4.834   1.00 60.77  ? 366  VAL A N     1 
ATOM   2780  C  CA    . VAL A 1  366  ? 116.184 28.182  3.904   1.00 60.01  ? 366  VAL A CA    1 
ATOM   2781  C  C     . VAL A 1  366  ? 115.493 26.942  4.475   1.00 63.13  ? 366  VAL A C     1 
ATOM   2782  O  O     . VAL A 1  366  ? 116.149 25.923  4.772   1.00 62.03  ? 366  VAL A O     1 
ATOM   2783  C  CB    . VAL A 1  366  ? 116.718 27.986  2.465   1.00 63.56  ? 366  VAL A CB    1 
ATOM   2784  C  CG1   . VAL A 1  366  ? 115.572 27.669  1.497   1.00 62.60  ? 366  VAL A CG1   1 
ATOM   2785  C  CG2   . VAL A 1  366  ? 117.511 29.217  1.995   1.00 63.16  ? 366  VAL A CG2   1 
ATOM   2786  N  N     . PRO A 1  367  ? 114.147 27.067  4.653   1.00 58.64  ? 367  PRO A N     1 
ATOM   2787  C  CA    . PRO A 1  367  ? 113.345 25.932  5.152   1.00 58.32  ? 367  PRO A CA    1 
ATOM   2788  C  C     . PRO A 1  367  ? 113.460 24.748  4.195   1.00 61.78  ? 367  PRO A C     1 
ATOM   2789  O  O     . PRO A 1  367  ? 113.348 24.965  2.985   1.00 61.13  ? 367  PRO A O     1 
ATOM   2790  C  CB    . PRO A 1  367  ? 111.926 26.498  5.164   1.00 59.44  ? 367  PRO A CB    1 
ATOM   2791  C  CG    . PRO A 1  367  ? 112.088 27.958  5.163   1.00 63.32  ? 367  PRO A CG    1 
ATOM   2792  C  CD    . PRO A 1  367  ? 113.292 28.231  4.358   1.00 58.80  ? 367  PRO A CD    1 
ATOM   2793  N  N     . LYS A 1  368  ? 113.767 23.530  4.716   1.00 58.56  ? 368  LYS A N     1 
ATOM   2794  C  CA    . LYS A 1  368  ? 113.957 22.291  3.930   1.00 58.86  ? 368  LYS A CA    1 
ATOM   2795  C  C     . LYS A 1  368  ? 112.876 22.105  2.828   1.00 63.82  ? 368  LYS A C     1 
ATOM   2796  O  O     . LYS A 1  368  ? 113.235 21.739  1.702   1.00 62.39  ? 368  LYS A O     1 
ATOM   2797  C  CB    . LYS A 1  368  ? 114.076 21.051  4.850   1.00 61.77  ? 368  LYS A CB    1 
ATOM   2798  C  CG    . LYS A 1  368  ? 114.672 19.790  4.221   1.00 77.84  ? 368  LYS A CG    1 
ATOM   2799  C  CD    . LYS A 1  368  ? 114.080 18.501  4.884   1.00 102.34 ? 368  LYS A CD    1 
ATOM   2800  C  CE    . LYS A 1  368  ? 114.954 17.234  4.838   1.00 119.75 ? 368  LYS A CE    1 
ATOM   2801  N  NZ    . LYS A 1  368  ? 114.195 15.954  4.579   1.00 120.50 ? 368  LYS A NZ    1 
ATOM   2802  N  N     . SER A 1  369  ? 111.568 22.425  3.144   1.00 61.55  ? 369  SER A N     1 
ATOM   2803  C  CA    . SER A 1  369  ? 110.402 22.364  2.226   1.00 61.01  ? 369  SER A CA    1 
ATOM   2804  C  C     . SER A 1  369  ? 110.728 23.120  0.935   1.00 65.67  ? 369  SER A C     1 
ATOM   2805  O  O     . SER A 1  369  ? 110.630 22.567  -0.160  1.00 64.76  ? 369  SER A O     1 
ATOM   2806  C  CB    . SER A 1  369  ? 109.153 22.959  2.894   1.00 62.11  ? 369  SER A CB    1 
ATOM   2807  O  OG    . SER A 1  369  ? 108.473 23.997  2.193   1.00 63.19  ? 369  SER A OG    1 
ATOM   2808  N  N     . ILE A 1  370  ? 111.168 24.380  1.114   1.00 63.08  ? 370  ILE A N     1 
ATOM   2809  C  CA    . ILE A 1  370  ? 111.544 25.342  0.092   1.00 62.18  ? 370  ILE A CA    1 
ATOM   2810  C  C     . ILE A 1  370  ? 112.789 24.850  -0.632  1.00 68.94  ? 370  ILE A C     1 
ATOM   2811  O  O     . ILE A 1  370  ? 112.812 24.886  -1.869  1.00 69.97  ? 370  ILE A O     1 
ATOM   2812  C  CB    . ILE A 1  370  ? 111.644 26.794  0.680   1.00 63.91  ? 370  ILE A CB    1 
ATOM   2813  C  CG1   . ILE A 1  370  ? 110.234 27.316  1.121   1.00 63.18  ? 370  ILE A CG1   1 
ATOM   2814  C  CG2   . ILE A 1  370  ? 112.275 27.739  -0.311  1.00 63.81  ? 370  ILE A CG2   1 
ATOM   2815  C  CD1   . ILE A 1  370  ? 110.111 28.725  1.739   1.00 61.87  ? 370  ILE A CD1   1 
ATOM   2816  N  N     . ALA A 1  371  ? 113.789 24.323  0.105   1.00 66.14  ? 371  ALA A N     1 
ATOM   2817  C  CA    . ALA A 1  371  ? 115.014 23.833  -0.544  1.00 66.46  ? 371  ALA A CA    1 
ATOM   2818  C  C     . ALA A 1  371  ? 114.728 22.645  -1.417  1.00 69.92  ? 371  ALA A C     1 
ATOM   2819  O  O     . ALA A 1  371  ? 115.362 22.485  -2.458  1.00 69.02  ? 371  ALA A O     1 
ATOM   2820  C  CB    . ALA A 1  371  ? 116.066 23.480  0.484   1.00 67.82  ? 371  ALA A CB    1 
ATOM   2821  N  N     . LYS A 1  372  ? 113.729 21.851  -1.016  1.00 67.11  ? 372  LYS A N     1 
ATOM   2822  C  CA    . LYS A 1  372  ? 113.323 20.661  -1.735  1.00 68.22  ? 372  LYS A CA    1 
ATOM   2823  C  C     . LYS A 1  372  ? 112.470 20.948  -2.988  1.00 74.54  ? 372  LYS A C     1 
ATOM   2824  O  O     . LYS A 1  372  ? 112.304 20.025  -3.802  1.00 76.06  ? 372  LYS A O     1 
ATOM   2825  C  CB    . LYS A 1  372  ? 112.623 19.653  -0.807  1.00 70.95  ? 372  LYS A CB    1 
ATOM   2826  C  CG    . LYS A 1  372  ? 113.549 18.815  0.087   1.00 70.10  ? 372  LYS A CG    1 
ATOM   2827  C  CD    . LYS A 1  372  ? 112.796 17.643  0.721   1.00 72.05  ? 372  LYS A CD    1 
ATOM   2828  C  CE    . LYS A 1  372  ? 111.809 18.067  1.787   1.00 80.63  ? 372  LYS A CE    1 
ATOM   2829  N  NZ    . LYS A 1  372  ? 111.092 16.909  2.367   1.00 93.62  ? 372  LYS A NZ    1 
ATOM   2830  N  N     . THR A 1  373  ? 111.901 22.192  -3.147  1.00 69.79  ? 373  THR A N     1 
ATOM   2831  C  CA    . THR A 1  373  ? 111.075 22.531  -4.332  1.00 67.93  ? 373  THR A CA    1 
ATOM   2832  C  C     . THR A 1  373  ? 111.836 23.307  -5.335  1.00 68.03  ? 373  THR A C     1 
ATOM   2833  O  O     . THR A 1  373  ? 111.712 23.015  -6.523  1.00 67.96  ? 373  THR A O     1 
ATOM   2834  C  CB    . THR A 1  373  ? 109.718 23.195  -4.059  1.00 75.93  ? 373  THR A CB    1 
ATOM   2835  O  OG1   . THR A 1  373  ? 109.602 23.677  -2.720  1.00 76.85  ? 373  THR A OG1   1 
ATOM   2836  C  CG2   . THR A 1  373  ? 108.569 22.268  -4.390  1.00 77.77  ? 373  THR A CG2   1 
ATOM   2837  N  N     . LEU A 1  374  ? 112.633 24.277  -4.879  1.00 62.29  ? 374  LEU A N     1 
ATOM   2838  C  CA    . LEU A 1  374  ? 113.463 25.065  -5.771  1.00 61.67  ? 374  LEU A CA    1 
ATOM   2839  C  C     . LEU A 1  374  ? 114.629 24.201  -6.298  1.00 68.59  ? 374  LEU A C     1 
ATOM   2840  O  O     . LEU A 1  374  ? 115.050 23.247  -5.631  1.00 69.28  ? 374  LEU A O     1 
ATOM   2841  C  CB    . LEU A 1  374  ? 113.949 26.330  -5.089  1.00 60.93  ? 374  LEU A CB    1 
ATOM   2842  C  CG    . LEU A 1  374  ? 112.923 27.283  -4.576  1.00 64.57  ? 374  LEU A CG    1 
ATOM   2843  C  CD1   . LEU A 1  374  ? 113.541 28.162  -3.563  1.00 64.66  ? 374  LEU A CD1   1 
ATOM   2844  C  CD2   . LEU A 1  374  ? 112.365 28.122  -5.693  1.00 66.82  ? 374  LEU A CD2   1 
ATOM   2845  N  N     . THR A 1  375  ? 115.140 24.527  -7.501  1.00 66.12  ? 375  THR A N     1 
ATOM   2846  C  CA    . THR A 1  375  ? 116.126 23.699  -8.167  1.00 67.39  ? 375  THR A CA    1 
ATOM   2847  C  C     . THR A 1  375  ? 117.187 24.452  -8.990  1.00 73.70  ? 375  THR A C     1 
ATOM   2848  O  O     . THR A 1  375  ? 116.857 25.361  -9.742  1.00 73.41  ? 375  THR A O     1 
ATOM   2849  C  CB    . THR A 1  375  ? 115.290 22.729  -9.024  1.00 81.39  ? 375  THR A CB    1 
ATOM   2850  O  OG1   . THR A 1  375  ? 115.451 21.404  -8.530  1.00 87.26  ? 375  THR A OG1   1 
ATOM   2851  C  CG2   . THR A 1  375  ? 115.532 22.839  -10.528 1.00 79.68  ? 375  THR A CG2   1 
ATOM   2852  N  N     . TYR A 1  376  ? 118.451 24.033  -8.897  1.00 73.01  ? 376  TYR A N     1 
ATOM   2853  C  CA    . TYR A 1  376  ? 119.496 24.590  -9.760  1.00 74.00  ? 376  TYR A CA    1 
ATOM   2854  C  C     . TYR A 1  376  ? 119.886 23.522  -10.815 1.00 80.75  ? 376  TYR A C     1 
ATOM   2855  O  O     . TYR A 1  376  ? 120.239 22.393  -10.447 1.00 82.36  ? 376  TYR A O     1 
ATOM   2856  C  CB    . TYR A 1  376  ? 120.722 25.103  -8.988  1.00 75.47  ? 376  TYR A CB    1 
ATOM   2857  C  CG    . TYR A 1  376  ? 121.868 25.489  -9.898  1.00 78.32  ? 376  TYR A CG    1 
ATOM   2858  C  CD1   . TYR A 1  376  ? 121.892 26.725  -10.534 1.00 80.49  ? 376  TYR A CD1   1 
ATOM   2859  C  CD2   . TYR A 1  376  ? 122.924 24.616  -10.129 1.00 80.65  ? 376  TYR A CD2   1 
ATOM   2860  C  CE1   . TYR A 1  376  ? 122.930 27.075  -11.399 1.00 83.67  ? 376  TYR A CE1   1 
ATOM   2861  C  CE2   . TYR A 1  376  ? 123.967 24.952  -10.993 1.00 83.04  ? 376  TYR A CE2   1 
ATOM   2862  C  CZ    . TYR A 1  376  ? 123.971 26.187  -11.626 1.00 93.94  ? 376  TYR A CZ    1 
ATOM   2863  O  OH    . TYR A 1  376  ? 125.003 26.520  -12.487 1.00 97.43  ? 376  TYR A OH    1 
ATOM   2864  N  N     . PRO A 1  377  ? 119.828 23.847  -12.123 1.00 76.35  ? 377  PRO A N     1 
ATOM   2865  C  CA    . PRO A 1  377  ? 120.144 22.844  -13.144 1.00 76.24  ? 377  PRO A CA    1 
ATOM   2866  C  C     . PRO A 1  377  ? 121.630 22.842  -13.354 1.00 78.05  ? 377  PRO A C     1 
ATOM   2867  O  O     . PRO A 1  377  ? 122.155 23.831  -13.861 1.00 77.37  ? 377  PRO A O     1 
ATOM   2868  C  CB    . PRO A 1  377  ? 119.418 23.373  -14.382 1.00 78.29  ? 377  PRO A CB    1 
ATOM   2869  C  CG    . PRO A 1  377  ? 118.577 24.556  -13.885 1.00 82.47  ? 377  PRO A CG    1 
ATOM   2870  C  CD    . PRO A 1  377  ? 119.376 25.091  -12.755 1.00 77.72  ? 377  PRO A CD    1 
ATOM   2871  N  N     . GLU A 1  378  ? 122.301 21.766  -12.907 1.00 74.23  ? 378  GLU A N     1 
ATOM   2872  C  CA    . GLU A 1  378  ? 123.754 21.589  -12.946 1.00 74.76  ? 378  GLU A CA    1 
ATOM   2873  C  C     . GLU A 1  378  ? 124.165 20.697  -14.098 1.00 81.21  ? 378  GLU A C     1 
ATOM   2874  O  O     . GLU A 1  378  ? 123.568 19.640  -14.260 1.00 82.40  ? 378  GLU A O     1 
ATOM   2875  C  CB    . GLU A 1  378  ? 124.212 20.964  -11.629 1.00 76.24  ? 378  GLU A CB    1 
ATOM   2876  C  CG    . GLU A 1  378  ? 125.704 21.057  -11.395 1.00 89.42  ? 378  GLU A CG    1 
ATOM   2877  C  CD    . GLU A 1  378  ? 126.062 21.214  -9.933  1.00 118.30 ? 378  GLU A CD    1 
ATOM   2878  O  OE1   . GLU A 1  378  ? 125.538 20.427  -9.112  1.00 93.37  ? 378  GLU A OE1   1 
ATOM   2879  O  OE2   . GLU A 1  378  ? 126.842 22.140  -9.601  1.00 128.20 ? 378  GLU A OE2   1 
ATOM   2880  N  N     . VAL A 1  379  ? 125.191 21.076  -14.878 1.00 78.53  ? 379  VAL A N     1 
ATOM   2881  C  CA    . VAL A 1  379  ? 125.607 20.220  -15.997 1.00 79.74  ? 379  VAL A CA    1 
ATOM   2882  C  C     . VAL A 1  379  ? 126.553 19.131  -15.545 1.00 84.88  ? 379  VAL A C     1 
ATOM   2883  O  O     . VAL A 1  379  ? 127.552 19.435  -14.894 1.00 85.41  ? 379  VAL A O     1 
ATOM   2884  C  CB    . VAL A 1  379  ? 126.158 20.988  -17.214 1.00 84.09  ? 379  VAL A CB    1 
ATOM   2885  C  CG1   . VAL A 1  379  ? 126.714 20.033  -18.277 1.00 85.00  ? 379  VAL A CG1   1 
ATOM   2886  C  CG2   . VAL A 1  379  ? 125.081 21.880  -17.813 1.00 83.12  ? 379  VAL A CG2   1 
ATOM   2887  N  N     . VAL A 1  380  ? 126.240 17.867  -15.930 1.00 81.36  ? 380  VAL A N     1 
ATOM   2888  C  CA    . VAL A 1  380  ? 126.989 16.637  -15.655 1.00 81.99  ? 380  VAL A CA    1 
ATOM   2889  C  C     . VAL A 1  380  ? 128.388 16.751  -16.261 1.00 86.58  ? 380  VAL A C     1 
ATOM   2890  O  O     . VAL A 1  380  ? 128.590 16.655  -17.475 1.00 86.10  ? 380  VAL A O     1 
ATOM   2891  C  CB    . VAL A 1  380  ? 126.213 15.370  -16.089 1.00 86.16  ? 380  VAL A CB    1 
ATOM   2892  C  CG1   . VAL A 1  380  ? 126.998 14.109  -15.773 1.00 87.50  ? 380  VAL A CG1   1 
ATOM   2893  C  CG2   . VAL A 1  380  ? 124.841 15.320  -15.427 1.00 84.66  ? 380  VAL A CG2   1 
ATOM   2894  N  N     . THR A 1  381  ? 129.332 17.043  -15.375 1.00 84.23  ? 381  THR A N     1 
ATOM   2895  C  CA    . THR A 1  381  ? 130.733 17.331  -15.649 1.00 85.46  ? 381  THR A CA    1 
ATOM   2896  C  C     . THR A 1  381  ? 131.595 16.345  -14.838 1.00 88.63  ? 381  THR A C     1 
ATOM   2897  O  O     . THR A 1  381  ? 131.130 15.952  -13.775 1.00 87.28  ? 381  THR A O     1 
ATOM   2898  C  CB    . THR A 1  381  ? 130.958 18.859  -15.423 1.00 99.57  ? 381  THR A CB    1 
ATOM   2899  O  OG1   . THR A 1  381  ? 132.061 19.311  -16.199 1.00 103.52 ? 381  THR A OG1   1 
ATOM   2900  C  CG2   . THR A 1  381  ? 131.088 19.275  -13.935 1.00 97.95  ? 381  THR A CG2   1 
ATOM   2901  N  N     . PRO A 1  382  ? 132.797 15.889  -15.299 1.00 85.95  ? 382  PRO A N     1 
ATOM   2902  C  CA    . PRO A 1  382  ? 133.552 14.877  -14.529 1.00 87.26  ? 382  PRO A CA    1 
ATOM   2903  C  C     . PRO A 1  382  ? 133.863 15.298  -13.122 1.00 94.65  ? 382  PRO A C     1 
ATOM   2904  O  O     . PRO A 1  382  ? 134.089 14.446  -12.260 1.00 94.29  ? 382  PRO A O     1 
ATOM   2905  C  CB    . PRO A 1  382  ? 134.829 14.681  -15.324 1.00 90.15  ? 382  PRO A CB    1 
ATOM   2906  C  CG    . PRO A 1  382  ? 134.556 15.212  -16.640 1.00 94.29  ? 382  PRO A CG    1 
ATOM   2907  C  CD    . PRO A 1  382  ? 133.513 16.257  -16.531 1.00 88.02  ? 382  PRO A CD    1 
ATOM   2908  N  N     . TYR A 1  383  ? 133.828 16.619  -12.897 1.00 94.36  ? 383  TYR A N     1 
ATOM   2909  C  CA    . TYR A 1  383  ? 134.046 17.229  -11.602 1.00 95.82  ? 383  TYR A CA    1 
ATOM   2910  C  C     . TYR A 1  383  ? 132.911 16.830  -10.659 1.00 100.84 ? 383  TYR A C     1 
ATOM   2911  O  O     . TYR A 1  383  ? 133.196 16.369  -9.554  1.00 101.63 ? 383  TYR A O     1 
ATOM   2912  C  CB    . TYR A 1  383  ? 134.148 18.769  -11.701 1.00 97.26  ? 383  TYR A CB    1 
ATOM   2913  C  CG    . TYR A 1  383  ? 134.828 19.327  -12.937 1.00 101.27 ? 383  TYR A CG    1 
ATOM   2914  C  CD1   . TYR A 1  383  ? 136.123 18.948  -13.283 1.00 103.91 ? 383  TYR A CD1   1 
ATOM   2915  C  CD2   . TYR A 1  383  ? 134.215 20.308  -13.703 1.00 103.18 ? 383  TYR A CD2   1 
ATOM   2916  C  CE1   . TYR A 1  383  ? 136.756 19.475  -14.414 1.00 105.81 ? 383  TYR A CE1   1 
ATOM   2917  C  CE2   . TYR A 1  383  ? 134.834 20.843  -14.834 1.00 106.22 ? 383  TYR A CE2   1 
ATOM   2918  C  CZ    . TYR A 1  383  ? 136.108 20.433  -15.184 1.00 115.05 ? 383  TYR A CZ    1 
ATOM   2919  O  OH    . TYR A 1  383  ? 136.687 20.986  -16.311 1.00 118.51 ? 383  TYR A OH    1 
ATOM   2920  N  N     . ASN A 1  384  ? 131.635 16.944  -11.108 1.00 96.67  ? 384  ASN A N     1 
ATOM   2921  C  CA    . ASN A 1  384  ? 130.470 16.630  -10.264 1.00 95.74  ? 384  ASN A CA    1 
ATOM   2922  C  C     . ASN A 1  384  ? 129.836 15.241  -10.454 1.00 99.47  ? 384  ASN A C     1 
ATOM   2923  O  O     . ASN A 1  384  ? 129.145 14.756  -9.555  1.00 100.08 ? 384  ASN A O     1 
ATOM   2924  C  CB    . ASN A 1  384  ? 129.385 17.700  -10.425 1.00 95.05  ? 384  ASN A CB    1 
ATOM   2925  C  CG    . ASN A 1  384  ? 128.753 17.810  -11.795 1.00 108.08 ? 384  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A 1  384  ? 128.750 16.874  -12.614 1.00 85.64  ? 384  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A 1  384  ? 128.163 18.976  -12.056 1.00 104.30 ? 384  ASN A ND2   1 
ATOM   2928  N  N     . ILE A 1  385  ? 130.031 14.641  -11.631 1.00 93.77  ? 385  ILE A N     1 
ATOM   2929  C  CA    . ILE A 1  385  ? 129.459 13.378  -12.092 1.00 91.91  ? 385  ILE A CA    1 
ATOM   2930  C  C     . ILE A 1  385  ? 129.145 12.415  -10.938 1.00 94.76  ? 385  ILE A C     1 
ATOM   2931  O  O     . ILE A 1  385  ? 128.001 12.001  -10.824 1.00 92.39  ? 385  ILE A O     1 
ATOM   2932  C  CB    . ILE A 1  385  ? 130.362 12.772  -13.207 1.00 94.90  ? 385  ILE A CB    1 
ATOM   2933  C  CG1   . ILE A 1  385  ? 129.545 12.058  -14.314 1.00 93.27  ? 385  ILE A CG1   1 
ATOM   2934  C  CG2   . ILE A 1  385  ? 131.507 11.915  -12.693 1.00 98.18  ? 385  ILE A CG2   1 
ATOM   2935  C  CD1   . ILE A 1  385  ? 128.494 11.088  -13.929 1.00 91.35  ? 385  ILE A CD1   1 
ATOM   2936  N  N     . ASP A 1  386  ? 130.094 12.174  -10.031 1.00 93.78  ? 386  ASP A N     1 
ATOM   2937  C  CA    . ASP A 1  386  ? 129.881 11.220  -8.952  1.00 95.39  ? 386  ASP A CA    1 
ATOM   2938  C  C     . ASP A 1  386  ? 128.918 11.710  -7.876  1.00 95.83  ? 386  ASP A C     1 
ATOM   2939  O  O     . ASP A 1  386  ? 128.059 10.929  -7.455  1.00 95.62  ? 386  ASP A O     1 
ATOM   2940  C  CB    . ASP A 1  386  ? 131.216 10.746  -8.363  1.00 100.07 ? 386  ASP A CB    1 
ATOM   2941  C  CG    . ASP A 1  386  ? 131.954 9.749   -9.260  1.00 117.40 ? 386  ASP A CG    1 
ATOM   2942  O  OD1   . ASP A 1  386  ? 131.490 8.581   -9.370  1.00 118.30 ? 386  ASP A OD1   1 
ATOM   2943  O  OD2   . ASP A 1  386  ? 132.997 10.134  -9.847  1.00 127.16 ? 386  ASP A OD2   1 
ATOM   2944  N  N     . ARG A 1  387  ? 129.039 12.981  -7.453  1.00 89.60  ? 387  ARG A N     1 
ATOM   2945  C  CA    . ARG A 1  387  ? 128.137 13.603  -6.476  1.00 87.81  ? 387  ARG A CA    1 
ATOM   2946  C  C     . ARG A 1  387  ? 126.702 13.610  -7.020  1.00 89.34  ? 387  ARG A C     1 
ATOM   2947  O  O     . ARG A 1  387  ? 125.789 13.116  -6.351  1.00 89.03  ? 387  ARG A O     1 
ATOM   2948  C  CB    . ARG A 1  387  ? 128.587 15.046  -6.167  1.00 88.13  ? 387  ARG A CB    1 
ATOM   2949  C  CG    . ARG A 1  387  ? 127.479 15.963  -5.611  1.00 96.82  ? 387  ARG A CG    1 
ATOM   2950  C  CD    . ARG A 1  387  ? 127.972 17.366  -5.286  1.00 108.32 ? 387  ARG A CD    1 
ATOM   2951  N  NE    . ARG A 1  387  ? 128.288 18.146  -6.484  1.00 113.38 ? 387  ARG A NE    1 
ATOM   2952  C  CZ    . ARG A 1  387  ? 127.596 19.202  -6.908  1.00 119.58 ? 387  ARG A CZ    1 
ATOM   2953  N  NH1   . ARG A 1  387  ? 126.547 19.642  -6.220  1.00 86.93  ? 387  ARG A NH1   1 
ATOM   2954  N  NH2   . ARG A 1  387  ? 127.966 19.844  -8.007  1.00 112.60 ? 387  ARG A NH2   1 
ATOM   2955  N  N     . LEU A 1  388  ? 126.524 14.162  -8.247  1.00 83.37  ? 388  LEU A N     1 
ATOM   2956  C  CA    . LEU A 1  388  ? 125.255 14.286  -8.958  1.00 80.66  ? 388  LEU A CA    1 
ATOM   2957  C  C     . LEU A 1  388  ? 124.495 13.002  -9.029  1.00 83.28  ? 388  LEU A C     1 
ATOM   2958  O  O     . LEU A 1  388  ? 123.278 13.029  -8.927  1.00 81.07  ? 388  LEU A O     1 
ATOM   2959  C  CB    . LEU A 1  388  ? 125.478 14.804  -10.365 1.00 80.05  ? 388  LEU A CB    1 
ATOM   2960  C  CG    . LEU A 1  388  ? 125.522 16.286  -10.513 1.00 83.06  ? 388  LEU A CG    1 
ATOM   2961  C  CD1   . LEU A 1  388  ? 125.407 16.645  -11.946 1.00 83.91  ? 388  LEU A CD1   1 
ATOM   2962  C  CD2   . LEU A 1  388  ? 124.376 16.937  -9.801  1.00 82.79  ? 388  LEU A CD2   1 
ATOM   2963  N  N     . THR A 1  389  ? 125.204 11.876  -9.192  1.00 81.53  ? 389  THR A N     1 
ATOM   2964  C  CA    . THR A 1  389  ? 124.555 10.578  -9.243  1.00 82.55  ? 389  THR A CA    1 
ATOM   2965  C  C     . THR A 1  389  ? 123.967 10.249  -7.901  1.00 87.15  ? 389  THR A C     1 
ATOM   2966  O  O     . THR A 1  389  ? 122.845 9.755   -7.851  1.00 87.06  ? 389  THR A O     1 
ATOM   2967  C  CB    . THR A 1  389  ? 125.472 9.488   -9.757  1.00 92.02  ? 389  THR A CB    1 
ATOM   2968  O  OG1   . THR A 1  389  ? 126.283 10.029  -10.786 1.00 94.86  ? 389  THR A OG1   1 
ATOM   2969  C  CG2   . THR A 1  389  ? 124.692 8.325   -10.330 1.00 91.07  ? 389  THR A CG2   1 
ATOM   2970  N  N     . GLN A 1  390  ? 124.676 10.578  -6.813  1.00 83.95  ? 390  GLN A N     1 
ATOM   2971  C  CA    . GLN A 1  390  ? 124.142 10.292  -5.495  1.00 83.93  ? 390  GLN A CA    1 
ATOM   2972  C  C     . GLN A 1  390  ? 122.931 11.176  -5.183  1.00 85.79  ? 390  GLN A C     1 
ATOM   2973  O  O     . GLN A 1  390  ? 122.046 10.725  -4.458  1.00 86.38  ? 390  GLN A O     1 
ATOM   2974  C  CB    . GLN A 1  390  ? 125.219 10.317  -4.396  1.00 86.17  ? 390  GLN A CB    1 
ATOM   2975  C  CG    . GLN A 1  390  ? 124.873 9.448   -3.173  1.00 111.37 ? 390  GLN A CG    1 
ATOM   2976  C  CD    . GLN A 1  390  ? 124.279 8.100   -3.541  1.00 144.27 ? 390  GLN A CD    1 
ATOM   2977  O  OE1   . GLN A 1  390  ? 124.938 7.242   -4.142  1.00 144.82 ? 390  GLN A OE1   1 
ATOM   2978  N  NE2   . GLN A 1  390  ? 123.004 7.899   -3.219  1.00 137.53 ? 390  GLN A NE2   1 
ATOM   2979  N  N     . LEU A 1  391  ? 122.832 12.370  -5.802  1.00 79.44  ? 391  LEU A N     1 
ATOM   2980  C  CA    . LEU A 1  391  ? 121.662 13.236  -5.623  1.00 77.30  ? 391  LEU A CA    1 
ATOM   2981  C  C     . LEU A 1  391  ? 120.448 12.659  -6.387  1.00 82.21  ? 391  LEU A C     1 
ATOM   2982  O  O     . LEU A 1  391  ? 119.355 12.584  -5.831  1.00 82.50  ? 391  LEU A O     1 
ATOM   2983  C  CB    . LEU A 1  391  ? 121.946 14.661  -6.098  1.00 75.75  ? 391  LEU A CB    1 
ATOM   2984  C  CG    . LEU A 1  391  ? 122.953 15.442  -5.304  1.00 79.71  ? 391  LEU A CG    1 
ATOM   2985  C  CD1   . LEU A 1  391  ? 123.688 16.415  -6.190  1.00 79.24  ? 391  LEU A CD1   1 
ATOM   2986  C  CD2   . LEU A 1  391  ? 122.296 16.170  -4.170  1.00 81.32  ? 391  LEU A CD2   1 
ATOM   2987  N  N     . VAL A 1  392  ? 120.651 12.243  -7.654  1.00 78.02  ? 392  VAL A N     1 
ATOM   2988  C  CA    . VAL A 1  392  ? 119.633 11.649  -8.516  1.00 77.25  ? 392  VAL A CA    1 
ATOM   2989  C  C     . VAL A 1  392  ? 119.138 10.380  -7.839  1.00 85.50  ? 392  VAL A C     1 
ATOM   2990  O  O     . VAL A 1  392  ? 117.931 10.147  -7.752  1.00 85.04  ? 392  VAL A O     1 
ATOM   2991  C  CB    . VAL A 1  392  ? 120.241 11.372  -9.904  1.00 80.53  ? 392  VAL A CB    1 
ATOM   2992  C  CG1   . VAL A 1  392  ? 119.365 10.463  -10.737 1.00 80.92  ? 392  VAL A CG1   1 
ATOM   2993  C  CG2   . VAL A 1  392  ? 120.497 12.662  -10.642 1.00 79.21  ? 392  VAL A CG2   1 
ATOM   2994  N  N     . ARG A 1  393  ? 120.072 9.586   -7.312  1.00 86.51  ? 393  ARG A N     1 
ATOM   2995  C  CA    . ARG A 1  393  ? 119.710 8.363   -6.615  1.00 89.24  ? 393  ARG A CA    1 
ATOM   2996  C  C     . ARG A 1  393  ? 119.032 8.682   -5.299  1.00 94.17  ? 393  ARG A C     1 
ATOM   2997  O  O     . ARG A 1  393  ? 118.224 7.881   -4.850  1.00 95.56  ? 393  ARG A O     1 
ATOM   2998  C  CB    . ARG A 1  393  ? 120.890 7.380   -6.470  1.00 94.21  ? 393  ARG A CB    1 
ATOM   2999  C  CG    . ARG A 1  393  ? 121.131 6.561   -7.746  1.00 115.93 ? 393  ARG A CG    1 
ATOM   3000  C  CD    . ARG A 1  393  ? 121.576 5.136   -7.451  1.00 143.82 ? 393  ARG A CD    1 
ATOM   3001  N  NE    . ARG A 1  393  ? 123.034 4.997   -7.366  1.00 163.94 ? 393  ARG A NE    1 
ATOM   3002  C  CZ    . ARG A 1  393  ? 123.732 4.992   -6.233  1.00 183.45 ? 393  ARG A CZ    1 
ATOM   3003  N  NH1   . ARG A 1  393  ? 123.116 5.119   -5.062  1.00 175.71 ? 393  ARG A NH1   1 
ATOM   3004  N  NH2   . ARG A 1  393  ? 125.052 4.858   -6.261  1.00 169.29 ? 393  ARG A NH2   1 
ATOM   3005  N  N     . ASN A 1  394  ? 119.287 9.868   -4.716  1.00 89.77  ? 394  ASN A N     1 
ATOM   3006  C  CA    . ASN A 1  394  ? 118.609 10.257  -3.477  1.00 89.64  ? 394  ASN A CA    1 
ATOM   3007  C  C     . ASN A 1  394  ? 117.135 10.628  -3.748  1.00 94.90  ? 394  ASN A C     1 
ATOM   3008  O  O     . ASN A 1  394  ? 116.260 10.423  -2.897  1.00 95.08  ? 394  ASN A O     1 
ATOM   3009  C  CB    . ASN A 1  394  ? 119.358 11.376  -2.756  1.00 88.16  ? 394  ASN A CB    1 
ATOM   3010  C  CG    . ASN A 1  394  ? 120.355 10.901  -1.722  1.00 112.72 ? 394  ASN A CG    1 
ATOM   3011  O  OD1   . ASN A 1  394  ? 121.008 9.849   -1.854  1.00 111.90 ? 394  ASN A OD1   1 
ATOM   3012  N  ND2   . ASN A 1  394  ? 120.492 11.675  -0.655  1.00 101.44 ? 394  ASN A ND2   1 
ATOM   3013  N  N     . GLY A 1  395  ? 116.879 11.128  -4.952  1.00 91.40  ? 395  GLY A N     1 
ATOM   3014  C  CA    . GLY A 1  395  ? 115.543 11.488  -5.399  1.00 90.50  ? 395  GLY A CA    1 
ATOM   3015  C  C     . GLY A 1  395  ? 114.990 12.782  -4.840  1.00 92.43  ? 395  GLY A C     1 
ATOM   3016  O  O     . GLY A 1  395  ? 115.640 13.446  -4.021  1.00 91.64  ? 395  GLY A O     1 
ATOM   3017  N  N     . PRO A 1  396  ? 113.752 13.134  -5.255  1.00 87.94  ? 396  PRO A N     1 
ATOM   3018  C  CA    . PRO A 1  396  ? 113.159 14.403  -4.807  1.00 87.30  ? 396  PRO A CA    1 
ATOM   3019  C  C     . PRO A 1  396  ? 112.663 14.471  -3.352  1.00 93.55  ? 396  PRO A C     1 
ATOM   3020  O  O     . PRO A 1  396  ? 112.250 15.556  -2.914  1.00 93.51  ? 396  PRO A O     1 
ATOM   3021  C  CB    . PRO A 1  396  ? 112.017 14.613  -5.800  1.00 88.22  ? 396  PRO A CB    1 
ATOM   3022  C  CG    . PRO A 1  396  ? 111.648 13.257  -6.235  1.00 92.57  ? 396  PRO A CG    1 
ATOM   3023  C  CD    . PRO A 1  396  ? 112.897 12.468  -6.259  1.00 88.94  ? 396  PRO A CD    1 
ATOM   3024  N  N     . ASN A 1  397  ? 112.724 13.369  -2.593  1.00 90.96  ? 397  ASN A N     1 
ATOM   3025  C  CA    . ASN A 1  397  ? 112.197 13.402  -1.238  1.00 91.62  ? 397  ASN A CA    1 
ATOM   3026  C  C     . ASN A 1  397  ? 113.243 13.553  -0.129  1.00 97.45  ? 397  ASN A C     1 
ATOM   3027  O  O     . ASN A 1  397  ? 112.935 14.176  0.894   1.00 96.86  ? 397  ASN A O     1 
ATOM   3028  C  CB    . ASN A 1  397  ? 111.322 12.195  -0.998  1.00 96.31  ? 397  ASN A CB    1 
ATOM   3029  C  CG    . ASN A 1  397  ? 110.104 12.115  -1.898  1.00 124.45 ? 397  ASN A CG    1 
ATOM   3030  O  OD1   . ASN A 1  397  ? 109.745 13.053  -2.629  1.00 114.72 ? 397  ASN A OD1   1 
ATOM   3031  N  ND2   . ASN A 1  397  ? 109.430 10.978  -1.847  1.00 120.60 ? 397  ASN A ND2   1 
ATOM   3032  N  N     . GLU A 1  398  ? 114.464 12.991  -0.317  1.00 95.90  ? 398  GLU A N     1 
ATOM   3033  C  CA    . GLU A 1  398  ? 115.596 13.095  0.638   1.00 96.41  ? 398  GLU A CA    1 
ATOM   3034  C  C     . GLU A 1  398  ? 116.067 14.552  0.615   1.00 96.03  ? 398  GLU A C     1 
ATOM   3035  O  O     . GLU A 1  398  ? 115.813 15.161  -0.426  1.00 94.09  ? 398  GLU A O     1 
ATOM   3036  C  CB    . GLU A 1  398  ? 116.768 12.194  0.166   1.00 99.36  ? 398  GLU A CB    1 
ATOM   3037  C  CG    . GLU A 1  398  ? 116.717 10.750  0.654   1.00 118.74 ? 398  GLU A CG    1 
ATOM   3038  C  CD    . GLU A 1  398  ? 118.044 9.999   0.689   1.00 159.98 ? 398  GLU A CD    1 
ATOM   3039  O  OE1   . GLU A 1  398  ? 118.966 10.447  1.411   1.00 161.06 ? 398  GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A 1  398  ? 118.150 8.938   0.027   1.00 161.97 ? 398  GLU A OE2   1 
ATOM   3041  N  N     . HIS A 1  399  ? 116.749 15.139  1.679   1.00 91.25  ? 399  HIS A N     1 
ATOM   3042  C  CA    . HIS A 1  399  ? 117.144 16.514  1.379   1.00 90.31  ? 399  HIS A CA    1 
ATOM   3043  C  C     . HIS A 1  399  ? 118.146 16.563  0.270   1.00 97.00  ? 399  HIS A C     1 
ATOM   3044  O  O     . HIS A 1  399  ? 117.706 16.949  -0.804  1.00 99.74  ? 399  HIS A O     1 
ATOM   3045  C  CB    . HIS A 1  399  ? 117.562 17.532  2.456   1.00 90.19  ? 399  HIS A CB    1 
ATOM   3046  C  CG    . HIS A 1  399  ? 117.954 18.828  1.752   1.00 92.01  ? 399  HIS A CG    1 
ATOM   3047  N  ND1   . HIS A 1  399  ? 117.043 19.515  0.925   1.00 92.29  ? 399  HIS A ND1   1 
ATOM   3048  C  CD2   . HIS A 1  399  ? 119.178 19.383  1.569   1.00 92.98  ? 399  HIS A CD2   1 
ATOM   3049  C  CE1   . HIS A 1  399  ? 117.728 20.488  0.348   1.00 90.55  ? 399  HIS A CE1   1 
ATOM   3050  N  NE2   . HIS A 1  399  ? 119.008 20.461  0.706   1.00 91.50  ? 399  HIS A NE2   1 
ATOM   3051  N  N     . PRO A 1  400  ? 119.466 16.366  0.433   1.00 91.03  ? 400  PRO A N     1 
ATOM   3052  C  CA    . PRO A 1  400  ? 120.325 16.519  -0.745  1.00 90.23  ? 400  PRO A CA    1 
ATOM   3053  C  C     . PRO A 1  400  ? 119.862 15.460  -1.734  1.00 93.73  ? 400  PRO A C     1 
ATOM   3054  O  O     . PRO A 1  400  ? 119.915 14.270  -1.441  1.00 95.16  ? 400  PRO A O     1 
ATOM   3055  C  CB    . PRO A 1  400  ? 121.736 16.346  -0.194  1.00 92.96  ? 400  PRO A CB    1 
ATOM   3056  C  CG    . PRO A 1  400  ? 121.582 16.479  1.295   1.00 97.77  ? 400  PRO A CG    1 
ATOM   3057  C  CD    . PRO A 1  400  ? 120.236 15.940  1.610   1.00 92.96  ? 400  PRO A CD    1 
ATOM   3058  N  N     . GLY A 1  401  ? 119.201 15.936  -2.779  1.00 87.95  ? 401  GLY A N     1 
ATOM   3059  C  CA    . GLY A 1  401  ? 118.582 15.127  -3.812  1.00 87.77  ? 401  GLY A CA    1 
ATOM   3060  C  C     . GLY A 1  401  ? 118.347 15.973  -5.035  1.00 90.96  ? 401  GLY A C     1 
ATOM   3061  O  O     . GLY A 1  401  ? 118.799 17.125  -5.086  1.00 91.03  ? 401  GLY A O     1 
ATOM   3062  N  N     . ALA A 1  402  ? 117.636 15.420  -6.023  1.00 86.23  ? 402  ALA A N     1 
ATOM   3063  C  CA    . ALA A 1  402  ? 117.347 16.120  -7.279  1.00 84.42  ? 402  ALA A CA    1 
ATOM   3064  C  C     . ALA A 1  402  ? 115.939 15.813  -7.748  1.00 84.31  ? 402  ALA A C     1 
ATOM   3065  O  O     . ALA A 1  402  ? 115.394 14.770  -7.387  1.00 84.76  ? 402  ALA A O     1 
ATOM   3066  C  CB    . ALA A 1  402  ? 118.357 15.715  -8.339  1.00 85.93  ? 402  ALA A CB    1 
ATOM   3067  N  N     . LYS A 1  403  ? 115.355 16.699  -8.558  1.00 77.43  ? 403  LYS A N     1 
ATOM   3068  C  CA    . LYS A 1  403  ? 113.990 16.501  -9.046  1.00 76.95  ? 403  LYS A CA    1 
ATOM   3069  C  C     . LYS A 1  403  ? 113.898 15.948  -10.493 1.00 80.55  ? 403  LYS A C     1 
ATOM   3070  O  O     . LYS A 1  403  ? 113.006 15.135  -10.774 1.00 80.94  ? 403  LYS A O     1 
ATOM   3071  C  CB    . LYS A 1  403  ? 113.148 17.787  -8.889  1.00 78.41  ? 403  LYS A CB    1 
ATOM   3072  C  CG    . LYS A 1  403  ? 112.811 18.165  -7.441  1.00 85.71  ? 403  LYS A CG    1 
ATOM   3073  C  CD    . LYS A 1  403  ? 112.186 19.548  -7.360  1.00 89.39  ? 403  LYS A CD    1 
ATOM   3074  C  CE    . LYS A 1  403  ? 110.709 19.460  -7.080  1.00 104.05 ? 403  LYS A CE    1 
ATOM   3075  N  NZ    . LYS A 1  403  ? 110.034 20.761  -7.322  1.00 114.15 ? 403  LYS A NZ    1 
ATOM   3076  N  N     . TYR A 1  404  ? 114.787 16.403  -11.405 1.00 75.91  ? 404  TYR A N     1 
ATOM   3077  C  CA    . TYR A 1  404  ? 114.780 15.972  -12.808 1.00 75.73  ? 404  TYR A CA    1 
ATOM   3078  C  C     . TYR A 1  404  ? 116.153 15.773  -13.392 1.00 76.85  ? 404  TYR A C     1 
ATOM   3079  O  O     . TYR A 1  404  ? 117.096 16.472  -13.021 1.00 75.35  ? 404  TYR A O     1 
ATOM   3080  C  CB    . TYR A 1  404  ? 114.070 16.986  -13.720 1.00 77.01  ? 404  TYR A CB    1 
ATOM   3081  C  CG    . TYR A 1  404  ? 112.639 17.318  -13.387 1.00 79.65  ? 404  TYR A CG    1 
ATOM   3082  C  CD1   . TYR A 1  404  ? 111.597 16.488  -13.790 1.00 81.43  ? 404  TYR A CD1   1 
ATOM   3083  C  CD2   . TYR A 1  404  ? 112.311 18.523  -12.785 1.00 81.59  ? 404  TYR A CD2   1 
ATOM   3084  C  CE1   . TYR A 1  404  ? 110.265 16.813  -13.525 1.00 82.61  ? 404  TYR A CE1   1 
ATOM   3085  C  CE2   . TYR A 1  404  ? 110.986 18.859  -12.510 1.00 85.52  ? 404  TYR A CE2   1 
ATOM   3086  C  CZ    . TYR A 1  404  ? 109.961 18.009  -12.892 1.00 93.94  ? 404  TYR A CZ    1 
ATOM   3087  O  OH    . TYR A 1  404  ? 108.657 18.393  -12.650 1.00 96.46  ? 404  TYR A OH    1 
ATOM   3088  N  N     . VAL A 1  405  ? 116.239 14.865  -14.379 1.00 73.24  ? 405  VAL A N     1 
ATOM   3089  C  CA    . VAL A 1  405  ? 117.444 14.600  -15.165 1.00 73.17  ? 405  VAL A CA    1 
ATOM   3090  C  C     . VAL A 1  405  ? 117.093 15.009  -16.586 1.00 82.65  ? 405  VAL A C     1 
ATOM   3091  O  O     . VAL A 1  405  ? 116.123 14.493  -17.139 1.00 84.11  ? 405  VAL A O     1 
ATOM   3092  C  CB    . VAL A 1  405  ? 117.988 13.153  -15.066 1.00 75.01  ? 405  VAL A CB    1 
ATOM   3093  C  CG1   . VAL A 1  405  ? 118.978 12.866  -16.175 1.00 74.82  ? 405  VAL A CG1   1 
ATOM   3094  C  CG2   . VAL A 1  405  ? 118.651 12.930  -13.728 1.00 74.40  ? 405  VAL A CG2   1 
ATOM   3095  N  N     . ILE A 1  406  ? 117.830 15.986  -17.143 1.00 80.83  ? 406  ILE A N     1 
ATOM   3096  C  CA    . ILE A 1  406  ? 117.609 16.482  -18.493 1.00 81.00  ? 406  ILE A CA    1 
ATOM   3097  C  C     . ILE A 1  406  ? 118.659 15.909  -19.432 1.00 90.51  ? 406  ILE A C     1 
ATOM   3098  O  O     . ILE A 1  406  ? 119.842 16.241  -19.339 1.00 89.73  ? 406  ILE A O     1 
ATOM   3099  C  CB    . ILE A 1  406  ? 117.468 18.015  -18.566 1.00 81.83  ? 406  ILE A CB    1 
ATOM   3100  C  CG1   . ILE A 1  406  ? 116.418 18.520  -17.536 1.00 80.22  ? 406  ILE A CG1   1 
ATOM   3101  C  CG2   . ILE A 1  406  ? 117.083 18.395  -19.997 1.00 83.02  ? 406  ILE A CG2   1 
ATOM   3102  C  CD1   . ILE A 1  406  ? 116.407 20.053  -17.195 1.00 79.04  ? 406  ILE A CD1   1 
ATOM   3103  N  N     . ARG A 1  407  ? 118.208 15.029  -20.327 1.00 92.75  ? 407  ARG A N     1 
ATOM   3104  C  CA    . ARG A 1  407  ? 119.054 14.334  -21.280 1.00 96.83  ? 407  ARG A CA    1 
ATOM   3105  C  C     . ARG A 1  407  ? 119.652 15.228  -22.366 1.00 110.70 ? 407  ARG A C     1 
ATOM   3106  O  O     . ARG A 1  407  ? 119.262 16.396  -22.505 1.00 110.28 ? 407  ARG A O     1 
ATOM   3107  C  CB    . ARG A 1  407  ? 118.291 13.161  -21.885 1.00 95.49  ? 407  ARG A CB    1 
ATOM   3108  C  CG    . ARG A 1  407  ? 118.763 11.841  -21.318 1.00 99.10  ? 407  ARG A CG    1 
ATOM   3109  C  CD    . ARG A 1  407  ? 117.690 10.794  -21.166 1.00 109.02 ? 407  ARG A CD    1 
ATOM   3110  N  NE    . ARG A 1  407  ? 117.228 10.289  -22.456 1.00 127.08 ? 407  ARG A NE    1 
ATOM   3111  C  CZ    . ARG A 1  407  ? 116.103 10.670  -23.053 1.00 148.89 ? 407  ARG A CZ    1 
ATOM   3112  N  NH1   . ARG A 1  407  ? 115.301 11.560  -22.474 1.00 132.02 ? 407  ARG A NH1   1 
ATOM   3113  N  NH2   . ARG A 1  407  ? 115.771 10.167  -24.235 1.00 144.24 ? 407  ARG A NH2   1 
ATOM   3114  N  N     . ASP A 1  408  ? 120.646 14.674  -23.109 1.00 115.06 ? 408  ASP A N     1 
ATOM   3115  C  CA    . ASP A 1  408  ? 121.326 15.323  -24.243 1.00 118.06 ? 408  ASP A CA    1 
ATOM   3116  C  C     . ASP A 1  408  ? 120.286 15.570  -25.331 1.00 124.91 ? 408  ASP A C     1 
ATOM   3117  O  O     . ASP A 1  408  ? 120.240 16.665  -25.904 1.00 123.64 ? 408  ASP A O     1 
ATOM   3118  C  CB    . ASP A 1  408  ? 122.528 14.477  -24.778 1.00 122.72 ? 408  ASP A CB    1 
ATOM   3119  C  CG    . ASP A 1  408  ? 122.356 12.954  -24.972 1.00 143.53 ? 408  ASP A CG    1 
ATOM   3120  O  OD1   . ASP A 1  408  ? 121.201 12.447  -24.848 1.00 145.67 ? 408  ASP A OD1   1 
ATOM   3121  O  OD2   . ASP A 1  408  ? 123.377 12.269  -25.247 1.00 151.78 ? 408  ASP A OD2   1 
ATOM   3122  N  N     . SER A 1  409  ? 119.382 14.559  -25.519 1.00 124.46 ? 409  SER A N     1 
ATOM   3123  C  CA    . SER A 1  409  ? 118.250 14.514  -26.454 1.00 125.25 ? 409  SER A CA    1 
ATOM   3124  C  C     . SER A 1  409  ? 117.319 15.697  -26.242 1.00 129.38 ? 409  SER A C     1 
ATOM   3125  O  O     . SER A 1  409  ? 116.638 16.136  -27.176 1.00 129.43 ? 409  SER A O     1 
ATOM   3126  C  CB    . SER A 1  409  ? 117.462 13.212  -26.271 1.00 129.16 ? 409  SER A CB    1 
ATOM   3127  O  OG    . SER A 1  409  ? 116.428 13.313  -25.301 1.00 135.15 ? 409  SER A OG    1 
ATOM   3128  N  N     . GLY A 1  410  ? 117.306 16.188  -25.007 1.00 125.29 ? 410  GLY A N     1 
ATOM   3129  C  CA    . GLY A 1  410  ? 116.427 17.254  -24.579 1.00 123.79 ? 410  GLY A CA    1 
ATOM   3130  C  C     . GLY A 1  410  ? 115.085 16.611  -24.300 1.00 127.53 ? 410  GLY A C     1 
ATOM   3131  O  O     . GLY A 1  410  ? 114.258 16.479  -25.214 1.00 128.95 ? 410  GLY A O     1 
ATOM   3132  N  N     . ASP A 1  411  ? 114.927 16.082  -23.065 1.00 120.96 ? 411  ASP A N     1 
ATOM   3133  C  CA    . ASP A 1  411  ? 113.703 15.475  -22.525 1.00 118.99 ? 411  ASP A CA    1 
ATOM   3134  C  C     . ASP A 1  411  ? 113.817 15.285  -21.025 1.00 116.27 ? 411  ASP A C     1 
ATOM   3135  O  O     . ASP A 1  411  ? 114.807 14.706  -20.563 1.00 117.15 ? 411  ASP A O     1 
ATOM   3136  C  CB    . ASP A 1  411  ? 113.287 14.170  -23.228 1.00 122.57 ? 411  ASP A CB    1 
ATOM   3137  C  CG    . ASP A 1  411  ? 111.821 14.178  -23.637 1.00 135.17 ? 411  ASP A CG    1 
ATOM   3138  O  OD1   . ASP A 1  411  ? 110.955 14.551  -22.784 1.00 133.56 ? 411  ASP A OD1   1 
ATOM   3139  O  OD2   . ASP A 1  411  ? 111.535 13.851  -24.810 1.00 144.75 ? 411  ASP A OD2   1 
ATOM   3140  N  N     . ARG A 1  412  ? 112.816 15.789  -20.267 1.00 105.43 ? 412  ARG A N     1 
ATOM   3141  C  CA    . ARG A 1  412  ? 112.788 15.721  -18.802 1.00 101.44 ? 412  ARG A CA    1 
ATOM   3142  C  C     . ARG A 1  412  ? 112.418 14.333  -18.271 1.00 98.90  ? 412  ARG A C     1 
ATOM   3143  O  O     . ARG A 1  412  ? 111.520 13.680  -18.809 1.00 99.51  ? 412  ARG A O     1 
ATOM   3144  C  CB    . ARG A 1  412  ? 111.851 16.791  -18.223 1.00 98.80  ? 412  ARG A CB    1 
ATOM   3145  C  CG    . ARG A 1  412  ? 112.565 17.851  -17.404 1.00 102.83 ? 412  ARG A CG    1 
ATOM   3146  C  CD    . ARG A 1  412  ? 111.743 19.123  -17.376 1.00 110.51 ? 412  ARG A CD    1 
ATOM   3147  N  NE    . ARG A 1  412  ? 112.466 20.245  -16.772 1.00 117.22 ? 412  ARG A NE    1 
ATOM   3148  C  CZ    . ARG A 1  412  ? 112.229 21.526  -17.040 1.00 129.01 ? 412  ARG A CZ    1 
ATOM   3149  N  NH1   . ARG A 1  412  ? 111.305 21.867  -17.931 1.00 110.21 ? 412  ARG A NH1   1 
ATOM   3150  N  NH2   . ARG A 1  412  ? 112.930 22.476  -16.437 1.00 120.32 ? 412  ARG A NH2   1 
ATOM   3151  N  N     . ILE A 1  413  ? 113.125 13.897  -17.212 1.00 88.78  ? 413  ILE A N     1 
ATOM   3152  C  CA    . ILE A 1  413  ? 112.917 12.634  -16.524 1.00 86.33  ? 413  ILE A CA    1 
ATOM   3153  C  C     . ILE A 1  413  ? 112.430 13.011  -15.144 1.00 87.82  ? 413  ILE A C     1 
ATOM   3154  O  O     . ILE A 1  413  ? 113.169 13.632  -14.390 1.00 85.74  ? 413  ILE A O     1 
ATOM   3155  C  CB    . ILE A 1  413  ? 114.227 11.806  -16.470 1.00 89.16  ? 413  ILE A CB    1 
ATOM   3156  C  CG1   . ILE A 1  413  ? 114.699 11.422  -17.871 1.00 89.53  ? 413  ILE A CG1   1 
ATOM   3157  C  CG2   . ILE A 1  413  ? 114.081 10.572  -15.575 1.00 90.71  ? 413  ILE A CG2   1 
ATOM   3158  C  CD1   . ILE A 1  413  ? 116.100 11.059  -17.935 1.00 96.09  ? 413  ILE A CD1   1 
ATOM   3159  N  N     . ASP A 1  414  ? 111.177 12.677  -14.823 1.00 85.76  ? 414  ASP A N     1 
ATOM   3160  C  CA    . ASP A 1  414  ? 110.610 12.986  -13.508 1.00 85.39  ? 414  ASP A CA    1 
ATOM   3161  C  C     . ASP A 1  414  ? 110.969 11.875  -12.576 1.00 88.04  ? 414  ASP A C     1 
ATOM   3162  O  O     . ASP A 1  414  ? 110.344 10.815  -12.587 1.00 88.28  ? 414  ASP A O     1 
ATOM   3163  C  CB    . ASP A 1  414  ? 109.078 13.188  -13.551 1.00 87.69  ? 414  ASP A CB    1 
ATOM   3164  C  CG    . ASP A 1  414  ? 108.503 13.957  -12.369 1.00 95.93  ? 414  ASP A CG    1 
ATOM   3165  O  OD1   . ASP A 1  414  ? 109.076 13.861  -11.250 1.00 94.14  ? 414  ASP A OD1   1 
ATOM   3166  O  OD2   . ASP A 1  414  ? 107.485 14.659  -12.563 1.00 103.29 ? 414  ASP A OD2   1 
ATOM   3167  N  N     . LEU A 1  415  ? 111.972 12.123  -11.756 1.00 83.26  ? 415  LEU A N     1 
ATOM   3168  C  CA    . LEU A 1  415  ? 112.470 11.136  -10.813 1.00 83.65  ? 415  LEU A CA    1 
ATOM   3169  C  C     . LEU A 1  415  ? 111.395 10.672  -9.821  1.00 86.51  ? 415  LEU A C     1 
ATOM   3170  O  O     . LEU A 1  415  ? 111.467 9.559   -9.310  1.00 86.39  ? 415  LEU A O     1 
ATOM   3171  C  CB    . LEU A 1  415  ? 113.734 11.669  -10.127 1.00 83.17  ? 415  LEU A CB    1 
ATOM   3172  C  CG    . LEU A 1  415  ? 114.903 11.940  -11.085 1.00 86.96  ? 415  LEU A CG    1 
ATOM   3173  C  CD1   . LEU A 1  415  ? 115.905 12.889  -10.473 1.00 86.24  ? 415  LEU A CD1   1 
ATOM   3174  C  CD2   . LEU A 1  415  ? 115.547 10.649  -11.554 1.00 88.66  ? 415  LEU A CD2   1 
ATOM   3175  N  N     . ARG A 1  416  ? 110.354 11.487  -9.642  1.00 82.39  ? 416  ARG A N     1 
ATOM   3176  C  CA    . ARG A 1  416  ? 109.202 11.203  -8.791  1.00 82.55  ? 416  ARG A CA    1 
ATOM   3177  C  C     . ARG A 1  416  ? 108.361 10.035  -9.352  1.00 87.12  ? 416  ARG A C     1 
ATOM   3178  O  O     . ARG A 1  416  ? 107.687 9.345   -8.582  1.00 87.51  ? 416  ARG A O     1 
ATOM   3179  C  CB    . ARG A 1  416  ? 108.329 12.465  -8.735  1.00 82.40  ? 416  ARG A CB    1 
ATOM   3180  C  CG    . ARG A 1  416  ? 107.546 12.724  -7.442  1.00 95.49  ? 416  ARG A CG    1 
ATOM   3181  C  CD    . ARG A 1  416  ? 106.712 14.003  -7.564  1.00 106.06 ? 416  ARG A CD    1 
ATOM   3182  N  NE    . ARG A 1  416  ? 107.396 15.017  -8.378  1.00 112.27 ? 416  ARG A NE    1 
ATOM   3183  C  CZ    . ARG A 1  416  ? 106.815 15.802  -9.284  1.00 120.28 ? 416  ARG A CZ    1 
ATOM   3184  N  NH1   . ARG A 1  416  ? 105.502 15.742  -9.484  1.00 93.52  ? 416  ARG A NH1   1 
ATOM   3185  N  NH2   . ARG A 1  416  ? 107.539 16.672  -9.976  1.00 111.50 ? 416  ARG A NH2   1 
ATOM   3186  N  N     . TYR A 1  417  ? 108.377 9.836   -10.684 1.00 83.33  ? 417  TYR A N     1 
ATOM   3187  C  CA    . TYR A 1  417  ? 107.554 8.828   -11.336 1.00 84.13  ? 417  TYR A CA    1 
ATOM   3188  C  C     . TYR A 1  417  ? 108.316 7.839   -12.148 1.00 88.84  ? 417  TYR A C     1 
ATOM   3189  O  O     . TYR A 1  417  ? 108.048 6.648   -12.014 1.00 91.94  ? 417  TYR A O     1 
ATOM   3190  C  CB    . TYR A 1  417  ? 106.476 9.486   -12.194 1.00 85.78  ? 417  TYR A CB    1 
ATOM   3191  C  CG    . TYR A 1  417  ? 105.666 10.487  -11.412 1.00 89.05  ? 417  TYR A CG    1 
ATOM   3192  C  CD1   . TYR A 1  417  ? 104.681 10.071  -10.521 1.00 91.47  ? 417  TYR A CD1   1 
ATOM   3193  C  CD2   . TYR A 1  417  ? 105.946 11.846  -11.484 1.00 90.27  ? 417  TYR A CD2   1 
ATOM   3194  C  CE1   . TYR A 1  417  ? 103.965 10.986  -9.749  1.00 92.34  ? 417  TYR A CE1   1 
ATOM   3195  C  CE2   . TYR A 1  417  ? 105.237 12.773  -10.720 1.00 92.58  ? 417  TYR A CE2   1 
ATOM   3196  C  CZ    . TYR A 1  417  ? 104.246 12.339  -9.849  1.00 102.57 ? 417  TYR A CZ    1 
ATOM   3197  O  OH    . TYR A 1  417  ? 103.539 13.242  -9.079  1.00 106.05 ? 417  TYR A OH    1 
ATOM   3198  N  N     . SER A 1  418  ? 109.244 8.312   -13.005 1.00 82.61  ? 418  SER A N     1 
ATOM   3199  C  CA    . SER A 1  418  ? 110.084 7.519   -13.914 1.00 82.19  ? 418  SER A CA    1 
ATOM   3200  C  C     . SER A 1  418  ? 110.373 6.114   -13.440 1.00 84.92  ? 418  SER A C     1 
ATOM   3201  O  O     . SER A 1  418  ? 110.865 5.929   -12.327 1.00 84.82  ? 418  SER A O     1 
ATOM   3202  C  CB    . SER A 1  418  ? 111.395 8.241   -14.207 1.00 84.84  ? 418  SER A CB    1 
ATOM   3203  O  OG    . SER A 1  418  ? 112.191 7.494   -15.110 1.00 93.28  ? 418  SER A OG    1 
ATOM   3204  N  N     . LYS A 1  419  ? 110.061 5.120   -14.270 1.00 81.46  ? 419  LYS A N     1 
ATOM   3205  C  CA    . LYS A 1  419  ? 110.320 3.719   -13.922 1.00 82.60  ? 419  LYS A CA    1 
ATOM   3206  C  C     . LYS A 1  419  ? 111.837 3.463   -13.721 1.00 90.20  ? 419  LYS A C     1 
ATOM   3207  O  O     . LYS A 1  419  ? 112.218 2.614   -12.913 1.00 91.28  ? 419  LYS A O     1 
ATOM   3208  C  CB    . LYS A 1  419  ? 109.705 2.756   -14.957 1.00 84.03  ? 419  LYS A CB    1 
ATOM   3209  C  CG    . LYS A 1  419  ? 110.349 2.814   -16.340 1.00 74.09  ? 419  LYS A CG    1 
ATOM   3210  C  CD    . LYS A 1  419  ? 110.121 1.581   -17.170 1.00 79.50  ? 419  LYS A CD    1 
ATOM   3211  C  CE    . LYS A 1  419  ? 108.772 1.511   -17.828 1.00 88.51  ? 419  LYS A CE    1 
ATOM   3212  N  NZ    . LYS A 1  419  ? 108.695 2.395   -19.016 1.00 99.44  ? 419  LYS A NZ    1 
ATOM   3213  N  N     . ARG A 1  420  ? 112.686 4.249   -14.417 1.00 87.53  ? 420  ARG A N     1 
ATOM   3214  C  CA    . ARG A 1  420  ? 114.142 4.155   -14.367 1.00 87.84  ? 420  ARG A CA    1 
ATOM   3215  C  C     . ARG A 1  420  ? 114.771 5.108   -13.344 1.00 92.45  ? 420  ARG A C     1 
ATOM   3216  O  O     . ARG A 1  420  ? 115.987 5.251   -13.338 1.00 91.54  ? 420  ARG A O     1 
ATOM   3217  C  CB    . ARG A 1  420  ? 114.742 4.340   -15.782 1.00 85.24  ? 420  ARG A CB    1 
ATOM   3218  C  CG    . ARG A 1  420  ? 115.051 3.017   -16.489 1.00 83.72  ? 420  ARG A CG    1 
ATOM   3219  C  CD    . ARG A 1  420  ? 115.284 3.196   -17.970 1.00 77.59  ? 420  ARG A CD    1 
ATOM   3220  N  NE    . ARG A 1  420  ? 116.596 3.768   -18.261 1.00 87.17  ? 420  ARG A NE    1 
ATOM   3221  C  CZ    . ARG A 1  420  ? 117.694 3.060   -18.508 1.00 116.84 ? 420  ARG A CZ    1 
ATOM   3222  N  NH1   . ARG A 1  420  ? 117.655 1.732   -18.498 1.00 113.57 ? 420  ARG A NH1   1 
ATOM   3223  N  NH2   . ARG A 1  420  ? 118.843 3.674   -18.764 1.00 110.87 ? 420  ARG A NH2   1 
ATOM   3224  N  N     . ALA A 1  421  ? 113.965 5.701   -12.439 1.00 91.36  ? 421  ALA A N     1 
ATOM   3225  C  CA    . ALA A 1  421  ? 114.456 6.638   -11.414 1.00 92.33  ? 421  ALA A CA    1 
ATOM   3226  C  C     . ALA A 1  421  ? 115.553 6.038   -10.524 1.00 102.04 ? 421  ALA A C     1 
ATOM   3227  O  O     . ALA A 1  421  ? 116.419 6.767   -10.006 1.00 100.86 ? 421  ALA A O     1 
ATOM   3228  C  CB    . ALA A 1  421  ? 113.310 7.149   -10.562 1.00 92.18  ? 421  ALA A CB    1 
ATOM   3229  N  N     . GLY A 1  422  ? 115.498 4.714   -10.370 1.00 103.50 ? 422  GLY A N     1 
ATOM   3230  C  CA    . GLY A 1  422  ? 116.472 3.960   -9.595  1.00 105.83 ? 422  GLY A CA    1 
ATOM   3231  C  C     . GLY A 1  422  ? 117.775 3.810   -10.348 1.00 112.92 ? 422  GLY A C     1 
ATOM   3232  O  O     . GLY A 1  422  ? 118.858 3.882   -9.760  1.00 114.30 ? 422  GLY A O     1 
ATOM   3233  N  N     . ASP A 1  423  ? 117.660 3.626   -11.663 1.00 109.41 ? 423  ASP A N     1 
ATOM   3234  C  CA    . ASP A 1  423  ? 118.765 3.452   -12.585 1.00 109.89 ? 423  ASP A CA    1 
ATOM   3235  C  C     . ASP A 1  423  ? 119.469 4.811   -12.889 1.00 110.65 ? 423  ASP A C     1 
ATOM   3236  O  O     . ASP A 1  423  ? 119.988 5.467   -11.971 1.00 109.63 ? 423  ASP A O     1 
ATOM   3237  C  CB    . ASP A 1  423  ? 118.203 2.773   -13.841 1.00 113.29 ? 423  ASP A CB    1 
ATOM   3238  C  CG    . ASP A 1  423  ? 119.246 2.253   -14.784 1.00 131.84 ? 423  ASP A CG    1 
ATOM   3239  O  OD1   . ASP A 1  423  ? 119.726 1.116   -14.564 1.00 135.37 ? 423  ASP A OD1   1 
ATOM   3240  O  OD2   . ASP A 1  423  ? 119.581 2.976   -15.753 1.00 139.12 ? 423  ASP A OD2   1 
ATOM   3241  N  N     . ILE A 1  424  ? 119.430 5.238   -14.169 1.00 105.25 ? 424  ILE A N     1 
ATOM   3242  C  CA    . ILE A 1  424  ? 120.017 6.440   -14.775 1.00 103.25 ? 424  ILE A CA    1 
ATOM   3243  C  C     . ILE A 1  424  ? 121.514 6.462   -14.611 1.00 106.58 ? 424  ILE A C     1 
ATOM   3244  O  O     . ILE A 1  424  ? 122.047 6.711   -13.524 1.00 105.43 ? 424  ILE A O     1 
ATOM   3245  C  CB    . ILE A 1  424  ? 119.407 7.834   -14.428 1.00 103.75 ? 424  ILE A CB    1 
ATOM   3246  C  CG1   . ILE A 1  424  ? 117.935 7.784   -14.079 1.00 103.15 ? 424  ILE A CG1   1 
ATOM   3247  C  CG2   . ILE A 1  424  ? 119.646 8.820   -15.558 1.00 103.30 ? 424  ILE A CG2   1 
ATOM   3248  C  CD1   . ILE A 1  424  ? 117.757 7.938   -12.689 1.00 110.40 ? 424  ILE A CD1   1 
ATOM   3249  N  N     . GLN A 1  425  ? 122.184 6.221   -15.718 1.00 103.89 ? 425  GLN A N     1 
ATOM   3250  C  CA    . GLN A 1  425  ? 123.627 6.266   -15.773 1.00 104.62 ? 425  GLN A CA    1 
ATOM   3251  C  C     . GLN A 1  425  ? 123.876 7.563   -16.480 1.00 103.53 ? 425  GLN A C     1 
ATOM   3252  O  O     . GLN A 1  425  ? 123.667 7.669   -17.696 1.00 101.87 ? 425  GLN A O     1 
ATOM   3253  C  CB    . GLN A 1  425  ? 124.210 5.046   -16.525 1.00 109.25 ? 425  GLN A CB    1 
ATOM   3254  C  CG    . GLN A 1  425  ? 123.549 3.683   -16.210 1.00 142.82 ? 425  GLN A CG    1 
ATOM   3255  C  CD    . GLN A 1  425  ? 123.591 3.274   -14.749 1.00 174.46 ? 425  GLN A CD    1 
ATOM   3256  O  OE1   . GLN A 1  425  ? 122.655 3.531   -13.974 1.00 172.59 ? 425  GLN A OE1   1 
ATOM   3257  N  NE2   . GLN A 1  425  ? 124.655 2.586   -14.354 1.00 169.24 ? 425  GLN A NE2   1 
ATOM   3258  N  N     . LEU A 1  426  ? 124.187 8.588   -15.675 1.00 97.97  ? 426  LEU A N     1 
ATOM   3259  C  CA    . LEU A 1  426  ? 124.391 9.970   -16.111 1.00 96.22  ? 426  LEU A CA    1 
ATOM   3260  C  C     . LEU A 1  426  ? 125.513 10.165  -17.125 1.00 101.88 ? 426  LEU A C     1 
ATOM   3261  O  O     . LEU A 1  426  ? 126.670 9.920   -16.798 1.00 104.27 ? 426  LEU A O     1 
ATOM   3262  C  CB    . LEU A 1  426  ? 124.610 10.895  -14.904 1.00 94.47  ? 426  LEU A CB    1 
ATOM   3263  C  CG    . LEU A 1  426  ? 123.388 11.240  -14.084 1.00 96.92  ? 426  LEU A CG    1 
ATOM   3264  C  CD1   . LEU A 1  426  ? 123.787 11.915  -12.792 1.00 96.14  ? 426  LEU A CD1   1 
ATOM   3265  C  CD2   . LEU A 1  426  ? 122.414 12.103  -14.873 1.00 96.85  ? 426  LEU A CD2   1 
ATOM   3266  N  N     . GLN A 1  427  ? 125.180 10.597  -18.352 1.00 95.92  ? 427  GLN A N     1 
ATOM   3267  C  CA    . GLN A 1  427  ? 126.189 10.881  -19.366 1.00 95.14  ? 427  GLN A CA    1 
ATOM   3268  C  C     . GLN A 1  427  ? 126.566 12.336  -19.148 1.00 94.72  ? 427  GLN A C     1 
ATOM   3269  O  O     . GLN A 1  427  ? 125.765 13.087  -18.596 1.00 91.95  ? 427  GLN A O     1 
ATOM   3270  C  CB    . GLN A 1  427  ? 125.621 10.683  -20.780 1.00 97.08  ? 427  GLN A CB    1 
ATOM   3271  C  CG    . GLN A 1  427  ? 125.450 9.222   -21.211 1.00 122.85 ? 427  GLN A CG    1 
ATOM   3272  C  CD    . GLN A 1  427  ? 124.448 9.035   -22.347 1.00 153.64 ? 427  GLN A CD    1 
ATOM   3273  O  OE1   . GLN A 1  427  ? 124.321 9.855   -23.276 1.00 149.55 ? 427  GLN A OE1   1 
ATOM   3274  N  NE2   . GLN A 1  427  ? 123.685 7.949   -22.285 1.00 150.10 ? 427  GLN A NE2   1 
ATOM   3275  N  N     . TYR A 1  428  ? 127.770 12.743  -19.567 1.00 91.11  ? 428  TYR A N     1 
ATOM   3276  C  CA    . TYR A 1  428  ? 128.200 14.132  -19.429 1.00 89.34  ? 428  TYR A CA    1 
ATOM   3277  C  C     . TYR A 1  428  ? 127.348 14.987  -20.320 1.00 91.33  ? 428  TYR A C     1 
ATOM   3278  O  O     . TYR A 1  428  ? 126.753 14.486  -21.264 1.00 90.87  ? 428  TYR A O     1 
ATOM   3279  C  CB    . TYR A 1  428  ? 129.657 14.300  -19.851 1.00 91.96  ? 428  TYR A CB    1 
ATOM   3280  C  CG    . TYR A 1  428  ? 130.634 13.478  -19.051 1.00 95.68  ? 428  TYR A CG    1 
ATOM   3281  C  CD1   . TYR A 1  428  ? 131.050 13.888  -17.789 1.00 96.00  ? 428  TYR A CD1   1 
ATOM   3282  C  CD2   . TYR A 1  428  ? 131.146 12.288  -19.552 1.00 99.95  ? 428  TYR A CD2   1 
ATOM   3283  C  CE1   . TYR A 1  428  ? 131.938 13.121  -17.037 1.00 98.14  ? 428  TYR A CE1   1 
ATOM   3284  C  CE2   . TYR A 1  428  ? 132.056 11.526  -18.819 1.00 102.80 ? 428  TYR A CE2   1 
ATOM   3285  C  CZ    . TYR A 1  428  ? 132.474 11.962  -17.572 1.00 107.15 ? 428  TYR A CZ    1 
ATOM   3286  O  OH    . TYR A 1  428  ? 133.377 11.218  -16.845 1.00 107.38 ? 428  TYR A OH    1 
ATOM   3287  N  N     . GLY A 1  429  ? 127.278 16.268  -20.024 1.00 87.94  ? 429  GLY A N     1 
ATOM   3288  C  CA    . GLY A 1  429  ? 126.487 17.188  -20.838 1.00 87.44  ? 429  GLY A CA    1 
ATOM   3289  C  C     . GLY A 1  429  ? 124.999 17.206  -20.532 1.00 88.53  ? 429  GLY A C     1 
ATOM   3290  O  O     . GLY A 1  429  ? 124.242 18.036  -21.059 1.00 87.63  ? 429  GLY A O     1 
ATOM   3291  N  N     . TRP A 1  430  ? 124.576 16.296  -19.671 1.00 82.27  ? 430  TRP A N     1 
ATOM   3292  C  CA    . TRP A 1  430  ? 123.211 16.252  -19.230 1.00 79.77  ? 430  TRP A CA    1 
ATOM   3293  C  C     . TRP A 1  430  ? 123.091 17.268  -18.129 1.00 81.76  ? 430  TRP A C     1 
ATOM   3294  O  O     . TRP A 1  430  ? 124.090 17.789  -17.639 1.00 80.04  ? 430  TRP A O     1 
ATOM   3295  C  CB    . TRP A 1  430  ? 122.913 14.871  -18.687 1.00 78.78  ? 430  TRP A CB    1 
ATOM   3296  C  CG    . TRP A 1  430  ? 122.791 13.813  -19.736 1.00 80.76  ? 430  TRP A CG    1 
ATOM   3297  C  CD1   . TRP A 1  430  ? 123.202 13.881  -21.033 1.00 84.35  ? 430  TRP A CD1   1 
ATOM   3298  C  CD2   . TRP A 1  430  ? 122.222 12.511  -19.561 1.00 81.31  ? 430  TRP A CD2   1 
ATOM   3299  N  NE1   . TRP A 1  430  ? 122.911 12.704  -21.681 1.00 85.02  ? 430  TRP A NE1   1 
ATOM   3300  C  CE2   . TRP A 1  430  ? 122.280 11.859  -20.808 1.00 86.28  ? 430  TRP A CE2   1 
ATOM   3301  C  CE3   . TRP A 1  430  ? 121.631 11.845  -18.476 1.00 82.29  ? 430  TRP A CE3   1 
ATOM   3302  C  CZ2   . TRP A 1  430  ? 121.777 10.575  -20.998 1.00 86.72  ? 430  TRP A CZ2   1 
ATOM   3303  C  CZ3   . TRP A 1  430  ? 121.114 10.582  -18.671 1.00 84.77  ? 430  TRP A CZ3   1 
ATOM   3304  C  CH2   . TRP A 1  430  ? 121.207 9.951   -19.914 1.00 86.76  ? 430  TRP A CH2   1 
ATOM   3305  N  N     . LYS A 1  431  ? 121.872 17.587  -17.768 1.00 78.84  ? 431  LYS A N     1 
ATOM   3306  C  CA    . LYS A 1  431  ? 121.629 18.524  -16.691 1.00 77.86  ? 431  LYS A CA    1 
ATOM   3307  C  C     . LYS A 1  431  ? 120.888 17.763  -15.585 1.00 80.82  ? 431  LYS A C     1 
ATOM   3308  O  O     . LYS A 1  431  ? 120.108 16.857  -15.865 1.00 81.21  ? 431  LYS A O     1 
ATOM   3309  C  CB    . LYS A 1  431  ? 120.830 19.769  -17.166 1.00 79.48  ? 431  LYS A CB    1 
ATOM   3310  C  CG    . LYS A 1  431  ? 121.589 20.771  -18.053 1.00 95.14  ? 431  LYS A CG    1 
ATOM   3311  C  CD    . LYS A 1  431  ? 121.047 20.829  -19.508 1.00 114.33 ? 431  LYS A CD    1 
ATOM   3312  C  CE    . LYS A 1  431  ? 121.546 19.678  -20.390 1.00 134.37 ? 431  LYS A CE    1 
ATOM   3313  N  NZ    . LYS A 1  431  ? 120.817 19.521  -21.690 1.00 141.65 ? 431  LYS A NZ    1 
ATOM   3314  N  N     . VAL A 1  432  ? 121.188 18.088  -14.334 1.00 75.03  ? 432  VAL A N     1 
ATOM   3315  C  CA    . VAL A 1  432  ? 120.509 17.534  -13.185 1.00 73.19  ? 432  VAL A CA    1 
ATOM   3316  C  C     . VAL A 1  432  ? 119.942 18.719  -12.400 1.00 80.56  ? 432  VAL A C     1 
ATOM   3317  O  O     . VAL A 1  432  ? 120.697 19.506  -11.807 1.00 81.31  ? 432  VAL A O     1 
ATOM   3318  C  CB    . VAL A 1  432  ? 121.411 16.651  -12.338 1.00 75.04  ? 432  VAL A CB    1 
ATOM   3319  C  CG1   . VAL A 1  432  ? 120.688 16.225  -11.086 1.00 73.88  ? 432  VAL A CG1   1 
ATOM   3320  C  CG2   . VAL A 1  432  ? 121.842 15.445  -13.127 1.00 76.08  ? 432  VAL A CG2   1 
ATOM   3321  N  N     . GLU A 1  433  ? 118.609 18.890  -12.471 1.00 76.98  ? 433  GLU A N     1 
ATOM   3322  C  CA    . GLU A 1  433  ? 117.885 19.920  -11.738 1.00 75.26  ? 433  GLU A CA    1 
ATOM   3323  C  C     . GLU A 1  433  ? 117.886 19.396  -10.300 1.00 80.59  ? 433  GLU A C     1 
ATOM   3324  O  O     . GLU A 1  433  ? 117.236 18.388  -10.001 1.00 81.64  ? 433  GLU A O     1 
ATOM   3325  C  CB    . GLU A 1  433  ? 116.468 20.057  -12.301 1.00 75.95  ? 433  GLU A CB    1 
ATOM   3326  C  CG    . GLU A 1  433  ? 116.440 20.740  -13.653 1.00 88.04  ? 433  GLU A CG    1 
ATOM   3327  C  CD    . GLU A 1  433  ? 115.300 21.715  -13.851 1.00 118.33 ? 433  GLU A CD    1 
ATOM   3328  O  OE1   . GLU A 1  433  ? 114.129 21.268  -13.836 1.00 114.40 ? 433  GLU A OE1   1 
ATOM   3329  O  OE2   . GLU A 1  433  ? 115.575 22.932  -13.977 1.00 114.62 ? 433  GLU A OE2   1 
ATOM   3330  N  N     . ARG A 1  434  ? 118.732 19.975  -9.449  1.00 76.80  ? 434  ARG A N     1 
ATOM   3331  C  CA    . ARG A 1  434  ? 118.870 19.478  -8.076  1.00 76.90  ? 434  ARG A CA    1 
ATOM   3332  C  C     . ARG A 1  434  ? 118.362 20.432  -7.010  1.00 79.55  ? 434  ARG A C     1 
ATOM   3333  O  O     . ARG A 1  434  ? 118.371 21.651  -7.215  1.00 78.67  ? 434  ARG A O     1 
ATOM   3334  C  CB    . ARG A 1  434  ? 120.326 19.071  -7.780  1.00 77.52  ? 434  ARG A CB    1 
ATOM   3335  C  CG    . ARG A 1  434  ? 121.366 20.134  -8.154  1.00 81.62  ? 434  ARG A CG    1 
ATOM   3336  C  CD    . ARG A 1  434  ? 122.437 20.253  -7.106  1.00 79.88  ? 434  ARG A CD    1 
ATOM   3337  N  NE    . ARG A 1  434  ? 122.389 21.568  -6.482  1.00 80.99  ? 434  ARG A NE    1 
ATOM   3338  C  CZ    . ARG A 1  434  ? 123.304 22.511  -6.656  1.00 90.19  ? 434  ARG A CZ    1 
ATOM   3339  N  NH1   . ARG A 1  434  ? 124.363 22.284  -7.420  1.00 85.69  ? 434  ARG A NH1   1 
ATOM   3340  N  NH2   . ARG A 1  434  ? 123.188 23.674  -6.043  1.00 64.33  ? 434  ARG A NH2   1 
ATOM   3341  N  N     . HIS A 1  435  ? 117.974 19.883  -5.845  1.00 75.22  ? 435  HIS A N     1 
ATOM   3342  C  CA    . HIS A 1  435  ? 117.539 20.710  -4.738  1.00 74.54  ? 435  HIS A CA    1 
ATOM   3343  C  C     . HIS A 1  435  ? 118.651 21.718  -4.434  1.00 79.63  ? 435  HIS A C     1 
ATOM   3344  O  O     . HIS A 1  435  ? 119.838 21.413  -4.593  1.00 78.93  ? 435  HIS A O     1 
ATOM   3345  C  CB    . HIS A 1  435  ? 117.282 19.876  -3.467  1.00 75.72  ? 435  HIS A CB    1 
ATOM   3346  C  CG    . HIS A 1  435  ? 116.217 18.830  -3.569  1.00 79.56  ? 435  HIS A CG    1 
ATOM   3347  N  ND1   . HIS A 1  435  ? 114.953 19.120  -4.025  1.00 81.07  ? 435  HIS A ND1   1 
ATOM   3348  C  CD2   . HIS A 1  435  ? 116.251 17.534  -3.190  1.00 82.37  ? 435  HIS A CD2   1 
ATOM   3349  C  CE1   . HIS A 1  435  ? 114.273 17.984  -3.953  1.00 81.17  ? 435  HIS A CE1   1 
ATOM   3350  N  NE2   . HIS A 1  435  ? 115.016 17.007  -3.449  1.00 82.35  ? 435  HIS A NE2   1 
ATOM   3351  N  N     . ILE A 1  436  ? 118.246 22.925  -4.014  1.00 77.16  ? 436  ILE A N     1 
ATOM   3352  C  CA    . ILE A 1  436  ? 119.102 24.021  -3.564  1.00 76.97  ? 436  ILE A CA    1 
ATOM   3353  C  C     . ILE A 1  436  ? 119.932 23.441  -2.424  1.00 84.37  ? 436  ILE A C     1 
ATOM   3354  O  O     . ILE A 1  436  ? 119.409 22.662  -1.617  1.00 85.80  ? 436  ILE A O     1 
ATOM   3355  C  CB    . ILE A 1  436  ? 118.185 25.165  -3.016  1.00 78.95  ? 436  ILE A CB    1 
ATOM   3356  C  CG1   . ILE A 1  436  ? 117.083 25.518  -3.966  1.00 78.69  ? 436  ILE A CG1   1 
ATOM   3357  C  CG2   . ILE A 1  436  ? 118.960 26.411  -2.641  1.00 80.12  ? 436  ILE A CG2   1 
ATOM   3358  C  CD1   . ILE A 1  436  ? 117.606 25.863  -5.366  1.00 91.92  ? 436  ILE A CD1   1 
ATOM   3359  N  N     . MET A 1  437  ? 121.203 23.780  -2.349  1.00 81.88  ? 437  MET A N     1 
ATOM   3360  C  CA    . MET A 1  437  ? 122.011 23.281  -1.252  1.00 83.24  ? 437  MET A CA    1 
ATOM   3361  C  C     . MET A 1  437  ? 122.703 24.402  -0.512  1.00 83.55  ? 437  MET A C     1 
ATOM   3362  O  O     . MET A 1  437  ? 122.713 25.543  -0.980  1.00 81.85  ? 437  MET A O     1 
ATOM   3363  C  CB    . MET A 1  437  ? 122.974 22.204  -1.736  1.00 88.10  ? 437  MET A CB    1 
ATOM   3364  C  CG    . MET A 1  437  ? 122.242 20.938  -2.205  1.00 94.71  ? 437  MET A CG    1 
ATOM   3365  S  SD    . MET A 1  437  ? 123.220 19.618  -3.003  1.00 102.65 ? 437  MET A SD    1 
ATOM   3366  C  CE    . MET A 1  437  ? 124.527 20.636  -3.904  1.00 99.56  ? 437  MET A CE    1 
ATOM   3367  N  N     . ASP A 1  438  ? 123.248 24.099  0.671   1.00 79.53  ? 438  ASP A N     1 
ATOM   3368  C  CA    . ASP A 1  438  ? 123.963 25.089  1.467   1.00 78.74  ? 438  ASP A CA    1 
ATOM   3369  C  C     . ASP A 1  438  ? 125.026 25.709  0.565   1.00 81.33  ? 438  ASP A C     1 
ATOM   3370  O  O     . ASP A 1  438  ? 125.649 25.032  -0.261  1.00 81.25  ? 438  ASP A O     1 
ATOM   3371  C  CB    . ASP A 1  438  ? 124.614 24.470  2.732   1.00 81.78  ? 438  ASP A CB    1 
ATOM   3372  C  CG    . ASP A 1  438  ? 123.713 24.147  3.937   1.00 98.16  ? 438  ASP A CG    1 
ATOM   3373  O  OD1   . ASP A 1  438  ? 122.890 23.194  3.840   1.00 100.14 ? 438  ASP A OD1   1 
ATOM   3374  O  OD2   . ASP A 1  438  ? 123.949 24.720  5.022   1.00 104.62 ? 438  ASP A OD2   1 
ATOM   3375  N  N     . ASN A 1  439  ? 125.107 27.025  0.647   1.00 77.21  ? 439  ASN A N     1 
ATOM   3376  C  CA    . ASN A 1  439  ? 126.044 27.940  0.000   1.00 76.43  ? 439  ASN A CA    1 
ATOM   3377  C  C     . ASN A 1  439  ? 125.747 28.245  -1.467  1.00 79.79  ? 439  ASN A C     1 
ATOM   3378  O  O     . ASN A 1  439  ? 126.579 28.862  -2.139  1.00 80.55  ? 439  ASN A O     1 
ATOM   3379  C  CB    . ASN A 1  439  ? 127.484 27.521  0.214   1.00 71.90  ? 439  ASN A CB    1 
ATOM   3380  C  CG    . ASN A 1  439  ? 127.893 27.782  1.643   1.00 88.11  ? 439  ASN A CG    1 
ATOM   3381  O  OD1   . ASN A 1  439  ? 127.257 28.554  2.405   1.00 71.93  ? 439  ASN A OD1   1 
ATOM   3382  N  ND2   . ASN A 1  439  ? 128.946 27.117  2.051   1.00 88.92  ? 439  ASN A ND2   1 
ATOM   3383  N  N     . ASP A 1  440  ? 124.519 28.003  -1.911  1.00 74.44  ? 440  ASP A N     1 
ATOM   3384  C  CA    . ASP A 1  440  ? 124.187 28.445  -3.251  1.00 73.47  ? 440  ASP A CA    1 
ATOM   3385  C  C     . ASP A 1  440  ? 123.844 29.941  -3.202  1.00 74.20  ? 440  ASP A C     1 
ATOM   3386  O  O     . ASP A 1  440  ? 123.178 30.379  -2.256  1.00 73.89  ? 440  ASP A O     1 
ATOM   3387  C  CB    . ASP A 1  440  ? 123.007 27.667  -3.822  1.00 75.45  ? 440  ASP A CB    1 
ATOM   3388  C  CG    . ASP A 1  440  ? 123.292 26.210  -4.077  1.00 96.08  ? 440  ASP A CG    1 
ATOM   3389  O  OD1   . ASP A 1  440  ? 124.495 25.835  -4.139  1.00 98.74  ? 440  ASP A OD1   1 
ATOM   3390  O  OD2   . ASP A 1  440  ? 122.319 25.437  -4.216  1.00 105.85 ? 440  ASP A OD2   1 
ATOM   3391  N  N     . PRO A 1  441  ? 124.286 30.747  -4.192  1.00 67.49  ? 441  PRO A N     1 
ATOM   3392  C  CA    . PRO A 1  441  ? 123.882 32.150  -4.210  1.00 65.71  ? 441  PRO A CA    1 
ATOM   3393  C  C     . PRO A 1  441  ? 122.387 32.266  -4.516  1.00 66.46  ? 441  PRO A C     1 
ATOM   3394  O  O     . PRO A 1  441  ? 121.869 31.582  -5.400  1.00 66.53  ? 441  PRO A O     1 
ATOM   3395  C  CB    . PRO A 1  441  ? 124.719 32.756  -5.355  1.00 67.67  ? 441  PRO A CB    1 
ATOM   3396  C  CG    . PRO A 1  441  ? 125.678 31.719  -5.765  1.00 73.09  ? 441  PRO A CG    1 
ATOM   3397  C  CD    . PRO A 1  441  ? 125.060 30.416  -5.401  1.00 69.04  ? 441  PRO A CD    1 
ATOM   3398  N  N     . VAL A 1  442  ? 121.693 33.097  -3.752  1.00 59.93  ? 442  VAL A N     1 
ATOM   3399  C  CA    . VAL A 1  442  ? 120.287 33.401  -3.959  1.00 58.05  ? 442  VAL A CA    1 
ATOM   3400  C  C     . VAL A 1  442  ? 120.070 34.912  -3.760  1.00 64.72  ? 442  VAL A C     1 
ATOM   3401  O  O     . VAL A 1  442  ? 120.777 35.545  -2.973  1.00 63.98  ? 442  VAL A O     1 
ATOM   3402  C  CB    . VAL A 1  442  ? 119.348 32.550  -3.097  1.00 59.55  ? 442  VAL A CB    1 
ATOM   3403  C  CG1   . VAL A 1  442  ? 119.411 31.094  -3.507  1.00 58.65  ? 442  VAL A CG1   1 
ATOM   3404  C  CG2   . VAL A 1  442  ? 119.679 32.704  -1.631  1.00 59.70  ? 442  VAL A CG2   1 
ATOM   3405  N  N     . LEU A 1  443  ? 119.130 35.491  -4.518  1.00 63.03  ? 443  LEU A N     1 
ATOM   3406  C  CA    . LEU A 1  443  ? 118.762 36.903  -4.434  1.00 62.65  ? 443  LEU A CA    1 
ATOM   3407  C  C     . LEU A 1  443  ? 117.581 36.960  -3.484  1.00 67.70  ? 443  LEU A C     1 
ATOM   3408  O  O     . LEU A 1  443  ? 116.560 36.301  -3.692  1.00 66.47  ? 443  LEU A O     1 
ATOM   3409  C  CB    . LEU A 1  443  ? 118.406 37.463  -5.827  1.00 61.94  ? 443  LEU A CB    1 
ATOM   3410  C  CG    . LEU A 1  443  ? 118.317 38.983  -6.015  1.00 65.74  ? 443  LEU A CG    1 
ATOM   3411  C  CD1   . LEU A 1  443  ? 116.934 39.486  -5.734  1.00 65.60  ? 443  LEU A CD1   1 
ATOM   3412  C  CD2   . LEU A 1  443  ? 119.394 39.751  -5.244  1.00 66.96  ? 443  LEU A CD2   1 
ATOM   3413  N  N     . PHE A 1  444  ? 117.766 37.678  -2.397  1.00 66.39  ? 444  PHE A N     1 
ATOM   3414  C  CA    . PHE A 1  444  ? 116.773 37.786  -1.348  1.00 67.39  ? 444  PHE A CA    1 
ATOM   3415  C  C     . PHE A 1  444  ? 116.285 39.194  -1.319  1.00 72.91  ? 444  PHE A C     1 
ATOM   3416  O  O     . PHE A 1  444  ? 117.099 40.118  -1.406  1.00 74.18  ? 444  PHE A O     1 
ATOM   3417  C  CB    . PHE A 1  444  ? 117.435 37.453  -0.017  1.00 70.08  ? 444  PHE A CB    1 
ATOM   3418  C  CG    . PHE A 1  444  ? 116.535 37.151  1.153   1.00 71.92  ? 444  PHE A CG    1 
ATOM   3419  C  CD1   . PHE A 1  444  ? 115.535 36.185  1.052   1.00 74.89  ? 444  PHE A CD1   1 
ATOM   3420  C  CD2   . PHE A 1  444  ? 116.769 37.736  2.395   1.00 74.28  ? 444  PHE A CD2   1 
ATOM   3421  C  CE1   . PHE A 1  444  ? 114.746 35.858  2.155   1.00 76.18  ? 444  PHE A CE1   1 
ATOM   3422  C  CE2   . PHE A 1  444  ? 115.991 37.400  3.501   1.00 77.46  ? 444  PHE A CE2   1 
ATOM   3423  C  CZ    . PHE A 1  444  ? 114.979 36.469  3.371   1.00 75.76  ? 444  PHE A CZ    1 
ATOM   3424  N  N     . ASN A 1  445  ? 114.970 39.385  -1.186  1.00 68.44  ? 445  ASN A N     1 
ATOM   3425  C  CA    . ASN A 1  445  ? 114.449 40.737  -1.196  1.00 68.29  ? 445  ASN A CA    1 
ATOM   3426  C  C     . ASN A 1  445  ? 113.247 40.895  -0.334  1.00 71.35  ? 445  ASN A C     1 
ATOM   3427  O  O     . ASN A 1  445  ? 112.586 39.913  -0.023  1.00 70.33  ? 445  ASN A O     1 
ATOM   3428  C  CB    . ASN A 1  445  ? 114.199 41.196  -2.648  1.00 70.62  ? 445  ASN A CB    1 
ATOM   3429  C  CG    . ASN A 1  445  ? 112.838 41.755  -2.994  1.00 95.97  ? 445  ASN A CG    1 
ATOM   3430  O  OD1   . ASN A 1  445  ? 111.870 41.010  -3.198  1.00 91.86  ? 445  ASN A OD1   1 
ATOM   3431  N  ND2   . ASN A 1  445  ? 112.769 43.073  -3.166  1.00 86.42  ? 445  ASN A ND2   1 
ATOM   3432  N  N     . ARG A 1  446  ? 112.973 42.153  0.045   1.00 69.02  ? 446  ARG A N     1 
ATOM   3433  C  CA    . ARG A 1  446  ? 111.826 42.581  0.828   1.00 69.36  ? 446  ARG A CA    1 
ATOM   3434  C  C     . ARG A 1  446  ? 111.208 43.788  0.151   1.00 74.89  ? 446  ARG A C     1 
ATOM   3435  O  O     . ARG A 1  446  ? 111.900 44.789  -0.080  1.00 74.43  ? 446  ARG A O     1 
ATOM   3436  C  CB    . ARG A 1  446  ? 112.252 42.962  2.245   1.00 68.99  ? 446  ARG A CB    1 
ATOM   3437  C  CG    . ARG A 1  446  ? 111.077 43.153  3.186   1.00 75.05  ? 446  ARG A CG    1 
ATOM   3438  C  CD    . ARG A 1  446  ? 111.406 44.138  4.286   1.00 79.19  ? 446  ARG A CD    1 
ATOM   3439  N  NE    . ARG A 1  446  ? 110.221 44.511  5.056   1.00 84.97  ? 446  ARG A NE    1 
ATOM   3440  C  CZ    . ARG A 1  446  ? 109.559 45.650  4.899   1.00 102.17 ? 446  ARG A CZ    1 
ATOM   3441  N  NH1   . ARG A 1  446  ? 109.980 46.557  4.023   1.00 95.01  ? 446  ARG A NH1   1 
ATOM   3442  N  NH2   . ARG A 1  446  ? 108.488 45.908  5.637   1.00 88.86  ? 446  ARG A NH2   1 
ATOM   3443  N  N     . GLN A 1  447  ? 109.900 43.694  -0.144  1.00 73.06  ? 447  GLN A N     1 
ATOM   3444  C  CA    . GLN A 1  447  ? 109.110 44.771  -0.752  1.00 73.93  ? 447  GLN A CA    1 
ATOM   3445  C  C     . GLN A 1  447  ? 108.631 45.757  0.325   1.00 80.45  ? 447  GLN A C     1 
ATOM   3446  O  O     . GLN A 1  447  ? 108.325 45.298  1.432   1.00 83.05  ? 447  GLN A O     1 
ATOM   3447  C  CB    . GLN A 1  447  ? 107.907 44.199  -1.490  1.00 74.79  ? 447  GLN A CB    1 
ATOM   3448  C  CG    . GLN A 1  447  ? 108.293 43.537  -2.784  1.00 86.67  ? 447  GLN A CG    1 
ATOM   3449  C  CD    . GLN A 1  447  ? 108.066 42.065  -2.730  1.00 106.92 ? 447  GLN A CD    1 
ATOM   3450  O  OE1   . GLN A 1  447  ? 107.817 41.485  -1.654  1.00 104.63 ? 447  GLN A OE1   1 
ATOM   3451  N  NE2   . GLN A 1  447  ? 108.063 41.449  -3.913  1.00 96.76  ? 447  GLN A NE2   1 
ATOM   3452  N  N     . PRO A 1  448  ? 108.509 47.081  0.056   1.00 75.08  ? 448  PRO A N     1 
ATOM   3453  C  CA    . PRO A 1  448  ? 108.776 47.774  -1.205  1.00 74.54  ? 448  PRO A CA    1 
ATOM   3454  C  C     . PRO A 1  448  ? 110.259 47.938  -1.429  1.00 77.74  ? 448  PRO A C     1 
ATOM   3455  O  O     . PRO A 1  448  ? 110.999 48.255  -0.498  1.00 78.41  ? 448  PRO A O     1 
ATOM   3456  C  CB    . PRO A 1  448  ? 107.957 49.062  -1.072  1.00 77.14  ? 448  PRO A CB    1 
ATOM   3457  C  CG    . PRO A 1  448  ? 107.912 49.337  0.390   1.00 81.83  ? 448  PRO A CG    1 
ATOM   3458  C  CD    . PRO A 1  448  ? 108.054 48.021  1.100   1.00 76.89  ? 448  PRO A CD    1 
ATOM   3459  N  N     . SER A 1  449  ? 110.691 47.642  -2.648  1.00 72.88  ? 449  SER A N     1 
ATOM   3460  C  CA    . SER A 1  449  ? 112.100 47.646  -2.997  1.00 72.78  ? 449  SER A CA    1 
ATOM   3461  C  C     . SER A 1  449  ? 112.603 49.019  -3.500  1.00 78.61  ? 449  SER A C     1 
ATOM   3462  O  O     . SER A 1  449  ? 112.848 49.216  -4.702  1.00 78.41  ? 449  SER A O     1 
ATOM   3463  C  CB    . SER A 1  449  ? 112.397 46.513  -3.976  1.00 74.58  ? 449  SER A CB    1 
ATOM   3464  O  OG    . SER A 1  449  ? 111.328 45.581  -4.013  1.00 79.31  ? 449  SER A OG    1 
ATOM   3465  N  N     . LEU A 1  450  ? 112.789 49.958  -2.563  1.00 77.09  ? 450  LEU A N     1 
ATOM   3466  C  CA    . LEU A 1  450  ? 113.241 51.333  -2.878  1.00 79.21  ? 450  LEU A CA    1 
ATOM   3467  C  C     . LEU A 1  450  ? 114.783 51.555  -2.820  1.00 87.42  ? 450  LEU A C     1 
ATOM   3468  O  O     . LEU A 1  450  ? 115.263 52.692  -2.821  1.00 87.73  ? 450  LEU A O     1 
ATOM   3469  C  CB    . LEU A 1  450  ? 112.518 52.368  -1.984  1.00 79.78  ? 450  LEU A CB    1 
ATOM   3470  C  CG    . LEU A 1  450  ? 112.001 51.892  -0.642  1.00 83.36  ? 450  LEU A CG    1 
ATOM   3471  C  CD1   . LEU A 1  450  ? 112.222 52.922  0.411   1.00 84.31  ? 450  LEU A CD1   1 
ATOM   3472  C  CD2   . LEU A 1  450  ? 110.556 51.609  -0.723  1.00 84.90  ? 450  LEU A CD2   1 
ATOM   3473  N  N     . HIS A 1  451  ? 115.539 50.465  -2.838  1.00 85.71  ? 451  HIS A N     1 
ATOM   3474  C  CA    . HIS A 1  451  ? 116.972 50.478  -2.679  1.00 86.44  ? 451  HIS A CA    1 
ATOM   3475  C  C     . HIS A 1  451  ? 117.685 49.508  -3.559  1.00 90.26  ? 451  HIS A C     1 
ATOM   3476  O  O     . HIS A 1  451  ? 117.173 48.407  -3.804  1.00 90.04  ? 451  HIS A O     1 
ATOM   3477  C  CB    . HIS A 1  451  ? 117.220 49.933  -1.294  1.00 88.00  ? 451  HIS A CB    1 
ATOM   3478  C  CG    . HIS A 1  451  ? 117.718 50.918  -0.341  1.00 93.48  ? 451  HIS A CG    1 
ATOM   3479  N  ND1   . HIS A 1  451  ? 117.721 50.649  1.006   1.00 96.24  ? 451  HIS A ND1   1 
ATOM   3480  C  CD2   . HIS A 1  451  ? 118.238 52.144  -0.561  1.00 97.54  ? 451  HIS A CD2   1 
ATOM   3481  C  CE1   . HIS A 1  451  ? 118.234 51.723  1.577   1.00 97.71  ? 451  HIS A CE1   1 
ATOM   3482  N  NE2   . HIS A 1  451  ? 118.562 52.653  0.670   1.00 98.67  ? 451  HIS A NE2   1 
ATOM   3483  N  N     . LYS A 1  452  ? 118.963 49.818  -3.855  1.00 85.63  ? 452  LYS A N     1 
ATOM   3484  C  CA    . LYS A 1  452  ? 119.914 48.910  -4.518  1.00 83.38  ? 452  LYS A CA    1 
ATOM   3485  C  C     . LYS A 1  452  ? 120.003 47.699  -3.541  1.00 85.21  ? 452  LYS A C     1 
ATOM   3486  O  O     . LYS A 1  452  ? 119.883 46.549  -3.960  1.00 82.52  ? 452  LYS A O     1 
ATOM   3487  C  CB    . LYS A 1  452  ? 121.270 49.649  -4.627  1.00 84.71  ? 452  LYS A CB    1 
ATOM   3488  C  CG    . LYS A 1  452  ? 122.415 48.919  -5.295  1.00 76.89  ? 452  LYS A CG    1 
ATOM   3489  C  CD    . LYS A 1  452  ? 123.587 49.871  -5.482  1.00 78.49  ? 452  LYS A CD    1 
ATOM   3490  C  CE    . LYS A 1  452  ? 124.916 49.312  -5.039  1.00 95.34  ? 452  LYS A CE    1 
ATOM   3491  N  NZ    . LYS A 1  452  ? 125.337 49.801  -3.691  1.00 106.93 ? 452  LYS A NZ    1 
ATOM   3492  N  N     . MET A 1  453  ? 120.051 48.029  -2.215  1.00 82.71  ? 453  MET A N     1 
ATOM   3493  C  CA    . MET A 1  453  ? 120.113 47.189  -1.020  1.00 82.14  ? 453  MET A CA    1 
ATOM   3494  C  C     . MET A 1  453  ? 118.857 46.441  -0.702  1.00 84.57  ? 453  MET A C     1 
ATOM   3495  O  O     . MET A 1  453  ? 118.929 45.570  0.153   1.00 85.18  ? 453  MET A O     1 
ATOM   3496  C  CB    . MET A 1  453  ? 120.418 48.041  0.212   1.00 85.68  ? 453  MET A CB    1 
ATOM   3497  C  CG    . MET A 1  453  ? 121.853 48.340  0.382   1.00 90.99  ? 453  MET A CG    1 
ATOM   3498  S  SD    . MET A 1  453  ? 122.343 49.753  -0.622  1.00 97.07  ? 453  MET A SD    1 
ATOM   3499  C  CE    . MET A 1  453  ? 121.614 51.086  0.305   1.00 94.92  ? 453  MET A CE    1 
ATOM   3500  N  N     . SER A 1  454  ? 117.701 46.784  -1.290  1.00 79.39  ? 454  SER A N     1 
ATOM   3501  C  CA    . SER A 1  454  ? 116.466 46.060  -0.965  1.00 78.39  ? 454  SER A CA    1 
ATOM   3502  C  C     . SER A 1  454  ? 116.472 44.580  -1.463  1.00 80.78  ? 454  SER A C     1 
ATOM   3503  O  O     . SER A 1  454  ? 115.648 43.766  -1.038  1.00 79.75  ? 454  SER A O     1 
ATOM   3504  C  CB    . SER A 1  454  ? 115.245 46.826  -1.451  1.00 81.14  ? 454  SER A CB    1 
ATOM   3505  O  OG    . SER A 1  454  ? 114.412 47.119  -0.344  1.00 90.47  ? 454  SER A OG    1 
ATOM   3506  N  N     . MET A 1  455  ? 117.447 44.255  -2.333  1.00 75.77  ? 455  MET A N     1 
ATOM   3507  C  CA    . MET A 1  455  ? 117.684 42.954  -2.924  1.00 74.37  ? 455  MET A CA    1 
ATOM   3508  C  C     . MET A 1  455  ? 119.166 42.649  -2.806  1.00 78.26  ? 455  MET A C     1 
ATOM   3509  O  O     . MET A 1  455  ? 119.986 43.304  -3.456  1.00 79.09  ? 455  MET A O     1 
ATOM   3510  C  CB    . MET A 1  455  ? 117.366 42.983  -4.412  1.00 76.54  ? 455  MET A CB    1 
ATOM   3511  C  CG    . MET A 1  455  ? 116.019 43.428  -4.732  1.00 80.97  ? 455  MET A CG    1 
ATOM   3512  S  SD    . MET A 1  455  ? 115.751 42.969  -6.426  1.00 86.10  ? 455  MET A SD    1 
ATOM   3513  C  CE    . MET A 1  455  ? 114.313 41.991  -6.247  1.00 82.42  ? 455  MET A CE    1 
ATOM   3514  N  N     . MET A 1  456  ? 119.525 41.648  -2.008  1.00 72.92  ? 456  MET A N     1 
ATOM   3515  C  CA    . MET A 1  456  ? 120.920 41.261  -1.887  1.00 71.52  ? 456  MET A CA    1 
ATOM   3516  C  C     . MET A 1  456  ? 121.094 39.777  -2.045  1.00 73.23  ? 456  MET A C     1 
ATOM   3517  O  O     . MET A 1  456  ? 120.190 38.990  -1.739  1.00 70.84  ? 456  MET A O     1 
ATOM   3518  C  CB    . MET A 1  456  ? 121.526 41.745  -0.576  1.00 74.31  ? 456  MET A CB    1 
ATOM   3519  C  CG    . MET A 1  456  ? 121.763 43.220  -0.552  1.00 78.63  ? 456  MET A CG    1 
ATOM   3520  S  SD    . MET A 1  456  ? 122.382 43.802  1.029   1.00 84.01  ? 456  MET A SD    1 
ATOM   3521  C  CE    . MET A 1  456  ? 120.977 43.710  1.958   1.00 80.49  ? 456  MET A CE    1 
ATOM   3522  N  N     . ALA A 1  457  ? 122.266 39.404  -2.560  1.00 70.67  ? 457  ALA A N     1 
ATOM   3523  C  CA    . ALA A 1  457  ? 122.668 38.026  -2.760  1.00 70.33  ? 457  ALA A CA    1 
ATOM   3524  C  C     . ALA A 1  457  ? 123.177 37.470  -1.420  1.00 74.49  ? 457  ALA A C     1 
ATOM   3525  O  O     . ALA A 1  457  ? 123.971 38.125  -0.723  1.00 75.00  ? 457  ALA A O     1 
ATOM   3526  C  CB    . ALA A 1  457  ? 123.747 37.944  -3.823  1.00 71.28  ? 457  ALA A CB    1 
ATOM   3527  N  N     . HIS A 1  458  ? 122.682 36.266  -1.059  1.00 69.26  ? 458  HIS A N     1 
ATOM   3528  C  CA    . HIS A 1  458  ? 122.979 35.553  0.185   1.00 68.42  ? 458  HIS A CA    1 
ATOM   3529  C  C     . HIS A 1  458  ? 123.371 34.085  -0.071  1.00 72.81  ? 458  HIS A C     1 
ATOM   3530  O  O     . HIS A 1  458  ? 122.841 33.482  -1.013  1.00 72.55  ? 458  HIS A O     1 
ATOM   3531  C  CB    . HIS A 1  458  ? 121.706 35.513  1.053   1.00 67.91  ? 458  HIS A CB    1 
ATOM   3532  C  CG    . HIS A 1  458  ? 121.334 36.780  1.755   1.00 70.48  ? 458  HIS A CG    1 
ATOM   3533  N  ND1   . HIS A 1  458  ? 121.593 36.956  3.103   1.00 72.26  ? 458  HIS A ND1   1 
ATOM   3534  C  CD2   . HIS A 1  458  ? 120.629 37.842  1.301   1.00 71.17  ? 458  HIS A CD2   1 
ATOM   3535  C  CE1   . HIS A 1  458  ? 121.079 38.130  3.410   1.00 71.56  ? 458  HIS A CE1   1 
ATOM   3536  N  NE2   . HIS A 1  458  ? 120.478 38.693  2.358   1.00 71.31  ? 458  HIS A NE2   1 
ATOM   3537  N  N     . ARG A 1  459  ? 124.233 33.489  0.821   1.00 69.18  ? 459  ARG A N     1 
ATOM   3538  C  CA    . ARG A 1  459  ? 124.605 32.054  0.824   1.00 68.25  ? 459  ARG A CA    1 
ATOM   3539  C  C     . ARG A 1  459  ? 123.429 31.316  1.462   1.00 70.78  ? 459  ARG A C     1 
ATOM   3540  O  O     . ARG A 1  459  ? 122.852 31.790  2.457   1.00 70.96  ? 459  ARG A O     1 
ATOM   3541  C  CB    . ARG A 1  459  ? 125.827 31.739  1.719   1.00 66.27  ? 459  ARG A CB    1 
ATOM   3542  C  CG    . ARG A 1  459  ? 127.160 32.306  1.317   1.00 67.98  ? 459  ARG A CG    1 
ATOM   3543  C  CD    . ARG A 1  459  ? 127.900 32.769  2.556   1.00 71.97  ? 459  ARG A CD    1 
ATOM   3544  N  NE    . ARG A 1  459  ? 128.473 31.692  3.370   1.00 88.26  ? 459  ARG A NE    1 
ATOM   3545  C  CZ    . ARG A 1  459  ? 128.800 31.819  4.659   1.00 111.83 ? 459  ARG A CZ    1 
ATOM   3546  N  NH1   . ARG A 1  459  ? 128.582 32.960  5.299   1.00 96.36  ? 459  ARG A NH1   1 
ATOM   3547  N  NH2   . ARG A 1  459  ? 129.337 30.796  5.319   1.00 106.98 ? 459  ARG A NH2   1 
ATOM   3548  N  N     . VAL A 1  460  ? 123.113 30.143  0.943   1.00 65.21  ? 460  VAL A N     1 
ATOM   3549  C  CA    . VAL A 1  460  ? 122.038 29.366  1.520   1.00 64.33  ? 460  VAL A CA    1 
ATOM   3550  C  C     . VAL A 1  460  ? 122.531 28.577  2.736   1.00 69.19  ? 460  VAL A C     1 
ATOM   3551  O  O     . VAL A 1  460  ? 123.716 28.251  2.875   1.00 69.62  ? 460  VAL A O     1 
ATOM   3552  C  CB    . VAL A 1  460  ? 121.364 28.490  0.434   1.00 67.57  ? 460  VAL A CB    1 
ATOM   3553  C  CG1   . VAL A 1  460  ? 120.585 27.320  1.023   1.00 67.42  ? 460  VAL A CG1   1 
ATOM   3554  C  CG2   . VAL A 1  460  ? 120.456 29.335  -0.432  1.00 66.69  ? 460  VAL A CG2   1 
ATOM   3555  N  N     . LYS A 1  461  ? 121.614 28.340  3.649   1.00 65.43  ? 461  LYS A N     1 
ATOM   3556  C  CA    . LYS A 1  461  ? 121.839 27.471  4.772   1.00 65.79  ? 461  LYS A CA    1 
ATOM   3557  C  C     . LYS A 1  461  ? 120.527 26.779  4.976   1.00 70.56  ? 461  LYS A C     1 
ATOM   3558  O  O     . LYS A 1  461  ? 119.546 27.415  5.392   1.00 69.85  ? 461  LYS A O     1 
ATOM   3559  C  CB    . LYS A 1  461  ? 122.325 28.196  6.024   1.00 68.07  ? 461  LYS A CB    1 
ATOM   3560  C  CG    . LYS A 1  461  ? 123.254 27.322  6.866   1.00 76.83  ? 461  LYS A CG    1 
ATOM   3561  C  CD    . LYS A 1  461  ? 122.620 26.810  8.149   1.00 84.17  ? 461  LYS A CD    1 
ATOM   3562  C  CE    . LYS A 1  461  ? 123.667 26.230  9.074   1.00 98.14  ? 461  LYS A CE    1 
ATOM   3563  N  NZ    . LYS A 1  461  ? 123.595 26.824  10.443  1.00 109.92 ? 461  LYS A NZ    1 
ATOM   3564  N  N     . VAL A 1  462  ? 120.476 25.489  4.576   1.00 67.68  ? 462  VAL A N     1 
ATOM   3565  C  CA    . VAL A 1  462  ? 119.261 24.701  4.731   1.00 67.34  ? 462  VAL A CA    1 
ATOM   3566  C  C     . VAL A 1  462  ? 119.079 24.319  6.206   1.00 75.28  ? 462  VAL A C     1 
ATOM   3567  O  O     . VAL A 1  462  ? 119.950 23.663  6.810   1.00 75.66  ? 462  VAL A O     1 
ATOM   3568  C  CB    . VAL A 1  462  ? 119.092 23.515  3.773   1.00 69.31  ? 462  VAL A CB    1 
ATOM   3569  C  CG1   . VAL A 1  462  ? 117.620 23.123  3.707   1.00 68.40  ? 462  VAL A CG1   1 
ATOM   3570  C  CG2   . VAL A 1  462  ? 119.631 23.840  2.385   1.00 68.23  ? 462  VAL A CG2   1 
ATOM   3571  N  N     . ILE A 1  463  ? 117.965 24.819  6.787   1.00 72.59  ? 463  ILE A N     1 
ATOM   3572  C  CA    . ILE A 1  463  ? 117.600 24.657  8.196   1.00 72.89  ? 463  ILE A CA    1 
ATOM   3573  C  C     . ILE A 1  463  ? 116.201 24.050  8.313   1.00 78.41  ? 463  ILE A C     1 
ATOM   3574  O  O     . ILE A 1  463  ? 115.443 24.113  7.337   1.00 77.71  ? 463  ILE A O     1 
ATOM   3575  C  CB    . ILE A 1  463  ? 117.670 26.033  8.957   1.00 75.18  ? 463  ILE A CB    1 
ATOM   3576  C  CG1   . ILE A 1  463  ? 117.212 27.217  8.090   1.00 74.07  ? 463  ILE A CG1   1 
ATOM   3577  C  CG2   . ILE A 1  463  ? 119.038 26.285  9.564   1.00 76.50  ? 463  ILE A CG2   1 
ATOM   3578  C  CD1   . ILE A 1  463  ? 115.764 27.609  8.305   1.00 82.82  ? 463  ILE A CD1   1 
ATOM   3579  N  N     . PRO A 1  464  ? 115.811 23.521  9.503   1.00 76.69  ? 464  PRO A N     1 
ATOM   3580  C  CA    . PRO A 1  464  ? 114.424 23.053  9.676   1.00 77.50  ? 464  PRO A CA    1 
ATOM   3581  C  C     . PRO A 1  464  ? 113.485 24.234  9.978   1.00 83.04  ? 464  PRO A C     1 
ATOM   3582  O  O     . PRO A 1  464  ? 113.961 25.366  10.046  1.00 83.48  ? 464  PRO A O     1 
ATOM   3583  C  CB    . PRO A 1  464  ? 114.529 22.098  10.865  1.00 80.26  ? 464  PRO A CB    1 
ATOM   3584  C  CG    . PRO A 1  464  ? 115.667 22.613  11.658  1.00 84.67  ? 464  PRO A CG    1 
ATOM   3585  C  CD    . PRO A 1  464  ? 116.588 23.370  10.751  1.00 79.19  ? 464  PRO A CD    1 
ATOM   3586  N  N     . TYR A 1  465  ? 112.171 23.984  10.192  1.00 80.52  ? 465  TYR A N     1 
ATOM   3587  C  CA    . TYR A 1  465  ? 111.149 25.001  10.509  1.00 80.76  ? 465  TYR A CA    1 
ATOM   3588  C  C     . TYR A 1  465  ? 110.898 25.959  9.345   1.00 81.69  ? 465  TYR A C     1 
ATOM   3589  O  O     . TYR A 1  465  ? 111.834 26.414  8.673   1.00 81.47  ? 465  TYR A O     1 
ATOM   3590  C  CB    . TYR A 1  465  ? 111.443 25.754  11.806  1.00 83.58  ? 465  TYR A CB    1 
ATOM   3591  C  CG    . TYR A 1  465  ? 111.763 24.871  12.989  1.00 87.48  ? 465  TYR A CG    1 
ATOM   3592  C  CD1   . TYR A 1  465  ? 113.078 24.531  13.295  1.00 89.41  ? 465  TYR A CD1   1 
ATOM   3593  C  CD2   . TYR A 1  465  ? 110.763 24.459  13.864  1.00 90.32  ? 465  TYR A CD2   1 
ATOM   3594  C  CE1   . TYR A 1  465  ? 113.385 23.761  14.417  1.00 92.52  ? 465  TYR A CE1   1 
ATOM   3595  C  CE2   . TYR A 1  465  ? 111.057 23.696  14.997  1.00 93.12  ? 465  TYR A CE2   1 
ATOM   3596  C  CZ    . TYR A 1  465  ? 112.372 23.356  15.277  1.00 103.43 ? 465  TYR A CZ    1 
ATOM   3597  O  OH    . TYR A 1  465  ? 112.657 22.596  16.394  1.00 107.02 ? 465  TYR A OH    1 
ATOM   3598  N  N     . SER A 1  466  ? 109.626 26.303  9.158   1.00 74.79  ? 466  SER A N     1 
ATOM   3599  C  CA    . SER A 1  466  ? 109.093 27.002  8.000   1.00 72.47  ? 466  SER A CA    1 
ATOM   3600  C  C     . SER A 1  466  ? 109.440 28.528  7.775   1.00 74.40  ? 466  SER A C     1 
ATOM   3601  O  O     . SER A 1  466  ? 108.896 29.077  6.818   1.00 74.65  ? 466  SER A O     1 
ATOM   3602  C  CB    . SER A 1  466  ? 107.586 26.816  7.967   1.00 75.06  ? 466  SER A CB    1 
ATOM   3603  O  OG    . SER A 1  466  ? 107.265 25.449  8.180   1.00 80.97  ? 466  SER A OG    1 
ATOM   3604  N  N     . THR A 1  467  ? 110.362 29.190  8.524   1.00 68.36  ? 467  THR A N     1 
ATOM   3605  C  CA    . THR A 1  467  ? 110.677 30.598  8.179   1.00 66.53  ? 467  THR A CA    1 
ATOM   3606  C  C     . THR A 1  467  ? 112.017 30.750  7.515   1.00 72.66  ? 467  THR A C     1 
ATOM   3607  O  O     . THR A 1  467  ? 112.902 29.894  7.684   1.00 74.10  ? 467  THR A O     1 
ATOM   3608  C  CB    . THR A 1  467  ? 110.782 31.531  9.388   1.00 65.76  ? 467  THR A CB    1 
ATOM   3609  O  OG1   . THR A 1  467  ? 111.584 30.956  10.414  1.00 66.49  ? 467  THR A OG1   1 
ATOM   3610  C  CG2   . THR A 1  467  ? 109.475 31.975  9.901   1.00 65.14  ? 467  THR A CG2   1 
ATOM   3611  N  N     . PHE A 1  468  ? 112.207 31.909  6.843   1.00 68.54  ? 468  PHE A N     1 
ATOM   3612  C  CA    . PHE A 1  468  ? 113.495 32.322  6.288   1.00 67.56  ? 468  PHE A CA    1 
ATOM   3613  C  C     . PHE A 1  468  ? 114.210 32.966  7.466   1.00 72.00  ? 468  PHE A C     1 
ATOM   3614  O  O     . PHE A 1  468  ? 113.753 33.992  7.994   1.00 71.66  ? 468  PHE A O     1 
ATOM   3615  C  CB    . PHE A 1  468  ? 113.364 33.374  5.154   1.00 68.46  ? 468  PHE A CB    1 
ATOM   3616  C  CG    . PHE A 1  468  ? 112.900 32.919  3.790   1.00 68.76  ? 468  PHE A CG    1 
ATOM   3617  C  CD1   . PHE A 1  468  ? 113.458 31.800  3.183   1.00 70.30  ? 468  PHE A CD1   1 
ATOM   3618  C  CD2   . PHE A 1  468  ? 111.938 33.634  3.094   1.00 70.51  ? 468  PHE A CD2   1 
ATOM   3619  C  CE1   . PHE A 1  468  ? 113.025 31.380  1.929   1.00 71.90  ? 468  PHE A CE1   1 
ATOM   3620  C  CE2   . PHE A 1  468  ? 111.504 33.206  1.843   1.00 70.60  ? 468  PHE A CE2   1 
ATOM   3621  C  CZ    . PHE A 1  468  ? 112.054 32.088  1.267   1.00 69.26  ? 468  PHE A CZ    1 
ATOM   3622  N  N     . ARG A 1  469  ? 115.281 32.342  7.924   1.00 69.32  ? 469  ARG A N     1 
ATOM   3623  C  CA    . ARG A 1  469  ? 116.027 32.895  9.051   1.00 70.30  ? 469  ARG A CA    1 
ATOM   3624  C  C     . ARG A 1  469  ? 117.111 33.834  8.475   1.00 75.99  ? 469  ARG A C     1 
ATOM   3625  O  O     . ARG A 1  469  ? 117.661 33.531  7.414   1.00 75.06  ? 469  ARG A O     1 
ATOM   3626  C  CB    . ARG A 1  469  ? 116.551 31.773  9.980   1.00 69.35  ? 469  ARG A CB    1 
ATOM   3627  C  CG    . ARG A 1  469  ? 115.534 30.633  10.083  1.00 78.94  ? 469  ARG A CG    1 
ATOM   3628  C  CD    . ARG A 1  469  ? 115.400 29.970  11.428  1.00 91.05  ? 469  ARG A CD    1 
ATOM   3629  N  NE    . ARG A 1  469  ? 114.605 30.751  12.378  1.00 98.36  ? 469  ARG A NE    1 
ATOM   3630  C  CZ    . ARG A 1  469  ? 115.110 31.385  13.433  1.00 108.48 ? 469  ARG A CZ    1 
ATOM   3631  N  NH1   . ARG A 1  469  ? 116.408 31.333  13.688  1.00 84.96  ? 469  ARG A NH1   1 
ATOM   3632  N  NH2   . ARG A 1  469  ? 114.319 32.070  14.246  1.00 100.28 ? 469  ARG A NH2   1 
ATOM   3633  N  N     . LEU A 1  470  ? 117.309 35.033  9.070   1.00 74.01  ? 470  LEU A N     1 
ATOM   3634  C  CA    . LEU A 1  470  ? 118.316 35.985  8.555   1.00 74.25  ? 470  LEU A CA    1 
ATOM   3635  C  C     . LEU A 1  470  ? 119.046 36.756  9.660   1.00 78.81  ? 470  LEU A C     1 
ATOM   3636  O  O     . LEU A 1  470  ? 118.416 37.096  10.673  1.00 79.38  ? 470  LEU A O     1 
ATOM   3637  C  CB    . LEU A 1  470  ? 117.760 36.948  7.486   1.00 73.64  ? 470  LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1  470  ? 116.635 37.849  7.890   1.00 78.28  ? 470  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1  470  ? 116.907 39.248  7.464   1.00 78.70  ? 470  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1  470  ? 115.372 37.367  7.311   1.00 80.41  ? 470  LEU A CD2   1 
ATOM   3641  N  N     . ASN A 1  471  ? 120.377 37.028  9.454   1.00 73.86  ? 471  ASN A N     1 
ATOM   3642  C  CA    . ASN A 1  471  ? 121.212 37.716  10.441  1.00 73.69  ? 471  ASN A CA    1 
ATOM   3643  C  C     . ASN A 1  471  ? 120.617 39.029  10.794  1.00 78.44  ? 471  ASN A C     1 
ATOM   3644  O  O     . ASN A 1  471  ? 120.143 39.734  9.906   1.00 79.01  ? 471  ASN A O     1 
ATOM   3645  C  CB    . ASN A 1  471  ? 122.643 37.899  9.989   1.00 71.50  ? 471  ASN A CB    1 
ATOM   3646  C  CG    . ASN A 1  471  ? 123.485 38.564  11.058  1.00 81.25  ? 471  ASN A CG    1 
ATOM   3647  O  OD1   . ASN A 1  471  ? 124.124 39.586  10.814  1.00 78.90  ? 471  ASN A OD1   1 
ATOM   3648  N  ND2   . ASN A 1  471  ? 123.392 38.089  12.300  1.00 66.22  ? 471  ASN A ND2   1 
ATOM   3649  N  N     . LEU A 1  472  ? 120.610 39.362  12.082  1.00 74.76  ? 472  LEU A N     1 
ATOM   3650  C  CA    . LEU A 1  472  ? 119.937 40.576  12.523  1.00 74.30  ? 472  LEU A CA    1 
ATOM   3651  C  C     . LEU A 1  472  ? 120.537 41.911  12.061  1.00 77.21  ? 472  LEU A C     1 
ATOM   3652  O  O     . LEU A 1  472  ? 119.789 42.876  12.037  1.00 77.03  ? 472  LEU A O     1 
ATOM   3653  C  CB    . LEU A 1  472  ? 119.759 40.574  14.032  1.00 75.04  ? 472  LEU A CB    1 
ATOM   3654  C  CG    . LEU A 1  472  ? 118.338 40.261  14.393  1.00 79.63  ? 472  LEU A CG    1 
ATOM   3655  C  CD1   . LEU A 1  472  ? 118.235 39.045  15.275  1.00 80.91  ? 472  LEU A CD1   1 
ATOM   3656  C  CD2   . LEU A 1  472  ? 117.645 41.455  14.918  1.00 82.01  ? 472  LEU A CD2   1 
ATOM   3657  N  N     . SER A 1  473  ? 121.823 41.984  11.673  1.00 73.54  ? 473  SER A N     1 
ATOM   3658  C  CA    . SER A 1  473  ? 122.423 43.272  11.306  1.00 74.24  ? 473  SER A CA    1 
ATOM   3659  C  C     . SER A 1  473  ? 122.148 43.701  9.867   1.00 77.87  ? 473  SER A C     1 
ATOM   3660  O  O     . SER A 1  473  ? 122.340 44.878  9.546   1.00 76.61  ? 473  SER A O     1 
ATOM   3661  C  CB    . SER A 1  473  ? 123.910 43.294  11.627  1.00 78.89  ? 473  SER A CB    1 
ATOM   3662  O  OG    . SER A 1  473  ? 124.133 43.589  13.000  1.00 88.75  ? 473  SER A OG    1 
ATOM   3663  N  N     . VAL A 1  474  ? 121.629 42.756  9.034   1.00 75.27  ? 474  VAL A N     1 
ATOM   3664  C  CA    . VAL A 1  474  ? 121.196 42.933  7.631   1.00 74.91  ? 474  VAL A CA    1 
ATOM   3665  C  C     . VAL A 1  474  ? 119.680 43.263  7.624   1.00 81.02  ? 474  VAL A C     1 
ATOM   3666  O  O     . VAL A 1  474  ? 119.025 43.267  6.584   1.00 80.38  ? 474  VAL A O     1 
ATOM   3667  C  CB    . VAL A 1  474  ? 121.560 41.695  6.750   1.00 77.48  ? 474  VAL A CB    1 
ATOM   3668  C  CG1   . VAL A 1  474  ? 120.543 40.570  6.879   1.00 76.54  ? 474  VAL A CG1   1 
ATOM   3669  C  CG2   . VAL A 1  474  ? 121.731 42.077  5.296   1.00 76.82  ? 474  VAL A CG2   1 
ATOM   3670  N  N     . THR A 1  475  ? 119.142 43.551  8.804   1.00 79.21  ? 475  THR A N     1 
ATOM   3671  C  CA    . THR A 1  475  ? 117.755 43.891  9.000   1.00 79.36  ? 475  THR A CA    1 
ATOM   3672  C  C     . THR A 1  475  ? 117.457 45.280  8.396   1.00 85.51  ? 475  THR A C     1 
ATOM   3673  O  O     . THR A 1  475  ? 116.515 45.425  7.608   1.00 84.05  ? 475  THR A O     1 
ATOM   3674  C  CB    . THR A 1  475  ? 117.457 43.705  10.481  1.00 88.19  ? 475  THR A CB    1 
ATOM   3675  O  OG1   . THR A 1  475  ? 116.185 43.102  10.633  1.00 92.26  ? 475  THR A OG1   1 
ATOM   3676  C  CG2   . THR A 1  475  ? 117.614 44.981  11.326  1.00 86.88  ? 475  THR A CG2   1 
ATOM   3677  N  N     . SER A 1  476  ? 118.320 46.270  8.730   1.00 85.25  ? 476  SER A N     1 
ATOM   3678  C  CA    . SER A 1  476  ? 118.262 47.681  8.316   1.00 86.50  ? 476  SER A CA    1 
ATOM   3679  C  C     . SER A 1  476  ? 118.212 47.901  6.784   1.00 88.14  ? 476  SER A C     1 
ATOM   3680  O  O     . SER A 1  476  ? 117.277 48.587  6.353   1.00 87.82  ? 476  SER A O     1 
ATOM   3681  C  CB    . SER A 1  476  ? 119.393 48.504  8.946   1.00 92.78  ? 476  SER A CB    1 
ATOM   3682  O  OG    . SER A 1  476  ? 120.376 47.704  9.589   1.00 105.37 ? 476  SER A OG    1 
ATOM   3683  N  N     . PRO A 1  477  ? 119.140 47.345  5.942   1.00 82.20  ? 477  PRO A N     1 
ATOM   3684  C  CA    . PRO A 1  477  ? 119.045 47.598  4.495   1.00 81.22  ? 477  PRO A CA    1 
ATOM   3685  C  C     . PRO A 1  477  ? 117.715 47.170  3.853   1.00 85.06  ? 477  PRO A C     1 
ATOM   3686  O  O     . PRO A 1  477  ? 117.246 47.875  2.948   1.00 84.88  ? 477  PRO A O     1 
ATOM   3687  C  CB    . PRO A 1  477  ? 120.261 46.862  3.909   1.00 82.21  ? 477  PRO A CB    1 
ATOM   3688  C  CG    . PRO A 1  477  ? 120.713 45.944  4.946   1.00 86.17  ? 477  PRO A CG    1 
ATOM   3689  C  CD    . PRO A 1  477  ? 120.325 46.516  6.253   1.00 82.92  ? 477  PRO A CD    1 
ATOM   3690  N  N     . TYR A 1  478  ? 117.099 46.042  4.342   1.00 80.66  ? 478  TYR A N     1 
ATOM   3691  C  CA    . TYR A 1  478  ? 115.810 45.493  3.873   1.00 78.88  ? 478  TYR A CA    1 
ATOM   3692  C  C     . TYR A 1  478  ? 114.677 46.274  4.483   1.00 85.33  ? 478  TYR A C     1 
ATOM   3693  O  O     . TYR A 1  478  ? 113.644 46.459  3.835   1.00 84.54  ? 478  TYR A O     1 
ATOM   3694  C  CB    . TYR A 1  478  ? 115.658 44.001  4.238   1.00 77.88  ? 478  TYR A CB    1 
ATOM   3695  C  CG    . TYR A 1  478  ? 116.533 43.077  3.416   1.00 77.72  ? 478  TYR A CG    1 
ATOM   3696  C  CD1   . TYR A 1  478  ? 116.294 42.879  2.058   1.00 77.90  ? 478  TYR A CD1   1 
ATOM   3697  C  CD2   . TYR A 1  478  ? 117.627 42.430  3.984   1.00 79.30  ? 478  TYR A CD2   1 
ATOM   3698  C  CE1   . TYR A 1  478  ? 117.131 42.070  1.284   1.00 78.21  ? 478  TYR A CE1   1 
ATOM   3699  C  CE2   . TYR A 1  478  ? 118.466 41.611  3.223   1.00 78.46  ? 478  TYR A CE2   1 
ATOM   3700  C  CZ    . TYR A 1  478  ? 118.212 41.431  1.873   1.00 82.74  ? 478  TYR A CZ    1 
ATOM   3701  O  OH    . TYR A 1  478  ? 119.020 40.610  1.124   1.00 79.47  ? 478  TYR A OH    1 
ATOM   3702  N  N     . ASN A 1  479  ? 114.919 46.799  5.711   1.00 84.71  ? 479  ASN A N     1 
ATOM   3703  C  CA    . ASN A 1  479  ? 113.995 47.549  6.575   1.00 86.16  ? 479  ASN A CA    1 
ATOM   3704  C  C     . ASN A 1  479  ? 112.935 46.560  7.082   1.00 89.29  ? 479  ASN A C     1 
ATOM   3705  O  O     . ASN A 1  479  ? 111.739 46.882  7.149   1.00 90.78  ? 479  ASN A O     1 
ATOM   3706  C  CB    . ASN A 1  479  ? 113.397 48.815  5.877   1.00 89.55  ? 479  ASN A CB    1 
ATOM   3707  C  CG    . ASN A 1  479  ? 112.439 49.664  6.714   1.00 117.55 ? 479  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A 1  479  ? 111.303 49.920  6.311   1.00 106.20 ? 479  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A 1  479  ? 112.866 50.132  7.887   1.00 116.24 ? 479  ASN A ND2   1 
ATOM   3710  N  N     . ALA A 1  480  ? 113.398 45.342  7.445   1.00 81.83  ? 480  ALA A N     1 
ATOM   3711  C  CA    . ALA A 1  480  ? 112.541 44.266  7.917   1.00 79.84  ? 480  ALA A CA    1 
ATOM   3712  C  C     . ALA A 1  480  ? 112.521 44.105  9.424   1.00 83.42  ? 480  ALA A C     1 
ATOM   3713  O  O     . ALA A 1  480  ? 113.540 44.306  10.081  1.00 82.99  ? 480  ALA A O     1 
ATOM   3714  C  CB    . ALA A 1  480  ? 112.963 42.974  7.281   1.00 79.61  ? 480  ALA A CB    1 
ATOM   3715  N  N     . ASP A 1  481  ? 111.337 43.750  9.961   1.00 80.89  ? 481  ASP A N     1 
ATOM   3716  C  CA    . ASP A 1  481  ? 111.044 43.453  11.368  1.00 82.00  ? 481  ASP A CA    1 
ATOM   3717  C  C     . ASP A 1  481  ? 110.478 42.062  11.395  1.00 86.83  ? 481  ASP A C     1 
ATOM   3718  O  O     . ASP A 1  481  ? 110.154 41.518  10.341  1.00 86.31  ? 481  ASP A O     1 
ATOM   3719  C  CB    . ASP A 1  481  ? 110.101 44.479  12.037  1.00 85.26  ? 481  ASP A CB    1 
ATOM   3720  C  CG    . ASP A 1  481  ? 108.976 45.103  11.210  1.00 102.66 ? 481  ASP A CG    1 
ATOM   3721  O  OD1   . ASP A 1  481  ? 109.225 45.497  10.039  1.00 109.78 ? 481  ASP A OD1   1 
ATOM   3722  O  OD2   . ASP A 1  481  ? 107.918 45.367  11.780  1.00 105.21 ? 481  ASP A OD2   1 
ATOM   3723  N  N     . PHE A 1  482  ? 110.410 41.437  12.547  1.00 84.66  ? 482  PHE A N     1 
ATOM   3724  C  CA    . PHE A 1  482  ? 109.955 40.057  12.508  1.00 84.49  ? 482  PHE A CA    1 
ATOM   3725  C  C     . PHE A 1  482  ? 108.549 39.866  13.100  1.00 89.40  ? 482  PHE A C     1 
ATOM   3726  O  O     . PHE A 1  482  ? 108.239 38.824  13.692  1.00 88.84  ? 482  PHE A O     1 
ATOM   3727  C  CB    . PHE A 1  482  ? 111.013 39.152  13.146  1.00 86.60  ? 482  PHE A CB    1 
ATOM   3728  C  CG    . PHE A 1  482  ? 112.421 39.340  12.614  1.00 87.73  ? 482  PHE A CG    1 
ATOM   3729  C  CD1   . PHE A 1  482  ? 112.748 38.969  11.314  1.00 88.85  ? 482  PHE A CD1   1 
ATOM   3730  C  CD2   . PHE A 1  482  ? 113.426 39.851  13.424  1.00 91.61  ? 482  PHE A CD2   1 
ATOM   3731  C  CE1   . PHE A 1  482  ? 114.052 39.110  10.831  1.00 91.46  ? 482  PHE A CE1   1 
ATOM   3732  C  CE2   . PHE A 1  482  ? 114.726 40.003  12.938  1.00 92.49  ? 482  PHE A CE2   1 
ATOM   3733  C  CZ    . PHE A 1  482  ? 115.030 39.635  11.640  1.00 90.38  ? 482  PHE A CZ    1 
ATOM   3734  N  N     . ASP A 1  483  ? 107.677 40.865  12.854  1.00 86.87  ? 483  ASP A N     1 
ATOM   3735  C  CA    . ASP A 1  483  ? 106.283 40.890  13.298  1.00 87.40  ? 483  ASP A CA    1 
ATOM   3736  C  C     . ASP A 1  483  ? 105.322 40.303  12.247  1.00 90.59  ? 483  ASP A C     1 
ATOM   3737  O  O     . ASP A 1  483  ? 104.160 40.714  12.173  1.00 90.71  ? 483  ASP A O     1 
ATOM   3738  C  CB    . ASP A 1  483  ? 105.878 42.330  13.654  1.00 90.34  ? 483  ASP A CB    1 
ATOM   3739  C  CG    . ASP A 1  483  ? 105.938 43.335  12.510  1.00 102.75 ? 483  ASP A CG    1 
ATOM   3740  O  OD1   . ASP A 1  483  ? 106.256 42.928  11.369  1.00 103.88 ? 483  ASP A OD1   1 
ATOM   3741  O  OD2   . ASP A 1  483  ? 105.692 44.539  12.765  1.00 105.98 ? 483  ASP A OD2   1 
ATOM   3742  N  N     . GLY A 1  484  ? 105.814 39.374  11.436  1.00 86.21  ? 484  GLY A N     1 
ATOM   3743  C  CA    . GLY A 1  484  ? 105.002 38.766  10.392  1.00 85.51  ? 484  GLY A CA    1 
ATOM   3744  C  C     . GLY A 1  484  ? 105.244 39.328  9.007   1.00 88.15  ? 484  GLY A C     1 
ATOM   3745  O  O     . GLY A 1  484  ? 104.303 39.433  8.200   1.00 88.20  ? 484  GLY A O     1 
ATOM   3746  N  N     . ASP A 1  485  ? 106.519 39.692  8.737   1.00 82.34  ? 485  ASP A N     1 
ATOM   3747  C  CA    . ASP A 1  485  ? 106.990 40.192  7.452   1.00 80.46  ? 485  ASP A CA    1 
ATOM   3748  C  C     . ASP A 1  485  ? 107.299 38.946  6.668   1.00 82.30  ? 485  ASP A C     1 
ATOM   3749  O  O     . ASP A 1  485  ? 107.678 37.941  7.285   1.00 82.61  ? 485  ASP A O     1 
ATOM   3750  C  CB    . ASP A 1  485  ? 108.312 40.964  7.635   1.00 82.38  ? 485  ASP A CB    1 
ATOM   3751  C  CG    . ASP A 1  485  ? 108.214 42.432  8.009   1.00 94.94  ? 485  ASP A CG    1 
ATOM   3752  O  OD1   . ASP A 1  485  ? 107.270 42.800  8.727   1.00 97.49  ? 485  ASP A OD1   1 
ATOM   3753  O  OD2   . ASP A 1  485  ? 109.130 43.201  7.644   1.00 98.94  ? 485  ASP A OD2   1 
ATOM   3754  N  N     . GLU A 1  486  ? 107.129 38.992  5.326   1.00 76.26  ? 486  GLU A N     1 
ATOM   3755  C  CA    . GLU A 1  486  ? 107.472 37.891  4.403   1.00 74.30  ? 486  GLU A CA    1 
ATOM   3756  C  C     . GLU A 1  486  ? 108.580 38.386  3.466   1.00 75.02  ? 486  GLU A C     1 
ATOM   3757  O  O     . GLU A 1  486  ? 108.660 39.583  3.157   1.00 74.56  ? 486  GLU A O     1 
ATOM   3758  C  CB    . GLU A 1  486  ? 106.272 37.437  3.539   1.00 75.57  ? 486  GLU A CB    1 
ATOM   3759  C  CG    . GLU A 1  486  ? 105.207 36.579  4.203   1.00 90.79  ? 486  GLU A CG    1 
ATOM   3760  C  CD    . GLU A 1  486  ? 104.009 36.342  3.297   1.00 129.18 ? 486  GLU A CD    1 
ATOM   3761  O  OE1   . GLU A 1  486  ? 103.133 37.237  3.224   1.00 138.02 ? 486  GLU A OE1   1 
ATOM   3762  O  OE2   . GLU A 1  486  ? 103.969 35.286  2.623   1.00 128.82 ? 486  GLU A OE2   1 
ATOM   3763  N  N     . MET A 1  487  ? 109.425 37.485  2.991   1.00 69.26  ? 487  MET A N     1 
ATOM   3764  C  CA    . MET A 1  487  ? 110.448 37.932  2.063   1.00 68.09  ? 487  MET A CA    1 
ATOM   3765  C  C     . MET A 1  487  ? 110.555 37.040  0.849   1.00 72.08  ? 487  MET A C     1 
ATOM   3766  O  O     . MET A 1  487  ? 110.209 35.867  0.920   1.00 71.71  ? 487  MET A O     1 
ATOM   3767  C  CB    . MET A 1  487  ? 111.777 38.122  2.759   1.00 70.30  ? 487  MET A CB    1 
ATOM   3768  C  CG    . MET A 1  487  ? 111.831 39.392  3.539   1.00 74.30  ? 487  MET A CG    1 
ATOM   3769  S  SD    . MET A 1  487  ? 113.520 39.948  3.566   1.00 79.04  ? 487  MET A SD    1 
ATOM   3770  C  CE    . MET A 1  487  ? 113.816 39.857  5.262   1.00 76.30  ? 487  MET A CE    1 
ATOM   3771  N  N     . ASN A 1  488  ? 110.993 37.603  -0.276  1.00 68.75  ? 488  ASN A N     1 
ATOM   3772  C  CA    . ASN A 1  488  ? 111.116 36.864  -1.525  1.00 68.20  ? 488  ASN A CA    1 
ATOM   3773  C  C     . ASN A 1  488  ? 112.529 36.330  -1.785  1.00 70.64  ? 488  ASN A C     1 
ATOM   3774  O  O     . ASN A 1  488  ? 113.528 37.003  -1.514  1.00 70.50  ? 488  ASN A O     1 
ATOM   3775  C  CB    . ASN A 1  488  ? 110.605 37.712  -2.692  1.00 71.90  ? 488  ASN A CB    1 
ATOM   3776  C  CG    . ASN A 1  488  ? 109.131 38.059  -2.592  1.00 101.60 ? 488  ASN A CG    1 
ATOM   3777  O  OD1   . ASN A 1  488  ? 108.524 38.017  -1.511  1.00 91.07  ? 488  ASN A OD1   1 
ATOM   3778  N  ND2   . ASN A 1  488  ? 108.523 38.425  -3.725  1.00 96.72  ? 488  ASN A ND2   1 
ATOM   3779  N  N     . LEU A 1  489  ? 112.593 35.101  -2.288  1.00 65.80  ? 489  LEU A N     1 
ATOM   3780  C  CA    . LEU A 1  489  ? 113.825 34.424  -2.639  1.00 65.63  ? 489  LEU A CA    1 
ATOM   3781  C  C     . LEU A 1  489  ? 113.800 34.044  -4.119  1.00 71.35  ? 489  LEU A C     1 
ATOM   3782  O  O     . LEU A 1  489  ? 112.812 33.480  -4.597  1.00 71.17  ? 489  LEU A O     1 
ATOM   3783  C  CB    . LEU A 1  489  ? 114.007 33.172  -1.795  1.00 65.51  ? 489  LEU A CB    1 
ATOM   3784  C  CG    . LEU A 1  489  ? 115.395 32.586  -1.880  1.00 70.24  ? 489  LEU A CG    1 
ATOM   3785  C  CD1   . LEU A 1  489  ? 116.106 32.773  -0.600  1.00 71.68  ? 489  LEU A CD1   1 
ATOM   3786  C  CD2   . LEU A 1  489  ? 115.356 31.132  -2.261  1.00 70.94  ? 489  LEU A CD2   1 
ATOM   3787  N  N     . HIS A 1  490  ? 114.899 34.342  -4.836  1.00 68.14  ? 490  HIS A N     1 
ATOM   3788  C  CA    . HIS A 1  490  ? 115.066 34.035  -6.256  1.00 67.07  ? 490  HIS A CA    1 
ATOM   3789  C  C     . HIS A 1  490  ? 116.308 33.173  -6.436  1.00 69.23  ? 490  HIS A C     1 
ATOM   3790  O  O     . HIS A 1  490  ? 117.352 33.460  -5.847  1.00 69.78  ? 490  HIS A O     1 
ATOM   3791  C  CB    . HIS A 1  490  ? 115.115 35.324  -7.090  1.00 67.87  ? 490  HIS A CB    1 
ATOM   3792  C  CG    . HIS A 1  490  ? 113.840 36.111  -7.013  1.00 71.56  ? 490  HIS A CG    1 
ATOM   3793  N  ND1   . HIS A 1  490  ? 112.732 35.767  -7.771  1.00 73.48  ? 490  HIS A ND1   1 
ATOM   3794  C  CD2   . HIS A 1  490  ? 113.518 37.168  -6.227  1.00 73.61  ? 490  HIS A CD2   1 
ATOM   3795  C  CE1   . HIS A 1  490  ? 111.784 36.630  -7.431  1.00 72.93  ? 490  HIS A CE1   1 
ATOM   3796  N  NE2   . HIS A 1  490  ? 112.214 37.501  -6.514  1.00 73.25  ? 490  HIS A NE2   1 
ATOM   3797  N  N     . VAL A 1  491  ? 116.173 32.075  -7.180  1.00 63.64  ? 491  VAL A N     1 
ATOM   3798  C  CA    . VAL A 1  491  ? 117.262 31.126  -7.416  1.00 62.89  ? 491  VAL A CA    1 
ATOM   3799  C  C     . VAL A 1  491  ? 117.884 31.297  -8.838  1.00 70.35  ? 491  VAL A C     1 
ATOM   3800  O  O     . VAL A 1  491  ? 117.250 30.920  -9.832  1.00 71.71  ? 491  VAL A O     1 
ATOM   3801  C  CB    . VAL A 1  491  ? 116.800 29.666  -7.153  1.00 64.63  ? 491  VAL A CB    1 
ATOM   3802  C  CG1   . VAL A 1  491  ? 117.896 28.671  -7.517  1.00 64.67  ? 491  VAL A CG1   1 
ATOM   3803  C  CG2   . VAL A 1  491  ? 116.340 29.471  -5.715  1.00 63.79  ? 491  VAL A CG2   1 
ATOM   3804  N  N     . PRO A 1  492  ? 119.126 31.805  -8.980  1.00 67.38  ? 492  PRO A N     1 
ATOM   3805  C  CA    . PRO A 1  492  ? 119.726 31.883  -10.326 1.00 67.69  ? 492  PRO A CA    1 
ATOM   3806  C  C     . PRO A 1  492  ? 119.910 30.466  -10.924 1.00 73.67  ? 492  PRO A C     1 
ATOM   3807  O  O     . PRO A 1  492  ? 120.116 29.511  -10.153 1.00 74.60  ? 492  PRO A O     1 
ATOM   3808  C  CB    . PRO A 1  492  ? 121.055 32.586  -10.055 1.00 69.68  ? 492  PRO A CB    1 
ATOM   3809  C  CG    . PRO A 1  492  ? 121.388 32.218  -8.643  1.00 74.21  ? 492  PRO A CG    1 
ATOM   3810  C  CD    . PRO A 1  492  ? 120.066 32.282  -7.947  1.00 69.11  ? 492  PRO A CD    1 
ATOM   3811  N  N     . GLN A 1  493  ? 119.795 30.314  -12.278 1.00 69.24  ? 493  GLN A N     1 
ATOM   3812  C  CA    . GLN A 1  493  ? 119.873 29.018  -13.009 1.00 68.31  ? 493  GLN A CA    1 
ATOM   3813  C  C     . GLN A 1  493  ? 121.143 28.773  -13.828 1.00 73.06  ? 493  GLN A C     1 
ATOM   3814  O  O     . GLN A 1  493  ? 121.350 27.643  -14.297 1.00 73.06  ? 493  GLN A O     1 
ATOM   3815  C  CB    . GLN A 1  493  ? 118.665 28.839  -13.954 1.00 68.81  ? 493  GLN A CB    1 
ATOM   3816  C  CG    . GLN A 1  493  ? 117.305 29.078  -13.334 1.00 67.10  ? 493  GLN A CG    1 
ATOM   3817  C  CD    . GLN A 1  493  ? 117.026 27.997  -12.363 1.00 70.63  ? 493  GLN A CD    1 
ATOM   3818  O  OE1   . GLN A 1  493  ? 116.706 26.871  -12.763 1.00 72.07  ? 493  GLN A OE1   1 
ATOM   3819  N  NE2   . GLN A 1  493  ? 117.245 28.296  -11.080 1.00 44.03  ? 493  GLN A NE2   1 
ATOM   3820  N  N     . SER A 1  494  ? 121.953 29.831  -14.047 1.00 70.32  ? 494  SER A N     1 
ATOM   3821  C  CA    . SER A 1  494  ? 123.195 29.802  -14.832 1.00 71.02  ? 494  SER A CA    1 
ATOM   3822  C  C     . SER A 1  494  ? 124.395 29.835  -13.921 1.00 74.10  ? 494  SER A C     1 
ATOM   3823  O  O     . SER A 1  494  ? 124.293 30.345  -12.815 1.00 72.45  ? 494  SER A O     1 
ATOM   3824  C  CB    . SER A 1  494  ? 123.230 30.999  -15.787 1.00 75.32  ? 494  SER A CB    1 
ATOM   3825  O  OG    . SER A 1  494  ? 124.444 31.195  -16.496 1.00 83.50  ? 494  SER A OG    1 
ATOM   3826  N  N     . GLU A 1  495  ? 125.538 29.315  -14.380 1.00 73.02  ? 495  GLU A N     1 
ATOM   3827  C  CA    . GLU A 1  495  ? 126.777 29.402  -13.587 1.00 74.28  ? 495  GLU A CA    1 
ATOM   3828  C  C     . GLU A 1  495  ? 127.332 30.873  -13.661 1.00 76.79  ? 495  GLU A C     1 
ATOM   3829  O  O     . GLU A 1  495  ? 128.065 31.335  -12.771 1.00 75.90  ? 495  GLU A O     1 
ATOM   3830  C  CB    . GLU A 1  495  ? 127.811 28.317  -14.018 1.00 76.78  ? 495  GLU A CB    1 
ATOM   3831  C  CG    . GLU A 1  495  ? 128.942 28.078  -13.020 1.00 88.95  ? 495  GLU A CG    1 
ATOM   3832  C  CD    . GLU A 1  495  ? 128.615 27.620  -11.602 1.00 119.67 ? 495  GLU A CD    1 
ATOM   3833  O  OE1   . GLU A 1  495  ? 128.028 26.521  -11.449 1.00 130.20 ? 495  GLU A OE1   1 
ATOM   3834  O  OE2   . GLU A 1  495  ? 129.020 28.321  -10.642 1.00 106.24 ? 495  GLU A OE2   1 
ATOM   3835  N  N     . GLU A 1  496  ? 126.894 31.602  -14.701 1.00 72.28  ? 496  GLU A N     1 
ATOM   3836  C  CA    . GLU A 1  496  ? 127.276 32.974  -14.971 1.00 72.30  ? 496  GLU A CA    1 
ATOM   3837  C  C     . GLU A 1  496  ? 126.361 33.945  -14.261 1.00 73.73  ? 496  GLU A C     1 
ATOM   3838  O  O     . GLU A 1  496  ? 126.771 35.051  -13.894 1.00 73.84  ? 496  GLU A O     1 
ATOM   3839  C  CB    . GLU A 1  496  ? 127.408 33.230  -16.497 1.00 74.54  ? 496  GLU A CB    1 
ATOM   3840  C  CG    . GLU A 1  496  ? 126.275 33.900  -17.265 1.00 87.54  ? 496  GLU A CG    1 
ATOM   3841  C  CD    . GLU A 1  496  ? 126.773 34.545  -18.550 1.00 123.51 ? 496  GLU A CD    1 
ATOM   3842  O  OE1   . GLU A 1  496  ? 127.263 35.699  -18.495 1.00 126.99 ? 496  GLU A OE1   1 
ATOM   3843  O  OE2   . GLU A 1  496  ? 126.730 33.870  -19.605 1.00 120.49 ? 496  GLU A OE2   1 
ATOM   3844  N  N     . THR A 1  497  ? 125.136 33.525  -14.038 1.00 68.60  ? 497  THR A N     1 
ATOM   3845  C  CA    . THR A 1  497  ? 124.200 34.364  -13.329 1.00 67.86  ? 497  THR A CA    1 
ATOM   3846  C  C     . THR A 1  497  ? 124.513 34.285  -11.836 1.00 74.03  ? 497  THR A C     1 
ATOM   3847  O  O     . THR A 1  497  ? 124.299 35.256  -11.104 1.00 73.35  ? 497  THR A O     1 
ATOM   3848  C  CB    . THR A 1  497  ? 122.774 34.016  -13.736 1.00 68.91  ? 497  THR A CB    1 
ATOM   3849  O  OG1   . THR A 1  497  ? 122.000 35.188  -13.633 1.00 71.81  ? 497  THR A OG1   1 
ATOM   3850  C  CG2   . THR A 1  497  ? 122.162 32.941  -12.899 1.00 60.47  ? 497  THR A CG2   1 
ATOM   3851  N  N     . ARG A 1  498  ? 125.033 33.113  -11.397 1.00 72.19  ? 498  ARG A N     1 
ATOM   3852  C  CA    . ARG A 1  498  ? 125.407 32.863  -10.015 1.00 72.54  ? 498  ARG A CA    1 
ATOM   3853  C  C     . ARG A 1  498  ? 126.494 33.841  -9.685  1.00 79.72  ? 498  ARG A C     1 
ATOM   3854  O  O     . ARG A 1  498  ? 126.305 34.655  -8.774  1.00 80.39  ? 498  ARG A O     1 
ATOM   3855  C  CB    . ARG A 1  498  ? 125.877 31.424  -9.821  1.00 71.30  ? 498  ARG A CB    1 
ATOM   3856  C  CG    . ARG A 1  498  ? 124.727 30.507  -9.499  1.00 77.14  ? 498  ARG A CG    1 
ATOM   3857  C  CD    . ARG A 1  498  ? 125.142 29.075  -9.611  1.00 81.36  ? 498  ARG A CD    1 
ATOM   3858  N  NE    . ARG A 1  498  ? 124.916 28.371  -8.356  1.00 88.90  ? 498  ARG A NE    1 
ATOM   3859  C  CZ    . ARG A 1  498  ? 125.872 27.767  -7.660  1.00 107.30 ? 498  ARG A CZ    1 
ATOM   3860  N  NH1   . ARG A 1  498  ? 127.128 27.767  -8.101  1.00 98.32  ? 498  ARG A NH1   1 
ATOM   3861  N  NH2   . ARG A 1  498  ? 125.581 27.153  -6.520  1.00 93.70  ? 498  ARG A NH2   1 
ATOM   3862  N  N     . ALA A 1  499  ? 127.567 33.859  -10.526 1.00 76.73  ? 499  ALA A N     1 
ATOM   3863  C  CA    . ALA A 1  499  ? 128.711 34.772  -10.432 1.00 76.58  ? 499  ALA A CA    1 
ATOM   3864  C  C     . ALA A 1  499  ? 128.239 36.221  -10.288 1.00 77.94  ? 499  ALA A C     1 
ATOM   3865  O  O     . ALA A 1  499  ? 128.698 36.912  -9.383  1.00 77.32  ? 499  ALA A O     1 
ATOM   3866  C  CB    . ALA A 1  499  ? 129.601 34.626  -11.654 1.00 78.00  ? 499  ALA A CB    1 
ATOM   3867  N  N     . GLU A 1  500  ? 127.246 36.638  -11.107 1.00 72.26  ? 500  GLU A N     1 
ATOM   3868  C  CA    . GLU A 1  500  ? 126.662 37.982  -11.067 1.00 70.85  ? 500  GLU A CA    1 
ATOM   3869  C  C     . GLU A 1  500  ? 126.272 38.369  -9.648  1.00 71.67  ? 500  GLU A C     1 
ATOM   3870  O  O     . GLU A 1  500  ? 126.640 39.447  -9.179  1.00 71.20  ? 500  GLU A O     1 
ATOM   3871  C  CB    . GLU A 1  500  ? 125.442 38.072  -11.999 1.00 71.46  ? 500  GLU A CB    1 
ATOM   3872  C  CG    . GLU A 1  500  ? 125.320 39.404  -12.705 1.00 78.71  ? 500  GLU A CG    1 
ATOM   3873  C  CD    . GLU A 1  500  ? 125.209 39.300  -14.212 1.00 102.86 ? 500  GLU A CD    1 
ATOM   3874  O  OE1   . GLU A 1  500  ? 126.155 38.790  -14.865 1.00 101.37 ? 500  GLU A OE1   1 
ATOM   3875  O  OE2   . GLU A 1  500  ? 124.163 39.739  -14.739 1.00 92.27  ? 500  GLU A OE2   1 
ATOM   3876  N  N     . LEU A 1  501  ? 125.577 37.459  -8.955  1.00 66.06  ? 501  LEU A N     1 
ATOM   3877  C  CA    . LEU A 1  501  ? 125.120 37.677  -7.600  1.00 65.13  ? 501  LEU A CA    1 
ATOM   3878  C  C     . LEU A 1  501  ? 126.263 37.691  -6.623  1.00 69.81  ? 501  LEU A C     1 
ATOM   3879  O  O     . LEU A 1  501  ? 126.508 38.715  -5.986  1.00 70.06  ? 501  LEU A O     1 
ATOM   3880  C  CB    . LEU A 1  501  ? 124.075 36.635  -7.239  1.00 64.51  ? 501  LEU A CB    1 
ATOM   3881  C  CG    . LEU A 1  501  ? 122.727 36.934  -7.840  1.00 69.43  ? 501  LEU A CG    1 
ATOM   3882  C  CD1   . LEU A 1  501  ? 121.874 35.692  -7.963  1.00 69.32  ? 501  LEU A CD1   1 
ATOM   3883  C  CD2   . LEU A 1  501  ? 122.023 37.983  -7.047  1.00 73.27  ? 501  LEU A CD2   1 
ATOM   3884  N  N     . SER A 1  502  ? 127.021 36.595  -6.566  1.00 66.52  ? 502  SER A N     1 
ATOM   3885  C  CA    . SER A 1  502  ? 128.154 36.457  -5.657  1.00 66.52  ? 502  SER A CA    1 
ATOM   3886  C  C     . SER A 1  502  ? 129.242 37.526  -5.869  1.00 68.90  ? 502  SER A C     1 
ATOM   3887  O  O     . SER A 1  502  ? 129.948 37.877  -4.917  1.00 69.01  ? 502  SER A O     1 
ATOM   3888  C  CB    . SER A 1  502  ? 128.732 35.036  -5.699  1.00 69.88  ? 502  SER A CB    1 
ATOM   3889  O  OG    . SER A 1  502  ? 129.096 34.552  -6.983  1.00 74.92  ? 502  SER A OG    1 
ATOM   3890  N  N     . GLN A 1  503  ? 129.328 38.096  -7.066  1.00 63.97  ? 503  GLN A N     1 
ATOM   3891  C  CA    . GLN A 1  503  ? 130.382 39.064  -7.318  1.00 65.04  ? 503  GLN A CA    1 
ATOM   3892  C  C     . GLN A 1  503  ? 129.963 40.559  -7.253  1.00 69.34  ? 503  GLN A C     1 
ATOM   3893  O  O     . GLN A 1  503  ? 130.854 41.410  -7.074  1.00 69.21  ? 503  GLN A O     1 
ATOM   3894  C  CB    . GLN A 1  503  ? 131.097 38.754  -8.640  1.00 66.76  ? 503  GLN A CB    1 
ATOM   3895  C  CG    . GLN A 1  503  ? 131.785 37.388  -8.667  1.00 75.42  ? 503  GLN A CG    1 
ATOM   3896  C  CD    . GLN A 1  503  ? 132.522 37.086  -7.391  1.00 95.38  ? 503  GLN A CD    1 
ATOM   3897  O  OE1   . GLN A 1  503  ? 132.132 36.183  -6.632  1.00 90.65  ? 503  GLN A OE1   1 
ATOM   3898  N  NE2   . GLN A 1  503  ? 133.572 37.870  -7.104  1.00 85.87  ? 503  GLN A NE2   1 
ATOM   3899  N  N     . LEU A 1  504  ? 128.639 40.874  -7.359  1.00 64.14  ? 504  LEU A N     1 
ATOM   3900  C  CA    . LEU A 1  504  ? 128.151 42.255  -7.330  1.00 62.77  ? 504  LEU A CA    1 
ATOM   3901  C  C     . LEU A 1  504  ? 127.119 42.489  -6.278  1.00 68.06  ? 504  LEU A C     1 
ATOM   3902  O  O     . LEU A 1  504  ? 127.132 43.542  -5.652  1.00 68.83  ? 504  LEU A O     1 
ATOM   3903  C  CB    . LEU A 1  504  ? 127.541 42.689  -8.673  1.00 61.85  ? 504  LEU A CB    1 
ATOM   3904  C  CG    . LEU A 1  504  ? 128.268 42.368  -9.975  1.00 66.68  ? 504  LEU A CG    1 
ATOM   3905  C  CD1   . LEU A 1  504  ? 127.376 42.633  -11.132 1.00 67.12  ? 504  LEU A CD1   1 
ATOM   3906  C  CD2   . LEU A 1  504  ? 129.510 43.204  -10.167 1.00 68.62  ? 504  LEU A CD2   1 
ATOM   3907  N  N     . CYS A 1  505  ? 126.181 41.559  -6.126  1.00 65.92  ? 505  CYS A N     1 
ATOM   3908  C  CA    . CYS A 1  505  ? 125.018 41.727  -5.255  1.00 66.76  ? 505  CYS A CA    1 
ATOM   3909  C  C     . CYS A 1  505  ? 125.180 41.231  -3.834  1.00 71.27  ? 505  CYS A C     1 
ATOM   3910  O  O     . CYS A 1  505  ? 124.289 41.496  -3.024  1.00 71.61  ? 505  CYS A O     1 
ATOM   3911  C  CB    . CYS A 1  505  ? 123.786 41.100  -5.897  1.00 67.05  ? 505  CYS A CB    1 
ATOM   3912  S  SG    . CYS A 1  505  ? 123.476 41.639  -7.593  1.00 71.22  ? 505  CYS A SG    1 
ATOM   3913  N  N     . ALA A 1  506  ? 126.238 40.468  -3.533  1.00 67.45  ? 506  ALA A N     1 
ATOM   3914  C  CA    . ALA A 1  506  ? 126.438 39.919  -2.192  1.00 66.97  ? 506  ALA A CA    1 
ATOM   3915  C  C     . ALA A 1  506  ? 126.408 40.955  -1.076  1.00 67.93  ? 506  ALA A C     1 
ATOM   3916  O  O     . ALA A 1  506  ? 126.876 42.094  -1.231  1.00 67.73  ? 506  ALA A O     1 
ATOM   3917  C  CB    . ALA A 1  506  ? 127.715 39.107  -2.131  1.00 68.78  ? 506  ALA A CB    1 
ATOM   3918  N  N     . VAL A 1  507  ? 125.802 40.551  0.034   1.00 61.79  ? 507  VAL A N     1 
ATOM   3919  C  CA    . VAL A 1  507  ? 125.632 41.368  1.218   1.00 61.17  ? 507  VAL A CA    1 
ATOM   3920  C  C     . VAL A 1  507  ? 126.942 42.070  1.638   1.00 65.35  ? 507  VAL A C     1 
ATOM   3921  O  O     . VAL A 1  507  ? 126.899 43.299  1.786   1.00 64.75  ? 507  VAL A O     1 
ATOM   3922  C  CB    . VAL A 1  507  ? 124.994 40.533  2.348   1.00 64.72  ? 507  VAL A CB    1 
ATOM   3923  C  CG1   . VAL A 1  507  ? 124.933 41.303  3.657   1.00 65.32  ? 507  VAL A CG1   1 
ATOM   3924  C  CG2   . VAL A 1  507  ? 123.614 40.066  1.948   1.00 63.65  ? 507  VAL A CG2   1 
ATOM   3925  N  N     . PRO A 1  508  ? 128.110 41.362  1.766   1.00 62.46  ? 508  PRO A N     1 
ATOM   3926  C  CA    . PRO A 1  508  ? 129.345 42.041  2.210   1.00 64.04  ? 508  PRO A CA    1 
ATOM   3927  C  C     . PRO A 1  508  ? 129.746 43.246  1.381   1.00 71.65  ? 508  PRO A C     1 
ATOM   3928  O  O     . PRO A 1  508  ? 130.316 44.217  1.894   1.00 72.41  ? 508  PRO A O     1 
ATOM   3929  C  CB    . PRO A 1  508  ? 130.399 40.946  2.107   1.00 65.57  ? 508  PRO A CB    1 
ATOM   3930  C  CG    . PRO A 1  508  ? 129.662 39.728  2.289   1.00 68.69  ? 508  PRO A CG    1 
ATOM   3931  C  CD    . PRO A 1  508  ? 128.358 39.918  1.608   1.00 63.14  ? 508  PRO A CD    1 
ATOM   3932  N  N     . LEU A 1  509  ? 129.411 43.178  0.094   1.00 68.92  ? 509  LEU A N     1 
ATOM   3933  C  CA    . LEU A 1  509  ? 129.685 44.221  -0.878  1.00 68.89  ? 509  LEU A CA    1 
ATOM   3934  C  C     . LEU A 1  509  ? 128.783 45.410  -0.624  1.00 71.83  ? 509  LEU A C     1 
ATOM   3935  O  O     . LEU A 1  509  ? 129.259 46.552  -0.648  1.00 71.85  ? 509  LEU A O     1 
ATOM   3936  C  CB    . LEU A 1  509  ? 129.485 43.660  -2.293  1.00 68.10  ? 509  LEU A CB    1 
ATOM   3937  C  CG    . LEU A 1  509  ? 130.108 42.277  -2.541  1.00 72.45  ? 509  LEU A CG    1 
ATOM   3938  C  CD1   . LEU A 1  509  ? 129.681 41.712  -3.870  1.00 71.71  ? 509  LEU A CD1   1 
ATOM   3939  C  CD2   . LEU A 1  509  ? 131.629 42.322  -2.434  1.00 77.26  ? 509  LEU A CD2   1 
ATOM   3940  N  N     . GLN A 1  510  ? 127.510 45.131  -0.269  1.00 67.28  ? 510  GLN A N     1 
ATOM   3941  C  CA    . GLN A 1  510  ? 126.502 46.161  -0.041  1.00 66.97  ? 510  GLN A CA    1 
ATOM   3942  C  C     . GLN A 1  510  ? 126.650 46.963  1.256   1.00 73.12  ? 510  GLN A C     1 
ATOM   3943  O  O     . GLN A 1  510  ? 126.001 48.021  1.340   1.00 72.23  ? 510  GLN A O     1 
ATOM   3944  C  CB    . GLN A 1  510  ? 125.094 45.588  -0.167  1.00 66.45  ? 510  GLN A CB    1 
ATOM   3945  C  CG    . GLN A 1  510  ? 124.798 45.092  -1.582  1.00 70.28  ? 510  GLN A CG    1 
ATOM   3946  C  CD    . GLN A 1  510  ? 125.173 46.092  -2.653  1.00 91.81  ? 510  GLN A CD    1 
ATOM   3947  O  OE1   . GLN A 1  510  ? 125.113 47.317  -2.450  1.00 91.68  ? 510  GLN A OE1   1 
ATOM   3948  N  NE2   . GLN A 1  510  ? 125.597 45.592  -3.810  1.00 79.20  ? 510  GLN A NE2   1 
ATOM   3949  N  N     . ILE A 1  511  ? 127.576 46.532  2.194   1.00 71.37  ? 511  ILE A N     1 
ATOM   3950  C  CA    . ILE A 1  511  ? 127.867 47.156  3.511   1.00 72.20  ? 511  ILE A CA    1 
ATOM   3951  C  C     . ILE A 1  511  ? 128.017 48.684  3.424   1.00 78.64  ? 511  ILE A C     1 
ATOM   3952  O  O     . ILE A 1  511  ? 127.194 49.361  4.038   1.00 78.75  ? 511  ILE A O     1 
ATOM   3953  C  CB    . ILE A 1  511  ? 129.036 46.515  4.316   1.00 75.16  ? 511  ILE A CB    1 
ATOM   3954  C  CG1   . ILE A 1  511  ? 128.681 45.064  4.721   1.00 74.23  ? 511  ILE A CG1   1 
ATOM   3955  C  CG2   . ILE A 1  511  ? 129.348 47.356  5.569   1.00 75.81  ? 511  ILE A CG2   1 
ATOM   3956  C  CD1   . ILE A 1  511  ? 129.737 44.310  5.565   1.00 79.21  ? 511  ILE A CD1   1 
ATOM   3957  N  N     . VAL A 1  512  ? 129.021 49.229  2.693   1.00 77.04  ? 512  VAL A N     1 
ATOM   3958  C  CA    . VAL A 1  512  ? 129.128 50.692  2.570   1.00 78.78  ? 512  VAL A CA    1 
ATOM   3959  C  C     . VAL A 1  512  ? 128.210 51.172  1.412   1.00 88.00  ? 512  VAL A C     1 
ATOM   3960  O  O     . VAL A 1  512  ? 128.361 50.690  0.288   1.00 89.44  ? 512  VAL A O     1 
ATOM   3961  C  CB    . VAL A 1  512  ? 130.591 51.196  2.508   1.00 82.50  ? 512  VAL A CB    1 
ATOM   3962  C  CG1   . VAL A 1  512  ? 130.746 52.382  1.578   1.00 82.96  ? 512  VAL A CG1   1 
ATOM   3963  C  CG2   . VAL A 1  512  ? 131.094 51.552  3.901   1.00 82.93  ? 512  VAL A CG2   1 
ATOM   3964  N  N     . SER A 1  513  ? 127.210 52.043  1.710   1.00 85.72  ? 513  SER A N     1 
ATOM   3965  C  CA    . SER A 1  513  ? 126.229 52.536  0.730   1.00 85.29  ? 513  SER A CA    1 
ATOM   3966  C  C     . SER A 1  513  ? 126.680 53.838  0.051   1.00 89.50  ? 513  SER A C     1 
ATOM   3967  O  O     . SER A 1  513  ? 127.136 54.760  0.740   1.00 90.44  ? 513  SER A O     1 
ATOM   3968  C  CB    . SER A 1  513  ? 124.859 52.723  1.378   1.00 89.70  ? 513  SER A CB    1 
ATOM   3969  O  OG    . SER A 1  513  ? 123.953 53.477  0.585   1.00 98.94  ? 513  SER A OG    1 
ATOM   3970  N  N     . PRO A 1  514  ? 126.502 53.950  -1.293  1.00 84.39  ? 514  PRO A N     1 
ATOM   3971  C  CA    . PRO A 1  514  ? 126.916 55.175  -1.987  1.00 84.67  ? 514  PRO A CA    1 
ATOM   3972  C  C     . PRO A 1  514  ? 125.868 56.290  -1.950  1.00 89.20  ? 514  PRO A C     1 
ATOM   3973  O  O     . PRO A 1  514  ? 126.118 57.357  -2.494  1.00 90.10  ? 514  PRO A O     1 
ATOM   3974  C  CB    . PRO A 1  514  ? 127.183 54.683  -3.408  1.00 85.26  ? 514  PRO A CB    1 
ATOM   3975  C  CG    . PRO A 1  514  ? 126.181 53.625  -3.599  1.00 88.26  ? 514  PRO A CG    1 
ATOM   3976  C  CD    . PRO A 1  514  ? 125.948 52.971  -2.251  1.00 83.99  ? 514  PRO A CD    1 
ATOM   3977  N  N     . GLN A 1  515  ? 124.704 56.075  -1.337  1.00 85.14  ? 515  GLN A N     1 
ATOM   3978  C  CA    . GLN A 1  515  ? 123.762 57.182  -1.326  1.00 86.41  ? 515  GLN A CA    1 
ATOM   3979  C  C     . GLN A 1  515  ? 124.068 58.150  -0.218  1.00 91.73  ? 515  GLN A C     1 
ATOM   3980  O  O     . GLN A 1  515  ? 123.754 59.337  -0.312  1.00 93.82  ? 515  GLN A O     1 
ATOM   3981  C  CB    . GLN A 1  515  ? 122.291 56.732  -1.317  1.00 87.74  ? 515  GLN A CB    1 
ATOM   3982  C  CG    . GLN A 1  515  ? 121.808 55.848  -0.165  1.00 116.56 ? 515  GLN A CG    1 
ATOM   3983  C  CD    . GLN A 1  515  ? 120.316 55.611  -0.288  1.00 134.31 ? 515  GLN A CD    1 
ATOM   3984  O  OE1   . GLN A 1  515  ? 119.839 54.888  -1.183  1.00 123.78 ? 515  GLN A OE1   1 
ATOM   3985  N  NE2   . GLN A 1  515  ? 119.544 56.274  0.567   1.00 128.51 ? 515  GLN A NE2   1 
ATOM   3986  N  N     . SER A 1  516  ? 124.745 57.654  0.801   1.00 86.58  ? 516  SER A N     1 
ATOM   3987  C  CA    . SER A 1  516  ? 125.070 58.410  1.993   1.00 87.03  ? 516  SER A CA    1 
ATOM   3988  C  C     . SER A 1  516  ? 126.557 58.531  2.214   1.00 86.61  ? 516  SER A C     1 
ATOM   3989  O  O     . SER A 1  516  ? 126.953 59.254  3.124   1.00 87.61  ? 516  SER A O     1 
ATOM   3990  C  CB    . SER A 1  516  ? 124.467 57.685  3.187   1.00 93.77  ? 516  SER A CB    1 
ATOM   3991  O  OG    . SER A 1  516  ? 124.815 56.306  3.123   1.00 107.98 ? 516  SER A OG    1 
ATOM   3992  N  N     . ASN A 1  517  ? 127.376 57.777  1.432   1.00 78.36  ? 517  ASN A N     1 
ATOM   3993  C  CA    . ASN A 1  517  ? 128.844 57.670  1.501   1.00 76.82  ? 517  ASN A CA    1 
ATOM   3994  C  C     . ASN A 1  517  ? 129.283 57.130  2.860   1.00 77.40  ? 517  ASN A C     1 
ATOM   3995  O  O     . ASN A 1  517  ? 130.395 57.405  3.314   1.00 77.42  ? 517  ASN A O     1 
ATOM   3996  C  CB    . ASN A 1  517  ? 129.594 58.967  1.079   1.00 78.08  ? 517  ASN A CB    1 
ATOM   3997  C  CG    . ASN A 1  517  ? 129.517 60.198  1.973   1.00 101.28 ? 517  ASN A CG    1 
ATOM   3998  O  OD1   . ASN A 1  517  ? 129.833 60.184  3.163   1.00 99.02  ? 517  ASN A OD1   1 
ATOM   3999  N  ND2   . ASN A 1  517  ? 129.212 61.333  1.383   1.00 90.38  ? 517  ASN A ND2   1 
ATOM   4000  N  N     . LYS A 1  518  ? 128.411 56.303  3.472   1.00 71.82  ? 518  LYS A N     1 
ATOM   4001  C  CA    . LYS A 1  518  ? 128.577 55.699  4.794   1.00 71.82  ? 518  LYS A CA    1 
ATOM   4002  C  C     . LYS A 1  518  ? 128.019 54.236  4.825   1.00 75.76  ? 518  LYS A C     1 
ATOM   4003  O  O     . LYS A 1  518  ? 127.236 53.886  3.930   1.00 73.62  ? 518  LYS A O     1 
ATOM   4004  C  CB    . LYS A 1  518  ? 127.911 56.644  5.851   1.00 74.76  ? 518  LYS A CB    1 
ATOM   4005  C  CG    . LYS A 1  518  ? 126.850 56.055  6.815   1.00 80.76  ? 518  LYS A CG    1 
ATOM   4006  C  CD    . LYS A 1  518  ? 125.457 56.669  6.680   1.00 84.44  ? 518  LYS A CD    1 
ATOM   4007  C  CE    . LYS A 1  518  ? 124.345 55.708  7.042   1.00 94.69  ? 518  LYS A CE    1 
ATOM   4008  N  NZ    . LYS A 1  518  ? 124.111 54.680  5.975   1.00 105.30 ? 518  LYS A NZ    1 
ATOM   4009  N  N     . PRO A 1  519  ? 128.376 53.379  5.840   1.00 73.97  ? 519  PRO A N     1 
ATOM   4010  C  CA    . PRO A 1  519  ? 127.787 52.024  5.897   1.00 72.35  ? 519  PRO A CA    1 
ATOM   4011  C  C     . PRO A 1  519  ? 126.295 51.970  6.237   1.00 73.82  ? 519  PRO A C     1 
ATOM   4012  O  O     . PRO A 1  519  ? 125.867 52.477  7.262   1.00 71.90  ? 519  PRO A O     1 
ATOM   4013  C  CB    . PRO A 1  519  ? 128.636 51.300  6.950   1.00 74.91  ? 519  PRO A CB    1 
ATOM   4014  C  CG    . PRO A 1  519  ? 129.200 52.366  7.810   1.00 81.06  ? 519  PRO A CG    1 
ATOM   4015  C  CD    . PRO A 1  519  ? 129.309 53.605  6.971   1.00 77.19  ? 519  PRO A CD    1 
ATOM   4016  N  N     . CYS A 1  520  ? 125.526 51.302  5.385   1.00 72.03  ? 520  CYS A N     1 
ATOM   4017  C  CA    . CYS A 1  520  ? 124.077 51.103  5.506   1.00 73.34  ? 520  CYS A CA    1 
ATOM   4018  C  C     . CYS A 1  520  ? 123.619 49.969  6.531   1.00 77.90  ? 520  CYS A C     1 
ATOM   4019  O  O     . CYS A 1  520  ? 122.410 49.671  6.660   1.00 77.72  ? 520  CYS A O     1 
ATOM   4020  C  CB    . CYS A 1  520  ? 123.491 50.858  4.124   1.00 73.42  ? 520  CYS A CB    1 
ATOM   4021  S  SG    . CYS A 1  520  ? 123.665 49.150  3.560   1.00 76.44  ? 520  CYS A SG    1 
ATOM   4022  N  N     . MET A 1  521  ? 124.584 49.334  7.217   1.00 72.85  ? 521  MET A N     1 
ATOM   4023  C  CA    . MET A 1  521  ? 124.313 48.335  8.242   1.00 71.02  ? 521  MET A CA    1 
ATOM   4024  C  C     . MET A 1  521  ? 125.370 48.360  9.332   1.00 78.77  ? 521  MET A C     1 
ATOM   4025  O  O     . MET A 1  521  ? 126.570 48.447  9.033   1.00 79.11  ? 521  MET A O     1 
ATOM   4026  C  CB    . MET A 1  521  ? 124.092 46.930  7.678   1.00 71.02  ? 521  MET A CB    1 
ATOM   4027  C  CG    . MET A 1  521  ? 124.913 46.588  6.476   1.00 72.90  ? 521  MET A CG    1 
ATOM   4028  S  SD    . MET A 1  521  ? 124.363 44.982  5.865   1.00 74.50  ? 521  MET A SD    1 
ATOM   4029  C  CE    . MET A 1  521  ? 124.672 45.190  4.141   1.00 70.49  ? 521  MET A CE    1 
ATOM   4030  N  N     . GLY A 1  522  ? 124.896 48.350  10.580  1.00 77.26  ? 522  GLY A N     1 
ATOM   4031  C  CA    . GLY A 1  522  ? 125.708 48.343  11.797  1.00 78.67  ? 522  GLY A CA    1 
ATOM   4032  C  C     . GLY A 1  522  ? 125.141 47.381  12.820  1.00 83.87  ? 522  GLY A C     1 
ATOM   4033  O  O     . GLY A 1  522  ? 124.230 46.609  12.489  1.00 83.51  ? 522  GLY A O     1 
ATOM   4034  N  N     . ILE A 1  523  ? 125.652 47.420  14.073  1.00 81.58  ? 523  ILE A N     1 
ATOM   4035  C  CA    . ILE A 1  523  ? 125.170 46.549  15.163  1.00 81.90  ? 523  ILE A CA    1 
ATOM   4036  C  C     . ILE A 1  523  ? 123.828 47.112  15.755  1.00 89.97  ? 523  ILE A C     1 
ATOM   4037  O  O     . ILE A 1  523  ? 123.716 48.313  16.030  1.00 91.19  ? 523  ILE A O     1 
ATOM   4038  C  CB    . ILE A 1  523  ? 126.306 46.279  16.191  1.00 85.06  ? 523  ILE A CB    1 
ATOM   4039  C  CG1   . ILE A 1  523  ? 127.114 45.046  15.778  1.00 84.64  ? 523  ILE A CG1   1 
ATOM   4040  C  CG2   . ILE A 1  523  ? 125.819 46.113  17.625  1.00 85.59  ? 523  ILE A CG2   1 
ATOM   4041  C  CD1   . ILE A 1  523  ? 128.078 45.216  14.644  1.00 91.33  ? 523  ILE A CD1   1 
ATOM   4042  N  N     . VAL A 1  524  ? 122.796 46.242  15.884  1.00 86.70  ? 524  VAL A N     1 
ATOM   4043  C  CA    . VAL A 1  524  ? 121.456 46.668  16.307  1.00 86.97  ? 524  VAL A CA    1 
ATOM   4044  C  C     . VAL A 1  524  ? 120.916 45.996  17.561  1.00 89.64  ? 524  VAL A C     1 
ATOM   4045  O  O     . VAL A 1  524  ? 121.341 44.894  17.905  1.00 89.96  ? 524  VAL A O     1 
ATOM   4046  C  CB    . VAL A 1  524  ? 120.423 46.465  15.158  1.00 91.23  ? 524  VAL A CB    1 
ATOM   4047  C  CG1   . VAL A 1  524  ? 119.391 47.604  15.129  1.00 92.46  ? 524  VAL A CG1   1 
ATOM   4048  C  CG2   . VAL A 1  524  ? 121.080 46.249  13.782  1.00 90.07  ? 524  VAL A CG2   1 
ATOM   4049  N  N     . GLN A 1  525  ? 119.894 46.629  18.173  1.00 84.91  ? 525  GLN A N     1 
ATOM   4050  C  CA    . GLN A 1  525  ? 119.094 46.150  19.300  1.00 84.75  ? 525  GLN A CA    1 
ATOM   4051  C  C     . GLN A 1  525  ? 119.896 45.440  20.408  1.00 87.59  ? 525  GLN A C     1 
ATOM   4052  O  O     . GLN A 1  525  ? 120.798 46.074  20.953  1.00 87.33  ? 525  GLN A O     1 
ATOM   4053  C  CB    . GLN A 1  525  ? 117.940 45.271  18.792  1.00 85.06  ? 525  GLN A CB    1 
ATOM   4054  C  CG    . GLN A 1  525  ? 116.768 46.079  18.234  1.00 101.12 ? 525  GLN A CG    1 
ATOM   4055  C  CD    . GLN A 1  525  ? 115.431 45.469  18.591  1.00 120.88 ? 525  GLN A CD    1 
ATOM   4056  O  OE1   . GLN A 1  525  ? 115.313 44.271  18.896  1.00 114.25 ? 525  GLN A OE1   1 
ATOM   4057  N  NE2   . GLN A 1  525  ? 114.382 46.281  18.545  1.00 115.73 ? 525  GLN A NE2   1 
ATOM   4058  N  N     . ASP A 1  526  ? 119.560 44.152  20.752  1.00 83.46  ? 526  ASP A N     1 
ATOM   4059  C  CA    . ASP A 1  526  ? 120.208 43.364  21.814  1.00 84.30  ? 526  ASP A CA    1 
ATOM   4060  C  C     . ASP A 1  526  ? 121.720 43.540  21.817  1.00 87.78  ? 526  ASP A C     1 
ATOM   4061  O  O     . ASP A 1  526  ? 122.274 43.927  22.842  1.00 90.00  ? 526  ASP A O     1 
ATOM   4062  C  CB    . ASP A 1  526  ? 119.867 41.852  21.738  1.00 86.43  ? 526  ASP A CB    1 
ATOM   4063  C  CG    . ASP A 1  526  ? 118.567 41.370  22.382  1.00 108.86 ? 526  ASP A CG    1 
ATOM   4064  O  OD1   . ASP A 1  526  ? 117.619 42.177  22.482  1.00 112.86 ? 526  ASP A OD1   1 
ATOM   4065  O  OD2   . ASP A 1  526  ? 118.472 40.146  22.713  1.00 115.39 ? 526  ASP A OD2   1 
ATOM   4066  N  N     . THR A 1  527  ? 122.379 43.308  20.667  1.00 81.22  ? 527  THR A N     1 
ATOM   4067  C  CA    . THR A 1  527  ? 123.831 43.406  20.528  1.00 80.54  ? 527  THR A CA    1 
ATOM   4068  C  C     . THR A 1  527  ? 124.348 44.818  20.758  1.00 85.33  ? 527  THR A C     1 
ATOM   4069  O  O     . THR A 1  527  ? 125.439 44.968  21.287  1.00 86.22  ? 527  THR A O     1 
ATOM   4070  C  CB    . THR A 1  527  ? 124.303 42.824  19.207  1.00 83.44  ? 527  THR A CB    1 
ATOM   4071  O  OG1   . THR A 1  527  ? 123.294 41.969  18.663  1.00 85.62  ? 527  THR A OG1   1 
ATOM   4072  C  CG2   . THR A 1  527  ? 125.601 42.067  19.350  1.00 77.55  ? 527  THR A CG2   1 
ATOM   4073  N  N     . LEU A 1  528  ? 123.572 45.846  20.406  1.00 82.09  ? 528  LEU A N     1 
ATOM   4074  C  CA    . LEU A 1  528  ? 123.994 47.223  20.649  1.00 83.67  ? 528  LEU A CA    1 
ATOM   4075  C  C     . LEU A 1  528  ? 123.824 47.584  22.137  1.00 93.40  ? 528  LEU A C     1 
ATOM   4076  O  O     . LEU A 1  528  ? 124.735 48.163  22.736  1.00 95.19  ? 528  LEU A O     1 
ATOM   4077  C  CB    . LEU A 1  528  ? 123.257 48.209  19.716  1.00 82.61  ? 528  LEU A CB    1 
ATOM   4078  C  CG    . LEU A 1  528  ? 123.414 49.714  19.979  1.00 87.37  ? 528  LEU A CG    1 
ATOM   4079  C  CD1   . LEU A 1  528  ? 124.854 50.126  20.012  1.00 87.68  ? 528  LEU A CD1   1 
ATOM   4080  C  CD2   . LEU A 1  528  ? 122.724 50.507  18.921  1.00 89.22  ? 528  LEU A CD2   1 
ATOM   4081  N  N     . CYS A 1  529  ? 122.671 47.225  22.731  1.00 91.65  ? 529  CYS A N     1 
ATOM   4082  C  CA    . CYS A 1  529  ? 122.351 47.475  24.142  1.00 93.38  ? 529  CYS A CA    1 
ATOM   4083  C  C     . CYS A 1  529  ? 123.364 46.785  25.058  1.00 93.66  ? 529  CYS A C     1 
ATOM   4084  O  O     . CYS A 1  529  ? 123.841 47.402  26.013  1.00 95.08  ? 529  CYS A O     1 
ATOM   4085  C  CB    . CYS A 1  529  ? 120.922 47.034  24.447  1.00 94.59  ? 529  CYS A CB    1 
ATOM   4086  S  SG    . CYS A 1  529  ? 120.388 47.348  26.149  1.00 100.99 ? 529  CYS A SG    1 
ATOM   4087  N  N     . GLY A 1  530  ? 123.695 45.540  24.713  1.00 85.82  ? 530  GLY A N     1 
ATOM   4088  C  CA    . GLY A 1  530  ? 124.656 44.697  25.408  1.00 85.14  ? 530  GLY A CA    1 
ATOM   4089  C  C     . GLY A 1  530  ? 126.107 45.080  25.186  1.00 87.76  ? 530  GLY A C     1 
ATOM   4090  O  O     . GLY A 1  530  ? 126.932 44.836  26.069  1.00 88.50  ? 530  GLY A O     1 
ATOM   4091  N  N     . ILE A 1  531  ? 126.450 45.674  24.015  1.00 81.95  ? 531  ILE A N     1 
ATOM   4092  C  CA    . ILE A 1  531  ? 127.830 46.089  23.769  1.00 81.77  ? 531  ILE A CA    1 
ATOM   4093  C  C     . ILE A 1  531  ? 128.198 47.247  24.702  1.00 88.77  ? 531  ILE A C     1 
ATOM   4094  O  O     . ILE A 1  531  ? 129.302 47.240  25.226  1.00 90.08  ? 531  ILE A O     1 
ATOM   4095  C  CB    . ILE A 1  531  ? 128.188 46.343  22.287  1.00 83.26  ? 531  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A 1  531  ? 129.696 46.207  22.063  1.00 83.94  ? 531  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A 1  531  ? 127.656 47.675  21.768  1.00 84.01  ? 531  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A 1  531  ? 130.102 45.975  20.688  1.00 88.37  ? 531  ILE A CD1   1 
ATOM   4099  N  N     . ARG A 1  532  ? 127.259 48.180  24.979  1.00 86.57  ? 532  ARG A N     1 
ATOM   4100  C  CA    . ARG A 1  532  ? 127.480 49.294  25.916  1.00 88.82  ? 532  ARG A CA    1 
ATOM   4101  C  C     . ARG A 1  532  ? 127.738 48.742  27.314  1.00 93.77  ? 532  ARG A C     1 
ATOM   4102  O  O     . ARG A 1  532  ? 128.755 49.078  27.937  1.00 94.68  ? 532  ARG A O     1 
ATOM   4103  C  CB    . ARG A 1  532  ? 126.268 50.244  25.944  1.00 90.34  ? 532  ARG A CB    1 
ATOM   4104  C  CG    . ARG A 1  532  ? 126.629 51.649  26.402  1.00 103.34 ? 532  ARG A CG    1 
ATOM   4105  C  CD    . ARG A 1  532  ? 125.446 52.413  26.942  1.00 113.41 ? 532  ARG A CD    1 
ATOM   4106  N  NE    . ARG A 1  532  ? 125.403 52.421  28.405  1.00 119.65 ? 532  ARG A NE    1 
ATOM   4107  C  CZ    . ARG A 1  532  ? 124.667 51.594  29.141  1.00 128.39 ? 532  ARG A CZ    1 
ATOM   4108  N  NH1   . ARG A 1  532  ? 123.913 50.660  28.557  1.00 105.59 ? 532  ARG A NH1   1 
ATOM   4109  N  NH2   . ARG A 1  532  ? 124.676 51.692  30.467  1.00 114.12 ? 532  ARG A NH2   1 
ATOM   4110  N  N     . LYS A 1  533  ? 126.822 47.843  27.763  1.00 89.37  ? 533  LYS A N     1 
ATOM   4111  C  CA    . LYS A 1  533  ? 126.828 47.148  29.050  1.00 89.63  ? 533  LYS A CA    1 
ATOM   4112  C  C     . LYS A 1  533  ? 128.132 46.402  29.240  1.00 95.88  ? 533  LYS A C     1 
ATOM   4113  O  O     . LYS A 1  533  ? 128.797 46.589  30.264  1.00 97.68  ? 533  LYS A O     1 
ATOM   4114  C  CB    . LYS A 1  533  ? 125.605 46.222  29.194  1.00 89.17  ? 533  LYS A CB    1 
ATOM   4115  C  CG    . LYS A 1  533  ? 124.299 46.998  29.373  1.00 90.17  ? 533  LYS A CG    1 
ATOM   4116  C  CD    . LYS A 1  533  ? 123.209 46.200  30.051  1.00 91.84  ? 533  LYS A CD    1 
ATOM   4117  C  CE    . LYS A 1  533  ? 123.389 46.148  31.545  1.00 100.39 ? 533  LYS A CE    1 
ATOM   4118  N  NZ    . LYS A 1  533  ? 122.308 45.373  32.200  1.00 110.09 ? 533  LYS A NZ    1 
ATOM   4119  N  N     . LEU A 1  534  ? 128.546 45.635  28.215  1.00 91.80  ? 534  LEU A N     1 
ATOM   4120  C  CA    . LEU A 1  534  ? 129.795 44.877  28.246  1.00 91.98  ? 534  LEU A CA    1 
ATOM   4121  C  C     . LEU A 1  534  ? 131.012 45.792  28.372  1.00 99.88  ? 534  LEU A C     1 
ATOM   4122  O  O     . LEU A 1  534  ? 131.911 45.493  29.152  1.00 101.24 ? 534  LEU A O     1 
ATOM   4123  C  CB    . LEU A 1  534  ? 129.923 43.957  27.009  1.00 89.46  ? 534  LEU A CB    1 
ATOM   4124  C  CG    . LEU A 1  534  ? 131.259 43.246  26.805  1.00 93.14  ? 534  LEU A CG    1 
ATOM   4125  C  CD1   . LEU A 1  534  ? 131.411 42.051  27.735  1.00 93.36  ? 534  LEU A CD1   1 
ATOM   4126  C  CD2   . LEU A 1  534  ? 131.451 42.866  25.354  1.00 93.30  ? 534  LEU A CD2   1 
ATOM   4127  N  N     . THR A 1  535  ? 131.023 46.911  27.636  1.00 97.36  ? 535  THR A N     1 
ATOM   4128  C  CA    . THR A 1  535  ? 132.170 47.800  27.575  1.00 98.99  ? 535  THR A CA    1 
ATOM   4129  C  C     . THR A 1  535  ? 132.507 48.465  28.936  1.00 106.12 ? 535  THR A C     1 
ATOM   4130  O  O     . THR A 1  535  ? 133.491 48.034  29.553  1.00 108.10 ? 535  THR A O     1 
ATOM   4131  C  CB    . THR A 1  535  ? 132.025 48.793  26.419  1.00 106.91 ? 535  THR A CB    1 
ATOM   4132  O  OG1   . THR A 1  535  ? 131.857 48.054  25.214  1.00 103.25 ? 535  THR A OG1   1 
ATOM   4133  C  CG2   . THR A 1  535  ? 133.244 49.637  26.241  1.00 108.80 ? 535  THR A CG2   1 
ATOM   4134  N  N     . LEU A 1  536  ? 131.732 49.498  29.374  1.00 102.10 ? 536  LEU A N     1 
ATOM   4135  C  CA    . LEU A 1  536  ? 131.925 50.355  30.570  1.00 103.26 ? 536  LEU A CA    1 
ATOM   4136  C  C     . LEU A 1  536  ? 132.862 49.790  31.679  1.00 110.58 ? 536  LEU A C     1 
ATOM   4137  O  O     . LEU A 1  536  ? 132.676 48.652  32.113  1.00 110.27 ? 536  LEU A O     1 
ATOM   4138  C  CB    . LEU A 1  536  ? 130.583 50.777  31.175  1.00 102.46 ? 536  LEU A CB    1 
ATOM   4139  C  CG    . LEU A 1  536  ? 129.501 49.736  31.287  1.00 103.61 ? 536  LEU A CG    1 
ATOM   4140  C  CD1   . LEU A 1  536  ? 129.336 49.320  32.715  1.00 104.82 ? 536  LEU A CD1   1 
ATOM   4141  C  CD2   . LEU A 1  536  ? 128.199 50.285  30.791  1.00 102.28 ? 536  LEU A CD2   1 
ATOM   4142  N  N     . ARG A 1  537  ? 133.861 50.609  32.122  1.00 109.60 ? 537  ARG A N     1 
ATOM   4143  C  CA    . ARG A 1  537  ? 134.915 50.310  33.120  1.00 111.68 ? 537  ARG A CA    1 
ATOM   4144  C  C     . ARG A 1  537  ? 134.539 49.388  34.307  1.00 117.60 ? 537  ARG A C     1 
ATOM   4145  O  O     . ARG A 1  537  ? 135.415 48.707  34.825  1.00 117.36 ? 537  ARG A O     1 
ATOM   4146  C  CB    . ARG A 1  537  ? 135.518 51.601  33.694  1.00 113.99 ? 537  ARG A CB    1 
ATOM   4147  C  CG    . ARG A 1  537  ? 136.502 52.295  32.779  1.00 126.43 ? 537  ARG A CG    1 
ATOM   4148  C  CD    . ARG A 1  537  ? 137.333 53.326  33.535  1.00 139.14 ? 537  ARG A CD    1 
ATOM   4149  N  NE    . ARG A 1  537  ? 136.898 54.702  33.288  1.00 144.78 ? 537  ARG A NE    1 
ATOM   4150  C  CZ    . ARG A 1  537  ? 137.324 55.464  32.282  1.00 155.22 ? 537  ARG A CZ    1 
ATOM   4151  N  NH1   . ARG A 1  537  ? 138.198 54.988  31.401  1.00 139.01 ? 537  ARG A NH1   1 
ATOM   4152  N  NH2   . ARG A 1  537  ? 136.862 56.697  32.138  1.00 141.18 ? 537  ARG A NH2   1 
ATOM   4153  N  N     . ASP A 1  538  ? 133.275 49.399  34.759  1.00 115.87 ? 538  ASP A N     1 
ATOM   4154  C  CA    . ASP A 1  538  ? 132.774 48.583  35.873  1.00 117.34 ? 538  ASP A CA    1 
ATOM   4155  C  C     . ASP A 1  538  ? 132.630 47.077  35.530  1.00 122.26 ? 538  ASP A C     1 
ATOM   4156  O  O     . ASP A 1  538  ? 132.606 46.231  36.437  1.00 123.31 ? 538  ASP A O     1 
ATOM   4157  C  CB    . ASP A 1  538  ? 131.418 49.134  36.338  1.00 119.79 ? 538  ASP A CB    1 
ATOM   4158  C  CG    . ASP A 1  538  ? 131.412 49.726  37.731  1.00 136.79 ? 538  ASP A CG    1 
ATOM   4159  O  OD1   . ASP A 1  538  ? 132.500 50.104  38.225  1.00 145.44 ? 538  ASP A OD1   1 
ATOM   4160  O  OD2   . ASP A 1  538  ? 130.315 49.824  38.328  1.00 138.62 ? 538  ASP A OD2   1 
ATOM   4161  N  N     . THR A 1  539  ? 132.499 46.753  34.225  1.00 116.71 ? 539  THR A N     1 
ATOM   4162  C  CA    . THR A 1  539  ? 132.350 45.386  33.735  1.00 114.03 ? 539  THR A CA    1 
ATOM   4163  C  C     . THR A 1  539  ? 133.689 44.640  33.749  1.00 117.62 ? 539  THR A C     1 
ATOM   4164  O  O     . THR A 1  539  ? 134.639 45.028  33.053  1.00 116.71 ? 539  THR A O     1 
ATOM   4165  C  CB    . THR A 1  539  ? 131.646 45.376  32.364  1.00 115.16 ? 539  THR A CB    1 
ATOM   4166  O  OG1   . THR A 1  539  ? 130.390 46.043  32.479  1.00 112.18 ? 539  THR A OG1   1 
ATOM   4167  C  CG2   . THR A 1  539  ? 131.420 43.964  31.822  1.00 111.45 ? 539  THR A CG2   1 
ATOM   4168  N  N     . PHE A 1  540  ? 133.737 43.565  34.555  1.00 114.80 ? 540  PHE A N     1 
ATOM   4169  C  CA    . PHE A 1  540  ? 134.871 42.657  34.676  1.00 115.50 ? 540  PHE A CA    1 
ATOM   4170  C  C     . PHE A 1  540  ? 134.438 41.220  34.587  1.00 116.18 ? 540  PHE A C     1 
ATOM   4171  O  O     . PHE A 1  540  ? 133.467 40.808  35.224  1.00 115.40 ? 540  PHE A O     1 
ATOM   4172  C  CB    . PHE A 1  540  ? 135.651 42.885  35.955  1.00 120.54 ? 540  PHE A CB    1 
ATOM   4173  C  CG    . PHE A 1  540  ? 136.365 44.205  35.973  1.00 124.68 ? 540  PHE A CG    1 
ATOM   4174  C  CD1   . PHE A 1  540  ? 137.556 44.378  35.278  1.00 128.18 ? 540  PHE A CD1   1 
ATOM   4175  C  CD2   . PHE A 1  540  ? 135.845 45.283  36.678  1.00 129.85 ? 540  PHE A CD2   1 
ATOM   4176  C  CE1   . PHE A 1  540  ? 138.211 45.608  35.285  1.00 132.92 ? 540  PHE A CE1   1 
ATOM   4177  C  CE2   . PHE A 1  540  ? 136.511 46.507  36.703  1.00 132.62 ? 540  PHE A CE2   1 
ATOM   4178  C  CZ    . PHE A 1  540  ? 137.688 46.663  36.005  1.00 132.33 ? 540  PHE A CZ    1 
ATOM   4179  N  N     . ILE A 1  541  ? 135.152 40.457  33.784  1.00 111.33 ? 541  ILE A N     1 
ATOM   4180  C  CA    . ILE A 1  541  ? 134.817 39.070  33.578  1.00 110.52 ? 541  ILE A CA    1 
ATOM   4181  C  C     . ILE A 1  541  ? 135.893 38.163  34.164  1.00 116.03 ? 541  ILE A C     1 
ATOM   4182  O  O     . ILE A 1  541  ? 137.082 38.359  33.922  1.00 115.85 ? 541  ILE A O     1 
ATOM   4183  C  CB    . ILE A 1  541  ? 134.474 38.773  32.089  1.00 111.79 ? 541  ILE A CB    1 
ATOM   4184  C  CG1   . ILE A 1  541  ? 133.485 39.812  31.522  1.00 110.96 ? 541  ILE A CG1   1 
ATOM   4185  C  CG2   . ILE A 1  541  ? 133.884 37.365  31.927  1.00 112.42 ? 541  ILE A CG2   1 
ATOM   4186  C  CD1   . ILE A 1  541  ? 134.023 40.580  30.439  1.00 118.35 ? 541  ILE A CD1   1 
ATOM   4187  N  N     . GLU A 1  542  ? 135.448 37.199  34.983  1.00 113.78 ? 542  GLU A N     1 
ATOM   4188  C  CA    . GLU A 1  542  ? 136.268 36.187  35.636  1.00 115.29 ? 542  GLU A CA    1 
ATOM   4189  C  C     . GLU A 1  542  ? 136.546 35.053  34.639  1.00 117.82 ? 542  GLU A C     1 
ATOM   4190  O  O     . GLU A 1  542  ? 135.715 34.810  33.752  1.00 115.90 ? 542  GLU A O     1 
ATOM   4191  C  CB    . GLU A 1  542  ? 135.580 35.672  36.918  1.00 118.02 ? 542  GLU A CB    1 
ATOM   4192  C  CG    . GLU A 1  542  ? 134.076 35.411  36.798  1.00 133.53 ? 542  GLU A CG    1 
ATOM   4193  C  CD    . GLU A 1  542  ? 133.377 34.842  38.027  1.00 172.11 ? 542  GLU A CD    1 
ATOM   4194  O  OE1   . GLU A 1  542  ? 133.675 35.292  39.159  1.00 175.36 ? 542  GLU A OE1   1 
ATOM   4195  O  OE2   . GLU A 1  542  ? 132.514 33.951  37.854  1.00 173.17 ? 542  GLU A OE2   1 
ATOM   4196  N  N     . LEU A 1  543  ? 137.711 34.362  34.801  1.00 114.54 ? 543  LEU A N     1 
ATOM   4197  C  CA    . LEU A 1  543  ? 138.264 33.289  33.947  1.00 112.88 ? 543  LEU A CA    1 
ATOM   4198  C  C     . LEU A 1  543  ? 137.254 32.311  33.353  1.00 115.42 ? 543  LEU A C     1 
ATOM   4199  O  O     . LEU A 1  543  ? 137.234 32.180  32.133  1.00 113.26 ? 543  LEU A O     1 
ATOM   4200  C  CB    . LEU A 1  543  ? 139.382 32.501  34.662  1.00 114.08 ? 543  LEU A CB    1 
ATOM   4201  C  CG    . LEU A 1  543  ? 140.004 31.303  33.910  1.00 117.10 ? 543  LEU A CG    1 
ATOM   4202  C  CD1   . LEU A 1  543  ? 140.838 31.742  32.737  1.00 116.01 ? 543  LEU A CD1   1 
ATOM   4203  C  CD2   . LEU A 1  543  ? 140.878 30.505  34.823  1.00 121.65 ? 543  LEU A CD2   1 
ATOM   4204  N  N     . ASP A 1  544  ? 136.461 31.606  34.191  1.00 113.80 ? 544  ASP A N     1 
ATOM   4205  C  CA    . ASP A 1  544  ? 135.473 30.597  33.763  1.00 113.46 ? 544  ASP A CA    1 
ATOM   4206  C  C     . ASP A 1  544  ? 134.641 31.008  32.544  1.00 114.01 ? 544  ASP A C     1 
ATOM   4207  O  O     . ASP A 1  544  ? 134.515 30.223  31.599  1.00 112.49 ? 544  ASP A O     1 
ATOM   4208  C  CB    . ASP A 1  544  ? 134.552 30.163  34.926  1.00 117.38 ? 544  ASP A CB    1 
ATOM   4209  C  CG    . ASP A 1  544  ? 133.742 31.275  35.599  1.00 140.14 ? 544  ASP A CG    1 
ATOM   4210  O  OD1   . ASP A 1  544  ? 132.784 31.789  34.964  1.00 147.25 ? 544  ASP A OD1   1 
ATOM   4211  O  OD2   . ASP A 1  544  ? 134.014 31.574  36.791  1.00 144.49 ? 544  ASP A OD2   1 
ATOM   4212  N  N     . GLN A 1  545  ? 134.114 32.249  32.567  1.00 108.91 ? 545  GLN A N     1 
ATOM   4213  C  CA    . GLN A 1  545  ? 133.284 32.816  31.520  1.00 106.52 ? 545  GLN A CA    1 
ATOM   4214  C  C     . GLN A 1  545  ? 134.124 33.357  30.375  1.00 108.29 ? 545  GLN A C     1 
ATOM   4215  O  O     . GLN A 1  545  ? 133.770 33.112  29.224  1.00 106.95 ? 545  GLN A O     1 
ATOM   4216  C  CB    . GLN A 1  545  ? 132.366 33.894  32.092  1.00 108.17 ? 545  GLN A CB    1 
ATOM   4217  C  CG    . GLN A 1  545  ? 130.985 33.911  31.439  1.00 125.90 ? 545  GLN A CG    1 
ATOM   4218  C  CD    . GLN A 1  545  ? 130.595 35.310  31.022  1.00 146.89 ? 545  GLN A CD    1 
ATOM   4219  O  OE1   . GLN A 1  545  ? 131.330 35.989  30.300  1.00 144.91 ? 545  GLN A OE1   1 
ATOM   4220  N  NE2   . GLN A 1  545  ? 129.424 35.774  31.452  1.00 135.11 ? 545  GLN A NE2   1 
ATOM   4221  N  N     . VAL A 1  546  ? 135.252 34.055  30.673  1.00 104.03 ? 546  VAL A N     1 
ATOM   4222  C  CA    . VAL A 1  546  ? 136.167 34.604  29.654  1.00 102.41 ? 546  VAL A CA    1 
ATOM   4223  C  C     . VAL A 1  546  ? 136.512 33.538  28.620  1.00 104.71 ? 546  VAL A C     1 
ATOM   4224  O  O     . VAL A 1  546  ? 136.452 33.815  27.429  1.00 103.74 ? 546  VAL A O     1 
ATOM   4225  C  CB    . VAL A 1  546  ? 137.465 35.214  30.246  1.00 107.12 ? 546  VAL A CB    1 
ATOM   4226  C  CG1   . VAL A 1  546  ? 138.399 35.710  29.146  1.00 106.30 ? 546  VAL A CG1   1 
ATOM   4227  C  CG2   . VAL A 1  546  ? 137.156 36.339  31.207  1.00 107.96 ? 546  VAL A CG2   1 
ATOM   4228  N  N     . LEU A 1  547  ? 136.848 32.319  29.078  1.00 100.43 ? 547  LEU A N     1 
ATOM   4229  C  CA    . LEU A 1  547  ? 137.244 31.226  28.202  1.00 98.88  ? 547  LEU A CA    1 
ATOM   4230  C  C     . LEU A 1  547  ? 136.152 30.822  27.239  1.00 99.66  ? 547  LEU A C     1 
ATOM   4231  O  O     . LEU A 1  547  ? 136.469 30.559  26.082  1.00 98.81  ? 547  LEU A O     1 
ATOM   4232  C  CB    . LEU A 1  547  ? 137.797 30.023  28.981  1.00 100.03 ? 547  LEU A CB    1 
ATOM   4233  C  CG    . LEU A 1  547  ? 139.077 30.281  29.816  1.00 106.53 ? 547  LEU A CG    1 
ATOM   4234  C  CD1   . LEU A 1  547  ? 139.681 28.994  30.276  1.00 108.06 ? 547  LEU A CD1   1 
ATOM   4235  C  CD2   . LEU A 1  547  ? 140.143 31.069  29.044  1.00 108.18 ? 547  LEU A CD2   1 
ATOM   4236  N  N     . ASN A 1  548  ? 134.875 30.855  27.672  1.00 94.71  ? 548  ASN A N     1 
ATOM   4237  C  CA    . ASN A 1  548  ? 133.717 30.522  26.813  1.00 92.56  ? 548  ASN A CA    1 
ATOM   4238  C  C     . ASN A 1  548  ? 133.482 31.591  25.738  1.00 93.77  ? 548  ASN A C     1 
ATOM   4239  O  O     . ASN A 1  548  ? 133.152 31.282  24.580  1.00 90.90  ? 548  ASN A O     1 
ATOM   4240  C  CB    . ASN A 1  548  ? 132.458 30.299  27.658  1.00 92.14  ? 548  ASN A CB    1 
ATOM   4241  C  CG    . ASN A 1  548  ? 132.501 28.990  28.377  1.00 113.30 ? 548  ASN A CG    1 
ATOM   4242  O  OD1   . ASN A 1  548  ? 132.080 27.962  27.849  1.00 102.24 ? 548  ASN A OD1   1 
ATOM   4243  N  ND2   . ASN A 1  548  ? 133.137 28.975  29.537  1.00 111.65 ? 548  ASN A ND2   1 
ATOM   4244  N  N     . MET A 1  549  ? 133.688 32.850  26.153  1.00 90.79  ? 549  MET A N     1 
ATOM   4245  C  CA    . MET A 1  549  ? 133.590 34.062  25.354  1.00 89.87  ? 549  MET A CA    1 
ATOM   4246  C  C     . MET A 1  549  ? 134.607 33.981  24.188  1.00 95.25  ? 549  MET A C     1 
ATOM   4247  O  O     . MET A 1  549  ? 134.262 34.266  23.039  1.00 94.05  ? 549  MET A O     1 
ATOM   4248  C  CB    . MET A 1  549  ? 133.903 35.270  26.250  1.00 92.97  ? 549  MET A CB    1 
ATOM   4249  C  CG    . MET A 1  549  ? 132.863 35.574  27.272  1.00 96.47  ? 549  MET A CG    1 
ATOM   4250  S  SD    . MET A 1  549  ? 131.971 37.043  26.755  1.00 100.22 ? 549  MET A SD    1 
ATOM   4251  C  CE    . MET A 1  549  ? 132.504 38.207  27.987  1.00 98.75  ? 549  MET A CE    1 
ATOM   4252  N  N     . LEU A 1  550  ? 135.845 33.546  24.494  1.00 93.17  ? 550  LEU A N     1 
ATOM   4253  C  CA    . LEU A 1  550  ? 136.927 33.406  23.533  1.00 92.99  ? 550  LEU A CA    1 
ATOM   4254  C  C     . LEU A 1  550  ? 136.669 32.286  22.561  1.00 97.22  ? 550  LEU A C     1 
ATOM   4255  O  O     . LEU A 1  550  ? 136.909 32.466  21.376  1.00 96.42  ? 550  LEU A O     1 
ATOM   4256  C  CB    . LEU A 1  550  ? 138.270 33.195  24.241  1.00 94.80  ? 550  LEU A CB    1 
ATOM   4257  C  CG    . LEU A 1  550  ? 138.724 34.310  25.178  1.00 100.79 ? 550  LEU A CG    1 
ATOM   4258  C  CD1   . LEU A 1  550  ? 139.880 33.849  26.071  1.00 102.61 ? 550  LEU A CD1   1 
ATOM   4259  C  CD2   . LEU A 1  550  ? 139.030 35.595  24.413  1.00 103.03 ? 550  LEU A CD2   1 
ATOM   4260  N  N     . TYR A 1  551  ? 136.157 31.141  23.035  1.00 95.60  ? 551  TYR A N     1 
ATOM   4261  C  CA    . TYR A 1  551  ? 135.873 30.005  22.157  1.00 95.79  ? 551  TYR A CA    1 
ATOM   4262  C  C     . TYR A 1  551  ? 134.838 30.364  21.110  1.00 98.53  ? 551  TYR A C     1 
ATOM   4263  O  O     . TYR A 1  551  ? 134.966 29.932  19.959  1.00 97.11  ? 551  TYR A O     1 
ATOM   4264  C  CB    . TYR A 1  551  ? 135.455 28.750  22.952  1.00 98.26  ? 551  TYR A CB    1 
ATOM   4265  C  CG    . TYR A 1  551  ? 135.365 27.482  22.122  1.00 100.81 ? 551  TYR A CG    1 
ATOM   4266  C  CD1   . TYR A 1  551  ? 136.301 27.206  21.129  1.00 103.39 ? 551  TYR A CD1   1 
ATOM   4267  C  CD2   . TYR A 1  551  ? 134.374 26.535  22.363  1.00 101.32 ? 551  TYR A CD2   1 
ATOM   4268  C  CE1   . TYR A 1  551  ? 136.213 26.054  20.350  1.00 104.35 ? 551  TYR A CE1   1 
ATOM   4269  C  CE2   . TYR A 1  551  ? 134.291 25.365  21.605  1.00 101.86 ? 551  TYR A CE2   1 
ATOM   4270  C  CZ    . TYR A 1  551  ? 135.211 25.132  20.594  1.00 109.32 ? 551  TYR A CZ    1 
ATOM   4271  O  OH    . TYR A 1  551  ? 135.152 23.992  19.829  1.00 109.07 ? 551  TYR A OH    1 
ATOM   4272  N  N     . TRP A 1  552  ? 133.867 31.217  21.505  1.00 95.21  ? 552  TRP A N     1 
ATOM   4273  C  CA    . TRP A 1  552  ? 132.770 31.716  20.687  1.00 94.08  ? 552  TRP A CA    1 
ATOM   4274  C  C     . TRP A 1  552  ? 133.183 32.479  19.432  1.00 96.16  ? 552  TRP A C     1 
ATOM   4275  O  O     . TRP A 1  552  ? 132.448 32.428  18.441  1.00 93.55  ? 552  TRP A O     1 
ATOM   4276  C  CB    . TRP A 1  552  ? 131.823 32.547  21.527  1.00 93.64  ? 552  TRP A CB    1 
ATOM   4277  C  CG    . TRP A 1  552  ? 130.630 31.755  21.934  1.00 94.72  ? 552  TRP A CG    1 
ATOM   4278  C  CD1   . TRP A 1  552  ? 130.372 31.234  23.163  1.00 98.50  ? 552  TRP A CD1   1 
ATOM   4279  C  CD2   . TRP A 1  552  ? 129.583 31.302  21.074  1.00 93.65  ? 552  TRP A CD2   1 
ATOM   4280  N  NE1   . TRP A 1  552  ? 129.214 30.505  23.131  1.00 97.51  ? 552  TRP A NE1   1 
ATOM   4281  C  CE2   . TRP A 1  552  ? 128.708 30.526  21.857  1.00 97.85  ? 552  TRP A CE2   1 
ATOM   4282  C  CE3   . TRP A 1  552  ? 129.316 31.450  19.701  1.00 94.21  ? 552  TRP A CE3   1 
ATOM   4283  C  CZ2   . TRP A 1  552  ? 127.583 29.895  21.317  1.00 96.53  ? 552  TRP A CZ2   1 
ATOM   4284  C  CZ3   . TRP A 1  552  ? 128.201 30.827  19.166  1.00 94.91  ? 552  TRP A CZ3   1 
ATOM   4285  C  CH2   . TRP A 1  552  ? 127.343 30.068  19.972  1.00 95.72  ? 552  TRP A CH2   1 
ATOM   4286  N  N     . VAL A 1  553  ? 134.349 33.169  19.471  1.00 94.19  ? 553  VAL A N     1 
ATOM   4287  C  CA    . VAL A 1  553  ? 134.969 33.860  18.334  1.00 94.02  ? 553  VAL A CA    1 
ATOM   4288  C  C     . VAL A 1  553  ? 135.504 32.736  17.415  1.00 101.73 ? 553  VAL A C     1 
ATOM   4289  O  O     . VAL A 1  553  ? 136.427 31.994  17.805  1.00 102.43 ? 553  VAL A O     1 
ATOM   4290  C  CB    . VAL A 1  553  ? 136.099 34.819  18.783  1.00 98.25  ? 553  VAL A CB    1 
ATOM   4291  C  CG1   . VAL A 1  553  ? 136.953 35.274  17.608  1.00 98.06  ? 553  VAL A CG1   1 
ATOM   4292  C  CG2   . VAL A 1  553  ? 135.533 36.016  19.511  1.00 97.91  ? 553  VAL A CG2   1 
ATOM   4293  N  N     . PRO A 1  554  ? 134.896 32.555  16.218  1.00 99.88  ? 554  PRO A N     1 
ATOM   4294  C  CA    . PRO A 1  554  ? 135.328 31.446  15.337  1.00 100.58 ? 554  PRO A CA    1 
ATOM   4295  C  C     . PRO A 1  554  ? 136.752 31.565  14.797  1.00 107.13 ? 554  PRO A C     1 
ATOM   4296  O  O     . PRO A 1  554  ? 137.350 30.573  14.367  1.00 106.39 ? 554  PRO A O     1 
ATOM   4297  C  CB    . PRO A 1  554  ? 134.275 31.428  14.221  1.00 100.70 ? 554  PRO A CB    1 
ATOM   4298  C  CG    . PRO A 1  554  ? 133.601 32.742  14.280  1.00 104.32 ? 554  PRO A CG    1 
ATOM   4299  C  CD    . PRO A 1  554  ? 133.758 33.306  15.647  1.00 100.44 ? 554  PRO A CD    1 
ATOM   4300  N  N     . ASP A 1  555  ? 137.293 32.783  14.857  1.00 106.42 ? 555  ASP A N     1 
ATOM   4301  C  CA    . ASP A 1  555  ? 138.622 33.122  14.383  1.00 108.49 ? 555  ASP A CA    1 
ATOM   4302  C  C     . ASP A 1  555  ? 139.562 33.432  15.551  1.00 111.47 ? 555  ASP A C     1 
ATOM   4303  O  O     . ASP A 1  555  ? 140.581 34.103  15.358  1.00 113.55 ? 555  ASP A O     1 
ATOM   4304  C  CB    . ASP A 1  555  ? 138.535 34.327  13.420  1.00 111.76 ? 555  ASP A CB    1 
ATOM   4305  C  CG    . ASP A 1  555  ? 137.507 34.181  12.311  1.00 134.75 ? 555  ASP A CG    1 
ATOM   4306  O  OD1   . ASP A 1  555  ? 137.604 33.190  11.529  1.00 137.97 ? 555  ASP A OD1   1 
ATOM   4307  O  OD2   . ASP A 1  555  ? 136.615 35.063  12.208  1.00 142.36 ? 555  ASP A OD2   1 
ATOM   4308  N  N     . TRP A 1  556  ? 139.237 32.954  16.756  1.00 104.50 ? 556  TRP A N     1 
ATOM   4309  C  CA    . TRP A 1  556  ? 140.097 33.197  17.905  1.00 104.31 ? 556  TRP A CA    1 
ATOM   4310  C  C     . TRP A 1  556  ? 141.463 32.563  17.642  1.00 107.11 ? 556  TRP A C     1 
ATOM   4311  O  O     . TRP A 1  556  ? 141.536 31.425  17.170  1.00 106.63 ? 556  TRP A O     1 
ATOM   4312  C  CB    . TRP A 1  556  ? 139.444 32.666  19.184  1.00 102.90 ? 556  TRP A CB    1 
ATOM   4313  C  CG    . TRP A 1  556  ? 140.268 32.832  20.428  1.00 105.24 ? 556  TRP A CG    1 
ATOM   4314  C  CD1   . TRP A 1  556  ? 140.788 33.991  20.924  1.00 109.06 ? 556  TRP A CD1   1 
ATOM   4315  C  CD2   . TRP A 1  556  ? 140.605 31.807  21.368  1.00 105.84 ? 556  TRP A CD2   1 
ATOM   4316  N  NE1   . TRP A 1  556  ? 141.468 33.742  22.091  1.00 109.88 ? 556  TRP A NE1   1 
ATOM   4317  C  CE2   . TRP A 1  556  ? 141.368 32.410  22.391  1.00 111.25 ? 556  TRP A CE2   1 
ATOM   4318  C  CE3   . TRP A 1  556  ? 140.358 30.428  21.435  1.00 106.71 ? 556  TRP A CE3   1 
ATOM   4319  C  CZ2   . TRP A 1  556  ? 141.867 31.687  23.477  1.00 111.94 ? 556  TRP A CZ2   1 
ATOM   4320  C  CZ3   . TRP A 1  556  ? 140.872 29.711  22.501  1.00 109.54 ? 556  TRP A CZ3   1 
ATOM   4321  C  CH2   . TRP A 1  556  ? 141.628 30.335  23.499  1.00 111.75 ? 556  TRP A CH2   1 
ATOM   4322  N  N     . ASP A 1  557  ? 142.537 33.333  17.880  1.00 103.17 ? 557  ASP A N     1 
ATOM   4323  C  CA    . ASP A 1  557  ? 143.917 32.901  17.639  1.00 103.62 ? 557  ASP A CA    1 
ATOM   4324  C  C     . ASP A 1  557  ? 144.372 31.726  18.519  1.00 103.56 ? 557  ASP A C     1 
ATOM   4325  O  O     . ASP A 1  557  ? 145.390 31.111  18.234  1.00 103.14 ? 557  ASP A O     1 
ATOM   4326  C  CB    . ASP A 1  557  ? 144.897 34.096  17.743  1.00 107.82 ? 557  ASP A CB    1 
ATOM   4327  C  CG    . ASP A 1  557  ? 144.964 34.837  19.074  1.00 124.52 ? 557  ASP A CG    1 
ATOM   4328  O  OD1   . ASP A 1  557  ? 144.041 34.663  19.906  1.00 126.07 ? 557  ASP A OD1   1 
ATOM   4329  O  OD2   . ASP A 1  557  ? 145.924 35.616  19.270  1.00 130.80 ? 557  ASP A OD2   1 
ATOM   4330  N  N     . GLY A 1  558  ? 143.599 31.406  19.540  1.00 98.57  ? 558  GLY A N     1 
ATOM   4331  C  CA    . GLY A 1  558  ? 143.905 30.317  20.453  1.00 99.39  ? 558  GLY A CA    1 
ATOM   4332  C  C     . GLY A 1  558  ? 144.697 30.804  21.643  1.00 105.46 ? 558  GLY A C     1 
ATOM   4333  O  O     . GLY A 1  558  ? 145.024 30.015  22.537  1.00 106.51 ? 558  GLY A O     1 
ATOM   4334  N  N     . VAL A 1  559  ? 144.977 32.123  21.668  1.00 102.46 ? 559  VAL A N     1 
ATOM   4335  C  CA    . VAL A 1  559  ? 145.747 32.813  22.709  1.00 104.18 ? 559  VAL A CA    1 
ATOM   4336  C  C     . VAL A 1  559  ? 144.819 33.388  23.785  1.00 107.74 ? 559  VAL A C     1 
ATOM   4337  O  O     . VAL A 1  559  ? 143.963 34.206  23.452  1.00 107.07 ? 559  VAL A O     1 
ATOM   4338  C  CB    . VAL A 1  559  ? 146.656 33.932  22.102  1.00 108.58 ? 559  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A 1  559  ? 147.364 34.734  23.190  1.00 110.20 ? 559  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A 1  559  ? 147.670 33.365  21.115  1.00 108.90 ? 559  VAL A CG2   1 
ATOM   4341  N  N     . ILE A 1  560  ? 145.004 32.990  25.067  1.00 104.07 ? 560  ILE A N     1 
ATOM   4342  C  CA    . ILE A 1  560  ? 144.236 33.563  26.175  1.00 103.33 ? 560  ILE A CA    1 
ATOM   4343  C  C     . ILE A 1  560  ? 144.952 34.876  26.498  1.00 107.71 ? 560  ILE A C     1 
ATOM   4344  O  O     . ILE A 1  560  ? 146.129 34.851  26.898  1.00 109.43 ? 560  ILE A O     1 
ATOM   4345  C  CB    . ILE A 1  560  ? 144.125 32.655  27.424  1.00 107.48 ? 560  ILE A CB    1 
ATOM   4346  C  CG1   . ILE A 1  560  ? 143.637 31.232  27.069  1.00 107.42 ? 560  ILE A CG1   1 
ATOM   4347  C  CG2   . ILE A 1  560  ? 143.214 33.308  28.459  1.00 108.09 ? 560  ILE A CG2   1 
ATOM   4348  C  CD1   . ILE A 1  560  ? 144.246 30.072  27.945  1.00 118.14 ? 560  ILE A CD1   1 
ATOM   4349  N  N     . PRO A 1  561  ? 144.297 36.032  26.259  1.00 102.32 ? 561  PRO A N     1 
ATOM   4350  C  CA    . PRO A 1  561  ? 144.968 37.314  26.516  1.00 103.58 ? 561  PRO A CA    1 
ATOM   4351  C  C     . PRO A 1  561  ? 145.247 37.534  27.999  1.00 110.19 ? 561  PRO A C     1 
ATOM   4352  O  O     . PRO A 1  561  ? 144.498 37.022  28.832  1.00 109.59 ? 561  PRO A O     1 
ATOM   4353  C  CB    . PRO A 1  561  ? 143.988 38.338  25.946  1.00 103.62 ? 561  PRO A CB    1 
ATOM   4354  C  CG    . PRO A 1  561  ? 142.680 37.685  26.003  1.00 105.68 ? 561  PRO A CG    1 
ATOM   4355  C  CD    . PRO A 1  561  ? 142.922 36.238  25.769  1.00 101.08 ? 561  PRO A CD    1 
ATOM   4356  N  N     . THR A 1  562  ? 146.336 38.255  28.328  1.00 108.98 ? 562  THR A N     1 
ATOM   4357  C  CA    . THR A 1  562  ? 146.714 38.523  29.723  1.00 110.84 ? 562  THR A CA    1 
ATOM   4358  C  C     . THR A 1  562  ? 145.624 39.351  30.416  1.00 114.29 ? 562  THR A C     1 
ATOM   4359  O  O     . THR A 1  562  ? 145.233 40.382  29.863  1.00 113.51 ? 562  THR A O     1 
ATOM   4360  C  CB    . THR A 1  562  ? 148.068 39.225  29.801  1.00 121.01 ? 562  THR A CB    1 
ATOM   4361  O  OG1   . THR A 1  562  ? 148.808 38.984  28.604  1.00 126.33 ? 562  THR A OG1   1 
ATOM   4362  C  CG2   . THR A 1  562  ? 148.863 38.820  31.025  1.00 117.84 ? 562  THR A CG2   1 
ATOM   4363  N  N     . PRO A 1  563  ? 145.096 38.904  31.589  1.00 110.46 ? 563  PRO A N     1 
ATOM   4364  C  CA    . PRO A 1  563  ? 144.023 39.668  32.261  1.00 109.88 ? 563  PRO A CA    1 
ATOM   4365  C  C     . PRO A 1  563  ? 144.450 41.066  32.707  1.00 115.73 ? 563  PRO A C     1 
ATOM   4366  O  O     . PRO A 1  563  ? 145.588 41.235  33.157  1.00 117.15 ? 563  PRO A O     1 
ATOM   4367  C  CB    . PRO A 1  563  ? 143.641 38.778  33.449  1.00 111.89 ? 563  PRO A CB    1 
ATOM   4368  C  CG    . PRO A 1  563  ? 144.792 37.890  33.666  1.00 117.28 ? 563  PRO A CG    1 
ATOM   4369  C  CD    . PRO A 1  563  ? 145.445 37.686  32.346  1.00 112.23 ? 563  PRO A CD    1 
ATOM   4370  N  N     . ALA A 1  564  ? 143.552 42.070  32.559  1.00 111.86 ? 564  ALA A N     1 
ATOM   4371  C  CA    . ALA A 1  564  ? 143.822 43.466  32.942  1.00 113.49 ? 564  ALA A CA    1 
ATOM   4372  C  C     . ALA A 1  564  ? 144.232 43.566  34.410  1.00 120.39 ? 564  ALA A C     1 
ATOM   4373  O  O     . ALA A 1  564  ? 145.197 44.254  34.729  1.00 121.57 ? 564  ALA A O     1 
ATOM   4374  C  CB    . ALA A 1  564  ? 142.606 44.340  32.674  1.00 113.08 ? 564  ALA A CB    1 
ATOM   4375  N  N     . ILE A 1  565  ? 143.516 42.837  35.285  1.00 117.50 ? 565  ILE A N     1 
ATOM   4376  C  CA    . ILE A 1  565  ? 143.756 42.716  36.721  1.00 119.28 ? 565  ILE A CA    1 
ATOM   4377  C  C     . ILE A 1  565  ? 144.338 41.314  36.941  1.00 124.49 ? 565  ILE A C     1 
ATOM   4378  O  O     . ILE A 1  565  ? 143.804 40.340  36.414  1.00 122.44 ? 565  ILE A O     1 
ATOM   4379  C  CB    . ILE A 1  565  ? 142.414 42.917  37.485  1.00 121.71 ? 565  ILE A CB    1 
ATOM   4380  C  CG1   . ILE A 1  565  ? 142.064 44.395  37.641  1.00 122.78 ? 565  ILE A CG1   1 
ATOM   4381  C  CG2   . ILE A 1  565  ? 142.389 42.216  38.836  1.00 123.61 ? 565  ILE A CG2   1 
ATOM   4382  C  CD1   . ILE A 1  565  ? 140.566 44.627  37.815  1.00 128.32 ? 565  ILE A CD1   1 
ATOM   4383  N  N     . ILE A 1  566  ? 145.429 41.219  37.696  1.00 124.23 ? 566  ILE A N     1 
ATOM   4384  C  CA    . ILE A 1  566  ? 146.072 39.950  38.032  1.00 125.25 ? 566  ILE A CA    1 
ATOM   4385  C  C     . ILE A 1  566  ? 145.989 39.760  39.551  1.00 133.62 ? 566  ILE A C     1 
ATOM   4386  O  O     . ILE A 1  566  ? 145.596 38.676  39.991  1.00 133.38 ? 566  ILE A O     1 
ATOM   4387  C  CB    . ILE A 1  566  ? 147.526 39.883  37.477  1.00 128.96 ? 566  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A 1  566  ? 147.525 39.820  35.936  1.00 127.06 ? 566  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A 1  566  ? 148.330 38.715  38.079  1.00 130.57 ? 566  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A 1  566  ? 148.690 40.519  35.275  1.00 132.72 ? 566  ILE A CD1   1 
ATOM   4391  N  N     . LYS A 1  567  ? 146.311 40.850  40.325  1.00 133.14 ? 567  LYS A N     1 
ATOM   4392  C  CA    . LYS A 1  567  ? 146.383 41.013  41.792  1.00 135.49 ? 567  LYS A CA    1 
ATOM   4393  C  C     . LYS A 1  567  ? 145.735 39.873  42.586  1.00 140.02 ? 567  LYS A C     1 
ATOM   4394  O  O     . LYS A 1  567  ? 146.444 38.872  42.727  1.00 140.91 ? 567  LYS A O     1 
ATOM   4395  C  CB    . LYS A 1  567  ? 145.890 42.379  42.288  1.00 139.47 ? 567  LYS A CB    1 
ATOM   4396  C  CG    . LYS A 1  567  ? 144.744 43.035  41.537  1.00 168.26 ? 567  LYS A CG    1 
ATOM   4397  C  CD    . LYS A 1  567  ? 143.903 43.908  42.488  1.00 189.81 ? 567  LYS A CD    1 
ATOM   4398  C  CE    . LYS A 1  567  ? 142.595 44.350  41.875  1.00 211.05 ? 567  LYS A CE    1 
ATOM   4399  N  NZ    . LYS A 1  567  ? 141.886 45.351  42.720  1.00 226.62 ? 567  LYS A NZ    1 
ATOM   4400  N  N     . PRO A 1  568  ? 144.474 39.909  43.123  1.00 135.74 ? 568  PRO A N     1 
ATOM   4401  C  CA    . PRO A 1  568  ? 143.980 38.734  43.844  1.00 135.77 ? 568  PRO A CA    1 
ATOM   4402  C  C     . PRO A 1  568  ? 143.333 37.761  42.854  1.00 136.47 ? 568  PRO A C     1 
ATOM   4403  O  O     . PRO A 1  568  ? 143.843 36.652  42.650  1.00 136.70 ? 568  PRO A O     1 
ATOM   4404  C  CB    . PRO A 1  568  ? 142.969 39.340  44.836  1.00 138.03 ? 568  PRO A CB    1 
ATOM   4405  C  CG    . PRO A 1  568  ? 142.870 40.831  44.497  1.00 141.94 ? 568  PRO A CG    1 
ATOM   4406  C  CD    . PRO A 1  568  ? 143.427 40.945  43.130  1.00 136.04 ? 568  PRO A CD    1 
ATOM   4407  N  N     . LYS A 1  569  ? 142.241 38.212  42.205  1.00 128.88 ? 569  LYS A N     1 
ATOM   4408  C  CA    . LYS A 1  569  ? 141.501 37.465  41.213  1.00 125.29 ? 569  LYS A CA    1 
ATOM   4409  C  C     . LYS A 1  569  ? 141.933 37.947  39.825  1.00 125.78 ? 569  LYS A C     1 
ATOM   4410  O  O     . LYS A 1  569  ? 141.928 39.151  39.585  1.00 124.74 ? 569  LYS A O     1 
ATOM   4411  C  CB    . LYS A 1  569  ? 139.981 37.663  41.427  1.00 126.62 ? 569  LYS A CB    1 
ATOM   4412  C  CG    . LYS A 1  569  ? 139.121 36.559  40.809  1.00 136.73 ? 569  LYS A CG    1 
ATOM   4413  C  CD    . LYS A 1  569  ? 137.641 36.642  41.189  1.00 141.76 ? 569  LYS A CD    1 
ATOM   4414  C  CE    . LYS A 1  569  ? 136.847 35.530  40.531  1.00 147.32 ? 569  LYS A CE    1 
ATOM   4415  N  NZ    . LYS A 1  569  ? 135.568 35.246  41.238  1.00 151.51 ? 569  LYS A NZ    1 
ATOM   4416  N  N     . PRO A 1  570  ? 142.326 37.044  38.902  1.00 121.00 ? 570  PRO A N     1 
ATOM   4417  C  CA    . PRO A 1  570  ? 142.632 37.491  37.539  1.00 119.28 ? 570  PRO A CA    1 
ATOM   4418  C  C     . PRO A 1  570  ? 141.323 37.746  36.775  1.00 119.05 ? 570  PRO A C     1 
ATOM   4419  O  O     . PRO A 1  570  ? 140.540 36.824  36.481  1.00 116.99 ? 570  PRO A O     1 
ATOM   4420  C  CB    . PRO A 1  570  ? 143.463 36.348  36.960  1.00 121.19 ? 570  PRO A CB    1 
ATOM   4421  C  CG    . PRO A 1  570  ? 143.054 35.146  37.730  1.00 126.36 ? 570  PRO A CG    1 
ATOM   4422  C  CD    . PRO A 1  570  ? 142.368 35.572  39.002  1.00 122.76 ? 570  PRO A CD    1 
ATOM   4423  N  N     . LEU A 1  571  ? 141.065 39.040  36.538  1.00 113.68 ? 571  LEU A N     1 
ATOM   4424  C  CA    . LEU A 1  571  ? 139.877 39.562  35.876  1.00 110.62 ? 571  LEU A CA    1 
ATOM   4425  C  C     . LEU A 1  571  ? 140.216 40.182  34.537  1.00 112.60 ? 571  LEU A C     1 
ATOM   4426  O  O     . LEU A 1  571  ? 141.294 40.760  34.355  1.00 112.54 ? 571  LEU A O     1 
ATOM   4427  C  CB    . LEU A 1  571  ? 139.229 40.625  36.774  1.00 111.23 ? 571  LEU A CB    1 
ATOM   4428  C  CG    . LEU A 1  571  ? 137.969 40.263  37.543  1.00 115.15 ? 571  LEU A CG    1 
ATOM   4429  C  CD1   . LEU A 1  571  ? 138.002 38.839  38.072  1.00 115.50 ? 571  LEU A CD1   1 
ATOM   4430  C  CD2   . LEU A 1  571  ? 137.756 41.231  38.686  1.00 118.90 ? 571  LEU A CD2   1 
ATOM   4431  N  N     . TRP A 1  572  ? 139.267 40.073  33.604  1.00 107.22 ? 572  TRP A N     1 
ATOM   4432  C  CA    . TRP A 1  572  ? 139.363 40.643  32.265  1.00 105.57 ? 572  TRP A CA    1 
ATOM   4433  C  C     . TRP A 1  572  ? 138.347 41.766  32.136  1.00 108.25 ? 572  TRP A C     1 
ATOM   4434  O  O     . TRP A 1  572  ? 137.316 41.734  32.806  1.00 108.18 ? 572  TRP A O     1 
ATOM   4435  C  CB    . TRP A 1  572  ? 139.110 39.575  31.189  1.00 102.22 ? 572  TRP A CB    1 
ATOM   4436  C  CG    . TRP A 1  572  ? 140.273 38.660  30.945  1.00 103.41 ? 572  TRP A CG    1 
ATOM   4437  C  CD1   . TRP A 1  572  ? 141.170 38.731  29.918  1.00 106.07 ? 572  TRP A CD1   1 
ATOM   4438  C  CD2   . TRP A 1  572  ? 140.660 37.526  31.741  1.00 103.94 ? 572  TRP A CD2   1 
ATOM   4439  N  NE1   . TRP A 1  572  ? 142.097 37.720  30.031  1.00 106.18 ? 572  TRP A NE1   1 
ATOM   4440  C  CE2   . TRP A 1  572  ? 141.795 36.954  31.130  1.00 107.98 ? 572  TRP A CE2   1 
ATOM   4441  C  CE3   . TRP A 1  572  ? 140.162 36.943  32.921  1.00 105.48 ? 572  TRP A CE3   1 
ATOM   4442  C  CZ2   . TRP A 1  572  ? 142.431 35.826  31.653  1.00 107.94 ? 572  TRP A CZ2   1 
ATOM   4443  C  CZ3   . TRP A 1  572  ? 140.797 35.829  33.436  1.00 107.48 ? 572  TRP A CZ3   1 
ATOM   4444  C  CH2   . TRP A 1  572  ? 141.922 35.289  32.811  1.00 108.41 ? 572  TRP A CH2   1 
ATOM   4445  N  N     . SER A 1  573  ? 138.635 42.764  31.303  1.00 103.19 ? 573  SER A N     1 
ATOM   4446  C  CA    . SER A 1  573  ? 137.690 43.850  31.116  1.00 102.10 ? 573  SER A CA    1 
ATOM   4447  C  C     . SER A 1  573  ? 136.728 43.497  29.983  1.00 103.23 ? 573  SER A C     1 
ATOM   4448  O  O     . SER A 1  573  ? 137.045 42.637  29.150  1.00 101.39 ? 573  SER A O     1 
ATOM   4449  C  CB    . SER A 1  573  ? 138.429 45.154  30.846  1.00 106.38 ? 573  SER A CB    1 
ATOM   4450  O  OG    . SER A 1  573  ? 138.166 45.691  29.561  1.00 113.16 ? 573  SER A OG    1 
ATOM   4451  N  N     . GLY A 1  574  ? 135.559 44.146  29.977  1.00 98.81  ? 574  GLY A N     1 
ATOM   4452  C  CA    . GLY A 1  574  ? 134.553 43.954  28.939  1.00 96.11  ? 574  GLY A CA    1 
ATOM   4453  C  C     . GLY A 1  574  ? 135.149 44.312  27.598  1.00 97.98  ? 574  GLY A C     1 
ATOM   4454  O  O     . GLY A 1  574  ? 135.164 43.482  26.680  1.00 96.36  ? 574  GLY A O     1 
ATOM   4455  N  N     . LYS A 1  575  ? 135.753 45.524  27.545  1.00 94.33  ? 575  LYS A N     1 
ATOM   4456  C  CA    . LYS A 1  575  ? 136.490 46.098  26.413  1.00 93.55  ? 575  LYS A CA    1 
ATOM   4457  C  C     . LYS A 1  575  ? 137.583 45.121  25.950  1.00 95.62  ? 575  LYS A C     1 
ATOM   4458  O  O     . LYS A 1  575  ? 137.680 44.819  24.758  1.00 94.46  ? 575  LYS A O     1 
ATOM   4459  C  CB    . LYS A 1  575  ? 137.180 47.429  26.817  1.00 98.11  ? 575  LYS A CB    1 
ATOM   4460  C  CG    . LYS A 1  575  ? 136.340 48.410  27.621  1.00 103.83 ? 575  LYS A CG    1 
ATOM   4461  C  CD    . LYS A 1  575  ? 137.024 49.745  27.746  1.00 105.57 ? 575  LYS A CD    1 
ATOM   4462  C  CE    . LYS A 1  575  ? 136.364 50.564  28.818  1.00 119.67 ? 575  LYS A CE    1 
ATOM   4463  N  NZ    . LYS A 1  575  ? 135.241 51.367  28.281  1.00 128.93 ? 575  LYS A NZ    1 
ATOM   4464  N  N     . GLN A 1  576  ? 138.393 44.625  26.913  1.00 91.41  ? 576  GLN A N     1 
ATOM   4465  C  CA    . GLN A 1  576  ? 139.497 43.688  26.712  1.00 90.15  ? 576  GLN A CA    1 
ATOM   4466  C  C     . GLN A 1  576  ? 139.119 42.501  25.820  1.00 89.67  ? 576  GLN A C     1 
ATOM   4467  O  O     . GLN A 1  576  ? 139.745 42.296  24.769  1.00 87.63  ? 576  GLN A O     1 
ATOM   4468  C  CB    . GLN A 1  576  ? 140.042 43.216  28.076  1.00 92.54  ? 576  GLN A CB    1 
ATOM   4469  C  CG    . GLN A 1  576  ? 141.344 42.434  28.000  1.00 97.14  ? 576  GLN A CG    1 
ATOM   4470  C  CD    . GLN A 1  576  ? 142.030 42.304  29.335  1.00 115.19 ? 576  GLN A CD    1 
ATOM   4471  O  OE1   . GLN A 1  576  ? 141.406 42.232  30.393  1.00 110.87 ? 576  GLN A OE1   1 
ATOM   4472  N  NE2   . GLN A 1  576  ? 143.343 42.260  29.308  1.00 109.27 ? 576  GLN A NE2   1 
ATOM   4473  N  N     . ILE A 1  577  ? 138.075 41.754  26.203  1.00 84.72  ? 577  ILE A N     1 
ATOM   4474  C  CA    . ILE A 1  577  ? 137.748 40.589  25.404  1.00 83.19  ? 577  ILE A CA    1 
ATOM   4475  C  C     . ILE A 1  577  ? 136.815 40.962  24.205  1.00 84.79  ? 577  ILE A C     1 
ATOM   4476  O  O     . ILE A 1  577  ? 136.689 40.156  23.276  1.00 83.04  ? 577  ILE A O     1 
ATOM   4477  C  CB    . ILE A 1  577  ? 137.288 39.352  26.231  1.00 86.32  ? 577  ILE A CB    1 
ATOM   4478  C  CG1   . ILE A 1  577  ? 135.796 39.329  26.474  1.00 86.07  ? 577  ILE A CG1   1 
ATOM   4479  C  CG2   . ILE A 1  577  ? 138.070 39.182  27.534  1.00 88.51  ? 577  ILE A CG2   1 
ATOM   4480  C  CD1   . ILE A 1  577  ? 135.220 38.270  25.645  1.00 94.48  ? 577  ILE A CD1   1 
ATOM   4481  N  N     . LEU A 1  578  ? 136.242 42.179  24.170  1.00 80.57  ? 578  LEU A N     1 
ATOM   4482  C  CA    . LEU A 1  578  ? 135.490 42.582  22.985  1.00 79.07  ? 578  LEU A CA    1 
ATOM   4483  C  C     . LEU A 1  578  ? 136.513 42.804  21.861  1.00 84.61  ? 578  LEU A C     1 
ATOM   4484  O  O     . LEU A 1  578  ? 136.262 42.450  20.713  1.00 82.45  ? 578  LEU A O     1 
ATOM   4485  C  CB    . LEU A 1  578  ? 134.700 43.876  23.223  1.00 79.55  ? 578  LEU A CB    1 
ATOM   4486  C  CG    . LEU A 1  578  ? 134.064 44.545  21.975  1.00 83.39  ? 578  LEU A CG    1 
ATOM   4487  C  CD1   . LEU A 1  578  ? 132.821 43.796  21.523  1.00 82.36  ? 578  LEU A CD1   1 
ATOM   4488  C  CD2   . LEU A 1  578  ? 133.695 45.984  22.246  1.00 85.80  ? 578  LEU A CD2   1 
ATOM   4489  N  N     . SER A 1  579  ? 137.690 43.333  22.221  1.00 85.03  ? 579  SER A N     1 
ATOM   4490  C  CA    . SER A 1  579  ? 138.801 43.630  21.322  1.00 86.55  ? 579  SER A CA    1 
ATOM   4491  C  C     . SER A 1  579  ? 139.373 42.385  20.604  1.00 92.68  ? 579  SER A C     1 
ATOM   4492  O  O     . SER A 1  579  ? 140.168 42.503  19.655  1.00 92.92  ? 579  SER A O     1 
ATOM   4493  C  CB    . SER A 1  579  ? 139.878 44.382  22.087  1.00 92.88  ? 579  SER A CB    1 
ATOM   4494  O  OG    . SER A 1  579  ? 139.368 45.585  22.640  1.00 103.34 ? 579  SER A OG    1 
ATOM   4495  N  N     . VAL A 1  580  ? 138.928 41.195  21.049  1.00 89.84  ? 580  VAL A N     1 
ATOM   4496  C  CA    . VAL A 1  580  ? 139.270 39.896  20.473  1.00 89.39  ? 580  VAL A CA    1 
ATOM   4497  C  C     . VAL A 1  580  ? 138.510 39.748  19.127  1.00 93.62  ? 580  VAL A C     1 
ATOM   4498  O  O     . VAL A 1  580  ? 139.040 39.125  18.195  1.00 93.26  ? 580  VAL A O     1 
ATOM   4499  C  CB    . VAL A 1  580  ? 139.015 38.746  21.493  1.00 92.79  ? 580  VAL A CB    1 
ATOM   4500  C  CG1   . VAL A 1  580  ? 139.181 37.363  20.869  1.00 91.81  ? 580  VAL A CG1   1 
ATOM   4501  C  CG2   . VAL A 1  580  ? 139.928 38.892  22.704  1.00 94.41  ? 580  VAL A CG2   1 
ATOM   4502  N  N     . ALA A 1  581  ? 137.303 40.377  19.009  1.00 90.25  ? 581  ALA A N     1 
ATOM   4503  C  CA    . ALA A 1  581  ? 136.501 40.367  17.770  1.00 89.03  ? 581  ALA A CA    1 
ATOM   4504  C  C     . ALA A 1  581  ? 137.008 41.398  16.766  1.00 95.36  ? 581  ALA A C     1 
ATOM   4505  O  O     . ALA A 1  581  ? 136.762 41.222  15.561  1.00 94.32  ? 581  ALA A O     1 
ATOM   4506  C  CB    . ALA A 1  581  ? 135.026 40.608  18.065  1.00 88.63  ? 581  ALA A CB    1 
ATOM   4507  N  N     . ILE A 1  582  ? 137.718 42.469  17.271  1.00 94.12  ? 582  ILE A N     1 
ATOM   4508  C  CA    . ILE A 1  582  ? 138.301 43.576  16.492  1.00 94.71  ? 582  ILE A CA    1 
ATOM   4509  C  C     . ILE A 1  582  ? 139.663 43.163  15.920  1.00 101.85 ? 582  ILE A C     1 
ATOM   4510  O  O     . ILE A 1  582  ? 140.624 42.930  16.682  1.00 103.12 ? 582  ILE A O     1 
ATOM   4511  C  CB    . ILE A 1  582  ? 138.343 44.959  17.225  1.00 98.88  ? 582  ILE A CB    1 
ATOM   4512  C  CG1   . ILE A 1  582  ? 136.960 45.346  17.787  1.00 98.88  ? 582  ILE A CG1   1 
ATOM   4513  C  CG2   . ILE A 1  582  ? 138.838 46.064  16.281  1.00 99.71  ? 582  ILE A CG2   1 
ATOM   4514  C  CD1   . ILE A 1  582  ? 136.952 46.437  18.824  1.00 107.20 ? 582  ILE A CD1   1 
ATOM   4515  N  N     . PRO A 1  583  ? 139.735 43.083  14.561  1.00 99.40  ? 583  PRO A N     1 
ATOM   4516  C  CA    . PRO A 1  583  ? 140.985 42.656  13.900  1.00 100.80 ? 583  PRO A CA    1 
ATOM   4517  C  C     . PRO A 1  583  ? 142.145 43.655  13.970  1.00 106.55 ? 583  PRO A C     1 
ATOM   4518  O  O     . PRO A 1  583  ? 141.919 44.863  13.919  1.00 106.58 ? 583  PRO A O     1 
ATOM   4519  C  CB    . PRO A 1  583  ? 140.545 42.396  12.450  1.00 101.19 ? 583  PRO A CB    1 
ATOM   4520  C  CG    . PRO A 1  583  ? 139.368 43.278  12.245  1.00 104.09 ? 583  PRO A CG    1 
ATOM   4521  C  CD    . PRO A 1  583  ? 138.659 43.316  13.571  1.00 99.41  ? 583  PRO A CD    1 
ATOM   4522  N  N     . ASN A 1  584  ? 143.387 43.137  14.028  1.00 103.73 ? 584  ASN A N     1 
ATOM   4523  C  CA    . ASN A 1  584  ? 144.626 43.913  14.089  1.00 105.53 ? 584  ASN A CA    1 
ATOM   4524  C  C     . ASN A 1  584  ? 144.745 44.954  12.981  1.00 110.51 ? 584  ASN A C     1 
ATOM   4525  O  O     . ASN A 1  584  ? 144.143 44.794  11.911  1.00 109.11 ? 584  ASN A O     1 
ATOM   4526  C  CB    . ASN A 1  584  ? 145.818 42.981  14.097  1.00 107.56 ? 584  ASN A CB    1 
ATOM   4527  C  CG    . ASN A 1  584  ? 145.659 41.935  15.158  1.00 149.92 ? 584  ASN A CG    1 
ATOM   4528  O  OD1   . ASN A 1  584  ? 145.777 42.212  16.362  1.00 153.28 ? 584  ASN A OD1   1 
ATOM   4529  N  ND2   . ASN A 1  584  ? 145.237 40.749  14.743  1.00 143.32 ? 584  ASN A ND2   1 
ATOM   4530  N  N     . GLY A 1  585  ? 145.462 46.041  13.276  1.00 108.54 ? 585  GLY A N     1 
ATOM   4531  C  CA    . GLY A 1  585  ? 145.663 47.142  12.338  1.00 108.55 ? 585  GLY A CA    1 
ATOM   4532  C  C     . GLY A 1  585  ? 144.459 48.048  12.158  1.00 110.37 ? 585  GLY A C     1 
ATOM   4533  O  O     . GLY A 1  585  ? 144.432 48.897  11.256  1.00 109.83 ? 585  GLY A O     1 
ATOM   4534  N  N     . ILE A 1  586  ? 143.449 47.862  12.999  1.00 105.19 ? 586  ILE A N     1 
ATOM   4535  C  CA    . ILE A 1  586  ? 142.291 48.718  12.960  1.00 103.82 ? 586  ILE A CA    1 
ATOM   4536  C  C     . ILE A 1  586  ? 142.588 49.831  13.944  1.00 109.56 ? 586  ILE A C     1 
ATOM   4537  O  O     . ILE A 1  586  ? 142.800 49.579  15.132  1.00 109.62 ? 586  ILE A O     1 
ATOM   4538  C  CB    . ILE A 1  586  ? 140.954 47.945  13.179  1.00 104.88 ? 586  ILE A CB    1 
ATOM   4539  C  CG1   . ILE A 1  586  ? 140.609 47.067  11.943  1.00 103.51 ? 586  ILE A CG1   1 
ATOM   4540  C  CG2   . ILE A 1  586  ? 139.767 48.863  13.577  1.00 105.19 ? 586  ILE A CG2   1 
ATOM   4541  C  CD1   . ILE A 1  586  ? 140.356 47.818  10.560  1.00 110.31 ? 586  ILE A CD1   1 
ATOM   4542  N  N     . HIS A 1  587  ? 142.741 51.041  13.410  1.00 107.52 ? 587  HIS A N     1 
ATOM   4543  C  CA    . HIS A 1  587  ? 143.004 52.214  14.217  1.00 109.28 ? 587  HIS A CA    1 
ATOM   4544  C  C     . HIS A 1  587  ? 141.850 53.218  14.097  1.00 109.59 ? 587  HIS A C     1 
ATOM   4545  O  O     . HIS A 1  587  ? 141.497 53.636  12.992  1.00 108.01 ? 587  HIS A O     1 
ATOM   4546  C  CB    . HIS A 1  587  ? 144.382 52.841  13.928  1.00 112.78 ? 587  HIS A CB    1 
ATOM   4547  C  CG    . HIS A 1  587  ? 144.694 53.973  14.866  1.00 118.88 ? 587  HIS A CG    1 
ATOM   4548  N  ND1   . HIS A 1  587  ? 144.391 55.289  14.542  1.00 121.62 ? 587  HIS A ND1   1 
ATOM   4549  C  CD2   . HIS A 1  587  ? 145.178 53.941  16.129  1.00 122.48 ? 587  HIS A CD2   1 
ATOM   4550  C  CE1   . HIS A 1  587  ? 144.742 56.014  15.595  1.00 122.88 ? 587  HIS A CE1   1 
ATOM   4551  N  NE2   . HIS A 1  587  ? 145.217 55.250  16.577  1.00 123.76 ? 587  HIS A NE2   1 
ATOM   4552  N  N     . LEU A 1  588  ? 141.274 53.594  15.255  1.00 104.47 ? 588  LEU A N     1 
ATOM   4553  C  CA    . LEU A 1  588  ? 140.155 54.520  15.371  1.00 102.67 ? 588  LEU A CA    1 
ATOM   4554  C  C     . LEU A 1  588  ? 140.299 55.492  16.563  1.00 107.34 ? 588  LEU A C     1 
ATOM   4555  O  O     . LEU A 1  588  ? 140.570 55.065  17.688  1.00 106.65 ? 588  LEU A O     1 
ATOM   4556  C  CB    . LEU A 1  588  ? 138.878 53.694  15.501  1.00 100.22 ? 588  LEU A CB    1 
ATOM   4557  C  CG    . LEU A 1  588  ? 137.594 54.405  15.208  1.00 103.60 ? 588  LEU A CG    1 
ATOM   4558  C  CD1   . LEU A 1  588  ? 136.661 53.506  14.473  1.00 101.93 ? 588  LEU A CD1   1 
ATOM   4559  C  CD2   . LEU A 1  588  ? 136.935 54.862  16.478  1.00 106.52 ? 588  LEU A CD2   1 
ATOM   4560  N  N     . GLN A 1  589  ? 140.059 56.793  16.305  1.00 105.12 ? 589  GLN A N     1 
ATOM   4561  C  CA    . GLN A 1  589  ? 140.095 57.877  17.295  1.00 107.12 ? 589  GLN A CA    1 
ATOM   4562  C  C     . GLN A 1  589  ? 138.780 58.668  17.224  1.00 112.10 ? 589  GLN A C     1 
ATOM   4563  O  O     . GLN A 1  589  ? 138.344 58.958  16.107  1.00 110.89 ? 589  GLN A O     1 
ATOM   4564  C  CB    . GLN A 1  589  ? 141.258 58.802  16.968  1.00 110.21 ? 589  GLN A CB    1 
ATOM   4565  C  CG    . GLN A 1  589  ? 141.727 59.628  18.137  1.00 124.13 ? 589  GLN A CG    1 
ATOM   4566  C  CD    . GLN A 1  589  ? 143.077 60.201  17.834  1.00 146.32 ? 589  GLN A CD    1 
ATOM   4567  O  OE1   . GLN A 1  589  ? 143.193 61.263  17.208  1.00 144.45 ? 589  GLN A OE1   1 
ATOM   4568  N  NE2   . GLN A 1  589  ? 144.129 59.480  18.222  1.00 137.10 ? 589  GLN A NE2   1 
ATOM   4569  N  N     . ARG A 1  590  ? 138.133 59.010  18.381  1.00 110.47 ? 590  ARG A N     1 
ATOM   4570  C  CA    . ARG A 1  590  ? 136.860 59.746  18.316  1.00 110.87 ? 590  ARG A CA    1 
ATOM   4571  C  C     . ARG A 1  590  ? 136.884 61.155  18.932  1.00 124.25 ? 590  ARG A C     1 
ATOM   4572  O  O     . ARG A 1  590  ? 136.997 62.131  18.175  1.00 126.89 ? 590  ARG A O     1 
ATOM   4573  C  CB    . ARG A 1  590  ? 135.682 58.951  18.878  1.00 105.33 ? 590  ARG A CB    1 
ATOM   4574  C  CG    . ARG A 1  590  ? 134.313 59.533  18.502  1.00 106.58 ? 590  ARG A CG    1 
ATOM   4575  C  CD    . ARG A 1  590  ? 133.352 58.522  17.872  1.00 111.00 ? 590  ARG A CD    1 
ATOM   4576  N  NE    . ARG A 1  590  ? 133.097 57.345  18.712  1.00 113.30 ? 590  ARG A NE    1 
ATOM   4577  C  CZ    . ARG A 1  590  ? 132.269 57.333  19.753  1.00 125.57 ? 590  ARG A CZ    1 
ATOM   4578  N  NH1   . ARG A 1  590  ? 131.599 58.429  20.088  1.00 107.63 ? 590  ARG A NH1   1 
ATOM   4579  N  NH2   . ARG A 1  590  ? 132.116 56.228  20.475  1.00 111.06 ? 590  ARG A NH2   1 
ATOM   4580  N  N     . PHE A 1  591  ? 136.718 61.280  20.270  1.00 123.96 ? 591  PHE A N     1 
ATOM   4581  C  CA    . PHE A 1  591  ? 136.601 62.567  20.986  1.00 126.73 ? 591  PHE A CA    1 
ATOM   4582  C  C     . PHE A 1  591  ? 135.193 63.156  20.849  1.00 131.48 ? 591  PHE A C     1 
ATOM   4583  O  O     . PHE A 1  591  ? 134.837 63.700  19.793  1.00 130.12 ? 591  PHE A O     1 
ATOM   4584  C  CB    . PHE A 1  591  ? 137.676 63.621  20.609  1.00 130.58 ? 591  PHE A CB    1 
ATOM   4585  C  CG    . PHE A 1  591  ? 139.100 63.242  20.918  1.00 133.36 ? 591  PHE A CG    1 
ATOM   4586  C  CD1   . PHE A 1  591  ? 139.565 63.235  22.227  1.00 137.17 ? 591  PHE A CD1   1 
ATOM   4587  C  CD2   . PHE A 1  591  ? 139.983 62.911  19.900  1.00 136.24 ? 591  PHE A CD2   1 
ATOM   4588  C  CE1   . PHE A 1  591  ? 140.878 62.867  22.518  1.00 141.13 ? 591  PHE A CE1   1 
ATOM   4589  C  CE2   . PHE A 1  591  ? 141.302 62.557  20.189  1.00 138.40 ? 591  PHE A CE2   1 
ATOM   4590  C  CZ    . PHE A 1  591  ? 141.739 62.533  21.497  1.00 138.88 ? 591  PHE A CZ    1 
ATOM   4591  N  N     . ASP A 1  592  ? 134.388 63.020  21.915  1.00 129.75 ? 592  ASP A N     1 
ATOM   4592  C  CA    . ASP A 1  592  ? 133.029 63.544  21.966  1.00 129.96 ? 592  ASP A CA    1 
ATOM   4593  C  C     . ASP A 1  592  ? 133.000 64.832  22.809  1.00 137.34 ? 592  ASP A C     1 
ATOM   4594  O  O     . ASP A 1  592  ? 133.484 65.858  22.333  1.00 138.60 ? 592  ASP A O     1 
ATOM   4595  C  CB    . ASP A 1  592  ? 132.005 62.484  22.445  1.00 130.24 ? 592  ASP A CB    1 
ATOM   4596  C  CG    . ASP A 1  592  ? 131.908 61.206  21.621  1.00 137.52 ? 592  ASP A CG    1 
ATOM   4597  O  OD1   . ASP A 1  592  ? 132.107 61.271  20.380  1.00 136.08 ? 592  ASP A OD1   1 
ATOM   4598  O  OD2   . ASP A 1  592  ? 131.563 60.154  22.204  1.00 143.33 ? 592  ASP A OD2   1 
ATOM   4599  N  N     . GLU A 1  593  ? 132.461 64.786  24.039  1.00 134.82 ? 593  GLU A N     1 
ATOM   4600  C  CA    . GLU A 1  593  ? 132.345 65.956  24.892  1.00 137.28 ? 593  GLU A CA    1 
ATOM   4601  C  C     . GLU A 1  593  ? 133.704 66.378  25.429  1.00 144.96 ? 593  GLU A C     1 
ATOM   4602  O  O     . GLU A 1  593  ? 134.436 67.113  24.760  1.00 146.12 ? 593  GLU A O     1 
ATOM   4603  C  CB    . GLU A 1  593  ? 131.333 65.700  26.013  1.00 138.89 ? 593  GLU A CB    1 
ATOM   4604  C  CG    . GLU A 1  593  ? 130.683 66.966  26.541  1.00 156.57 ? 593  GLU A CG    1 
ATOM   4605  C  CD    . GLU A 1  593  ? 130.072 66.885  27.930  1.00 192.04 ? 593  GLU A CD    1 
ATOM   4606  O  OE1   . GLU A 1  593  ? 129.741 65.761  28.378  1.00 188.25 ? 593  GLU A OE1   1 
ATOM   4607  O  OE2   . GLU A 1  593  ? 129.916 67.952  28.569  1.00 193.99 ? 593  GLU A OE2   1 
ATOM   4608  N  N     . GLY A 1  594  ? 134.034 65.919  26.625  1.00 143.09 ? 594  GLY A N     1 
ATOM   4609  C  CA    . GLY A 1  594  ? 135.302 66.254  27.254  1.00 145.44 ? 594  GLY A CA    1 
ATOM   4610  C  C     . GLY A 1  594  ? 136.283 65.109  27.177  1.00 148.56 ? 594  GLY A C     1 
ATOM   4611  O  O     . GLY A 1  594  ? 136.959 64.812  28.164  1.00 150.77 ? 594  GLY A O     1 
ATOM   4612  N  N     . THR A 1  595  ? 136.348 64.446  26.013  1.00 140.87 ? 595  THR A N     1 
ATOM   4613  C  CA    . THR A 1  595  ? 137.237 63.312  25.786  1.00 138.48 ? 595  THR A CA    1 
ATOM   4614  C  C     . THR A 1  595  ? 138.654 63.850  25.766  1.00 141.23 ? 595  THR A C     1 
ATOM   4615  O  O     . THR A 1  595  ? 138.939 64.761  24.985  1.00 141.13 ? 595  THR A O     1 
ATOM   4616  C  CB    . THR A 1  595  ? 136.803 62.609  24.535  1.00 144.39 ? 595  THR A CB    1 
ATOM   4617  O  OG1   . THR A 1  595  ? 135.378 62.671  24.462  1.00 140.14 ? 595  THR A OG1   1 
ATOM   4618  C  CG2   . THR A 1  595  ? 137.283 61.178  24.488  1.00 144.27 ? 595  THR A CG2   1 
ATOM   4619  N  N     . THR A 1  596  ? 139.501 63.385  26.711  1.00 137.10 ? 596  THR A N     1 
ATOM   4620  C  CA    . THR A 1  596  ? 140.831 63.956  26.898  1.00 138.64 ? 596  THR A CA    1 
ATOM   4621  C  C     . THR A 1  596  ? 141.995 62.976  26.958  1.00 142.19 ? 596  THR A C     1 
ATOM   4622  O  O     . THR A 1  596  ? 142.863 63.157  27.823  1.00 144.73 ? 596  THR A O     1 
ATOM   4623  C  CB    . THR A 1  596  ? 140.866 64.843  28.171  1.00 146.46 ? 596  THR A CB    1 
ATOM   4624  O  OG1   . THR A 1  596  ? 140.449 64.089  29.311  1.00 143.25 ? 596  THR A OG1   1 
ATOM   4625  C  CG2   . THR A 1  596  ? 140.073 66.135  28.034  1.00 145.90 ? 596  THR A CG2   1 
ATOM   4626  N  N     . LEU A 1  597  ? 142.082 61.998  26.022  1.00 135.48 ? 597  LEU A N     1 
ATOM   4627  C  CA    . LEU A 1  597  ? 143.192 61.017  25.978  1.00 135.18 ? 597  LEU A CA    1 
ATOM   4628  C  C     . LEU A 1  597  ? 143.346 60.319  27.336  1.00 139.92 ? 597  LEU A C     1 
ATOM   4629  O  O     . LEU A 1  597  ? 144.343 59.649  27.578  1.00 140.73 ? 597  LEU A O     1 
ATOM   4630  C  CB    . LEU A 1  597  ? 144.557 61.666  25.611  1.00 137.19 ? 597  LEU A CB    1 
ATOM   4631  C  CG    . LEU A 1  597  ? 144.656 62.560  24.382  1.00 142.42 ? 597  LEU A CG    1 
ATOM   4632  C  CD1   . LEU A 1  597  ? 145.298 63.908  24.742  1.00 145.50 ? 597  LEU A CD1   1 
ATOM   4633  C  CD2   . LEU A 1  597  ? 145.432 61.869  23.263  1.00 144.01 ? 597  LEU A CD2   1 
ATOM   4634  N  N     . LEU A 1  598  ? 142.383 60.552  28.234  1.00 136.05 ? 598  LEU A N     1 
ATOM   4635  C  CA    . LEU A 1  598  ? 142.266 60.073  29.606  1.00 136.35 ? 598  LEU A CA    1 
ATOM   4636  C  C     . LEU A 1  598  ? 140.801 60.339  29.978  1.00 140.23 ? 598  LEU A C     1 
ATOM   4637  O  O     . LEU A 1  598  ? 140.517 60.680  31.130  1.00 141.60 ? 598  LEU A O     1 
ATOM   4638  C  CB    . LEU A 1  598  ? 143.203 60.881  30.541  1.00 138.97 ? 598  LEU A CB    1 
ATOM   4639  C  CG    . LEU A 1  598  ? 144.030 60.138  31.608  1.00 144.08 ? 598  LEU A CG    1 
ATOM   4640  C  CD1   . LEU A 1  598  ? 144.564 61.102  32.611  1.00 146.90 ? 598  LEU A CD1   1 
ATOM   4641  C  CD2   . LEU A 1  598  ? 143.219 59.151  32.380  1.00 144.97 ? 598  LEU A CD2   1 
ATOM   4642  N  N     . SER A 1  599  ? 139.879 60.217  28.969  1.00 134.22 ? 599  SER A N     1 
ATOM   4643  C  CA    . SER A 1  599  ? 138.430 60.449  29.065  1.00 132.21 ? 599  SER A CA    1 
ATOM   4644  C  C     . SER A 1  599  ? 137.903 59.935  30.393  1.00 135.27 ? 599  SER A C     1 
ATOM   4645  O  O     . SER A 1  599  ? 137.967 58.726  30.648  1.00 133.30 ? 599  SER A O     1 
ATOM   4646  C  CB    . SER A 1  599  ? 137.688 59.798  27.904  1.00 131.50 ? 599  SER A CB    1 
ATOM   4647  O  OG    . SER A 1  599  ? 137.844 58.391  27.954  1.00 135.05 ? 599  SER A OG    1 
ATOM   4648  N  N     . PRO A 1  600  ? 137.524 60.865  31.300  1.00 132.85 ? 600  PRO A N     1 
ATOM   4649  C  CA    . PRO A 1  600  ? 137.073 60.443  32.638  1.00 133.18 ? 600  PRO A CA    1 
ATOM   4650  C  C     . PRO A 1  600  ? 135.664 59.864  32.608  1.00 134.24 ? 600  PRO A C     1 
ATOM   4651  O  O     . PRO A 1  600  ? 135.317 58.991  33.410  1.00 133.79 ? 600  PRO A O     1 
ATOM   4652  C  CB    . PRO A 1  600  ? 137.153 61.736  33.468  1.00 137.66 ? 600  PRO A CB    1 
ATOM   4653  C  CG    . PRO A 1  600  ? 137.732 62.797  32.541  1.00 142.67 ? 600  PRO A CG    1 
ATOM   4654  C  CD    . PRO A 1  600  ? 137.466 62.331  31.157  1.00 135.63 ? 600  PRO A CD    1 
ATOM   4655  N  N     . LYS A 1  601  ? 134.873 60.339  31.645  1.00 128.12 ? 601  LYS A N     1 
ATOM   4656  C  CA    . LYS A 1  601  ? 133.497 59.947  31.426  1.00 125.75 ? 601  LYS A CA    1 
ATOM   4657  C  C     . LYS A 1  601  ? 133.400 58.603  30.669  1.00 128.66 ? 601  LYS A C     1 
ATOM   4658  O  O     . LYS A 1  601  ? 132.289 58.072  30.512  1.00 127.88 ? 601  LYS A O     1 
ATOM   4659  C  CB    . LYS A 1  601  ? 132.795 61.067  30.633  1.00 126.87 ? 601  LYS A CB    1 
ATOM   4660  C  CG    . LYS A 1  601  ? 132.732 62.398  31.371  1.00 133.88 ? 601  LYS A CG    1 
ATOM   4661  C  CD    . LYS A 1  601  ? 132.193 63.532  30.509  1.00 141.05 ? 601  LYS A CD    1 
ATOM   4662  C  CE    . LYS A 1  601  ? 130.743 63.835  30.798  1.00 149.15 ? 601  LYS A CE    1 
ATOM   4663  N  NZ    . LYS A 1  601  ? 129.825 63.118  29.872  1.00 155.15 ? 601  LYS A NZ    1 
ATOM   4664  N  N     . ASP A 1  602  ? 134.561 58.049  30.206  1.00 124.08 ? 602  ASP A N     1 
ATOM   4665  C  CA    . ASP A 1  602  ? 134.660 56.868  29.332  1.00 121.28 ? 602  ASP A CA    1 
ATOM   4666  C  C     . ASP A 1  602  ? 133.921 57.312  28.046  1.00 122.43 ? 602  ASP A C     1 
ATOM   4667  O  O     . ASP A 1  602  ? 133.067 56.621  27.491  1.00 119.57 ? 602  ASP A O     1 
ATOM   4668  C  CB    . ASP A 1  602  ? 134.063 55.598  29.987  1.00 122.28 ? 602  ASP A CB    1 
ATOM   4669  C  CG    . ASP A 1  602  ? 134.828 54.288  29.804  1.00 130.42 ? 602  ASP A CG    1 
ATOM   4670  O  OD1   . ASP A 1  602  ? 136.028 54.339  29.407  1.00 130.76 ? 602  ASP A OD1   1 
ATOM   4671  O  OD2   . ASP A 1  602  ? 134.253 53.215  30.125  1.00 133.78 ? 602  ASP A OD2   1 
ATOM   4672  N  N     . ASN A 1  603  ? 134.226 58.561  27.665  1.00 120.31 ? 603  ASN A N     1 
ATOM   4673  C  CA    . ASN A 1  603  ? 133.715 59.332  26.543  1.00 119.48 ? 603  ASN A CA    1 
ATOM   4674  C  C     . ASN A 1  603  ? 134.450 58.913  25.282  1.00 122.71 ? 603  ASN A C     1 
ATOM   4675  O  O     . ASN A 1  603  ? 135.474 58.235  25.380  1.00 123.57 ? 603  ASN A O     1 
ATOM   4676  C  CB    . ASN A 1  603  ? 134.023 60.802  26.824  1.00 121.96 ? 603  ASN A CB    1 
ATOM   4677  C  CG    . ASN A 1  603  ? 132.845 61.726  26.740  1.00 156.13 ? 603  ASN A CG    1 
ATOM   4678  O  OD1   . ASN A 1  603  ? 131.742 61.366  26.293  1.00 150.67 ? 603  ASN A OD1   1 
ATOM   4679  N  ND2   . ASN A 1  603  ? 133.068 62.955  27.171  1.00 154.26 ? 603  ASN A ND2   1 
ATOM   4680  N  N     . GLY A 1  604  ? 133.954 59.335  24.118  1.00 116.91 ? 604  GLY A N     1 
ATOM   4681  C  CA    . GLY A 1  604  ? 134.587 59.064  22.830  1.00 115.05 ? 604  GLY A CA    1 
ATOM   4682  C  C     . GLY A 1  604  ? 134.996 57.626  22.583  1.00 116.05 ? 604  GLY A C     1 
ATOM   4683  O  O     . GLY A 1  604  ? 134.268 56.698  22.970  1.00 114.88 ? 604  GLY A O     1 
ATOM   4684  N  N     . MET A 1  605  ? 136.178 57.443  21.934  1.00 110.86 ? 605  MET A N     1 
ATOM   4685  C  CA    . MET A 1  605  ? 136.716 56.130  21.555  1.00 108.59 ? 605  MET A CA    1 
ATOM   4686  C  C     . MET A 1  605  ? 138.170 56.179  21.117  1.00 111.43 ? 605  MET A C     1 
ATOM   4687  O  O     . MET A 1  605  ? 138.580 57.096  20.405  1.00 111.35 ? 605  MET A O     1 
ATOM   4688  C  CB    . MET A 1  605  ? 135.890 55.539  20.396  1.00 108.69 ? 605  MET A CB    1 
ATOM   4689  C  CG    . MET A 1  605  ? 136.217 54.122  20.062  1.00 111.45 ? 605  MET A CG    1 
ATOM   4690  S  SD    . MET A 1  605  ? 135.368 52.999  21.171  1.00 115.76 ? 605  MET A SD    1 
ATOM   4691  C  CE    . MET A 1  605  ? 136.703 52.433  22.115  1.00 113.80 ? 605  MET A CE    1 
ATOM   4692  N  N     . LEU A 1  606  ? 138.925 55.147  21.504  1.00 107.06 ? 606  LEU A N     1 
ATOM   4693  C  CA    . LEU A 1  606  ? 140.300 54.943  21.090  1.00 107.32 ? 606  LEU A CA    1 
ATOM   4694  C  C     . LEU A 1  606  ? 140.584 53.465  20.942  1.00 109.50 ? 606  LEU A C     1 
ATOM   4695  O  O     . LEU A 1  606  ? 140.609 52.734  21.934  1.00 109.54 ? 606  LEU A O     1 
ATOM   4696  C  CB    . LEU A 1  606  ? 141.337 55.620  22.001  1.00 109.86 ? 606  LEU A CB    1 
ATOM   4697  C  CG    . LEU A 1  606  ? 142.820 55.435  21.567  1.00 115.82 ? 606  LEU A CG    1 
ATOM   4698  C  CD1   . LEU A 1  606  ? 143.129 56.113  20.210  1.00 115.88 ? 606  LEU A CD1   1 
ATOM   4699  C  CD2   . LEU A 1  606  ? 143.764 55.954  22.615  1.00 121.18 ? 606  LEU A CD2   1 
ATOM   4700  N  N     . ILE A 1  607  ? 140.779 53.033  19.684  1.00 103.84 ? 607  ILE A N     1 
ATOM   4701  C  CA    . ILE A 1  607  ? 141.103 51.660  19.304  1.00 102.02 ? 607  ILE A CA    1 
ATOM   4702  C  C     . ILE A 1  607  ? 142.400 51.711  18.496  1.00 107.64 ? 607  ILE A C     1 
ATOM   4703  O  O     . ILE A 1  607  ? 142.438 52.365  17.461  1.00 106.96 ? 607  ILE A O     1 
ATOM   4704  C  CB    . ILE A 1  607  ? 139.941 50.954  18.527  1.00 102.18 ? 607  ILE A CB    1 
ATOM   4705  C  CG1   . ILE A 1  607  ? 138.624 50.972  19.326  1.00 100.78 ? 607  ILE A CG1   1 
ATOM   4706  C  CG2   . ILE A 1  607  ? 140.316 49.507  18.126  1.00 102.41 ? 607  ILE A CG2   1 
ATOM   4707  C  CD1   . ILE A 1  607  ? 137.389 51.016  18.502  1.00 97.84  ? 607  ILE A CD1   1 
ATOM   4708  N  N     . ILE A 1  608  ? 143.462 51.052  18.987  1.00 106.09 ? 608  ILE A N     1 
ATOM   4709  C  CA    . ILE A 1  608  ? 144.773 50.984  18.335  1.00 107.16 ? 608  ILE A CA    1 
ATOM   4710  C  C     . ILE A 1  608  ? 145.137 49.511  18.148  1.00 113.37 ? 608  ILE A C     1 
ATOM   4711  O  O     . ILE A 1  608  ? 145.108 48.753  19.122  1.00 113.05 ? 608  ILE A O     1 
ATOM   4712  C  CB    . ILE A 1  608  ? 145.847 51.714  19.177  1.00 112.29 ? 608  ILE A CB    1 
ATOM   4713  C  CG1   . ILE A 1  608  ? 145.497 53.199  19.408  1.00 113.51 ? 608  ILE A CG1   1 
ATOM   4714  C  CG2   . ILE A 1  608  ? 147.231 51.537  18.568  1.00 114.46 ? 608  ILE A CG2   1 
ATOM   4715  C  CD1   . ILE A 1  608  ? 146.277 53.902  20.535  1.00 123.90 ? 608  ILE A CD1   1 
ATOM   4716  N  N     . ASP A 1  609  ? 145.491 49.110  16.904  1.00 111.69 ? 609  ASP A N     1 
ATOM   4717  C  CA    . ASP A 1  609  ? 145.893 47.736  16.537  1.00 111.86 ? 609  ASP A CA    1 
ATOM   4718  C  C     . ASP A 1  609  ? 144.783 46.703  16.831  1.00 114.13 ? 609  ASP A C     1 
ATOM   4719  O  O     . ASP A 1  609  ? 145.060 45.536  17.147  1.00 114.52 ? 609  ASP A O     1 
ATOM   4720  C  CB    . ASP A 1  609  ? 147.253 47.356  17.196  1.00 116.48 ? 609  ASP A CB    1 
ATOM   4721  C  CG    . ASP A 1  609  ? 147.917 46.092  16.666  1.00 133.25 ? 609  ASP A CG    1 
ATOM   4722  O  OD1   . ASP A 1  609  ? 148.073 45.975  15.422  1.00 134.48 ? 609  ASP A OD1   1 
ATOM   4723  O  OD2   . ASP A 1  609  ? 148.296 45.227  17.494  1.00 140.82 ? 609  ASP A OD2   1 
ATOM   4724  N  N     . GLY A 1  610  ? 143.529 47.153  16.712  1.00 108.09 ? 610  GLY A N     1 
ATOM   4725  C  CA    . GLY A 1  610  ? 142.349 46.328  16.962  1.00 105.04 ? 610  GLY A CA    1 
ATOM   4726  C  C     . GLY A 1  610  ? 142.248 45.895  18.406  1.00 104.96 ? 610  GLY A C     1 
ATOM   4727  O  O     . GLY A 1  610  ? 142.156 44.690  18.700  1.00 103.48 ? 610  GLY A O     1 
ATOM   4728  N  N     . GLN A 1  611  ? 142.366 46.912  19.299  1.00 99.31  ? 611  GLN A N     1 
ATOM   4729  C  CA    . GLN A 1  611  ? 142.332 46.851  20.760  1.00 98.49  ? 611  GLN A CA    1 
ATOM   4730  C  C     . GLN A 1  611  ? 141.730 48.137  21.317  1.00 99.62  ? 611  GLN A C     1 
ATOM   4731  O  O     . GLN A 1  611  ? 142.198 49.220  20.973  1.00 99.47  ? 611  GLN A O     1 
ATOM   4732  C  CB    . GLN A 1  611  ? 143.745 46.649  21.350  1.00 101.39 ? 611  GLN A CB    1 
ATOM   4733  C  CG    . GLN A 1  611  ? 144.314 45.251  21.180  1.00 115.55 ? 611  GLN A CG    1 
ATOM   4734  C  CD    . GLN A 1  611  ? 143.422 44.192  21.775  1.00 138.42 ? 611  GLN A CD    1 
ATOM   4735  O  OE1   . GLN A 1  611  ? 143.067 44.247  22.962  1.00 133.60 ? 611  GLN A OE1   1 
ATOM   4736  N  NE2   . GLN A 1  611  ? 143.007 43.227  20.946  1.00 133.12 ? 611  GLN A NE2   1 
ATOM   4737  N  N     . ILE A 1  612  ? 140.701 48.018  22.180  1.00 93.78  ? 612  ILE A N     1 
ATOM   4738  C  CA    . ILE A 1  612  ? 140.053 49.166  22.821  1.00 93.18  ? 612  ILE A CA    1 
ATOM   4739  C  C     . ILE A 1  612  ? 140.939 49.645  23.977  1.00 101.23 ? 612  ILE A C     1 
ATOM   4740  O  O     . ILE A 1  612  ? 141.278 48.843  24.864  1.00 102.31 ? 612  ILE A O     1 
ATOM   4741  C  CB    . ILE A 1  612  ? 138.597 48.844  23.276  1.00 93.49  ? 612  ILE A CB    1 
ATOM   4742  C  CG1   . ILE A 1  612  ? 137.684 48.635  22.070  1.00 90.18  ? 612  ILE A CG1   1 
ATOM   4743  C  CG2   . ILE A 1  612  ? 138.027 49.926  24.218  1.00 94.64  ? 612  ILE A CG2   1 
ATOM   4744  C  CD1   . ILE A 1  612  ? 136.690 47.654  22.274  1.00 86.27  ? 612  ILE A CD1   1 
ATOM   4745  N  N     . ILE A 1  613  ? 141.312 50.951  23.945  1.00 98.93  ? 613  ILE A N     1 
ATOM   4746  C  CA    . ILE A 1  613  ? 142.128 51.630  24.956  1.00 100.92 ? 613  ILE A CA    1 
ATOM   4747  C  C     . ILE A 1  613  ? 141.226 52.356  25.954  1.00 106.86 ? 613  ILE A C     1 
ATOM   4748  O  O     . ILE A 1  613  ? 141.435 52.219  27.157  1.00 108.56 ? 613  ILE A O     1 
ATOM   4749  C  CB    . ILE A 1  613  ? 143.240 52.524  24.342  1.00 105.09 ? 613  ILE A CB    1 
ATOM   4750  C  CG1   . ILE A 1  613  ? 144.339 51.682  23.698  1.00 105.04 ? 613  ILE A CG1   1 
ATOM   4751  C  CG2   . ILE A 1  613  ? 143.877 53.414  25.378  1.00 108.57 ? 613  ILE A CG2   1 
ATOM   4752  C  CD1   . ILE A 1  613  ? 144.159 51.487  22.319  1.00 110.38 ? 613  ILE A CD1   1 
ATOM   4753  N  N     . PHE A 1  614  ? 140.225 53.108  25.480  1.00 103.25 ? 614  PHE A N     1 
ATOM   4754  C  CA    . PHE A 1  614  ? 139.280 53.763  26.387  1.00 104.59 ? 614  PHE A CA    1 
ATOM   4755  C  C     . PHE A 1  614  ? 137.953 54.025  25.714  1.00 108.53 ? 614  PHE A C     1 
ATOM   4756  O  O     . PHE A 1  614  ? 137.868 53.972  24.481  1.00 106.95 ? 614  PHE A O     1 
ATOM   4757  C  CB    . PHE A 1  614  ? 139.839 55.067  26.994  1.00 109.21 ? 614  PHE A CB    1 
ATOM   4758  C  CG    . PHE A 1  614  ? 140.130 56.217  26.046  1.00 111.66 ? 614  PHE A CG    1 
ATOM   4759  C  CD1   . PHE A 1  614  ? 139.098 56.876  25.382  1.00 113.67 ? 614  PHE A CD1   1 
ATOM   4760  C  CD2   . PHE A 1  614  ? 141.421 56.710  25.905  1.00 115.84 ? 614  PHE A CD2   1 
ATOM   4761  C  CE1   . PHE A 1  614  ? 139.363 57.945  24.529  1.00 115.25 ? 614  PHE A CE1   1 
ATOM   4762  C  CE2   . PHE A 1  614  ? 141.683 57.789  25.060  1.00 119.44 ? 614  PHE A CE2   1 
ATOM   4763  C  CZ    . PHE A 1  614  ? 140.651 58.403  24.383  1.00 116.47 ? 614  PHE A CZ    1 
ATOM   4764  N  N     . GLY A 1  615  ? 136.954 54.369  26.533  1.00 105.87 ? 615  GLY A N     1 
ATOM   4765  C  CA    . GLY A 1  615  ? 135.622 54.745  26.077  1.00 104.41 ? 615  GLY A CA    1 
ATOM   4766  C  C     . GLY A 1  615  ? 134.662 53.603  25.859  1.00 105.87 ? 615  GLY A C     1 
ATOM   4767  O  O     . GLY A 1  615  ? 135.073 52.482  25.539  1.00 104.33 ? 615  GLY A O     1 
ATOM   4768  N  N     . VAL A 1  616  ? 133.365 53.906  26.005  1.00 101.93 ? 616  VAL A N     1 
ATOM   4769  C  CA    . VAL A 1  616  ? 132.294 52.929  25.843  1.00 99.76  ? 616  VAL A CA    1 
ATOM   4770  C  C     . VAL A 1  616  ? 131.939 52.743  24.369  1.00 101.75 ? 616  VAL A C     1 
ATOM   4771  O  O     . VAL A 1  616  ? 132.048 53.682  23.556  1.00 101.18 ? 616  VAL A O     1 
ATOM   4772  C  CB    . VAL A 1  616  ? 131.045 53.200  26.732  1.00 103.61 ? 616  VAL A CB    1 
ATOM   4773  C  CG1   . VAL A 1  616  ? 130.119 51.985  26.770  1.00 101.56 ? 616  VAL A CG1   1 
ATOM   4774  C  CG2   . VAL A 1  616  ? 131.446 53.602  28.154  1.00 105.54 ? 616  VAL A CG2   1 
ATOM   4775  N  N     . VAL A 1  617  ? 131.541 51.503  24.036  1.00 96.64  ? 617  VAL A N     1 
ATOM   4776  C  CA    . VAL A 1  617  ? 131.110 51.141  22.703  1.00 95.00  ? 617  VAL A CA    1 
ATOM   4777  C  C     . VAL A 1  617  ? 129.615 51.155  22.710  1.00 97.90  ? 617  VAL A C     1 
ATOM   4778  O  O     . VAL A 1  617  ? 128.977 50.462  23.500  1.00 96.83  ? 617  VAL A O     1 
ATOM   4779  C  CB    . VAL A 1  617  ? 131.670 49.802  22.186  1.00 98.25  ? 617  VAL A CB    1 
ATOM   4780  C  CG1   . VAL A 1  617  ? 131.348 49.611  20.697  1.00 96.05  ? 617  VAL A CG1   1 
ATOM   4781  C  CG2   . VAL A 1  617  ? 133.173 49.727  22.424  1.00 99.65  ? 617  VAL A CG2   1 
ATOM   4782  N  N     . GLU A 1  618  ? 129.074 51.990  21.836  1.00 94.47  ? 618  GLU A N     1 
ATOM   4783  C  CA    . GLU A 1  618  ? 127.656 52.198  21.605  1.00 93.57  ? 618  GLU A CA    1 
ATOM   4784  C  C     . GLU A 1  618  ? 127.466 52.591  20.121  1.00 95.82  ? 618  GLU A C     1 
ATOM   4785  O  O     . GLU A 1  618  ? 128.413 52.488  19.334  1.00 95.57  ? 618  GLU A O     1 
ATOM   4786  C  CB    . GLU A 1  618  ? 127.091 53.255  22.583  1.00 96.58  ? 618  GLU A CB    1 
ATOM   4787  C  CG    . GLU A 1  618  ? 127.958 54.491  22.780  1.00 109.20 ? 618  GLU A CG    1 
ATOM   4788  C  CD    . GLU A 1  618  ? 128.272 55.253  21.511  1.00 130.52 ? 618  GLU A CD    1 
ATOM   4789  O  OE1   . GLU A 1  618  ? 127.364 55.956  21.011  1.00 130.58 ? 618  GLU A OE1   1 
ATOM   4790  O  OE2   . GLU A 1  618  ? 129.377 55.044  20.955  1.00 122.08 ? 618  GLU A OE2   1 
ATOM   4791  N  N     . LYS A 1  619  ? 126.264 53.076  19.764  1.00 90.24  ? 619  LYS A N     1 
ATOM   4792  C  CA    . LYS A 1  619  ? 125.864 53.469  18.420  1.00 87.92  ? 619  LYS A CA    1 
ATOM   4793  C  C     . LYS A 1  619  ? 126.938 54.228  17.626  1.00 90.96  ? 619  LYS A C     1 
ATOM   4794  O  O     . LYS A 1  619  ? 127.206 53.842  16.494  1.00 89.72  ? 619  LYS A O     1 
ATOM   4795  C  CB    . LYS A 1  619  ? 124.560 54.267  18.483  1.00 90.37  ? 619  LYS A CB    1 
ATOM   4796  C  CG    . LYS A 1  619  ? 123.572 53.917  17.382  1.00 106.03 ? 619  LYS A CG    1 
ATOM   4797  C  CD    . LYS A 1  619  ? 122.341 54.805  17.452  1.00 117.84 ? 619  LYS A CD    1 
ATOM   4798  C  CE    . LYS A 1  619  ? 121.717 55.039  16.102  1.00 131.97 ? 619  LYS A CE    1 
ATOM   4799  N  NZ    . LYS A 1  619  ? 120.633 56.051  16.181  1.00 147.28 ? 619  LYS A NZ    1 
ATOM   4800  N  N     . LYS A 1  620  ? 127.594 55.248  18.225  1.00 88.25  ? 620  LYS A N     1 
ATOM   4801  C  CA    . LYS A 1  620  ? 128.599 56.091  17.559  1.00 88.69  ? 620  LYS A CA    1 
ATOM   4802  C  C     . LYS A 1  620  ? 129.882 55.364  17.129  1.00 94.10  ? 620  LYS A C     1 
ATOM   4803  O  O     . LYS A 1  620  ? 130.732 55.968  16.471  1.00 94.87  ? 620  LYS A O     1 
ATOM   4804  C  CB    . LYS A 1  620  ? 128.949 57.315  18.414  1.00 93.00  ? 620  LYS A CB    1 
ATOM   4805  C  CG    . LYS A 1  620  ? 127.826 58.334  18.598  1.00 107.06 ? 620  LYS A CG    1 
ATOM   4806  C  CD    . LYS A 1  620  ? 128.252 59.511  19.495  1.00 118.42 ? 620  LYS A CD    1 
ATOM   4807  C  CE    . LYS A 1  620  ? 127.890 59.343  20.959  1.00 126.95 ? 620  LYS A CE    1 
ATOM   4808  N  NZ    . LYS A 1  620  ? 129.052 58.905  21.787  1.00 132.95 ? 620  LYS A NZ    1 
ATOM   4809  N  N     . THR A 1  621  ? 130.022 54.083  17.487  1.00 91.08  ? 621  THR A N     1 
ATOM   4810  C  CA    . THR A 1  621  ? 131.188 53.270  17.126  1.00 91.29  ? 621  THR A CA    1 
ATOM   4811  C  C     . THR A 1  621  ? 130.714 52.106  16.215  1.00 94.74  ? 621  THR A C     1 
ATOM   4812  O  O     . THR A 1  621  ? 130.958 52.064  15.001  1.00 93.09  ? 621  THR A O     1 
ATOM   4813  C  CB    . THR A 1  621  ? 131.887 52.731  18.427  1.00 96.80  ? 621  THR A CB    1 
ATOM   4814  O  OG1   . THR A 1  621  ? 131.893 53.710  19.474  1.00 94.71  ? 621  THR A OG1   1 
ATOM   4815  C  CG2   . THR A 1  621  ? 133.293 52.202  18.176  1.00 93.66  ? 621  THR A CG2   1 
ATOM   4816  N  N     . VAL A 1  622  ? 129.974 51.204  16.845  1.00 91.96  ? 622  VAL A N     1 
ATOM   4817  C  CA    . VAL A 1  622  ? 129.461 49.946  16.357  1.00 90.62  ? 622  VAL A CA    1 
ATOM   4818  C  C     . VAL A 1  622  ? 128.189 50.049  15.474  1.00 93.52  ? 622  VAL A C     1 
ATOM   4819  O  O     . VAL A 1  622  ? 127.740 49.046  14.926  1.00 91.20  ? 622  VAL A O     1 
ATOM   4820  C  CB    . VAL A 1  622  ? 129.263 49.076  17.616  1.00 95.46  ? 622  VAL A CB    1 
ATOM   4821  C  CG1   . VAL A 1  622  ? 127.899 49.282  18.267  1.00 95.19  ? 622  VAL A CG1   1 
ATOM   4822  C  CG2   . VAL A 1  622  ? 129.533 47.617  17.324  1.00 94.75  ? 622  VAL A CG2   1 
ATOM   4823  N  N     . GLY A 1  623  ? 127.625 51.236  15.342  1.00 91.94  ? 623  GLY A N     1 
ATOM   4824  C  CA    . GLY A 1  623  ? 126.450 51.416  14.501  1.00 91.47  ? 623  GLY A CA    1 
ATOM   4825  C  C     . GLY A 1  623  ? 126.843 51.675  13.063  1.00 97.65  ? 623  GLY A C     1 
ATOM   4826  O  O     . GLY A 1  623  ? 128.026 51.547  12.699  1.00 97.98  ? 623  GLY A O     1 
ATOM   4827  N  N     . SER A 1  624  ? 125.846 52.077  12.241  1.00 95.11  ? 624  SER A N     1 
ATOM   4828  C  CA    . SER A 1  624  ? 126.021 52.416  10.821  1.00 95.03  ? 624  SER A CA    1 
ATOM   4829  C  C     . SER A 1  624  ? 126.359 53.920  10.667  1.00 100.08 ? 624  SER A C     1 
ATOM   4830  O  O     . SER A 1  624  ? 125.759 54.659  9.879   1.00 98.76  ? 624  SER A O     1 
ATOM   4831  C  CB    . SER A 1  624  ? 124.821 51.953  9.988   1.00 98.76  ? 624  SER A CB    1 
ATOM   4832  O  OG    . SER A 1  624  ? 123.727 52.855  9.938   1.00 112.40 ? 624  SER A OG    1 
ATOM   4833  N  N     . SER A 1  625  ? 127.343 54.347  11.476  1.00 99.09  ? 625  SER A N     1 
ATOM   4834  C  CA    . SER A 1  625  ? 127.894 55.697  11.550  1.00 100.75 ? 625  SER A CA    1 
ATOM   4835  C  C     . SER A 1  625  ? 128.988 55.872  10.502  1.00 103.78 ? 625  SER A C     1 
ATOM   4836  O  O     . SER A 1  625  ? 129.576 54.879  10.047  1.00 102.87 ? 625  SER A O     1 
ATOM   4837  C  CB    . SER A 1  625  ? 128.428 55.996  12.953  1.00 106.39 ? 625  SER A CB    1 
ATOM   4838  O  OG    . SER A 1  625  ? 129.228 54.946  13.475  1.00 115.40 ? 625  SER A OG    1 
ATOM   4839  N  N     . ASN A 1  626  ? 129.243 57.139  10.120  1.00 99.93  ? 626  ASN A N     1 
ATOM   4840  C  CA    . ASN A 1  626  ? 130.208 57.512  9.105   1.00 99.72  ? 626  ASN A CA    1 
ATOM   4841  C  C     . ASN A 1  626  ? 131.638 57.124  9.486   1.00 105.14 ? 626  ASN A C     1 
ATOM   4842  O  O     . ASN A 1  626  ? 132.297 56.408  8.730   1.00 103.96 ? 626  ASN A O     1 
ATOM   4843  C  CB    . ASN A 1  626  ? 130.095 58.999  8.804   1.00 101.05 ? 626  ASN A CB    1 
ATOM   4844  C  CG    . ASN A 1  626  ? 130.384 59.367  7.369   1.00 132.78 ? 626  ASN A CG    1 
ATOM   4845  O  OD1   . ASN A 1  626  ? 131.527 59.302  6.879   1.00 126.72 ? 626  ASN A OD1   1 
ATOM   4846  N  ND2   . ASN A 1  626  ? 129.349 59.827  6.682   1.00 128.16 ? 626  ASN A ND2   1 
ATOM   4847  N  N     . GLY A 1  627  ? 132.099 57.572  10.653  1.00 103.50 ? 627  GLY A N     1 
ATOM   4848  C  CA    . GLY A 1  627  ? 133.467 57.307  11.096  1.00 104.40 ? 627  GLY A CA    1 
ATOM   4849  C  C     . GLY A 1  627  ? 133.656 56.046  11.903  1.00 106.98 ? 627  GLY A C     1 
ATOM   4850  O  O     . GLY A 1  627  ? 134.771 55.732  12.317  1.00 106.81 ? 627  GLY A O     1 
ATOM   4851  N  N     . GLY A 1  628  ? 132.564 55.329  12.108  1.00 102.83 ? 628  GLY A N     1 
ATOM   4852  C  CA    . GLY A 1  628  ? 132.506 54.120  12.919  1.00 101.70 ? 628  GLY A CA    1 
ATOM   4853  C  C     . GLY A 1  628  ? 133.075 52.854  12.330  1.00 100.68 ? 628  GLY A C     1 
ATOM   4854  O  O     . GLY A 1  628  ? 132.928 52.594  11.134  1.00 99.35  ? 628  GLY A O     1 
ATOM   4855  N  N     . LEU A 1  629  ? 133.682 52.054  13.229  1.00 94.08  ? 629  LEU A N     1 
ATOM   4856  C  CA    . LEU A 1  629  ? 134.324 50.757  13.057  1.00 92.30  ? 629  LEU A CA    1 
ATOM   4857  C  C     . LEU A 1  629  ? 133.971 49.996  11.770  1.00 96.08  ? 629  LEU A C     1 
ATOM   4858  O  O     . LEU A 1  629  ? 134.873 49.452  11.137  1.00 96.44  ? 629  LEU A O     1 
ATOM   4859  C  CB    . LEU A 1  629  ? 134.002 49.882  14.278  1.00 91.63  ? 629  LEU A CB    1 
ATOM   4860  C  CG    . LEU A 1  629  ? 135.137 49.110  14.963  1.00 96.37  ? 629  LEU A CG    1 
ATOM   4861  C  CD1   . LEU A 1  629  ? 134.623 48.386  16.185  1.00 96.84  ? 629  LEU A CD1   1 
ATOM   4862  C  CD2   . LEU A 1  629  ? 135.734 48.061  14.078  1.00 96.55  ? 629  LEU A CD2   1 
ATOM   4863  N  N     . ILE A 1  630  ? 132.672 49.926  11.398  1.00 90.83  ? 630  ILE A N     1 
ATOM   4864  C  CA    . ILE A 1  630  ? 132.228 49.198  10.212  1.00 88.19  ? 630  ILE A CA    1 
ATOM   4865  C  C     . ILE A 1  630  ? 132.846 49.824  8.963   1.00 90.44  ? 630  ILE A C     1 
ATOM   4866  O  O     . ILE A 1  630  ? 133.668 49.153  8.345   1.00 89.42  ? 630  ILE A O     1 
ATOM   4867  C  CB    . ILE A 1  630  ? 130.694 49.034  10.190  1.00 89.99  ? 630  ILE A CB    1 
ATOM   4868  C  CG1   . ILE A 1  630  ? 130.267 48.066  11.293  1.00 90.13  ? 630  ILE A CG1   1 
ATOM   4869  C  CG2   . ILE A 1  630  ? 130.198 48.511  8.867   1.00 89.47  ? 630  ILE A CG2   1 
ATOM   4870  C  CD1   . ILE A 1  630  ? 129.915 48.751  12.552  1.00 102.32 ? 630  ILE A CD1   1 
ATOM   4871  N  N     . HIS A 1  631  ? 132.580 51.127  8.680   1.00 86.65  ? 631  HIS A N     1 
ATOM   4872  C  CA    . HIS A 1  631  ? 133.178 51.890  7.557   1.00 86.27  ? 631  HIS A CA    1 
ATOM   4873  C  C     . HIS A 1  631  ? 134.725 51.776  7.528   1.00 87.66  ? 631  HIS A C     1 
ATOM   4874  O  O     . HIS A 1  631  ? 135.330 51.889  6.468   1.00 86.55  ? 631  HIS A O     1 
ATOM   4875  C  CB    . HIS A 1  631  ? 132.818 53.386  7.691   1.00 88.48  ? 631  HIS A CB    1 
ATOM   4876  C  CG    . HIS A 1  631  ? 132.851 54.191  6.417   1.00 92.28  ? 631  HIS A CG    1 
ATOM   4877  N  ND1   . HIS A 1  631  ? 132.044 55.303  6.252   1.00 94.45  ? 631  HIS A ND1   1 
ATOM   4878  C  CD2   . HIS A 1  631  ? 133.593 54.031  5.293   1.00 94.28  ? 631  HIS A CD2   1 
ATOM   4879  C  CE1   . HIS A 1  631  ? 132.312 55.775  5.045   1.00 94.09  ? 631  HIS A CE1   1 
ATOM   4880  N  NE2   . HIS A 1  631  ? 133.230 55.037  4.423   1.00 94.22  ? 631  HIS A NE2   1 
ATOM   4881  N  N     . VAL A 1  632  ? 135.351 51.576  8.696   1.00 83.66  ? 632  VAL A N     1 
ATOM   4882  C  CA    . VAL A 1  632  ? 136.808 51.477  8.855   1.00 84.05  ? 632  VAL A CA    1 
ATOM   4883  C  C     . VAL A 1  632  ? 137.322 50.085  8.513   1.00 86.50  ? 632  VAL A C     1 
ATOM   4884  O  O     . VAL A 1  632  ? 138.351 49.962  7.846   1.00 86.61  ? 632  VAL A O     1 
ATOM   4885  C  CB    . VAL A 1  632  ? 137.263 51.901  10.267  1.00 88.84  ? 632  VAL A CB    1 
ATOM   4886  C  CG1   . VAL A 1  632  ? 138.724 52.331  10.259  1.00 89.89  ? 632  VAL A CG1   1 
ATOM   4887  C  CG2   . VAL A 1  632  ? 136.367 53.006  10.825  1.00 89.00  ? 632  VAL A CG2   1 
ATOM   4888  N  N     . VAL A 1  633  ? 136.634 49.039  8.994   1.00 81.01  ? 633  VAL A N     1 
ATOM   4889  C  CA    . VAL A 1  633  ? 137.043 47.685  8.686   1.00 79.80  ? 633  VAL A CA    1 
ATOM   4890  C  C     . VAL A 1  633  ? 136.755 47.474  7.223   1.00 84.83  ? 633  VAL A C     1 
ATOM   4891  O  O     . VAL A 1  633  ? 137.640 47.025  6.511   1.00 86.04  ? 633  VAL A O     1 
ATOM   4892  C  CB    . VAL A 1  633  ? 136.396 46.611  9.574   1.00 82.22  ? 633  VAL A CB    1 
ATOM   4893  C  CG1   . VAL A 1  633  ? 136.931 45.227  9.227   1.00 81.50  ? 633  VAL A CG1   1 
ATOM   4894  C  CG2   . VAL A 1  633  ? 136.657 46.897  11.034  1.00 83.23  ? 633  VAL A CG2   1 
ATOM   4895  N  N     . THR A 1  634  ? 135.573 47.892  6.742   1.00 80.61  ? 634  THR A N     1 
ATOM   4896  C  CA    . THR A 1  634  ? 135.237 47.728  5.330   1.00 79.75  ? 634  THR A CA    1 
ATOM   4897  C  C     . THR A 1  634  ? 136.254 48.400  4.438   1.00 85.30  ? 634  THR A C     1 
ATOM   4898  O  O     . THR A 1  634  ? 136.675 47.796  3.456   1.00 84.74  ? 634  THR A O     1 
ATOM   4899  C  CB    . THR A 1  634  ? 133.811 48.142  5.013   1.00 89.96  ? 634  THR A CB    1 
ATOM   4900  O  OG1   . THR A 1  634  ? 132.971 47.825  6.119   1.00 91.83  ? 634  THR A OG1   1 
ATOM   4901  C  CG2   . THR A 1  634  ? 133.275 47.442  3.763   1.00 88.77  ? 634  THR A CG2   1 
ATOM   4902  N  N     . ARG A 1  635  ? 136.705 49.599  4.806   1.00 84.66  ? 635  ARG A N     1 
ATOM   4903  C  CA    . ARG A 1  635  ? 137.708 50.262  3.995   1.00 87.00  ? 635  ARG A CA    1 
ATOM   4904  C  C     . ARG A 1  635  ? 139.078 49.616  4.146   1.00 96.33  ? 635  ARG A C     1 
ATOM   4905  O  O     . ARG A 1  635  ? 139.575 49.042  3.179   1.00 96.94  ? 635  ARG A O     1 
ATOM   4906  C  CB    . ARG A 1  635  ? 137.746 51.783  4.229   1.00 87.60  ? 635  ARG A CB    1 
ATOM   4907  C  CG    . ARG A 1  635  ? 136.753 52.576  3.372   1.00 95.58  ? 635  ARG A CG    1 
ATOM   4908  C  CD    . ARG A 1  635  ? 137.119 52.642  1.890   1.00 103.01 ? 635  ARG A CD    1 
ATOM   4909  N  NE    . ARG A 1  635  ? 135.928 52.675  1.037   1.00 109.13 ? 635  ARG A NE    1 
ATOM   4910  C  CZ    . ARG A 1  635  ? 135.324 51.598  0.540   1.00 121.87 ? 635  ARG A CZ    1 
ATOM   4911  N  NH1   . ARG A 1  635  ? 135.801 50.383  0.794   1.00 110.85 ? 635  ARG A NH1   1 
ATOM   4912  N  NH2   . ARG A 1  635  ? 134.239 51.727  -0.216  1.00 105.35 ? 635  ARG A NH2   1 
ATOM   4913  N  N     . GLU A 1  636  ? 139.650 49.635  5.354   1.00 95.88  ? 636  GLU A N     1 
ATOM   4914  C  CA    . GLU A 1  636  ? 140.978 49.094  5.592   1.00 97.95  ? 636  GLU A CA    1 
ATOM   4915  C  C     . GLU A 1  636  ? 141.099 47.576  5.367   1.00 101.16 ? 636  GLU A C     1 
ATOM   4916  O  O     . GLU A 1  636  ? 141.971 47.160  4.605   1.00 101.82 ? 636  GLU A O     1 
ATOM   4917  C  CB    . GLU A 1  636  ? 141.493 49.491  6.990   1.00 101.32 ? 636  GLU A CB    1 
ATOM   4918  C  CG    . GLU A 1  636  ? 143.013 49.597  7.117   1.00 120.41 ? 636  GLU A CG    1 
ATOM   4919  C  CD    . GLU A 1  636  ? 143.697 50.739  6.381   1.00 158.53 ? 636  GLU A CD    1 
ATOM   4920  O  OE1   . GLU A 1  636  ? 143.064 51.809  6.219   1.00 156.37 ? 636  GLU A OE1   1 
ATOM   4921  O  OE2   . GLU A 1  636  ? 144.875 50.571  5.983   1.00 163.41 ? 636  GLU A OE2   1 
ATOM   4922  N  N     . LYS A 1  637  ? 140.247 46.758  5.994   1.00 96.37  ? 637  LYS A N     1 
ATOM   4923  C  CA    . LYS A 1  637  ? 140.396 45.300  5.914   1.00 95.89  ? 637  LYS A CA    1 
ATOM   4924  C  C     . LYS A 1  637  ? 139.631 44.563  4.783   1.00 99.39  ? 637  LYS A C     1 
ATOM   4925  O  O     . LYS A 1  637  ? 140.127 43.526  4.351   1.00 99.69  ? 637  LYS A O     1 
ATOM   4926  C  CB    . LYS A 1  637  ? 140.094 44.624  7.262   1.00 97.90  ? 637  LYS A CB    1 
ATOM   4927  C  CG    . LYS A 1  637  ? 141.095 44.951  8.386   1.00 108.87 ? 637  LYS A CG    1 
ATOM   4928  C  CD    . LYS A 1  637  ? 142.487 44.315  8.237   1.00 111.96 ? 637  LYS A CD    1 
ATOM   4929  C  CE    . LYS A 1  637  ? 143.595 45.281  8.600   1.00 112.89 ? 637  LYS A CE    1 
ATOM   4930  N  NZ    . LYS A 1  637  ? 143.941 46.202  7.475   1.00 117.03 ? 637  LYS A NZ    1 
ATOM   4931  N  N     . GLY A 1  638  ? 138.489 45.052  4.310   1.00 94.64  ? 638  GLY A N     1 
ATOM   4932  C  CA    . GLY A 1  638  ? 137.792 44.353  3.228   1.00 93.26  ? 638  GLY A CA    1 
ATOM   4933  C  C     . GLY A 1  638  ? 136.316 44.104  3.454   1.00 96.98  ? 638  GLY A C     1 
ATOM   4934  O  O     . GLY A 1  638  ? 135.835 44.351  4.561   1.00 96.68  ? 638  GLY A O     1 
ATOM   4935  N  N     . PRO A 1  639  ? 135.537 43.648  2.430   1.00 93.73  ? 639  PRO A N     1 
ATOM   4936  C  CA    . PRO A 1  639  ? 134.097 43.438  2.657   1.00 92.04  ? 639  PRO A CA    1 
ATOM   4937  C  C     . PRO A 1  639  ? 133.824 42.133  3.390   1.00 95.11  ? 639  PRO A C     1 
ATOM   4938  O  O     . PRO A 1  639  ? 132.974 42.116  4.292   1.00 93.76  ? 639  PRO A O     1 
ATOM   4939  C  CB    . PRO A 1  639  ? 133.485 43.483  1.249   1.00 92.78  ? 639  PRO A CB    1 
ATOM   4940  C  CG    . PRO A 1  639  ? 134.570 43.047  0.343   1.00 98.51  ? 639  PRO A CG    1 
ATOM   4941  C  CD    . PRO A 1  639  ? 135.914 43.279  1.046   1.00 95.90  ? 639  PRO A CD    1 
ATOM   4942  N  N     . GLN A 1  640  ? 134.574 41.053  3.048   1.00 91.65  ? 640  GLN A N     1 
ATOM   4943  C  CA    . GLN A 1  640  ? 134.351 39.788  3.715   1.00 90.96  ? 640  GLN A CA    1 
ATOM   4944  C  C     . GLN A 1  640  ? 134.938 39.805  5.124   1.00 93.26  ? 640  GLN A C     1 
ATOM   4945  O  O     . GLN A 1  640  ? 134.393 39.150  6.017   1.00 92.88  ? 640  GLN A O     1 
ATOM   4946  C  CB    . GLN A 1  640  ? 134.785 38.584  2.873   1.00 92.74  ? 640  GLN A CB    1 
ATOM   4947  C  CG    . GLN A 1  640  ? 133.595 37.640  2.545   1.00 123.44 ? 640  GLN A CG    1 
ATOM   4948  C  CD    . GLN A 1  640  ? 133.124 36.738  3.698   1.00 158.20 ? 640  GLN A CD    1 
ATOM   4949  O  OE1   . GLN A 1  640  ? 131.974 36.813  4.184   1.00 150.28 ? 640  GLN A OE1   1 
ATOM   4950  N  NE2   . GLN A 1  640  ? 133.984 35.818  4.127   1.00 160.26 ? 640  GLN A NE2   1 
ATOM   4951  N  N     . VAL A 1  641  ? 135.952 40.642  5.359   1.00 88.57  ? 641  VAL A N     1 
ATOM   4952  C  CA    . VAL A 1  641  ? 136.535 40.787  6.696   1.00 88.75  ? 641  VAL A CA    1 
ATOM   4953  C  C     . VAL A 1  641  ? 135.552 41.458  7.648   1.00 90.46  ? 641  VAL A C     1 
ATOM   4954  O  O     . VAL A 1  641  ? 135.489 41.103  8.830   1.00 89.89  ? 641  VAL A O     1 
ATOM   4955  C  CB    . VAL A 1  641  ? 137.837 41.579  6.639   1.00 94.37  ? 641  VAL A CB    1 
ATOM   4956  C  CG1   . VAL A 1  641  ? 138.616 41.418  7.943   1.00 95.53  ? 641  VAL A CG1   1 
ATOM   4957  C  CG2   . VAL A 1  641  ? 138.663 41.142  5.439   1.00 94.60  ? 641  VAL A CG2   1 
ATOM   4958  N  N     . CYS A 1  642  ? 134.808 42.451  7.123   1.00 85.23  ? 642  CYS A N     1 
ATOM   4959  C  CA    . CYS A 1  642  ? 133.824 43.194  7.877   1.00 83.97  ? 642  CYS A CA    1 
ATOM   4960  C  C     . CYS A 1  642  ? 132.621 42.331  8.152   1.00 87.50  ? 642  CYS A C     1 
ATOM   4961  O  O     . CYS A 1  642  ? 132.140 42.326  9.281   1.00 87.78  ? 642  CYS A O     1 
ATOM   4962  C  CB    . CYS A 1  642  ? 133.441 44.481  7.167   1.00 83.71  ? 642  CYS A CB    1 
ATOM   4963  S  SG    . CYS A 1  642  ? 132.521 45.629  8.212   1.00 87.88  ? 642  CYS A SG    1 
ATOM   4964  N  N     . ALA A 1  643  ? 132.171 41.551  7.148   1.00 82.92  ? 643  ALA A N     1 
ATOM   4965  C  CA    . ALA A 1  643  ? 131.037 40.630  7.266   1.00 82.00  ? 643  ALA A CA    1 
ATOM   4966  C  C     . ALA A 1  643  ? 131.249 39.603  8.394   1.00 86.87  ? 643  ALA A C     1 
ATOM   4967  O  O     . ALA A 1  643  ? 130.279 39.025  8.928   1.00 86.08  ? 643  ALA A O     1 
ATOM   4968  C  CB    . ALA A 1  643  ? 130.826 39.916  5.948   1.00 81.96  ? 643  ALA A CB    1 
ATOM   4969  N  N     . LYS A 1  644  ? 132.537 39.385  8.742   1.00 84.26  ? 644  LYS A N     1 
ATOM   4970  C  CA    . LYS A 1  644  ? 132.956 38.491  9.810   1.00 84.70  ? 644  LYS A CA    1 
ATOM   4971  C  C     . LYS A 1  644  ? 132.858 39.236  11.133  1.00 88.93  ? 644  LYS A C     1 
ATOM   4972  O  O     . LYS A 1  644  ? 132.155 38.760  12.025  1.00 88.69  ? 644  LYS A O     1 
ATOM   4973  C  CB    . LYS A 1  644  ? 134.368 37.953  9.560   1.00 88.43  ? 644  LYS A CB    1 
ATOM   4974  C  CG    . LYS A 1  644  ? 134.428 36.436  9.454   1.00 108.65 ? 644  LYS A CG    1 
ATOM   4975  C  CD    . LYS A 1  644  ? 135.734 35.994  8.793   1.00 126.85 ? 644  LYS A CD    1 
ATOM   4976  C  CE    . LYS A 1  644  ? 135.918 34.494  8.819   1.00 146.06 ? 644  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A 1  644  ? 137.203 34.079  8.193   1.00 157.09 ? 644  LYS A NZ    1 
ATOM   4978  N  N     . LEU A 1  645  ? 133.498 40.440  11.238  1.00 85.49  ? 645  LEU A N     1 
ATOM   4979  C  CA    . LEU A 1  645  ? 133.489 41.330  12.420  1.00 85.27  ? 645  LEU A CA    1 
ATOM   4980  C  C     . LEU A 1  645  ? 132.078 41.451  13.013  1.00 86.82  ? 645  LEU A C     1 
ATOM   4981  O  O     . LEU A 1  645  ? 131.921 41.413  14.235  1.00 86.89  ? 645  LEU A O     1 
ATOM   4982  C  CB    . LEU A 1  645  ? 134.033 42.717  12.034  1.00 85.69  ? 645  LEU A CB    1 
ATOM   4983  C  CG    . LEU A 1  645  ? 133.672 43.874  12.956  1.00 90.88  ? 645  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A 1  645  ? 134.810 44.210  13.864  1.00 92.53  ? 645  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A 1  645  ? 133.214 45.093  12.166  1.00 93.73  ? 645  LEU A CD2   1 
ATOM   4986  N  N     . PHE A 1  646  ? 131.065 41.574  12.119  1.00 80.98  ? 646  PHE A N     1 
ATOM   4987  C  CA    . PHE A 1  646  ? 129.634 41.653  12.404  1.00 79.39  ? 646  PHE A CA    1 
ATOM   4988  C  C     . PHE A 1  646  ? 129.240 40.475  13.236  1.00 82.27  ? 646  PHE A C     1 
ATOM   4989  O  O     . PHE A 1  646  ? 128.753 40.657  14.350  1.00 82.50  ? 646  PHE A O     1 
ATOM   4990  C  CB    . PHE A 1  646  ? 128.821 41.637  11.091  1.00 79.76  ? 646  PHE A CB    1 
ATOM   4991  C  CG    . PHE A 1  646  ? 128.430 43.008  10.626  1.00 80.89  ? 646  PHE A CG    1 
ATOM   4992  C  CD1   . PHE A 1  646  ? 129.322 43.794  9.908   1.00 84.36  ? 646  PHE A CD1   1 
ATOM   4993  C  CD2   . PHE A 1  646  ? 127.196 43.540  10.953  1.00 82.32  ? 646  PHE A CD2   1 
ATOM   4994  C  CE1   . PHE A 1  646  ? 128.986 45.089  9.527   1.00 85.49  ? 646  PHE A CE1   1 
ATOM   4995  C  CE2   . PHE A 1  646  ? 126.856 44.833  10.566  1.00 85.61  ? 646  PHE A CE2   1 
ATOM   4996  C  CZ    . PHE A 1  646  ? 127.755 45.600  9.856   1.00 84.34  ? 646  PHE A CZ    1 
ATOM   4997  N  N     . GLY A 1  647  ? 129.490 39.281  12.697  1.00 77.71  ? 647  GLY A N     1 
ATOM   4998  C  CA    . GLY A 1  647  ? 129.187 38.023  13.355  1.00 77.41  ? 647  GLY A CA    1 
ATOM   4999  C  C     . GLY A 1  647  ? 129.943 37.846  14.654  1.00 82.04  ? 647  GLY A C     1 
ATOM   5000  O  O     . GLY A 1  647  ? 129.339 37.525  15.673  1.00 82.41  ? 647  GLY A O     1 
ATOM   5001  N  N     . ASN A 1  648  ? 131.253 38.102  14.641  1.00 78.03  ? 648  ASN A N     1 
ATOM   5002  C  CA    . ASN A 1  648  ? 132.094 37.916  15.812  1.00 78.62  ? 648  ASN A CA    1 
ATOM   5003  C  C     . ASN A 1  648  ? 131.734 38.854  16.968  1.00 82.56  ? 648  ASN A C     1 
ATOM   5004  O  O     . ASN A 1  648  ? 131.746 38.397  18.112  1.00 83.30  ? 648  ASN A O     1 
ATOM   5005  C  CB    . ASN A 1  648  ? 133.557 37.962  15.431  1.00 79.71  ? 648  ASN A CB    1 
ATOM   5006  C  CG    . ASN A 1  648  ? 133.914 36.750  14.592  1.00 105.89 ? 648  ASN A CG    1 
ATOM   5007  O  OD1   . ASN A 1  648  ? 133.037 36.015  14.084  1.00 96.90  ? 648  ASN A OD1   1 
ATOM   5008  N  ND2   . ASN A 1  648  ? 135.205 36.500  14.440  1.00 101.35 ? 648  ASN A ND2   1 
ATOM   5009  N  N     . ILE A 1  649  ? 131.326 40.110  16.689  1.00 77.79  ? 649  ILE A N     1 
ATOM   5010  C  CA    . ILE A 1  649  ? 130.861 41.017  17.748  1.00 77.53  ? 649  ILE A CA    1 
ATOM   5011  C  C     . ILE A 1  649  ? 129.593 40.380  18.338  1.00 80.91  ? 649  ILE A C     1 
ATOM   5012  O  O     . ILE A 1  649  ? 129.546 40.140  19.540  1.00 82.95  ? 649  ILE A O     1 
ATOM   5013  C  CB    . ILE A 1  649  ? 130.625 42.471  17.239  1.00 79.89  ? 649  ILE A CB    1 
ATOM   5014  C  CG1   . ILE A 1  649  ? 131.963 43.211  17.073  1.00 80.96  ? 649  ILE A CG1   1 
ATOM   5015  C  CG2   . ILE A 1  649  ? 129.657 43.256  18.151  1.00 79.73  ? 649  ILE A CG2   1 
ATOM   5016  C  CD1   . ILE A 1  649  ? 131.884 44.401  16.188  1.00 83.29  ? 649  ILE A CD1   1 
ATOM   5017  N  N     . GLN A 1  650  ? 128.627 40.022  17.472  1.00 73.64  ? 650  GLN A N     1 
ATOM   5018  C  CA    . GLN A 1  650  ? 127.370 39.391  17.835  1.00 71.78  ? 650  GLN A CA    1 
ATOM   5019  C  C     . GLN A 1  650  ? 127.561 38.132  18.665  1.00 76.36  ? 650  GLN A C     1 
ATOM   5020  O  O     . GLN A 1  650  ? 127.001 38.035  19.745  1.00 76.21  ? 650  GLN A O     1 
ATOM   5021  C  CB    . GLN A 1  650  ? 126.569 39.060  16.581  1.00 71.30  ? 650  GLN A CB    1 
ATOM   5022  C  CG    . GLN A 1  650  ? 125.864 40.239  15.968  1.00 79.96  ? 650  GLN A CG    1 
ATOM   5023  C  CD    . GLN A 1  650  ? 125.098 39.825  14.741  1.00 98.85  ? 650  GLN A CD    1 
ATOM   5024  O  OE1   . GLN A 1  650  ? 124.056 39.141  14.814  1.00 100.41 ? 650  GLN A OE1   1 
ATOM   5025  N  NE2   . GLN A 1  650  ? 125.581 40.264  13.590  1.00 81.43  ? 650  GLN A NE2   1 
ATOM   5026  N  N     . LYS A 1  651  ? 128.380 37.186  18.190  1.00 73.74  ? 651  LYS A N     1 
ATOM   5027  C  CA    . LYS A 1  651  ? 128.624 35.912  18.874  1.00 74.27  ? 651  LYS A CA    1 
ATOM   5028  C  C     . LYS A 1  651  ? 129.071 36.128  20.326  1.00 80.19  ? 651  LYS A C     1 
ATOM   5029  O  O     . LYS A 1  651  ? 128.565 35.441  21.222  1.00 81.39  ? 651  LYS A O     1 
ATOM   5030  C  CB    . LYS A 1  651  ? 129.590 34.997  18.071  1.00 76.00  ? 651  LYS A CB    1 
ATOM   5031  C  CG    . LYS A 1  651  ? 128.893 34.153  16.982  1.00 82.79  ? 651  LYS A CG    1 
ATOM   5032  C  CD    . LYS A 1  651  ? 129.768 33.884  15.729  1.00 87.76  ? 651  LYS A CD    1 
ATOM   5033  C  CE    . LYS A 1  651  ? 129.153 34.326  14.398  1.00 88.83  ? 651  LYS A CE    1 
ATOM   5034  N  NZ    . LYS A 1  651  ? 127.933 33.550  13.972  1.00 86.25  ? 651  LYS A NZ    1 
ATOM   5035  N  N     . VAL A 1  652  ? 129.928 37.146  20.562  1.00 75.84  ? 652  VAL A N     1 
ATOM   5036  C  CA    . VAL A 1  652  ? 130.440 37.468  21.890  1.00 76.31  ? 652  VAL A CA    1 
ATOM   5037  C  C     . VAL A 1  652  ? 129.446 38.280  22.692  1.00 82.36  ? 652  VAL A C     1 
ATOM   5038  O  O     . VAL A 1  652  ? 129.087 37.869  23.798  1.00 83.91  ? 652  VAL A O     1 
ATOM   5039  C  CB    . VAL A 1  652  ? 131.834 38.120  21.856  1.00 80.03  ? 652  VAL A CB    1 
ATOM   5040  C  CG1   . VAL A 1  652  ? 132.296 38.488  23.255  1.00 81.29  ? 652  VAL A CG1   1 
ATOM   5041  C  CG2   . VAL A 1  652  ? 132.839 37.191  21.213  1.00 79.44  ? 652  VAL A CG2   1 
ATOM   5042  N  N     . VAL A 1  653  ? 129.015 39.435  22.159  1.00 78.52  ? 653  VAL A N     1 
ATOM   5043  C  CA    . VAL A 1  653  ? 128.077 40.327  22.848  1.00 78.79  ? 653  VAL A CA    1 
ATOM   5044  C  C     . VAL A 1  653  ? 126.799 39.581  23.223  1.00 82.16  ? 653  VAL A C     1 
ATOM   5045  O  O     . VAL A 1  653  ? 126.440 39.565  24.404  1.00 83.37  ? 653  VAL A O     1 
ATOM   5046  C  CB    . VAL A 1  653  ? 127.808 41.669  22.108  1.00 82.33  ? 653  VAL A CB    1 
ATOM   5047  C  CG1   . VAL A 1  653  ? 126.697 42.465  22.785  1.00 82.06  ? 653  VAL A CG1   1 
ATOM   5048  C  CG2   . VAL A 1  653  ? 129.083 42.511  22.019  1.00 83.44  ? 653  VAL A CG2   1 
ATOM   5049  N  N     . ASN A 1  654  ? 126.174 38.899  22.252  1.00 76.57  ? 654  ASN A N     1 
ATOM   5050  C  CA    . ASN A 1  654  ? 124.950 38.152  22.486  1.00 75.67  ? 654  ASN A CA    1 
ATOM   5051  C  C     . ASN A 1  654  ? 125.111 37.147  23.615  1.00 81.15  ? 654  ASN A C     1 
ATOM   5052  O  O     . ASN A 1  654  ? 124.260 37.131  24.515  1.00 81.90  ? 654  ASN A O     1 
ATOM   5053  C  CB    . ASN A 1  654  ? 124.435 37.509  21.202  1.00 75.25  ? 654  ASN A CB    1 
ATOM   5054  C  CG    . ASN A 1  654  ? 123.979 38.490  20.133  1.00 98.57  ? 654  ASN A CG    1 
ATOM   5055  O  OD1   . ASN A 1  654  ? 123.441 39.573  20.424  1.00 91.99  ? 654  ASN A OD1   1 
ATOM   5056  N  ND2   . ASN A 1  654  ? 124.151 38.104  18.861  1.00 87.09  ? 654  ASN A ND2   1 
ATOM   5057  N  N     . PHE A 1  655  ? 126.237 36.380  23.620  1.00 78.25  ? 655  PHE A N     1 
ATOM   5058  C  CA    . PHE A 1  655  ? 126.551 35.379  24.654  1.00 79.39  ? 655  PHE A CA    1 
ATOM   5059  C  C     . PHE A 1  655  ? 126.637 36.017  26.050  1.00 85.09  ? 655  PHE A C     1 
ATOM   5060  O  O     . PHE A 1  655  ? 125.966 35.556  26.985  1.00 84.40  ? 655  PHE A O     1 
ATOM   5061  C  CB    . PHE A 1  655  ? 127.842 34.585  24.315  1.00 81.44  ? 655  PHE A CB    1 
ATOM   5062  C  CG    . PHE A 1  655  ? 128.392 33.759  25.463  1.00 84.23  ? 655  PHE A CG    1 
ATOM   5063  C  CD1   . PHE A 1  655  ? 129.273 34.316  26.386  1.00 87.62  ? 655  PHE A CD1   1 
ATOM   5064  C  CD2   . PHE A 1  655  ? 128.008 32.437  25.636  1.00 87.05  ? 655  PHE A CD2   1 
ATOM   5065  C  CE1   . PHE A 1  655  ? 129.739 33.568  27.474  1.00 91.61  ? 655  PHE A CE1   1 
ATOM   5066  C  CE2   . PHE A 1  655  ? 128.500 31.681  26.709  1.00 89.08  ? 655  PHE A CE2   1 
ATOM   5067  C  CZ    . PHE A 1  655  ? 129.358 32.253  27.624  1.00 89.35  ? 655  PHE A CZ    1 
ATOM   5068  N  N     . TRP A 1  656  ? 127.480 37.060  26.182  1.00 83.64  ? 656  TRP A N     1 
ATOM   5069  C  CA    . TRP A 1  656  ? 127.675 37.771  27.434  1.00 85.89  ? 656  TRP A CA    1 
ATOM   5070  C  C     . TRP A 1  656  ? 126.339 38.241  28.001  1.00 86.62  ? 656  TRP A C     1 
ATOM   5071  O  O     . TRP A 1  656  ? 126.048 37.956  29.166  1.00 87.68  ? 656  TRP A O     1 
ATOM   5072  C  CB    . TRP A 1  656  ? 128.652 38.941  27.270  1.00 86.88  ? 656  TRP A CB    1 
ATOM   5073  C  CG    . TRP A 1  656  ? 128.828 39.698  28.550  1.00 91.04  ? 656  TRP A CG    1 
ATOM   5074  C  CD1   . TRP A 1  656  ? 129.646 39.365  29.592  1.00 95.84  ? 656  TRP A CD1   1 
ATOM   5075  C  CD2   . TRP A 1  656  ? 128.063 40.828  28.986  1.00 91.87  ? 656  TRP A CD2   1 
ATOM   5076  N  NE1   . TRP A 1  656  ? 129.480 40.254  30.628  1.00 97.31  ? 656  TRP A NE1   1 
ATOM   5077  C  CE2   . TRP A 1  656  ? 128.507 41.158  30.287  1.00 98.31  ? 656  TRP A CE2   1 
ATOM   5078  C  CE3   . TRP A 1  656  ? 127.055 41.609  28.397  1.00 92.53  ? 656  TRP A CE3   1 
ATOM   5079  C  CZ2   . TRP A 1  656  ? 127.990 42.247  30.999  1.00 98.83  ? 656  TRP A CZ2   1 
ATOM   5080  C  CZ3   . TRP A 1  656  ? 126.535 42.679  29.108  1.00 95.35  ? 656  TRP A CZ3   1 
ATOM   5081  C  CH2   . TRP A 1  656  ? 127.009 42.998  30.387  1.00 97.92  ? 656  TRP A CH2   1 
ATOM   5082  N  N     . LEU A 1  657  ? 125.532 38.940  27.167  1.00 78.73  ? 657  LEU A N     1 
ATOM   5083  C  CA    . LEU A 1  657  ? 124.218 39.443  27.533  1.00 76.93  ? 657  LEU A CA    1 
ATOM   5084  C  C     . LEU A 1  657  ? 123.280 38.300  27.907  1.00 80.17  ? 657  LEU A C     1 
ATOM   5085  O  O     . LEU A 1  657  ? 122.579 38.443  28.899  1.00 80.85  ? 657  LEU A O     1 
ATOM   5086  C  CB    . LEU A 1  657  ? 123.619 40.354  26.448  1.00 75.47  ? 657  LEU A CB    1 
ATOM   5087  C  CG    . LEU A 1  657  ? 122.259 41.000  26.774  1.00 79.76  ? 657  LEU A CG    1 
ATOM   5088  C  CD1   . LEU A 1  657  ? 122.405 42.164  27.714  1.00 82.07  ? 657  LEU A CD1   1 
ATOM   5089  C  CD2   . LEU A 1  657  ? 121.522 41.428  25.530  1.00 79.43  ? 657  LEU A CD2   1 
ATOM   5090  N  N     . LEU A 1  658  ? 123.301 37.148  27.190  1.00 75.04  ? 658  LEU A N     1 
ATOM   5091  C  CA    . LEU A 1  658  ? 122.456 36.005  27.585  1.00 74.75  ? 658  LEU A CA    1 
ATOM   5092  C  C     . LEU A 1  658  ? 122.681 35.683  29.057  1.00 84.32  ? 658  LEU A C     1 
ATOM   5093  O  O     . LEU A 1  658  ? 121.716 35.412  29.767  1.00 83.78  ? 658  LEU A O     1 
ATOM   5094  C  CB    . LEU A 1  658  ? 122.716 34.734  26.726  1.00 72.69  ? 658  LEU A CB    1 
ATOM   5095  C  CG    . LEU A 1  658  ? 122.292 33.353  27.301  1.00 74.58  ? 658  LEU A CG    1 
ATOM   5096  C  CD1   . LEU A 1  658  ? 120.823 33.147  27.230  1.00 72.93  ? 658  LEU A CD1   1 
ATOM   5097  C  CD2   . LEU A 1  658  ? 122.895 32.262  26.538  1.00 74.88  ? 658  LEU A CD2   1 
ATOM   5098  N  N     . HIS A 1  659  ? 123.950 35.753  29.506  1.00 85.95  ? 659  HIS A N     1 
ATOM   5099  C  CA    . HIS A 1  659  ? 124.356 35.449  30.872  1.00 89.68  ? 659  HIS A CA    1 
ATOM   5100  C  C     . HIS A 1  659  ? 124.393 36.646  31.804  1.00 100.02 ? 659  HIS A C     1 
ATOM   5101  O  O     . HIS A 1  659  ? 124.701 36.471  32.980  1.00 101.42 ? 659  HIS A O     1 
ATOM   5102  C  CB    . HIS A 1  659  ? 125.686 34.705  30.875  1.00 91.27  ? 659  HIS A CB    1 
ATOM   5103  C  CG    . HIS A 1  659  ? 125.539 33.333  30.322  1.00 94.12  ? 659  HIS A CG    1 
ATOM   5104  N  ND1   . HIS A 1  659  ? 125.669 33.089  28.966  1.00 94.67  ? 659  HIS A ND1   1 
ATOM   5105  C  CD2   . HIS A 1  659  ? 125.158 32.193  30.944  1.00 96.54  ? 659  HIS A CD2   1 
ATOM   5106  C  CE1   . HIS A 1  659  ? 125.414 31.799  28.811  1.00 94.02  ? 659  HIS A CE1   1 
ATOM   5107  N  NE2   . HIS A 1  659  ? 125.085 31.221  29.971  1.00 95.39  ? 659  HIS A NE2   1 
ATOM   5108  N  N     . ASN A 1  660  ? 124.041 37.846  31.313  1.00 82.51  ? 660  ASN A N     1 
ATOM   5109  C  CA    . ASN A 1  660  ? 123.948 39.059  32.145  1.00 85.08  ? 660  ASN A CA    1 
ATOM   5110  C  C     . ASN A 1  660  ? 122.464 39.428  32.340  1.00 90.00  ? 660  ASN A C     1 
ATOM   5111  O  O     . ASN A 1  660  ? 122.041 39.756  33.455  1.00 89.92  ? 660  ASN A O     1 
ATOM   5112  C  CB    . ASN A 1  660  ? 124.718 40.229  31.523  1.00 86.16  ? 660  ASN A CB    1 
ATOM   5113  C  CG    . ASN A 1  660  ? 124.741 41.445  32.409  1.00 103.81 ? 660  ASN A CG    1 
ATOM   5114  O  OD1   . ASN A 1  660  ? 125.650 41.620  33.219  1.00 101.98 ? 660  ASN A OD1   1 
ATOM   5115  N  ND2   . ASN A 1  660  ? 123.748 42.317  32.270  1.00 89.38  ? 660  ASN A ND2   1 
ATOM   5116  N  N     . GLY A 1  661  ? 121.718 39.369  31.233  1.00 86.63  ? 661  GLY A N     1 
ATOM   5117  C  CA    . GLY A 1  661  ? 120.296 39.656  31.137  1.00 86.76  ? 661  GLY A CA    1 
ATOM   5118  C  C     . GLY A 1  661  ? 119.996 41.135  31.041  1.00 92.95  ? 661  GLY A C     1 
ATOM   5119  O  O     . GLY A 1  661  ? 120.811 41.977  31.440  1.00 93.99  ? 661  GLY A O     1 
ATOM   5120  N  N     . PHE A 1  662  ? 118.815 41.453  30.498  1.00 89.28  ? 662  PHE A N     1 
ATOM   5121  C  CA    . PHE A 1  662  ? 118.304 42.814  30.371  1.00 89.25  ? 662  PHE A CA    1 
ATOM   5122  C  C     . PHE A 1  662  ? 116.783 42.792  30.372  1.00 91.71  ? 662  PHE A C     1 
ATOM   5123  O  O     . PHE A 1  662  ? 116.198 41.821  29.895  1.00 91.06  ? 662  PHE A O     1 
ATOM   5124  C  CB    . PHE A 1  662  ? 118.845 43.498  29.123  1.00 90.30  ? 662  PHE A CB    1 
ATOM   5125  C  CG    . PHE A 1  662  ? 118.593 44.981  29.157  1.00 93.47  ? 662  PHE A CG    1 
ATOM   5126  C  CD1   . PHE A 1  662  ? 119.145 45.775  30.158  1.00 99.44  ? 662  PHE A CD1   1 
ATOM   5127  C  CD2   . PHE A 1  662  ? 117.778 45.586  28.206  1.00 95.23  ? 662  PHE A CD2   1 
ATOM   5128  C  CE1   . PHE A 1  662  ? 118.907 47.153  30.190  1.00 101.32 ? 662  PHE A CE1   1 
ATOM   5129  C  CE2   . PHE A 1  662  ? 117.538 46.964  28.240  1.00 98.85  ? 662  PHE A CE2   1 
ATOM   5130  C  CZ    . PHE A 1  662  ? 118.113 47.741  29.224  1.00 98.87  ? 662  PHE A CZ    1 
ATOM   5131  N  N     . SER A 1  663  ? 116.137 43.827  30.941  1.00 87.21  ? 663  SER A N     1 
ATOM   5132  C  CA    . SER A 1  663  ? 114.673 43.872  31.044  1.00 86.05  ? 663  SER A CA    1 
ATOM   5133  C  C     . SER A 1  663  ? 114.142 45.323  30.998  1.00 90.52  ? 663  SER A C     1 
ATOM   5134  O  O     . SER A 1  663  ? 114.898 46.213  30.640  1.00 89.65  ? 663  SER A O     1 
ATOM   5135  C  CB    . SER A 1  663  ? 114.236 43.138  32.312  1.00 89.26  ? 663  SER A CB    1 
ATOM   5136  O  OG    . SER A 1  663  ? 112.832 43.019  32.461  1.00 93.54  ? 663  SER A OG    1 
ATOM   5137  N  N     . THR A 1  664  ? 112.837 45.538  31.290  1.00 88.39  ? 664  THR A N     1 
ATOM   5138  C  CA    . THR A 1  664  ? 112.102 46.811  31.356  1.00 89.09  ? 664  THR A CA    1 
ATOM   5139  C  C     . THR A 1  664  ? 110.790 46.566  32.089  1.00 97.40  ? 664  THR A C     1 
ATOM   5140  O  O     . THR A 1  664  ? 110.019 45.697  31.672  1.00 97.83  ? 664  THR A O     1 
ATOM   5141  C  CB    . THR A 1  664  ? 111.903 47.429  29.959  1.00 92.26  ? 664  THR A CB    1 
ATOM   5142  O  OG1   . THR A 1  664  ? 113.058 48.206  29.690  1.00 95.25  ? 664  THR A OG1   1 
ATOM   5143  C  CG2   . THR A 1  664  ? 110.681 48.350  29.864  1.00 88.07  ? 664  THR A CG2   1 
ATOM   5144  N  N     . GLY A 1  665  ? 110.559 47.312  33.171  1.00 96.57  ? 665  GLY A N     1 
ATOM   5145  C  CA    . GLY A 1  665  ? 109.345 47.230  33.990  1.00 97.65  ? 665  GLY A CA    1 
ATOM   5146  C  C     . GLY A 1  665  ? 108.669 48.573  34.136  1.00 101.19 ? 665  GLY A C     1 
ATOM   5147  O  O     . GLY A 1  665  ? 109.156 49.563  33.576  1.00 100.20 ? 665  GLY A O     1 
ATOM   5148  N  N     . ILE A 1  666  ? 107.560 48.643  34.893  1.00 98.38  ? 666  ILE A N     1 
ATOM   5149  C  CA    . ILE A 1  666  ? 106.902 49.950  35.079  1.00 99.29  ? 666  ILE A CA    1 
ATOM   5150  C  C     . ILE A 1  666  ? 107.767 50.839  35.963  1.00 106.47 ? 666  ILE A C     1 
ATOM   5151  O  O     . ILE A 1  666  ? 107.612 52.062  35.941  1.00 107.14 ? 666  ILE A O     1 
ATOM   5152  C  CB    . ILE A 1  666  ? 105.406 49.960  35.524  1.00 102.94 ? 666  ILE A CB    1 
ATOM   5153  C  CG1   . ILE A 1  666  ? 104.812 48.562  35.592  1.00 103.75 ? 666  ILE A CG1   1 
ATOM   5154  C  CG2   . ILE A 1  666  ? 104.542 50.901  34.669  1.00 101.23 ? 666  ILE A CG2   1 
ATOM   5155  C  CD1   . ILE A 1  666  ? 105.170 47.872  36.857  1.00 118.41 ? 666  ILE A CD1   1 
ATOM   5156  N  N     . GLY A 1  667  ? 108.718 50.227  36.670  1.00 104.24 ? 667  GLY A N     1 
ATOM   5157  C  CA    . GLY A 1  667  ? 109.664 50.949  37.514  1.00 106.41 ? 667  GLY A CA    1 
ATOM   5158  C  C     . GLY A 1  667  ? 110.573 51.901  36.751  1.00 109.62 ? 667  GLY A C     1 
ATOM   5159  O  O     . GLY A 1  667  ? 111.065 52.898  37.305  1.00 110.65 ? 667  GLY A O     1 
ATOM   5160  N  N     . ASP A 1  668  ? 110.795 51.593  35.463  1.00 103.48 ? 668  ASP A N     1 
ATOM   5161  C  CA    . ASP A 1  668  ? 111.614 52.413  34.587  1.00 102.22 ? 668  ASP A CA    1 
ATOM   5162  C  C     . ASP A 1  668  ? 110.906 53.730  34.161  1.00 106.33 ? 668  ASP A C     1 
ATOM   5163  O  O     . ASP A 1  668  ? 111.589 54.656  33.726  1.00 105.96 ? 668  ASP A O     1 
ATOM   5164  C  CB    . ASP A 1  668  ? 112.121 51.594  33.394  1.00 101.35 ? 668  ASP A CB    1 
ATOM   5165  C  CG    . ASP A 1  668  ? 113.010 50.427  33.785  1.00 106.30 ? 668  ASP A CG    1 
ATOM   5166  O  OD1   . ASP A 1  668  ? 114.015 50.653  34.489  1.00 107.32 ? 668  ASP A OD1   1 
ATOM   5167  O  OD2   . ASP A 1  668  ? 112.725 49.298  33.354  1.00 109.65 ? 668  ASP A OD2   1 
ATOM   5168  N  N     . THR A 1  669  ? 109.564 53.834  34.327  1.00 102.97 ? 669  THR A N     1 
ATOM   5169  C  CA    . THR A 1  669  ? 108.808 55.058  34.015  1.00 103.25 ? 669  THR A CA    1 
ATOM   5170  C  C     . THR A 1  669  ? 108.558 55.879  35.288  1.00 112.66 ? 669  THR A C     1 
ATOM   5171  O  O     . THR A 1  669  ? 108.265 57.084  35.210  1.00 114.25 ? 669  THR A O     1 
ATOM   5172  C  CB    . THR A 1  669  ? 107.478 54.746  33.309  1.00 106.14 ? 669  THR A CB    1 
ATOM   5173  O  OG1   . THR A 1  669  ? 106.787 53.729  34.014  1.00 103.53 ? 669  THR A OG1   1 
ATOM   5174  C  CG2   . THR A 1  669  ? 107.658 54.313  31.883  1.00 104.36 ? 669  THR A CG2   1 
ATOM   5175  N  N     . ILE A 1  670  ? 108.664 55.220  36.464  1.00 111.11 ? 670  ILE A N     1 
ATOM   5176  C  CA    . ILE A 1  670  ? 108.427 55.831  37.771  1.00 113.63 ? 670  ILE A CA    1 
ATOM   5177  C  C     . ILE A 1  670  ? 109.504 56.860  38.105  1.00 119.91 ? 670  ILE A C     1 
ATOM   5178  O  O     . ILE A 1  670  ? 110.682 56.515  38.243  1.00 119.69 ? 670  ILE A O     1 
ATOM   5179  C  CB    . ILE A 1  670  ? 108.236 54.727  38.849  1.00 117.67 ? 670  ILE A CB    1 
ATOM   5180  C  CG1   . ILE A 1  670  ? 106.783 54.243  38.828  1.00 117.48 ? 670  ILE A CG1   1 
ATOM   5181  C  CG2   . ILE A 1  670  ? 108.621 55.185  40.265  1.00 121.57 ? 670  ILE A CG2   1 
ATOM   5182  C  CD1   . ILE A 1  670  ? 106.609 52.804  38.847  1.00 124.23 ? 670  ILE A CD1   1 
ATOM   5183  N  N     . ALA A 1  671  ? 109.099 58.131  38.180  1.00 118.63 ? 671  ALA A N     1 
ATOM   5184  C  CA    . ALA A 1  671  ? 110.026 59.198  38.545  1.00 121.35 ? 671  ALA A CA    1 
ATOM   5185  C  C     . ALA A 1  671  ? 109.882 59.492  40.039  1.00 130.99 ? 671  ALA A C     1 
ATOM   5186  O  O     . ALA A 1  671  ? 108.806 59.265  40.603  1.00 132.10 ? 671  ALA A O     1 
ATOM   5187  C  CB    . ALA A 1  671  ? 109.746 60.443  37.729  1.00 121.68 ? 671  ALA A CB    1 
ATOM   5188  N  N     . ASP A 1  672  ? 110.959 59.984  40.680  1.00 130.46 ? 672  ASP A N     1 
ATOM   5189  C  CA    . ASP A 1  672  ? 111.019 60.301  42.115  1.00 134.00 ? 672  ASP A CA    1 
ATOM   5190  C  C     . ASP A 1  672  ? 109.890 61.208  42.587  1.00 138.83 ? 672  ASP A C     1 
ATOM   5191  O  O     . ASP A 1  672  ? 109.483 62.109  41.856  1.00 137.81 ? 672  ASP A O     1 
ATOM   5192  C  CB    . ASP A 1  672  ? 112.364 60.965  42.437  1.00 138.29 ? 672  ASP A CB    1 
ATOM   5193  C  CG    . ASP A 1  672  ? 112.801 61.005  43.887  1.00 154.97 ? 672  ASP A CG    1 
ATOM   5194  O  OD1   . ASP A 1  672  ? 112.226 60.250  44.707  1.00 157.48 ? 672  ASP A OD1   1 
ATOM   5195  O  OD2   . ASP A 1  672  ? 113.744 61.768  44.199  1.00 162.39 ? 672  ASP A OD2   1 
ATOM   5196  N  N     . GLY A 1  673  ? 109.412 60.958  43.804  1.00 137.35 ? 673  GLY A N     1 
ATOM   5197  C  CA    . GLY A 1  673  ? 108.358 61.736  44.455  1.00 138.94 ? 673  GLY A CA    1 
ATOM   5198  C  C     . GLY A 1  673  ? 108.571 63.243  44.427  1.00 143.46 ? 673  GLY A C     1 
ATOM   5199  O  O     . GLY A 1  673  ? 107.729 63.950  43.860  1.00 141.85 ? 673  GLY A O     1 
ATOM   5200  N  N     . PRO A 1  674  ? 109.706 63.774  44.984  1.00 141.68 ? 674  PRO A N     1 
ATOM   5201  C  CA    . PRO A 1  674  ? 109.938 65.231  44.947  1.00 142.73 ? 674  PRO A CA    1 
ATOM   5202  C  C     . PRO A 1  674  ? 110.129 65.770  43.534  1.00 141.95 ? 674  PRO A C     1 
ATOM   5203  O  O     . PRO A 1  674  ? 109.754 66.912  43.259  1.00 142.44 ? 674  PRO A O     1 
ATOM   5204  C  CB    . PRO A 1  674  ? 111.204 65.412  45.791  1.00 147.42 ? 674  PRO A CB    1 
ATOM   5205  C  CG    . PRO A 1  674  ? 111.902 64.111  45.714  1.00 150.53 ? 674  PRO A CG    1 
ATOM   5206  C  CD    . PRO A 1  674  ? 110.800 63.096  45.712  1.00 144.60 ? 674  PRO A CD    1 
ATOM   5207  N  N     . THR A 1  675  ? 110.693 64.939  42.642  1.00 133.76 ? 675  THR A N     1 
ATOM   5208  C  CA    . THR A 1  675  ? 110.901 65.282  41.244  1.00 130.82 ? 675  THR A CA    1 
ATOM   5209  C  C     . THR A 1  675  ? 109.545 65.446  40.575  1.00 132.42 ? 675  THR A C     1 
ATOM   5210  O  O     . THR A 1  675  ? 109.389 66.312  39.725  1.00 130.85 ? 675  THR A O     1 
ATOM   5211  C  CB    . THR A 1  675  ? 111.776 64.224  40.578  1.00 139.10 ? 675  THR A CB    1 
ATOM   5212  O  OG1   . THR A 1  675  ? 113.001 64.133  41.308  1.00 143.34 ? 675  THR A OG1   1 
ATOM   5213  C  CG2   . THR A 1  675  ? 112.045 64.512  39.095  1.00 134.82 ? 675  THR A CG2   1 
ATOM   5214  N  N     . MET A 1  676  ? 108.558 64.647  40.992  1.00 129.38 ? 676  MET A N     1 
ATOM   5215  C  CA    . MET A 1  676  ? 107.208 64.709  40.449  1.00 128.37 ? 676  MET A CA    1 
ATOM   5216  C  C     . MET A 1  676  ? 106.500 66.000  40.783  1.00 134.28 ? 676  MET A C     1 
ATOM   5217  O  O     . MET A 1  676  ? 105.864 66.586  39.906  1.00 132.66 ? 676  MET A O     1 
ATOM   5218  C  CB    . MET A 1  676  ? 106.386 63.503  40.887  1.00 130.39 ? 676  MET A CB    1 
ATOM   5219  C  CG    . MET A 1  676  ? 106.642 62.294  40.047  1.00 131.70 ? 676  MET A CG    1 
ATOM   5220  S  SD    . MET A 1  676  ? 106.443 62.637  38.282  1.00 133.73 ? 676  MET A SD    1 
ATOM   5221  C  CE    . MET A 1  676  ? 106.025 60.894  37.661  1.00 127.94 ? 676  MET A CE    1 
ATOM   5222  N  N     . ARG A 1  677  ? 106.638 66.460  42.039  1.00 134.00 ? 677  ARG A N     1 
ATOM   5223  C  CA    . ARG A 1  677  ? 106.063 67.716  42.528  1.00 136.10 ? 677  ARG A CA    1 
ATOM   5224  C  C     . ARG A 1  677  ? 106.656 68.867  41.707  1.00 138.58 ? 677  ARG A C     1 
ATOM   5225  O  O     . ARG A 1  677  ? 105.923 69.744  41.246  1.00 137.61 ? 677  ARG A O     1 
ATOM   5226  C  CB    . ARG A 1  677  ? 106.367 67.905  44.031  1.00 141.04 ? 677  ARG A CB    1 
ATOM   5227  C  CG    . ARG A 1  677  ? 105.917 66.740  44.930  1.00 153.99 ? 677  ARG A CG    1 
ATOM   5228  C  CD    . ARG A 1  677  ? 106.077 67.022  46.419  1.00 169.79 ? 677  ARG A CD    1 
ATOM   5229  N  NE    . ARG A 1  677  ? 107.480 67.123  46.829  1.00 184.86 ? 677  ARG A NE    1 
ATOM   5230  C  CZ    . ARG A 1  677  ? 108.090 68.261  47.156  1.00 207.12 ? 677  ARG A CZ    1 
ATOM   5231  N  NH1   . ARG A 1  677  ? 107.425 69.411  47.135  1.00 196.50 ? 677  ARG A NH1   1 
ATOM   5232  N  NH2   . ARG A 1  677  ? 109.368 68.255  47.513  1.00 198.10 ? 677  ARG A NH2   1 
ATOM   5233  N  N     . GLU A 1  678  ? 107.984 68.793  41.473  1.00 134.94 ? 678  GLU A N     1 
ATOM   5234  C  CA    . GLU A 1  678  ? 108.813 69.717  40.698  1.00 134.92 ? 678  GLU A CA    1 
ATOM   5235  C  C     . GLU A 1  678  ? 108.315 69.817  39.252  1.00 134.82 ? 678  GLU A C     1 
ATOM   5236  O  O     . GLU A 1  678  ? 108.235 70.924  38.718  1.00 135.07 ? 678  GLU A O     1 
ATOM   5237  C  CB    . GLU A 1  678  ? 110.274 69.236  40.737  1.00 136.63 ? 678  GLU A CB    1 
ATOM   5238  C  CG    . GLU A 1  678  ? 111.328 70.315  40.568  1.00 151.20 ? 678  GLU A CG    1 
ATOM   5239  C  CD    . GLU A 1  678  ? 112.715 69.935  41.060  1.00 180.20 ? 678  GLU A CD    1 
ATOM   5240  O  OE1   . GLU A 1  678  ? 112.818 69.103  41.993  1.00 176.90 ? 678  GLU A OE1   1 
ATOM   5241  O  OE2   . GLU A 1  678  ? 113.703 70.490  40.527  1.00 181.25 ? 678  GLU A OE2   1 
ATOM   5242  N  N     . ILE A 1  679  ? 107.963 68.664  38.635  1.00 127.47 ? 679  ILE A N     1 
ATOM   5243  C  CA    . ILE A 1  679  ? 107.433 68.588  37.271  1.00 124.18 ? 679  ILE A CA    1 
ATOM   5244  C  C     . ILE A 1  679  ? 106.042 69.235  37.266  1.00 128.63 ? 679  ILE A C     1 
ATOM   5245  O  O     . ILE A 1  679  ? 105.780 70.116  36.447  1.00 127.20 ? 679  ILE A O     1 
ATOM   5246  C  CB    . ILE A 1  679  ? 107.427 67.116  36.740  1.00 124.22 ? 679  ILE A CB    1 
ATOM   5247  C  CG1   . ILE A 1  679  ? 108.858 66.590  36.525  1.00 124.16 ? 679  ILE A CG1   1 
ATOM   5248  C  CG2   . ILE A 1  679  ? 106.619 66.974  35.446  1.00 122.24 ? 679  ILE A CG2   1 
ATOM   5249  C  CD1   . ILE A 1  679  ? 109.038 65.069  36.663  1.00 129.53 ? 679  ILE A CD1   1 
ATOM   5250  N  N     . THR A 1  680  ? 105.184 68.832  38.230  1.00 127.34 ? 680  THR A N     1 
ATOM   5251  C  CA    . THR A 1  680  ? 103.807 69.305  38.403  1.00 128.22 ? 680  THR A CA    1 
ATOM   5252  C  C     . THR A 1  680  ? 103.761 70.833  38.548  1.00 135.29 ? 680  THR A C     1 
ATOM   5253  O  O     . THR A 1  680  ? 102.924 71.468  37.897  1.00 134.37 ? 680  THR A O     1 
ATOM   5254  C  CB    . THR A 1  680  ? 103.107 68.515  39.529  1.00 135.22 ? 680  THR A CB    1 
ATOM   5255  O  OG1   . THR A 1  680  ? 102.292 67.506  38.920  1.00 130.70 ? 680  THR A OG1   1 
ATOM   5256  C  CG2   . THR A 1  680  ? 102.264 69.390  40.475  1.00 135.11 ? 680  THR A CG2   1 
ATOM   5257  N  N     . GLU A 1  681  ? 104.680 71.416  39.346  1.00 135.13 ? 681  GLU A N     1 
ATOM   5258  C  CA    . GLU A 1  681  ? 104.726 72.867  39.517  1.00 137.95 ? 681  GLU A CA    1 
ATOM   5259  C  C     . GLU A 1  681  ? 105.351 73.570  38.292  1.00 139.63 ? 681  GLU A C     1 
ATOM   5260  O  O     . GLU A 1  681  ? 105.061 74.747  38.064  1.00 140.85 ? 681  GLU A O     1 
ATOM   5261  C  CB    . GLU A 1  681  ? 105.364 73.296  40.855  1.00 143.23 ? 681  GLU A CB    1 
ATOM   5262  C  CG    . GLU A 1  681  ? 106.841 72.989  41.032  1.00 159.38 ? 681  GLU A CG    1 
ATOM   5263  C  CD    . GLU A 1  681  ? 107.375 73.377  42.399  1.00 194.83 ? 681  GLU A CD    1 
ATOM   5264  O  OE1   . GLU A 1  681  ? 107.206 72.578  43.349  1.00 195.15 ? 681  GLU A OE1   1 
ATOM   5265  O  OE2   . GLU A 1  681  ? 107.945 74.487  42.525  1.00 194.90 ? 681  GLU A OE2   1 
ATOM   5266  N  N     . THR A 1  682  ? 106.147 72.838  37.478  1.00 132.33 ? 682  THR A N     1 
ATOM   5267  C  CA    . THR A 1  682  ? 106.712 73.374  36.242  1.00 130.59 ? 682  THR A CA    1 
ATOM   5268  C  C     . THR A 1  682  ? 105.576 73.583  35.262  1.00 133.56 ? 682  THR A C     1 
ATOM   5269  O  O     . THR A 1  682  ? 105.532 74.624  34.607  1.00 133.90 ? 682  THR A O     1 
ATOM   5270  C  CB    . THR A 1  682  ? 107.863 72.509  35.762  1.00 132.56 ? 682  THR A CB    1 
ATOM   5271  O  OG1   . THR A 1  682  ? 108.997 72.896  36.524  1.00 135.92 ? 682  THR A OG1   1 
ATOM   5272  C  CG2   . THR A 1  682  ? 108.166 72.664  34.271  1.00 126.50 ? 682  THR A CG2   1 
ATOM   5273  N  N     . ILE A 1  683  ? 104.613 72.637  35.225  1.00 128.95 ? 683  ILE A N     1 
ATOM   5274  C  CA    . ILE A 1  683  ? 103.420 72.775  34.387  1.00 128.00 ? 683  ILE A CA    1 
ATOM   5275  C  C     . ILE A 1  683  ? 102.624 73.983  34.881  1.00 135.70 ? 683  ILE A C     1 
ATOM   5276  O  O     . ILE A 1  683  ? 102.312 74.869  34.088  1.00 135.96 ? 683  ILE A O     1 
ATOM   5277  C  CB    . ILE A 1  683  ? 102.509 71.526  34.367  1.00 129.03 ? 683  ILE A CB    1 
ATOM   5278  C  CG1   . ILE A 1  683  ? 103.306 70.206  34.434  1.00 128.00 ? 683  ILE A CG1   1 
ATOM   5279  C  CG2   . ILE A 1  683  ? 101.600 71.588  33.139  1.00 127.75 ? 683  ILE A CG2   1 
ATOM   5280  C  CD1   . ILE A 1  683  ? 102.513 68.939  34.999  1.00 136.21 ? 683  ILE A CD1   1 
ATOM   5281  N  N     . ALA A 1  684  ? 102.326 74.012  36.199  1.00 134.37 ? 684  ALA A N     1 
ATOM   5282  C  CA    . ALA A 1  684  ? 101.574 75.056  36.900  1.00 136.64 ? 684  ALA A CA    1 
ATOM   5283  C  C     . ALA A 1  684  ? 102.082 76.468  36.628  1.00 140.97 ? 684  ALA A C     1 
ATOM   5284  O  O     . ALA A 1  684  ? 101.288 77.344  36.267  1.00 140.41 ? 684  ALA A O     1 
ATOM   5285  C  CB    . ALA A 1  684  ? 101.575 74.780  38.396  1.00 139.48 ? 684  ALA A CB    1 
ATOM   5286  N  N     . GLU A 1  685  ? 103.403 76.681  36.778  1.00 138.82 ? 685  GLU A N     1 
ATOM   5287  C  CA    . GLU A 1  685  ? 104.017 77.986  36.539  1.00 141.38 ? 685  GLU A CA    1 
ATOM   5288  C  C     . GLU A 1  685  ? 103.899 78.405  35.070  1.00 143.05 ? 685  GLU A C     1 
ATOM   5289  O  O     . GLU A 1  685  ? 103.800 79.606  34.798  1.00 145.04 ? 685  GLU A O     1 
ATOM   5290  C  CB    . GLU A 1  685  ? 105.470 78.061  37.067  1.00 144.69 ? 685  GLU A CB    1 
ATOM   5291  C  CG    . GLU A 1  685  ? 106.493 77.227  36.303  1.00 156.74 ? 685  GLU A CG    1 
ATOM   5292  C  CD    . GLU A 1  685  ? 107.916 77.224  36.831  1.00 184.57 ? 685  GLU A CD    1 
ATOM   5293  O  OE1   . GLU A 1  685  ? 108.379 78.275  37.335  1.00 185.86 ? 685  GLU A OE1   1 
ATOM   5294  O  OE2   . GLU A 1  685  ? 108.586 76.173  36.694  1.00 174.48 ? 685  GLU A OE2   1 
ATOM   5295  N  N     . ALA A 1  686  ? 103.871 77.410  34.138  1.00 134.63 ? 686  ALA A N     1 
ATOM   5296  C  CA    . ALA A 1  686  ? 103.726 77.626  32.695  1.00 131.74 ? 686  ALA A CA    1 
ATOM   5297  C  C     . ALA A 1  686  ? 102.254 77.863  32.317  1.00 132.05 ? 686  ALA A C     1 
ATOM   5298  O  O     . ALA A 1  686  ? 101.985 78.637  31.398  1.00 131.61 ? 686  ALA A O     1 
ATOM   5299  C  CB    . ALA A 1  686  ? 104.301 76.454  31.920  1.00 129.52 ? 686  ALA A CB    1 
ATOM   5300  N  N     . LYS A 1  687  ? 101.306 77.233  33.042  1.00 125.97 ? 687  LYS A N     1 
ATOM   5301  C  CA    . LYS A 1  687  ? 99.876  77.433  32.809  1.00 124.79 ? 687  LYS A CA    1 
ATOM   5302  C  C     . LYS A 1  687  ? 99.478  78.810  33.313  1.00 131.13 ? 687  LYS A C     1 
ATOM   5303  O  O     . LYS A 1  687  ? 98.663  79.480  32.671  1.00 131.31 ? 687  LYS A O     1 
ATOM   5304  C  CB    . LYS A 1  687  ? 99.043  76.344  33.482  1.00 125.79 ? 687  LYS A CB    1 
ATOM   5305  C  CG    . LYS A 1  687  ? 98.939  75.070  32.652  1.00 131.78 ? 687  LYS A CG    1 
ATOM   5306  C  CD    . LYS A 1  687  ? 98.264  73.941  33.428  1.00 137.27 ? 687  LYS A CD    1 
ATOM   5307  C  CE    . LYS A 1  687  ? 96.767  73.888  33.205  1.00 140.36 ? 687  LYS A CE    1 
ATOM   5308  N  NZ    . LYS A 1  687  ? 96.089  73.048  34.227  1.00 142.91 ? 687  LYS A NZ    1 
ATOM   5309  N  N     . LYS A 1  688  ? 100.092 79.251  34.443  1.00 129.02 ? 688  LYS A N     1 
ATOM   5310  C  CA    . LYS A 1  688  ? 99.882  80.582  35.014  1.00 131.35 ? 688  LYS A CA    1 
ATOM   5311  C  C     . LYS A 1  688  ? 100.489 81.618  34.066  1.00 136.10 ? 688  LYS A C     1 
ATOM   5312  O  O     . LYS A 1  688  ? 99.919  82.688  33.931  1.00 137.38 ? 688  LYS A O     1 
ATOM   5313  C  CB    . LYS A 1  688  ? 100.485 80.698  36.422  1.00 135.40 ? 688  LYS A CB    1 
ATOM   5314  C  CG    . LYS A 1  688  ? 99.953  81.889  37.224  1.00 147.41 ? 688  LYS A CG    1 
ATOM   5315  C  CD    . LYS A 1  688  ? 100.905 83.101  37.219  1.00 156.75 ? 688  LYS A CD    1 
ATOM   5316  C  CE    . LYS A 1  688  ? 100.305 84.334  37.870  1.00 164.27 ? 688  LYS A CE    1 
ATOM   5317  N  NZ    . LYS A 1  688  ? 101.255 85.486  37.898  1.00 170.22 ? 688  LYS A NZ    1 
ATOM   5318  N  N     . LYS A 1  689  ? 101.613 81.280  33.383  1.00 131.93 ? 689  LYS A N     1 
ATOM   5319  C  CA    . LYS A 1  689  ? 102.306 82.116  32.384  1.00 132.65 ? 689  LYS A CA    1 
ATOM   5320  C  C     . LYS A 1  689  ? 101.421 82.300  31.143  1.00 135.45 ? 689  LYS A C     1 
ATOM   5321  O  O     . LYS A 1  689  ? 101.462 83.370  30.527  1.00 136.70 ? 689  LYS A O     1 
ATOM   5322  C  CB    . LYS A 1  689  ? 103.652 81.479  31.984  1.00 133.85 ? 689  LYS A CB    1 
ATOM   5323  C  CG    . LYS A 1  689  ? 104.589 82.362  31.158  1.00 147.03 ? 689  LYS A CG    1 
ATOM   5324  C  CD    . LYS A 1  689  ? 105.737 81.534  30.559  1.00 153.99 ? 689  LYS A CD    1 
ATOM   5325  C  CE    . LYS A 1  689  ? 106.893 82.372  30.053  1.00 166.12 ? 689  LYS A CE    1 
ATOM   5326  N  NZ    . LYS A 1  689  ? 107.917 81.559  29.336  1.00 168.45 ? 689  LYS A NZ    1 
ATOM   5327  N  N     . VAL A 1  690  ? 100.626 81.257  30.785  1.00 129.31 ? 690  VAL A N     1 
ATOM   5328  C  CA    . VAL A 1  690  ? 99.684  81.294  29.662  1.00 128.15 ? 690  VAL A CA    1 
ATOM   5329  C  C     . VAL A 1  690  ? 98.526  82.217  30.038  1.00 136.27 ? 690  VAL A C     1 
ATOM   5330  O  O     . VAL A 1  690  ? 98.340  83.237  29.368  1.00 137.75 ? 690  VAL A O     1 
ATOM   5331  C  CB    . VAL A 1  690  ? 99.215  79.891  29.205  1.00 128.51 ? 690  VAL A CB    1 
ATOM   5332  C  CG1   . VAL A 1  690  ? 97.976  79.972  28.321  1.00 127.32 ? 690  VAL A CG1   1 
ATOM   5333  C  CG2   . VAL A 1  690  ? 100.331 79.161  28.472  1.00 126.58 ? 690  VAL A CG2   1 
ATOM   5334  N  N     . LEU A 1  691  ? 97.795  81.892  31.145  1.00 134.10 ? 691  LEU A N     1 
ATOM   5335  C  CA    . LEU A 1  691  ? 96.671  82.669  31.703  1.00 136.28 ? 691  LEU A CA    1 
ATOM   5336  C  C     . LEU A 1  691  ? 96.947  84.187  31.639  1.00 145.34 ? 691  LEU A C     1 
ATOM   5337  O  O     . LEU A 1  691  ? 96.081  84.957  31.213  1.00 145.84 ? 691  LEU A O     1 
ATOM   5338  C  CB    . LEU A 1  691  ? 96.398  82.206  33.153  1.00 136.76 ? 691  LEU A CB    1 
ATOM   5339  C  CG    . LEU A 1  691  ? 95.565  83.124  34.052  1.00 144.01 ? 691  LEU A CG    1 
ATOM   5340  C  CD1   . LEU A 1  691  ? 94.301  82.443  34.515  1.00 143.04 ? 691  LEU A CD1   1 
ATOM   5341  C  CD2   . LEU A 1  691  ? 96.380  83.613  35.242  1.00 149.66 ? 691  LEU A CD2   1 
ATOM   5342  N  N     . ASP A 1  692  ? 98.181  84.585  32.024  1.00 145.24 ? 692  ASP A N     1 
ATOM   5343  C  CA    . ASP A 1  692  ? 98.692  85.952  32.019  1.00 149.03 ? 692  ASP A CA    1 
ATOM   5344  C  C     . ASP A 1  692  ? 98.559  86.552  30.623  1.00 152.52 ? 692  ASP A C     1 
ATOM   5345  O  O     . ASP A 1  692  ? 97.841  87.541  30.447  1.00 154.04 ? 692  ASP A O     1 
ATOM   5346  C  CB    . ASP A 1  692  ? 100.178 85.969  32.457  1.00 152.61 ? 692  ASP A CB    1 
ATOM   5347  C  CG    . ASP A 1  692  ? 100.479 85.557  33.893  1.00 168.87 ? 692  ASP A CG    1 
ATOM   5348  O  OD1   . ASP A 1  692  ? 99.529  85.509  34.719  1.00 171.12 ? 692  ASP A OD1   1 
ATOM   5349  O  OD2   . ASP A 1  692  ? 101.662 85.274  34.193  1.00 176.05 ? 692  ASP A OD2   1 
ATOM   5350  N  N     . VAL A 1  693  ? 99.202  85.899  29.629  1.00 146.28 ? 693  VAL A N     1 
ATOM   5351  C  CA    . VAL A 1  693  ? 99.220  86.294  28.219  1.00 145.80 ? 693  VAL A CA    1 
ATOM   5352  C  C     . VAL A 1  693  ? 97.804  86.220  27.611  1.00 150.53 ? 693  VAL A C     1 
ATOM   5353  O  O     . VAL A 1  693  ? 97.498  86.986  26.698  1.00 151.17 ? 693  VAL A O     1 
ATOM   5354  C  CB    . VAL A 1  693  ? 100.302 85.499  27.430  1.00 146.88 ? 693  VAL A CB    1 
ATOM   5355  C  CG1   . VAL A 1  693  ? 100.342 85.885  25.952  1.00 146.43 ? 693  VAL A CG1   1 
ATOM   5356  C  CG2   . VAL A 1  693  ? 101.678 85.703  28.057  1.00 147.98 ? 693  VAL A CG2   1 
ATOM   5357  N  N     . THR A 1  694  ? 96.925  85.372  28.179  1.00 146.78 ? 694  THR A N     1 
ATOM   5358  C  CA    . THR A 1  694  ? 95.539  85.252  27.726  1.00 146.46 ? 694  THR A CA    1 
ATOM   5359  C  C     . THR A 1  694  ? 94.702  86.432  28.192  1.00 154.44 ? 694  THR A C     1 
ATOM   5360  O  O     . THR A 1  694  ? 94.082  87.075  27.347  1.00 155.23 ? 694  THR A O     1 
ATOM   5361  C  CB    . THR A 1  694  ? 94.916  83.932  28.155  1.00 155.73 ? 694  THR A CB    1 
ATOM   5362  O  OG1   . THR A 1  694  ? 95.852  82.885  27.926  1.00 157.98 ? 694  THR A OG1   1 
ATOM   5363  C  CG2   . THR A 1  694  ? 93.620  83.636  27.415  1.00 153.34 ? 694  THR A CG2   1 
ATOM   5364  N  N     . LYS A 1  695  ? 94.671  86.717  29.521  1.00 153.22 ? 695  LYS A N     1 
ATOM   5365  C  CA    . LYS A 1  695  ? 93.882  87.830  30.073  1.00 156.09 ? 695  LYS A CA    1 
ATOM   5366  C  C     . LYS A 1  695  ? 94.416  89.201  29.638  1.00 162.48 ? 695  LYS A C     1 
ATOM   5367  O  O     . LYS A 1  695  ? 93.640  90.159  29.567  1.00 163.76 ? 695  LYS A O     1 
ATOM   5368  C  CB    . LYS A 1  695  ? 93.713  87.730  31.603  1.00 159.85 ? 695  LYS A CB    1 
ATOM   5369  C  CG    . LYS A 1  695  ? 92.471  86.921  32.034  1.00 170.84 ? 695  LYS A CG    1 
ATOM   5370  C  CD    . LYS A 1  695  ? 91.215  87.793  32.285  1.00 179.44 ? 695  LYS A CD    1 
ATOM   5371  C  CE    . LYS A 1  695  ? 89.978  86.976  32.615  1.00 177.19 ? 695  LYS A CE    1 
ATOM   5372  N  NZ    . LYS A 1  695  ? 88.823  87.832  33.014  1.00 174.46 ? 695  LYS A NZ    1 
ATOM   5373  N  N     . GLU A 1  696  ? 95.723  89.272  29.296  1.00 159.21 ? 696  GLU A N     1 
ATOM   5374  C  CA    . GLU A 1  696  ? 96.388  90.477  28.801  1.00 161.73 ? 696  GLU A CA    1 
ATOM   5375  C  C     . GLU A 1  696  ? 95.925  90.765  27.362  1.00 163.48 ? 696  GLU A C     1 
ATOM   5376  O  O     . GLU A 1  696  ? 95.664  91.919  27.024  1.00 165.34 ? 696  GLU A O     1 
ATOM   5377  C  CB    . GLU A 1  696  ? 97.912  90.299  28.866  1.00 163.46 ? 696  GLU A CB    1 
ATOM   5378  C  CG    . GLU A 1  696  ? 98.719  91.514  28.431  1.00 181.47 ? 696  GLU A CG    1 
ATOM   5379  C  CD    . GLU A 1  696  ? 99.780  91.254  27.373  1.00 208.34 ? 696  GLU A CD    1 
ATOM   5380  O  OE1   . GLU A 1  696  ? 100.240 90.093  27.248  1.00 198.58 ? 696  GLU A OE1   1 
ATOM   5381  O  OE2   . GLU A 1  696  ? 100.170 92.224  26.681  1.00 205.19 ? 696  GLU A OE2   1 
ATOM   5382  N  N     . ALA A 1  697  ? 95.817  89.712  26.530  1.00 155.95 ? 697  ALA A N     1 
ATOM   5383  C  CA    . ALA A 1  697  ? 95.370  89.801  25.139  1.00 154.86 ? 697  ALA A CA    1 
ATOM   5384  C  C     . ALA A 1  697  ? 93.874  90.086  25.052  1.00 158.49 ? 697  ALA A C     1 
ATOM   5385  O  O     . ALA A 1  697  ? 93.409  90.578  24.021  1.00 158.55 ? 697  ALA A O     1 
ATOM   5386  C  CB    . ALA A 1  697  ? 95.695  88.514  24.408  1.00 152.30 ? 697  ALA A CB    1 
ATOM   5387  N  N     . GLN A 1  698  ? 93.124  89.741  26.124  1.00 155.09 ? 698  GLN A N     1 
ATOM   5388  C  CA    . GLN A 1  698  ? 91.686  89.978  26.279  1.00 156.03 ? 698  GLN A CA    1 
ATOM   5389  C  C     . GLN A 1  698  ? 91.461  91.447  26.622  1.00 166.07 ? 698  GLN A C     1 
ATOM   5390  O  O     . GLN A 1  698  ? 90.470  92.053  26.204  1.00 166.29 ? 698  GLN A O     1 
ATOM   5391  C  CB    . GLN A 1  698  ? 91.105  89.075  27.373  1.00 155.71 ? 698  GLN A CB    1 
ATOM   5392  C  CG    . GLN A 1  698  ? 90.663  87.718  26.837  1.00 164.18 ? 698  GLN A CG    1 
ATOM   5393  C  CD    . GLN A 1  698  ? 90.487  86.644  27.890  1.00 176.73 ? 698  GLN A CD    1 
ATOM   5394  O  OE1   . GLN A 1  698  ? 90.370  86.902  29.096  1.00 173.64 ? 698  GLN A OE1   1 
ATOM   5395  N  NE2   . GLN A 1  698  ? 90.441  85.401  27.442  1.00 161.57 ? 698  GLN A NE2   1 
ATOM   5396  N  N     . ALA A 1  699  ? 92.427  92.024  27.350  1.00 166.81 ? 699  ALA A N     1 
ATOM   5397  C  CA    . ALA A 1  699  ? 92.445  93.419  27.759  1.00 171.17 ? 699  ALA A CA    1 
ATOM   5398  C  C     . ALA A 1  699  ? 92.977  94.341  26.630  1.00 179.55 ? 699  ALA A C     1 
ATOM   5399  O  O     . ALA A 1  699  ? 93.178  95.540  26.871  1.00 183.76 ? 699  ALA A O     1 
ATOM   5400  C  CB    . ALA A 1  699  ? 93.285  93.568  29.019  1.00 173.17 ? 699  ALA A CB    1 
ATOM   5401  N  N     . ASN A 1  700  ? 93.174  93.785  25.397  1.00 174.83 ? 700  ASN A N     1 
ATOM   5402  C  CA    . ASN A 1  700  ? 93.642  94.469  24.175  1.00 176.38 ? 700  ASN A CA    1 
ATOM   5403  C  C     . ASN A 1  700  ? 94.929  95.290  24.410  1.00 184.63 ? 700  ASN A C     1 
ATOM   5404  O  O     . ASN A 1  700  ? 94.929  96.521  24.305  1.00 185.36 ? 700  ASN A O     1 
ATOM   5405  C  CB    . ASN A 1  700  ? 92.509  95.311  23.562  1.00 178.50 ? 700  ASN A CB    1 
ATOM   5406  C  CG    . ASN A 1  700  ? 92.684  95.715  22.118  1.00 194.03 ? 700  ASN A CG    1 
ATOM   5407  O  OD1   . ASN A 1  700  ? 92.663  94.882  21.208  1.00 184.61 ? 700  ASN A OD1   1 
ATOM   5408  N  ND2   . ASN A 1  700  ? 92.741  97.021  21.869  1.00 189.08 ? 700  ASN A ND2   1 
ATOM   5409  N  N     . LEU A 1  701  ? 96.017  94.591  24.776  1.00 180.82 ? 701  LEU A N     1 
ATOM   5410  C  CA    . LEU A 1  701  ? 97.316  95.209  25.059  1.00 183.21 ? 701  LEU A CA    1 
ATOM   5411  C  C     . LEU A 1  701  ? 98.426  94.586  24.199  1.00 186.71 ? 701  LEU A C     1 
ATOM   5412  O  O     . LEU A 1  701  ? 99.441  95.238  23.942  1.00 187.63 ? 701  LEU A O     1 
ATOM   5413  C  CB    . LEU A 1  701  ? 97.664  95.113  26.565  1.00 183.70 ? 701  LEU A CB    1 
ATOM   5414  C  CG    . LEU A 1  701  ? 96.560  95.448  27.588  1.00 187.26 ? 701  LEU A CG    1 
ATOM   5415  C  CD1   . LEU A 1  701  ? 96.897  94.897  28.952  1.00 187.44 ? 701  LEU A CD1   1 
ATOM   5416  C  CD2   . LEU A 1  701  ? 96.286  96.936  27.659  1.00 189.25 ? 701  LEU A CD2   1 
ATOM   5417  N  N     . LEU A 1  702  ? 98.204  93.337  23.733  1.00 180.28 ? 702  LEU A N     1 
ATOM   5418  C  CA    . LEU A 1  702  ? 99.108  92.549  22.892  1.00 178.27 ? 702  LEU A CA    1 
ATOM   5419  C  C     . LEU A 1  702  ? 99.505  93.260  21.595  1.00 184.72 ? 702  LEU A C     1 
ATOM   5420  O  O     . LEU A 1  702  ? 98.750  94.089  21.087  1.00 186.29 ? 702  LEU A O     1 
ATOM   5421  C  CB    . LEU A 1  702  ? 98.427  91.221  22.552  1.00 174.36 ? 702  LEU A CB    1 
ATOM   5422  C  CG    . LEU A 1  702  ? 99.333  90.010  22.500  1.00 176.34 ? 702  LEU A CG    1 
ATOM   5423  C  CD1   . LEU A 1  702  ? 99.493  89.395  23.884  1.00 175.37 ? 702  LEU A CD1   1 
ATOM   5424  C  CD2   . LEU A 1  702  ? 98.788  88.973  21.537  1.00 176.07 ? 702  LEU A CD2   1 
ATOM   5425  N  N     . THR A 1  703  ? 100.692 92.938  21.066  1.00 182.01 ? 703  THR A N     1 
ATOM   5426  C  CA    . THR A 1  703  ? 101.203 93.517  19.823  1.00 183.83 ? 703  THR A CA    1 
ATOM   5427  C  C     . THR A 1  703  ? 101.755 92.378  18.978  1.00 186.44 ? 703  THR A C     1 
ATOM   5428  O  O     . THR A 1  703  ? 102.689 91.695  19.404  1.00 184.81 ? 703  THR A O     1 
ATOM   5429  C  CB    . THR A 1  703  ? 102.211 94.636  20.120  1.00 191.84 ? 703  THR A CB    1 
ATOM   5430  O  OG1   . THR A 1  703  ? 101.646 95.533  21.080  1.00 192.43 ? 703  THR A OG1   1 
ATOM   5431  C  CG2   . THR A 1  703  ? 102.612 95.411  18.873  1.00 191.45 ? 703  THR A CG2   1 
ATOM   5432  N  N     . ALA A 1  704  ? 101.153 92.162  17.795  1.00 183.66 ? 704  ALA A N     1 
ATOM   5433  C  CA    . ALA A 1  704  ? 101.465 91.062  16.873  1.00 181.69 ? 704  ALA A CA    1 
ATOM   5434  C  C     . ALA A 1  704  ? 102.758 91.211  16.042  1.00 188.06 ? 704  ALA A C     1 
ATOM   5435  O  O     . ALA A 1  704  ? 102.910 92.222  15.352  1.00 190.95 ? 704  ALA A O     1 
ATOM   5436  C  CB    . ALA A 1  704  ? 100.281 90.825  15.945  1.00 181.62 ? 704  ALA A CB    1 
ATOM   5437  N  N     . LYS A 1  705  ? 103.662 90.177  16.067  1.00 182.06 ? 705  LYS A N     1 
ATOM   5438  C  CA    . LYS A 1  705  ? 104.911 90.162  15.271  1.00 182.19 ? 705  LYS A CA    1 
ATOM   5439  C  C     . LYS A 1  705  ? 104.595 89.812  13.818  1.00 185.85 ? 705  LYS A C     1 
ATOM   5440  O  O     . LYS A 1  705  ? 104.058 88.738  13.552  1.00 182.27 ? 705  LYS A O     1 
ATOM   5441  C  CB    . LYS A 1  705  ? 106.040 89.280  15.863  1.00 181.73 ? 705  LYS A CB    1 
ATOM   5442  C  CG    . LYS A 1  705  ? 105.602 88.258  16.905  1.00 183.75 ? 705  LYS A CG    1 
ATOM   5443  C  CD    . LYS A 1  705  ? 105.314 86.891  16.291  1.00 183.84 ? 705  LYS A CD    1 
ATOM   5444  C  CE    . LYS A 1  705  ? 104.490 85.983  17.179  1.00 179.01 ? 705  LYS A CE    1 
ATOM   5445  N  NZ    . LYS A 1  705  ? 105.212 85.555  18.407  1.00 180.50 ? 705  LYS A NZ    1 
ATOM   5446  N  N     . HIS A 1  706  ? 104.873 90.780  12.905  1.00 186.29 ? 706  HIS A N     1 
ATOM   5447  C  CA    . HIS A 1  706  ? 104.632 90.858  11.450  1.00 187.01 ? 706  HIS A CA    1 
ATOM   5448  C  C     . HIS A 1  706  ? 104.255 89.565  10.747  1.00 188.66 ? 706  HIS A C     1 
ATOM   5449  O  O     . HIS A 1  706  ? 104.901 88.528  10.935  1.00 185.96 ? 706  HIS A O     1 
ATOM   5450  C  CB    . HIS A 1  706  ? 105.828 91.478  10.721  1.00 188.93 ? 706  HIS A CB    1 
ATOM   5451  C  CG    . HIS A 1  706  ? 105.487 92.653  9.857   1.00 192.30 ? 706  HIS A CG    1 
ATOM   5452  N  ND1   . HIS A 1  706  ? 105.203 93.890  10.402  1.00 194.25 ? 706  HIS A ND1   1 
ATOM   5453  C  CD2   . HIS A 1  706  ? 105.455 92.752  8.507   1.00 193.39 ? 706  HIS A CD2   1 
ATOM   5454  C  CE1   . HIS A 1  706  ? 104.979 94.692  9.372   1.00 194.33 ? 706  HIS A CE1   1 
ATOM   5455  N  NE2   . HIS A 1  706  ? 105.124 94.053  8.213   1.00 194.18 ? 706  HIS A NE2   1 
ATOM   5456  N  N     . GLY A 1  707  ? 103.241 89.677  9.893   1.00 185.94 ? 707  GLY A N     1 
ATOM   5457  C  CA    . GLY A 1  707  ? 102.710 88.569  9.109   1.00 183.45 ? 707  GLY A CA    1 
ATOM   5458  C  C     . GLY A 1  707  ? 101.796 87.670  9.913   1.00 183.99 ? 707  GLY A C     1 
ATOM   5459  O  O     . GLY A 1  707  ? 101.527 86.530  9.514   1.00 181.21 ? 707  GLY A O     1 
ATOM   5460  N  N     . MET A 1  708  ? 101.320 88.191  11.062  1.00 180.22 ? 708  MET A N     1 
ATOM   5461  C  CA    . MET A 1  708  ? 100.453 87.480  11.994  1.00 176.96 ? 708  MET A CA    1 
ATOM   5462  C  C     . MET A 1  708  ? 99.423  88.401  12.637  1.00 178.79 ? 708  MET A C     1 
ATOM   5463  O  O     . MET A 1  708  ? 99.719  89.567  12.917  1.00 181.52 ? 708  MET A O     1 
ATOM   5464  C  CB    . MET A 1  708  ? 101.299 86.825  13.096  1.00 177.89 ? 708  MET A CB    1 
ATOM   5465  C  CG    . MET A 1  708  ? 101.857 85.475  12.716  1.00 179.46 ? 708  MET A CG    1 
ATOM   5466  S  SD    . MET A 1  708  ? 103.312 85.066  13.704  1.00 183.54 ? 708  MET A SD    1 
ATOM   5467  C  CE    . MET A 1  708  ? 104.631 85.541  12.552  1.00 182.61 ? 708  MET A CE    1 
ATOM   5468  N  N     . THR A 1  709  ? 98.222  87.848  12.900  1.00 169.37 ? 709  THR A N     1 
ATOM   5469  C  CA    . THR A 1  709  ? 97.109  88.495  13.597  1.00 168.27 ? 709  THR A CA    1 
ATOM   5470  C  C     . THR A 1  709  ? 97.525  88.550  15.066  1.00 169.17 ? 709  THR A C     1 
ATOM   5471  O  O     . THR A 1  709  ? 98.476  87.867  15.450  1.00 166.71 ? 709  THR A O     1 
ATOM   5472  C  CB    . THR A 1  709  ? 95.862  87.577  13.512  1.00 171.25 ? 709  THR A CB    1 
ATOM   5473  O  OG1   . THR A 1  709  ? 95.705  87.056  12.194  1.00 168.94 ? 709  THR A OG1   1 
ATOM   5474  C  CG2   . THR A 1  709  ? 94.585  88.262  13.962  1.00 170.02 ? 709  THR A CG2   1 
ATOM   5475  N  N     . LEU A 1  710  ? 96.788  89.302  15.902  1.00 166.24 ? 710  LEU A N     1 
ATOM   5476  C  CA    . LEU A 1  710  ? 97.005  89.315  17.355  1.00 165.20 ? 710  LEU A CA    1 
ATOM   5477  C  C     . LEU A 1  710  ? 96.764  87.875  17.803  1.00 163.56 ? 710  LEU A C     1 
ATOM   5478  O  O     . LEU A 1  710  ? 97.518  87.346  18.614  1.00 161.86 ? 710  LEU A O     1 
ATOM   5479  C  CB    . LEU A 1  710  ? 95.981  90.200  18.090  1.00 167.36 ? 710  LEU A CB    1 
ATOM   5480  C  CG    . LEU A 1  710  ? 95.582  91.520  17.483  1.00 175.68 ? 710  LEU A CG    1 
ATOM   5481  C  CD1   . LEU A 1  710  ? 94.407  91.346  16.529  1.00 175.32 ? 710  LEU A CD1   1 
ATOM   5482  C  CD2   . LEU A 1  710  ? 95.188  92.479  18.571  1.00 181.71 ? 710  LEU A CD2   1 
ATOM   5483  N  N     . ARG A 1  711  ? 95.714  87.251  17.215  1.00 156.76 ? 711  ARG A N     1 
ATOM   5484  C  CA    . ARG A 1  711  ? 95.262  85.881  17.409  1.00 152.62 ? 711  ARG A CA    1 
ATOM   5485  C  C     . ARG A 1  711  ? 96.354  84.867  17.041  1.00 153.87 ? 711  ARG A C     1 
ATOM   5486  O  O     . ARG A 1  711  ? 96.656  83.983  17.851  1.00 151.18 ? 711  ARG A O     1 
ATOM   5487  C  CB    . ARG A 1  711  ? 93.998  85.640  16.579  1.00 150.88 ? 711  ARG A CB    1 
ATOM   5488  C  CG    . ARG A 1  711  ? 92.779  86.346  17.133  1.00 158.06 ? 711  ARG A CG    1 
ATOM   5489  C  CD    . ARG A 1  711  ? 91.519  85.842  16.475  1.00 160.53 ? 711  ARG A CD    1 
ATOM   5490  N  NE    . ARG A 1  711  ? 90.331  86.183  17.253  1.00 162.83 ? 711  ARG A NE    1 
ATOM   5491  C  CZ    . ARG A 1  711  ? 89.113  86.297  16.740  1.00 179.31 ? 711  ARG A CZ    1 
ATOM   5492  N  NH1   . ARG A 1  711  ? 88.912  86.111  15.441  1.00 166.89 ? 711  ARG A NH1   1 
ATOM   5493  N  NH2   . ARG A 1  711  ? 88.087  86.610  17.517  1.00 170.78 ? 711  ARG A NH2   1 
ATOM   5494  N  N     . GLU A 1  712  ? 96.953  85.011  15.827  1.00 150.53 ? 712  GLU A N     1 
ATOM   5495  C  CA    . GLU A 1  712  ? 98.043  84.165  15.313  1.00 148.01 ? 712  GLU A CA    1 
ATOM   5496  C  C     . GLU A 1  712  ? 99.269  84.303  16.234  1.00 150.64 ? 712  GLU A C     1 
ATOM   5497  O  O     . GLU A 1  712  ? 99.816  83.292  16.685  1.00 147.78 ? 712  GLU A O     1 
ATOM   5498  C  CB    . GLU A 1  712  ? 98.427  84.562  13.864  1.00 150.64 ? 712  GLU A CB    1 
ATOM   5499  C  CG    . GLU A 1  712  ? 97.451  84.155  12.766  1.00 159.42 ? 712  GLU A CG    1 
ATOM   5500  C  CD    . GLU A 1  712  ? 97.868  84.513  11.347  1.00 178.02 ? 712  GLU A CD    1 
ATOM   5501  O  OE1   . GLU A 1  712  ? 98.925  84.021  10.884  1.00 168.56 ? 712  GLU A OE1   1 
ATOM   5502  O  OE2   . GLU A 1  712  ? 97.110  85.251  10.679  1.00 171.57 ? 712  GLU A OE2   1 
ATOM   5503  N  N     . SER A 1  713  ? 99.661  85.566  16.538  1.00 148.95 ? 713  SER A N     1 
ATOM   5504  C  CA    . SER A 1  713  ? 100.786 85.914  17.404  1.00 149.05 ? 713  SER A CA    1 
ATOM   5505  C  C     . SER A 1  713  ? 100.611 85.394  18.816  1.00 150.08 ? 713  SER A C     1 
ATOM   5506  O  O     . SER A 1  713  ? 101.590 84.940  19.406  1.00 149.17 ? 713  SER A O     1 
ATOM   5507  C  CB    . SER A 1  713  ? 101.013 87.419  17.421  1.00 156.15 ? 713  SER A CB    1 
ATOM   5508  O  OG    . SER A 1  713  ? 101.759 87.818  16.284  1.00 166.29 ? 713  SER A OG    1 
ATOM   5509  N  N     . PHE A 1  714  ? 99.372  85.447  19.351  1.00 144.97 ? 714  PHE A N     1 
ATOM   5510  C  CA    . PHE A 1  714  ? 99.025  84.946  20.681  1.00 143.10 ? 714  PHE A CA    1 
ATOM   5511  C  C     . PHE A 1  714  ? 99.195  83.448  20.697  1.00 144.17 ? 714  PHE A C     1 
ATOM   5512  O  O     . PHE A 1  714  ? 99.913  82.924  21.545  1.00 142.68 ? 714  PHE A O     1 
ATOM   5513  C  CB    . PHE A 1  714  ? 97.575  85.314  21.054  1.00 144.93 ? 714  PHE A CB    1 
ATOM   5514  C  CG    . PHE A 1  714  ? 96.868  84.415  22.051  1.00 143.71 ? 714  PHE A CG    1 
ATOM   5515  C  CD1   . PHE A 1  714  ? 96.978  84.642  23.417  1.00 146.88 ? 714  PHE A CD1   1 
ATOM   5516  C  CD2   . PHE A 1  714  ? 96.023  83.397  21.617  1.00 142.47 ? 714  PHE A CD2   1 
ATOM   5517  C  CE1   . PHE A 1  714  ? 96.296  83.840  24.331  1.00 145.94 ? 714  PHE A CE1   1 
ATOM   5518  C  CE2   . PHE A 1  714  ? 95.344  82.594  22.532  1.00 143.43 ? 714  PHE A CE2   1 
ATOM   5519  C  CZ    . PHE A 1  714  ? 95.477  82.827  23.882  1.00 142.42 ? 714  PHE A CZ    1 
ATOM   5520  N  N     . GLU A 1  715  ? 98.552  82.763  19.743  1.00 140.05 ? 715  GLU A N     1 
ATOM   5521  C  CA    . GLU A 1  715  ? 98.597  81.313  19.660  1.00 137.58 ? 715  GLU A CA    1 
ATOM   5522  C  C     . GLU A 1  715  ? 100.020 80.775  19.640  1.00 140.44 ? 715  GLU A C     1 
ATOM   5523  O  O     . GLU A 1  715  ? 100.253 79.755  20.283  1.00 138.64 ? 715  GLU A O     1 
ATOM   5524  C  CB    . GLU A 1  715  ? 97.748  80.779  18.504  1.00 137.93 ? 715  GLU A CB    1 
ATOM   5525  C  CG    . GLU A 1  715  ? 96.294  80.573  18.904  1.00 148.30 ? 715  GLU A CG    1 
ATOM   5526  C  CD    . GLU A 1  715  ? 95.992  79.249  19.582  1.00 161.71 ? 715  GLU A CD    1 
ATOM   5527  O  OE1   . GLU A 1  715  ? 96.014  78.211  18.883  1.00 152.63 ? 715  GLU A OE1   1 
ATOM   5528  O  OE2   . GLU A 1  715  ? 95.679  79.256  20.794  1.00 150.14 ? 715  GLU A OE2   1 
ATOM   5529  N  N     . ASP A 1  716  ? 100.977 81.497  19.002  1.00 137.92 ? 716  ASP A N     1 
ATOM   5530  C  CA    . ASP A 1  716  ? 102.390 81.109  18.988  1.00 137.44 ? 716  ASP A CA    1 
ATOM   5531  C  C     . ASP A 1  716  ? 102.905 81.034  20.415  1.00 140.12 ? 716  ASP A C     1 
ATOM   5532  O  O     . ASP A 1  716  ? 103.529 80.034  20.769  1.00 138.33 ? 716  ASP A O     1 
ATOM   5533  C  CB    . ASP A 1  716  ? 103.248 82.105  18.179  1.00 142.44 ? 716  ASP A CB    1 
ATOM   5534  C  CG    . ASP A 1  716  ? 104.757 82.023  18.432  1.00 157.15 ? 716  ASP A CG    1 
ATOM   5535  O  OD1   . ASP A 1  716  ? 105.436 81.243  17.729  1.00 162.51 ? 716  ASP A OD1   1 
ATOM   5536  O  OD2   . ASP A 1  716  ? 105.259 82.765  19.317  1.00 159.94 ? 716  ASP A OD2   1 
ATOM   5537  N  N     . ASN A 1  717  ? 102.641 82.087  21.224  1.00 137.54 ? 717  ASN A N     1 
ATOM   5538  C  CA    . ASN A 1  717  ? 103.081 82.185  22.613  1.00 137.91 ? 717  ASN A CA    1 
ATOM   5539  C  C     . ASN A 1  717  ? 102.525 81.044  23.462  1.00 139.66 ? 717  ASN A C     1 
ATOM   5540  O  O     . ASN A 1  717  ? 103.304 80.394  24.159  1.00 138.99 ? 717  ASN A O     1 
ATOM   5541  C  CB    . ASN A 1  717  ? 102.748 83.552  23.214  1.00 141.64 ? 717  ASN A CB    1 
ATOM   5542  C  CG    . ASN A 1  717  ? 103.270 84.742  22.434  1.00 170.42 ? 717  ASN A CG    1 
ATOM   5543  O  OD1   . ASN A 1  717  ? 104.293 84.678  21.737  1.00 168.27 ? 717  ASN A OD1   1 
ATOM   5544  N  ND2   . ASN A 1  717  ? 102.578 85.869  22.554  1.00 161.58 ? 717  ASN A ND2   1 
ATOM   5545  N  N     . VAL A 1  718  ? 101.211 80.744  23.348  1.00 134.57 ? 718  VAL A N     1 
ATOM   5546  C  CA    . VAL A 1  718  ? 100.555 79.648  24.082  1.00 132.41 ? 718  VAL A CA    1 
ATOM   5547  C  C     . VAL A 1  718  ? 101.349 78.358  23.847  1.00 134.08 ? 718  VAL A C     1 
ATOM   5548  O  O     . VAL A 1  718  ? 101.951 77.827  24.789  1.00 133.88 ? 718  VAL A O     1 
ATOM   5549  C  CB    . VAL A 1  718  ? 99.069  79.463  23.681  1.00 135.76 ? 718  VAL A CB    1 
ATOM   5550  C  CG1   . VAL A 1  718  ? 98.311  78.682  24.746  1.00 134.59 ? 718  VAL A CG1   1 
ATOM   5551  C  CG2   . VAL A 1  718  ? 98.393  80.798  23.431  1.00 138.31 ? 718  VAL A CG2   1 
ATOM   5552  N  N     . VAL A 1  719  ? 101.390 77.915  22.554  1.00 128.04 ? 719  VAL A N     1 
ATOM   5553  C  CA    . VAL A 1  719  ? 102.097 76.758  21.970  1.00 123.96 ? 719  VAL A CA    1 
ATOM   5554  C  C     . VAL A 1  719  ? 103.537 76.710  22.500  1.00 125.48 ? 719  VAL A C     1 
ATOM   5555  O  O     . VAL A 1  719  ? 103.971 75.657  22.981  1.00 123.00 ? 719  VAL A O     1 
ATOM   5556  C  CB    . VAL A 1  719  ? 102.025 76.856  20.412  1.00 126.76 ? 719  VAL A CB    1 
ATOM   5557  C  CG1   . VAL A 1  719  ? 103.170 76.132  19.717  1.00 125.00 ? 719  VAL A CG1   1 
ATOM   5558  C  CG2   . VAL A 1  719  ? 100.679 76.375  19.892  1.00 125.43 ? 719  VAL A CG2   1 
ATOM   5559  N  N     . ARG A 1  720  ? 104.237 77.875  22.466  1.00 122.26 ? 720  ARG A N     1 
ATOM   5560  C  CA    . ARG A 1  720  ? 105.601 78.038  22.943  1.00 122.30 ? 720  ARG A CA    1 
ATOM   5561  C  C     . ARG A 1  720  ? 105.725 77.759  24.434  1.00 126.16 ? 720  ARG A C     1 
ATOM   5562  O  O     . ARG A 1  720  ? 106.510 76.889  24.787  1.00 125.71 ? 720  ARG A O     1 
ATOM   5563  C  CB    . ARG A 1  720  ? 106.144 79.420  22.595  1.00 124.84 ? 720  ARG A CB    1 
ATOM   5564  C  CG    . ARG A 1  720  ? 107.354 79.414  21.664  1.00 134.04 ? 720  ARG A CG    1 
ATOM   5565  C  CD    . ARG A 1  720  ? 107.915 80.815  21.446  1.00 141.41 ? 720  ARG A CD    1 
ATOM   5566  N  NE    . ARG A 1  720  ? 108.645 81.292  22.623  1.00 152.15 ? 720  ARG A NE    1 
ATOM   5567  C  CZ    . ARG A 1  720  ? 108.137 82.099  23.553  1.00 172.24 ? 720  ARG A CZ    1 
ATOM   5568  N  NH1   . ARG A 1  720  ? 106.890 82.548  23.447  1.00 158.09 ? 720  ARG A NH1   1 
ATOM   5569  N  NH2   . ARG A 1  720  ? 108.874 82.467  24.596  1.00 164.44 ? 720  ARG A NH2   1 
ATOM   5570  N  N     . PHE A 1  721  ? 104.920 78.410  25.300  1.00 123.31 ? 721  PHE A N     1 
ATOM   5571  C  CA    . PHE A 1  721  ? 105.008 78.194  26.753  1.00 124.11 ? 721  PHE A CA    1 
ATOM   5572  C  C     . PHE A 1  721  ? 104.732 76.773  27.184  1.00 124.84 ? 721  PHE A C     1 
ATOM   5573  O  O     . PHE A 1  721  ? 105.338 76.302  28.143  1.00 123.71 ? 721  PHE A O     1 
ATOM   5574  C  CB    . PHE A 1  721  ? 104.111 79.158  27.547  1.00 128.79 ? 721  PHE A CB    1 
ATOM   5575  C  CG    . PHE A 1  721  ? 104.218 80.631  27.209  1.00 133.93 ? 721  PHE A CG    1 
ATOM   5576  C  CD1   . PHE A 1  721  ? 105.454 81.216  26.934  1.00 138.13 ? 721  PHE A CD1   1 
ATOM   5577  C  CD2   . PHE A 1  721  ? 103.084 81.432  27.160  1.00 138.50 ? 721  PHE A CD2   1 
ATOM   5578  C  CE1   . PHE A 1  721  ? 105.545 82.566  26.588  1.00 143.65 ? 721  PHE A CE1   1 
ATOM   5579  C  CE2   . PHE A 1  721  ? 103.177 82.779  26.812  1.00 142.16 ? 721  PHE A CE2   1 
ATOM   5580  C  CZ    . PHE A 1  721  ? 104.406 83.338  26.532  1.00 142.93 ? 721  PHE A CZ    1 
ATOM   5581  N  N     . LEU A 1  722  ? 103.825 76.097  26.467  1.00 120.51 ? 722  LEU A N     1 
ATOM   5582  C  CA    . LEU A 1  722  ? 103.393 74.721  26.722  1.00 118.76 ? 722  LEU A CA    1 
ATOM   5583  C  C     . LEU A 1  722  ? 104.349 73.660  26.151  1.00 121.74 ? 722  LEU A C     1 
ATOM   5584  O  O     . LEU A 1  722  ? 104.322 72.487  26.571  1.00 120.16 ? 722  LEU A O     1 
ATOM   5585  C  CB    . LEU A 1  722  ? 101.969 74.512  26.184  1.00 117.88 ? 722  LEU A CB    1 
ATOM   5586  C  CG    . LEU A 1  722  ? 100.843 75.291  26.867  1.00 124.34 ? 722  LEU A CG    1 
ATOM   5587  C  CD1   . LEU A 1  722  ? 99.595  75.268  26.018  1.00 123.81 ? 722  LEU A CD1   1 
ATOM   5588  C  CD2   . LEU A 1  722  ? 100.546 74.745  28.266  1.00 127.08 ? 722  LEU A CD2   1 
ATOM   5589  N  N     . ASN A 1  723  ? 105.169 74.059  25.177  1.00 117.95 ? 723  ASN A N     1 
ATOM   5590  C  CA    . ASN A 1  723  ? 106.134 73.133  24.627  1.00 115.86 ? 723  ASN A CA    1 
ATOM   5591  C  C     . ASN A 1  723  ? 107.431 73.275  25.369  1.00 121.17 ? 723  ASN A C     1 
ATOM   5592  O  O     . ASN A 1  723  ? 108.085 72.268  25.612  1.00 119.32 ? 723  ASN A O     1 
ATOM   5593  C  CB    . ASN A 1  723  ? 106.251 73.252  23.123  1.00 114.95 ? 723  ASN A CB    1 
ATOM   5594  C  CG    . ASN A 1  723  ? 105.115 72.555  22.396  1.00 135.00 ? 723  ASN A CG    1 
ATOM   5595  O  OD1   . ASN A 1  723  ? 104.470 71.604  22.905  1.00 126.19 ? 723  ASN A OD1   1 
ATOM   5596  N  ND2   . ASN A 1  723  ? 104.861 73.001  21.171  1.00 124.83 ? 723  ASN A ND2   1 
ATOM   5597  N  N     . GLU A 1  724  ? 107.745 74.505  25.840  1.00 121.32 ? 724  GLU A N     1 
ATOM   5598  C  CA    . GLU A 1  724  ? 108.903 74.799  26.691  1.00 123.55 ? 724  GLU A CA    1 
ATOM   5599  C  C     . GLU A 1  724  ? 108.711 73.966  27.938  1.00 126.26 ? 724  GLU A C     1 
ATOM   5600  O  O     . GLU A 1  724  ? 109.637 73.274  28.360  1.00 125.92 ? 724  GLU A O     1 
ATOM   5601  C  CB    . GLU A 1  724  ? 108.902 76.273  27.140  1.00 128.57 ? 724  GLU A CB    1 
ATOM   5602  C  CG    . GLU A 1  724  ? 109.387 77.288  26.120  1.00 145.75 ? 724  GLU A CG    1 
ATOM   5603  C  CD    . GLU A 1  724  ? 108.771 78.676  26.236  1.00 176.74 ? 724  GLU A CD    1 
ATOM   5604  O  OE1   . GLU A 1  724  ? 108.296 79.044  27.336  1.00 173.03 ? 724  GLU A OE1   1 
ATOM   5605  O  OE2   . GLU A 1  724  ? 108.770 79.400  25.214  1.00 175.17 ? 724  GLU A OE2   1 
ATOM   5606  N  N     . ALA A 1  725  ? 107.470 74.014  28.488  1.00 121.78 ? 725  ALA A N     1 
ATOM   5607  C  CA    . ALA A 1  725  ? 107.002 73.322  29.682  1.00 121.25 ? 725  ALA A CA    1 
ATOM   5608  C  C     . ALA A 1  725  ? 107.264 71.830  29.636  1.00 122.41 ? 725  ALA A C     1 
ATOM   5609  O  O     . ALA A 1  725  ? 108.029 71.349  30.472  1.00 122.66 ? 725  ALA A O     1 
ATOM   5610  C  CB    . ALA A 1  725  ? 105.522 73.586  29.896  1.00 122.39 ? 725  ALA A CB    1 
ATOM   5611  N  N     . ARG A 1  726  ? 106.665 71.107  28.647  1.00 116.07 ? 726  ARG A N     1 
ATOM   5612  C  CA    . ARG A 1  726  ? 106.809 69.651  28.447  1.00 113.19 ? 726  ARG A CA    1 
ATOM   5613  C  C     . ARG A 1  726  ? 108.287 69.207  28.402  1.00 117.27 ? 726  ARG A C     1 
ATOM   5614  O  O     . ARG A 1  726  ? 108.660 68.196  29.006  1.00 116.39 ? 726  ARG A O     1 
ATOM   5615  C  CB    . ARG A 1  726  ? 106.050 69.204  27.174  1.00 108.74 ? 726  ARG A CB    1 
ATOM   5616  C  CG    . ARG A 1  726  ? 106.366 67.781  26.680  1.00 105.25 ? 726  ARG A CG    1 
ATOM   5617  C  CD    . ARG A 1  726  ? 105.778 67.481  25.315  1.00 107.95 ? 726  ARG A CD    1 
ATOM   5618  N  NE    . ARG A 1  726  ? 106.019 68.544  24.339  1.00 124.46 ? 726  ARG A NE    1 
ATOM   5619  C  CZ    . ARG A 1  726  ? 107.067 68.589  23.522  1.00 147.59 ? 726  ARG A CZ    1 
ATOM   5620  N  NH1   . ARG A 1  726  ? 107.978 67.624  23.544  1.00 138.92 ? 726  ARG A NH1   1 
ATOM   5621  N  NH2   . ARG A 1  726  ? 107.210 69.597  22.674  1.00 138.88 ? 726  ARG A NH2   1 
ATOM   5622  N  N     . ASP A 1  727  ? 109.114 69.987  27.703  1.00 114.07 ? 727  ASP A N     1 
ATOM   5623  C  CA    . ASP A 1  727  ? 110.520 69.709  27.532  1.00 113.52 ? 727  ASP A CA    1 
ATOM   5624  C  C     . ASP A 1  727  ? 111.305 69.903  28.810  1.00 119.14 ? 727  ASP A C     1 
ATOM   5625  O  O     . ASP A 1  727  ? 112.056 68.995  29.164  1.00 118.18 ? 727  ASP A O     1 
ATOM   5626  C  CB    . ASP A 1  727  ? 111.076 70.505  26.354  1.00 116.00 ? 727  ASP A CB    1 
ATOM   5627  C  CG    . ASP A 1  727  ? 110.426 70.102  25.035  1.00 125.73 ? 727  ASP A CG    1 
ATOM   5628  O  OD1   . ASP A 1  727  ? 110.075 68.904  24.881  1.00 122.85 ? 727  ASP A OD1   1 
ATOM   5629  O  OD2   . ASP A 1  727  ? 110.277 70.978  24.155  1.00 135.73 ? 727  ASP A OD2   1 
ATOM   5630  N  N     . LYS A 1  728  ? 111.108 71.020  29.546  1.00 118.37 ? 728  LYS A N     1 
ATOM   5631  C  CA    . LYS A 1  728  ? 111.844 71.164  30.808  1.00 120.44 ? 728  LYS A CA    1 
ATOM   5632  C  C     . LYS A 1  728  ? 111.317 70.177  31.852  1.00 123.70 ? 728  LYS A C     1 
ATOM   5633  O  O     . LYS A 1  728  ? 112.130 69.523  32.511  1.00 124.22 ? 728  LYS A O     1 
ATOM   5634  C  CB    . LYS A 1  728  ? 111.974 72.610  31.338  1.00 125.99 ? 728  LYS A CB    1 
ATOM   5635  C  CG    . LYS A 1  728  ? 110.706 73.440  31.469  1.00 145.13 ? 728  LYS A CG    1 
ATOM   5636  C  CD    . LYS A 1  728  ? 111.036 74.926  31.824  1.00 160.45 ? 728  LYS A CD    1 
ATOM   5637  C  CE    . LYS A 1  728  ? 111.189 75.877  30.637  1.00 165.09 ? 728  LYS A CE    1 
ATOM   5638  N  NZ    . LYS A 1  728  ? 111.597 77.257  31.047  1.00 167.29 ? 728  LYS A NZ    1 
ATOM   5639  N  N     . ALA A 1  729  ? 109.986 69.961  31.897  1.00 118.25 ? 729  ALA A N     1 
ATOM   5640  C  CA    . ALA A 1  729  ? 109.363 68.986  32.797  1.00 117.34 ? 729  ALA A CA    1 
ATOM   5641  C  C     . ALA A 1  729  ? 109.924 67.587  32.529  1.00 119.20 ? 729  ALA A C     1 
ATOM   5642  O  O     . ALA A 1  729  ? 110.242 66.856  33.472  1.00 119.07 ? 729  ALA A O     1 
ATOM   5643  C  CB    . ALA A 1  729  ? 107.860 68.988  32.610  1.00 117.11 ? 729  ALA A CB    1 
ATOM   5644  N  N     . GLY A 1  730  ? 110.083 67.262  31.245  1.00 113.84 ? 730  GLY A N     1 
ATOM   5645  C  CA    . GLY A 1  730  ? 110.655 66.004  30.787  1.00 111.41 ? 730  GLY A CA    1 
ATOM   5646  C  C     . GLY A 1  730  ? 112.098 65.872  31.227  1.00 116.16 ? 730  GLY A C     1 
ATOM   5647  O  O     . GLY A 1  730  ? 112.474 64.846  31.800  1.00 115.39 ? 730  GLY A O     1 
ATOM   5648  N  N     . ARG A 1  731  ? 112.902 66.942  31.026  1.00 113.91 ? 731  ARG A N     1 
ATOM   5649  C  CA    . ARG A 1  731  ? 114.322 66.963  31.381  1.00 114.72 ? 731  ARG A CA    1 
ATOM   5650  C  C     . ARG A 1  731  ? 114.591 66.688  32.836  1.00 120.24 ? 731  ARG A C     1 
ATOM   5651  O  O     . ARG A 1  731  ? 115.591 66.041  33.136  1.00 119.21 ? 731  ARG A O     1 
ATOM   5652  C  CB    . ARG A 1  731  ? 114.994 68.250  30.945  1.00 116.55 ? 731  ARG A CB    1 
ATOM   5653  C  CG    . ARG A 1  731  ? 115.866 68.052  29.722  1.00 126.77 ? 731  ARG A CG    1 
ATOM   5654  C  CD    . ARG A 1  731  ? 116.550 69.337  29.314  1.00 143.56 ? 731  ARG A CD    1 
ATOM   5655  N  NE    . ARG A 1  731  ? 115.607 70.339  28.808  1.00 150.98 ? 731  ARG A NE    1 
ATOM   5656  C  CZ    . ARG A 1  731  ? 115.229 71.427  29.473  1.00 163.47 ? 731  ARG A CZ    1 
ATOM   5657  N  NH1   . ARG A 1  731  ? 115.702 71.668  30.693  1.00 150.06 ? 731  ARG A NH1   1 
ATOM   5658  N  NH2   . ARG A 1  731  ? 114.373 72.282  28.927  1.00 147.54 ? 731  ARG A NH2   1 
ATOM   5659  N  N     . LEU A 1  732  ? 113.683 67.131  33.730  1.00 119.24 ? 732  LEU A N     1 
ATOM   5660  C  CA    . LEU A 1  732  ? 113.760 66.899  35.177  1.00 121.64 ? 732  LEU A CA    1 
ATOM   5661  C  C     . LEU A 1  732  ? 113.750 65.400  35.477  1.00 124.64 ? 732  LEU A C     1 
ATOM   5662  O  O     . LEU A 1  732  ? 114.512 64.938  36.332  1.00 125.95 ? 732  LEU A O     1 
ATOM   5663  C  CB    . LEU A 1  732  ? 112.562 67.542  35.901  1.00 123.31 ? 732  LEU A CB    1 
ATOM   5664  C  CG    . LEU A 1  732  ? 112.374 69.049  35.820  1.00 130.19 ? 732  LEU A CG    1 
ATOM   5665  C  CD1   . LEU A 1  732  ? 111.217 69.498  36.707  1.00 131.44 ? 732  LEU A CD1   1 
ATOM   5666  C  CD2   . LEU A 1  732  ? 113.643 69.788  36.210  1.00 137.22 ? 732  LEU A CD2   1 
ATOM   5667  N  N     . ALA A 1  733  ? 112.875 64.655  34.770  1.00 117.92 ? 733  ALA A N     1 
ATOM   5668  C  CA    . ALA A 1  733  ? 112.714 63.214  34.910  1.00 115.71 ? 733  ALA A CA    1 
ATOM   5669  C  C     . ALA A 1  733  ? 113.931 62.426  34.400  1.00 117.46 ? 733  ALA A C     1 
ATOM   5670  O  O     . ALA A 1  733  ? 114.444 61.575  35.130  1.00 117.26 ? 733  ALA A O     1 
ATOM   5671  C  CB    . ALA A 1  733  ? 111.450 62.765  34.199  1.00 114.25 ? 733  ALA A CB    1 
ATOM   5672  N  N     . GLU A 1  734  ? 114.401 62.718  33.165  1.00 112.37 ? 734  GLU A N     1 
ATOM   5673  C  CA    . GLU A 1  734  ? 115.563 62.067  32.547  1.00 111.47 ? 734  GLU A CA    1 
ATOM   5674  C  C     . GLU A 1  734  ? 116.763 62.133  33.506  1.00 117.18 ? 734  GLU A C     1 
ATOM   5675  O  O     . GLU A 1  734  ? 117.390 61.111  33.793  1.00 115.22 ? 734  GLU A O     1 
ATOM   5676  C  CB    . GLU A 1  734  ? 115.856 62.723  31.174  1.00 112.24 ? 734  GLU A CB    1 
ATOM   5677  C  CG    . GLU A 1  734  ? 117.237 62.480  30.576  1.00 126.64 ? 734  GLU A CG    1 
ATOM   5678  C  CD    . GLU A 1  734  ? 118.139 63.700  30.625  1.00 162.50 ? 734  GLU A CD    1 
ATOM   5679  O  OE1   . GLU A 1  734  ? 117.991 64.591  29.755  1.00 161.14 ? 734  GLU A OE1   1 
ATOM   5680  O  OE2   . GLU A 1  734  ? 118.971 63.783  31.559  1.00 163.95 ? 734  GLU A OE2   1 
ATOM   5681  N  N     . VAL A 1  735  ? 116.995 63.345  34.050  1.00 117.34 ? 735  VAL A N     1 
ATOM   5682  C  CA    . VAL A 1  735  ? 118.012 63.758  35.018  1.00 120.19 ? 735  VAL A CA    1 
ATOM   5683  C  C     . VAL A 1  735  ? 117.893 62.985  36.351  1.00 124.98 ? 735  VAL A C     1 
ATOM   5684  O  O     . VAL A 1  735  ? 118.915 62.599  36.932  1.00 125.60 ? 735  VAL A O     1 
ATOM   5685  C  CB    . VAL A 1  735  ? 117.876 65.295  35.166  1.00 126.81 ? 735  VAL A CB    1 
ATOM   5686  C  CG1   . VAL A 1  735  ? 118.095 65.794  36.593  1.00 130.21 ? 735  VAL A CG1   1 
ATOM   5687  C  CG2   . VAL A 1  735  ? 118.769 66.019  34.167  1.00 127.00 ? 735  VAL A CG2   1 
ATOM   5688  N  N     . ASN A 1  736  ? 116.644 62.752  36.810  1.00 121.22 ? 736  ASN A N     1 
ATOM   5689  C  CA    . ASN A 1  736  ? 116.320 62.014  38.033  1.00 122.07 ? 736  ASN A CA    1 
ATOM   5690  C  C     . ASN A 1  736  ? 116.445 60.481  37.855  1.00 122.67 ? 736  ASN A C     1 
ATOM   5691  O  O     . ASN A 1  736  ? 116.579 59.755  38.854  1.00 122.95 ? 736  ASN A O     1 
ATOM   5692  C  CB    . ASN A 1  736  ? 114.924 62.395  38.525  1.00 124.72 ? 736  ASN A CB    1 
ATOM   5693  C  CG    . ASN A 1  736  ? 114.488 61.656  39.764  1.00 154.00 ? 736  ASN A CG    1 
ATOM   5694  O  OD1   . ASN A 1  736  ? 113.824 60.615  39.689  1.00 147.66 ? 736  ASN A OD1   1 
ATOM   5695  N  ND2   . ASN A 1  736  ? 114.937 62.124  40.921  1.00 150.34 ? 736  ASN A ND2   1 
ATOM   5696  N  N     . LEU A 1  737  ? 116.390 59.994  36.592  1.00 115.61 ? 737  LEU A N     1 
ATOM   5697  C  CA    . LEU A 1  737  ? 116.527 58.565  36.300  1.00 112.97 ? 737  LEU A CA    1 
ATOM   5698  C  C     . LEU A 1  737  ? 117.963 58.109  36.516  1.00 118.70 ? 737  LEU A C     1 
ATOM   5699  O  O     . LEU A 1  737  ? 118.902 58.779  36.063  1.00 119.65 ? 737  LEU A O     1 
ATOM   5700  C  CB    . LEU A 1  737  ? 116.053 58.214  34.882  1.00 109.30 ? 737  LEU A CB    1 
ATOM   5701  C  CG    . LEU A 1  737  ? 114.574 58.401  34.602  1.00 111.71 ? 737  LEU A CG    1 
ATOM   5702  C  CD1   . LEU A 1  737  ? 114.275 58.114  33.175  1.00 108.83 ? 737  LEU A CD1   1 
ATOM   5703  C  CD2   . LEU A 1  737  ? 113.713 57.546  35.512  1.00 113.51 ? 737  LEU A CD2   1 
ATOM   5704  N  N     . LYS A 1  738  ? 118.132 56.994  37.250  1.00 114.92 ? 738  LYS A N     1 
ATOM   5705  C  CA    . LYS A 1  738  ? 119.448 56.430  37.558  1.00 115.36 ? 738  LYS A CA    1 
ATOM   5706  C  C     . LYS A 1  738  ? 120.052 55.742  36.338  1.00 117.19 ? 738  LYS A C     1 
ATOM   5707  O  O     . LYS A 1  738  ? 119.350 55.478  35.355  1.00 114.54 ? 738  LYS A O     1 
ATOM   5708  C  CB    . LYS A 1  738  ? 119.364 55.433  38.720  1.00 118.48 ? 738  LYS A CB    1 
ATOM   5709  C  CG    . LYS A 1  738  ? 118.909 56.026  40.023  1.00 129.03 ? 738  LYS A CG    1 
ATOM   5710  C  CD    . LYS A 1  738  ? 117.504 55.587  40.362  1.00 135.93 ? 738  LYS A CD    1 
ATOM   5711  C  CE    . LYS A 1  738  ? 117.050 56.277  41.617  1.00 152.78 ? 738  LYS A CE    1 
ATOM   5712  N  NZ    . LYS A 1  738  ? 117.861 55.868  42.799  1.00 164.77 ? 738  LYS A NZ    1 
ATOM   5713  N  N     . ASP A 1  739  ? 121.351 55.413  36.416  1.00 114.01 ? 739  ASP A N     1 
ATOM   5714  C  CA    . ASP A 1  739  ? 122.044 54.716  35.341  1.00 111.33 ? 739  ASP A CA    1 
ATOM   5715  C  C     . ASP A 1  739  ? 121.517 53.289  35.209  1.00 109.26 ? 739  ASP A C     1 
ATOM   5716  O  O     . ASP A 1  739  ? 121.680 52.670  34.158  1.00 106.14 ? 739  ASP A O     1 
ATOM   5717  C  CB    . ASP A 1  739  ? 123.560 54.757  35.573  1.00 115.90 ? 739  ASP A CB    1 
ATOM   5718  C  CG    . ASP A 1  739  ? 124.276 55.926  34.905  1.00 134.82 ? 739  ASP A CG    1 
ATOM   5719  O  OD1   . ASP A 1  739  ? 123.594 56.923  34.544  1.00 136.05 ? 739  ASP A OD1   1 
ATOM   5720  O  OD2   . ASP A 1  739  ? 125.521 55.855  34.757  1.00 145.20 ? 739  ASP A OD2   1 
ATOM   5721  N  N     . LEU A 1  740  ? 120.832 52.801  36.271  1.00 104.36 ? 740  LEU A N     1 
ATOM   5722  C  CA    . LEU A 1  740  ? 120.198 51.488  36.336  1.00 101.82 ? 740  LEU A CA    1 
ATOM   5723  C  C     . LEU A 1  740  ? 118.862 51.457  35.613  1.00 100.77 ? 740  LEU A C     1 
ATOM   5724  O  O     . LEU A 1  740  ? 118.293 50.375  35.441  1.00 98.61  ? 740  LEU A O     1 
ATOM   5725  C  CB    . LEU A 1  740  ? 120.059 50.968  37.789  1.00 104.20 ? 740  LEU A CB    1 
ATOM   5726  C  CG    . LEU A 1  740  ? 119.257 51.779  38.826  1.00 110.91 ? 740  LEU A CG    1 
ATOM   5727  C  CD1   . LEU A 1  740  ? 117.740 51.606  38.655  1.00 109.74 ? 740  LEU A CD1   1 
ATOM   5728  C  CD2   . LEU A 1  740  ? 119.635 51.356  40.238  1.00 115.92 ? 740  LEU A CD2   1 
ATOM   5729  N  N     . ASN A 1  741  ? 118.346 52.636  35.220  1.00 96.00  ? 741  ASN A N     1 
ATOM   5730  C  CA    . ASN A 1  741  ? 117.084 52.698  34.505  1.00 94.16  ? 741  ASN A CA    1 
ATOM   5731  C  C     . ASN A 1  741  ? 117.259 52.069  33.148  1.00 97.17  ? 741  ASN A C     1 
ATOM   5732  O  O     . ASN A 1  741  ? 117.974 52.605  32.290  1.00 96.18  ? 741  ASN A O     1 
ATOM   5733  C  CB    . ASN A 1  741  ? 116.555 54.114  34.371  1.00 94.37  ? 741  ASN A CB    1 
ATOM   5734  C  CG    . ASN A 1  741  ? 115.080 54.147  34.069  1.00 108.66 ? 741  ASN A CG    1 
ATOM   5735  O  OD1   . ASN A 1  741  ? 114.255 54.379  34.959  1.00 112.83 ? 741  ASN A OD1   1 
ATOM   5736  N  ND2   . ASN A 1  741  ? 114.711 53.877  32.823  1.00 85.84  ? 741  ASN A ND2   1 
ATOM   5737  N  N     . ASN A 1  742  ? 116.632 50.888  32.985  1.00 93.09  ? 742  ASN A N     1 
ATOM   5738  C  CA    . ASN A 1  742  ? 116.656 50.078  31.771  1.00 90.43  ? 742  ASN A CA    1 
ATOM   5739  C  C     . ASN A 1  742  ? 116.291 50.917  30.539  1.00 92.08  ? 742  ASN A C     1 
ATOM   5740  O  O     . ASN A 1  742  ? 116.990 50.839  29.524  1.00 90.39  ? 742  ASN A O     1 
ATOM   5741  C  CB    . ASN A 1  742  ? 115.715 48.887  31.909  1.00 90.34  ? 742  ASN A CB    1 
ATOM   5742  C  CG    . ASN A 1  742  ? 116.034 47.950  33.046  1.00 112.69 ? 742  ASN A CG    1 
ATOM   5743  O  OD1   . ASN A 1  742  ? 116.838 47.007  32.927  1.00 104.15 ? 742  ASN A OD1   1 
ATOM   5744  N  ND2   . ASN A 1  742  ? 115.343 48.151  34.149  1.00 108.03 ? 742  ASN A ND2   1 
ATOM   5745  N  N     . VAL A 1  743  ? 115.234 51.758  30.656  1.00 88.03  ? 743  VAL A N     1 
ATOM   5746  C  CA    . VAL A 1  743  ? 114.777 52.633  29.577  1.00 86.23  ? 743  VAL A CA    1 
ATOM   5747  C  C     . VAL A 1  743  ? 115.851 53.664  29.245  1.00 89.66  ? 743  VAL A C     1 
ATOM   5748  O  O     . VAL A 1  743  ? 116.078 53.914  28.061  1.00 88.30  ? 743  VAL A O     1 
ATOM   5749  C  CB    . VAL A 1  743  ? 113.373 53.243  29.822  1.00 90.03  ? 743  VAL A CB    1 
ATOM   5750  C  CG1   . VAL A 1  743  ? 113.065 54.365  28.833  1.00 89.13  ? 743  VAL A CG1   1 
ATOM   5751  C  CG2   . VAL A 1  743  ? 112.296 52.163  29.744  1.00 88.80  ? 743  VAL A CG2   1 
ATOM   5752  N  N     . LYS A 1  744  ? 116.563 54.184  30.263  1.00 87.59  ? 744  LYS A N     1 
ATOM   5753  C  CA    . LYS A 1  744  ? 117.655 55.146  30.056  1.00 88.73  ? 744  LYS A CA    1 
ATOM   5754  C  C     . LYS A 1  744  ? 118.816 54.431  29.348  1.00 91.15  ? 744  LYS A C     1 
ATOM   5755  O  O     . LYS A 1  744  ? 119.367 54.951  28.374  1.00 89.29  ? 744  LYS A O     1 
ATOM   5756  C  CB    . LYS A 1  744  ? 118.110 55.743  31.403  1.00 94.41  ? 744  LYS A CB    1 
ATOM   5757  C  CG    . LYS A 1  744  ? 118.576 57.201  31.370  1.00 109.88 ? 744  LYS A CG    1 
ATOM   5758  C  CD    . LYS A 1  744  ? 119.146 57.628  32.735  1.00 124.22 ? 744  LYS A CD    1 
ATOM   5759  C  CE    . LYS A 1  744  ? 119.848 58.968  32.710  1.00 141.82 ? 744  LYS A CE    1 
ATOM   5760  N  NZ    . LYS A 1  744  ? 120.676 59.200  33.932  1.00 155.50 ? 744  LYS A NZ    1 
ATOM   5761  N  N     . GLN A 1  745  ? 119.116 53.200  29.795  1.00 88.46  ? 745  GLN A N     1 
ATOM   5762  C  CA    . GLN A 1  745  ? 120.171 52.338  29.258  1.00 88.61  ? 745  GLN A CA    1 
ATOM   5763  C  C     . GLN A 1  745  ? 120.024 51.980  27.769  1.00 93.58  ? 745  GLN A C     1 
ATOM   5764  O  O     . GLN A 1  745  ? 121.018 51.610  27.124  1.00 93.15  ? 745  GLN A O     1 
ATOM   5765  C  CB    . GLN A 1  745  ? 120.244 51.058  30.066  1.00 89.88  ? 745  GLN A CB    1 
ATOM   5766  C  CG    . GLN A 1  745  ? 120.931 51.206  31.389  1.00 102.14 ? 745  GLN A CG    1 
ATOM   5767  C  CD    . GLN A 1  745  ? 120.938 49.864  32.039  1.00 120.43 ? 745  GLN A CD    1 
ATOM   5768  O  OE1   . GLN A 1  745  ? 120.054 49.541  32.841  1.00 117.81 ? 745  GLN A OE1   1 
ATOM   5769  N  NE2   . GLN A 1  745  ? 121.865 49.013  31.613  1.00 109.07 ? 745  GLN A NE2   1 
ATOM   5770  N  N     . MET A 1  746  ? 118.782 52.017  27.253  1.00 90.23  ? 746  MET A N     1 
ATOM   5771  C  CA    . MET A 1  746  ? 118.498 51.743  25.851  1.00 88.58  ? 746  MET A CA    1 
ATOM   5772  C  C     . MET A 1  746  ? 118.677 53.013  25.051  1.00 94.55  ? 746  MET A C     1 
ATOM   5773  O  O     . MET A 1  746  ? 119.177 52.960  23.927  1.00 94.75  ? 746  MET A O     1 
ATOM   5774  C  CB    . MET A 1  746  ? 117.096 51.200  25.670  1.00 89.49  ? 746  MET A CB    1 
ATOM   5775  C  CG    . MET A 1  746  ? 117.034 49.737  25.853  1.00 92.24  ? 746  MET A CG    1 
ATOM   5776  S  SD    . MET A 1  746  ? 115.335 49.177  25.684  1.00 95.87  ? 746  MET A SD    1 
ATOM   5777  C  CE    . MET A 1  746  ? 114.767 49.392  27.335  1.00 94.18  ? 746  MET A CE    1 
ATOM   5778  N  N     . VAL A 1  747  ? 118.303 54.160  25.630  1.00 91.63  ? 747  VAL A N     1 
ATOM   5779  C  CA    . VAL A 1  747  ? 118.478 55.444  24.967  1.00 91.87  ? 747  VAL A CA    1 
ATOM   5780  C  C     . VAL A 1  747  ? 119.970 55.733  24.891  1.00 98.49  ? 747  VAL A C     1 
ATOM   5781  O  O     . VAL A 1  747  ? 120.436 56.260  23.879  1.00 97.76  ? 747  VAL A O     1 
ATOM   5782  C  CB    . VAL A 1  747  ? 117.700 56.567  25.681  1.00 96.33  ? 747  VAL A CB    1 
ATOM   5783  C  CG1   . VAL A 1  747  ? 117.819 57.879  24.930  1.00 96.65  ? 747  VAL A CG1   1 
ATOM   5784  C  CG2   . VAL A 1  747  ? 116.235 56.193  25.828  1.00 95.36  ? 747  VAL A CG2   1 
ATOM   5785  N  N     . MET A 1  748  ? 120.713 55.317  25.936  1.00 98.28  ? 748  MET A N     1 
ATOM   5786  C  CA    . MET A 1  748  ? 122.158 55.500  26.086  1.00 101.07 ? 748  MET A CA    1 
ATOM   5787  C  C     . MET A 1  748  ? 123.015 54.801  25.019  1.00 104.55 ? 748  MET A C     1 
ATOM   5788  O  O     . MET A 1  748  ? 123.898 55.439  24.427  1.00 105.75 ? 748  MET A O     1 
ATOM   5789  C  CB    . MET A 1  748  ? 122.601 55.069  27.483  1.00 105.43 ? 748  MET A CB    1 
ATOM   5790  C  CG    . MET A 1  748  ? 122.500 56.153  28.509  1.00 112.42 ? 748  MET A CG    1 
ATOM   5791  S  SD    . MET A 1  748  ? 123.284 55.597  30.038  1.00 119.88 ? 748  MET A SD    1 
ATOM   5792  C  CE    . MET A 1  748  ? 121.851 55.280  31.056  1.00 116.86 ? 748  MET A CE    1 
ATOM   5793  N  N     . ALA A 1  749  ? 122.770 53.491  24.794  1.00 98.49  ? 749  ALA A N     1 
ATOM   5794  C  CA    . ALA A 1  749  ? 123.483 52.684  23.804  1.00 96.72  ? 749  ALA A CA    1 
ATOM   5795  C  C     . ALA A 1  749  ? 123.037 53.098  22.412  1.00 99.37  ? 749  ALA A C     1 
ATOM   5796  O  O     . ALA A 1  749  ? 123.818 53.025  21.465  1.00 98.13  ? 749  ALA A O     1 
ATOM   5797  C  CB    . ALA A 1  749  ? 123.187 51.209  24.030  1.00 96.09  ? 749  ALA A CB    1 
ATOM   5798  N  N     . GLY A 1  750  ? 121.793 53.573  22.329  1.00 96.29  ? 750  GLY A N     1 
ATOM   5799  C  CA    . GLY A 1  750  ? 121.141 54.008  21.101  1.00 95.43  ? 750  GLY A CA    1 
ATOM   5800  C  C     . GLY A 1  750  ? 120.474 52.845  20.405  1.00 96.95  ? 750  GLY A C     1 
ATOM   5801  O  O     . GLY A 1  750  ? 120.283 52.878  19.192  1.00 96.13  ? 750  GLY A O     1 
ATOM   5802  N  N     . SER A 1  751  ? 120.149 51.797  21.174  1.00 92.35  ? 751  SER A N     1 
ATOM   5803  C  CA    . SER A 1  751  ? 119.506 50.569  20.716  1.00 90.78  ? 751  SER A CA    1 
ATOM   5804  C  C     . SER A 1  751  ? 118.034 50.770  20.352  1.00 93.46  ? 751  SER A C     1 
ATOM   5805  O  O     . SER A 1  751  ? 117.589 50.201  19.347  1.00 91.51  ? 751  SER A O     1 
ATOM   5806  C  CB    . SER A 1  751  ? 119.678 49.460  21.751  1.00 95.57  ? 751  SER A CB    1 
ATOM   5807  O  OG    . SER A 1  751  ? 119.298 49.860  23.060  1.00 107.22 ? 751  SER A OG    1 
ATOM   5808  N  N     . LYS A 1  752  ? 117.292 51.564  21.191  1.00 91.16  ? 752  LYS A N     1 
ATOM   5809  C  CA    . LYS A 1  752  ? 115.882 52.014  21.092  1.00 90.59  ? 752  LYS A CA    1 
ATOM   5810  C  C     . LYS A 1  752  ? 115.566 53.156  22.085  1.00 96.66  ? 752  LYS A C     1 
ATOM   5811  O  O     . LYS A 1  752  ? 116.122 53.214  23.190  1.00 96.43  ? 752  LYS A O     1 
ATOM   5812  C  CB    . LYS A 1  752  ? 114.855 50.872  21.274  1.00 90.91  ? 752  LYS A CB    1 
ATOM   5813  C  CG    . LYS A 1  752  ? 114.369 50.242  19.975  1.00 98.89  ? 752  LYS A CG    1 
ATOM   5814  C  CD    . LYS A 1  752  ? 113.237 50.982  19.284  1.00 110.36 ? 752  LYS A CD    1 
ATOM   5815  C  CE    . LYS A 1  752  ? 112.863 50.330  17.961  1.00 125.82 ? 752  LYS A CE    1 
ATOM   5816  N  NZ    . LYS A 1  752  ? 111.982 49.125  18.124  1.00 133.93 ? 752  LYS A NZ    1 
ATOM   5817  N  N     . GLY A 1  753  ? 114.647 54.028  21.676  1.00 94.49  ? 753  GLY A N     1 
ATOM   5818  C  CA    . GLY A 1  753  ? 114.168 55.136  22.494  1.00 95.99  ? 753  GLY A CA    1 
ATOM   5819  C  C     . GLY A 1  753  ? 115.012 56.394  22.451  1.00 101.79 ? 753  GLY A C     1 
ATOM   5820  O  O     . GLY A 1  753  ? 116.224 56.335  22.189  1.00 102.68 ? 753  GLY A O     1 
ATOM   5821  N  N     . SER A 1  754  ? 114.354 57.540  22.755  1.00 97.43  ? 754  SER A N     1 
ATOM   5822  C  CA    . SER A 1  754  ? 114.917 58.885  22.771  1.00 98.10  ? 754  SER A CA    1 
ATOM   5823  C  C     . SER A 1  754  ? 114.403 59.664  23.978  1.00 102.95 ? 754  SER A C     1 
ATOM   5824  O  O     . SER A 1  754  ? 113.619 59.125  24.755  1.00 102.05 ? 754  SER A O     1 
ATOM   5825  C  CB    . SER A 1  754  ? 114.508 59.622  21.505  1.00 101.79 ? 754  SER A CB    1 
ATOM   5826  O  OG    . SER A 1  754  ? 113.345 60.394  21.757  1.00 113.34 ? 754  SER A OG    1 
ATOM   5827  N  N     . PHE A 1  755  ? 114.793 60.956  24.095  1.00 101.35 ? 755  PHE A N     1 
ATOM   5828  C  CA    . PHE A 1  755  ? 114.379 61.833  25.183  1.00 102.79 ? 755  PHE A CA    1 
ATOM   5829  C  C     . PHE A 1  755  ? 112.876 61.952  25.276  1.00 102.78 ? 755  PHE A C     1 
ATOM   5830  O  O     . PHE A 1  755  ? 112.308 61.697  26.334  1.00 101.06 ? 755  PHE A O     1 
ATOM   5831  C  CB    . PHE A 1  755  ? 115.016 63.231  25.054  1.00 107.61 ? 755  PHE A CB    1 
ATOM   5832  C  CG    . PHE A 1  755  ? 114.326 64.297  25.888  1.00 112.20 ? 755  PHE A CG    1 
ATOM   5833  C  CD1   . PHE A 1  755  ? 114.597 64.425  27.247  1.00 117.75 ? 755  PHE A CD1   1 
ATOM   5834  C  CD2   . PHE A 1  755  ? 113.393 65.157  25.318  1.00 115.45 ? 755  PHE A CD2   1 
ATOM   5835  C  CE1   . PHE A 1  755  ? 113.935 65.383  28.021  1.00 120.72 ? 755  PHE A CE1   1 
ATOM   5836  C  CE2   . PHE A 1  755  ? 112.726 66.108  26.096  1.00 120.34 ? 755  PHE A CE2   1 
ATOM   5837  C  CZ    . PHE A 1  755  ? 113.004 66.217  27.441  1.00 120.07 ? 755  PHE A CZ    1 
ATOM   5838  N  N     . ILE A 1  756  ? 112.242 62.356  24.173  1.00 99.18  ? 756  ILE A N     1 
ATOM   5839  C  CA    . ILE A 1  756  ? 110.803 62.598  24.109  1.00 99.75  ? 756  ILE A CA    1 
ATOM   5840  C  C     . ILE A 1  756  ? 110.012 61.344  24.535  1.00 102.25 ? 756  ILE A C     1 
ATOM   5841  O  O     . ILE A 1  756  ? 109.011 61.487  25.249  1.00 102.09 ? 756  ILE A O     1 
ATOM   5842  C  CB    . ILE A 1  756  ? 110.384 63.213  22.738  1.00 103.25 ? 756  ILE A CB    1 
ATOM   5843  C  CG1   . ILE A 1  756  ? 108.855 63.612  22.725  1.00 104.22 ? 756  ILE A CG1   1 
ATOM   5844  C  CG2   . ILE A 1  756  ? 110.812 62.362  21.527  1.00 102.29 ? 756  ILE A CG2   1 
ATOM   5845  C  CD1   . ILE A 1  756  ? 107.843 62.759  21.849  1.00 113.14 ? 756  ILE A CD1   1 
ATOM   5846  N  N     . ASN A 1  757  ? 110.532 60.133  24.197  1.00 97.41  ? 757  ASN A N     1 
ATOM   5847  C  CA    . ASN A 1  757  ? 109.969 58.837  24.594  1.00 96.23  ? 757  ASN A CA    1 
ATOM   5848  C  C     . ASN A 1  757  ? 109.927 58.723  26.135  1.00 102.31 ? 757  ASN A C     1 
ATOM   5849  O  O     . ASN A 1  757  ? 108.941 58.208  26.668  1.00 102.28 ? 757  ASN A O     1 
ATOM   5850  C  CB    . ASN A 1  757  ? 110.770 57.670  23.991  1.00 94.39  ? 757  ASN A CB    1 
ATOM   5851  C  CG    . ASN A 1  757  ? 110.512 57.402  22.530  1.00 113.11 ? 757  ASN A CG    1 
ATOM   5852  O  OD1   . ASN A 1  757  ? 109.373 57.219  22.091  1.00 109.25 ? 757  ASN A OD1   1 
ATOM   5853  N  ND2   . ASN A 1  757  ? 111.571 57.308  21.747  1.00 101.36 ? 757  ASN A ND2   1 
ATOM   5854  N  N     . ILE A 1  758  ? 110.979 59.239  26.846  1.00 99.53  ? 758  ILE A N     1 
ATOM   5855  C  CA    . ILE A 1  758  ? 111.063 59.252  28.320  1.00 99.94  ? 758  ILE A CA    1 
ATOM   5856  C  C     . ILE A 1  758  ? 110.075 60.284  28.830  1.00 104.71 ? 758  ILE A C     1 
ATOM   5857  O  O     . ILE A 1  758  ? 109.240 59.984  29.687  1.00 104.19 ? 758  ILE A O     1 
ATOM   5858  C  CB    . ILE A 1  758  ? 112.503 59.583  28.831  1.00 103.59 ? 758  ILE A CB    1 
ATOM   5859  C  CG1   . ILE A 1  758  ? 113.483 58.462  28.504  1.00 102.59 ? 758  ILE A CG1   1 
ATOM   5860  C  CG2   . ILE A 1  758  ? 112.517 59.896  30.335  1.00 105.83 ? 758  ILE A CG2   1 
ATOM   5861  C  CD1   . ILE A 1  758  ? 114.928 58.815  28.737  1.00 111.63 ? 758  ILE A CD1   1 
ATOM   5862  N  N     . ALA A 1  759  ? 110.197 61.506  28.290  1.00 102.62 ? 759  ALA A N     1 
ATOM   5863  C  CA    . ALA A 1  759  ? 109.418 62.681  28.655  1.00 104.47 ? 759  ALA A CA    1 
ATOM   5864  C  C     . ALA A 1  759  ? 107.916 62.426  28.698  1.00 107.24 ? 759  ALA A C     1 
ATOM   5865  O  O     . ALA A 1  759  ? 107.261 62.747  29.701  1.00 108.76 ? 759  ALA A O     1 
ATOM   5866  C  CB    . ALA A 1  759  ? 109.747 63.840  27.718  1.00 105.89 ? 759  ALA A CB    1 
ATOM   5867  N  N     . GLN A 1  760  ? 107.382 61.818  27.636  1.00 100.06 ? 760  GLN A N     1 
ATOM   5868  C  CA    . GLN A 1  760  ? 105.958 61.563  27.567  1.00 98.87  ? 760  GLN A CA    1 
ATOM   5869  C  C     . GLN A 1  760  ? 105.501 60.467  28.533  1.00 104.50 ? 760  GLN A C     1 
ATOM   5870  O  O     . GLN A 1  760  ? 104.432 60.601  29.126  1.00 105.07 ? 760  GLN A O     1 
ATOM   5871  C  CB    . GLN A 1  760  ? 105.532 61.281  26.130  1.00 97.90  ? 760  GLN A CB    1 
ATOM   5872  C  CG    . GLN A 1  760  ? 105.785 62.430  25.165  1.00 96.19  ? 760  GLN A CG    1 
ATOM   5873  C  CD    . GLN A 1  760  ? 105.031 62.236  23.875  1.00 110.77 ? 760  GLN A CD    1 
ATOM   5874  O  OE1   . GLN A 1  760  ? 105.020 61.147  23.284  1.00 99.36  ? 760  GLN A OE1   1 
ATOM   5875  N  NE2   . GLN A 1  760  ? 104.403 63.300  23.388  1.00 110.03 ? 760  GLN A NE2   1 
ATOM   5876  N  N     . MET A 1  761  ? 106.318 59.411  28.718  1.00 101.58 ? 761  MET A N     1 
ATOM   5877  C  CA    . MET A 1  761  ? 106.002 58.268  29.586  1.00 101.92 ? 761  MET A CA    1 
ATOM   5878  C  C     . MET A 1  761  ? 106.028 58.599  31.078  1.00 106.08 ? 761  MET A C     1 
ATOM   5879  O  O     . MET A 1  761  ? 105.088 58.271  31.802  1.00 105.20 ? 761  MET A O     1 
ATOM   5880  C  CB    . MET A 1  761  ? 106.975 57.104  29.316  1.00 103.66 ? 761  MET A CB    1 
ATOM   5881  C  CG    . MET A 1  761  ? 106.644 56.279  28.082  1.00 106.34 ? 761  MET A CG    1 
ATOM   5882  S  SD    . MET A 1  761  ? 107.475 54.644  28.001  1.00 110.22 ? 761  MET A SD    1 
ATOM   5883  C  CE    . MET A 1  761  ? 109.171 55.119  27.571  1.00 106.70 ? 761  MET A CE    1 
ATOM   5884  N  N     . SER A 1  762  ? 107.127 59.230  31.523  1.00 103.98 ? 762  SER A N     1 
ATOM   5885  C  CA    . SER A 1  762  ? 107.449 59.551  32.912  1.00 105.74 ? 762  SER A CA    1 
ATOM   5886  C  C     . SER A 1  762  ? 106.866 60.839  33.434  1.00 110.15 ? 762  SER A C     1 
ATOM   5887  O  O     . SER A 1  762  ? 106.224 60.804  34.484  1.00 110.31 ? 762  SER A O     1 
ATOM   5888  C  CB    . SER A 1  762  ? 108.963 59.577  33.102  1.00 109.92 ? 762  SER A CB    1 
ATOM   5889  O  OG    . SER A 1  762  ? 109.611 58.649  32.244  1.00 118.30 ? 762  SER A OG    1 
ATOM   5890  N  N     . ALA A 1  763  ? 107.121 61.977  32.712  1.00 106.87 ? 763  ALA A N     1 
ATOM   5891  C  CA    . ALA A 1  763  ? 106.765 63.370  33.056  1.00 108.27 ? 763  ALA A CA    1 
ATOM   5892  C  C     . ALA A 1  763  ? 105.407 63.843  32.569  1.00 110.94 ? 763  ALA A C     1 
ATOM   5893  O  O     . ALA A 1  763  ? 104.500 64.006  33.393  1.00 112.25 ? 763  ALA A O     1 
ATOM   5894  C  CB    . ALA A 1  763  ? 107.845 64.331  32.575  1.00 109.64 ? 763  ALA A CB    1 
ATOM   5895  N  N     . CYS A 1  764  ? 105.276 64.126  31.256  1.00 104.94 ? 764  CYS A N     1 
ATOM   5896  C  CA    . CYS A 1  764  ? 104.020 64.593  30.668  1.00 104.37 ? 764  CYS A CA    1 
ATOM   5897  C  C     . CYS A 1  764  ? 104.043 64.558  29.129  1.00 106.43 ? 764  CYS A C     1 
ATOM   5898  O  O     . CYS A 1  764  ? 105.069 64.859  28.517  1.00 105.40 ? 764  CYS A O     1 
ATOM   5899  C  CB    . CYS A 1  764  ? 103.618 65.960  31.223  1.00 106.86 ? 764  CYS A CB    1 
ATOM   5900  S  SG    . CYS A 1  764  ? 103.499 67.275  29.991  1.00 111.10 ? 764  CYS A SG    1 
ATOM   5901  N  N     . VAL A 1  765  ? 102.899 64.165  28.521  1.00 102.37 ? 765  VAL A N     1 
ATOM   5902  C  CA    . VAL A 1  765  ? 102.682 64.004  27.074  1.00 100.70 ? 765  VAL A CA    1 
ATOM   5903  C  C     . VAL A 1  765  ? 102.827 65.335  26.311  1.00 107.59 ? 765  VAL A C     1 
ATOM   5904  O  O     . VAL A 1  765  ? 103.527 65.388  25.300  1.00 106.03 ? 765  VAL A O     1 
ATOM   5905  C  CB    . VAL A 1  765  ? 101.334 63.286  26.790  1.00 103.05 ? 765  VAL A CB    1 
ATOM   5906  C  CG1   . VAL A 1  765  ? 101.000 63.278  25.302  1.00 101.68 ? 765  VAL A CG1   1 
ATOM   5907  C  CG2   . VAL A 1  765  ? 101.339 61.860  27.344  1.00 101.81 ? 765  VAL A CG2   1 
ATOM   5908  N  N     . GLY A 1  766  ? 102.159 66.375  26.802  1.00 108.09 ? 766  GLY A N     1 
ATOM   5909  C  CA    . GLY A 1  766  ? 102.213 67.716  26.231  1.00 109.92 ? 766  GLY A CA    1 
ATOM   5910  C  C     . GLY A 1  766  ? 101.112 68.064  25.253  1.00 115.40 ? 766  GLY A C     1 
ATOM   5911  O  O     . GLY A 1  766  ? 100.108 67.344  25.147  1.00 114.44 ? 766  GLY A O     1 
ATOM   5912  N  N     . GLN A 1  767  ? 101.314 69.191  24.518  1.00 113.16 ? 767  GLN A N     1 
ATOM   5913  C  CA    . GLN A 1  767  ? 100.365 69.730  23.535  1.00 112.37 ? 767  GLN A CA    1 
ATOM   5914  C  C     . GLN A 1  767  ? 100.067 68.759  22.374  1.00 113.41 ? 767  GLN A C     1 
ATOM   5915  O  O     . GLN A 1  767  ? 100.936 68.005  21.929  1.00 111.24 ? 767  GLN A O     1 
ATOM   5916  C  CB    . GLN A 1  767  ? 100.822 71.114  23.027  1.00 114.70 ? 767  GLN A CB    1 
ATOM   5917  C  CG    . GLN A 1  767  ? 99.771  71.912  22.229  1.00 124.60 ? 767  GLN A CG    1 
ATOM   5918  C  CD    . GLN A 1  767  ? 98.424  72.143  22.907  1.00 144.71 ? 767  GLN A CD    1 
ATOM   5919  O  OE1   . GLN A 1  767  ? 98.276  72.894  23.885  1.00 141.57 ? 767  GLN A OE1   1 
ATOM   5920  N  NE2   . GLN A 1  767  ? 97.388  71.576  22.326  1.00 135.25 ? 767  GLN A NE2   1 
ATOM   5921  N  N     . GLN A 1  768  ? 98.807  68.753  21.945  1.00 109.56 ? 768  GLN A N     1 
ATOM   5922  C  CA    . GLN A 1  768  ? 98.333  67.955  20.831  1.00 108.00 ? 768  GLN A CA    1 
ATOM   5923  C  C     . GLN A 1  768  ? 98.087  68.855  19.643  1.00 114.47 ? 768  GLN A C     1 
ATOM   5924  O  O     . GLN A 1  768  ? 97.679  70.002  19.824  1.00 116.12 ? 768  GLN A O     1 
ATOM   5925  C  CB    . GLN A 1  768  ? 97.060  67.198  21.213  1.00 108.41 ? 768  GLN A CB    1 
ATOM   5926  C  CG    . GLN A 1  768  ? 97.204  65.707  21.012  1.00 107.99 ? 768  GLN A CG    1 
ATOM   5927  C  CD    . GLN A 1  768  ? 98.396  65.188  21.753  1.00 116.34 ? 768  GLN A CD    1 
ATOM   5928  O  OE1   . GLN A 1  768  ? 98.555  65.429  22.955  1.00 112.11 ? 768  GLN A OE1   1 
ATOM   5929  N  NE2   . GLN A 1  768  ? 99.314  64.575  21.020  1.00 103.21 ? 768  GLN A NE2   1 
ATOM   5930  N  N     . SER A 1  769  ? 98.358  68.360  18.430  1.00 111.10 ? 769  SER A N     1 
ATOM   5931  C  CA    . SER A 1  769  ? 98.162  69.165  17.238  1.00 112.59 ? 769  SER A CA    1 
ATOM   5932  C  C     . SER A 1  769  ? 97.576  68.446  16.075  1.00 116.51 ? 769  SER A C     1 
ATOM   5933  O  O     . SER A 1  769  ? 97.946  67.310  15.750  1.00 114.82 ? 769  SER A O     1 
ATOM   5934  C  CB    . SER A 1  769  ? 99.455  69.832  16.794  1.00 118.34 ? 769  SER A CB    1 
ATOM   5935  O  OG    . SER A 1  769  ? 99.266  70.416  15.514  1.00 131.90 ? 769  SER A OG    1 
ATOM   5936  N  N     . VAL A 1  770  ? 96.703  69.180  15.396  1.00 114.75 ? 770  VAL A N     1 
ATOM   5937  C  CA    . VAL A 1  770  ? 96.046  68.788  14.166  1.00 114.58 ? 770  VAL A CA    1 
ATOM   5938  C  C     . VAL A 1  770  ? 96.180  70.008  13.248  1.00 120.38 ? 770  VAL A C     1 
ATOM   5939  O  O     . VAL A 1  770  ? 95.829  71.123  13.656  1.00 121.79 ? 770  VAL A O     1 
ATOM   5940  C  CB    . VAL A 1  770  ? 94.573  68.345  14.372  1.00 118.46 ? 770  VAL A CB    1 
ATOM   5941  C  CG1   . VAL A 1  770  ? 93.983  67.820  13.070  1.00 118.61 ? 770  VAL A CG1   1 
ATOM   5942  C  CG2   . VAL A 1  770  ? 94.457  67.282  15.458  1.00 116.72 ? 770  VAL A CG2   1 
ATOM   5943  N  N     . GLU A 1  771  ? 96.744  69.792  12.033  1.00 116.37 ? 771  GLU A N     1 
ATOM   5944  C  CA    . GLU A 1  771  ? 96.993  70.802  10.987  1.00 117.73 ? 771  GLU A CA    1 
ATOM   5945  C  C     . GLU A 1  771  ? 97.922  71.951  11.475  1.00 119.60 ? 771  GLU A C     1 
ATOM   5946  O  O     . GLU A 1  771  ? 97.838  73.085  10.981  1.00 120.94 ? 771  GLU A O     1 
ATOM   5947  C  CB    . GLU A 1  771  ? 95.670  71.338  10.360  1.00 121.20 ? 771  GLU A CB    1 
ATOM   5948  C  CG    . GLU A 1  771  ? 94.973  70.377  9.393   1.00 135.54 ? 771  GLU A CG    1 
ATOM   5949  C  CD    . GLU A 1  771  ? 93.657  70.816  8.758   1.00 164.72 ? 771  GLU A CD    1 
ATOM   5950  O  OE1   . GLU A 1  771  ? 93.057  71.818  9.215   1.00 155.67 ? 771  GLU A OE1   1 
ATOM   5951  O  OE2   . GLU A 1  771  ? 93.212  70.128  7.809   1.00 162.86 ? 771  GLU A OE2   1 
ATOM   5952  N  N     . GLY A 1  772  ? 98.805  71.625  12.425  1.00 112.67 ? 772  GLY A N     1 
ATOM   5953  C  CA    . GLY A 1  772  ? 99.779  72.559  12.988  1.00 112.37 ? 772  GLY A CA    1 
ATOM   5954  C  C     . GLY A 1  772  ? 99.304  73.334  14.198  1.00 113.37 ? 772  GLY A C     1 
ATOM   5955  O  O     . GLY A 1  772  ? 100.108 73.703  15.062  1.00 111.70 ? 772  GLY A O     1 
ATOM   5956  N  N     . LYS A 1  773  ? 97.992  73.586  14.249  1.00 109.80 ? 773  LYS A N     1 
ATOM   5957  C  CA    . LYS A 1  773  ? 97.337  74.319  15.323  1.00 110.29 ? 773  LYS A CA    1 
ATOM   5958  C  C     . LYS A 1  773  ? 96.850  73.362  16.397  1.00 110.64 ? 773  LYS A C     1 
ATOM   5959  O  O     . LYS A 1  773  ? 96.557  72.193  16.122  1.00 107.10 ? 773  LYS A O     1 
ATOM   5960  C  CB    . LYS A 1  773  ? 96.156  75.167  14.796  1.00 114.54 ? 773  LYS A CB    1 
ATOM   5961  C  CG    . LYS A 1  773  ? 96.511  76.177  13.711  1.00 130.32 ? 773  LYS A CG    1 
ATOM   5962  C  CD    . LYS A 1  773  ? 96.072  75.686  12.333  1.00 142.89 ? 773  LYS A CD    1 
ATOM   5963  C  CE    . LYS A 1  773  ? 96.807  76.375  11.208  1.00 159.23 ? 773  LYS A CE    1 
ATOM   5964  N  NZ    . LYS A 1  773  ? 96.869  75.525  9.987   1.00 167.03 ? 773  LYS A NZ    1 
ATOM   5965  N  N     . ARG A 1  774  ? 96.757  73.881  17.629  1.00 108.04 ? 774  ARG A N     1 
ATOM   5966  C  CA    . ARG A 1  774  ? 96.254  73.153  18.782  1.00 107.09 ? 774  ARG A CA    1 
ATOM   5967  C  C     . ARG A 1  774  ? 94.773  72.876  18.553  1.00 112.44 ? 774  ARG A C     1 
ATOM   5968  O  O     . ARG A 1  774  ? 94.124  73.644  17.844  1.00 113.11 ? 774  ARG A O     1 
ATOM   5969  C  CB    . ARG A 1  774  ? 96.536  73.910  20.092  1.00 107.83 ? 774  ARG A CB    1 
ATOM   5970  C  CG    . ARG A 1  774  ? 96.303  75.419  20.061  1.00 119.89 ? 774  ARG A CG    1 
ATOM   5971  C  CD    . ARG A 1  774  ? 97.085  76.153  21.144  1.00 132.01 ? 774  ARG A CD    1 
ATOM   5972  N  NE    . ARG A 1  774  ? 96.711  75.725  22.495  1.00 142.48 ? 774  ARG A NE    1 
ATOM   5973  C  CZ    . ARG A 1  774  ? 95.942  76.421  23.329  1.00 156.67 ? 774  ARG A CZ    1 
ATOM   5974  N  NH1   . ARG A 1  774  ? 95.457  77.604  22.969  1.00 134.50 ? 774  ARG A NH1   1 
ATOM   5975  N  NH2   . ARG A 1  774  ? 95.652  75.938  24.530  1.00 149.22 ? 774  ARG A NH2   1 
ATOM   5976  N  N     . ILE A 1  775  ? 94.267  71.737  19.061  1.00 109.38 ? 775  ILE A N     1 
ATOM   5977  C  CA    . ILE A 1  775  ? 92.888  71.272  18.861  1.00 109.98 ? 775  ILE A CA    1 
ATOM   5978  C  C     . ILE A 1  775  ? 91.942  72.446  18.825  1.00 118.37 ? 775  ILE A C     1 
ATOM   5979  O  O     . ILE A 1  775  ? 91.863  73.178  19.807  1.00 119.30 ? 775  ILE A O     1 
ATOM   5980  C  CB    . ILE A 1  775  ? 92.425  70.200  19.891  1.00 111.89 ? 775  ILE A CB    1 
ATOM   5981  C  CG1   . ILE A 1  775  ? 93.523  69.138  20.234  1.00 110.11 ? 775  ILE A CG1   1 
ATOM   5982  C  CG2   . ILE A 1  775  ? 91.130  69.547  19.425  1.00 112.41 ? 775  ILE A CG2   1 
ATOM   5983  C  CD1   . ILE A 1  775  ? 94.136  68.300  19.089  1.00 112.77 ? 775  ILE A CD1   1 
ATOM   5984  N  N     . ALA A 1  776  ? 91.286  72.677  17.683  1.00 117.48 ? 776  ALA A N     1 
ATOM   5985  C  CA    . ALA A 1  776  ? 90.396  73.834  17.575  1.00 120.64 ? 776  ALA A CA    1 
ATOM   5986  C  C     . ALA A 1  776  ? 88.932  73.525  17.839  1.00 125.57 ? 776  ALA A C     1 
ATOM   5987  O  O     . ALA A 1  776  ? 88.569  72.365  18.031  1.00 123.55 ? 776  ALA A O     1 
ATOM   5988  C  CB    . ALA A 1  776  ? 90.568  74.525  16.234  1.00 122.77 ? 776  ALA A CB    1 
ATOM   5989  N  N     . PHE A 1  777  ? 88.099  74.582  17.865  1.00 124.90 ? 777  PHE A N     1 
ATOM   5990  C  CA    . PHE A 1  777  ? 86.672  74.494  18.136  1.00 125.95 ? 777  PHE A CA    1 
ATOM   5991  C  C     . PHE A 1  777  ? 85.883  73.901  16.964  1.00 128.37 ? 777  PHE A C     1 
ATOM   5992  O  O     . PHE A 1  777  ? 85.521  74.629  16.040  1.00 129.27 ? 777  PHE A O     1 
ATOM   5993  C  CB    . PHE A 1  777  ? 86.112  75.873  18.549  1.00 130.81 ? 777  PHE A CB    1 
ATOM   5994  C  CG    . PHE A 1  777  ? 86.884  76.647  19.601  1.00 134.14 ? 777  PHE A CG    1 
ATOM   5995  C  CD1   . PHE A 1  777  ? 87.334  76.024  20.761  1.00 136.42 ? 777  PHE A CD1   1 
ATOM   5996  C  CD2   . PHE A 1  777  ? 87.138  78.002  19.443  1.00 139.80 ? 777  PHE A CD2   1 
ATOM   5997  C  CE1   . PHE A 1  777  ? 88.012  76.748  21.750  1.00 140.38 ? 777  PHE A CE1   1 
ATOM   5998  C  CE2   . PHE A 1  777  ? 87.809  78.726  20.437  1.00 141.97 ? 777  PHE A CE2   1 
ATOM   5999  C  CZ    . PHE A 1  777  ? 88.249  78.092  21.578  1.00 140.23 ? 777  PHE A CZ    1 
ATOM   6000  N  N     . GLY A 1  778  ? 85.631  72.588  17.023  1.00 122.64 ? 778  GLY A N     1 
ATOM   6001  C  CA    . GLY A 1  778  ? 84.831  71.846  16.044  1.00 121.80 ? 778  GLY A CA    1 
ATOM   6002  C  C     . GLY A 1  778  ? 83.363  72.132  16.273  1.00 125.73 ? 778  GLY A C     1 
ATOM   6003  O  O     . GLY A 1  778  ? 82.563  72.203  15.335  1.00 125.76 ? 778  GLY A O     1 
ATOM   6004  N  N     . PHE A 1  779  ? 83.024  72.321  17.550  1.00 122.33 ? 779  PHE A N     1 
ATOM   6005  C  CA    . PHE A 1  779  ? 81.731  72.780  18.009  1.00 124.10 ? 779  PHE A CA    1 
ATOM   6006  C  C     . PHE A 1  779  ? 81.888  74.300  18.007  1.00 130.05 ? 779  PHE A C     1 
ATOM   6007  O  O     . PHE A 1  779  ? 82.989  74.807  17.766  1.00 129.96 ? 779  PHE A O     1 
ATOM   6008  C  CB    . PHE A 1  779  ? 81.453  72.296  19.443  1.00 125.85 ? 779  PHE A CB    1 
ATOM   6009  C  CG    . PHE A 1  779  ? 81.155  70.825  19.603  1.00 126.30 ? 779  PHE A CG    1 
ATOM   6010  C  CD1   . PHE A 1  779  ? 79.849  70.352  19.539  1.00 129.00 ? 779  PHE A CD1   1 
ATOM   6011  C  CD2   . PHE A 1  779  ? 82.176  69.916  19.868  1.00 127.42 ? 779  PHE A CD2   1 
ATOM   6012  C  CE1   . PHE A 1  779  ? 79.573  68.996  19.710  1.00 130.61 ? 779  PHE A CE1   1 
ATOM   6013  C  CE2   . PHE A 1  779  ? 81.898  68.560  20.042  1.00 126.91 ? 779  PHE A CE2   1 
ATOM   6014  C  CZ    . PHE A 1  779  ? 80.599  68.112  19.965  1.00 126.86 ? 779  PHE A CZ    1 
ATOM   6015  N  N     . VAL A 1  780  ? 80.824  75.028  18.311  1.00 127.56 ? 780  VAL A N     1 
ATOM   6016  C  CA    . VAL A 1  780  ? 80.868  76.482  18.331  1.00 128.44 ? 780  VAL A CA    1 
ATOM   6017  C  C     . VAL A 1  780  ? 81.634  77.034  19.552  1.00 130.60 ? 780  VAL A C     1 
ATOM   6018  O  O     . VAL A 1  780  ? 81.178  76.873  20.682  1.00 130.48 ? 780  VAL A O     1 
ATOM   6019  C  CB    . VAL A 1  780  ? 79.444  77.050  18.204  1.00 134.70 ? 780  VAL A CB    1 
ATOM   6020  C  CG1   . VAL A 1  780  ? 79.467  78.574  18.164  1.00 137.07 ? 780  VAL A CG1   1 
ATOM   6021  C  CG2   . VAL A 1  780  ? 78.745  76.492  16.969  1.00 134.58 ? 780  VAL A CG2   1 
ATOM   6022  N  N     . ASP A 1  781  ? 82.809  77.662  19.308  1.00 125.99 ? 781  ASP A N     1 
ATOM   6023  C  CA    . ASP A 1  781  ? 83.698  78.322  20.288  1.00 125.90 ? 781  ASP A CA    1 
ATOM   6024  C  C     . ASP A 1  781  ? 84.127  77.437  21.511  1.00 124.94 ? 781  ASP A C     1 
ATOM   6025  O  O     . ASP A 1  781  ? 84.637  77.939  22.520  1.00 123.99 ? 781  ASP A O     1 
ATOM   6026  C  CB    . ASP A 1  781  ? 83.093  79.671  20.753  1.00 131.31 ? 781  ASP A CB    1 
ATOM   6027  C  CG    . ASP A 1  781  ? 83.041  80.777  19.693  1.00 149.39 ? 781  ASP A CG    1 
ATOM   6028  O  OD1   . ASP A 1  781  ? 83.370  80.493  18.514  1.00 149.91 ? 781  ASP A OD1   1 
ATOM   6029  O  OD2   . ASP A 1  781  ? 82.653  81.927  20.043  1.00 159.77 ? 781  ASP A OD2   1 
ATOM   6030  N  N     . ARG A 1  782  ? 83.989  76.123  21.373  1.00 118.79 ? 782  ARG A N     1 
ATOM   6031  C  CA    . ARG A 1  782  ? 84.383  75.163  22.400  1.00 117.07 ? 782  ARG A CA    1 
ATOM   6032  C  C     . ARG A 1  782  ? 84.862  73.866  21.733  1.00 117.62 ? 782  ARG A C     1 
ATOM   6033  O  O     . ARG A 1  782  ? 84.320  73.476  20.697  1.00 116.30 ? 782  ARG A O     1 
ATOM   6034  C  CB    . ARG A 1  782  ? 83.252  74.935  23.417  1.00 118.95 ? 782  ARG A CB    1 
ATOM   6035  C  CG    . ARG A 1  782  ? 81.975  74.317  22.839  1.00 127.52 ? 782  ARG A CG    1 
ATOM   6036  C  CD    . ARG A 1  782  ? 80.743  75.015  23.356  1.00 129.82 ? 782  ARG A CD    1 
ATOM   6037  N  NE    . ARG A 1  782  ? 79.549  74.210  23.134  1.00 126.05 ? 782  ARG A NE    1 
ATOM   6038  C  CZ    . ARG A 1  782  ? 78.980  73.459  24.068  1.00 131.74 ? 782  ARG A CZ    1 
ATOM   6039  N  NH1   . ARG A 1  782  ? 79.481  73.422  25.299  1.00 111.76 ? 782  ARG A NH1   1 
ATOM   6040  N  NH2   . ARG A 1  782  ? 77.894  72.753  23.786  1.00 115.69 ? 782  ARG A NH2   1 
ATOM   6041  N  N     . THR A 1  783  ? 85.917  73.249  22.278  1.00 112.73 ? 783  THR A N     1 
ATOM   6042  C  CA    . THR A 1  783  ? 86.490  72.020  21.714  1.00 110.82 ? 783  THR A CA    1 
ATOM   6043  C  C     . THR A 1  783  ? 85.615  70.783  21.906  1.00 114.73 ? 783  THR A C     1 
ATOM   6044  O  O     . THR A 1  783  ? 85.655  69.856  21.092  1.00 112.86 ? 783  THR A O     1 
ATOM   6045  C  CB    . THR A 1  783  ? 87.885  71.783  22.251  1.00 117.83 ? 783  THR A CB    1 
ATOM   6046  O  OG1   . THR A 1  783  ? 87.935  72.194  23.617  1.00 118.81 ? 783  THR A OG1   1 
ATOM   6047  C  CG2   . THR A 1  783  ? 88.939  72.491  21.438  1.00 116.61 ? 783  THR A CG2   1 
ATOM   6048  N  N     . LEU A 1  784  ? 84.855  70.755  23.003  1.00 112.60 ? 784  LEU A N     1 
ATOM   6049  C  CA    . LEU A 1  784  ? 83.961  69.656  23.361  1.00 112.21 ? 784  LEU A CA    1 
ATOM   6050  C  C     . LEU A 1  784  ? 82.753  70.221  24.109  1.00 119.26 ? 784  LEU A C     1 
ATOM   6051  O  O     . LEU A 1  784  ? 82.860  71.329  24.633  1.00 120.18 ? 784  LEU A O     1 
ATOM   6052  C  CB    . LEU A 1  784  ? 84.702  68.657  24.264  1.00 110.74 ? 784  LEU A CB    1 
ATOM   6053  C  CG    . LEU A 1  784  ? 85.764  67.784  23.621  1.00 112.60 ? 784  LEU A CG    1 
ATOM   6054  C  CD1   . LEU A 1  784  ? 86.543  67.035  24.683  1.00 111.74 ? 784  LEU A CD1   1 
ATOM   6055  C  CD2   . LEU A 1  784  ? 85.153  66.845  22.583  1.00 113.36 ? 784  LEU A CD2   1 
ATOM   6056  N  N     . PRO A 1  785  ? 81.618  69.492  24.235  1.00 117.30 ? 785  PRO A N     1 
ATOM   6057  C  CA    . PRO A 1  785  ? 80.465  70.055  24.971  1.00 119.79 ? 785  PRO A CA    1 
ATOM   6058  C  C     . PRO A 1  785  ? 80.629  70.102  26.501  1.00 125.07 ? 785  PRO A C     1 
ATOM   6059  O  O     . PRO A 1  785  ? 79.692  70.469  27.219  1.00 127.05 ? 785  PRO A O     1 
ATOM   6060  C  CB    . PRO A 1  785  ? 79.293  69.176  24.523  1.00 121.84 ? 785  PRO A CB    1 
ATOM   6061  C  CG    . PRO A 1  785  ? 79.909  67.896  24.165  1.00 124.15 ? 785  PRO A CG    1 
ATOM   6062  C  CD    . PRO A 1  785  ? 81.300  68.164  23.674  1.00 117.85 ? 785  PRO A CD    1 
ATOM   6063  N  N     . HIS A 1  786  ? 81.838  69.786  26.989  1.00 119.66 ? 786  HIS A N     1 
ATOM   6064  C  CA    . HIS A 1  786  ? 82.199  69.788  28.403  1.00 119.61 ? 786  HIS A CA    1 
ATOM   6065  C  C     . HIS A 1  786  ? 82.902  71.076  28.779  1.00 124.32 ? 786  HIS A C     1 
ATOM   6066  O  O     . HIS A 1  786  ? 83.470  71.168  29.865  1.00 124.34 ? 786  HIS A O     1 
ATOM   6067  C  CB    . HIS A 1  786  ? 83.111  68.601  28.695  1.00 118.34 ? 786  HIS A CB    1 
ATOM   6068  C  CG    . HIS A 1  786  ? 82.583  67.320  28.155  1.00 120.58 ? 786  HIS A CG    1 
ATOM   6069  N  ND1   . HIS A 1  786  ? 82.604  67.051  26.805  1.00 121.04 ? 786  HIS A ND1   1 
ATOM   6070  C  CD2   . HIS A 1  786  ? 82.021  66.276  28.804  1.00 122.75 ? 786  HIS A CD2   1 
ATOM   6071  C  CE1   . HIS A 1  786  ? 82.061  65.856  26.674  1.00 120.17 ? 786  HIS A CE1   1 
ATOM   6072  N  NE2   . HIS A 1  786  ? 81.703  65.347  27.852  1.00 121.41 ? 786  HIS A NE2   1 
ATOM   6073  N  N     . PHE A 1  787  ? 82.870  72.069  27.884  1.00 121.69 ? 787  PHE A N     1 
ATOM   6074  C  CA    . PHE A 1  787  ? 83.513  73.365  28.080  1.00 122.73 ? 787  PHE A CA    1 
ATOM   6075  C  C     . PHE A 1  787  ? 82.555  74.502  27.778  1.00 126.94 ? 787  PHE A C     1 
ATOM   6076  O  O     . PHE A 1  787  ? 81.625  74.355  26.972  1.00 125.09 ? 787  PHE A O     1 
ATOM   6077  C  CB    . PHE A 1  787  ? 84.744  73.513  27.152  1.00 123.33 ? 787  PHE A CB    1 
ATOM   6078  C  CG    . PHE A 1  787  ? 85.855  72.501  27.308  1.00 123.02 ? 787  PHE A CG    1 
ATOM   6079  C  CD1   . PHE A 1  787  ? 85.776  71.256  26.696  1.00 124.28 ? 787  PHE A CD1   1 
ATOM   6080  C  CD2   . PHE A 1  787  ? 87.018  72.824  27.996  1.00 125.24 ? 787  PHE A CD2   1 
ATOM   6081  C  CE1   . PHE A 1  787  ? 86.814  70.333  26.821  1.00 123.55 ? 787  PHE A CE1   1 
ATOM   6082  C  CE2   . PHE A 1  787  ? 88.051  71.895  28.132  1.00 126.15 ? 787  PHE A CE2   1 
ATOM   6083  C  CZ    . PHE A 1  787  ? 87.951  70.666  27.526  1.00 122.56 ? 787  PHE A CZ    1 
ATOM   6084  N  N     . SER A 1  788  ? 82.813  75.656  28.396  1.00 125.95 ? 788  SER A N     1 
ATOM   6085  C  CA    . SER A 1  788  ? 82.037  76.842  28.094  1.00 128.60 ? 788  SER A CA    1 
ATOM   6086  C  C     . SER A 1  788  ? 82.720  77.450  26.882  1.00 133.45 ? 788  SER A C     1 
ATOM   6087  O  O     . SER A 1  788  ? 83.868  77.107  26.581  1.00 131.84 ? 788  SER A O     1 
ATOM   6088  C  CB    . SER A 1  788  ? 82.013  77.818  29.270  1.00 134.95 ? 788  SER A CB    1 
ATOM   6089  O  OG    . SER A 1  788  ? 80.686  78.180  29.637  1.00 144.69 ? 788  SER A OG    1 
ATOM   6090  N  N     . LYS A 1  789  ? 82.003  78.303  26.157  1.00 132.37 ? 789  LYS A N     1 
ATOM   6091  C  CA    . LYS A 1  789  ? 82.520  78.954  24.964  1.00 132.57 ? 789  LYS A CA    1 
ATOM   6092  C  C     . LYS A 1  789  ? 83.661  79.924  25.312  1.00 138.01 ? 789  LYS A C     1 
ATOM   6093  O  O     . LYS A 1  789  ? 83.843  80.293  26.478  1.00 137.79 ? 789  LYS A O     1 
ATOM   6094  C  CB    . LYS A 1  789  ? 81.382  79.663  24.195  1.00 136.80 ? 789  LYS A CB    1 
ATOM   6095  C  CG    . LYS A 1  789  ? 80.431  78.718  23.451  1.00 149.49 ? 789  LYS A CG    1 
ATOM   6096  C  CD    . LYS A 1  789  ? 79.178  79.434  22.931  1.00 162.71 ? 789  LYS A CD    1 
ATOM   6097  C  CE    . LYS A 1  789  ? 78.201  78.497  22.253  1.00 172.46 ? 789  LYS A CE    1 
ATOM   6098  N  NZ    . LYS A 1  789  ? 76.951  79.198  21.848  1.00 182.56 ? 789  LYS A NZ    1 
ATOM   6099  N  N     . ASP A 1  790  ? 84.457  80.276  24.287  1.00 135.74 ? 790  ASP A N     1 
ATOM   6100  C  CA    . ASP A 1  790  ? 85.580  81.212  24.316  1.00 136.96 ? 790  ASP A CA    1 
ATOM   6101  C  C     . ASP A 1  790  ? 86.588  80.892  25.461  1.00 141.32 ? 790  ASP A C     1 
ATOM   6102  O  O     . ASP A 1  790  ? 87.019  81.773  26.221  1.00 141.98 ? 790  ASP A O     1 
ATOM   6103  C  CB    . ASP A 1  790  ? 85.067  82.672  24.315  1.00 141.71 ? 790  ASP A CB    1 
ATOM   6104  C  CG    . ASP A 1  790  ? 84.198  83.017  23.099  1.00 152.94 ? 790  ASP A CG    1 
ATOM   6105  O  OD1   . ASP A 1  790  ? 84.725  82.986  21.958  1.00 158.29 ? 790  ASP A OD1   1 
ATOM   6106  O  OD2   . ASP A 1  790  ? 82.984  83.296  23.289  1.00 154.45 ? 790  ASP A OD2   1 
ATOM   6107  N  N     . ASP A 1  791  ? 86.956  79.590  25.541  1.00 136.97 ? 791  ASP A N     1 
ATOM   6108  C  CA    . ASP A 1  791  ? 87.938  79.008  26.463  1.00 136.44 ? 791  ASP A CA    1 
ATOM   6109  C  C     . ASP A 1  791  ? 89.170  78.646  25.615  1.00 140.22 ? 791  ASP A C     1 
ATOM   6110  O  O     . ASP A 1  791  ? 89.090  77.744  24.772  1.00 138.54 ? 791  ASP A O     1 
ATOM   6111  C  CB    . ASP A 1  791  ? 87.357  77.753  27.158  1.00 136.72 ? 791  ASP A CB    1 
ATOM   6112  C  CG    . ASP A 1  791  ? 88.216  77.121  28.248  1.00 139.62 ? 791  ASP A CG    1 
ATOM   6113  O  OD1   . ASP A 1  791  ? 89.066  77.831  28.829  1.00 140.49 ? 791  ASP A OD1   1 
ATOM   6114  O  OD2   . ASP A 1  791  ? 87.981  75.940  28.573  1.00 140.58 ? 791  ASP A OD2   1 
ATOM   6115  N  N     . TYR A 1  792  ? 90.284  79.392  25.802  1.00 137.62 ? 792  TYR A N     1 
ATOM   6116  C  CA    . TYR A 1  792  ? 91.526  79.235  25.034  1.00 136.20 ? 792  TYR A CA    1 
ATOM   6117  C  C     . TYR A 1  792  ? 92.660  78.559  25.831  1.00 138.50 ? 792  TYR A C     1 
ATOM   6118  O  O     . TYR A 1  792  ? 93.761  78.340  25.308  1.00 136.65 ? 792  TYR A O     1 
ATOM   6119  C  CB    . TYR A 1  792  ? 91.945  80.603  24.465  1.00 139.54 ? 792  TYR A CB    1 
ATOM   6120  C  CG    . TYR A 1  792  ? 91.123  81.026  23.263  1.00 142.55 ? 792  TYR A CG    1 
ATOM   6121  C  CD1   . TYR A 1  792  ? 89.770  81.335  23.389  1.00 145.84 ? 792  TYR A CD1   1 
ATOM   6122  C  CD2   . TYR A 1  792  ? 91.700  81.129  22.000  1.00 143.26 ? 792  TYR A CD2   1 
ATOM   6123  C  CE1   . TYR A 1  792  ? 89.001  81.696  22.280  1.00 147.65 ? 792  TYR A CE1   1 
ATOM   6124  C  CE2   . TYR A 1  792  ? 90.947  81.512  20.887  1.00 145.10 ? 792  TYR A CE2   1 
ATOM   6125  C  CZ    . TYR A 1  792  ? 89.595  81.793  21.032  1.00 153.84 ? 792  TYR A CZ    1 
ATOM   6126  O  OH    . TYR A 1  792  ? 88.837  82.166  19.945  1.00 155.07 ? 792  TYR A OH    1 
ATOM   6127  N  N     . SER A 1  793  ? 92.336  78.174  27.079  1.00 135.44 ? 793  SER A N     1 
ATOM   6128  C  CA    . SER A 1  793  ? 93.178  77.538  28.097  1.00 134.58 ? 793  SER A CA    1 
ATOM   6129  C  C     . SER A 1  793  ? 93.886  76.270  27.636  1.00 134.47 ? 793  SER A C     1 
ATOM   6130  O  O     . SER A 1  793  ? 93.321  75.571  26.791  1.00 133.00 ? 793  SER A O     1 
ATOM   6131  C  CB    . SER A 1  793  ? 92.330  77.208  29.324  1.00 139.36 ? 793  SER A CB    1 
ATOM   6132  O  OG    . SER A 1  793  ? 91.356  76.214  29.048  1.00 145.40 ? 793  SER A OG    1 
ATOM   6133  N  N     . PRO A 1  794  ? 95.065  75.913  28.236  1.00 129.21 ? 794  PRO A N     1 
ATOM   6134  C  CA    . PRO A 1  794  ? 95.754  74.658  27.850  1.00 126.26 ? 794  PRO A CA    1 
ATOM   6135  C  C     . PRO A 1  794  ? 94.840  73.425  27.719  1.00 126.84 ? 794  PRO A C     1 
ATOM   6136  O  O     . PRO A 1  794  ? 94.847  72.779  26.671  1.00 123.64 ? 794  PRO A O     1 
ATOM   6137  C  CB    . PRO A 1  794  ? 96.797  74.480  28.960  1.00 128.47 ? 794  PRO A CB    1 
ATOM   6138  C  CG    . PRO A 1  794  ? 97.094  75.847  29.422  1.00 135.20 ? 794  PRO A CG    1 
ATOM   6139  C  CD    . PRO A 1  794  ? 95.840  76.652  29.259  1.00 132.19 ? 794  PRO A CD    1 
ATOM   6140  N  N     . GLU A 1  795  ? 94.012  73.161  28.761  1.00 124.14 ? 795  GLU A N     1 
ATOM   6141  C  CA    . GLU A 1  795  ? 93.038  72.068  28.878  1.00 123.01 ? 795  GLU A CA    1 
ATOM   6142  C  C     . GLU A 1  795  ? 92.064  72.057  27.723  1.00 126.93 ? 795  GLU A C     1 
ATOM   6143  O  O     . GLU A 1  795  ? 91.824  70.995  27.159  1.00 125.83 ? 795  GLU A O     1 
ATOM   6144  C  CB    . GLU A 1  795  ? 92.214  72.142  30.188  1.00 126.20 ? 795  GLU A CB    1 
ATOM   6145  C  CG    . GLU A 1  795  ? 92.896  72.778  31.388  1.00 142.52 ? 795  GLU A CG    1 
ATOM   6146  C  CD    . GLU A 1  795  ? 92.883  74.297  31.405  1.00 175.33 ? 795  GLU A CD    1 
ATOM   6147  O  OE1   . GLU A 1  795  ? 91.784  74.886  31.519  1.00 182.35 ? 795  GLU A OE1   1 
ATOM   6148  O  OE2   . GLU A 1  795  ? 93.978  74.897  31.314  1.00 168.92 ? 795  GLU A OE2   1 
ATOM   6149  N  N     . SER A 1  796  ? 91.486  73.221  27.382  1.00 124.95 ? 796  SER A N     1 
ATOM   6150  C  CA    . SER A 1  796  ? 90.506  73.338  26.303  1.00 124.91 ? 796  SER A CA    1 
ATOM   6151  C  C     . SER A 1  796  ? 91.035  72.917  24.942  1.00 126.89 ? 796  SER A C     1 
ATOM   6152  O  O     . SER A 1  796  ? 90.526  71.949  24.376  1.00 125.74 ? 796  SER A O     1 
ATOM   6153  C  CB    . SER A 1  796  ? 89.918  74.746  26.235  1.00 131.39 ? 796  SER A CB    1 
ATOM   6154  O  OG    . SER A 1  796  ? 88.729  74.785  25.458  1.00 141.04 ? 796  SER A OG    1 
ATOM   6155  N  N     . LYS A 1  797  ? 92.080  73.600  24.439  1.00 122.13 ? 797  LYS A N     1 
ATOM   6156  C  CA    . LYS A 1  797  ? 92.624  73.349  23.105  1.00 119.77 ? 797  LYS A CA    1 
ATOM   6157  C  C     . LYS A 1  797  ? 93.731  72.252  23.059  1.00 119.55 ? 797  LYS A C     1 
ATOM   6158  O  O     . LYS A 1  797  ? 94.730  72.386  22.350  1.00 117.37 ? 797  LYS A O     1 
ATOM   6159  C  CB    . LYS A 1  797  ? 93.070  74.673  22.462  1.00 123.35 ? 797  LYS A CB    1 
ATOM   6160  C  CG    . LYS A 1  797  ? 91.908  75.638  22.189  1.00 124.01 ? 797  LYS A CG    1 
ATOM   6161  C  CD    . LYS A 1  797  ? 92.362  76.902  21.477  1.00 126.80 ? 797  LYS A CD    1 
ATOM   6162  C  CE    . LYS A 1  797  ? 91.620  77.109  20.180  1.00 127.64 ? 797  LYS A CE    1 
ATOM   6163  N  NZ    . LYS A 1  797  ? 92.243  76.359  19.061  1.00 129.00 ? 797  LYS A NZ    1 
ATOM   6164  N  N     . GLY A 1  798  ? 93.481  71.164  23.790  1.00 115.13 ? 798  GLY A N     1 
ATOM   6165  C  CA    . GLY A 1  798  ? 94.277  69.939  23.837  1.00 112.97 ? 798  GLY A CA    1 
ATOM   6166  C  C     . GLY A 1  798  ? 95.667  69.860  24.454  1.00 116.04 ? 798  GLY A C     1 
ATOM   6167  O  O     . GLY A 1  798  ? 96.568  69.292  23.823  1.00 114.62 ? 798  GLY A O     1 
ATOM   6168  N  N     . PHE A 1  799  ? 95.863  70.333  25.704  1.00 112.37 ? 799  PHE A N     1 
ATOM   6169  C  CA    . PHE A 1  799  ? 97.173  70.164  26.347  1.00 110.65 ? 799  PHE A CA    1 
ATOM   6170  C  C     . PHE A 1  799  ? 97.105  69.022  27.349  1.00 111.38 ? 799  PHE A C     1 
ATOM   6171  O  O     . PHE A 1  799  ? 96.274  69.036  28.271  1.00 111.23 ? 799  PHE A O     1 
ATOM   6172  C  CB    . PHE A 1  799  ? 97.756  71.463  26.949  1.00 114.19 ? 799  PHE A CB    1 
ATOM   6173  C  CG    . PHE A 1  799  ? 99.039  71.267  27.729  1.00 115.43 ? 799  PHE A CG    1 
ATOM   6174  C  CD1   . PHE A 1  799  ? 100.239 71.013  27.076  1.00 117.56 ? 799  PHE A CD1   1 
ATOM   6175  C  CD2   . PHE A 1  799  ? 99.043  71.324  29.115  1.00 118.25 ? 799  PHE A CD2   1 
ATOM   6176  C  CE1   . PHE A 1  799  ? 101.419 70.816  27.797  1.00 118.56 ? 799  PHE A CE1   1 
ATOM   6177  C  CE2   . PHE A 1  799  ? 100.223 71.129  29.835  1.00 121.22 ? 799  PHE A CE2   1 
ATOM   6178  C  CZ    . PHE A 1  799  ? 101.401 70.877  29.172  1.00 118.55 ? 799  PHE A CZ    1 
ATOM   6179  N  N     . VAL A 1  800  ? 97.950  68.005  27.120  1.00 105.38 ? 800  VAL A N     1 
ATOM   6180  C  CA    . VAL A 1  800  ? 98.005  66.812  27.958  1.00 104.10 ? 800  VAL A CA    1 
ATOM   6181  C  C     . VAL A 1  800  ? 99.027  67.010  29.086  1.00 110.84 ? 800  VAL A C     1 
ATOM   6182  O  O     . VAL A 1  800  ? 100.203 66.684  28.931  1.00 110.72 ? 800  VAL A O     1 
ATOM   6183  C  CB    . VAL A 1  800  ? 98.195  65.490  27.158  1.00 104.32 ? 800  VAL A CB    1 
ATOM   6184  C  CG1   . VAL A 1  800  ? 98.080  64.289  28.077  1.00 103.54 ? 800  VAL A CG1   1 
ATOM   6185  C  CG2   . VAL A 1  800  ? 97.185  65.375  26.022  1.00 103.02 ? 800  VAL A CG2   1 
ATOM   6186  N  N     . GLU A 1  801  ? 98.554  67.560  30.220  1.00 109.34 ? 801  GLU A N     1 
ATOM   6187  C  CA    . GLU A 1  801  ? 99.313  67.845  31.446  1.00 110.72 ? 801  GLU A CA    1 
ATOM   6188  C  C     . GLU A 1  801  ? 99.898  66.560  32.072  1.00 111.58 ? 801  GLU A C     1 
ATOM   6189  O  O     . GLU A 1  801  ? 100.867 66.615  32.839  1.00 112.29 ? 801  GLU A O     1 
ATOM   6190  C  CB    . GLU A 1  801  ? 98.375  68.561  32.448  1.00 114.75 ? 801  GLU A CB    1 
ATOM   6191  C  CG    . GLU A 1  801  ? 99.004  68.961  33.776  1.00 134.41 ? 801  GLU A CG    1 
ATOM   6192  C  CD    . GLU A 1  801  ? 98.435  70.177  34.489  1.00 180.92 ? 801  GLU A CD    1 
ATOM   6193  O  OE1   . GLU A 1  801  ? 97.240  70.491  34.278  1.00 183.40 ? 801  GLU A OE1   1 
ATOM   6194  O  OE2   . GLU A 1  801  ? 99.175  70.797  35.289  1.00 188.97 ? 801  GLU A OE2   1 
ATOM   6195  N  N     . ASN A 1  802  ? 99.306  65.416  31.726  1.00 104.48 ? 802  ASN A N     1 
ATOM   6196  C  CA    . ASN A 1  802  ? 99.653  64.117  32.265  1.00 102.95 ? 802  ASN A CA    1 
ATOM   6197  C  C     . ASN A 1  802  ? 100.661 63.292  31.468  1.00 103.14 ? 802  ASN A C     1 
ATOM   6198  O  O     . ASN A 1  802  ? 100.782 63.443  30.250  1.00 100.83 ? 802  ASN A O     1 
ATOM   6199  C  CB    . ASN A 1  802  ? 98.375  63.304  32.430  1.00 103.80 ? 802  ASN A CB    1 
ATOM   6200  C  CG    . ASN A 1  802  ? 97.501  63.754  33.551  1.00 129.71 ? 802  ASN A CG    1 
ATOM   6201  O  OD1   . ASN A 1  802  ? 97.857  63.645  34.726  1.00 130.41 ? 802  ASN A OD1   1 
ATOM   6202  N  ND2   . ASN A 1  802  ? 96.319  64.224  33.214  1.00 122.11 ? 802  ASN A ND2   1 
ATOM   6203  N  N     . SER A 1  803  ? 101.342 62.374  32.188  1.00 98.77  ? 803  SER A N     1 
ATOM   6204  C  CA    . SER A 1  803  ? 102.254 61.362  31.668  1.00 96.31  ? 803  SER A CA    1 
ATOM   6205  C  C     . SER A 1  803  ? 101.422 60.127  31.347  1.00 99.05  ? 803  SER A C     1 
ATOM   6206  O  O     . SER A 1  803  ? 100.290 60.007  31.828  1.00 98.52  ? 803  SER A O     1 
ATOM   6207  C  CB    . SER A 1  803  ? 103.338 61.009  32.689  1.00 99.48  ? 803  SER A CB    1 
ATOM   6208  O  OG    . SER A 1  803  ? 102.927 61.075  34.046  1.00 107.44 ? 803  SER A OG    1 
ATOM   6209  N  N     . TYR A 1  804  ? 101.976 59.207  30.535  1.00 95.04  ? 804  TYR A N     1 
ATOM   6210  C  CA    . TYR A 1  804  ? 101.289 57.962  30.190  1.00 93.82  ? 804  TYR A CA    1 
ATOM   6211  C  C     . TYR A 1  804  ? 101.170 57.065  31.426  1.00 98.04  ? 804  TYR A C     1 
ATOM   6212  O  O     . TYR A 1  804  ? 100.145 56.401  31.598  1.00 97.99  ? 804  TYR A O     1 
ATOM   6213  C  CB    . TYR A 1  804  ? 101.990 57.218  29.043  1.00 93.10  ? 804  TYR A CB    1 
ATOM   6214  C  CG    . TYR A 1  804  ? 101.827 57.832  27.669  1.00 94.22  ? 804  TYR A CG    1 
ATOM   6215  C  CD1   . TYR A 1  804  ? 100.571 57.964  27.084  1.00 94.80  ? 804  TYR A CD1   1 
ATOM   6216  C  CD2   . TYR A 1  804  ? 102.935 58.200  26.916  1.00 95.97  ? 804  TYR A CD2   1 
ATOM   6217  C  CE1   . TYR A 1  804  ? 100.419 58.516  25.812  1.00 95.10  ? 804  TYR A CE1   1 
ATOM   6218  C  CE2   . TYR A 1  804  ? 102.797 58.735  25.637  1.00 96.85  ? 804  TYR A CE2   1 
ATOM   6219  C  CZ    . TYR A 1  804  ? 101.537 58.894  25.088  1.00 102.76 ? 804  TYR A CZ    1 
ATOM   6220  O  OH    . TYR A 1  804  ? 101.413 59.418  23.823  1.00 103.17 ? 804  TYR A OH    1 
ATOM   6221  N  N     . LEU A 1  805  ? 102.202 57.081  32.301  1.00 94.43  ? 805  LEU A N     1 
ATOM   6222  C  CA    . LEU A 1  805  ? 102.237 56.317  33.551  1.00 95.06  ? 805  LEU A CA    1 
ATOM   6223  C  C     . LEU A 1  805  ? 101.108 56.782  34.467  1.00 101.88 ? 805  LEU A C     1 
ATOM   6224  O  O     . LEU A 1  805  ? 100.434 55.952  35.082  1.00 101.93 ? 805  LEU A O     1 
ATOM   6225  C  CB    . LEU A 1  805  ? 103.609 56.483  34.243  1.00 95.64  ? 805  LEU A CB    1 
ATOM   6226  C  CG    . LEU A 1  805  ? 103.729 56.065  35.718  1.00 101.67 ? 805  LEU A CG    1 
ATOM   6227  C  CD1   . LEU A 1  805  ? 103.982 54.573  35.848  1.00 100.91 ? 805  LEU A CD1   1 
ATOM   6228  C  CD2   . LEU A 1  805  ? 104.804 56.896  36.448  1.00 105.93 ? 805  LEU A CD2   1 
ATOM   6229  N  N     . ARG A 1  806  ? 100.897 58.109  34.544  1.00 100.63 ? 806  ARG A N     1 
ATOM   6230  C  CA    . ARG A 1  806  ? 99.860  58.698  35.381  1.00 102.93 ? 806  ARG A CA    1 
ATOM   6231  C  C     . ARG A 1  806  ? 98.496  58.313  34.849  1.00 107.62 ? 806  ARG A C     1 
ATOM   6232  O  O     . ARG A 1  806  ? 97.651  57.823  35.612  1.00 109.28 ? 806  ARG A O     1 
ATOM   6233  C  CB    . ARG A 1  806  ? 100.007 60.215  35.422  1.00 104.03 ? 806  ARG A CB    1 
ATOM   6234  C  CG    . ARG A 1  806  ? 99.780  60.812  36.785  1.00 117.43 ? 806  ARG A CG    1 
ATOM   6235  C  CD    . ARG A 1  806  ? 100.253 62.239  36.758  1.00 132.99 ? 806  ARG A CD    1 
ATOM   6236  N  NE    . ARG A 1  806  ? 100.355 62.811  38.095  1.00 149.45 ? 806  ARG A NE    1 
ATOM   6237  C  CZ    . ARG A 1  806  ? 101.056 63.900  38.381  1.00 169.15 ? 806  ARG A CZ    1 
ATOM   6238  N  NH1   . ARG A 1  806  ? 101.740 64.526  37.429  1.00 158.59 ? 806  ARG A NH1   1 
ATOM   6239  N  NH2   . ARG A 1  806  ? 101.096 64.364  39.622  1.00 158.77 ? 806  ARG A NH2   1 
ATOM   6240  N  N     . GLY A 1  807  ? 98.332  58.472  33.535  1.00 102.08 ? 807  GLY A N     1 
ATOM   6241  C  CA    . GLY A 1  807  ? 97.092  58.186  32.831  1.00 101.25 ? 807  GLY A CA    1 
ATOM   6242  C  C     . GLY A 1  807  ? 96.437  59.459  32.351  1.00 105.72 ? 807  GLY A C     1 
ATOM   6243  O  O     . GLY A 1  807  ? 96.642  60.528  32.939  1.00 107.63 ? 807  GLY A O     1 
ATOM   6244  N  N     . LEU A 1  808  ? 95.640  59.351  31.282  1.00 99.80  ? 808  LEU A N     1 
ATOM   6245  C  CA    . LEU A 1  808  ? 94.987  60.505  30.667  1.00 99.11  ? 808  LEU A CA    1 
ATOM   6246  C  C     . LEU A 1  808  ? 93.557  60.720  31.104  1.00 105.69 ? 808  LEU A C     1 
ATOM   6247  O  O     . LEU A 1  808  ? 92.829  59.746  31.329  1.00 105.72 ? 808  LEU A O     1 
ATOM   6248  C  CB    . LEU A 1  808  ? 95.056  60.383  29.137  1.00 96.41  ? 808  LEU A CB    1 
ATOM   6249  C  CG    . LEU A 1  808  ? 96.235  61.062  28.456  1.00 98.43  ? 808  LEU A CG    1 
ATOM   6250  C  CD1   . LEU A 1  808  ? 97.539  60.271  28.621  1.00 96.70  ? 808  LEU A CD1   1 
ATOM   6251  C  CD2   . LEU A 1  808  ? 95.940  61.283  27.006  1.00 98.30  ? 808  LEU A CD2   1 
ATOM   6252  N  N     . THR A 1  809  ? 93.150  62.009  31.191  1.00 103.87 ? 809  THR A N     1 
ATOM   6253  C  CA    . THR A 1  809  ? 91.775  62.425  31.498  1.00 105.64 ? 809  THR A CA    1 
ATOM   6254  C  C     . THR A 1  809  ? 90.924  62.145  30.226  1.00 109.32 ? 809  THR A C     1 
ATOM   6255  O  O     . THR A 1  809  ? 91.501  62.138  29.130  1.00 108.31 ? 809  THR A O     1 
ATOM   6256  C  CB    . THR A 1  809  ? 91.698  63.912  31.922  1.00 117.19 ? 809  THR A CB    1 
ATOM   6257  O  OG1   . THR A 1  809  ? 91.590  64.755  30.777  1.00 115.91 ? 809  THR A OG1   1 
ATOM   6258  C  CG2   . THR A 1  809  ? 92.854  64.349  32.802  1.00 118.44 ? 809  THR A CG2   1 
ATOM   6259  N  N     . PRO A 1  810  ? 89.583  61.915  30.319  1.00 105.56 ? 810  PRO A N     1 
ATOM   6260  C  CA    . PRO A 1  810  ? 88.801  61.591  29.101  1.00 103.96 ? 810  PRO A CA    1 
ATOM   6261  C  C     . PRO A 1  810  ? 88.919  62.590  27.945  1.00 105.71 ? 810  PRO A C     1 
ATOM   6262  O  O     . PRO A 1  810  ? 88.978  62.173  26.780  1.00 103.07 ? 810  PRO A O     1 
ATOM   6263  C  CB    . PRO A 1  810  ? 87.371  61.473  29.620  1.00 107.23 ? 810  PRO A CB    1 
ATOM   6264  C  CG    . PRO A 1  810  ? 87.528  61.100  31.056  1.00 112.77 ? 810  PRO A CG    1 
ATOM   6265  C  CD    . PRO A 1  810  ? 88.735  61.841  31.528  1.00 108.52 ? 810  PRO A CD    1 
ATOM   6266  N  N     . GLN A 1  811  ? 89.001  63.898  28.276  1.00 103.15 ? 811  GLN A N     1 
ATOM   6267  C  CA    . GLN A 1  811  ? 89.159  64.988  27.306  1.00 102.84 ? 811  GLN A CA    1 
ATOM   6268  C  C     . GLN A 1  811  ? 90.548  64.879  26.653  1.00 104.94 ? 811  GLN A C     1 
ATOM   6269  O  O     . GLN A 1  811  ? 90.636  64.879  25.421  1.00 103.72 ? 811  GLN A O     1 
ATOM   6270  C  CB    . GLN A 1  811  ? 88.954  66.384  27.948  1.00 105.85 ? 811  GLN A CB    1 
ATOM   6271  C  CG    . GLN A 1  811  ? 87.695  66.535  28.804  1.00 116.32 ? 811  GLN A CG    1 
ATOM   6272  C  CD    . GLN A 1  811  ? 87.954  66.203  30.260  1.00 133.71 ? 811  GLN A CD    1 
ATOM   6273  O  OE1   . GLN A 1  811  ? 88.072  65.036  30.649  1.00 126.64 ? 811  GLN A OE1   1 
ATOM   6274  N  NE2   . GLN A 1  811  ? 88.050  67.222  31.104  1.00 126.96 ? 811  GLN A NE2   1 
ATOM   6275  N  N     . GLU A 1  812  ? 91.618  64.716  27.488  1.00 100.65 ? 812  GLU A N     1 
ATOM   6276  C  CA    . GLU A 1  812  ? 93.021  64.553  27.067  1.00 98.93  ? 812  GLU A CA    1 
ATOM   6277  C  C     . GLU A 1  812  ? 93.137  63.361  26.132  1.00 99.83  ? 812  GLU A C     1 
ATOM   6278  O  O     . GLU A 1  812  ? 93.842  63.436  25.121  1.00 97.64  ? 812  GLU A O     1 
ATOM   6279  C  CB    . GLU A 1  812  ? 93.942  64.339  28.285  1.00 100.77 ? 812  GLU A CB    1 
ATOM   6280  C  CG    . GLU A 1  812  ? 94.575  65.607  28.830  1.00 115.21 ? 812  GLU A CG    1 
ATOM   6281  C  CD    . GLU A 1  812  ? 95.326  65.484  30.145  1.00 142.67 ? 812  GLU A CD    1 
ATOM   6282  O  OE1   . GLU A 1  812  ? 95.696  64.348  30.524  1.00 133.14 ? 812  GLU A OE1   1 
ATOM   6283  O  OE2   . GLU A 1  812  ? 95.558  66.533  30.792  1.00 141.38 ? 812  GLU A OE2   1 
ATOM   6284  N  N     . PHE A 1  813  ? 92.415  62.271  26.478  1.00 95.66  ? 813  PHE A N     1 
ATOM   6285  C  CA    . PHE A 1  813  ? 92.355  61.039  25.728  1.00 93.97  ? 813  PHE A CA    1 
ATOM   6286  C  C     . PHE A 1  813  ? 91.767  61.277  24.355  1.00 98.85  ? 813  PHE A C     1 
ATOM   6287  O  O     . PHE A 1  813  ? 92.302  60.762  23.373  1.00 97.00  ? 813  PHE A O     1 
ATOM   6288  C  CB    . PHE A 1  813  ? 91.546  59.979  26.485  1.00 96.11  ? 813  PHE A CB    1 
ATOM   6289  C  CG    . PHE A 1  813  ? 91.455  58.665  25.737  1.00 96.47  ? 813  PHE A CG    1 
ATOM   6290  C  CD1   . PHE A 1  813  ? 92.530  57.776  25.722  1.00 98.69  ? 813  PHE A CD1   1 
ATOM   6291  C  CD2   . PHE A 1  813  ? 90.315  58.336  25.013  1.00 98.08  ? 813  PHE A CD2   1 
ATOM   6292  C  CE1   . PHE A 1  813  ? 92.461  56.583  25.008  1.00 98.37  ? 813  PHE A CE1   1 
ATOM   6293  C  CE2   . PHE A 1  813  ? 90.239  57.137  24.313  1.00 99.93  ? 813  PHE A CE2   1 
ATOM   6294  C  CZ    . PHE A 1  813  ? 91.307  56.263  24.324  1.00 97.31  ? 813  PHE A CZ    1 
ATOM   6295  N  N     . PHE A 1  814  ? 90.671  62.044  24.279  1.00 98.06  ? 814  PHE A N     1 
ATOM   6296  C  CA    . PHE A 1  814  ? 90.052  62.328  22.997  1.00 98.87  ? 814  PHE A CA    1 
ATOM   6297  C  C     . PHE A 1  814  ? 90.898  63.261  22.128  1.00 104.92 ? 814  PHE A C     1 
ATOM   6298  O  O     . PHE A 1  814  ? 90.973  63.038  20.922  1.00 103.82 ? 814  PHE A O     1 
ATOM   6299  C  CB    . PHE A 1  814  ? 88.642  62.871  23.170  1.00 102.46 ? 814  PHE A CB    1 
ATOM   6300  C  CG    . PHE A 1  814  ? 87.874  62.955  21.873  1.00 104.95 ? 814  PHE A CG    1 
ATOM   6301  C  CD1   . PHE A 1  814  ? 87.184  61.854  21.383  1.00 108.83 ? 814  PHE A CD1   1 
ATOM   6302  C  CD2   . PHE A 1  814  ? 87.843  64.135  21.138  1.00 108.58 ? 814  PHE A CD2   1 
ATOM   6303  C  CE1   . PHE A 1  814  ? 86.460  61.935  20.185  1.00 110.65 ? 814  PHE A CE1   1 
ATOM   6304  C  CE2   . PHE A 1  814  ? 87.128  64.213  19.936  1.00 112.37 ? 814  PHE A CE2   1 
ATOM   6305  C  CZ    . PHE A 1  814  ? 86.440  63.112  19.468  1.00 110.48 ? 814  PHE A CZ    1 
ATOM   6306  N  N     . PHE A 1  815  ? 91.513  64.310  22.722  1.00 103.90 ? 815  PHE A N     1 
ATOM   6307  C  CA    . PHE A 1  815  ? 92.354  65.258  21.977  1.00 104.27 ? 815  PHE A CA    1 
ATOM   6308  C  C     . PHE A 1  815  ? 93.590  64.568  21.412  1.00 107.00 ? 815  PHE A C     1 
ATOM   6309  O  O     . PHE A 1  815  ? 93.904  64.760  20.234  1.00 106.15 ? 815  PHE A O     1 
ATOM   6310  C  CB    . PHE A 1  815  ? 92.723  66.486  22.825  1.00 107.64 ? 815  PHE A CB    1 
ATOM   6311  C  CG    . PHE A 1  815  ? 91.571  67.376  23.242  1.00 111.16 ? 815  PHE A CG    1 
ATOM   6312  C  CD1   . PHE A 1  815  ? 90.580  67.733  22.334  1.00 114.06 ? 815  PHE A CD1   1 
ATOM   6313  C  CD2   . PHE A 1  815  ? 91.486  67.868  24.538  1.00 115.52 ? 815  PHE A CD2   1 
ATOM   6314  C  CE1   . PHE A 1  815  ? 89.527  68.569  22.714  1.00 118.68 ? 815  PHE A CE1   1 
ATOM   6315  C  CE2   . PHE A 1  815  ? 90.433  68.701  24.917  1.00 118.43 ? 815  PHE A CE2   1 
ATOM   6316  C  CZ    . PHE A 1  815  ? 89.458  69.042  24.003  1.00 118.03 ? 815  PHE A CZ    1 
ATOM   6317  N  N     . HIS A 1  816  ? 94.240  63.703  22.229  1.00 103.12 ? 816  HIS A N     1 
ATOM   6318  C  CA    . HIS A 1  816  ? 95.384  62.871  21.829  1.00 101.43 ? 816  HIS A CA    1 
ATOM   6319  C  C     . HIS A 1  816  ? 94.952  61.978  20.671  1.00 103.21 ? 816  HIS A C     1 
ATOM   6320  O  O     . HIS A 1  816  ? 95.672  61.864  19.681  1.00 101.07 ? 816  HIS A O     1 
ATOM   6321  C  CB    . HIS A 1  816  ? 95.864  62.016  23.009  1.00 101.93 ? 816  HIS A CB    1 
ATOM   6322  C  CG    . HIS A 1  816  ? 97.121  61.249  22.750  1.00 104.13 ? 816  HIS A CG    1 
ATOM   6323  N  ND1   . HIS A 1  816  ? 98.285  61.882  22.350  1.00 106.03 ? 816  HIS A ND1   1 
ATOM   6324  C  CD2   . HIS A 1  816  ? 97.381  59.936  22.936  1.00 105.04 ? 816  HIS A CD2   1 
ATOM   6325  C  CE1   . HIS A 1  816  ? 99.197  60.927  22.248  1.00 104.38 ? 816  HIS A CE1   1 
ATOM   6326  N  NE2   . HIS A 1  816  ? 98.701  59.738  22.592  1.00 104.03 ? 816  HIS A NE2   1 
ATOM   6327  N  N     . ALA A 1  817  ? 93.729  61.420  20.774  1.00 100.19 ? 817  ALA A N     1 
ATOM   6328  C  CA    . ALA A 1  817  ? 93.104  60.593  19.754  1.00 99.51  ? 817  ALA A CA    1 
ATOM   6329  C  C     . ALA A 1  817  ? 92.971  61.311  18.403  1.00 103.83 ? 817  ALA A C     1 
ATOM   6330  O  O     . ALA A 1  817  ? 93.185  60.679  17.371  1.00 103.28 ? 817  ALA A O     1 
ATOM   6331  C  CB    . ALA A 1  817  ? 91.754  60.108  20.234  1.00 101.00 ? 817  ALA A CB    1 
ATOM   6332  N  N     . MET A 1  818  ? 92.661  62.621  18.400  1.00 100.99 ? 818  MET A N     1 
ATOM   6333  C  CA    . MET A 1  818  ? 92.550  63.381  17.148  1.00 101.05 ? 818  MET A CA    1 
ATOM   6334  C  C     . MET A 1  818  ? 93.929  63.610  16.553  1.00 105.58 ? 818  MET A C     1 
ATOM   6335  O  O     . MET A 1  818  ? 94.109  63.434  15.346  1.00 105.78 ? 818  MET A O     1 
ATOM   6336  C  CB    . MET A 1  818  ? 91.855  64.728  17.355  1.00 104.48 ? 818  MET A CB    1 
ATOM   6337  C  CG    . MET A 1  818  ? 90.514  64.603  17.949  1.00 108.26 ? 818  MET A CG    1 
ATOM   6338  S  SD    . MET A 1  818  ? 90.100  66.079  18.846  1.00 113.50 ? 818  MET A SD    1 
ATOM   6339  C  CE    . MET A 1  818  ? 89.064  66.829  17.674  1.00 111.63 ? 818  MET A CE    1 
ATOM   6340  N  N     . GLY A 1  819  ? 94.882  63.985  17.409  1.00 101.76 ? 819  GLY A N     1 
ATOM   6341  C  CA    . GLY A 1  819  ? 96.259  64.251  17.014  1.00 101.38 ? 819  GLY A CA    1 
ATOM   6342  C  C     . GLY A 1  819  ? 96.968  63.029  16.466  1.00 103.72 ? 819  GLY A C     1 
ATOM   6343  O  O     . GLY A 1  819  ? 97.784  63.143  15.540  1.00 104.05 ? 819  GLY A O     1 
ATOM   6344  N  N     . GLY A 1  820  ? 96.642  61.871  17.051  1.00 97.12  ? 820  GLY A N     1 
ATOM   6345  C  CA    . GLY A 1  820  ? 97.208  60.582  16.689  1.00 94.52  ? 820  GLY A CA    1 
ATOM   6346  C  C     . GLY A 1  820  ? 96.710  60.117  15.348  1.00 97.27  ? 820  GLY A C     1 
ATOM   6347  O  O     . GLY A 1  820  ? 97.481  59.543  14.577  1.00 95.79  ? 820  GLY A O     1 
ATOM   6348  N  N     . ARG A 1  821  ? 95.412  60.385  15.063  1.00 94.95  ? 821  ARG A N     1 
ATOM   6349  C  CA    . ARG A 1  821  ? 94.736  60.026  13.811  1.00 95.14  ? 821  ARG A CA    1 
ATOM   6350  C  C     . ARG A 1  821  ? 95.369  60.774  12.663  1.00 101.24 ? 821  ARG A C     1 
ATOM   6351  O  O     . ARG A 1  821  ? 95.546  60.193  11.599  1.00 100.23 ? 821  ARG A O     1 
ATOM   6352  C  CB    . ARG A 1  821  ? 93.220  60.296  13.874  1.00 94.60  ? 821  ARG A CB    1 
ATOM   6353  C  CG    . ARG A 1  821  ? 92.462  59.835  12.630  1.00 99.77  ? 821  ARG A CG    1 
ATOM   6354  C  CD    . ARG A 1  821  ? 91.620  58.596  12.841  1.00 106.70 ? 821  ARG A CD    1 
ATOM   6355  N  NE    . ARG A 1  821  ? 90.217  58.912  12.586  1.00 120.51 ? 821  ARG A NE    1 
ATOM   6356  C  CZ    . ARG A 1  821  ? 89.201  58.512  13.344  1.00 139.54 ? 821  ARG A CZ    1 
ATOM   6357  N  NH1   . ARG A 1  821  ? 89.416  57.730  14.396  1.00 125.60 ? 821  ARG A NH1   1 
ATOM   6358  N  NH2   . ARG A 1  821  ? 87.958  58.882  13.049  1.00 129.50 ? 821  ARG A NH2   1 
ATOM   6359  N  N     . GLU A 1  822  ? 95.778  62.033  12.902  1.00 101.00 ? 822  GLU A N     1 
ATOM   6360  C  CA    . GLU A 1  822  ? 96.436  62.885  11.907  1.00 102.99 ? 822  GLU A CA    1 
ATOM   6361  C  C     . GLU A 1  822  ? 97.706  62.219  11.365  1.00 104.95 ? 822  GLU A C     1 
ATOM   6362  O  O     . GLU A 1  822  ? 98.035  62.385  10.185  1.00 104.95 ? 822  GLU A O     1 
ATOM   6363  C  CB    . GLU A 1  822  ? 96.750  64.278  12.495  1.00 106.17 ? 822  GLU A CB    1 
ATOM   6364  C  CG    . GLU A 1  822  ? 96.462  65.434  11.543  1.00 123.19 ? 822  GLU A CG    1 
ATOM   6365  C  CD    . GLU A 1  822  ? 97.639  66.351  11.254  1.00 152.66 ? 822  GLU A CD    1 
ATOM   6366  O  OE1   . GLU A 1  822  ? 98.186  66.954  12.208  1.00 144.89 ? 822  GLU A OE1   1 
ATOM   6367  O  OE2   . GLU A 1  822  ? 98.015  66.464  10.064  1.00 157.53 ? 822  GLU A OE2   1 
ATOM   6368  N  N     . GLY A 1  823  ? 98.362  61.443  12.230  1.00 99.73  ? 823  GLY A N     1 
ATOM   6369  C  CA    . GLY A 1  823  ? 99.577  60.699  11.921  1.00 98.51  ? 823  GLY A CA    1 
ATOM   6370  C  C     . GLY A 1  823  ? 99.362  59.569  10.940  1.00 101.36 ? 823  GLY A C     1 
ATOM   6371  O  O     . GLY A 1  823  ? 100.137 59.407  9.994   1.00 101.04 ? 823  GLY A O     1 
ATOM   6372  N  N     . LEU A 1  824  ? 98.298  58.792  11.158  1.00 97.46  ? 824  LEU A N     1 
ATOM   6373  C  CA    . LEU A 1  824  ? 97.920  57.666  10.308  1.00 97.18  ? 824  LEU A CA    1 
ATOM   6374  C  C     . LEU A 1  824  ? 97.437  58.124  8.941   1.00 101.14 ? 824  LEU A C     1 
ATOM   6375  O  O     . LEU A 1  824  ? 97.643  57.424  7.949   1.00 99.94  ? 824  LEU A O     1 
ATOM   6376  C  CB    . LEU A 1  824  ? 96.841  56.825  10.997  1.00 97.49  ? 824  LEU A CB    1 
ATOM   6377  C  CG    . LEU A 1  824  ? 97.282  56.115  12.273  1.00 102.06 ? 824  LEU A CG    1 
ATOM   6378  C  CD1   . LEU A 1  824  ? 96.187  56.135  13.309  1.00 102.96 ? 824  LEU A CD1   1 
ATOM   6379  C  CD2   . LEU A 1  824  ? 97.747  54.692  11.983  1.00 104.98 ? 824  LEU A CD2   1 
ATOM   6380  N  N     . ILE A 1  825  ? 96.801  59.302  8.892   1.00 99.52  ? 825  ILE A N     1 
ATOM   6381  C  CA    . ILE A 1  825  ? 96.286  59.878  7.656   1.00 101.07 ? 825  ILE A CA    1 
ATOM   6382  C  C     . ILE A 1  825  ? 97.450  60.304  6.782   1.00 109.68 ? 825  ILE A C     1 
ATOM   6383  O  O     . ILE A 1  825  ? 97.527  59.852  5.647   1.00 109.63 ? 825  ILE A O     1 
ATOM   6384  C  CB    . ILE A 1  825  ? 95.273  61.017  7.907   1.00 104.37 ? 825  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A 1  825  ? 94.102  60.540  8.763   1.00 103.50 ? 825  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A 1  825  ? 94.761  61.570  6.587   1.00 106.78 ? 825  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A 1  825  ? 93.552  61.574  9.584   1.00 107.77 ? 825  ILE A CD1   1 
ATOM   6388  N  N     . ASP A 1  826  ? 98.369  61.128  7.323   1.00 110.02 ? 826  ASP A N     1 
ATOM   6389  C  CA    . ASP A 1  826  ? 99.560  61.621  6.624   1.00 112.32 ? 826  ASP A CA    1 
ATOM   6390  C  C     . ASP A 1  826  ? 100.457 60.487  6.103   1.00 115.12 ? 826  ASP A C     1 
ATOM   6391  O  O     . ASP A 1  826  ? 101.021 60.610  5.011   1.00 115.73 ? 826  ASP A O     1 
ATOM   6392  C  CB    . ASP A 1  826  ? 100.358 62.569  7.526   1.00 115.90 ? 826  ASP A CB    1 
ATOM   6393  C  CG    . ASP A 1  826  ? 100.576 63.940  6.921   1.00 140.73 ? 826  ASP A CG    1 
ATOM   6394  O  OD1   . ASP A 1  826  ? 99.630  64.777  6.984   1.00 151.57 ? 826  ASP A OD1   1 
ATOM   6395  O  OD2   . ASP A 1  826  ? 101.700 64.188  6.390   1.00 143.23 ? 826  ASP A OD2   1 
ATOM   6396  N  N     . THR A 1  827  ? 100.566 59.381  6.870   1.00 109.53 ? 827  THR A N     1 
ATOM   6397  C  CA    . THR A 1  827  ? 101.331 58.198  6.480   1.00 108.21 ? 827  THR A CA    1 
ATOM   6398  C  C     . THR A 1  827  ? 100.659 57.538  5.254   1.00 113.59 ? 827  THR A C     1 
ATOM   6399  O  O     . THR A 1  827  ? 101.364 57.098  4.358   1.00 113.45 ? 827  THR A O     1 
ATOM   6400  C  CB    . THR A 1  827  ? 101.569 57.275  7.705   1.00 111.96 ? 827  THR A CB    1 
ATOM   6401  O  OG1   . THR A 1  827  ? 102.658 57.781  8.488   1.00 109.36 ? 827  THR A OG1   1 
ATOM   6402  C  CG2   . THR A 1  827  ? 101.857 55.835  7.325   1.00 108.97 ? 827  THR A CG2   1 
ATOM   6403  N  N     . ALA A 1  828  ? 99.308  57.548  5.191   1.00 111.40 ? 828  ALA A N     1 
ATOM   6404  C  CA    . ALA A 1  828  ? 98.484  56.967  4.117   1.00 112.31 ? 828  ALA A CA    1 
ATOM   6405  C  C     . ALA A 1  828  ? 98.338  57.845  2.864   1.00 117.26 ? 828  ALA A C     1 
ATOM   6406  O  O     . ALA A 1  828  ? 98.418  57.339  1.744   1.00 117.01 ? 828  ALA A O     1 
ATOM   6407  C  CB    . ALA A 1  828  ? 97.109  56.639  4.660   1.00 113.35 ? 828  ALA A CB    1 
ATOM   6408  N  N     . VAL A 1  829  ? 98.053  59.139  3.062   1.00 115.02 ? 829  VAL A N     1 
ATOM   6409  C  CA    . VAL A 1  829  ? 97.865  60.139  2.008   1.00 116.99 ? 829  VAL A CA    1 
ATOM   6410  C  C     . VAL A 1  829  ? 99.145  60.294  1.199   1.00 121.33 ? 829  VAL A C     1 
ATOM   6411  O  O     . VAL A 1  829  ? 99.169  59.988  0.005   1.00 122.57 ? 829  VAL A O     1 
ATOM   6412  C  CB    . VAL A 1  829  ? 97.386  61.502  2.604   1.00 121.65 ? 829  VAL A CB    1 
ATOM   6413  C  CG1   . VAL A 1  829  ? 97.603  62.663  1.632   1.00 123.60 ? 829  VAL A CG1   1 
ATOM   6414  C  CG2   . VAL A 1  829  ? 95.927  61.433  3.033   1.00 121.78 ? 829  VAL A CG2   1 
ATOM   6415  N  N     . LYS A 1  830  ? 100.212 60.731  1.881   1.00 116.12 ? 830  LYS A N     1 
ATOM   6416  C  CA    . LYS A 1  830  ? 101.504 61.047  1.297   1.00 115.47 ? 830  LYS A CA    1 
ATOM   6417  C  C     . LYS A 1  830  ? 102.382 59.830  1.041   1.00 113.74 ? 830  LYS A C     1 
ATOM   6418  O  O     . LYS A 1  830  ? 103.560 60.003  0.748   1.00 113.33 ? 830  LYS A O     1 
ATOM   6419  C  CB    . LYS A 1  830  ? 102.229 62.106  2.158   1.00 118.47 ? 830  LYS A CB    1 
ATOM   6420  C  CG    . LYS A 1  830  ? 101.702 63.538  1.987   1.00 127.26 ? 830  LYS A CG    1 
ATOM   6421  C  CD    . LYS A 1  830  ? 102.357 64.449  2.990   1.00 132.63 ? 830  LYS A CD    1 
ATOM   6422  C  CE    . LYS A 1  830  ? 102.280 65.882  2.569   1.00 149.28 ? 830  LYS A CE    1 
ATOM   6423  N  NZ    . LYS A 1  830  ? 102.966 66.746  3.560   1.00 163.50 ? 830  LYS A NZ    1 
ATOM   6424  N  N     . THR A 1  831  ? 101.834 58.618  1.095   1.00 106.85 ? 831  THR A N     1 
ATOM   6425  C  CA    . THR A 1  831  ? 102.692 57.476  0.807   1.00 105.01 ? 831  THR A CA    1 
ATOM   6426  C  C     . THR A 1  831  ? 102.653 57.143  -0.683  1.00 107.56 ? 831  THR A C     1 
ATOM   6427  O  O     . THR A 1  831  ? 103.635 56.622  -1.204  1.00 106.61 ? 831  THR A O     1 
ATOM   6428  C  CB    . THR A 1  831  ? 102.431 56.287  1.739   1.00 113.92 ? 831  THR A CB    1 
ATOM   6429  O  OG1   . THR A 1  831  ? 103.595 55.469  1.801   1.00 108.72 ? 831  THR A OG1   1 
ATOM   6430  C  CG2   . THR A 1  831  ? 101.190 55.465  1.369   1.00 116.51 ? 831  THR A CG2   1 
ATOM   6431  N  N     . ALA A 1  832  ? 101.539 57.438  -1.367  1.00 96.81  ? 832  ALA A N     1 
ATOM   6432  C  CA    . ALA A 1  832  ? 101.464 57.151  -2.791  1.00 94.73  ? 832  ALA A CA    1 
ATOM   6433  C  C     . ALA A 1  832  ? 102.168 58.256  -3.537  1.00 95.96  ? 832  ALA A C     1 
ATOM   6434  O  O     . ALA A 1  832  ? 102.968 57.978  -4.430  1.00 93.17  ? 832  ALA A O     1 
ATOM   6435  C  CB    . ALA A 1  832  ? 100.022 57.029  -3.237  1.00 95.98  ? 832  ALA A CB    1 
ATOM   6436  N  N     . GLU A 1  833  ? 101.941 59.504  -3.093  1.00 93.94  ? 833  GLU A N     1 
ATOM   6437  C  CA    . GLU A 1  833  ? 102.515 60.726  -3.666  1.00 94.37  ? 833  GLU A CA    1 
ATOM   6438  C  C     . GLU A 1  833  ? 104.048 60.659  -3.750  1.00 96.24  ? 833  GLU A C     1 
ATOM   6439  O  O     . GLU A 1  833  ? 104.654 61.115  -4.733  1.00 94.83  ? 833  GLU A O     1 
ATOM   6440  C  CB    . GLU A 1  833  ? 102.058 61.954  -2.854  1.00 97.41  ? 833  GLU A CB    1 
ATOM   6441  C  CG    . GLU A 1  833  ? 102.024 63.245  -3.660  1.00 114.55 ? 833  GLU A CG    1 
ATOM   6442  C  CD    . GLU A 1  833  ? 101.316 64.412  -2.992  1.00 157.83 ? 833  GLU A CD    1 
ATOM   6443  O  OE1   . GLU A 1  833  ? 101.814 64.907  -1.953  1.00 161.85 ? 833  GLU A OE1   1 
ATOM   6444  O  OE2   . GLU A 1  833  ? 100.268 64.845  -3.526  1.00 161.87 ? 833  GLU A OE2   1 
ATOM   6445  N  N     . THR A 1  834  ? 104.643 60.055  -2.712  1.00 91.72  ? 834  THR A N     1 
ATOM   6446  C  CA    . THR A 1  834  ? 106.068 59.856  -2.526  1.00 90.27  ? 834  THR A CA    1 
ATOM   6447  C  C     . THR A 1  834  ? 106.555 58.746  -3.434  1.00 93.16  ? 834  THR A C     1 
ATOM   6448  O  O     . THR A 1  834  ? 107.693 58.794  -3.917  1.00 91.71  ? 834  THR A O     1 
ATOM   6449  C  CB    . THR A 1  834  ? 106.319 59.578  -1.042  1.00 97.78  ? 834  THR A CB    1 
ATOM   6450  O  OG1   . THR A 1  834  ? 107.537 60.175  -0.641  1.00 101.68 ? 834  THR A OG1   1 
ATOM   6451  C  CG2   . THR A 1  834  ? 106.303 58.104  -0.683  1.00 94.30  ? 834  THR A CG2   1 
ATOM   6452  N  N     . GLY A 1  835  ? 105.685 57.750  -3.626  1.00 89.98  ? 835  GLY A N     1 
ATOM   6453  C  CA    . GLY A 1  835  ? 105.957 56.575  -4.440  1.00 89.00  ? 835  GLY A CA    1 
ATOM   6454  C  C     . GLY A 1  835  ? 105.998 56.935  -5.906  1.00 90.18  ? 835  GLY A C     1 
ATOM   6455  O  O     . GLY A 1  835  ? 106.944 56.561  -6.614  1.00 90.34  ? 835  GLY A O     1 
ATOM   6456  N  N     . TYR A 1  836  ? 104.980 57.699  -6.352  1.00 82.85  ? 836  TYR A N     1 
ATOM   6457  C  CA    . TYR A 1  836  ? 104.889 58.174  -7.721  1.00 81.07  ? 836  TYR A CA    1 
ATOM   6458  C  C     . TYR A 1  836  ? 106.113 59.017  -8.037  1.00 82.13  ? 836  TYR A C     1 
ATOM   6459  O  O     . TYR A 1  836  ? 106.669 58.904  -9.128  1.00 79.57  ? 836  TYR A O     1 
ATOM   6460  C  CB    . TYR A 1  836  ? 103.603 58.983  -7.913  1.00 83.14  ? 836  TYR A CB    1 
ATOM   6461  C  CG    . TYR A 1  836  ? 103.317 59.412  -9.339  1.00 84.64  ? 836  TYR A CG    1 
ATOM   6462  C  CD1   . TYR A 1  836  ? 103.592 58.569  -10.414 1.00 86.04  ? 836  TYR A CD1   1 
ATOM   6463  C  CD2   . TYR A 1  836  ? 102.698 60.625  -9.609  1.00 86.19  ? 836  TYR A CD2   1 
ATOM   6464  C  CE1   . TYR A 1  836  ? 103.302 58.946  -11.725 1.00 86.28  ? 836  TYR A CE1   1 
ATOM   6465  C  CE2   . TYR A 1  836  ? 102.397 61.009  -10.914 1.00 87.41  ? 836  TYR A CE2   1 
ATOM   6466  C  CZ    . TYR A 1  836  ? 102.704 60.168  -11.969 1.00 93.98  ? 836  TYR A CZ    1 
ATOM   6467  O  OH    . TYR A 1  836  ? 102.409 60.549  -13.251 1.00 97.68  ? 836  TYR A OH    1 
ATOM   6468  N  N     . ILE A 1  837  ? 106.568 59.810  -7.050  1.00 79.50  ? 837  ILE A N     1 
ATOM   6469  C  CA    . ILE A 1  837  ? 107.765 60.630  -7.173  1.00 78.98  ? 837  ILE A CA    1 
ATOM   6470  C  C     . ILE A 1  837  ? 108.950 59.760  -7.522  1.00 81.92  ? 837  ILE A C     1 
ATOM   6471  O  O     . ILE A 1  837  ? 109.722 60.145  -8.403  1.00 81.61  ? 837  ILE A O     1 
ATOM   6472  C  CB    . ILE A 1  837  ? 107.989 61.543  -5.945  1.00 82.53  ? 837  ILE A CB    1 
ATOM   6473  C  CG1   . ILE A 1  837  ? 107.278 62.878  -6.186  1.00 84.47  ? 837  ILE A CG1   1 
ATOM   6474  C  CG2   . ILE A 1  837  ? 109.478 61.753  -5.619  1.00 81.26  ? 837  ILE A CG2   1 
ATOM   6475  C  CD1   . ILE A 1  837  ? 107.193 63.828  -4.980  1.00 98.74  ? 837  ILE A CD1   1 
ATOM   6476  N  N     . GLN A 1  838  ? 109.068 58.562  -6.900  1.00 77.63  ? 838  GLN A N     1 
ATOM   6477  C  CA    . GLN A 1  838  ? 110.192 57.684  -7.238  1.00 76.61  ? 838  GLN A CA    1 
ATOM   6478  C  C     . GLN A 1  838  ? 110.071 57.144  -8.659  1.00 78.44  ? 838  GLN A C     1 
ATOM   6479  O  O     . GLN A 1  838  ? 110.971 57.382  -9.459  1.00 78.01  ? 838  GLN A O     1 
ATOM   6480  C  CB    . GLN A 1  838  ? 110.440 56.575  -6.210  1.00 78.01  ? 838  GLN A CB    1 
ATOM   6481  C  CG    . GLN A 1  838  ? 111.924 56.202  -6.160  1.00 87.93  ? 838  GLN A CG    1 
ATOM   6482  C  CD    . GLN A 1  838  ? 112.272 55.205  -5.085  1.00 108.29 ? 838  GLN A CD    1 
ATOM   6483  O  OE1   . GLN A 1  838  ? 112.938 54.191  -5.341  1.00 105.89 ? 838  GLN A OE1   1 
ATOM   6484  N  NE2   . GLN A 1  838  ? 111.856 55.478  -3.853  1.00 98.07  ? 838  GLN A NE2   1 
ATOM   6485  N  N     . ARG A 1  839  ? 108.936 56.502  -8.987  1.00 72.91  ? 839  ARG A N     1 
ATOM   6486  C  CA    . ARG A 1  839  ? 108.613 55.966  -10.313 1.00 71.54  ? 839  ARG A CA    1 
ATOM   6487  C  C     . ARG A 1  839  ? 109.050 56.941  -11.408 1.00 71.12  ? 839  ARG A C     1 
ATOM   6488  O  O     . ARG A 1  839  ? 109.733 56.545  -12.346 1.00 70.23  ? 839  ARG A O     1 
ATOM   6489  C  CB    . ARG A 1  839  ? 107.090 55.731  -10.404 1.00 74.48  ? 839  ARG A CB    1 
ATOM   6490  C  CG    . ARG A 1  839  ? 106.663 54.475  -11.156 1.00 79.95  ? 839  ARG A CG    1 
ATOM   6491  C  CD    . ARG A 1  839  ? 105.915 54.783  -12.439 1.00 73.76  ? 839  ARG A CD    1 
ATOM   6492  N  NE    . ARG A 1  839  ? 106.257 53.785  -13.447 1.00 77.44  ? 839  ARG A NE    1 
ATOM   6493  C  CZ    . ARG A 1  839  ? 105.807 53.780  -14.695 1.00 99.13  ? 839  ARG A CZ    1 
ATOM   6494  N  NH1   . ARG A 1  839  ? 104.965 54.728  -15.112 1.00 91.61  ? 839  ARG A NH1   1 
ATOM   6495  N  NH2   . ARG A 1  839  ? 106.188 52.826  -15.538 1.00 84.64  ? 839  ARG A NH2   1 
ATOM   6496  N  N     . ARG A 1  840  ? 108.700 58.222  -11.244 1.00 66.35  ? 840  ARG A N     1 
ATOM   6497  C  CA    . ARG A 1  840  ? 109.040 59.309  -12.160 1.00 65.92  ? 840  ARG A CA    1 
ATOM   6498  C  C     . ARG A 1  840  ? 110.545 59.554  -12.203 1.00 66.79  ? 840  ARG A C     1 
ATOM   6499  O  O     . ARG A 1  840  ? 111.127 59.558  -13.285 1.00 65.84  ? 840  ARG A O     1 
ATOM   6500  C  CB    . ARG A 1  840  ? 108.301 60.589  -11.755 1.00 67.69  ? 840  ARG A CB    1 
ATOM   6501  C  CG    . ARG A 1  840  ? 106.838 60.605  -12.156 1.00 77.71  ? 840  ARG A CG    1 
ATOM   6502  C  CD    . ARG A 1  840  ? 105.977 61.361  -11.177 1.00 86.11  ? 840  ARG A CD    1 
ATOM   6503  N  NE    . ARG A 1  840  ? 106.377 62.754  -11.057 1.00 93.43  ? 840  ARG A NE    1 
ATOM   6504  C  CZ    . ARG A 1  840  ? 106.046 63.529  -10.037 1.00 108.93 ? 840  ARG A CZ    1 
ATOM   6505  N  NH1   . ARG A 1  840  ? 105.285 63.053  -9.049  1.00 85.65  ? 840  ARG A NH1   1 
ATOM   6506  N  NH2   . ARG A 1  840  ? 106.488 64.778  -9.980  1.00 101.52 ? 840  ARG A NH2   1 
ATOM   6507  N  N     . LEU A 1  841  ? 111.169 59.720  -11.023 1.00 62.09  ? 841  LEU A N     1 
ATOM   6508  C  CA    . LEU A 1  841  ? 112.605 59.919  -10.873 1.00 61.70  ? 841  LEU A CA    1 
ATOM   6509  C  C     . LEU A 1  841  ? 113.394 58.771  -11.540 1.00 66.93  ? 841  LEU A C     1 
ATOM   6510  O  O     . LEU A 1  841  ? 114.408 59.028  -12.206 1.00 67.21  ? 841  LEU A O     1 
ATOM   6511  C  CB    . LEU A 1  841  ? 112.968 60.002  -9.383  1.00 61.31  ? 841  LEU A CB    1 
ATOM   6512  C  CG    . LEU A 1  841  ? 112.911 61.372  -8.736  1.00 65.55  ? 841  LEU A CG    1 
ATOM   6513  C  CD1   . LEU A 1  841  ? 112.930 61.238  -7.245  1.00 65.54  ? 841  LEU A CD1   1 
ATOM   6514  C  CD2   . LEU A 1  841  ? 114.089 62.236  -9.159  1.00 67.09  ? 841  LEU A CD2   1 
ATOM   6515  N  N     . VAL A 1  842  ? 112.911 57.514  -11.368 1.00 62.62  ? 842  VAL A N     1 
ATOM   6516  C  CA    . VAL A 1  842  ? 113.508 56.308  -11.938 1.00 61.93  ? 842  VAL A CA    1 
ATOM   6517  C  C     . VAL A 1  842  ? 113.305 56.294  -13.424 1.00 67.37  ? 842  VAL A C     1 
ATOM   6518  O  O     . VAL A 1  842  ? 114.267 56.084  -14.165 1.00 68.75  ? 842  VAL A O     1 
ATOM   6519  C  CB    . VAL A 1  842  ? 113.009 54.998  -11.287 1.00 65.28  ? 842  VAL A CB    1 
ATOM   6520  C  CG1   . VAL A 1  842  ? 113.285 53.791  -12.178 1.00 65.06  ? 842  VAL A CG1   1 
ATOM   6521  C  CG2   . VAL A 1  842  ? 113.644 54.802  -9.922  1.00 65.12  ? 842  VAL A CG2   1 
ATOM   6522  N  N     . LYS A 1  843  ? 112.077 56.529  -13.878 1.00 63.25  ? 843  LYS A N     1 
ATOM   6523  C  CA    . LYS A 1  843  ? 111.861 56.462  -15.302 1.00 63.16  ? 843  LYS A CA    1 
ATOM   6524  C  C     . LYS A 1  843  ? 112.602 57.601  -16.019 1.00 69.45  ? 843  LYS A C     1 
ATOM   6525  O  O     . LYS A 1  843  ? 113.090 57.361  -17.121 1.00 69.69  ? 843  LYS A O     1 
ATOM   6526  C  CB    . LYS A 1  843  ? 110.380 56.318  -15.666 1.00 64.11  ? 843  LYS A CB    1 
ATOM   6527  C  CG    . LYS A 1  843  ? 109.843 54.901  -15.385 1.00 61.47  ? 843  LYS A CG    1 
ATOM   6528  C  CD    . LYS A 1  843  ? 110.236 53.810  -16.445 1.00 76.21  ? 843  LYS A CD    1 
ATOM   6529  C  CE    . LYS A 1  843  ? 110.300 52.377  -15.891 1.00 96.48  ? 843  LYS A CE    1 
ATOM   6530  N  NZ    . LYS A 1  843  ? 109.123 51.502  -16.221 1.00 104.17 ? 843  LYS A NZ    1 
ATOM   6531  N  N     . ALA A 1  844  ? 112.853 58.745  -15.343 1.00 67.70  ? 844  ALA A N     1 
ATOM   6532  C  CA    . ALA A 1  844  ? 113.639 59.841  -15.936 1.00 69.00  ? 844  ALA A CA    1 
ATOM   6533  C  C     . ALA A 1  844  ? 115.133 59.508  -16.066 1.00 76.29  ? 844  ALA A C     1 
ATOM   6534  O  O     . ALA A 1  844  ? 115.767 59.874  -17.073 1.00 77.38  ? 844  ALA A O     1 
ATOM   6535  C  CB    . ALA A 1  844  ? 113.481 61.121  -15.130 1.00 69.42  ? 844  ALA A CB    1 
ATOM   6536  N  N     . LEU A 1  845  ? 115.688 58.799  -15.062 1.00 72.37  ? 845  LEU A N     1 
ATOM   6537  C  CA    . LEU A 1  845  ? 117.121 58.567  -15.017 1.00 71.69  ? 845  LEU A CA    1 
ATOM   6538  C  C     . LEU A 1  845  ? 117.613 57.176  -15.467 1.00 75.51  ? 845  LEU A C     1 
ATOM   6539  O  O     . LEU A 1  845  ? 118.813 57.059  -15.712 1.00 76.16  ? 845  LEU A O     1 
ATOM   6540  C  CB    . LEU A 1  845  ? 117.671 58.912  -13.616 1.00 71.09  ? 845  LEU A CB    1 
ATOM   6541  C  CG    . LEU A 1  845  ? 117.292 60.298  -13.013 1.00 75.34  ? 845  LEU A CG    1 
ATOM   6542  C  CD1   . LEU A 1  845  ? 118.035 60.553  -11.728 1.00 75.39  ? 845  LEU A CD1   1 
ATOM   6543  C  CD2   . LEU A 1  845  ? 117.579 61.441  -13.958 1.00 76.42  ? 845  LEU A CD2   1 
ATOM   6544  N  N     . GLU A 1  846  ? 116.723 56.162  -15.624 1.00 71.25  ? 846  GLU A N     1 
ATOM   6545  C  CA    . GLU A 1  846  ? 117.038 54.768  -16.026 1.00 71.18  ? 846  GLU A CA    1 
ATOM   6546  C  C     . GLU A 1  846  ? 118.387 54.572  -16.751 1.00 75.26  ? 846  GLU A C     1 
ATOM   6547  O  O     . GLU A 1  846  ? 119.381 54.126  -16.154 1.00 72.77  ? 846  GLU A O     1 
ATOM   6548  C  CB    . GLU A 1  846  ? 115.957 54.243  -16.975 1.00 73.01  ? 846  GLU A CB    1 
ATOM   6549  C  CG    . GLU A 1  846  ? 114.697 53.677  -16.368 1.00 83.46  ? 846  GLU A CG    1 
ATOM   6550  C  CD    . GLU A 1  846  ? 113.717 53.316  -17.470 1.00 113.54 ? 846  GLU A CD    1 
ATOM   6551  O  OE1   . GLU A 1  846  ? 113.544 54.128  -18.410 1.00 104.62 ? 846  GLU A OE1   1 
ATOM   6552  O  OE2   . GLU A 1  846  ? 113.187 52.182  -17.443 1.00 123.61 ? 846  GLU A OE2   1 
ATOM   6553  N  N     . ASP A 1  847  ? 118.365 54.948  -18.060 1.00 74.19  ? 847  ASP A N     1 
ATOM   6554  C  CA    . ASP A 1  847  ? 119.365 54.875  -19.131 1.00 75.71  ? 847  ASP A CA    1 
ATOM   6555  C  C     . ASP A 1  847  ? 120.719 55.621  -18.896 1.00 80.57  ? 847  ASP A C     1 
ATOM   6556  O  O     . ASP A 1  847  ? 121.697 55.371  -19.639 1.00 82.71  ? 847  ASP A O     1 
ATOM   6557  C  CB    . ASP A 1  847  ? 118.726 55.371  -20.438 1.00 78.59  ? 847  ASP A CB    1 
ATOM   6558  C  CG    . ASP A 1  847  ? 118.326 56.843  -20.438 1.00 95.96  ? 847  ASP A CG    1 
ATOM   6559  O  OD1   . ASP A 1  847  ? 118.091 57.406  -19.328 1.00 96.95  ? 847  ASP A OD1   1 
ATOM   6560  O  OD2   . ASP A 1  847  ? 118.203 57.427  -21.546 1.00 105.08 ? 847  ASP A OD2   1 
ATOM   6561  N  N     . ILE A 1  848  ? 120.782 56.520  -17.891 1.00 73.69  ? 848  ILE A N     1 
ATOM   6562  C  CA    . ILE A 1  848  ? 122.029 57.224  -17.597 1.00 72.26  ? 848  ILE A CA    1 
ATOM   6563  C  C     . ILE A 1  848  ? 122.997 56.290  -16.885 1.00 76.59  ? 848  ILE A C     1 
ATOM   6564  O  O     . ILE A 1  848  ? 122.636 55.703  -15.853 1.00 76.63  ? 848  ILE A O     1 
ATOM   6565  C  CB    . ILE A 1  848  ? 121.821 58.520  -16.798 1.00 74.12  ? 848  ILE A CB    1 
ATOM   6566  C  CG1   . ILE A 1  848  ? 120.714 59.372  -17.427 1.00 74.84  ? 848  ILE A CG1   1 
ATOM   6567  C  CG2   . ILE A 1  848  ? 123.143 59.290  -16.699 1.00 73.29  ? 848  ILE A CG2   1 
ATOM   6568  C  CD1   . ILE A 1  848  ? 119.918 60.126  -16.476 1.00 80.11  ? 848  ILE A CD1   1 
ATOM   6569  N  N     . MET A 1  849  ? 124.223 56.146  -17.462 1.00 72.32  ? 849  MET A N     1 
ATOM   6570  C  CA    . MET A 1  849  ? 125.339 55.351  -16.933 1.00 70.85  ? 849  MET A CA    1 
ATOM   6571  C  C     . MET A 1  849  ? 126.701 55.965  -17.264 1.00 74.87  ? 849  MET A C     1 
ATOM   6572  O  O     . MET A 1  849  ? 126.771 56.896  -18.065 1.00 74.66  ? 849  MET A O     1 
ATOM   6573  C  CB    . MET A 1  849  ? 125.249 53.874  -17.360 1.00 72.98  ? 849  MET A CB    1 
ATOM   6574  C  CG    . MET A 1  849  ? 125.897 53.531  -18.670 1.00 76.71  ? 849  MET A CG    1 
ATOM   6575  S  SD    . MET A 1  849  ? 126.251 51.752  -18.739 1.00 80.77  ? 849  MET A SD    1 
ATOM   6576  C  CE    . MET A 1  849  ? 127.649 51.783  -19.797 1.00 78.06  ? 849  MET A CE    1 
ATOM   6577  N  N     . VAL A 1  850  ? 127.775 55.471  -16.627 1.00 71.58  ? 850  VAL A N     1 
ATOM   6578  C  CA    . VAL A 1  850  ? 129.112 55.960  -16.942 1.00 71.47  ? 850  VAL A CA    1 
ATOM   6579  C  C     . VAL A 1  850  ? 129.621 55.118  -18.077 1.00 76.82  ? 850  VAL A C     1 
ATOM   6580  O  O     . VAL A 1  850  ? 129.463 53.890  -18.048 1.00 76.81  ? 850  VAL A O     1 
ATOM   6581  C  CB    . VAL A 1  850  ? 130.118 55.945  -15.777 1.00 74.47  ? 850  VAL A CB    1 
ATOM   6582  C  CG1   . VAL A 1  850  ? 131.386 56.693  -16.176 1.00 74.70  ? 850  VAL A CG1   1 
ATOM   6583  C  CG2   . VAL A 1  850  ? 129.521 56.558  -14.527 1.00 73.30  ? 850  VAL A CG2   1 
ATOM   6584  N  N     . HIS A 1  851  ? 130.222 55.770  -19.078 1.00 74.00  ? 851  HIS A N     1 
ATOM   6585  C  CA    . HIS A 1  851  ? 130.802 55.070  -20.217 1.00 74.99  ? 851  HIS A CA    1 
ATOM   6586  C  C     . HIS A 1  851  ? 132.272 55.025  -20.000 1.00 80.51  ? 851  HIS A C     1 
ATOM   6587  O  O     . HIS A 1  851  ? 132.784 55.842  -19.222 1.00 77.81  ? 851  HIS A O     1 
ATOM   6588  C  CB    . HIS A 1  851  ? 130.432 55.731  -21.543 1.00 75.83  ? 851  HIS A CB    1 
ATOM   6589  C  CG    . HIS A 1  851  ? 128.966 55.689  -21.780 1.00 78.28  ? 851  HIS A CG    1 
ATOM   6590  N  ND1   . HIS A 1  851  ? 128.397 54.680  -22.509 1.00 80.38  ? 851  HIS A ND1   1 
ATOM   6591  C  CD2   . HIS A 1  851  ? 127.986 56.476  -21.279 1.00 79.08  ? 851  HIS A CD2   1 
ATOM   6592  C  CE1   . HIS A 1  851  ? 127.091 54.909  -22.485 1.00 79.36  ? 851  HIS A CE1   1 
ATOM   6593  N  NE2   . HIS A 1  851  ? 126.794 55.970  -21.744 1.00 78.86  ? 851  HIS A NE2   1 
ATOM   6594  N  N     . TYR A 1  852  ? 132.946 54.048  -20.662 1.00 80.97  ? 852  TYR A N     1 
ATOM   6595  C  CA    . TYR A 1  852  ? 134.389 53.773  -20.575 1.00 82.78  ? 852  TYR A CA    1 
ATOM   6596  C  C     . TYR A 1  852  ? 135.316 55.022  -20.748 1.00 88.29  ? 852  TYR A C     1 
ATOM   6597  O  O     . TYR A 1  852  ? 136.521 54.924  -20.433 1.00 88.27  ? 852  TYR A O     1 
ATOM   6598  C  CB    . TYR A 1  852  ? 134.787 52.638  -21.536 1.00 85.08  ? 852  TYR A CB    1 
ATOM   6599  C  CG    . TYR A 1  852  ? 134.478 51.279  -20.964 1.00 85.62  ? 852  TYR A CG    1 
ATOM   6600  C  CD1   . TYR A 1  852  ? 135.315 50.692  -20.027 1.00 85.83  ? 852  TYR A CD1   1 
ATOM   6601  C  CD2   . TYR A 1  852  ? 133.324 50.596  -21.325 1.00 88.22  ? 852  TYR A CD2   1 
ATOM   6602  C  CE1   . TYR A 1  852  ? 134.999 49.472  -19.439 1.00 86.83  ? 852  TYR A CE1   1 
ATOM   6603  C  CE2   . TYR A 1  852  ? 133.025 49.344  -20.787 1.00 90.08  ? 852  TYR A CE2   1 
ATOM   6604  C  CZ    . TYR A 1  852  ? 133.864 48.788  -19.837 1.00 95.48  ? 852  TYR A CZ    1 
ATOM   6605  O  OH    . TYR A 1  852  ? 133.548 47.587  -19.250 1.00 96.11  ? 852  TYR A OH    1 
ATOM   6606  N  N     . ASP A 1  853  ? 134.715 56.193  -21.162 1.00 84.20  ? 853  ASP A N     1 
ATOM   6607  C  CA    . ASP A 1  853  ? 135.341 57.512  -21.349 1.00 84.25  ? 853  ASP A CA    1 
ATOM   6608  C  C     . ASP A 1  853  ? 135.094 58.505  -20.136 1.00 86.32  ? 853  ASP A C     1 
ATOM   6609  O  O     . ASP A 1  853  ? 135.416 59.703  -20.222 1.00 85.55  ? 853  ASP A O     1 
ATOM   6610  C  CB    . ASP A 1  853  ? 134.930 58.130  -22.726 1.00 86.86  ? 853  ASP A CB    1 
ATOM   6611  C  CG    . ASP A 1  853  ? 133.499 58.637  -22.887 1.00 89.21  ? 853  ASP A CG    1 
ATOM   6612  O  OD1   . ASP A 1  853  ? 132.702 58.461  -21.952 1.00 89.24  ? 853  ASP A OD1   1 
ATOM   6613  O  OD2   . ASP A 1  853  ? 133.181 59.211  -23.966 1.00 87.05  ? 853  ASP A OD2   1 
ATOM   6614  N  N     . ASN A 1  854  ? 134.555 57.971  -19.007 1.00 81.94  ? 854  ASN A N     1 
ATOM   6615  C  CA    . ASN A 1  854  ? 134.239 58.674  -17.745 1.00 81.16  ? 854  ASN A CA    1 
ATOM   6616  C  C     . ASN A 1  854  ? 133.112 59.729  -17.872 1.00 82.95  ? 854  ASN A C     1 
ATOM   6617  O  O     . ASN A 1  854  ? 132.706 60.358  -16.881 1.00 80.78  ? 854  ASN A O     1 
ATOM   6618  C  CB    . ASN A 1  854  ? 135.485 59.272  -17.096 1.00 85.33  ? 854  ASN A CB    1 
ATOM   6619  C  CG    . ASN A 1  854  ? 136.367 58.257  -16.422 1.00 119.81 ? 854  ASN A CG    1 
ATOM   6620  O  OD1   . ASN A 1  854  ? 135.951 57.551  -15.485 1.00 112.46 ? 854  ASN A OD1   1 
ATOM   6621  N  ND2   . ASN A 1  854  ? 137.627 58.207  -16.854 1.00 118.67 ? 854  ASN A ND2   1 
ATOM   6622  N  N     . THR A 1  855  ? 132.587 59.867  -19.088 1.00 78.63  ? 855  THR A N     1 
ATOM   6623  C  CA    . THR A 1  855  ? 131.485 60.736  -19.387 1.00 77.17  ? 855  THR A CA    1 
ATOM   6624  C  C     . THR A 1  855  ? 130.194 60.050  -18.971 1.00 78.78  ? 855  THR A C     1 
ATOM   6625  O  O     . THR A 1  855  ? 130.099 58.828  -19.077 1.00 78.66  ? 855  THR A O     1 
ATOM   6626  C  CB    . THR A 1  855  ? 131.536 61.123  -20.849 1.00 87.22  ? 855  THR A CB    1 
ATOM   6627  O  OG1   . THR A 1  855  ? 130.783 62.307  -20.997 1.00 101.21 ? 855  THR A OG1   1 
ATOM   6628  C  CG2   . THR A 1  855  ? 130.934 60.104  -21.739 1.00 79.52  ? 855  THR A CG2   1 
ATOM   6629  N  N     . THR A 1  856  ? 129.222 60.825  -18.472 1.00 74.50  ? 856  THR A N     1 
ATOM   6630  C  CA    . THR A 1  856  ? 127.903 60.346  -18.032 1.00 74.09  ? 856  THR A CA    1 
ATOM   6631  C  C     . THR A 1  856  ? 126.884 60.637  -19.152 1.00 77.54  ? 856  THR A C     1 
ATOM   6632  O  O     . THR A 1  856  ? 126.650 61.801  -19.481 1.00 79.32  ? 856  THR A O     1 
ATOM   6633  C  CB    . THR A 1  856  ? 127.560 60.944  -16.639 1.00 85.50  ? 856  THR A CB    1 
ATOM   6634  O  OG1   . THR A 1  856  ? 128.139 60.140  -15.614 1.00 86.49  ? 856  THR A OG1   1 
ATOM   6635  C  CG2   . THR A 1  856  ? 126.083 61.035  -16.379 1.00 85.63  ? 856  THR A CG2   1 
ATOM   6636  N  N     . ARG A 1  857  ? 126.321 59.599  -19.769 1.00 71.12  ? 857  ARG A N     1 
ATOM   6637  C  CA    . ARG A 1  857  ? 125.406 59.814  -20.886 1.00 70.62  ? 857  ARG A CA    1 
ATOM   6638  C  C     . ARG A 1  857  ? 124.132 58.964  -20.817 1.00 75.88  ? 857  ARG A C     1 
ATOM   6639  O  O     . ARG A 1  857  ? 124.126 57.875  -20.230 1.00 76.98  ? 857  ARG A O     1 
ATOM   6640  C  CB    . ARG A 1  857  ? 126.104 59.521  -22.222 1.00 68.90  ? 857  ARG A CB    1 
ATOM   6641  C  CG    . ARG A 1  857  ? 127.451 60.163  -22.478 1.00 67.72  ? 857  ARG A CG    1 
ATOM   6642  C  CD    . ARG A 1  857  ? 127.958 59.670  -23.813 1.00 64.21  ? 857  ARG A CD    1 
ATOM   6643  N  NE    . ARG A 1  857  ? 129.298 60.151  -24.106 1.00 70.43  ? 857  ARG A NE    1 
ATOM   6644  C  CZ    . ARG A 1  857  ? 129.692 60.617  -25.286 1.00 89.61  ? 857  ARG A CZ    1 
ATOM   6645  N  NH1   . ARG A 1  857  ? 128.853 60.641  -26.311 1.00 82.47  ? 857  ARG A NH1   1 
ATOM   6646  N  NH2   . ARG A 1  857  ? 130.949 60.997  -25.469 1.00 76.48  ? 857  ARG A NH2   1 
ATOM   6647  N  N     . ASN A 1  858  ? 123.073 59.431  -21.499 1.00 71.02  ? 858  ASN A N     1 
ATOM   6648  C  CA    . ASN A 1  858  ? 121.791 58.746  -21.579 1.00 69.57  ? 858  ASN A CA    1 
ATOM   6649  C  C     . ASN A 1  858  ? 121.772 57.823  -22.821 1.00 75.77  ? 858  ASN A C     1 
ATOM   6650  O  O     . ASN A 1  858  ? 122.805 57.722  -23.506 1.00 76.72  ? 858  ASN A O     1 
ATOM   6651  C  CB    . ASN A 1  858  ? 120.683 59.769  -21.606 1.00 64.78  ? 858  ASN A CB    1 
ATOM   6652  C  CG    . ASN A 1  858  ? 120.474 60.368  -22.955 1.00 91.57  ? 858  ASN A CG    1 
ATOM   6653  O  OD1   . ASN A 1  858  ? 119.401 60.245  -23.530 1.00 105.62 ? 858  ASN A OD1   1 
ATOM   6654  N  ND2   . ASN A 1  858  ? 121.505 60.931  -23.537 1.00 74.42  ? 858  ASN A ND2   1 
ATOM   6655  N  N     . SER A 1  859  ? 120.600 57.155  -23.111 1.00 71.99  ? 859  SER A N     1 
ATOM   6656  C  CA    . SER A 1  859  ? 120.415 56.203  -24.228 1.00 72.12  ? 859  SER A CA    1 
ATOM   6657  C  C     . SER A 1  859  ? 120.605 56.850  -25.633 1.00 77.73  ? 859  SER A C     1 
ATOM   6658  O  O     . SER A 1  859  ? 120.744 56.150  -26.653 1.00 78.23  ? 859  SER A O     1 
ATOM   6659  C  CB    . SER A 1  859  ? 119.091 55.444  -24.111 1.00 73.58  ? 859  SER A CB    1 
ATOM   6660  O  OG    . SER A 1  859  ? 117.922 56.205  -24.364 1.00 80.49  ? 859  SER A OG    1 
ATOM   6661  N  N     . LEU A 1  860  ? 120.703 58.183  -25.658 1.00 74.82  ? 860  LEU A N     1 
ATOM   6662  C  CA    . LEU A 1  860  ? 120.942 58.931  -26.882 1.00 76.42  ? 860  LEU A CA    1 
ATOM   6663  C  C     . LEU A 1  860  ? 122.422 59.292  -27.032 1.00 81.24  ? 860  LEU A C     1 
ATOM   6664  O  O     . LEU A 1  860  ? 122.820 59.845  -28.068 1.00 82.74  ? 860  LEU A O     1 
ATOM   6665  C  CB    . LEU A 1  860  ? 120.066 60.188  -26.909 1.00 76.50  ? 860  LEU A CB    1 
ATOM   6666  C  CG    . LEU A 1  860  ? 118.640 59.967  -27.367 1.00 81.68  ? 860  LEU A CG    1 
ATOM   6667  C  CD1   . LEU A 1  860  ? 117.712 60.998  -26.767 1.00 81.33  ? 860  LEU A CD1   1 
ATOM   6668  C  CD2   . LEU A 1  860  ? 118.556 59.971  -28.882 1.00 87.32  ? 860  LEU A CD2   1 
ATOM   6669  N  N     . GLY A 1  861  ? 123.214 58.973  -26.003 1.00 75.62  ? 861  GLY A N     1 
ATOM   6670  C  CA    . GLY A 1  861  ? 124.633 59.290  -25.963 1.00 75.41  ? 861  GLY A CA    1 
ATOM   6671  C  C     . GLY A 1  861  ? 124.871 60.771  -25.750 1.00 79.82  ? 861  GLY A C     1 
ATOM   6672  O  O     . GLY A 1  861  ? 125.966 61.278  -26.001 1.00 80.47  ? 861  GLY A O     1 
ATOM   6673  N  N     . ASN A 1  862  ? 123.839 61.489  -25.304 1.00 76.12  ? 862  ASN A N     1 
ATOM   6674  C  CA    . ASN A 1  862  ? 123.980 62.902  -25.007 1.00 75.83  ? 862  ASN A CA    1 
ATOM   6675  C  C     . ASN A 1  862  ? 124.637 62.986  -23.625 1.00 76.72  ? 862  ASN A C     1 
ATOM   6676  O  O     . ASN A 1  862  ? 124.268 62.248  -22.709 1.00 73.47  ? 862  ASN A O     1 
ATOM   6677  C  CB    . ASN A 1  862  ? 122.621 63.661  -25.045 1.00 78.62  ? 862  ASN A CB    1 
ATOM   6678  C  CG    . ASN A 1  862  ? 121.772 63.522  -26.306 1.00 105.17 ? 862  ASN A CG    1 
ATOM   6679  O  OD1   . ASN A 1  862  ? 122.248 63.583  -27.453 1.00 99.16  ? 862  ASN A OD1   1 
ATOM   6680  N  ND2   . ASN A 1  862  ? 120.461 63.423  -26.113 1.00 97.25  ? 862  ASN A ND2   1 
ATOM   6681  N  N     . VAL A 1  863  ? 125.652 63.836  -23.503 1.00 74.66  ? 863  VAL A N     1 
ATOM   6682  C  CA    . VAL A 1  863  ? 126.365 64.049  -22.241 1.00 73.75  ? 863  VAL A CA    1 
ATOM   6683  C  C     . VAL A 1  863  ? 125.450 64.797  -21.221 1.00 81.93  ? 863  VAL A C     1 
ATOM   6684  O  O     . VAL A 1  863  ? 124.813 65.814  -21.572 1.00 83.69  ? 863  VAL A O     1 
ATOM   6685  C  CB    . VAL A 1  863  ? 127.756 64.726  -22.476 1.00 75.28  ? 863  VAL A CB    1 
ATOM   6686  C  CG1   . VAL A 1  863  ? 128.408 65.192  -21.175 1.00 73.30  ? 863  VAL A CG1   1 
ATOM   6687  C  CG2   . VAL A 1  863  ? 128.681 63.784  -23.234 1.00 75.04  ? 863  VAL A CG2   1 
ATOM   6688  N  N     . ILE A 1  864  ? 125.336 64.227  -19.994 1.00 77.89  ? 864  ILE A N     1 
ATOM   6689  C  CA    . ILE A 1  864  ? 124.616 64.823  -18.873 1.00 77.64  ? 864  ILE A CA    1 
ATOM   6690  C  C     . ILE A 1  864  ? 125.699 65.460  -18.019 1.00 85.29  ? 864  ILE A C     1 
ATOM   6691  O  O     . ILE A 1  864  ? 125.702 66.684  -17.852 1.00 88.25  ? 864  ILE A O     1 
ATOM   6692  C  CB    . ILE A 1  864  ? 123.715 63.828  -18.097 1.00 79.48  ? 864  ILE A CB    1 
ATOM   6693  C  CG1   . ILE A 1  864  ? 122.490 63.486  -18.917 1.00 80.08  ? 864  ILE A CG1   1 
ATOM   6694  C  CG2   . ILE A 1  864  ? 123.273 64.386  -16.737 1.00 79.72  ? 864  ILE A CG2   1 
ATOM   6695  C  CD1   . ILE A 1  864  ? 122.667 62.332  -19.774 1.00 93.12  ? 864  ILE A CD1   1 
ATOM   6696  N  N     . GLN A 1  865  ? 126.640 64.645  -17.518 1.00 80.46  ? 865  GLN A N     1 
ATOM   6697  C  CA    . GLN A 1  865  ? 127.785 65.127  -16.749 1.00 79.93  ? 865  GLN A CA    1 
ATOM   6698  C  C     . GLN A 1  865  ? 128.994 64.782  -17.596 1.00 83.03  ? 865  GLN A C     1 
ATOM   6699  O  O     . GLN A 1  865  ? 128.990 63.717  -18.217 1.00 82.98  ? 865  GLN A O     1 
ATOM   6700  C  CB    . GLN A 1  865  ? 127.875 64.407  -15.386 1.00 80.27  ? 865  GLN A CB    1 
ATOM   6701  C  CG    . GLN A 1  865  ? 127.004 65.007  -14.282 1.00 85.80  ? 865  GLN A CG    1 
ATOM   6702  C  CD    . GLN A 1  865  ? 126.932 64.142  -13.038 1.00 95.22  ? 865  GLN A CD    1 
ATOM   6703  O  OE1   . GLN A 1  865  ? 127.356 62.976  -13.027 1.00 87.50  ? 865  GLN A OE1   1 
ATOM   6704  N  NE2   . GLN A 1  865  ? 126.352 64.682  -11.964 1.00 82.63  ? 865  GLN A NE2   1 
ATOM   6705  N  N     . PHE A 1  866  ? 130.016 65.657  -17.646 1.00 78.10  ? 866  PHE A N     1 
ATOM   6706  C  CA    . PHE A 1  866  ? 131.220 65.334  -18.408 1.00 77.46  ? 866  PHE A CA    1 
ATOM   6707  C  C     . PHE A 1  866  ? 132.077 64.304  -17.707 1.00 81.54  ? 866  PHE A C     1 
ATOM   6708  O  O     . PHE A 1  866  ? 132.816 63.568  -18.374 1.00 82.48  ? 866  PHE A O     1 
ATOM   6709  C  CB    . PHE A 1  866  ? 132.016 66.568  -18.791 1.00 79.59  ? 866  PHE A CB    1 
ATOM   6710  C  CG    . PHE A 1  866  ? 131.543 67.118  -20.109 1.00 82.03  ? 866  PHE A CG    1 
ATOM   6711  C  CD1   . PHE A 1  866  ? 131.920 66.517  -21.308 1.00 84.42  ? 866  PHE A CD1   1 
ATOM   6712  C  CD2   . PHE A 1  866  ? 130.690 68.218  -20.156 1.00 86.02  ? 866  PHE A CD2   1 
ATOM   6713  C  CE1   . PHE A 1  866  ? 131.473 67.020  -22.532 1.00 88.55  ? 866  PHE A CE1   1 
ATOM   6714  C  CE2   . PHE A 1  866  ? 130.241 68.726  -21.384 1.00 87.99  ? 866  PHE A CE2   1 
ATOM   6715  C  CZ    . PHE A 1  866  ? 130.636 68.122  -22.563 1.00 87.48  ? 866  PHE A CZ    1 
ATOM   6716  N  N     . ILE A 1  867  ? 131.945 64.235  -16.362 1.00 77.06  ? 867  ILE A N     1 
ATOM   6717  C  CA    . ILE A 1  867  ? 132.616 63.310  -15.433 1.00 76.83  ? 867  ILE A CA    1 
ATOM   6718  C  C     . ILE A 1  867  ? 131.670 63.090  -14.243 1.00 82.50  ? 867  ILE A C     1 
ATOM   6719  O  O     . ILE A 1  867  ? 131.099 64.072  -13.755 1.00 82.27  ? 867  ILE A O     1 
ATOM   6720  C  CB    . ILE A 1  867  ? 134.061 63.807  -15.079 1.00 79.47  ? 867  ILE A CB    1 
ATOM   6721  C  CG1   . ILE A 1  867  ? 135.107 63.129  -15.982 1.00 81.29  ? 867  ILE A CG1   1 
ATOM   6722  C  CG2   . ILE A 1  867  ? 134.446 63.735  -13.615 1.00 76.48  ? 867  ILE A CG2   1 
ATOM   6723  C  CD1   . ILE A 1  867  ? 135.485 64.019  -17.358 1.00 96.56  ? 867  ILE A CD1   1 
ATOM   6724  N  N     . TYR A 1  868  ? 131.452 61.811  -13.821 1.00 79.44  ? 868  TYR A N     1 
ATOM   6725  C  CA    . TYR A 1  868  ? 130.511 61.480  -12.739 1.00 79.07  ? 868  TYR A CA    1 
ATOM   6726  C  C     . TYR A 1  868  ? 130.679 62.337  -11.502 1.00 83.88  ? 868  TYR A C     1 
ATOM   6727  O  O     . TYR A 1  868  ? 131.784 62.452  -10.980 1.00 83.35  ? 868  TYR A O     1 
ATOM   6728  C  CB    . TYR A 1  868  ? 130.534 59.986  -12.362 1.00 80.16  ? 868  TYR A CB    1 
ATOM   6729  C  CG    . TYR A 1  868  ? 129.528 59.588  -11.292 1.00 80.79  ? 868  TYR A CG    1 
ATOM   6730  C  CD1   . TYR A 1  868  ? 128.168 59.577  -11.556 1.00 82.06  ? 868  TYR A CD1   1 
ATOM   6731  C  CD2   . TYR A 1  868  ? 129.943 59.228  -10.014 1.00 81.64  ? 868  TYR A CD2   1 
ATOM   6732  C  CE1   . TYR A 1  868  ? 127.245 59.209  -10.581 1.00 82.92  ? 868  TYR A CE1   1 
ATOM   6733  C  CE2   . TYR A 1  868  ? 129.031 58.824  -9.041  1.00 82.24  ? 868  TYR A CE2   1 
ATOM   6734  C  CZ    . TYR A 1  868  ? 127.680 58.811  -9.331  1.00 90.03  ? 868  TYR A CZ    1 
ATOM   6735  O  OH    . TYR A 1  868  ? 126.760 58.413  -8.389  1.00 92.99  ? 868  TYR A OH    1 
ATOM   6736  N  N     . GLY A 1  869  ? 129.571 62.941  -11.067 1.00 81.37  ? 869  GLY A N     1 
ATOM   6737  C  CA    . GLY A 1  869  ? 129.508 63.813  -9.897  1.00 81.24  ? 869  GLY A CA    1 
ATOM   6738  C  C     . GLY A 1  869  ? 130.581 64.886  -9.869  1.00 84.75  ? 869  GLY A C     1 
ATOM   6739  O  O     . GLY A 1  869  ? 131.065 65.238  -8.793  1.00 85.17  ? 869  GLY A O     1 
ATOM   6740  N  N     . GLU A 1  870  ? 130.997 65.368  -11.068 1.00 79.72  ? 870  GLU A N     1 
ATOM   6741  C  CA    . GLU A 1  870  ? 132.009 66.403  -11.311 1.00 79.00  ? 870  GLU A CA    1 
ATOM   6742  C  C     . GLU A 1  870  ? 133.436 65.971  -10.892 1.00 83.60  ? 870  GLU A C     1 
ATOM   6743  O  O     . GLU A 1  870  ? 134.383 66.705  -11.176 1.00 85.57  ? 870  GLU A O     1 
ATOM   6744  C  CB    . GLU A 1  870  ? 131.594 67.761  -10.687 1.00 79.85  ? 870  GLU A CB    1 
ATOM   6745  C  CG    . GLU A 1  870  ? 130.366 68.328  -11.379 1.00 87.05  ? 870  GLU A CG    1 
ATOM   6746  C  CD    . GLU A 1  870  ? 129.544 69.444  -10.762 1.00 109.25 ? 870  GLU A CD    1 
ATOM   6747  O  OE1   . GLU A 1  870  ? 130.123 70.397  -10.189 1.00 108.06 ? 870  GLU A OE1   1 
ATOM   6748  O  OE2   . GLU A 1  870  ? 128.306 69.411  -10.956 1.00 101.86 ? 870  GLU A OE2   1 
ATOM   6749  N  N     . ASP A 1  871  ? 133.608 64.760  -10.329 1.00 77.74  ? 871  ASP A N     1 
ATOM   6750  C  CA    . ASP A 1  871  ? 134.913 64.321  -9.855  1.00 78.10  ? 871  ASP A CA    1 
ATOM   6751  C  C     . ASP A 1  871  ? 135.392 62.926  -10.353 1.00 83.20  ? 871  ASP A C     1 
ATOM   6752  O  O     . ASP A 1  871  ? 136.570 62.581  -10.194 1.00 83.24  ? 871  ASP A O     1 
ATOM   6753  C  CB    . ASP A 1  871  ? 134.921 64.376  -8.313  1.00 80.12  ? 871  ASP A CB    1 
ATOM   6754  C  CG    . ASP A 1  871  ? 134.127 63.287  -7.609  1.00 91.48  ? 871  ASP A CG    1 
ATOM   6755  O  OD1   . ASP A 1  871  ? 133.460 62.498  -8.306  1.00 92.85  ? 871  ASP A OD1   1 
ATOM   6756  O  OD2   . ASP A 1  871  ? 134.181 63.220  -6.347  1.00 95.23  ? 871  ASP A OD2   1 
ATOM   6757  N  N     . GLY A 1  872  ? 134.457 62.133  -10.871 1.00 79.80  ? 872  GLY A N     1 
ATOM   6758  C  CA    . GLY A 1  872  ? 134.677 60.782  -11.375 1.00 79.22  ? 872  GLY A CA    1 
ATOM   6759  C  C     . GLY A 1  872  ? 134.942 59.761  -10.298 1.00 82.17  ? 872  GLY A C     1 
ATOM   6760  O  O     . GLY A 1  872  ? 135.532 58.724  -10.581 1.00 82.77  ? 872  GLY A O     1 
ATOM   6761  N  N     . MET A 1  873  ? 134.466 60.018  -9.076  1.00 78.17  ? 873  MET A N     1 
ATOM   6762  C  CA    . MET A 1  873  ? 134.657 59.157  -7.907  1.00 78.35  ? 873  MET A CA    1 
ATOM   6763  C  C     . MET A 1  873  ? 133.392 58.380  -7.512  1.00 82.61  ? 873  MET A C     1 
ATOM   6764  O  O     . MET A 1  873  ? 132.292 58.937  -7.556  1.00 81.96  ? 873  MET A O     1 
ATOM   6765  C  CB    . MET A 1  873  ? 135.134 60.013  -6.725  1.00 80.87  ? 873  MET A CB    1 
ATOM   6766  C  CG    . MET A 1  873  ? 136.330 59.467  -6.019  1.00 85.41  ? 873  MET A CG    1 
ATOM   6767  S  SD    . MET A 1  873  ? 137.762 59.133  -7.081  1.00 91.21  ? 873  MET A SD    1 
ATOM   6768  C  CE    . MET A 1  873  ? 138.157 60.820  -7.710  1.00 88.49  ? 873  MET A CE    1 
ATOM   6769  N  N     . ASP A 1  874  ? 133.550 57.096  -7.132  1.00 79.74  ? 874  ASP A N     1 
ATOM   6770  C  CA    . ASP A 1  874  ? 132.446 56.240  -6.679  1.00 80.08  ? 874  ASP A CA    1 
ATOM   6771  C  C     . ASP A 1  874  ? 132.117 56.640  -5.231  1.00 82.87  ? 874  ASP A C     1 
ATOM   6772  O  O     . ASP A 1  874  ? 132.967 56.527  -4.341  1.00 82.53  ? 874  ASP A O     1 
ATOM   6773  C  CB    . ASP A 1  874  ? 132.842 54.735  -6.782  1.00 83.60  ? 874  ASP A CB    1 
ATOM   6774  C  CG    . ASP A 1  874  ? 131.788 53.654  -6.481  1.00 96.98  ? 874  ASP A CG    1 
ATOM   6775  O  OD1   . ASP A 1  874  ? 130.755 53.978  -5.823  1.00 96.00  ? 874  ASP A OD1   1 
ATOM   6776  O  OD2   . ASP A 1  874  ? 132.023 52.471  -6.862  1.00 105.37 ? 874  ASP A OD2   1 
ATOM   6777  N  N     . ALA A 1  875  ? 130.877 57.107  -5.014  1.00 78.56  ? 875  ALA A N     1 
ATOM   6778  C  CA    . ALA A 1  875  ? 130.327 57.582  -3.739  1.00 77.97  ? 875  ALA A CA    1 
ATOM   6779  C  C     . ALA A 1  875  ? 130.552 56.670  -2.509  1.00 81.09  ? 875  ALA A C     1 
ATOM   6780  O  O     . ALA A 1  875  ? 130.501 57.188  -1.395  1.00 81.33  ? 875  ALA A O     1 
ATOM   6781  C  CB    . ALA A 1  875  ? 128.855 57.869  -3.903  1.00 78.17  ? 875  ALA A CB    1 
ATOM   6782  N  N     . ALA A 1  876  ? 130.787 55.341  -2.698  1.00 75.73  ? 876  ALA A N     1 
ATOM   6783  C  CA    . ALA A 1  876  ? 131.073 54.393  -1.618  1.00 75.66  ? 876  ALA A CA    1 
ATOM   6784  C  C     . ALA A 1  876  ? 132.443 54.694  -0.999  1.00 81.64  ? 876  ALA A C     1 
ATOM   6785  O  O     . ALA A 1  876  ? 132.619 54.627  0.220   1.00 81.04  ? 876  ALA A O     1 
ATOM   6786  C  CB    . ALA A 1  876  ? 131.083 52.988  -2.172  1.00 76.44  ? 876  ALA A CB    1 
ATOM   6787  N  N     . HIS A 1  877  ? 133.400 55.079  -1.863  1.00 80.53  ? 877  HIS A N     1 
ATOM   6788  C  CA    . HIS A 1  877  ? 134.807 55.379  -1.572  1.00 81.91  ? 877  HIS A CA    1 
ATOM   6789  C  C     . HIS A 1  877  ? 135.057 56.838  -1.176  1.00 87.52  ? 877  HIS A C     1 
ATOM   6790  O  O     . HIS A 1  877  ? 136.097 57.397  -1.525  1.00 88.37  ? 877  HIS A O     1 
ATOM   6791  C  CB    . HIS A 1  877  ? 135.651 55.043  -2.811  1.00 82.77  ? 877  HIS A CB    1 
ATOM   6792  C  CG    . HIS A 1  877  ? 135.558 53.616  -3.245  1.00 86.84  ? 877  HIS A CG    1 
ATOM   6793  N  ND1   . HIS A 1  877  ? 136.523 52.696  -2.901  1.00 89.64  ? 877  HIS A ND1   1 
ATOM   6794  C  CD2   . HIS A 1  877  ? 134.604 52.997  -3.980  1.00 88.58  ? 877  HIS A CD2   1 
ATOM   6795  C  CE1   . HIS A 1  877  ? 136.132 51.555  -3.439  1.00 89.38  ? 877  HIS A CE1   1 
ATOM   6796  N  NE2   . HIS A 1  877  ? 134.974 51.687  -4.086  1.00 88.94  ? 877  HIS A NE2   1 
ATOM   6797  N  N     . ILE A 1  878  ? 134.128 57.449  -0.432  1.00 84.11  ? 878  ILE A N     1 
ATOM   6798  C  CA    . ILE A 1  878  ? 134.211 58.854  -0.045  1.00 83.68  ? 878  ILE A CA    1 
ATOM   6799  C  C     . ILE A 1  878  ? 133.898 59.054  1.462   1.00 90.76  ? 878  ILE A C     1 
ATOM   6800  O  O     . ILE A 1  878  ? 132.868 58.575  1.959   1.00 91.77  ? 878  ILE A O     1 
ATOM   6801  C  CB    . ILE A 1  878  ? 133.296 59.615  -1.029  1.00 85.13  ? 878  ILE A CB    1 
ATOM   6802  C  CG1   . ILE A 1  878  ? 134.097 60.036  -2.242  1.00 85.10  ? 878  ILE A CG1   1 
ATOM   6803  C  CG2   . ILE A 1  878  ? 132.563 60.788  -0.429  1.00 86.09  ? 878  ILE A CG2   1 
ATOM   6804  C  CD1   . ILE A 1  878  ? 133.545 59.573  -3.431  1.00 93.85  ? 878  ILE A CD1   1 
ATOM   6805  N  N     . GLU A 1  879  ? 134.832 59.703  2.189   1.00 87.66  ? 879  GLU A N     1 
ATOM   6806  C  CA    . GLU A 1  879  ? 134.726 59.961  3.630   1.00 88.70  ? 879  GLU A CA    1 
ATOM   6807  C  C     . GLU A 1  879  ? 134.909 61.431  3.842   1.00 93.62  ? 879  GLU A C     1 
ATOM   6808  O  O     . GLU A 1  879  ? 135.766 62.017  3.185   1.00 93.30  ? 879  GLU A O     1 
ATOM   6809  C  CB    . GLU A 1  879  ? 135.846 59.236  4.400   1.00 91.42  ? 879  GLU A CB    1 
ATOM   6810  C  CG    . GLU A 1  879  ? 135.621 57.754  4.630   1.00 105.44 ? 879  GLU A CG    1 
ATOM   6811  C  CD    . GLU A 1  879  ? 136.891 56.932  4.761   1.00 126.00 ? 879  GLU A CD    1 
ATOM   6812  O  OE1   . GLU A 1  879  ? 137.471 56.902  5.871   1.00 112.78 ? 879  GLU A OE1   1 
ATOM   6813  O  OE2   . GLU A 1  879  ? 137.288 56.290  3.759   1.00 124.88 ? 879  GLU A OE2   1 
ATOM   6814  N  N     . LYS A 1  880  ? 134.146 62.031  4.779   1.00 91.60  ? 880  LYS A N     1 
ATOM   6815  C  CA    . LYS A 1  880  ? 134.270 63.453  5.124   1.00 92.13  ? 880  LYS A CA    1 
ATOM   6816  C  C     . LYS A 1  880  ? 135.661 63.658  5.744   1.00 96.16  ? 880  LYS A C     1 
ATOM   6817  O  O     . LYS A 1  880  ? 136.070 62.857  6.581   1.00 97.31  ? 880  LYS A O     1 
ATOM   6818  C  CB    . LYS A 1  880  ? 133.138 63.887  6.079   1.00 96.25  ? 880  LYS A CB    1 
ATOM   6819  C  CG    . LYS A 1  880  ? 132.855 65.401  6.100   1.00 117.66 ? 880  LYS A CG    1 
ATOM   6820  C  CD    . LYS A 1  880  ? 131.564 65.780  6.881   1.00 130.01 ? 880  LYS A CD    1 
ATOM   6821  C  CE    . LYS A 1  880  ? 130.276 65.747  6.066   1.00 137.89 ? 880  LYS A CE    1 
ATOM   6822  N  NZ    . LYS A 1  880  ? 129.694 64.375  5.965   1.00 142.68 ? 880  LYS A NZ    1 
ATOM   6823  N  N     . GLN A 1  881  ? 136.427 64.630  5.237   1.00 91.42  ? 881  GLN A N     1 
ATOM   6824  C  CA    . GLN A 1  881  ? 137.790 64.915  5.693   1.00 92.18  ? 881  GLN A CA    1 
ATOM   6825  C  C     . GLN A 1  881  ? 137.923 66.420  5.766   1.00 99.22  ? 881  GLN A C     1 
ATOM   6826  O  O     . GLN A 1  881  ? 137.353 67.082  4.898   1.00 99.93  ? 881  GLN A O     1 
ATOM   6827  C  CB    . GLN A 1  881  ? 138.809 64.380  4.675   1.00 92.34  ? 881  GLN A CB    1 
ATOM   6828  C  CG    . GLN A 1  881  ? 138.886 62.868  4.583   1.00 97.65  ? 881  GLN A CG    1 
ATOM   6829  C  CD    . GLN A 1  881  ? 140.120 62.425  3.849   1.00 103.58 ? 881  GLN A CD    1 
ATOM   6830  O  OE1   . GLN A 1  881  ? 141.202 62.253  4.447   1.00 99.27  ? 881  GLN A OE1   1 
ATOM   6831  N  NE2   . GLN A 1  881  ? 139.984 62.261  2.534   1.00 82.80  ? 881  GLN A NE2   1 
ATOM   6832  N  N     . SER A 1  882  ? 138.660 66.983  6.763   1.00 96.54  ? 882  SER A N     1 
ATOM   6833  C  CA    . SER A 1  882  ? 138.817 68.451  6.854   1.00 96.26  ? 882  SER A CA    1 
ATOM   6834  C  C     . SER A 1  882  ? 139.885 68.998  5.885   1.00 99.95  ? 882  SER A C     1 
ATOM   6835  O  O     . SER A 1  882  ? 140.648 68.216  5.323   1.00 98.85  ? 882  SER A O     1 
ATOM   6836  C  CB    . SER A 1  882  ? 139.051 68.914  8.291   1.00 99.96  ? 882  SER A CB    1 
ATOM   6837  O  OG    . SER A 1  882  ? 140.404 68.828  8.703   1.00 106.76 ? 882  SER A OG    1 
ATOM   6838  N  N     . LEU A 1  883  ? 139.884 70.323  5.632   1.00 97.97  ? 883  LEU A N     1 
ATOM   6839  C  CA    . LEU A 1  883  ? 140.852 71.010  4.754   1.00 98.64  ? 883  LEU A CA    1 
ATOM   6840  C  C     . LEU A 1  883  ? 141.449 72.150  5.607   1.00 108.01 ? 883  LEU A C     1 
ATOM   6841  O  O     . LEU A 1  883  ? 140.987 73.298  5.565   1.00 109.32 ? 883  LEU A O     1 
ATOM   6842  C  CB    . LEU A 1  883  ? 140.163 71.529  3.461   1.00 97.21  ? 883  LEU A CB    1 
ATOM   6843  C  CG    . LEU A 1  883  ? 139.445 70.487  2.575   1.00 99.53  ? 883  LEU A CG    1 
ATOM   6844  C  CD1   . LEU A 1  883  ? 138.087 70.945  2.185   1.00 98.73  ? 883  LEU A CD1   1 
ATOM   6845  C  CD2   . LEU A 1  883  ? 140.203 70.221  1.314   1.00 101.32 ? 883  LEU A CD2   1 
ATOM   6846  N  N     . ASP A 1  884  ? 142.424 71.796  6.458   1.00 107.00 ? 884  ASP A N     1 
ATOM   6847  C  CA    . ASP A 1  884  ? 143.047 72.677  7.464   1.00 109.67 ? 884  ASP A CA    1 
ATOM   6848  C  C     . ASP A 1  884  ? 143.760 73.915  6.888   1.00 115.67 ? 884  ASP A C     1 
ATOM   6849  O  O     . ASP A 1  884  ? 144.403 74.682  7.633   1.00 118.20 ? 884  ASP A O     1 
ATOM   6850  C  CB    . ASP A 1  884  ? 143.995 71.888  8.379   1.00 112.94 ? 884  ASP A CB    1 
ATOM   6851  C  CG    . ASP A 1  884  ? 143.915 70.389  8.219   1.00 128.16 ? 884  ASP A CG    1 
ATOM   6852  O  OD1   . ASP A 1  884  ? 144.252 69.886  7.110   1.00 134.06 ? 884  ASP A OD1   1 
ATOM   6853  O  OD2   . ASP A 1  884  ? 143.504 69.714  9.189   1.00 130.85 ? 884  ASP A OD2   1 
ATOM   6854  N  N     . THR A 1  885  ? 143.652 74.098  5.562   1.00 109.23 ? 885  THR A N     1 
ATOM   6855  C  CA    . THR A 1  885  ? 144.192 75.248  4.858   1.00 107.95 ? 885  THR A CA    1 
ATOM   6856  C  C     . THR A 1  885  ? 143.091 76.347  4.870   1.00 110.27 ? 885  THR A C     1 
ATOM   6857  O  O     . THR A 1  885  ? 143.434 77.528  5.011   1.00 111.08 ? 885  THR A O     1 
ATOM   6858  C  CB    . THR A 1  885  ? 144.783 74.809  3.496   1.00 105.19 ? 885  THR A CB    1 
ATOM   6859  O  OG1   . THR A 1  885  ? 145.745 73.800  3.749   1.00 99.93  ? 885  THR A OG1   1 
ATOM   6860  C  CG2   . THR A 1  885  ? 145.511 75.911  2.783   1.00 102.40 ? 885  THR A CG2   1 
ATOM   6861  N  N     . ILE A 1  886  ? 141.782 75.948  4.848   1.00 103.84 ? 886  ILE A N     1 
ATOM   6862  C  CA    . ILE A 1  886  ? 140.667 76.895  4.849   1.00 103.86 ? 886  ILE A CA    1 
ATOM   6863  C  C     . ILE A 1  886  ? 140.670 77.778  6.072   1.00 113.77 ? 886  ILE A C     1 
ATOM   6864  O  O     . ILE A 1  886  ? 140.941 78.975  5.957   1.00 115.32 ? 886  ILE A O     1 
ATOM   6865  C  CB    . ILE A 1  886  ? 139.267 76.283  4.621   1.00 105.10 ? 886  ILE A CB    1 
ATOM   6866  C  CG1   . ILE A 1  886  ? 139.259 75.404  3.395   1.00 104.60 ? 886  ILE A CG1   1 
ATOM   6867  C  CG2   . ILE A 1  886  ? 138.220 77.388  4.466   1.00 105.00 ? 886  ILE A CG2   1 
ATOM   6868  C  CD1   . ILE A 1  886  ? 137.940 74.710  3.110   1.00 116.55 ? 886  ILE A CD1   1 
ATOM   6869  N  N     . GLY A 1  887  ? 140.357 77.196  7.223   1.00 112.57 ? 887  GLY A N     1 
ATOM   6870  C  CA    . GLY A 1  887  ? 140.215 77.950  8.464   1.00 114.67 ? 887  GLY A CA    1 
ATOM   6871  C  C     . GLY A 1  887  ? 141.465 78.489  9.127   1.00 119.53 ? 887  GLY A C     1 
ATOM   6872  O  O     . GLY A 1  887  ? 142.574 78.402  8.587   1.00 118.24 ? 887  GLY A O     1 
ATOM   6873  N  N     . GLY A 1  888  ? 141.242 79.061  10.308  1.00 117.99 ? 888  GLY A N     1 
ATOM   6874  C  CA    . GLY A 1  888  ? 142.269 79.588  11.193  1.00 119.64 ? 888  GLY A CA    1 
ATOM   6875  C  C     . GLY A 1  888  ? 142.821 80.935  10.812  1.00 124.32 ? 888  GLY A C     1 
ATOM   6876  O  O     . GLY A 1  888  ? 142.577 81.428  9.707   1.00 123.43 ? 888  GLY A O     1 
ATOM   6877  N  N     . SER A 1  889  ? 143.583 81.529  11.740  1.00 122.20 ? 889  SER A N     1 
ATOM   6878  C  CA    . SER A 1  889  ? 144.220 82.820  11.526  1.00 123.20 ? 889  SER A CA    1 
ATOM   6879  C  C     . SER A 1  889  ? 145.301 82.672  10.501  1.00 124.71 ? 889  SER A C     1 
ATOM   6880  O  O     . SER A 1  889  ? 145.844 81.572  10.332  1.00 122.69 ? 889  SER A O     1 
ATOM   6881  C  CB    . SER A 1  889  ? 144.828 83.339  12.822  1.00 130.29 ? 889  SER A CB    1 
ATOM   6882  O  OG    . SER A 1  889  ? 145.813 82.446  13.311  1.00 141.46 ? 889  SER A OG    1 
ATOM   6883  N  N     . ASP A 1  890  ? 145.640 83.778  9.835   1.00 121.59 ? 890  ASP A N     1 
ATOM   6884  C  CA    . ASP A 1  890  ? 146.703 83.766  8.845   1.00 121.00 ? 890  ASP A CA    1 
ATOM   6885  C  C     . ASP A 1  890  ? 148.063 83.475  9.510   1.00 124.71 ? 890  ASP A C     1 
ATOM   6886  O  O     . ASP A 1  890  ? 148.962 82.901  8.880   1.00 122.80 ? 890  ASP A O     1 
ATOM   6887  C  CB    . ASP A 1  890  ? 146.701 85.068  8.044   1.00 124.26 ? 890  ASP A CB    1 
ATOM   6888  C  CG    . ASP A 1  890  ? 145.763 85.033  6.846   1.00 139.39 ? 890  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A 1  890  ? 146.016 84.227  5.909   1.00 139.52 ? 890  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A 1  890  ? 144.823 85.856  6.806   1.00 147.30 ? 890  ASP A OD2   1 
ATOM   6891  N  N     . ALA A 1  891  ? 148.162 83.804  10.819  1.00 122.66 ? 891  ALA A N     1 
ATOM   6892  C  CA    . ALA A 1  891  ? 149.338 83.578  11.654  1.00 123.30 ? 891  ALA A CA    1 
ATOM   6893  C  C     . ALA A 1  891  ? 149.551 82.094  11.848  1.00 124.36 ? 891  ALA A C     1 
ATOM   6894  O  O     . ALA A 1  891  ? 150.551 81.578  11.365  1.00 123.62 ? 891  ALA A O     1 
ATOM   6895  C  CB    . ALA A 1  891  ? 149.178 84.274  13.002  1.00 126.60 ? 891  ALA A CB    1 
ATOM   6896  N  N     . ALA A 1  892  ? 148.574 81.397  12.480  1.00 119.54 ? 892  ALA A N     1 
ATOM   6897  C  CA    . ALA A 1  892  ? 148.592 79.956  12.782  1.00 117.91 ? 892  ALA A CA    1 
ATOM   6898  C  C     . ALA A 1  892  ? 148.938 79.094  11.585  1.00 116.82 ? 892  ALA A C     1 
ATOM   6899  O  O     . ALA A 1  892  ? 149.562 78.039  11.758  1.00 115.89 ? 892  ALA A O     1 
ATOM   6900  C  CB    . ALA A 1  892  ? 147.259 79.521  13.361  1.00 118.74 ? 892  ALA A CB    1 
ATOM   6901  N  N     . PHE A 1  893  ? 148.538 79.558  10.376  1.00 109.87 ? 893  PHE A N     1 
ATOM   6902  C  CA    . PHE A 1  893  ? 148.803 78.915  9.093   1.00 106.98 ? 893  PHE A CA    1 
ATOM   6903  C  C     . PHE A 1  893  ? 150.304 78.916  8.819   1.00 110.10 ? 893  PHE A C     1 
ATOM   6904  O  O     . PHE A 1  893  ? 150.910 77.866  8.577   1.00 108.51 ? 893  PHE A O     1 
ATOM   6905  C  CB    . PHE A 1  893  ? 148.067 79.667  7.976   1.00 107.60 ? 893  PHE A CB    1 
ATOM   6906  C  CG    . PHE A 1  893  ? 148.424 79.207  6.583   1.00 107.19 ? 893  PHE A CG    1 
ATOM   6907  C  CD1   . PHE A 1  893  ? 147.745 78.148  5.989   1.00 108.20 ? 893  PHE A CD1   1 
ATOM   6908  C  CD2   . PHE A 1  893  ? 149.429 79.842  5.859   1.00 109.28 ? 893  PHE A CD2   1 
ATOM   6909  C  CE1   . PHE A 1  893  ? 148.071 77.727  4.700   1.00 107.64 ? 893  PHE A CE1   1 
ATOM   6910  C  CE2   . PHE A 1  893  ? 149.755 79.419  4.572   1.00 110.73 ? 893  PHE A CE2   1 
ATOM   6911  C  CZ    . PHE A 1  893  ? 149.070 78.369  3.999   1.00 107.24 ? 893  PHE A CZ    1 
ATOM   6912  N  N     . GLU A 1  894  ? 150.887 80.117  8.842   1.00 107.42 ? 894  GLU A N     1 
ATOM   6913  C  CA    . GLU A 1  894  ? 152.302 80.338  8.639   1.00 107.87 ? 894  GLU A CA    1 
ATOM   6914  C  C     . GLU A 1  894  ? 153.092 79.488  9.643   1.00 111.21 ? 894  GLU A C     1 
ATOM   6915  O  O     . GLU A 1  894  ? 154.074 78.876  9.244   1.00 111.75 ? 894  GLU A O     1 
ATOM   6916  C  CB    . GLU A 1  894  ? 152.609 81.833  8.780   1.00 111.35 ? 894  GLU A CB    1 
ATOM   6917  C  CG    . GLU A 1  894  ? 154.048 82.217  8.499   1.00 126.84 ? 894  GLU A CG    1 
ATOM   6918  C  CD    . GLU A 1  894  ? 154.572 83.265  9.458   1.00 160.35 ? 894  GLU A CD    1 
ATOM   6919  O  OE1   . GLU A 1  894  ? 154.043 84.402  9.441   1.00 157.25 ? 894  GLU A OE1   1 
ATOM   6920  O  OE2   . GLU A 1  894  ? 155.489 82.941  10.249  1.00 161.55 ? 894  GLU A OE2   1 
ATOM   6921  N  N     . LYS A 1  895  ? 152.627 79.387  10.914  1.00 106.60 ? 895  LYS A N     1 
ATOM   6922  C  CA    . LYS A 1  895  ? 153.275 78.571  11.952  1.00 106.69 ? 895  LYS A CA    1 
ATOM   6923  C  C     . LYS A 1  895  ? 153.293 77.111  11.515  1.00 109.34 ? 895  LYS A C     1 
ATOM   6924  O  O     . LYS A 1  895  ? 154.337 76.441  11.545  1.00 108.15 ? 895  LYS A O     1 
ATOM   6925  C  CB    . LYS A 1  895  ? 152.539 78.718  13.304  1.00 109.69 ? 895  LYS A CB    1 
ATOM   6926  C  CG    . LYS A 1  895  ? 153.159 77.918  14.460  1.00 122.93 ? 895  LYS A CG    1 
ATOM   6927  C  CD    . LYS A 1  895  ? 152.916 78.570  15.830  1.00 134.91 ? 895  LYS A CD    1 
ATOM   6928  C  CE    . LYS A 1  895  ? 153.679 77.901  16.955  1.00 142.00 ? 895  LYS A CE    1 
ATOM   6929  N  NZ    . LYS A 1  895  ? 153.806 78.778  18.152  1.00 146.82 ? 895  LYS A NZ    1 
ATOM   6930  N  N     . ARG A 1  896  ? 152.126 76.658  11.053  1.00 105.53 ? 896  ARG A N     1 
ATOM   6931  C  CA    . ARG A 1  896  ? 151.868 75.301  10.639  1.00 104.10 ? 896  ARG A CA    1 
ATOM   6932  C  C     . ARG A 1  896  ? 152.608 74.846  9.404   1.00 109.20 ? 896  ARG A C     1 
ATOM   6933  O  O     . ARG A 1  896  ? 153.035 73.686  9.370   1.00 109.82 ? 896  ARG A O     1 
ATOM   6934  C  CB    . ARG A 1  896  ? 150.367 75.098  10.450  1.00 100.59 ? 896  ARG A CB    1 
ATOM   6935  C  CG    . ARG A 1  896  ? 149.837 73.932  11.243  1.00 108.44 ? 896  ARG A CG    1 
ATOM   6936  C  CD    . ARG A 1  896  ? 149.430 72.784  10.345  1.00 114.24 ? 896  ARG A CD    1 
ATOM   6937  N  NE    . ARG A 1  896  ? 148.562 71.844  11.055  1.00 124.34 ? 896  ARG A NE    1 
ATOM   6938  C  CZ    . ARG A 1  896  ? 147.235 71.936  11.107  1.00 141.05 ? 896  ARG A CZ    1 
ATOM   6939  N  NH1   . ARG A 1  896  ? 146.603 72.926  10.481  1.00 128.80 ? 896  ARG A NH1   1 
ATOM   6940  N  NH2   . ARG A 1  896  ? 146.528 71.041  11.786  1.00 129.31 ? 896  ARG A NH2   1 
ATOM   6941  N  N     . TYR A 1  897  ? 152.753 75.714  8.387   1.00 105.21 ? 897  TYR A N     1 
ATOM   6942  C  CA    . TYR A 1  897  ? 153.322 75.254  7.125   1.00 104.21 ? 897  TYR A CA    1 
ATOM   6943  C  C     . TYR A 1  897  ? 154.636 75.907  6.671   1.00 109.12 ? 897  TYR A C     1 
ATOM   6944  O  O     . TYR A 1  897  ? 155.361 75.307  5.863   1.00 109.19 ? 897  TYR A O     1 
ATOM   6945  C  CB    . TYR A 1  897  ? 152.266 75.388  6.015   1.00 103.87 ? 897  TYR A CB    1 
ATOM   6946  C  CG    . TYR A 1  897  ? 150.962 74.678  6.320   1.00 105.13 ? 897  TYR A CG    1 
ATOM   6947  C  CD1   . TYR A 1  897  ? 150.813 73.314  6.082   1.00 104.72 ? 897  TYR A CD1   1 
ATOM   6948  C  CD2   . TYR A 1  897  ? 149.875 75.368  6.845   1.00 108.02 ? 897  TYR A CD2   1 
ATOM   6949  C  CE1   . TYR A 1  897  ? 149.618 72.654  6.369   1.00 104.76 ? 897  TYR A CE1   1 
ATOM   6950  C  CE2   . TYR A 1  897  ? 148.671 74.721  7.129   1.00 109.04 ? 897  TYR A CE2   1 
ATOM   6951  C  CZ    . TYR A 1  897  ? 148.544 73.364  6.882   1.00 113.34 ? 897  TYR A CZ    1 
ATOM   6952  O  OH    . TYR A 1  897  ? 147.353 72.736  7.149   1.00 113.08 ? 897  TYR A OH    1 
ATOM   6953  N  N     . ARG A 1  898  ? 154.941 77.113  7.152   1.00 105.78 ? 898  ARG A N     1 
ATOM   6954  C  CA    . ARG A 1  898  ? 156.143 77.813  6.705   1.00 105.69 ? 898  ARG A CA    1 
ATOM   6955  C  C     . ARG A 1  898  ? 157.414 77.249  7.270   1.00 110.21 ? 898  ARG A C     1 
ATOM   6956  O  O     . ARG A 1  898  ? 157.563 77.097  8.486   1.00 111.12 ? 898  ARG A O     1 
ATOM   6957  C  CB    . ARG A 1  898  ? 156.056 79.340  6.957   1.00 104.67 ? 898  ARG A CB    1 
ATOM   6958  C  CG    . ARG A 1  898  ? 157.257 80.183  6.524   1.00 109.34 ? 898  ARG A CG    1 
ATOM   6959  C  CD    . ARG A 1  898  ? 157.611 80.072  5.050   1.00 115.44 ? 898  ARG A CD    1 
ATOM   6960  N  NE    . ARG A 1  898  ? 158.196 81.316  4.550   1.00 126.48 ? 898  ARG A NE    1 
ATOM   6961  C  CZ    . ARG A 1  898  ? 158.848 81.435  3.398   1.00 139.42 ? 898  ARG A CZ    1 
ATOM   6962  N  NH1   . ARG A 1  898  ? 159.039 80.371  2.620   1.00 119.06 ? 898  ARG A NH1   1 
ATOM   6963  N  NH2   . ARG A 1  898  ? 159.325 82.616  3.019   1.00 129.62 ? 898  ARG A NH2   1 
ATOM   6964  N  N     . VAL A 1  899  ? 158.329 76.937  6.352   1.00 106.09 ? 899  VAL A N     1 
ATOM   6965  C  CA    . VAL A 1  899  ? 159.693 76.526  6.634   1.00 106.92 ? 899  VAL A CA    1 
ATOM   6966  C  C     . VAL A 1  899  ? 160.573 77.539  5.888   1.00 113.06 ? 899  VAL A C     1 
ATOM   6967  O  O     . VAL A 1  899  ? 160.380 77.762  4.683   1.00 112.52 ? 899  VAL A O     1 
ATOM   6968  C  CB    . VAL A 1  899  ? 160.022 75.073  6.254   1.00 109.35 ? 899  VAL A CB    1 
ATOM   6969  C  CG1   . VAL A 1  899  ? 161.461 74.748  6.622   1.00 110.52 ? 899  VAL A CG1   1 
ATOM   6970  C  CG2   . VAL A 1  899  ? 159.072 74.103  6.938   1.00 108.39 ? 899  VAL A CG2   1 
ATOM   6971  N  N     . ASP A 1  900  ? 161.489 78.191  6.624   1.00 111.10 ? 900  ASP A N     1 
ATOM   6972  C  CA    . ASP A 1  900  ? 162.383 79.214  6.097   1.00 111.76 ? 900  ASP A CA    1 
ATOM   6973  C  C     . ASP A 1  900  ? 163.791 78.811  6.459   1.00 116.00 ? 900  ASP A C     1 
ATOM   6974  O  O     . ASP A 1  900  ? 164.248 79.129  7.555   1.00 117.40 ? 900  ASP A O     1 
ATOM   6975  C  CB    . ASP A 1  900  ? 162.025 80.573  6.733   1.00 115.28 ? 900  ASP A CB    1 
ATOM   6976  C  CG    . ASP A 1  900  ? 162.575 81.814  6.052   1.00 130.69 ? 900  ASP A CG    1 
ATOM   6977  O  OD1   . ASP A 1  900  ? 163.671 81.724  5.433   1.00 132.41 ? 900  ASP A OD1   1 
ATOM   6978  O  OD2   . ASP A 1  900  ? 161.932 82.893  6.171   1.00 137.05 ? 900  ASP A OD2   1 
ATOM   6979  N  N     . LEU A 1  901  ? 164.483 78.099  5.551   1.00 111.61 ? 901  LEU A N     1 
ATOM   6980  C  CA    . LEU A 1  901  ? 165.866 77.639  5.780   1.00 112.52 ? 901  LEU A CA    1 
ATOM   6981  C  C     . LEU A 1  901  ? 166.874 78.802  5.810   1.00 117.27 ? 901  LEU A C     1 
ATOM   6982  O  O     . LEU A 1  901  ? 168.049 78.595  6.116   1.00 118.20 ? 901  LEU A O     1 
ATOM   6983  C  CB    . LEU A 1  901  ? 166.308 76.581  4.744   1.00 111.44 ? 901  LEU A CB    1 
ATOM   6984  C  CG    . LEU A 1  901  ? 165.384 75.404  4.525   1.00 114.09 ? 901  LEU A CG    1 
ATOM   6985  C  CD1   . LEU A 1  901  ? 165.813 74.602  3.326   1.00 113.49 ? 901  LEU A CD1   1 
ATOM   6986  C  CD2   . LEU A 1  901  ? 165.300 74.536  5.753   1.00 117.42 ? 901  LEU A CD2   1 
ATOM   6987  N  N     . LEU A 1  902  ? 166.414 80.015  5.510   1.00 112.24 ? 902  LEU A N     1 
ATOM   6988  C  CA    . LEU A 1  902  ? 167.295 81.161  5.500   1.00 113.39 ? 902  LEU A CA    1 
ATOM   6989  C  C     . LEU A 1  902  ? 167.136 82.029  6.753   1.00 119.70 ? 902  LEU A C     1 
ATOM   6990  O  O     . LEU A 1  902  ? 167.826 83.038  6.890   1.00 121.39 ? 902  LEU A O     1 
ATOM   6991  C  CB    . LEU A 1  902  ? 167.110 81.960  4.204   1.00 112.67 ? 902  LEU A CB    1 
ATOM   6992  C  CG    . LEU A 1  902  ? 167.073 81.190  2.881   1.00 115.42 ? 902  LEU A CG    1 
ATOM   6993  C  CD1   . LEU A 1  902  ? 166.893 82.118  1.738   1.00 116.13 ? 902  LEU A CD1   1 
ATOM   6994  C  CD2   . LEU A 1  902  ? 168.321 80.401  2.639   1.00 117.46 ? 902  LEU A CD2   1 
ATOM   6995  N  N     . ASN A 1  903  ? 166.263 81.614  7.687   1.00 115.71 ? 903  ASN A N     1 
ATOM   6996  C  CA    . ASN A 1  903  ? 166.038 82.321  8.949   1.00 116.92 ? 903  ASN A CA    1 
ATOM   6997  C  C     . ASN A 1  903  ? 166.352 81.366  10.095  1.00 122.35 ? 903  ASN A C     1 
ATOM   6998  O  O     . ASN A 1  903  ? 165.756 80.293  10.152  1.00 119.97 ? 903  ASN A O     1 
ATOM   6999  C  CB    . ASN A 1  903  ? 164.597 82.805  9.029   1.00 114.67 ? 903  ASN A CB    1 
ATOM   7000  C  CG    . ASN A 1  903  ? 164.324 83.646  10.235  1.00 140.82 ? 903  ASN A CG    1 
ATOM   7001  O  OD1   . ASN A 1  903  ? 164.379 84.870  10.182  1.00 147.04 ? 903  ASN A OD1   1 
ATOM   7002  N  ND2   . ASN A 1  903  ? 164.037 83.016  11.351  1.00 129.18 ? 903  ASN A ND2   1 
ATOM   7003  N  N     . THR A 1  904  ? 167.260 81.754  11.016  1.00 122.71 ? 904  THR A N     1 
ATOM   7004  C  CA    . THR A 1  904  ? 167.687 80.905  12.134  1.00 124.70 ? 904  THR A CA    1 
ATOM   7005  C  C     . THR A 1  904  ? 166.534 80.418  13.047  1.00 132.56 ? 904  THR A C     1 
ATOM   7006  O  O     . THR A 1  904  ? 166.657 79.336  13.625  1.00 133.12 ? 904  THR A O     1 
ATOM   7007  C  CB    . THR A 1  904  ? 168.819 81.541  12.957  1.00 131.87 ? 904  THR A CB    1 
ATOM   7008  O  OG1   . THR A 1  904  ? 169.320 80.558  13.862  1.00 132.00 ? 904  THR A OG1   1 
ATOM   7009  C  CG2   . THR A 1  904  ? 168.389 82.771  13.747  1.00 130.61 ? 904  THR A CG2   1 
ATOM   7010  N  N     . ASP A 1  905  ? 165.432 81.179  13.167  1.00 130.85 ? 905  ASP A N     1 
ATOM   7011  C  CA    . ASP A 1  905  ? 164.315 80.781  14.026  1.00 131.29 ? 905  ASP A CA    1 
ATOM   7012  C  C     . ASP A 1  905  ? 163.289 79.896  13.337  1.00 134.47 ? 905  ASP A C     1 
ATOM   7013  O  O     . ASP A 1  905  ? 162.757 78.999  13.984  1.00 135.00 ? 905  ASP A O     1 
ATOM   7014  C  CB    . ASP A 1  905  ? 163.594 81.996  14.632  1.00 134.67 ? 905  ASP A CB    1 
ATOM   7015  C  CG    . ASP A 1  905  ? 164.454 83.212  14.910  1.00 152.67 ? 905  ASP A CG    1 
ATOM   7016  O  OD1   . ASP A 1  905  ? 165.571 83.042  15.455  1.00 155.70 ? 905  ASP A OD1   1 
ATOM   7017  O  OD2   . ASP A 1  905  ? 163.991 84.340  14.629  1.00 160.93 ? 905  ASP A OD2   1 
ATOM   7018  N  N     . HIS A 1  906  ? 162.994 80.146  12.046  1.00 129.18 ? 906  HIS A N     1 
ATOM   7019  C  CA    . HIS A 1  906  ? 161.935 79.451  11.307  1.00 126.47 ? 906  HIS A CA    1 
ATOM   7020  C  C     . HIS A 1  906  ? 162.384 78.265  10.403  1.00 127.04 ? 906  HIS A C     1 
ATOM   7021  O  O     . HIS A 1  906  ? 161.607 77.823  9.553   1.00 123.86 ? 906  HIS A O     1 
ATOM   7022  C  CB    . HIS A 1  906  ? 161.139 80.483  10.501  1.00 127.00 ? 906  HIS A CB    1 
ATOM   7023  C  CG    . HIS A 1  906  ? 160.541 81.581  11.339  1.00 132.19 ? 906  HIS A CG    1 
ATOM   7024  N  ND1   . HIS A 1  906  ? 161.335 82.537  11.955  1.00 136.31 ? 906  HIS A ND1   1 
ATOM   7025  C  CD2   . HIS A 1  906  ? 159.243 81.851  11.613  1.00 133.80 ? 906  HIS A CD2   1 
ATOM   7026  C  CE1   . HIS A 1  906  ? 160.502 83.348  12.584  1.00 136.77 ? 906  HIS A CE1   1 
ATOM   7027  N  NE2   . HIS A 1  906  ? 159.231 82.977  12.405  1.00 135.61 ? 906  HIS A NE2   1 
ATOM   7028  N  N     . THR A 1  907  ? 163.591 77.713  10.633  1.00 124.58 ? 907  THR A N     1 
ATOM   7029  C  CA    . THR A 1  907  ? 164.122 76.541  9.915   1.00 123.44 ? 907  THR A CA    1 
ATOM   7030  C  C     . THR A 1  907  ? 163.506 75.303  10.584  1.00 128.22 ? 907  THR A C     1 
ATOM   7031  O  O     . THR A 1  907  ? 162.876 75.409  11.647  1.00 127.96 ? 907  THR A O     1 
ATOM   7032  C  CB    . THR A 1  907  ? 165.695 76.531  10.010  1.00 128.97 ? 907  THR A CB    1 
ATOM   7033  O  OG1   . THR A 1  907  ? 166.185 77.716  9.409   1.00 135.04 ? 907  THR A OG1   1 
ATOM   7034  C  CG2   . THR A 1  907  ? 166.380 75.341  9.307   1.00 120.92 ? 907  THR A CG2   1 
ATOM   7035  N  N     . LEU A 1  908  ? 163.678 74.136  9.933   1.00 124.92 ? 908  LEU A N     1 
ATOM   7036  C  CA    . LEU A 1  908  ? 163.358 72.808  10.437  1.00 124.23 ? 908  LEU A CA    1 
ATOM   7037  C  C     . LEU A 1  908  ? 164.543 72.483  11.384  1.00 132.22 ? 908  LEU A C     1 
ATOM   7038  O  O     . LEU A 1  908  ? 165.717 72.504  10.961  1.00 132.82 ? 908  LEU A O     1 
ATOM   7039  C  CB    . LEU A 1  908  ? 163.321 71.794  9.280   1.00 122.17 ? 908  LEU A CB    1 
ATOM   7040  C  CG    . LEU A 1  908  ? 162.077 71.767  8.419   1.00 124.00 ? 908  LEU A CG    1 
ATOM   7041  C  CD1   . LEU A 1  908  ? 162.395 71.283  7.031   1.00 122.57 ? 908  LEU A CD1   1 
ATOM   7042  C  CD2   . LEU A 1  908  ? 160.995 70.910  9.042   1.00 126.15 ? 908  LEU A CD2   1 
ATOM   7043  N  N     . ASP A 1  909  ? 164.236 72.279  12.680  1.00 130.34 ? 909  ASP A N     1 
ATOM   7044  C  CA    . ASP A 1  909  ? 165.231 71.994  13.712  1.00 132.33 ? 909  ASP A CA    1 
ATOM   7045  C  C     . ASP A 1  909  ? 165.996 70.697  13.393  1.00 135.72 ? 909  ASP A C     1 
ATOM   7046  O  O     . ASP A 1  909  ? 165.370 69.727  12.943  1.00 134.36 ? 909  ASP A O     1 
ATOM   7047  C  CB    . ASP A 1  909  ? 164.551 71.892  15.084  1.00 135.41 ? 909  ASP A CB    1 
ATOM   7048  C  CG    . ASP A 1  909  ? 165.510 72.038  16.244  1.00 150.05 ? 909  ASP A CG    1 
ATOM   7049  O  OD1   . ASP A 1  909  ? 166.152 71.030  16.615  1.00 151.13 ? 909  ASP A OD1   1 
ATOM   7050  O  OD2   . ASP A 1  909  ? 165.639 73.163  16.766  1.00 159.41 ? 909  ASP A OD2   1 
ATOM   7051  N  N     . PRO A 1  910  ? 167.332 70.645  13.623  1.00 132.79 ? 910  PRO A N     1 
ATOM   7052  C  CA    . PRO A 1  910  ? 168.092 69.413  13.323  1.00 132.44 ? 910  PRO A CA    1 
ATOM   7053  C  C     . PRO A 1  910  ? 167.740 68.187  14.183  1.00 135.01 ? 910  PRO A C     1 
ATOM   7054  O  O     . PRO A 1  910  ? 168.482 67.197  14.183  1.00 135.50 ? 910  PRO A O     1 
ATOM   7055  C  CB    . PRO A 1  910  ? 169.548 69.847  13.493  1.00 136.37 ? 910  PRO A CB    1 
ATOM   7056  C  CG    . PRO A 1  910  ? 169.488 70.981  14.437  1.00 142.43 ? 910  PRO A CG    1 
ATOM   7057  C  CD    . PRO A 1  910  ? 168.226 71.713  14.110  1.00 136.27 ? 910  PRO A CD    1 
ATOM   7058  N  N     . SER A 1  911  ? 166.592 68.259  14.892  1.00 129.46 ? 911  SER A N     1 
ATOM   7059  C  CA    . SER A 1  911  ? 165.987 67.217  15.719  1.00 128.70 ? 911  SER A CA    1 
ATOM   7060  C  C     . SER A 1  911  ? 164.860 66.542  14.939  1.00 127.66 ? 911  SER A C     1 
ATOM   7061  O  O     . SER A 1  911  ? 164.400 65.473  15.350  1.00 127.15 ? 911  SER A O     1 
ATOM   7062  C  CB    . SER A 1  911  ? 165.407 67.827  16.991  1.00 133.00 ? 911  SER A CB    1 
ATOM   7063  O  OG    . SER A 1  911  ? 164.354 68.729  16.690  1.00 138.40 ? 911  SER A OG    1 
ATOM   7064  N  N     . LEU A 1  912  ? 164.408 67.191  13.833  1.00 120.74 ? 912  LEU A N     1 
ATOM   7065  C  CA    . LEU A 1  912  ? 163.308 66.758  12.957  1.00 117.84 ? 912  LEU A CA    1 
ATOM   7066  C  C     . LEU A 1  912  ? 163.753 65.901  11.776  1.00 119.66 ? 912  LEU A C     1 
ATOM   7067  O  O     . LEU A 1  912  ? 163.014 64.992  11.357  1.00 117.98 ? 912  LEU A O     1 
ATOM   7068  C  CB    . LEU A 1  912  ? 162.511 67.967  12.445  1.00 116.41 ? 912  LEU A CB    1 
ATOM   7069  C  CG    . LEU A 1  912  ? 161.854 68.837  13.503  1.00 121.85 ? 912  LEU A CG    1 
ATOM   7070  C  CD1   . LEU A 1  912  ? 161.432 70.169  12.921  1.00 120.87 ? 912  LEU A CD1   1 
ATOM   7071  C  CD2   . LEU A 1  912  ? 160.690 68.114  14.170  1.00 124.52 ? 912  LEU A CD2   1 
ATOM   7072  N  N     . LEU A 1  913  ? 164.940 66.223  11.223  1.00 115.33 ? 913  LEU A N     1 
ATOM   7073  C  CA    . LEU A 1  913  ? 165.570 65.506  10.115  1.00 113.92 ? 913  LEU A CA    1 
ATOM   7074  C  C     . LEU A 1  913  ? 167.073 65.532  10.270  1.00 120.30 ? 913  LEU A C     1 
ATOM   7075  O  O     . LEU A 1  913  ? 167.601 66.417  10.945  1.00 121.09 ? 913  LEU A O     1 
ATOM   7076  C  CB    . LEU A 1  913  ? 165.115 66.012  8.727   1.00 111.31 ? 913  LEU A CB    1 
ATOM   7077  C  CG    . LEU A 1  913  ? 165.647 67.332  8.177   1.00 114.43 ? 913  LEU A CG    1 
ATOM   7078  C  CD1   . LEU A 1  913  ? 165.104 67.567  6.794   1.00 111.91 ? 913  LEU A CD1   1 
ATOM   7079  C  CD2   . LEU A 1  913  ? 165.260 68.504  9.054   1.00 116.01 ? 913  LEU A CD2   1 
ATOM   7080  N  N     . GLU A 1  914  ? 167.753 64.546  9.675   1.00 118.03 ? 914  GLU A N     1 
ATOM   7081  C  CA    . GLU A 1  914  ? 169.209 64.384  9.749   1.00 120.54 ? 914  GLU A CA    1 
ATOM   7082  C  C     . GLU A 1  914  ? 169.961 65.559  9.116   1.00 125.69 ? 914  GLU A C     1 
ATOM   7083  O  O     . GLU A 1  914  ? 170.914 66.086  9.703   1.00 126.31 ? 914  GLU A O     1 
ATOM   7084  C  CB    . GLU A 1  914  ? 169.623 63.045  9.111   1.00 122.25 ? 914  GLU A CB    1 
ATOM   7085  C  CG    . GLU A 1  914  ? 169.210 61.834  9.940   1.00 134.14 ? 914  GLU A CG    1 
ATOM   7086  C  CD    . GLU A 1  914  ? 168.990 60.502  9.241   1.00 150.14 ? 914  GLU A CD    1 
ATOM   7087  O  OE1   . GLU A 1  914  ? 169.432 60.342  8.079   1.00 139.13 ? 914  GLU A OE1   1 
ATOM   7088  O  OE2   . GLU A 1  914  ? 168.397 59.602  9.880   1.00 141.02 ? 914  GLU A OE2   1 
ATOM   7089  N  N     . SER A 1  915  ? 169.470 65.998  7.946   1.00 121.95 ? 915  SER A N     1 
ATOM   7090  C  CA    . SER A 1  915  ? 170.002 67.096  7.137   1.00 122.12 ? 915  SER A CA    1 
ATOM   7091  C  C     . SER A 1  915  ? 169.829 68.512  7.756   1.00 126.99 ? 915  SER A C     1 
ATOM   7092  O  O     . SER A 1  915  ? 170.437 69.466  7.255   1.00 127.63 ? 915  SER A O     1 
ATOM   7093  C  CB    . SER A 1  915  ? 169.412 67.044  5.727   1.00 123.34 ? 915  SER A CB    1 
ATOM   7094  O  OG    . SER A 1  915  ? 168.029 66.725  5.724   1.00 128.89 ? 915  SER A OG    1 
ATOM   7095  N  N     . GLY A 1  916  ? 169.053 68.614  8.845   1.00 122.72 ? 916  GLY A N     1 
ATOM   7096  C  CA    . GLY A 1  916  ? 168.733 69.851  9.564   1.00 122.45 ? 916  GLY A CA    1 
ATOM   7097  C  C     . GLY A 1  916  ? 169.841 70.862  9.799   1.00 126.20 ? 916  GLY A C     1 
ATOM   7098  O  O     . GLY A 1  916  ? 169.597 72.073  9.760   1.00 125.54 ? 916  GLY A O     1 
ATOM   7099  N  N     . SER A 1  917  ? 171.056 70.369  10.055  1.00 123.34 ? 917  SER A N     1 
ATOM   7100  C  CA    . SER A 1  917  ? 172.239 71.180  10.325  1.00 124.62 ? 917  SER A CA    1 
ATOM   7101  C  C     . SER A 1  917  ? 172.827 71.789  9.066   1.00 127.06 ? 917  SER A C     1 
ATOM   7102  O  O     . SER A 1  917  ? 173.117 72.983  9.048   1.00 127.08 ? 917  SER A O     1 
ATOM   7103  C  CB    . SER A 1  917  ? 173.289 70.351  11.054  1.00 130.29 ? 917  SER A CB    1 
ATOM   7104  O  OG    . SER A 1  917  ? 173.387 69.040  10.521  1.00 138.04 ? 917  SER A OG    1 
ATOM   7105  N  N     . GLU A 1  918  ? 173.022 70.966  8.025   1.00 122.41 ? 918  GLU A N     1 
ATOM   7106  C  CA    . GLU A 1  918  ? 173.596 71.373  6.742   1.00 121.99 ? 918  GLU A CA    1 
ATOM   7107  C  C     . GLU A 1  918  ? 172.546 71.984  5.806   1.00 122.34 ? 918  GLU A C     1 
ATOM   7108  O  O     . GLU A 1  918  ? 172.892 72.493  4.738   1.00 121.58 ? 918  GLU A O     1 
ATOM   7109  C  CB    . GLU A 1  918  ? 174.337 70.194  6.073   1.00 124.18 ? 918  GLU A CB    1 
ATOM   7110  C  CG    . GLU A 1  918  ? 173.442 69.036  5.628   1.00 137.80 ? 918  GLU A CG    1 
ATOM   7111  C  CD    . GLU A 1  918  ? 173.545 67.730  6.398   1.00 165.27 ? 918  GLU A CD    1 
ATOM   7112  O  OE1   . GLU A 1  918  ? 173.383 67.748  7.640   1.00 163.83 ? 918  GLU A OE1   1 
ATOM   7113  O  OE2   . GLU A 1  918  ? 173.730 66.677  5.745   1.00 159.89 ? 918  GLU A OE2   1 
ATOM   7114  N  N     . ILE A 1  919  ? 171.275 71.932  6.207   1.00 116.73 ? 919  ILE A N     1 
ATOM   7115  C  CA    . ILE A 1  919  ? 170.191 72.458  5.406   1.00 115.00 ? 919  ILE A CA    1 
ATOM   7116  C  C     . ILE A 1  919  ? 170.067 73.973  5.511   1.00 119.34 ? 919  ILE A C     1 
ATOM   7117  O  O     . ILE A 1  919  ? 169.581 74.600  4.569   1.00 118.41 ? 919  ILE A O     1 
ATOM   7118  C  CB    . ILE A 1  919  ? 168.878 71.727  5.744   1.00 117.23 ? 919  ILE A CB    1 
ATOM   7119  C  CG1   . ILE A 1  919  ? 168.028 71.514  4.496   1.00 116.60 ? 919  ILE A CG1   1 
ATOM   7120  C  CG2   . ILE A 1  919  ? 168.084 72.374  6.886   1.00 118.38 ? 919  ILE A CG2   1 
ATOM   7121  C  CD1   . ILE A 1  919  ? 168.003 70.038  4.045   1.00 131.63 ? 919  ILE A CD1   1 
ATOM   7122  N  N     . LEU A 1  920  ? 170.466 74.555  6.662   1.00 116.78 ? 920  LEU A N     1 
ATOM   7123  C  CA    . LEU A 1  920  ? 170.389 75.995  6.915   1.00 116.85 ? 920  LEU A CA    1 
ATOM   7124  C  C     . LEU A 1  920  ? 171.143 76.765  5.839   1.00 119.58 ? 920  LEU A C     1 
ATOM   7125  O  O     . LEU A 1  920  ? 172.233 76.360  5.441   1.00 118.84 ? 920  LEU A O     1 
ATOM   7126  C  CB    . LEU A 1  920  ? 170.987 76.320  8.291   1.00 119.15 ? 920  LEU A CB    1 
ATOM   7127  C  CG    . LEU A 1  920  ? 170.175 77.216  9.240   1.00 124.43 ? 920  LEU A CG    1 
ATOM   7128  C  CD1   . LEU A 1  920  ? 170.905 77.409  10.556  1.00 126.66 ? 920  LEU A CD1   1 
ATOM   7129  C  CD2   . LEU A 1  920  ? 169.944 78.593  8.663   1.00 127.80 ? 920  LEU A CD2   1 
ATOM   7130  N  N     . GLY A 1  921  ? 170.529 77.831  5.347   1.00 116.33 ? 921  GLY A N     1 
ATOM   7131  C  CA    . GLY A 1  921  ? 171.101 78.689  4.317   1.00 117.40 ? 921  GLY A CA    1 
ATOM   7132  C  C     . GLY A 1  921  ? 171.055 78.162  2.891   1.00 122.56 ? 921  GLY A C     1 
ATOM   7133  O  O     . GLY A 1  921  ? 171.442 78.899  1.975   1.00 122.79 ? 921  GLY A O     1 
ATOM   7134  N  N     . ASP A 1  922  ? 170.573 76.895  2.670   1.00 118.82 ? 922  ASP A N     1 
ATOM   7135  C  CA    . ASP A 1  922  ? 170.485 76.291  1.330   1.00 117.84 ? 922  ASP A CA    1 
ATOM   7136  C  C     . ASP A 1  922  ? 169.425 77.002  0.519   1.00 119.11 ? 922  ASP A C     1 
ATOM   7137  O  O     . ASP A 1  922  ? 168.247 76.636  0.560   1.00 116.19 ? 922  ASP A O     1 
ATOM   7138  C  CB    . ASP A 1  922  ? 170.232 74.766  1.373   1.00 119.55 ? 922  ASP A CB    1 
ATOM   7139  C  CG    . ASP A 1  922  ? 170.666 73.991  0.126   1.00 134.36 ? 922  ASP A CG    1 
ATOM   7140  O  OD1   . ASP A 1  922  ? 170.743 74.603  -0.970  1.00 136.29 ? 922  ASP A OD1   1 
ATOM   7141  O  OD2   . ASP A 1  922  ? 170.916 72.771  0.243   1.00 139.33 ? 922  ASP A OD2   1 
ATOM   7142  N  N     . LEU A 1  923  ? 169.872 78.055  -0.196  1.00 116.66 ? 923  LEU A N     1 
ATOM   7143  C  CA    . LEU A 1  923  ? 169.079 78.946  -1.053  1.00 115.59 ? 923  LEU A CA    1 
ATOM   7144  C  C     . LEU A 1  923  ? 168.378 78.198  -2.179  1.00 118.42 ? 923  LEU A C     1 
ATOM   7145  O  O     . LEU A 1  923  ? 167.283 78.594  -2.578  1.00 117.93 ? 923  LEU A O     1 
ATOM   7146  C  CB    . LEU A 1  923  ? 169.939 80.088  -1.617  1.00 116.90 ? 923  LEU A CB    1 
ATOM   7147  C  CG    . LEU A 1  923  ? 171.444 79.928  -1.472  1.00 123.28 ? 923  LEU A CG    1 
ATOM   7148  C  CD1   . LEU A 1  923  ? 172.051 79.177  -2.660  1.00 123.63 ? 923  LEU A CD1   1 
ATOM   7149  C  CD2   . LEU A 1  923  ? 172.093 81.258  -1.282  1.00 127.82 ? 923  LEU A CD2   1 
ATOM   7150  N  N     . LYS A 1  924  ? 168.999 77.109  -2.664  1.00 113.67 ? 924  LYS A N     1 
ATOM   7151  C  CA    . LYS A 1  924  ? 168.480 76.233  -3.708  1.00 111.88 ? 924  LYS A CA    1 
ATOM   7152  C  C     . LYS A 1  924  ? 167.246 75.490  -3.172  1.00 113.88 ? 924  LYS A C     1 
ATOM   7153  O  O     . LYS A 1  924  ? 166.224 75.413  -3.858  1.00 111.73 ? 924  LYS A O     1 
ATOM   7154  C  CB    . LYS A 1  924  ? 169.560 75.222  -4.129  1.00 115.25 ? 924  LYS A CB    1 
ATOM   7155  C  CG    . LYS A 1  924  ? 170.903 75.844  -4.460  1.00 131.91 ? 924  LYS A CG    1 
ATOM   7156  C  CD    . LYS A 1  924  ? 172.061 74.965  -4.029  1.00 144.52 ? 924  LYS A CD    1 
ATOM   7157  C  CE    . LYS A 1  924  ? 173.348 75.749  -4.085  1.00 162.39 ? 924  LYS A CE    1 
ATOM   7158  N  NZ    . LYS A 1  924  ? 174.540 74.869  -3.998  1.00 176.86 ? 924  LYS A NZ    1 
ATOM   7159  N  N     . LEU A 1  925  ? 167.343 74.956  -1.939  1.00 110.96 ? 925  LEU A N     1 
ATOM   7160  C  CA    . LEU A 1  925  ? 166.249 74.230  -1.297  1.00 109.72 ? 925  LEU A CA    1 
ATOM   7161  C  C     . LEU A 1  925  ? 165.171 75.158  -0.801  1.00 113.73 ? 925  LEU A C     1 
ATOM   7162  O  O     . LEU A 1  925  ? 164.020 74.735  -0.658  1.00 112.42 ? 925  LEU A O     1 
ATOM   7163  C  CB    . LEU A 1  925  ? 166.755 73.382  -0.146  1.00 110.64 ? 925  LEU A CB    1 
ATOM   7164  C  CG    . LEU A 1  925  ? 167.593 72.194  -0.527  1.00 117.08 ? 925  LEU A CG    1 
ATOM   7165  C  CD1   . LEU A 1  925  ? 168.058 71.498  0.689   1.00 118.89 ? 925  LEU A CD1   1 
ATOM   7166  C  CD2   . LEU A 1  925  ? 166.812 71.203  -1.378  1.00 119.53 ? 925  LEU A CD2   1 
ATOM   7167  N  N     . GLN A 1  926  ? 165.540 76.422  -0.512  1.00 110.87 ? 926  GLN A N     1 
ATOM   7168  C  CA    . GLN A 1  926  ? 164.577 77.418  -0.075  1.00 109.56 ? 926  GLN A CA    1 
ATOM   7169  C  C     . GLN A 1  926  ? 163.758 77.814  -1.249  1.00 111.95 ? 926  GLN A C     1 
ATOM   7170  O  O     . GLN A 1  926  ? 162.591 78.115  -1.068  1.00 111.08 ? 926  GLN A O     1 
ATOM   7171  C  CB    . GLN A 1  926  ? 165.230 78.634  0.577   1.00 112.37 ? 926  GLN A CB    1 
ATOM   7172  C  CG    . GLN A 1  926  ? 164.833 78.771  2.041   1.00 124.96 ? 926  GLN A CG    1 
ATOM   7173  C  CD    . GLN A 1  926  ? 163.345 78.852  2.260   1.00 140.08 ? 926  GLN A CD    1 
ATOM   7174  O  OE1   . GLN A 1  926  ? 162.689 79.822  1.890   1.00 137.95 ? 926  GLN A OE1   1 
ATOM   7175  N  NE2   . GLN A 1  926  ? 162.781 77.830  2.869   1.00 127.95 ? 926  GLN A NE2   1 
ATOM   7176  N  N     . VAL A 1  927  ? 164.340 77.730  -2.464  1.00 108.51 ? 927  VAL A N     1 
ATOM   7177  C  CA    . VAL A 1  927  ? 163.662 77.990  -3.731  1.00 107.89 ? 927  VAL A CA    1 
ATOM   7178  C  C     . VAL A 1  927  ? 162.523 76.988  -3.874  1.00 108.83 ? 927  VAL A C     1 
ATOM   7179  O  O     . VAL A 1  927  ? 161.399 77.394  -4.182  1.00 107.81 ? 927  VAL A O     1 
ATOM   7180  C  CB    . VAL A 1  927  ? 164.657 77.953  -4.919  1.00 113.65 ? 927  VAL A CB    1 
ATOM   7181  C  CG1   . VAL A 1  927  ? 163.987 77.533  -6.227  1.00 112.44 ? 927  VAL A CG1   1 
ATOM   7182  C  CG2   . VAL A 1  927  ? 165.363 79.299  -5.076  1.00 115.59 ? 927  VAL A CG2   1 
ATOM   7183  N  N     . LEU A 1  928  ? 162.814 75.698  -3.583  1.00 103.64 ? 928  LEU A N     1 
ATOM   7184  C  CA    . LEU A 1  928  ? 161.870 74.585  -3.601  1.00 101.52 ? 928  LEU A CA    1 
ATOM   7185  C  C     . LEU A 1  928  ? 160.755 74.785  -2.575  1.00 103.80 ? 928  LEU A C     1 
ATOM   7186  O  O     . LEU A 1  928  ? 159.585 74.577  -2.891  1.00 102.06 ? 928  LEU A O     1 
ATOM   7187  C  CB    . LEU A 1  928  ? 162.607 73.280  -3.258  1.00 102.01 ? 928  LEU A CB    1 
ATOM   7188  C  CG    . LEU A 1  928  ? 162.983 72.305  -4.371  1.00 106.76 ? 928  LEU A CG    1 
ATOM   7189  C  CD1   . LEU A 1  928  ? 163.298 70.933  -3.776  1.00 106.41 ? 928  LEU A CD1   1 
ATOM   7190  C  CD2   . LEU A 1  928  ? 161.873 72.170  -5.427  1.00 109.09 ? 928  LEU A CD2   1 
ATOM   7191  N  N     . LEU A 1  929  ? 161.133 75.164  -1.346  1.00 101.42 ? 929  LEU A N     1 
ATOM   7192  C  CA    . LEU A 1  929  ? 160.249 75.389  -0.204  1.00 101.53 ? 929  LEU A CA    1 
ATOM   7193  C  C     . LEU A 1  929  ? 159.398 76.661  -0.328  1.00 107.74 ? 929  LEU A C     1 
ATOM   7194  O  O     . LEU A 1  929  ? 158.364 76.787  0.346   1.00 106.06 ? 929  LEU A O     1 
ATOM   7195  C  CB    . LEU A 1  929  ? 161.103 75.418  1.070   1.00 102.91 ? 929  LEU A CB    1 
ATOM   7196  C  CG    . LEU A 1  929  ? 160.931 74.274  2.080   1.00 107.11 ? 929  LEU A CG    1 
ATOM   7197  C  CD1   . LEU A 1  929  ? 160.837 72.928  1.416   1.00 106.01 ? 929  LEU A CD1   1 
ATOM   7198  C  CD2   . LEU A 1  929  ? 162.081 74.229  3.034   1.00 111.44 ? 929  LEU A CD2   1 
ATOM   7199  N  N     . ASP A 1  930  ? 159.851 77.602  -1.179  1.00 107.75 ? 930  ASP A N     1 
ATOM   7200  C  CA    . ASP A 1  930  ? 159.163 78.850  -1.467  1.00 109.10 ? 930  ASP A CA    1 
ATOM   7201  C  C     . ASP A 1  930  ? 158.004 78.545  -2.367  1.00 113.57 ? 930  ASP A C     1 
ATOM   7202  O  O     . ASP A 1  930  ? 156.887 78.905  -2.026  1.00 113.23 ? 930  ASP A O     1 
ATOM   7203  C  CB    . ASP A 1  930  ? 160.099 79.884  -2.102  1.00 113.18 ? 930  ASP A CB    1 
ATOM   7204  C  CG    . ASP A 1  930  ? 160.886 80.704  -1.091  1.00 132.41 ? 930  ASP A CG    1 
ATOM   7205  O  OD1   . ASP A 1  930  ? 160.511 80.688  0.111   1.00 133.76 ? 930  ASP A OD1   1 
ATOM   7206  O  OD2   . ASP A 1  930  ? 161.881 81.366  -1.500  1.00 141.78 ? 930  ASP A OD2   1 
ATOM   7207  N  N     . GLU A 1  931  ? 158.239 77.808  -3.468  1.00 110.64 ? 931  GLU A N     1 
ATOM   7208  C  CA    . GLU A 1  931  ? 157.171 77.387  -4.380  1.00 109.58 ? 931  GLU A CA    1 
ATOM   7209  C  C     . GLU A 1  931  ? 156.144 76.617  -3.587  1.00 108.74 ? 931  GLU A C     1 
ATOM   7210  O  O     . GLU A 1  931  ? 154.960 76.875  -3.745  1.00 106.54 ? 931  GLU A O     1 
ATOM   7211  C  CB    . GLU A 1  931  ? 157.696 76.461  -5.484  1.00 111.78 ? 931  GLU A CB    1 
ATOM   7212  C  CG    . GLU A 1  931  ? 158.791 77.033  -6.373  1.00 135.79 ? 931  GLU A CG    1 
ATOM   7213  C  CD    . GLU A 1  931  ? 159.754 75.995  -6.934  1.00 181.99 ? 931  GLU A CD    1 
ATOM   7214  O  OE1   . GLU A 1  931  ? 159.358 74.814  -7.094  1.00 181.59 ? 931  GLU A OE1   1 
ATOM   7215  O  OE2   . GLU A 1  931  ? 160.922 76.367  -7.196  1.00 190.65 ? 931  GLU A OE2   1 
ATOM   7216  N  N     . GLU A 1  932  ? 156.610 75.705  -2.706  1.00 105.22 ? 932  GLU A N     1 
ATOM   7217  C  CA    . GLU A 1  932  ? 155.790 74.842  -1.843  1.00 104.89 ? 932  GLU A CA    1 
ATOM   7218  C  C     . GLU A 1  932  ? 154.761 75.666  -1.062  1.00 108.30 ? 932  GLU A C     1 
ATOM   7219  O  O     . GLU A 1  932  ? 153.544 75.449  -1.199  1.00 106.54 ? 932  GLU A O     1 
ATOM   7220  C  CB    . GLU A 1  932  ? 156.694 74.005  -0.889  1.00 107.17 ? 932  GLU A CB    1 
ATOM   7221  C  CG    . GLU A 1  932  ? 155.984 72.946  -0.038  1.00 115.98 ? 932  GLU A CG    1 
ATOM   7222  C  CD    . GLU A 1  932  ? 156.110 73.052  1.479   1.00 133.91 ? 932  GLU A CD    1 
ATOM   7223  O  OE1   . GLU A 1  932  ? 156.300 74.178  2.004   1.00 138.29 ? 932  GLU A OE1   1 
ATOM   7224  O  OE2   . GLU A 1  932  ? 155.969 72.002  2.147   1.00 99.01  ? 932  GLU A OE2   1 
ATOM   7225  N  N     . TYR A 1  933  ? 155.270 76.628  -0.274  1.00 105.28 ? 933  TYR A N     1 
ATOM   7226  C  CA    . TYR A 1  933  ? 154.464 77.515  0.541   1.00 104.86 ? 933  TYR A CA    1 
ATOM   7227  C  C     . TYR A 1  933  ? 153.588 78.414  -0.344  1.00 104.85 ? 933  TYR A C     1 
ATOM   7228  O  O     . TYR A 1  933  ? 152.385 78.493  -0.107  1.00 103.52 ? 933  TYR A O     1 
ATOM   7229  C  CB    . TYR A 1  933  ? 155.356 78.302  1.522   1.00 108.53 ? 933  TYR A CB    1 
ATOM   7230  C  CG    . TYR A 1  933  ? 154.590 79.149  2.517   1.00 111.78 ? 933  TYR A CG    1 
ATOM   7231  C  CD1   . TYR A 1  933  ? 153.953 78.572  3.613   1.00 114.27 ? 933  TYR A CD1   1 
ATOM   7232  C  CD2   . TYR A 1  933  ? 154.522 80.531  2.380   1.00 113.18 ? 933  TYR A CD2   1 
ATOM   7233  C  CE1   . TYR A 1  933  ? 153.243 79.349  4.533   1.00 116.08 ? 933  TYR A CE1   1 
ATOM   7234  C  CE2   . TYR A 1  933  ? 153.830 81.320  3.303   1.00 114.75 ? 933  TYR A CE2   1 
ATOM   7235  C  CZ    . TYR A 1  933  ? 153.190 80.724  4.377   1.00 122.11 ? 933  TYR A CZ    1 
ATOM   7236  O  OH    . TYR A 1  933  ? 152.511 81.496  5.289   1.00 125.08 ? 933  TYR A OH    1 
ATOM   7237  N  N     . LYS A 1  934  ? 154.159 79.000  -1.418  1.00 99.78  ? 934  LYS A N     1 
ATOM   7238  C  CA    . LYS A 1  934  ? 153.428 79.871  -2.361  1.00 98.82  ? 934  LYS A CA    1 
ATOM   7239  C  C     . LYS A 1  934  ? 152.159 79.187  -2.923  1.00 97.52  ? 934  LYS A C     1 
ATOM   7240  O  O     . LYS A 1  934  ? 151.124 79.834  -3.103  1.00 95.90  ? 934  LYS A O     1 
ATOM   7241  C  CB    . LYS A 1  934  ? 154.358 80.394  -3.495  1.00 102.61 ? 934  LYS A CB    1 
ATOM   7242  C  CG    . LYS A 1  934  ? 154.833 81.865  -3.356  1.00 116.32 ? 934  LYS A CG    1 
ATOM   7243  C  CD    . LYS A 1  934  ? 156.205 82.057  -2.636  1.00 124.23 ? 934  LYS A CD    1 
ATOM   7244  C  CE    . LYS A 1  934  ? 156.577 83.520  -2.425  1.00 132.15 ? 934  LYS A CE    1 
ATOM   7245  N  NZ    . LYS A 1  934  ? 157.714 83.705  -1.474  1.00 136.37 ? 934  LYS A NZ    1 
ATOM   7246  N  N     . GLN A 1  935  ? 152.253 77.869  -3.138  1.00 91.58  ? 935  GLN A N     1 
ATOM   7247  C  CA    . GLN A 1  935  ? 151.192 77.009  -3.638  1.00 89.33  ? 935  GLN A CA    1 
ATOM   7248  C  C     . GLN A 1  935  ? 150.180 76.745  -2.535  1.00 90.62  ? 935  GLN A C     1 
ATOM   7249  O  O     . GLN A 1  935  ? 148.981 76.689  -2.820  1.00 88.76  ? 935  GLN A O     1 
ATOM   7250  C  CB    . GLN A 1  935  ? 151.802 75.700  -4.190  1.00 90.33  ? 935  GLN A CB    1 
ATOM   7251  C  CG    . GLN A 1  935  ? 150.827 74.582  -4.588  1.00 105.77 ? 935  GLN A CG    1 
ATOM   7252  C  CD    . GLN A 1  935  ? 149.657 75.009  -5.449  1.00 120.39 ? 935  GLN A CD    1 
ATOM   7253  O  OE1   . GLN A 1  935  ? 149.794 75.663  -6.490  1.00 115.34 ? 935  GLN A OE1   1 
ATOM   7254  N  NE2   . GLN A 1  935  ? 148.477 74.606  -5.044  1.00 109.85 ? 935  GLN A NE2   1 
ATOM   7255  N  N     . LEU A 1  936  ? 150.653 76.580  -1.281  1.00 87.18  ? 936  LEU A N     1 
ATOM   7256  C  CA    . LEU A 1  936  ? 149.756 76.348  -0.142  1.00 86.79  ? 936  LEU A CA    1 
ATOM   7257  C  C     . LEU A 1  936  ? 148.877 77.595  0.093   1.00 93.26  ? 936  LEU A C     1 
ATOM   7258  O  O     . LEU A 1  936  ? 147.692 77.464  0.436   1.00 92.91  ? 936  LEU A O     1 
ATOM   7259  C  CB    . LEU A 1  936  ? 150.529 76.009  1.149   1.00 87.34  ? 936  LEU A CB    1 
ATOM   7260  C  CG    . LEU A 1  936  ? 151.387 74.756  1.216   1.00 91.12  ? 936  LEU A CG    1 
ATOM   7261  C  CD1   . LEU A 1  936  ? 152.412 74.914  2.284   1.00 92.53  ? 936  LEU A CD1   1 
ATOM   7262  C  CD2   . LEU A 1  936  ? 150.560 73.526  1.541   1.00 92.09  ? 936  LEU A CD2   1 
ATOM   7263  N  N     . VAL A 1  937  ? 149.467 78.802  -0.102  1.00 91.05  ? 937  VAL A N     1 
ATOM   7264  C  CA    . VAL A 1  937  ? 148.778 80.083  0.041   1.00 91.60  ? 937  VAL A CA    1 
ATOM   7265  C  C     . VAL A 1  937  ? 147.758 80.208  -1.074  1.00 96.00  ? 937  VAL A C     1 
ATOM   7266  O  O     . VAL A 1  937  ? 146.629 80.609  -0.809  1.00 94.94  ? 937  VAL A O     1 
ATOM   7267  C  CB    . VAL A 1  937  ? 149.765 81.256  0.073   1.00 96.77  ? 937  VAL A CB    1 
ATOM   7268  C  CG1   . VAL A 1  937  ? 149.033 82.590  0.221   1.00 97.67  ? 937  VAL A CG1   1 
ATOM   7269  C  CG2   . VAL A 1  937  ? 150.762 81.064  1.203   1.00 97.53  ? 937  VAL A CG2   1 
ATOM   7270  N  N     . LYS A 1  938  ? 148.145 79.794  -2.303  1.00 93.81  ? 938  LYS A N     1 
ATOM   7271  C  CA    . LYS A 1  938  ? 147.291 79.756  -3.492  1.00 93.30  ? 938  LYS A CA    1 
ATOM   7272  C  C     . LYS A 1  938  ? 146.093 78.898  -3.123  1.00 95.43  ? 938  LYS A C     1 
ATOM   7273  O  O     . LYS A 1  938  ? 144.969 79.412  -3.115  1.00 95.45  ? 938  LYS A O     1 
ATOM   7274  C  CB    . LYS A 1  938  ? 148.058 79.149  -4.692  1.00 96.34  ? 938  LYS A CB    1 
ATOM   7275  C  CG    . LYS A 1  938  ? 147.441 79.409  -6.074  1.00 117.79 ? 938  LYS A CG    1 
ATOM   7276  C  CD    . LYS A 1  938  ? 148.304 78.816  -7.212  1.00 133.27 ? 938  LYS A CD    1 
ATOM   7277  C  CE    . LYS A 1  938  ? 147.918 79.305  -8.596  1.00 148.99 ? 938  LYS A CE    1 
ATOM   7278  N  NZ    . LYS A 1  938  ? 148.912 78.906  -9.634  1.00 160.77 ? 938  LYS A NZ    1 
ATOM   7279  N  N     . ASP A 1  939  ? 146.355 77.633  -2.714  1.00 90.32  ? 939  ASP A N     1 
ATOM   7280  C  CA    . ASP A 1  939  ? 145.365 76.669  -2.265  1.00 89.59  ? 939  ASP A CA    1 
ATOM   7281  C  C     . ASP A 1  939  ? 144.360 77.317  -1.322  1.00 94.90  ? 939  ASP A C     1 
ATOM   7282  O  O     . ASP A 1  939  ? 143.164 77.329  -1.626  1.00 94.21  ? 939  ASP A O     1 
ATOM   7283  C  CB    . ASP A 1  939  ? 146.054 75.491  -1.559  1.00 91.89  ? 939  ASP A CB    1 
ATOM   7284  C  CG    . ASP A 1  939  ? 146.445 74.352  -2.468  1.00 103.94 ? 939  ASP A CG    1 
ATOM   7285  O  OD1   . ASP A 1  939  ? 146.156 74.442  -3.690  1.00 106.06 ? 939  ASP A OD1   1 
ATOM   7286  O  OD2   . ASP A 1  939  ? 146.991 73.338  -1.952  1.00 104.32 ? 939  ASP A OD2   1 
ATOM   7287  N  N     . ARG A 1  940  ? 144.846 77.911  -0.215  1.00 93.22  ? 940  ARG A N     1 
ATOM   7288  C  CA    . ARG A 1  940  ? 143.996 78.590  0.764   1.00 94.40  ? 940  ARG A CA    1 
ATOM   7289  C  C     . ARG A 1  940  ? 143.026 79.563  0.091   1.00 100.04 ? 940  ARG A C     1 
ATOM   7290  O  O     . ARG A 1  940  ? 141.829 79.497  0.349   1.00 98.07  ? 940  ARG A O     1 
ATOM   7291  C  CB    . ARG A 1  940  ? 144.847 79.311  1.830   1.00 96.15  ? 940  ARG A CB    1 
ATOM   7292  C  CG    . ARG A 1  940  ? 144.044 79.844  3.017   1.00 103.22 ? 940  ARG A CG    1 
ATOM   7293  C  CD    . ARG A 1  940  ? 144.916 80.582  4.007   1.00 108.78 ? 940  ARG A CD    1 
ATOM   7294  N  NE    . ARG A 1  940  ? 144.673 80.132  5.376   1.00 110.87 ? 940  ARG A NE    1 
ATOM   7295  C  CZ    . ARG A 1  940  ? 144.354 80.939  6.382   1.00 124.35 ? 940  ARG A CZ    1 
ATOM   7296  N  NH1   . ARG A 1  940  ? 144.215 82.244  6.179   1.00 100.81 ? 940  ARG A NH1   1 
ATOM   7297  N  NH2   . ARG A 1  940  ? 144.162 80.448  7.598   1.00 118.44 ? 940  ARG A NH2   1 
ATOM   7298  N  N     . LYS A 1  941  ? 143.537 80.428  -0.800  1.00 100.31 ? 941  LYS A N     1 
ATOM   7299  C  CA    . LYS A 1  941  ? 142.708 81.413  -1.486  1.00 102.12 ? 941  LYS A CA    1 
ATOM   7300  C  C     . LYS A 1  941  ? 141.648 80.735  -2.320  1.00 105.73 ? 941  LYS A C     1 
ATOM   7301  O  O     . LYS A 1  941  ? 140.478 81.123  -2.223  1.00 106.72 ? 941  LYS A O     1 
ATOM   7302  C  CB    . LYS A 1  941  ? 143.538 82.441  -2.290  1.00 107.37 ? 941  LYS A CB    1 
ATOM   7303  C  CG    . LYS A 1  941  ? 144.719 83.109  -1.519  1.00 141.70 ? 941  LYS A CG    1 
ATOM   7304  C  CD    . LYS A 1  941  ? 144.371 84.021  -0.286  1.00 158.09 ? 941  LYS A CD    1 
ATOM   7305  C  CE    . LYS A 1  941  ? 144.516 83.375  1.098   1.00 167.06 ? 941  LYS A CE    1 
ATOM   7306  N  NZ    . LYS A 1  941  ? 145.929 83.175  1.544   1.00 170.00 ? 941  LYS A NZ    1 
ATOM   7307  N  N     . PHE A 1  942  ? 142.030 79.657  -3.044  1.00 99.88  ? 942  PHE A N     1 
ATOM   7308  C  CA    . PHE A 1  942  ? 141.110 78.881  -3.879  1.00 97.91  ? 942  PHE A CA    1 
ATOM   7309  C  C     . PHE A 1  942  ? 139.963 78.239  -3.096  1.00 99.53  ? 942  PHE A C     1 
ATOM   7310  O  O     . PHE A 1  942  ? 138.809 78.324  -3.522  1.00 99.18  ? 942  PHE A O     1 
ATOM   7311  C  CB    . PHE A 1  942  ? 141.854 77.815  -4.704  1.00 98.79  ? 942  PHE A CB    1 
ATOM   7312  C  CG    . PHE A 1  942  ? 140.912 76.952  -5.506  1.00 99.10  ? 942  PHE A CG    1 
ATOM   7313  C  CD1   . PHE A 1  942  ? 140.240 77.468  -6.610  1.00 102.51 ? 942  PHE A CD1   1 
ATOM   7314  C  CD2   . PHE A 1  942  ? 140.636 75.650  -5.117  1.00 100.25 ? 942  PHE A CD2   1 
ATOM   7315  C  CE1   . PHE A 1  942  ? 139.342 76.682  -7.337  1.00 102.33 ? 942  PHE A CE1   1 
ATOM   7316  C  CE2   . PHE A 1  942  ? 139.740 74.862  -5.847  1.00 102.22 ? 942  PHE A CE2   1 
ATOM   7317  C  CZ    . PHE A 1  942  ? 139.113 75.379  -6.964  1.00 100.35 ? 942  PHE A CZ    1 
ATOM   7318  N  N     . LEU A 1  943  ? 140.293 77.555  -1.991  1.00 93.69  ? 943  LEU A N     1 
ATOM   7319  C  CA    . LEU A 1  943  ? 139.331 76.859  -1.133  1.00 91.45  ? 943  LEU A CA    1 
ATOM   7320  C  C     . LEU A 1  943  ? 138.318 77.801  -0.453  1.00 96.34  ? 943  LEU A C     1 
ATOM   7321  O  O     . LEU A 1  943  ? 137.143 77.454  -0.307  1.00 94.50  ? 943  LEU A O     1 
ATOM   7322  C  CB    . LEU A 1  943  ? 140.101 76.062  -0.096  1.00 90.44  ? 943  LEU A CB    1 
ATOM   7323  C  CG    . LEU A 1  943  ? 140.683 74.789  -0.594  1.00 92.21  ? 943  LEU A CG    1 
ATOM   7324  C  CD1   . LEU A 1  943  ? 142.052 74.599  -0.046  1.00 92.96  ? 943  LEU A CD1   1 
ATOM   7325  C  CD2   . LEU A 1  943  ? 139.825 73.650  -0.185  1.00 92.55  ? 943  LEU A CD2   1 
ATOM   7326  N  N     . ARG A 1  944  ? 138.790 78.996  -0.059  1.00 95.60  ? 944  ARG A N     1 
ATOM   7327  C  CA    . ARG A 1  944  ? 138.004 80.054  0.580   1.00 97.38  ? 944  ARG A CA    1 
ATOM   7328  C  C     . ARG A 1  944  ? 137.097 80.676  -0.469  1.00 102.94 ? 944  ARG A C     1 
ATOM   7329  O  O     . ARG A 1  944  ? 136.099 81.333  -0.133  1.00 103.31 ? 944  ARG A O     1 
ATOM   7330  C  CB    . ARG A 1  944  ? 138.930 81.128  1.205   1.00 98.71  ? 944  ARG A CB    1 
ATOM   7331  C  CG    . ARG A 1  944  ? 139.590 80.681  2.512   1.00 102.37 ? 944  ARG A CG    1 
ATOM   7332  C  CD    . ARG A 1  944  ? 140.111 81.820  3.355   1.00 100.58 ? 944  ARG A CD    1 
ATOM   7333  N  NE    . ARG A 1  944  ? 140.269 81.406  4.749   1.00 102.82 ? 944  ARG A NE    1 
ATOM   7334  C  CZ    . ARG A 1  944  ? 140.557 82.226  5.756   1.00 122.94 ? 944  ARG A CZ    1 
ATOM   7335  N  NH1   . ARG A 1  944  ? 140.721 83.528  5.538   1.00 107.67 ? 944  ARG A NH1   1 
ATOM   7336  N  NH2   . ARG A 1  944  ? 140.675 81.754  6.990   1.00 116.96 ? 944  ARG A NH2   1 
ATOM   7337  N  N     . GLU A 1  945  ? 137.472 80.469  -1.747  1.00 99.78  ? 945  GLU A N     1 
ATOM   7338  C  CA    . GLU A 1  945  ? 136.743 80.947  -2.908  1.00 100.28 ? 945  GLU A CA    1 
ATOM   7339  C  C     . GLU A 1  945  ? 135.570 80.012  -3.130  1.00 101.15 ? 945  GLU A C     1 
ATOM   7340  O  O     . GLU A 1  945  ? 134.441 80.481  -3.275  1.00 100.85 ? 945  GLU A O     1 
ATOM   7341  C  CB    . GLU A 1  945  ? 137.652 80.963  -4.161  1.00 102.04 ? 945  GLU A CB    1 
ATOM   7342  C  CG    . GLU A 1  945  ? 138.313 82.291  -4.490  1.00 119.04 ? 945  GLU A CG    1 
ATOM   7343  C  CD    . GLU A 1  945  ? 138.735 82.409  -5.944  1.00 153.98 ? 945  GLU A CD    1 
ATOM   7344  O  OE1   . GLU A 1  945  ? 139.716 81.737  -6.340  1.00 150.83 ? 945  GLU A OE1   1 
ATOM   7345  O  OE2   . GLU A 1  945  ? 138.073 83.164  -6.693  1.00 158.13 ? 945  GLU A OE2   1 
ATOM   7346  N  N     . VAL A 1  946  ? 135.849 78.692  -3.150  1.00 95.57  ? 946  VAL A N     1 
ATOM   7347  C  CA    . VAL A 1  946  ? 134.881 77.623  -3.384  1.00 94.15  ? 946  VAL A CA    1 
ATOM   7348  C  C     . VAL A 1  946  ? 133.866 77.551  -2.244  1.00 102.36 ? 946  VAL A C     1 
ATOM   7349  O  O     . VAL A 1  946  ? 132.673 77.773  -2.474  1.00 102.57 ? 946  VAL A O     1 
ATOM   7350  C  CB    . VAL A 1  946  ? 135.600 76.282  -3.667  1.00 95.38  ? 946  VAL A CB    1 
ATOM   7351  C  CG1   . VAL A 1  946  ? 134.625 75.112  -3.713  1.00 93.57  ? 946  VAL A CG1   1 
ATOM   7352  C  CG2   . VAL A 1  946  ? 136.388 76.370  -4.964  1.00 94.84  ? 946  VAL A CG2   1 
ATOM   7353  N  N     . PHE A 1  947  ? 134.345 77.277  -1.018  1.00 101.25 ? 947  PHE A N     1 
ATOM   7354  C  CA    . PHE A 1  947  ? 133.505 77.209  0.177   1.00 102.18 ? 947  PHE A CA    1 
ATOM   7355  C  C     . PHE A 1  947  ? 133.596 78.554  0.861   1.00 109.20 ? 947  PHE A C     1 
ATOM   7356  O  O     . PHE A 1  947  ? 134.499 78.777  1.671   1.00 110.94 ? 947  PHE A O     1 
ATOM   7357  C  CB    . PHE A 1  947  ? 133.986 76.083  1.098   1.00 103.49 ? 947  PHE A CB    1 
ATOM   7358  C  CG    . PHE A 1  947  ? 134.248 74.795  0.369   1.00 103.50 ? 947  PHE A CG    1 
ATOM   7359  C  CD1   . PHE A 1  947  ? 133.209 74.083  -0.213  1.00 104.92 ? 947  PHE A CD1   1 
ATOM   7360  C  CD2   . PHE A 1  947  ? 135.537 74.317  0.220   1.00 106.60 ? 947  PHE A CD2   1 
ATOM   7361  C  CE1   . PHE A 1  947  ? 133.448 72.881  -0.879  1.00 106.63 ? 947  PHE A CE1   1 
ATOM   7362  C  CE2   . PHE A 1  947  ? 135.777 73.112  -0.445  1.00 106.71 ? 947  PHE A CE2   1 
ATOM   7363  C  CZ    . PHE A 1  947  ? 134.731 72.407  -0.998  1.00 104.67 ? 947  PHE A CZ    1 
ATOM   7364  N  N     . VAL A 1  948  ? 132.690 79.464  0.496   1.00 106.03 ? 948  VAL A N     1 
ATOM   7365  C  CA    . VAL A 1  948  ? 132.666 80.858  0.954   1.00 107.98 ? 948  VAL A CA    1 
ATOM   7366  C  C     . VAL A 1  948  ? 132.470 81.030  2.478   1.00 112.75 ? 948  VAL A C     1 
ATOM   7367  O  O     . VAL A 1  948  ? 133.000 81.987  3.051   1.00 113.05 ? 948  VAL A O     1 
ATOM   7368  C  CB    . VAL A 1  948  ? 131.651 81.706  0.155   1.00 112.87 ? 948  VAL A CB    1 
ATOM   7369  C  CG1   . VAL A 1  948  ? 132.379 82.731  -0.704  1.00 113.78 ? 948  VAL A CG1   1 
ATOM   7370  C  CG2   . VAL A 1  948  ? 130.732 80.831  -0.708  1.00 111.14 ? 948  VAL A CG2   1 
ATOM   7371  N  N     . ASP A 1  949  ? 131.740 80.095  3.120   1.00 109.63 ? 949  ASP A N     1 
ATOM   7372  C  CA    . ASP A 1  949  ? 131.455 80.071  4.561   1.00 111.06 ? 949  ASP A CA    1 
ATOM   7373  C  C     . ASP A 1  949  ? 132.656 79.617  5.421   1.00 116.04 ? 949  ASP A C     1 
ATOM   7374  O  O     . ASP A 1  949  ? 132.670 79.841  6.632   1.00 117.23 ? 949  ASP A O     1 
ATOM   7375  C  CB    . ASP A 1  949  ? 130.209 79.212  4.848   1.00 112.55 ? 949  ASP A CB    1 
ATOM   7376  C  CG    . ASP A 1  949  ? 130.282 77.782  4.330   1.00 130.62 ? 949  ASP A CG    1 
ATOM   7377  O  OD1   . ASP A 1  949  ? 130.462 77.596  3.096   1.00 131.33 ? 949  ASP A OD1   1 
ATOM   7378  O  OD2   . ASP A 1  949  ? 130.076 76.852  5.134   1.00 140.97 ? 949  ASP A OD2   1 
ATOM   7379  N  N     . GLY A 1  950  ? 133.652 79.002  4.790   1.00 111.89 ? 950  GLY A N     1 
ATOM   7380  C  CA    . GLY A 1  950  ? 134.850 78.526  5.469   1.00 112.00 ? 950  GLY A CA    1 
ATOM   7381  C  C     . GLY A 1  950  ? 134.769 77.098  5.962   1.00 115.17 ? 950  GLY A C     1 
ATOM   7382  O  O     . GLY A 1  950  ? 135.689 76.630  6.643   1.00 115.25 ? 950  GLY A O     1 
ATOM   7383  N  N     . GLU A 1  951  ? 133.656 76.401  5.618   1.00 110.53 ? 951  GLU A N     1 
ATOM   7384  C  CA    . GLU A 1  951  ? 133.374 75.005  5.965   1.00 109.07 ? 951  GLU A CA    1 
ATOM   7385  C  C     . GLU A 1  951  ? 134.517 74.155  5.460   1.00 111.25 ? 951  GLU A C     1 
ATOM   7386  O  O     . GLU A 1  951  ? 134.775 74.144  4.261   1.00 110.88 ? 951  GLU A O     1 
ATOM   7387  C  CB    . GLU A 1  951  ? 132.041 74.546  5.337   1.00 109.23 ? 951  GLU A CB    1 
ATOM   7388  C  CG    . GLU A 1  951  ? 131.546 73.196  5.820   1.00 119.06 ? 951  GLU A CG    1 
ATOM   7389  C  CD    . GLU A 1  951  ? 131.923 72.851  7.245   1.00 144.01 ? 951  GLU A CD    1 
ATOM   7390  O  OE1   . GLU A 1  951  ? 131.410 73.510  8.178   1.00 148.78 ? 951  GLU A OE1   1 
ATOM   7391  O  OE2   . GLU A 1  951  ? 132.800 71.976  7.421   1.00 136.85 ? 951  GLU A OE2   1 
ATOM   7392  N  N     . ALA A 1  952  ? 135.262 73.527  6.361   1.00 106.43 ? 952  ALA A N     1 
ATOM   7393  C  CA    . ALA A 1  952  ? 136.416 72.770  5.910   1.00 104.72 ? 952  ALA A CA    1 
ATOM   7394  C  C     . ALA A 1  952  ? 136.216 71.263  5.897   1.00 105.89 ? 952  ALA A C     1 
ATOM   7395  O  O     . ALA A 1  952  ? 137.100 70.566  5.413   1.00 105.59 ? 952  ALA A O     1 
ATOM   7396  C  CB    . ALA A 1  952  ? 137.649 73.151  6.711   1.00 106.72 ? 952  ALA A CB    1 
ATOM   7397  N  N     . ASN A 1  953  ? 135.063 70.758  6.354   1.00 100.29 ? 953  ASN A N     1 
ATOM   7398  C  CA    . ASN A 1  953  ? 134.825 69.320  6.360   1.00 99.21  ? 953  ASN A CA    1 
ATOM   7399  C  C     . ASN A 1  953  ? 133.999 68.844  5.172   1.00 102.26 ? 953  ASN A C     1 
ATOM   7400  O  O     . ASN A 1  953  ? 132.779 69.023  5.133   1.00 103.23 ? 953  ASN A O     1 
ATOM   7401  C  CB    . ASN A 1  953  ? 134.244 68.879  7.680   1.00 101.88 ? 953  ASN A CB    1 
ATOM   7402  C  CG    . ASN A 1  953  ? 135.326 68.697  8.691   1.00 133.76 ? 953  ASN A CG    1 
ATOM   7403  O  OD1   . ASN A 1  953  ? 135.924 67.622  8.798   1.00 136.72 ? 953  ASN A OD1   1 
ATOM   7404  N  ND2   . ASN A 1  953  ? 135.682 69.770  9.373   1.00 124.37 ? 953  ASN A ND2   1 
ATOM   7405  N  N     . TRP A 1  954  ? 134.673 68.232  4.197   1.00 96.91  ? 954  TRP A N     1 
ATOM   7406  C  CA    . TRP A 1  954  ? 134.043 67.779  2.962   1.00 95.49  ? 954  TRP A CA    1 
ATOM   7407  C  C     . TRP A 1  954  ? 134.320 66.345  2.626   1.00 98.30  ? 954  TRP A C     1 
ATOM   7408  O  O     . TRP A 1  954  ? 135.434 65.882  2.885   1.00 99.40  ? 954  TRP A O     1 
ATOM   7409  C  CB    . TRP A 1  954  ? 134.469 68.676  1.808   1.00 94.19  ? 954  TRP A CB    1 
ATOM   7410  C  CG    . TRP A 1  954  ? 133.946 70.055  1.999   1.00 96.05  ? 954  TRP A CG    1 
ATOM   7411  C  CD1   . TRP A 1  954  ? 134.583 71.094  2.609   1.00 100.17 ? 954  TRP A CD1   1 
ATOM   7412  C  CD2   . TRP A 1  954  ? 132.600 70.476  1.792   1.00 95.66  ? 954  TRP A CD2   1 
ATOM   7413  N  NE1   . TRP A 1  954  ? 133.740 72.170  2.704   1.00 100.29 ? 954  TRP A NE1   1 
ATOM   7414  C  CE2   . TRP A 1  954  ? 132.506 71.811  2.235   1.00 100.75 ? 954  TRP A CE2   1 
ATOM   7415  C  CE3   . TRP A 1  954  ? 131.470 69.865  1.241   1.00 95.96  ? 954  TRP A CE3   1 
ATOM   7416  C  CZ2   . TRP A 1  954  ? 131.339 72.554  2.113   1.00 100.30 ? 954  TRP A CZ2   1 
ATOM   7417  C  CZ3   . TRP A 1  954  ? 130.311 70.599  1.133   1.00 97.73  ? 954  TRP A CZ3   1 
ATOM   7418  C  CH2   . TRP A 1  954  ? 130.256 71.931  1.554   1.00 99.58  ? 954  TRP A CH2   1 
ATOM   7419  N  N     . PRO A 1  955  ? 133.352 65.616  2.021   1.00 92.07  ? 955  PRO A N     1 
ATOM   7420  C  CA    . PRO A 1  955  ? 133.609 64.218  1.686   1.00 90.38  ? 955  PRO A CA    1 
ATOM   7421  C  C     . PRO A 1  955  ? 134.484 64.162  0.447   1.00 92.40  ? 955  PRO A C     1 
ATOM   7422  O  O     . PRO A 1  955  ? 134.202 64.829  -0.548  1.00 91.46  ? 955  PRO A O     1 
ATOM   7423  C  CB    . PRO A 1  955  ? 132.211 63.617  1.514   1.00 91.46  ? 955  PRO A CB    1 
ATOM   7424  C  CG    . PRO A 1  955  ? 131.254 64.694  1.884   1.00 97.23  ? 955  PRO A CG    1 
ATOM   7425  C  CD    . PRO A 1  955  ? 131.979 65.983  1.645   1.00 93.38  ? 955  PRO A CD    1 
ATOM   7426  N  N     . LEU A 1  956  ? 135.625 63.469  0.590   1.00 88.28  ? 956  LEU A N     1 
ATOM   7427  C  CA    . LEU A 1  956  ? 136.664 63.285  -0.414  1.00 87.27  ? 956  LEU A CA    1 
ATOM   7428  C  C     . LEU A 1  956  ? 137.148 61.832  -0.409  1.00 91.03  ? 956  LEU A C     1 
ATOM   7429  O  O     . LEU A 1  956  ? 136.928 61.143  0.590   1.00 91.07  ? 956  LEU A O     1 
ATOM   7430  C  CB    . LEU A 1  956  ? 137.828 64.252  -0.130  1.00 87.95  ? 956  LEU A CB    1 
ATOM   7431  C  CG    . LEU A 1  956  ? 137.622 65.658  -0.707  1.00 92.86  ? 956  LEU A CG    1 
ATOM   7432  C  CD1   . LEU A 1  956  ? 138.468 66.681  0.001   1.00 94.19  ? 956  LEU A CD1   1 
ATOM   7433  C  CD2   . LEU A 1  956  ? 137.895 65.700  -2.204  1.00 95.14  ? 956  LEU A CD2   1 
ATOM   7434  N  N     . PRO A 1  957  ? 137.753 61.307  -1.507  1.00 87.12  ? 957  PRO A N     1 
ATOM   7435  C  CA    . PRO A 1  957  ? 138.247 59.923  -1.459  1.00 86.66  ? 957  PRO A CA    1 
ATOM   7436  C  C     . PRO A 1  957  ? 139.601 59.886  -0.758  1.00 89.56  ? 957  PRO A C     1 
ATOM   7437  O  O     . PRO A 1  957  ? 140.194 60.955  -0.536  1.00 89.72  ? 957  PRO A O     1 
ATOM   7438  C  CB    . PRO A 1  957  ? 138.372 59.550  -2.930  1.00 88.10  ? 957  PRO A CB    1 
ATOM   7439  C  CG    . PRO A 1  957  ? 138.695 60.831  -3.612  1.00 92.83  ? 957  PRO A CG    1 
ATOM   7440  C  CD    . PRO A 1  957  ? 138.095 61.950  -2.797  1.00 88.58  ? 957  PRO A CD    1 
ATOM   7441  N  N     . VAL A 1  958  ? 140.097 58.666  -0.434  1.00 84.65  ? 958  VAL A N     1 
ATOM   7442  C  CA    . VAL A 1  958  ? 141.391 58.427  0.236   1.00 84.91  ? 958  VAL A CA    1 
ATOM   7443  C  C     . VAL A 1  958  ? 141.477 59.104  1.627   1.00 89.66  ? 958  VAL A C     1 
ATOM   7444  O  O     . VAL A 1  958  ? 141.808 60.287  1.715   1.00 89.75  ? 958  VAL A O     1 
ATOM   7445  C  CB    . VAL A 1  958  ? 142.618 58.791  -0.652  1.00 88.17  ? 958  VAL A CB    1 
ATOM   7446  C  CG1   . VAL A 1  958  ? 143.877 58.092  -0.175  1.00 89.06  ? 958  VAL A CG1   1 
ATOM   7447  C  CG2   . VAL A 1  958  ? 142.362 58.480  -2.112  1.00 87.04  ? 958  VAL A CG2   1 
ATOM   7448  N  N     . ASN A 1  959  ? 141.189 58.362  2.706   1.00 86.65  ? 959  ASN A N     1 
ATOM   7449  C  CA    . ASN A 1  959  ? 141.289 58.944  4.039   1.00 87.13  ? 959  ASN A CA    1 
ATOM   7450  C  C     . ASN A 1  959  ? 142.754 58.945  4.423   1.00 90.81  ? 959  ASN A C     1 
ATOM   7451  O  O     . ASN A 1  959  ? 143.301 57.909  4.820   1.00 91.63  ? 959  ASN A O     1 
ATOM   7452  C  CB    . ASN A 1  959  ? 140.436 58.206  5.058   1.00 90.45  ? 959  ASN A CB    1 
ATOM   7453  C  CG    . ASN A 1  959  ? 140.207 58.996  6.321   1.00 116.72 ? 959  ASN A CG    1 
ATOM   7454  O  OD1   . ASN A 1  959  ? 141.099 59.162  7.165   1.00 110.83 ? 959  ASN A OD1   1 
ATOM   7455  N  ND2   . ASN A 1  959  ? 138.992 59.495  6.479   1.00 110.10 ? 959  ASN A ND2   1 
ATOM   7456  N  N     . ILE A 1  960  ? 143.396 60.108  4.212   1.00 85.65  ? 960  ILE A N     1 
ATOM   7457  C  CA    . ILE A 1  960  ? 144.813 60.365  4.449   1.00 85.36  ? 960  ILE A CA    1 
ATOM   7458  C  C     . ILE A 1  960  ? 145.172 60.189  5.919   1.00 90.57  ? 960  ILE A C     1 
ATOM   7459  O  O     . ILE A 1  960  ? 146.222 59.597  6.215   1.00 90.38  ? 960  ILE A O     1 
ATOM   7460  C  CB    . ILE A 1  960  ? 145.195 61.744  3.858   1.00 87.32  ? 960  ILE A CB    1 
ATOM   7461  C  CG1   . ILE A 1  960  ? 145.487 61.607  2.367   1.00 86.54  ? 960  ILE A CG1   1 
ATOM   7462  C  CG2   . ILE A 1  960  ? 146.362 62.413  4.569   1.00 88.66  ? 960  ILE A CG2   1 
ATOM   7463  C  CD1   . ILE A 1  960  ? 144.551 62.350  1.529   1.00 92.51  ? 960  ILE A CD1   1 
ATOM   7464  N  N     . ARG A 1  961  ? 144.284 60.658  6.836   1.00 88.03  ? 961  ARG A N     1 
ATOM   7465  C  CA    . ARG A 1  961  ? 144.519 60.519  8.277   1.00 89.78  ? 961  ARG A CA    1 
ATOM   7466  C  C     . ARG A 1  961  ? 144.839 59.063  8.590   1.00 93.01  ? 961  ARG A C     1 
ATOM   7467  O  O     . ARG A 1  961  ? 145.951 58.783  9.027   1.00 93.51  ? 961  ARG A O     1 
ATOM   7468  C  CB    . ARG A 1  961  ? 143.341 61.058  9.124   1.00 92.77  ? 961  ARG A CB    1 
ATOM   7469  C  CG    . ARG A 1  961  ? 143.548 60.928  10.654  1.00 114.50 ? 961  ARG A CG    1 
ATOM   7470  C  CD    . ARG A 1  961  ? 142.770 61.961  11.466  1.00 140.26 ? 961  ARG A CD    1 
ATOM   7471  N  NE    . ARG A 1  961  ? 142.144 61.400  12.672  1.00 161.67 ? 961  ARG A NE    1 
ATOM   7472  C  CZ    . ARG A 1  961  ? 141.931 62.079  13.799  1.00 184.30 ? 961  ARG A CZ    1 
ATOM   7473  N  NH1   . ARG A 1  961  ? 142.317 63.347  13.904  1.00 174.79 ? 961  ARG A NH1   1 
ATOM   7474  N  NH2   . ARG A 1  961  ? 141.344 61.491  14.835  1.00 173.24 ? 961  ARG A NH2   1 
ATOM   7475  N  N     . ARG A 1  962  ? 143.915 58.140  8.234   1.00 87.92  ? 962  ARG A N     1 
ATOM   7476  C  CA    . ARG A 1  962  ? 144.044 56.699  8.437   1.00 87.77  ? 962  ARG A CA    1 
ATOM   7477  C  C     . ARG A 1  962  ? 145.352 56.157  7.874   1.00 90.76  ? 962  ARG A C     1 
ATOM   7478  O  O     . ARG A 1  962  ? 145.957 55.299  8.511   1.00 92.16  ? 962  ARG A O     1 
ATOM   7479  C  CB    . ARG A 1  962  ? 142.835 55.939  7.862   1.00 87.43  ? 962  ARG A CB    1 
ATOM   7480  C  CG    . ARG A 1  962  ? 141.547 56.070  8.694   1.00 100.13 ? 962  ARG A CG    1 
ATOM   7481  C  CD    . ARG A 1  962  ? 140.554 54.924  8.468   1.00 107.95 ? 962  ARG A CD    1 
ATOM   7482  N  NE    . ARG A 1  962  ? 139.754 55.085  7.254   1.00 109.46 ? 962  ARG A NE    1 
ATOM   7483  C  CZ    . ARG A 1  962  ? 140.057 54.543  6.078   1.00 126.11 ? 962  ARG A CZ    1 
ATOM   7484  N  NH1   . ARG A 1  962  ? 141.135 53.778  5.947   1.00 112.35 ? 962  ARG A NH1   1 
ATOM   7485  N  NH2   . ARG A 1  962  ? 139.288 54.764  5.023   1.00 115.58 ? 962  ARG A NH2   1 
ATOM   7486  N  N     . ILE A 1  963  ? 145.825 56.697  6.729   1.00 84.72  ? 963  ILE A N     1 
ATOM   7487  C  CA    . ILE A 1  963  ? 147.079 56.251  6.112   1.00 84.34  ? 963  ILE A CA    1 
ATOM   7488  C  C     . ILE A 1  963  ? 148.261 56.646  6.981   1.00 87.89  ? 963  ILE A C     1 
ATOM   7489  O  O     . ILE A 1  963  ? 149.092 55.796  7.300   1.00 88.76  ? 963  ILE A O     1 
ATOM   7490  C  CB    . ILE A 1  963  ? 147.230 56.674  4.627   1.00 86.28  ? 963  ILE A CB    1 
ATOM   7491  C  CG1   . ILE A 1  963  ? 145.995 56.224  3.819   1.00 86.10  ? 963  ILE A CG1   1 
ATOM   7492  C  CG2   . ILE A 1  963  ? 148.510 56.080  4.007   1.00 87.03  ? 963  ILE A CG2   1 
ATOM   7493  C  CD1   . ILE A 1  963  ? 145.798 56.910  2.522   1.00 96.25  ? 963  ILE A CD1   1 
ATOM   7494  N  N     . ILE A 1  964  ? 148.310 57.898  7.416   1.00 83.44  ? 964  ILE A N     1 
ATOM   7495  C  CA    . ILE A 1  964  ? 149.390 58.321  8.298   1.00 84.86  ? 964  ILE A CA    1 
ATOM   7496  C  C     . ILE A 1  964  ? 149.304 57.539  9.633   1.00 90.11  ? 964  ILE A C     1 
ATOM   7497  O  O     . ILE A 1  964  ? 150.295 56.935  10.059  1.00 89.30  ? 964  ILE A O     1 
ATOM   7498  C  CB    . ILE A 1  964  ? 149.384 59.867  8.426   1.00 87.76  ? 964  ILE A CB    1 
ATOM   7499  C  CG1   . ILE A 1  964  ? 149.910 60.494  7.122   1.00 87.16  ? 964  ILE A CG1   1 
ATOM   7500  C  CG2   . ILE A 1  964  ? 150.190 60.368  9.640   1.00 90.21  ? 964  ILE A CG2   1 
ATOM   7501  C  CD1   . ILE A 1  964  ? 149.071 61.586  6.598   1.00 95.94  ? 964  ILE A CD1   1 
ATOM   7502  N  N     . GLN A 1  965  ? 148.080 57.475  10.213  1.00 88.67  ? 965  GLN A N     1 
ATOM   7503  C  CA    . GLN A 1  965  ? 147.730 56.776  11.455  1.00 90.79  ? 965  GLN A CA    1 
ATOM   7504  C  C     . GLN A 1  965  ? 148.308 55.379  11.434  1.00 97.36  ? 965  GLN A C     1 
ATOM   7505  O  O     . GLN A 1  965  ? 148.955 54.983  12.410  1.00 99.13  ? 965  GLN A O     1 
ATOM   7506  C  CB    . GLN A 1  965  ? 146.201 56.696  11.643  1.00 91.46  ? 965  GLN A CB    1 
ATOM   7507  C  CG    . GLN A 1  965  ? 145.535 57.952  12.213  1.00 109.71 ? 965  GLN A CG    1 
ATOM   7508  C  CD    . GLN A 1  965  ? 144.065 57.769  12.579  1.00 136.74 ? 965  GLN A CD    1 
ATOM   7509  O  OE1   . GLN A 1  965  ? 143.541 58.469  13.450  1.00 135.74 ? 965  GLN A OE1   1 
ATOM   7510  N  NE2   . GLN A 1  965  ? 143.357 56.818  11.954  1.00 128.84 ? 965  GLN A NE2   1 
ATOM   7511  N  N     . ASN A 1  966  ? 148.109 54.650  10.297  1.00 93.94  ? 966  ASN A N     1 
ATOM   7512  C  CA    . ASN A 1  966  ? 148.639 53.299  10.091  1.00 95.15  ? 966  ASN A CA    1 
ATOM   7513  C  C     . ASN A 1  966  ? 150.158 53.343  10.003  1.00 99.39  ? 966  ASN A C     1 
ATOM   7514  O  O     . ASN A 1  966  ? 150.799 52.673  10.803  1.00 101.31 ? 966  ASN A O     1 
ATOM   7515  C  CB    . ASN A 1  966  ? 148.066 52.615  8.848   1.00 96.66  ? 966  ASN A CB    1 
ATOM   7516  C  CG    . ASN A 1  966  ? 146.578 52.443  8.813   1.00 130.29 ? 966  ASN A CG    1 
ATOM   7517  O  OD1   . ASN A 1  966  ? 145.918 52.159  9.829   1.00 129.16 ? 966  ASN A OD1   1 
ATOM   7518  N  ND2   . ASN A 1  966  ? 146.026 52.620  7.614   1.00 121.52 ? 966  ASN A ND2   1 
ATOM   7519  N  N     . ALA A 1  967  ? 150.741 54.170  9.099   1.00 93.13  ? 967  ALA A N     1 
ATOM   7520  C  CA    . ALA A 1  967  ? 152.191 54.264  8.960   1.00 93.18  ? 967  ALA A CA    1 
ATOM   7521  C  C     . ALA A 1  967  ? 152.881 54.329  10.307  1.00 98.91  ? 967  ALA A C     1 
ATOM   7522  O  O     . ALA A 1  967  ? 153.833 53.584  10.510  1.00 100.63 ? 967  ALA A O     1 
ATOM   7523  C  CB    . ALA A 1  967  ? 152.570 55.449  8.109   1.00 92.67  ? 967  ALA A CB    1 
ATOM   7524  N  N     . GLN A 1  968  ? 152.341 55.115  11.261  1.00 95.83  ? 968  GLN A N     1 
ATOM   7525  C  CA    . GLN A 1  968  ? 152.899 55.216  12.609  1.00 98.65  ? 968  GLN A CA    1 
ATOM   7526  C  C     . GLN A 1  968  ? 152.889 53.887  13.385  1.00 107.95 ? 968  GLN A C     1 
ATOM   7527  O  O     . GLN A 1  968  ? 153.922 53.505  13.948  1.00 109.47 ? 968  GLN A O     1 
ATOM   7528  C  CB    . GLN A 1  968  ? 152.220 56.329  13.403  1.00 99.56  ? 968  GLN A CB    1 
ATOM   7529  C  CG    . GLN A 1  968  ? 152.902 57.663  13.217  1.00 111.29 ? 968  GLN A CG    1 
ATOM   7530  C  CD    . GLN A 1  968  ? 151.946 58.799  12.994  1.00 133.27 ? 968  GLN A CD    1 
ATOM   7531  O  OE1   . GLN A 1  968  ? 150.803 58.625  12.549  1.00 126.98 ? 968  GLN A OE1   1 
ATOM   7532  N  NE2   . GLN A 1  968  ? 152.420 60.007  13.257  1.00 130.76 ? 968  GLN A NE2   1 
ATOM   7533  N  N     . GLN A 1  969  ? 151.734 53.177  13.397  1.00 106.40 ? 969  GLN A N     1 
ATOM   7534  C  CA    . GLN A 1  969  ? 151.602 51.889  14.098  1.00 108.92 ? 969  GLN A CA    1 
ATOM   7535  C  C     . GLN A 1  969  ? 152.362 50.758  13.326  1.00 114.97 ? 969  GLN A C     1 
ATOM   7536  O  O     . GLN A 1  969  ? 152.858 49.826  13.961  1.00 117.84 ? 969  GLN A O     1 
ATOM   7537  C  CB    . GLN A 1  969  ? 150.103 51.573  14.440  1.00 109.34 ? 969  GLN A CB    1 
ATOM   7538  C  CG    . GLN A 1  969  ? 149.462 50.263  13.933  1.00 124.28 ? 969  GLN A CG    1 
ATOM   7539  C  CD    . GLN A 1  969  ? 148.058 50.489  13.352  1.00 147.35 ? 969  GLN A CD    1 
ATOM   7540  O  OE1   . GLN A 1  969  ? 147.064 50.725  14.067  1.00 141.75 ? 969  GLN A OE1   1 
ATOM   7541  N  NE2   . GLN A 1  969  ? 147.933 50.408  12.028  1.00 138.69 ? 969  GLN A NE2   1 
ATOM   7542  N  N     . THR A 1  970  ? 152.511 50.904  11.984  1.00 108.80 ? 970  THR A N     1 
ATOM   7543  C  CA    . THR A 1  970  ? 153.158 49.963  11.067  1.00 108.48 ? 970  THR A CA    1 
ATOM   7544  C  C     . THR A 1  970  ? 154.627 50.008  11.241  1.00 114.82 ? 970  THR A C     1 
ATOM   7545  O  O     . THR A 1  970  ? 155.263 48.967  11.370  1.00 116.70 ? 970  THR A O     1 
ATOM   7546  C  CB    . THR A 1  970  ? 152.881 50.359  9.609   1.00 114.35 ? 970  THR A CB    1 
ATOM   7547  O  OG1   . THR A 1  970  ? 151.478 50.439  9.384   1.00 119.49 ? 970  THR A OG1   1 
ATOM   7548  C  CG2   . THR A 1  970  ? 153.519 49.413  8.603   1.00 110.85 ? 970  THR A CG2   1 
ATOM   7549  N  N     . PHE A 1  971  ? 155.180 51.203  11.151  1.00 111.98 ? 971  PHE A N     1 
ATOM   7550  C  CA    . PHE A 1  971  ? 156.603 51.379  11.200  1.00 114.44 ? 971  PHE A CA    1 
ATOM   7551  C  C     . PHE A 1  971  ? 157.102 51.760  12.577  1.00 126.91 ? 971  PHE A C     1 
ATOM   7552  O  O     . PHE A 1  971  ? 158.272 52.107  12.707  1.00 128.14 ? 971  PHE A O     1 
ATOM   7553  C  CB    . PHE A 1  971  ? 157.041 52.366  10.118  1.00 114.11 ? 971  PHE A CB    1 
ATOM   7554  C  CG    . PHE A 1  971  ? 156.712 51.939  8.702   1.00 113.51 ? 971  PHE A CG    1 
ATOM   7555  C  CD1   . PHE A 1  971  ? 157.498 51.006  8.037   1.00 115.61 ? 971  PHE A CD1   1 
ATOM   7556  C  CD2   . PHE A 1  971  ? 155.641 52.501  8.020   1.00 114.30 ? 971  PHE A CD2   1 
ATOM   7557  C  CE1   . PHE A 1  971  ? 157.215 50.639  6.718   1.00 116.84 ? 971  PHE A CE1   1 
ATOM   7558  C  CE2   . PHE A 1  971  ? 155.360 52.132  6.700   1.00 113.48 ? 971  PHE A CE2   1 
ATOM   7559  C  CZ    . PHE A 1  971  ? 156.155 51.211  6.055   1.00 112.80 ? 971  PHE A CZ    1 
ATOM   7560  N  N     . HIS A 1  972  ? 156.252 51.637  13.617  1.00 129.58 ? 972  HIS A N     1 
ATOM   7561  C  CA    . HIS A 1  972  ? 156.618 51.931  15.012  1.00 134.55 ? 972  HIS A CA    1 
ATOM   7562  C  C     . HIS A 1  972  ? 157.422 53.242  15.113  1.00 139.95 ? 972  HIS A C     1 
ATOM   7563  O  O     . HIS A 1  972  ? 158.543 53.280  15.647  1.00 140.99 ? 972  HIS A O     1 
ATOM   7564  C  CB    . HIS A 1  972  ? 157.355 50.740  15.665  1.00 139.63 ? 972  HIS A CB    1 
ATOM   7565  C  CG    . HIS A 1  972  ? 156.798 49.391  15.312  1.00 144.69 ? 972  HIS A CG    1 
ATOM   7566  N  ND1   . HIS A 1  972  ? 155.456 49.216  14.975  1.00 145.70 ? 972  HIS A ND1   1 
ATOM   7567  C  CD2   . HIS A 1  972  ? 157.418 48.186  15.271  1.00 149.25 ? 972  HIS A CD2   1 
ATOM   7568  C  CE1   . HIS A 1  972  ? 155.312 47.919  14.730  1.00 146.30 ? 972  HIS A CE1   1 
ATOM   7569  N  NE2   . HIS A 1  972  ? 156.462 47.257  14.898  1.00 148.70 ? 972  HIS A NE2   1 
ATOM   7570  N  N     . ILE A 1  973  ? 156.834 54.306  14.535  1.00 135.69 ? 973  ILE A N     1 
ATOM   7571  C  CA    . ILE A 1  973  ? 157.392 55.645  14.457  1.00 135.72 ? 973  ILE A CA    1 
ATOM   7572  C  C     . ILE A 1  973  ? 157.613 56.239  15.858  1.00 145.17 ? 973  ILE A C     1 
ATOM   7573  O  O     . ILE A 1  973  ? 156.651 56.522  16.583  1.00 144.56 ? 973  ILE A O     1 
ATOM   7574  C  CB    . ILE A 1  973  ? 156.522 56.512  13.500  1.00 135.49 ? 973  ILE A CB    1 
ATOM   7575  C  CG1   . ILE A 1  973  ? 157.027 56.334  12.062  1.00 134.16 ? 973  ILE A CG1   1 
ATOM   7576  C  CG2   . ILE A 1  973  ? 156.498 57.998  13.882  1.00 136.01 ? 973  ILE A CG2   1 
ATOM   7577  C  CD1   . ILE A 1  973  ? 156.053 56.527  11.020  1.00 137.44 ? 973  ILE A CD1   1 
ATOM   7578  N  N     . ASP A 1  974  ? 158.900 56.355  16.250  1.00 146.68 ? 974  ASP A N     1 
ATOM   7579  C  CA    . ASP A 1  974  ? 159.284 56.952  17.524  1.00 150.08 ? 974  ASP A CA    1 
ATOM   7580  C  C     . ASP A 1  974  ? 159.436 58.450  17.286  1.00 154.62 ? 974  ASP A C     1 
ATOM   7581  O  O     . ASP A 1  974  ? 160.167 58.881  16.386  1.00 153.44 ? 974  ASP A O     1 
ATOM   7582  C  CB    . ASP A 1  974  ? 160.540 56.289  18.134  1.00 155.44 ? 974  ASP A CB    1 
ATOM   7583  C  CG    . ASP A 1  974  ? 161.890 56.777  17.631  1.00 172.74 ? 974  ASP A CG    1 
ATOM   7584  O  OD1   . ASP A 1  974  ? 162.106 56.768  16.394  1.00 173.30 ? 974  ASP A OD1   1 
ATOM   7585  O  OD2   . ASP A 1  974  ? 162.744 57.133  18.476  1.00 181.57 ? 974  ASP A OD2   1 
ATOM   7586  N  N     . HIS A 1  975  ? 158.675 59.241  18.041  1.00 152.47 ? 975  HIS A N     1 
ATOM   7587  C  CA    . HIS A 1  975  ? 158.633 60.693  17.888  1.00 152.11 ? 975  HIS A CA    1 
ATOM   7588  C  C     . HIS A 1  975  ? 159.787 61.347  18.644  1.00 155.05 ? 975  HIS A C     1 
ATOM   7589  O  O     . HIS A 1  975  ? 159.657 62.461  19.148  1.00 154.74 ? 975  HIS A O     1 
ATOM   7590  C  CB    . HIS A 1  975  ? 157.250 61.224  18.326  1.00 153.41 ? 975  HIS A CB    1 
ATOM   7591  C  CG    . HIS A 1  975  ? 156.085 60.566  17.626  1.00 155.76 ? 975  HIS A CG    1 
ATOM   7592  N  ND1   . HIS A 1  975  ? 155.327 61.247  16.677  1.00 155.68 ? 975  HIS A ND1   1 
ATOM   7593  C  CD2   . HIS A 1  975  ? 155.577 59.314  17.767  1.00 158.21 ? 975  HIS A CD2   1 
ATOM   7594  C  CE1   . HIS A 1  975  ? 154.402 60.389  16.268  1.00 154.02 ? 975  HIS A CE1   1 
ATOM   7595  N  NE2   . HIS A 1  975  ? 154.514 59.212  16.891  1.00 155.74 ? 975  HIS A NE2   1 
ATOM   7596  N  N     . THR A 1  976  ? 160.932 60.645  18.694  1.00 151.39 ? 976  THR A N     1 
ATOM   7597  C  CA    . THR A 1  976  ? 162.148 61.059  19.396  1.00 152.71 ? 976  THR A CA    1 
ATOM   7598  C  C     . THR A 1  976  ? 163.295 61.385  18.426  1.00 153.72 ? 976  THR A C     1 
ATOM   7599  O  O     . THR A 1  976  ? 163.880 62.473  18.496  1.00 154.03 ? 976  THR A O     1 
ATOM   7600  C  CB    . THR A 1  976  ? 162.565 60.006  20.482  1.00 163.24 ? 976  THR A CB    1 
ATOM   7601  O  OG1   . THR A 1  976  ? 163.646 59.183  20.029  1.00 162.45 ? 976  THR A OG1   1 
ATOM   7602  C  CG2   . THR A 1  976  ? 161.404 59.126  20.970  1.00 161.80 ? 976  THR A CG2   1 
ATOM   7603  N  N     . LYS A 1  977  ? 163.603 60.431  17.526  1.00 146.71 ? 977  LYS A N     1 
ATOM   7604  C  CA    . LYS A 1  977  ? 164.717 60.492  16.583  1.00 144.75 ? 977  LYS A CA    1 
ATOM   7605  C  C     . LYS A 1  977  ? 164.404 61.230  15.261  1.00 142.51 ? 977  LYS A C     1 
ATOM   7606  O  O     . LYS A 1  977  ? 163.254 61.196  14.801  1.00 140.23 ? 977  LYS A O     1 
ATOM   7607  C  CB    . LYS A 1  977  ? 165.260 59.075  16.324  1.00 147.80 ? 977  LYS A CB    1 
ATOM   7608  C  CG    . LYS A 1  977  ? 165.711 58.335  17.598  1.00 164.46 ? 977  LYS A CG    1 
ATOM   7609  C  CD    . LYS A 1  977  ? 166.806 59.072  18.396  1.00 174.41 ? 977  LYS A CD    1 
ATOM   7610  C  CE    . LYS A 1  977  ? 166.995 58.517  19.786  1.00 182.72 ? 977  LYS A CE    1 
ATOM   7611  N  NZ    . LYS A 1  977  ? 168.267 58.993  20.393  1.00 189.93 ? 977  LYS A NZ    1 
ATOM   7612  N  N     . PRO A 1  978  ? 165.423 61.904  14.649  1.00 135.89 ? 978  PRO A N     1 
ATOM   7613  C  CA    . PRO A 1  978  ? 165.175 62.653  13.400  1.00 132.44 ? 978  PRO A CA    1 
ATOM   7614  C  C     . PRO A 1  978  ? 165.030 61.802  12.130  1.00 131.75 ? 978  PRO A C     1 
ATOM   7615  O  O     . PRO A 1  978  ? 165.717 60.790  11.979  1.00 132.33 ? 978  PRO A O     1 
ATOM   7616  C  CB    . PRO A 1  978  ? 166.370 63.604  13.321  1.00 135.27 ? 978  PRO A CB    1 
ATOM   7617  C  CG    . PRO A 1  978  ? 167.457 62.888  14.017  1.00 142.26 ? 978  PRO A CG    1 
ATOM   7618  C  CD    . PRO A 1  978  ? 166.826 62.057  15.091  1.00 138.99 ? 978  PRO A CD    1 
ATOM   7619  N  N     . SER A 1  979  ? 164.154 62.248  11.205  1.00 123.58 ? 979  SER A N     1 
ATOM   7620  C  CA    . SER A 1  979  ? 163.831 61.592  9.933   1.00 120.77 ? 979  SER A CA    1 
ATOM   7621  C  C     . SER A 1  979  ? 164.992 61.468  8.939   1.00 124.23 ? 979  SER A C     1 
ATOM   7622  O  O     . SER A 1  979  ? 165.927 62.273  8.966   1.00 124.65 ? 979  SER A O     1 
ATOM   7623  C  CB    . SER A 1  979  ? 162.654 62.296  9.265   1.00 120.55 ? 979  SER A CB    1 
ATOM   7624  O  OG    . SER A 1  979  ? 162.405 61.817  7.952   1.00 123.55 ? 979  SER A OG    1 
ATOM   7625  N  N     . ASP A 1  980  ? 164.887 60.476  8.028   1.00 119.85 ? 980  ASP A N     1 
ATOM   7626  C  CA    . ASP A 1  980  ? 165.864 60.237  6.960   1.00 120.25 ? 980  ASP A CA    1 
ATOM   7627  C  C     . ASP A 1  980  ? 165.494 60.954  5.648   1.00 121.26 ? 980  ASP A C     1 
ATOM   7628  O  O     . ASP A 1  980  ? 166.261 60.910  4.676   1.00 121.21 ? 980  ASP A O     1 
ATOM   7629  C  CB    . ASP A 1  980  ? 166.151 58.734  6.721   1.00 123.39 ? 980  ASP A CB    1 
ATOM   7630  C  CG    . ASP A 1  980  ? 165.273 57.744  7.445   1.00 135.83 ? 980  ASP A CG    1 
ATOM   7631  O  OD1   . ASP A 1  980  ? 164.155 57.487  6.962   1.00 135.94 ? 980  ASP A OD1   1 
ATOM   7632  O  OD2   . ASP A 1  980  ? 165.740 57.160  8.449   1.00 143.31 ? 980  ASP A OD2   1 
ATOM   7633  N  N     . LEU A 1  981  ? 164.334 61.637  5.639   1.00 114.74 ? 981  LEU A N     1 
ATOM   7634  C  CA    . LEU A 1  981  ? 163.835 62.397  4.492   1.00 111.93 ? 981  LEU A CA    1 
ATOM   7635  C  C     . LEU A 1  981  ? 164.647 63.691  4.193   1.00 115.89 ? 981  LEU A C     1 
ATOM   7636  O  O     . LEU A 1  981  ? 165.281 64.265  5.093   1.00 116.53 ? 981  LEU A O     1 
ATOM   7637  C  CB    . LEU A 1  981  ? 162.353 62.735  4.706   1.00 109.76 ? 981  LEU A CB    1 
ATOM   7638  C  CG    . LEU A 1  981  ? 161.376 61.582  4.596   1.00 112.82 ? 981  LEU A CG    1 
ATOM   7639  C  CD1   . LEU A 1  981  ? 160.141 61.848  5.392   1.00 111.70 ? 981  LEU A CD1   1 
ATOM   7640  C  CD2   . LEU A 1  981  ? 160.983 61.342  3.164   1.00 114.24 ? 981  LEU A CD2   1 
ATOM   7641  N  N     . THR A 1  982  ? 164.630 64.120  2.909   1.00 111.02 ? 982  THR A N     1 
ATOM   7642  C  CA    . THR A 1  982  ? 165.264 65.345  2.406   1.00 111.01 ? 982  THR A CA    1 
ATOM   7643  C  C     . THR A 1  982  ? 164.142 66.271  2.022   1.00 113.34 ? 982  THR A C     1 
ATOM   7644  O  O     . THR A 1  982  ? 163.030 65.800  1.744   1.00 110.37 ? 982  THR A O     1 
ATOM   7645  C  CB    . THR A 1  982  ? 166.040 65.113  1.089   1.00 119.14 ? 982  THR A CB    1 
ATOM   7646  O  OG1   . THR A 1  982  ? 166.486 63.765  0.984   1.00 120.50 ? 982  THR A OG1   1 
ATOM   7647  C  CG2   . THR A 1  982  ? 167.199 66.109  0.897   1.00 119.02 ? 982  THR A CG2   1 
ATOM   7648  N  N     . ILE A 1  983  ? 164.443 67.586  1.926   1.00 111.43 ? 983  ILE A N     1 
ATOM   7649  C  CA    . ILE A 1  983  ? 163.469 68.572  1.464   1.00 110.32 ? 983  ILE A CA    1 
ATOM   7650  C  C     . ILE A 1  983  ? 163.002 68.141  0.057   1.00 114.56 ? 983  ILE A C     1 
ATOM   7651  O  O     . ILE A 1  983  ? 161.795 68.098  -0.213  1.00 112.38 ? 983  ILE A O     1 
ATOM   7652  C  CB    . ILE A 1  983  ? 164.060 70.003  1.567   1.00 113.97 ? 983  ILE A CB    1 
ATOM   7653  C  CG1   . ILE A 1  983  ? 163.649 70.654  2.899   1.00 114.49 ? 983  ILE A CG1   1 
ATOM   7654  C  CG2   . ILE A 1  983  ? 163.658 70.898  0.390   1.00 113.87 ? 983  ILE A CG2   1 
ATOM   7655  C  CD1   . ILE A 1  983  ? 164.311 70.097  4.115   1.00 121.35 ? 983  ILE A CD1   1 
ATOM   7656  N  N     . LYS A 1  984  ? 163.974 67.696  -0.774  1.00 112.69 ? 984  LYS A N     1 
ATOM   7657  C  CA    . LYS A 1  984  ? 163.755 67.166  -2.113  1.00 111.34 ? 984  LYS A CA    1 
ATOM   7658  C  C     . LYS A 1  984  ? 162.830 65.953  -2.016  1.00 113.46 ? 984  LYS A C     1 
ATOM   7659  O  O     . LYS A 1  984  ? 161.799 65.961  -2.679  1.00 111.94 ? 984  LYS A O     1 
ATOM   7660  C  CB    . LYS A 1  984  ? 165.096 66.810  -2.797  1.00 114.59 ? 984  LYS A CB    1 
ATOM   7661  C  CG    . LYS A 1  984  ? 165.925 68.023  -3.236  1.00 115.12 ? 984  LYS A CG    1 
ATOM   7662  C  CD    . LYS A 1  984  ? 166.430 67.893  -4.674  1.00 119.22 ? 984  LYS A CD    1 
ATOM   7663  C  CE    . LYS A 1  984  ? 167.440 68.960  -5.020  1.00 132.06 ? 984  LYS A CE    1 
ATOM   7664  N  NZ    . LYS A 1  984  ? 167.886 68.875  -6.437  1.00 143.10 ? 984  LYS A NZ    1 
ATOM   7665  N  N     . ASP A 1  985  ? 163.135 64.977  -1.119  1.00 110.21 ? 985  ASP A N     1 
ATOM   7666  C  CA    . ASP A 1  985  ? 162.333 63.759  -0.910  1.00 109.37 ? 985  ASP A CA    1 
ATOM   7667  C  C     . ASP A 1  985  ? 160.853 64.040  -0.737  1.00 109.32 ? 985  ASP A C     1 
ATOM   7668  O  O     . ASP A 1  985  ? 160.035 63.426  -1.428  1.00 107.33 ? 985  ASP A O     1 
ATOM   7669  C  CB    . ASP A 1  985  ? 162.833 62.955  0.303   1.00 113.41 ? 985  ASP A CB    1 
ATOM   7670  C  CG    . ASP A 1  985  ? 163.946 61.970  0.023   1.00 135.28 ? 985  ASP A CG    1 
ATOM   7671  O  OD1   . ASP A 1  985  ? 164.170 61.648  -1.165  1.00 138.14 ? 985  ASP A OD1   1 
ATOM   7672  O  OD2   . ASP A 1  985  ? 164.576 61.489  0.999   1.00 144.88 ? 985  ASP A OD2   1 
ATOM   7673  N  N     . ILE A 1  986  ? 160.516 64.981  0.176   1.00 104.37 ? 986  ILE A N     1 
ATOM   7674  C  CA    . ILE A 1  986  ? 159.139 65.369  0.479   1.00 101.83 ? 986  ILE A CA    1 
ATOM   7675  C  C     . ILE A 1  986  ? 158.549 66.205  -0.662  1.00 104.60 ? 986  ILE A C     1 
ATOM   7676  O  O     . ILE A 1  986  ? 157.651 65.712  -1.350  1.00 103.39 ? 986  ILE A O     1 
ATOM   7677  C  CB    . ILE A 1  986  ? 158.988 66.037  1.882   1.00 104.62 ? 986  ILE A CB    1 
ATOM   7678  C  CG1   . ILE A 1  986  ? 159.537 65.117  2.997   1.00 105.49 ? 986  ILE A CG1   1 
ATOM   7679  C  CG2   . ILE A 1  986  ? 157.525 66.433  2.152   1.00 103.85 ? 986  ILE A CG2   1 
ATOM   7680  C  CD1   . ILE A 1  986  ? 159.588 65.702  4.392   1.00 107.92 ? 986  ILE A CD1   1 
ATOM   7681  N  N     . VAL A 1  987  ? 159.070 67.442  -0.879  1.00 100.86 ? 987  VAL A N     1 
ATOM   7682  C  CA    . VAL A 1  987  ? 158.593 68.384  -1.902  1.00 99.95  ? 987  VAL A CA    1 
ATOM   7683  C  C     . VAL A 1  987  ? 158.339 67.681  -3.245  1.00 103.83 ? 987  VAL A C     1 
ATOM   7684  O  O     . VAL A 1  987  ? 157.187 67.640  -3.702  1.00 101.99 ? 987  VAL A O     1 
ATOM   7685  C  CB    . VAL A 1  987  ? 159.498 69.654  -2.029  1.00 104.70 ? 987  VAL A CB    1 
ATOM   7686  C  CG1   . VAL A 1  987  ? 159.305 70.390  -3.359  1.00 103.96 ? 987  VAL A CG1   1 
ATOM   7687  C  CG2   . VAL A 1  987  ? 159.243 70.607  -0.872  1.00 104.91 ? 987  VAL A CG2   1 
ATOM   7688  N  N     . LEU A 1  988  ? 159.392 67.085  -3.827  1.00 102.19 ? 988  LEU A N     1 
ATOM   7689  C  CA    . LEU A 1  988  ? 159.304 66.414  -5.117  1.00 102.27 ? 988  LEU A CA    1 
ATOM   7690  C  C     . LEU A 1  988  ? 158.476 65.146  -5.077  1.00 106.21 ? 988  LEU A C     1 
ATOM   7691  O  O     . LEU A 1  988  ? 157.818 64.867  -6.074  1.00 106.89 ? 988  LEU A O     1 
ATOM   7692  C  CB    . LEU A 1  988  ? 160.678 66.163  -5.741  1.00 104.00 ? 988  LEU A CB    1 
ATOM   7693  C  CG    . LEU A 1  988  ? 161.627 67.359  -5.717  1.00 110.74 ? 988  LEU A CG    1 
ATOM   7694  C  CD1   . LEU A 1  988  ? 163.039 66.937  -6.006  1.00 112.82 ? 988  LEU A CD1   1 
ATOM   7695  C  CD2   . LEU A 1  988  ? 161.169 68.459  -6.663  1.00 114.54 ? 988  LEU A CD2   1 
ATOM   7696  N  N     . GLY A 1  989  ? 158.444 64.442  -3.938  1.00 101.21 ? 989  GLY A N     1 
ATOM   7697  C  CA    . GLY A 1  989  ? 157.633 63.233  -3.772  1.00 99.64  ? 989  GLY A CA    1 
ATOM   7698  C  C     . GLY A 1  989  ? 156.139 63.469  -3.942  1.00 99.26  ? 989  GLY A C     1 
ATOM   7699  O  O     . GLY A 1  989  ? 155.456 62.747  -4.683  1.00 96.20  ? 989  GLY A O     1 
ATOM   7700  N  N     . VAL A 1  990  ? 155.638 64.510  -3.270  1.00 95.88  ? 990  VAL A N     1 
ATOM   7701  C  CA    . VAL A 1  990  ? 154.241 64.910  -3.330  1.00 95.15  ? 990  VAL A CA    1 
ATOM   7702  C  C     . VAL A 1  990  ? 153.899 65.398  -4.737  1.00 100.94 ? 990  VAL A C     1 
ATOM   7703  O  O     . VAL A 1  990  ? 152.851 65.018  -5.273  1.00 99.83  ? 990  VAL A O     1 
ATOM   7704  C  CB    . VAL A 1  990  ? 153.865 65.942  -2.241  1.00 99.03  ? 990  VAL A CB    1 
ATOM   7705  C  CG1   . VAL A 1  990  ? 152.354 66.151  -2.202  1.00 97.56  ? 990  VAL A CG1   1 
ATOM   7706  C  CG2   . VAL A 1  990  ? 154.363 65.499  -0.870  1.00 99.80  ? 990  VAL A CG2   1 
ATOM   7707  N  N     . LYS A 1  991  ? 154.792 66.220  -5.340  1.00 99.78  ? 991  LYS A N     1 
ATOM   7708  C  CA    . LYS A 1  991  ? 154.630 66.743  -6.700  1.00 99.89  ? 991  LYS A CA    1 
ATOM   7709  C  C     . LYS A 1  991  ? 154.414 65.584  -7.671  1.00 106.37 ? 991  LYS A C     1 
ATOM   7710  O  O     . LYS A 1  991  ? 153.461 65.611  -8.456  1.00 105.51 ? 991  LYS A O     1 
ATOM   7711  C  CB    . LYS A 1  991  ? 155.845 67.587  -7.119  1.00 102.49 ? 991  LYS A CB    1 
ATOM   7712  C  CG    . LYS A 1  991  ? 155.748 69.049  -6.721  1.00 112.30 ? 991  LYS A CG    1 
ATOM   7713  C  CD    . LYS A 1  991  ? 157.050 69.790  -7.045  1.00 129.70 ? 991  LYS A CD    1 
ATOM   7714  C  CE    . LYS A 1  991  ? 156.934 71.308  -7.018  1.00 145.51 ? 991  LYS A CE    1 
ATOM   7715  N  NZ    . LYS A 1  991  ? 158.257 71.996  -7.175  1.00 150.82 ? 991  LYS A NZ    1 
ATOM   7716  N  N     . ASP A 1  992  ? 155.238 64.528  -7.533  1.00 105.46 ? 992  ASP A N     1 
ATOM   7717  C  CA    . ASP A 1  992  ? 155.197 63.332  -8.365  1.00 106.76 ? 992  ASP A CA    1 
ATOM   7718  C  C     . ASP A 1  992  ? 154.005 62.452  -8.109  1.00 107.93 ? 992  ASP A C     1 
ATOM   7719  O  O     . ASP A 1  992  ? 153.527 61.847  -9.067  1.00 107.95 ? 992  ASP A O     1 
ATOM   7720  C  CB    . ASP A 1  992  ? 156.499 62.526  -8.255  1.00 112.06 ? 992  ASP A CB    1 
ATOM   7721  C  CG    . ASP A 1  992  ? 157.758 63.279  -8.690  1.00 141.02 ? 992  ASP A CG    1 
ATOM   7722  O  OD1   . ASP A 1  992  ? 157.646 64.489  -9.059  1.00 143.71 ? 992  ASP A OD1   1 
ATOM   7723  O  OD2   . ASP A 1  992  ? 158.868 62.685  -8.604  1.00 153.99 ? 992  ASP A OD2   1 
ATOM   7724  N  N     . LEU A 1  993  ? 153.525 62.358  -6.837  1.00 101.67 ? 993  LEU A N     1 
ATOM   7725  C  CA    . LEU A 1  993  ? 152.342 61.548  -6.477  1.00 99.14  ? 993  LEU A CA    1 
ATOM   7726  C  C     . LEU A 1  993  ? 151.126 62.032  -7.246  1.00 100.74 ? 993  LEU A C     1 
ATOM   7727  O  O     . LEU A 1  993  ? 150.382 61.218  -7.798  1.00 99.40  ? 993  LEU A O     1 
ATOM   7728  C  CB    . LEU A 1  993  ? 152.066 61.572  -4.950  1.00 98.50  ? 993  LEU A CB    1 
ATOM   7729  C  CG    . LEU A 1  993  ? 150.627 61.285  -4.433  1.00 100.83 ? 993  LEU A CG    1 
ATOM   7730  C  CD1   . LEU A 1  993  ? 150.172 59.861  -4.733  1.00 100.54 ? 993  LEU A CD1   1 
ATOM   7731  C  CD2   . LEU A 1  993  ? 150.553 61.476  -2.957  1.00 102.39 ? 993  LEU A CD2   1 
ATOM   7732  N  N     . GLN A 1  994  ? 150.953 63.363  -7.277  1.00 96.78  ? 994  GLN A N     1 
ATOM   7733  C  CA    . GLN A 1  994  ? 149.874 64.084  -7.942  1.00 95.50  ? 994  GLN A CA    1 
ATOM   7734  C  C     . GLN A 1  994  ? 149.668 63.667  -9.403  1.00 98.72  ? 994  GLN A C     1 
ATOM   7735  O  O     . GLN A 1  994  ? 148.534 63.366  -9.811  1.00 97.20  ? 994  GLN A O     1 
ATOM   7736  C  CB    . GLN A 1  994  ? 150.120 65.590  -7.820  1.00 96.84  ? 994  GLN A CB    1 
ATOM   7737  C  CG    . GLN A 1  994  ? 149.492 66.143  -6.572  1.00 102.94 ? 994  GLN A CG    1 
ATOM   7738  C  CD    . GLN A 1  994  ? 149.932 67.537  -6.302  1.00 117.78 ? 994  GLN A CD    1 
ATOM   7739  O  OE1   . GLN A 1  994  ? 150.770 67.770  -5.441  1.00 113.70 ? 994  GLN A OE1   1 
ATOM   7740  N  NE2   . GLN A 1  994  ? 149.339 68.499  -6.993  1.00 110.94 ? 994  GLN A NE2   1 
ATOM   7741  N  N     . GLU A 1  995  ? 150.783 63.600  -10.167 1.00 95.03  ? 995  GLU A N     1 
ATOM   7742  C  CA    . GLU A 1  995  ? 150.816 63.216  -11.579 1.00 94.43  ? 995  GLU A CA    1 
ATOM   7743  C  C     . GLU A 1  995  ? 150.268 61.806  -11.794 1.00 92.55  ? 995  GLU A C     1 
ATOM   7744  O  O     . GLU A 1  995  ? 149.911 61.451  -12.915 1.00 92.21  ? 995  GLU A O     1 
ATOM   7745  C  CB    . GLU A 1  995  ? 152.262 63.294  -12.098 1.00 98.06  ? 995  GLU A CB    1 
ATOM   7746  C  CG    . GLU A 1  995  ? 152.752 64.707  -12.361 1.00 120.13 ? 995  GLU A CG    1 
ATOM   7747  C  CD    . GLU A 1  995  ? 152.605 65.192  -13.793 1.00 166.76 ? 995  GLU A CD    1 
ATOM   7748  O  OE1   . GLU A 1  995  ? 153.551 64.985  -14.590 1.00 177.95 ? 995  GLU A OE1   1 
ATOM   7749  O  OE2   . GLU A 1  995  ? 151.560 65.810  -14.108 1.00 167.00 ? 995  GLU A OE2   1 
ATOM   7750  N  N     . ASN A 1  996  ? 150.215 61.012  -10.723 1.00 84.91  ? 996  ASN A N     1 
ATOM   7751  C  CA    . ASN A 1  996  ? 149.769 59.642  -10.773 1.00 83.54  ? 996  ASN A CA    1 
ATOM   7752  C  C     . ASN A 1  996  ? 148.320 59.428  -10.313 1.00 83.70  ? 996  ASN A C     1 
ATOM   7753  O  O     . ASN A 1  996  ? 147.774 58.335  -10.508 1.00 83.14  ? 996  ASN A O     1 
ATOM   7754  C  CB    . ASN A 1  996  ? 150.742 58.775  -10.000 1.00 86.57  ? 996  ASN A CB    1 
ATOM   7755  C  CG    . ASN A 1  996  ? 152.034 58.551  -10.733 1.00 125.26 ? 996  ASN A CG    1 
ATOM   7756  O  OD1   . ASN A 1  996  ? 152.093 58.587  -11.972 1.00 121.57 ? 996  ASN A OD1   1 
ATOM   7757  N  ND2   . ASN A 1  996  ? 153.100 58.301  -9.981  1.00 125.21 ? 996  ASN A ND2   1 
ATOM   7758  N  N     . LEU A 1  997  ? 147.678 60.459  -9.754  1.00 77.30  ? 997  LEU A N     1 
ATOM   7759  C  CA    . LEU A 1  997  ? 146.289 60.329  -9.318  1.00 75.40  ? 997  LEU A CA    1 
ATOM   7760  C  C     . LEU A 1  997  ? 145.360 60.498  -10.545 1.00 79.18  ? 997  LEU A C     1 
ATOM   7761  O  O     . LEU A 1  997  ? 144.561 61.434  -10.615 1.00 78.32  ? 997  LEU A O     1 
ATOM   7762  C  CB    . LEU A 1  997  ? 145.951 61.327  -8.177  1.00 74.88  ? 997  LEU A CB    1 
ATOM   7763  C  CG    . LEU A 1  997  ? 146.893 61.407  -6.952  1.00 80.08  ? 997  LEU A CG    1 
ATOM   7764  C  CD1   . LEU A 1  997  ? 146.811 62.775  -6.283  1.00 79.56  ? 997  LEU A CD1   1 
ATOM   7765  C  CD2   . LEU A 1  997  ? 146.607 60.301  -5.937  1.00 82.63  ? 997  LEU A CD2   1 
ATOM   7766  N  N     . LEU A 1  998  ? 145.466 59.581  -11.513 1.00 76.98  ? 998  LEU A N     1 
ATOM   7767  C  CA    . LEU A 1  998  ? 144.685 59.633  -12.748 1.00 77.58  ? 998  LEU A CA    1 
ATOM   7768  C  C     . LEU A 1  998  ? 143.226 59.190  -12.635 1.00 83.78  ? 998  LEU A C     1 
ATOM   7769  O  O     . LEU A 1  998  ? 142.920 58.150  -12.051 1.00 83.76  ? 998  LEU A O     1 
ATOM   7770  C  CB    . LEU A 1  998  ? 145.373 58.838  -13.863 1.00 78.76  ? 998  LEU A CB    1 
ATOM   7771  C  CG    . LEU A 1  998  ? 146.515 59.559  -14.547 1.00 84.97  ? 998  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A 1  998  ? 147.843 59.006  -14.096 1.00 86.49  ? 998  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A 1  998  ? 146.362 59.544  -16.080 1.00 88.77  ? 998  LEU A CD2   1 
ATOM   7774  N  N     . VAL A 1  999  ? 142.339 59.969  -13.264 1.00 81.98  ? 999  VAL A N     1 
ATOM   7775  C  CA    . VAL A 1  999  ? 140.904 59.734  -13.401 1.00 82.15  ? 999  VAL A CA    1 
ATOM   7776  C  C     . VAL A 1  999  ? 140.588 59.559  -14.905 1.00 92.42  ? 999  VAL A C     1 
ATOM   7777  O  O     . VAL A 1  999  ? 139.987 58.555  -15.304 1.00 93.36  ? 999  VAL A O     1 
ATOM   7778  C  CB    . VAL A 1  999  ? 140.106 60.865  -12.738 1.00 84.04  ? 999  VAL A CB    1 
ATOM   7779  C  CG1   . VAL A 1  999  ? 138.753 61.059  -13.404 1.00 83.16  ? 999  VAL A CG1   1 
ATOM   7780  C  CG2   . VAL A 1  999  ? 139.948 60.597  -11.250 1.00 83.18  ? 999  VAL A CG2   1 
ATOM   7781  N  N     . LEU A 1  1000 ? 141.067 60.510  -15.730 1.00 92.10  ? 1000 LEU A N     1 
ATOM   7782  C  CA    . LEU A 1  1000 ? 140.935 60.537  -17.187 1.00 93.57  ? 1000 LEU A CA    1 
ATOM   7783  C  C     . LEU A 1  1000 ? 142.303 60.355  -17.825 1.00 99.75  ? 1000 LEU A C     1 
ATOM   7784  O  O     . LEU A 1  1000 ? 143.275 61.047  -17.464 1.00 98.70  ? 1000 LEU A O     1 
ATOM   7785  C  CB    . LEU A 1  1000 ? 140.360 61.865  -17.612 1.00 93.75  ? 1000 LEU A CB    1 
ATOM   7786  C  CG    . LEU A 1  1000 ? 139.015 62.153  -17.073 1.00 97.54  ? 1000 LEU A CG    1 
ATOM   7787  C  CD1   . LEU A 1  1000 ? 138.951 63.579  -16.619 1.00 97.39  ? 1000 LEU A CD1   1 
ATOM   7788  C  CD2   . LEU A 1  1000 ? 137.967 61.767  -18.087 1.00 101.61 ? 1000 LEU A CD2   1 
ATOM   7789  N  N     . ARG A 1  1001 ? 142.373 59.441  -18.793 1.00 99.06  ? 1001 ARG A N     1 
ATOM   7790  C  CA    . ARG A 1  1001 ? 143.655 59.092  -19.362 1.00 101.40 ? 1001 ARG A CA    1 
ATOM   7791  C  C     . ARG A 1  1001 ? 144.078 59.881  -20.607 1.00 109.15 ? 1001 ARG A C     1 
ATOM   7792  O  O     . ARG A 1  1001 ? 145.283 60.182  -20.702 1.00 111.54 ? 1001 ARG A O     1 
ATOM   7793  C  CB    . ARG A 1  1001 ? 143.740 57.592  -19.601 1.00 101.82 ? 1001 ARG A CB    1 
ATOM   7794  C  CG    . ARG A 1  1001 ? 144.612 56.917  -18.538 1.00 111.02 ? 1001 ARG A CG    1 
ATOM   7795  C  CD    . ARG A 1  1001 ? 144.135 55.531  -18.159 1.00 116.68 ? 1001 ARG A CD    1 
ATOM   7796  N  NE    . ARG A 1  1001 ? 143.193 55.566  -17.043 1.00 116.30 ? 1001 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A 1  1001 ? 143.555 55.575  -15.766 1.00 119.65 ? 1001 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A 1  1001 ? 144.848 55.553  -15.433 1.00 94.99  ? 1001 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A 1  1001 ? 142.630 55.603  -14.809 1.00 99.92  ? 1001 ARG A NH2   1 
ATOM   7800  N  N     . GLY A 1  1002 ? 143.126 60.219  -21.498 1.00 104.90 ? 1002 GLY A N     1 
ATOM   7801  C  CA    . GLY A 1  1002 ? 143.347 60.978  -22.742 1.00 105.94 ? 1002 GLY A CA    1 
ATOM   7802  C  C     . GLY A 1  1002 ? 144.649 61.767  -22.941 1.00 109.80 ? 1002 GLY A C     1 
ATOM   7803  O  O     . GLY A 1  1002 ? 144.927 62.729  -22.211 1.00 107.63 ? 1002 GLY A O     1 
ATOM   7804  N  N     . LYS A 1  1003 ? 145.439 61.385  -23.976 1.00 107.81 ? 1003 LYS A N     1 
ATOM   7805  C  CA    . LYS A 1  1003 ? 146.734 61.990  -24.295 1.00 109.26 ? 1003 LYS A CA    1 
ATOM   7806  C  C     . LYS A 1  1003 ? 146.665 63.417  -24.926 1.00 113.01 ? 1003 LYS A C     1 
ATOM   7807  O  O     . LYS A 1  1003 ? 147.711 64.073  -25.061 1.00 114.65 ? 1003 LYS A O     1 
ATOM   7808  C  CB    . LYS A 1  1003 ? 147.563 61.038  -25.176 1.00 114.40 ? 1003 LYS A CB    1 
ATOM   7809  C  CG    . LYS A 1  1003 ? 149.079 61.106  -24.914 1.00 129.18 ? 1003 LYS A CG    1 
ATOM   7810  C  CD    . LYS A 1  1003 ? 149.906 60.246  -25.897 1.00 139.78 ? 1003 LYS A CD    1 
ATOM   7811  C  CE    . LYS A 1  1003 ? 150.273 58.880  -25.350 1.00 149.30 ? 1003 LYS A CE    1 
ATOM   7812  N  NZ    . LYS A 1  1003 ? 151.250 58.160  -26.214 1.00 158.85 ? 1003 LYS A NZ    1 
ATOM   7813  N  N     . ASN A 1  1004 ? 145.454 63.917  -25.258 1.00 106.50 ? 1004 ASN A N     1 
ATOM   7814  C  CA    . ASN A 1  1004 ? 145.261 65.261  -25.826 1.00 105.71 ? 1004 ASN A CA    1 
ATOM   7815  C  C     . ASN A 1  1004 ? 145.365 66.379  -24.755 1.00 107.51 ? 1004 ASN A C     1 
ATOM   7816  O  O     . ASN A 1  1004 ? 145.906 66.139  -23.682 1.00 106.83 ? 1004 ASN A O     1 
ATOM   7817  C  CB    . ASN A 1  1004 ? 143.933 65.327  -26.578 1.00 102.60 ? 1004 ASN A CB    1 
ATOM   7818  C  CG    . ASN A 1  1004 ? 142.739 65.201  -25.684 1.00 109.12 ? 1004 ASN A CG    1 
ATOM   7819  O  OD1   . ASN A 1  1004 ? 142.570 65.967  -24.742 1.00 92.94  ? 1004 ASN A OD1   1 
ATOM   7820  N  ND2   . ASN A 1  1004 ? 141.895 64.222  -25.955 1.00 103.58 ? 1004 ASN A ND2   1 
ATOM   7821  N  N     . GLU A 1  1005 ? 144.827 67.577  -25.024 1.00 103.36 ? 1005 GLU A N     1 
ATOM   7822  C  CA    . GLU A 1  1005 ? 144.904 68.658  -24.047 1.00 102.63 ? 1005 GLU A CA    1 
ATOM   7823  C  C     . GLU A 1  1005 ? 143.563 68.974  -23.406 1.00 100.87 ? 1005 GLU A C     1 
ATOM   7824  O  O     . GLU A 1  1005 ? 143.546 69.487  -22.293 1.00 98.63  ? 1005 GLU A O     1 
ATOM   7825  C  CB    . GLU A 1  1005 ? 145.575 69.910  -24.651 1.00 106.68 ? 1005 GLU A CB    1 
ATOM   7826  C  CG    . GLU A 1  1005 ? 146.050 70.988  -23.666 1.00 125.77 ? 1005 GLU A CG    1 
ATOM   7827  C  CD    . GLU A 1  1005 ? 146.821 70.595  -22.412 1.00 159.83 ? 1005 GLU A CD    1 
ATOM   7828  O  OE1   . GLU A 1  1005 ? 147.735 69.740  -22.499 1.00 158.77 ? 1005 GLU A OE1   1 
ATOM   7829  O  OE2   . GLU A 1  1005 ? 146.544 71.195  -21.348 1.00 159.52 ? 1005 GLU A OE2   1 
ATOM   7830  N  N     . ILE A 1  1006 ? 142.451 68.660  -24.074 1.00 96.09  ? 1006 ILE A N     1 
ATOM   7831  C  CA    . ILE A 1  1006 ? 141.112 68.869  -23.502 1.00 94.71  ? 1006 ILE A CA    1 
ATOM   7832  C  C     . ILE A 1  1006 ? 140.923 67.935  -22.284 1.00 96.91  ? 1006 ILE A C     1 
ATOM   7833  O  O     . ILE A 1  1006 ? 140.377 68.344  -21.243 1.00 94.79  ? 1006 ILE A O     1 
ATOM   7834  C  CB    . ILE A 1  1006 ? 139.994 68.621  -24.549 1.00 98.20  ? 1006 ILE A CB    1 
ATOM   7835  C  CG1   . ILE A 1  1006 ? 140.269 69.406  -25.854 1.00 101.02 ? 1006 ILE A CG1   1 
ATOM   7836  C  CG2   . ILE A 1  1006 ? 138.586 68.890  -23.946 1.00 97.06  ? 1006 ILE A CG2   1 
ATOM   7837  C  CD1   . ILE A 1  1006 ? 139.072 69.628  -26.762 1.00 113.32 ? 1006 ILE A CD1   1 
ATOM   7838  N  N     . ILE A 1  1007 ? 141.372 66.672  -22.456 1.00 93.34  ? 1007 ILE A N     1 
ATOM   7839  C  CA    . ILE A 1  1007 ? 141.295 65.594  -21.482 1.00 91.44  ? 1007 ILE A CA    1 
ATOM   7840  C  C     . ILE A 1  1007 ? 142.371 65.766  -20.456 1.00 93.79  ? 1007 ILE A C     1 
ATOM   7841  O  O     . ILE A 1  1007 ? 142.063 65.646  -19.271 1.00 92.31  ? 1007 ILE A O     1 
ATOM   7842  C  CB    . ILE A 1  1007 ? 141.264 64.170  -22.105 1.00 94.94  ? 1007 ILE A CB    1 
ATOM   7843  C  CG1   . ILE A 1  1007 ? 140.219 64.031  -23.250 1.00 95.62  ? 1007 ILE A CG1   1 
ATOM   7844  C  CG2   . ILE A 1  1007 ? 141.037 63.107  -21.029 1.00 95.26  ? 1007 ILE A CG2   1 
ATOM   7845  C  CD1   . ILE A 1  1007 ? 138.702 64.342  -22.918 1.00 98.44  ? 1007 ILE A CD1   1 
ATOM   7846  N  N     . GLN A 1  1008 ? 143.622 66.086  -20.869 1.00 90.70  ? 1008 GLN A N     1 
ATOM   7847  C  CA    . GLN A 1  1008 ? 144.639 66.307  -19.844 1.00 90.22  ? 1008 GLN A CA    1 
ATOM   7848  C  C     . GLN A 1  1008 ? 144.248 67.509  -18.995 1.00 93.65  ? 1008 GLN A C     1 
ATOM   7849  O  O     . GLN A 1  1008 ? 144.419 67.450  -17.781 1.00 92.70  ? 1008 GLN A O     1 
ATOM   7850  C  CB    . GLN A 1  1008 ? 146.085 66.343  -20.364 1.00 92.87  ? 1008 GLN A CB    1 
ATOM   7851  C  CG    . GLN A 1  1008 ? 146.715 64.935  -20.484 1.00 108.85 ? 1008 GLN A CG    1 
ATOM   7852  C  CD    . GLN A 1  1008 ? 146.784 64.125  -19.185 1.00 127.48 ? 1008 GLN A CD    1 
ATOM   7853  O  OE1   . GLN A 1  1008 ? 147.201 64.636  -18.134 1.00 124.46 ? 1008 GLN A OE1   1 
ATOM   7854  N  NE2   . GLN A 1  1008 ? 146.412 62.826  -19.232 1.00 110.65 ? 1008 GLN A NE2   1 
ATOM   7855  N  N     . ASN A 1  1009 ? 143.565 68.508  -19.587 1.00 90.78  ? 1009 ASN A N     1 
ATOM   7856  C  CA    . ASN A 1  1009 ? 143.055 69.609  -18.784 1.00 90.38  ? 1009 ASN A CA    1 
ATOM   7857  C  C     . ASN A 1  1009 ? 141.871 69.168  -17.939 1.00 94.12  ? 1009 ASN A C     1 
ATOM   7858  O  O     . ASN A 1  1009 ? 141.768 69.600  -16.796 1.00 93.90  ? 1009 ASN A O     1 
ATOM   7859  C  CB    . ASN A 1  1009 ? 142.764 70.859  -19.589 1.00 91.13  ? 1009 ASN A CB    1 
ATOM   7860  C  CG    . ASN A 1  1009 ? 143.662 71.976  -19.163 1.00 124.18 ? 1009 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A 1  1009 ? 143.754 72.306  -17.969 1.00 118.12 ? 1009 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A 1  1009 ? 144.401 72.534  -20.116 1.00 123.67 ? 1009 ASN A ND2   1 
ATOM   7863  N  N     . ALA A 1  1010 ? 141.031 68.254  -18.447 1.00 90.61  ? 1010 ALA A N     1 
ATOM   7864  C  CA    . ALA A 1  1010 ? 139.906 67.735  -17.659 1.00 90.16  ? 1010 ALA A CA    1 
ATOM   7865  C  C     . ALA A 1  1010 ? 140.386 66.928  -16.441 1.00 92.46  ? 1010 ALA A C     1 
ATOM   7866  O  O     . ALA A 1  1010 ? 139.731 66.947  -15.387 1.00 91.24  ? 1010 ALA A O     1 
ATOM   7867  C  CB    . ALA A 1  1010 ? 138.996 66.876  -18.524 1.00 91.29  ? 1010 ALA A CB    1 
ATOM   7868  N  N     . GLN A 1  1011 ? 141.529 66.220  -16.608 1.00 88.20  ? 1011 GLN A N     1 
ATOM   7869  C  CA    . GLN A 1  1011 ? 142.182 65.410  -15.593 1.00 86.88  ? 1011 GLN A CA    1 
ATOM   7870  C  C     . GLN A 1  1011 ? 142.612 66.340  -14.497 1.00 92.32  ? 1011 GLN A C     1 
ATOM   7871  O  O     . GLN A 1  1011 ? 142.150 66.198  -13.369 1.00 91.21  ? 1011 GLN A O     1 
ATOM   7872  C  CB    . GLN A 1  1011 ? 143.383 64.662  -16.196 1.00 88.40  ? 1011 GLN A CB    1 
ATOM   7873  C  CG    . GLN A 1  1011 ? 144.375 64.103  -15.183 1.00 91.18  ? 1011 GLN A CG    1 
ATOM   7874  C  CD    . GLN A 1  1011 ? 143.689 63.253  -14.157 1.00 105.16 ? 1011 GLN A CD    1 
ATOM   7875  O  OE1   . GLN A 1  1011 ? 143.026 62.281  -14.488 1.00 104.04 ? 1011 GLN A OE1   1 
ATOM   7876  N  NE2   . GLN A 1  1011 ? 143.755 63.660  -12.904 1.00 91.93  ? 1011 GLN A NE2   1 
ATOM   7877  N  N     . ARG A 1  1012 ? 143.425 67.343  -14.859 1.00 91.91  ? 1012 ARG A N     1 
ATOM   7878  C  CA    . ARG A 1  1012 ? 143.965 68.400  -14.005 1.00 93.50  ? 1012 ARG A CA    1 
ATOM   7879  C  C     . ARG A 1  1012 ? 142.862 68.995  -13.144 1.00 99.67  ? 1012 ARG A C     1 
ATOM   7880  O  O     . ARG A 1  1012 ? 143.066 69.233  -11.954 1.00 100.01 ? 1012 ARG A O     1 
ATOM   7881  C  CB    . ARG A 1  1012 ? 144.529 69.505  -14.910 1.00 95.73  ? 1012 ARG A CB    1 
ATOM   7882  C  CG    . ARG A 1  1012 ? 145.748 70.225  -14.385 1.00 109.34 ? 1012 ARG A CG    1 
ATOM   7883  C  CD    . ARG A 1  1012 ? 146.585 70.737  -15.547 1.00 122.31 ? 1012 ARG A CD    1 
ATOM   7884  N  NE    . ARG A 1  1012 ? 147.254 69.639  -16.258 1.00 132.21 ? 1012 ARG A NE    1 
ATOM   7885  C  CZ    . ARG A 1  1012 ? 147.173 69.424  -17.569 1.00 147.26 ? 1012 ARG A CZ    1 
ATOM   7886  N  NH1   . ARG A 1  1012 ? 146.463 70.240  -18.341 1.00 137.04 ? 1012 ARG A NH1   1 
ATOM   7887  N  NH2   . ARG A 1  1012 ? 147.814 68.400  -18.121 1.00 130.61 ? 1012 ARG A NH2   1 
ATOM   7888  N  N     . ASP A 1  1013 ? 141.684 69.200  -13.754 1.00 96.84  ? 1013 ASP A N     1 
ATOM   7889  C  CA    . ASP A 1  1013 ? 140.538 69.817  -13.129 1.00 96.83  ? 1013 ASP A CA    1 
ATOM   7890  C  C     . ASP A 1  1013 ? 139.834 68.925  -12.119 1.00 98.59  ? 1013 ASP A C     1 
ATOM   7891  O  O     . ASP A 1  1013 ? 139.497 69.427  -11.056 1.00 98.54  ? 1013 ASP A O     1 
ATOM   7892  C  CB    . ASP A 1  1013 ? 139.566 70.355  -14.190 1.00 100.21 ? 1013 ASP A CB    1 
ATOM   7893  C  CG    . ASP A 1  1013 ? 139.811 71.816  -14.565 1.00 123.48 ? 1013 ASP A CG    1 
ATOM   7894  O  OD1   . ASP A 1  1013 ? 140.685 72.075  -15.432 1.00 127.17 ? 1013 ASP A OD1   1 
ATOM   7895  O  OD2   . ASP A 1  1013 ? 139.117 72.699  -14.005 1.00 132.69 ? 1013 ASP A OD2   1 
ATOM   7896  N  N     . ALA A 1  1014 ? 139.598 67.633  -12.420 1.00 93.41  ? 1014 ALA A N     1 
ATOM   7897  C  CA    . ALA A 1  1014 ? 138.890 66.714  -11.502 1.00 91.61  ? 1014 ALA A CA    1 
ATOM   7898  C  C     . ALA A 1  1014 ? 139.615 66.466  -10.152 1.00 92.49  ? 1014 ALA A C     1 
ATOM   7899  O  O     . ALA A 1  1014 ? 138.974 66.163  -9.124  1.00 90.82  ? 1014 ALA A O     1 
ATOM   7900  C  CB    . ALA A 1  1014 ? 138.634 65.389  -12.197 1.00 92.04  ? 1014 ALA A CB    1 
ATOM   7901  N  N     . VAL A 1  1015 ? 140.960 66.589  -10.174 1.00 86.99  ? 1015 VAL A N     1 
ATOM   7902  C  CA    . VAL A 1  1015 ? 141.796 66.344  -8.999  1.00 85.33  ? 1015 VAL A CA    1 
ATOM   7903  C  C     . VAL A 1  1015 ? 141.996 67.607  -8.158  1.00 88.49  ? 1015 VAL A C     1 
ATOM   7904  O  O     . VAL A 1  1015 ? 142.309 67.487  -6.972  1.00 88.96  ? 1015 VAL A O     1 
ATOM   7905  C  CB    . VAL A 1  1015 ? 143.139 65.633  -9.320  1.00 88.21  ? 1015 VAL A CB    1 
ATOM   7906  C  CG1   . VAL A 1  1015 ? 142.933 64.148  -9.564  1.00 87.02  ? 1015 VAL A CG1   1 
ATOM   7907  C  CG2   . VAL A 1  1015 ? 143.846 66.273  -10.498 1.00 88.86  ? 1015 VAL A CG2   1 
ATOM   7908  N  N     . THR A 1  1016 ? 141.789 68.798  -8.761  1.00 83.58  ? 1016 THR A N     1 
ATOM   7909  C  CA    . THR A 1  1016 ? 141.952 70.136  -8.167  1.00 83.71  ? 1016 THR A CA    1 
ATOM   7910  C  C     . THR A 1  1016 ? 141.767 70.190  -6.637  1.00 86.69  ? 1016 THR A C     1 
ATOM   7911  O  O     . THR A 1  1016 ? 142.671 70.665  -5.950  1.00 85.96  ? 1016 THR A O     1 
ATOM   7912  C  CB    . THR A 1  1016 ? 141.026 71.139  -8.876  1.00 95.59  ? 1016 THR A CB    1 
ATOM   7913  O  OG1   . THR A 1  1016 ? 141.356 71.213  -10.266 1.00 97.79  ? 1016 THR A OG1   1 
ATOM   7914  C  CG2   . THR A 1  1016 ? 141.074 72.524  -8.271  1.00 95.34  ? 1016 THR A CG2   1 
ATOM   7915  N  N     . LEU A 1  1017 ? 140.608 69.697  -6.119  1.00 83.45  ? 1017 LEU A N     1 
ATOM   7916  C  CA    . LEU A 1  1017 ? 140.257 69.713  -4.692  1.00 83.23  ? 1017 LEU A CA    1 
ATOM   7917  C  C     . LEU A 1  1017 ? 141.016 68.671  -3.886  1.00 87.85  ? 1017 LEU A C     1 
ATOM   7918  O  O     . LEU A 1  1017 ? 141.532 69.024  -2.821  1.00 87.78  ? 1017 LEU A O     1 
ATOM   7919  C  CB    . LEU A 1  1017 ? 138.728 69.612  -4.464  1.00 82.22  ? 1017 LEU A CB    1 
ATOM   7920  C  CG    . LEU A 1  1017 ? 138.151 69.536  -3.034  1.00 86.31  ? 1017 LEU A CG    1 
ATOM   7921  C  CD1   . LEU A 1  1017 ? 138.636 70.658  -2.145  1.00 86.95  ? 1017 LEU A CD1   1 
ATOM   7922  C  CD2   . LEU A 1  1017 ? 136.659 69.590  -3.073  1.00 87.94  ? 1017 LEU A CD2   1 
ATOM   7923  N  N     . PHE A 1  1018 ? 141.098 67.403  -4.376  1.00 84.16  ? 1018 PHE A N     1 
ATOM   7924  C  CA    . PHE A 1  1018 ? 141.829 66.345  -3.659  1.00 84.25  ? 1018 PHE A CA    1 
ATOM   7925  C  C     . PHE A 1  1018 ? 143.294 66.709  -3.474  1.00 91.68  ? 1018 PHE A C     1 
ATOM   7926  O  O     . PHE A 1  1018 ? 143.878 66.407  -2.433  1.00 92.14  ? 1018 PHE A O     1 
ATOM   7927  C  CB    . PHE A 1  1018 ? 141.675 64.964  -4.323  1.00 84.83  ? 1018 PHE A CB    1 
ATOM   7928  C  CG    . PHE A 1  1018 ? 142.484 63.860  -3.672  1.00 85.72  ? 1018 PHE A CG    1 
ATOM   7929  C  CD1   . PHE A 1  1018 ? 142.096 63.315  -2.452  1.00 87.96  ? 1018 PHE A CD1   1 
ATOM   7930  C  CD2   . PHE A 1  1018 ? 143.647 63.383  -4.270  1.00 87.11  ? 1018 PHE A CD2   1 
ATOM   7931  C  CE1   . PHE A 1  1018 ? 142.868 62.331  -1.836  1.00 89.03  ? 1018 PHE A CE1   1 
ATOM   7932  C  CE2   . PHE A 1  1018 ? 144.411 62.392  -3.657  1.00 89.92  ? 1018 PHE A CE2   1 
ATOM   7933  C  CZ    . PHE A 1  1018 ? 144.019 61.875  -2.443  1.00 88.09  ? 1018 PHE A CZ    1 
ATOM   7934  N  N     . CYS A 1  1019 ? 143.871 67.385  -4.464  1.00 90.52  ? 1019 CYS A N     1 
ATOM   7935  C  CA    . CYS A 1  1019 ? 145.246 67.830  -4.393  1.00 92.91  ? 1019 CYS A CA    1 
ATOM   7936  C  C     . CYS A 1  1019 ? 145.412 68.888  -3.343  1.00 96.99  ? 1019 CYS A C     1 
ATOM   7937  O  O     . CYS A 1  1019 ? 146.411 68.857  -2.628  1.00 96.61  ? 1019 CYS A O     1 
ATOM   7938  C  CB    . CYS A 1  1019 ? 145.725 68.300  -5.754  1.00 94.79  ? 1019 CYS A CB    1 
ATOM   7939  S  SG    . CYS A 1  1019 ? 145.822 66.974  -6.977  1.00 99.20  ? 1019 CYS A SG    1 
ATOM   7940  N  N     . CYS A 1  1020 ? 144.406 69.787  -3.202  1.00 94.40  ? 1020 CYS A N     1 
ATOM   7941  C  CA    . CYS A 1  1020 ? 144.382 70.834  -2.173  1.00 95.67  ? 1020 CYS A CA    1 
ATOM   7942  C  C     . CYS A 1  1020 ? 144.537 70.174  -0.823  1.00 99.69  ? 1020 CYS A C     1 
ATOM   7943  O  O     . CYS A 1  1020 ? 145.332 70.632  0.000   1.00 101.09 ? 1020 CYS A O     1 
ATOM   7944  C  CB    . CYS A 1  1020 ? 143.087 71.634  -2.233  1.00 95.96  ? 1020 CYS A CB    1 
ATOM   7945  S  SG    . CYS A 1  1020 ? 143.037 72.867  -3.546  1.00 100.51 ? 1020 CYS A SG    1 
ATOM   7946  N  N     . LEU A 1  1021 ? 143.782 69.072  -0.627  1.00 93.62  ? 1021 LEU A N     1 
ATOM   7947  C  CA    . LEU A 1  1021 ? 143.778 68.248  0.566   1.00 92.67  ? 1021 LEU A CA    1 
ATOM   7948  C  C     . LEU A 1  1021 ? 145.110 67.567  0.697   1.00 98.27  ? 1021 LEU A C     1 
ATOM   7949  O  O     . LEU A 1  1021 ? 145.653 67.557  1.795   1.00 100.45 ? 1021 LEU A O     1 
ATOM   7950  C  CB    . LEU A 1  1021 ? 142.649 67.209  0.493   1.00 91.00  ? 1021 LEU A CB    1 
ATOM   7951  C  CG    . LEU A 1  1021 ? 142.641 66.117  1.545   1.00 94.93  ? 1021 LEU A CG    1 
ATOM   7952  C  CD1   . LEU A 1  1021 ? 142.229 66.656  2.903   1.00 95.12  ? 1021 LEU A CD1   1 
ATOM   7953  C  CD2   . LEU A 1  1021 ? 141.753 64.980  1.116   1.00 97.31  ? 1021 LEU A CD2   1 
ATOM   7954  N  N     . LEU A 1  1022 ? 145.652 67.021  -0.412  1.00 93.56  ? 1022 LEU A N     1 
ATOM   7955  C  CA    . LEU A 1  1022 ? 146.933 66.313  -0.431  1.00 93.74  ? 1022 LEU A CA    1 
ATOM   7956  C  C     . LEU A 1  1022 ? 148.101 67.195  0.052   1.00 97.43  ? 1022 LEU A C     1 
ATOM   7957  O  O     . LEU A 1  1022 ? 148.784 66.832  1.016   1.00 97.37  ? 1022 LEU A O     1 
ATOM   7958  C  CB    . LEU A 1  1022 ? 147.203 65.761  -1.833  1.00 93.28  ? 1022 LEU A CB    1 
ATOM   7959  C  CG    . LEU A 1  1022 ? 148.190 64.625  -1.895  1.00 98.55  ? 1022 LEU A CG    1 
ATOM   7960  C  CD1   . LEU A 1  1022 ? 147.474 63.325  -1.855  1.00 98.31  ? 1022 LEU A CD1   1 
ATOM   7961  C  CD2   . LEU A 1  1022 ? 149.043 64.721  -3.137  1.00 101.29 ? 1022 LEU A CD2   1 
ATOM   7962  N  N     . ARG A 1  1023 ? 148.277 68.367  -0.585  1.00 93.35  ? 1023 ARG A N     1 
ATOM   7963  C  CA    . ARG A 1  1023 ? 149.310 69.359  -0.273  1.00 94.22  ? 1023 ARG A CA    1 
ATOM   7964  C  C     . ARG A 1  1023 ? 149.156 69.925  1.166   1.00 99.40  ? 1023 ARG A C     1 
ATOM   7965  O  O     . ARG A 1  1023 ? 150.158 70.182  1.848   1.00 99.82  ? 1023 ARG A O     1 
ATOM   7966  C  CB    . ARG A 1  1023 ? 149.299 70.482  -1.327  1.00 93.36  ? 1023 ARG A CB    1 
ATOM   7967  C  CG    . ARG A 1  1023 ? 149.499 70.013  -2.771  1.00 94.49  ? 1023 ARG A CG    1 
ATOM   7968  C  CD    . ARG A 1  1023 ? 149.638 71.205  -3.692  1.00 96.45  ? 1023 ARG A CD    1 
ATOM   7969  N  NE    . ARG A 1  1023 ? 148.984 71.004  -4.983  1.00 99.58  ? 1023 ARG A NE    1 
ATOM   7970  C  CZ    . ARG A 1  1023 ? 147.721 71.328  -5.239  1.00 108.58 ? 1023 ARG A CZ    1 
ATOM   7971  N  NH1   . ARG A 1  1023 ? 146.958 71.847  -4.289  1.00 86.08  ? 1023 ARG A NH1   1 
ATOM   7972  N  NH2   . ARG A 1  1023 ? 147.206 71.121  -6.447  1.00 97.10  ? 1023 ARG A NH2   1 
ATOM   7973  N  N     . SER A 1  1024 ? 147.893 70.096  1.615   1.00 95.91  ? 1024 SER A N     1 
ATOM   7974  C  CA    . SER A 1  1024 ? 147.512 70.529  2.963   1.00 96.69  ? 1024 SER A CA    1 
ATOM   7975  C  C     . SER A 1  1024 ? 148.150 69.553  3.971   1.00 99.07  ? 1024 SER A C     1 
ATOM   7976  O  O     . SER A 1  1024 ? 148.969 69.964  4.789   1.00 100.12 ? 1024 SER A O     1 
ATOM   7977  C  CB    . SER A 1  1024 ? 145.974 70.584  3.088   1.00 101.32 ? 1024 SER A CB    1 
ATOM   7978  O  OG    . SER A 1  1024 ? 145.313 69.967  4.190   1.00 110.57 ? 1024 SER A OG    1 
ATOM   7979  N  N     . ARG A 1  1025 ? 147.867 68.254  3.797   1.00 92.53  ? 1025 ARG A N     1 
ATOM   7980  C  CA    . ARG A 1  1025 ? 148.308 67.162  4.640   1.00 92.09  ? 1025 ARG A CA    1 
ATOM   7981  C  C     . ARG A 1  1025 ? 149.745 66.742  4.470   1.00 97.70  ? 1025 ARG A C     1 
ATOM   7982  O  O     . ARG A 1  1025 ? 150.270 66.154  5.406   1.00 98.94  ? 1025 ARG A O     1 
ATOM   7983  C  CB    . ARG A 1  1025 ? 147.405 65.946  4.452   1.00 89.69  ? 1025 ARG A CB    1 
ATOM   7984  C  CG    . ARG A 1  1025 ? 145.957 66.195  4.811   1.00 96.05  ? 1025 ARG A CG    1 
ATOM   7985  C  CD    . ARG A 1  1025 ? 145.633 65.794  6.222   1.00 103.96 ? 1025 ARG A CD    1 
ATOM   7986  N  NE    . ARG A 1  1025 ? 144.572 66.644  6.748   1.00 113.51 ? 1025 ARG A NE    1 
ATOM   7987  C  CZ    . ARG A 1  1025 ? 143.275 66.375  6.665   1.00 135.83 ? 1025 ARG A CZ    1 
ATOM   7988  N  NH1   . ARG A 1  1025 ? 142.856 65.249  6.095   1.00 129.52 ? 1025 ARG A NH1   1 
ATOM   7989  N  NH2   . ARG A 1  1025 ? 142.387 67.213  7.176   1.00 127.62 ? 1025 ARG A NH2   1 
ATOM   7990  N  N     . LEU A 1  1026 ? 150.390 66.969  3.309   1.00 94.16  ? 1026 LEU A N     1 
ATOM   7991  C  CA    . LEU A 1  1026 ? 151.787 66.506  3.182   1.00 94.99  ? 1026 LEU A CA    1 
ATOM   7992  C  C     . LEU A 1  1026 ? 152.813 67.659  2.970   1.00 102.24 ? 1026 LEU A C     1 
ATOM   7993  O  O     . LEU A 1  1026 ? 153.773 67.527  2.190   1.00 102.79 ? 1026 LEU A O     1 
ATOM   7994  C  CB    . LEU A 1  1026 ? 151.972 65.383  2.130   1.00 93.73  ? 1026 LEU A CB    1 
ATOM   7995  C  CG    . LEU A 1  1026 ? 151.033 64.182  2.200   1.00 96.68  ? 1026 LEU A CG    1 
ATOM   7996  C  CD1   . LEU A 1  1026 ? 151.074 63.406  0.923   1.00 96.07  ? 1026 LEU A CD1   1 
ATOM   7997  C  CD2   . LEU A 1  1026 ? 151.344 63.286  3.377   1.00 99.32  ? 1026 LEU A CD2   1 
ATOM   7998  N  N     . ALA A 1  1027 ? 152.638 68.762  3.718   1.00 99.87  ? 1027 ALA A N     1 
ATOM   7999  C  CA    . ALA A 1  1027 ? 153.583 69.873  3.682   1.00 101.34 ? 1027 ALA A CA    1 
ATOM   8000  C  C     . ALA A 1  1027 ? 154.874 69.423  4.391   1.00 106.84 ? 1027 ALA A C     1 
ATOM   8001  O  O     . ALA A 1  1027 ? 154.803 68.613  5.325   1.00 107.46 ? 1027 ALA A O     1 
ATOM   8002  C  CB    . ALA A 1  1027 ? 152.994 71.068  4.397   1.00 102.78 ? 1027 ALA A CB    1 
ATOM   8003  N  N     . THR A 1  1028 ? 156.043 69.939  3.947   1.00 102.51 ? 1028 THR A N     1 
ATOM   8004  C  CA    . THR A 1  1028 ? 157.369 69.607  4.482   1.00 102.59 ? 1028 THR A CA    1 
ATOM   8005  C  C     . THR A 1  1028 ? 157.411 69.711  6.002   1.00 104.95 ? 1028 THR A C     1 
ATOM   8006  O  O     . THR A 1  1028 ? 157.862 68.768  6.649   1.00 104.84 ? 1028 THR A O     1 
ATOM   8007  C  CB    . THR A 1  1028 ? 158.429 70.433  3.780   1.00 112.54 ? 1028 THR A CB    1 
ATOM   8008  O  OG1   . THR A 1  1028 ? 158.275 70.228  2.378   1.00 111.11 ? 1028 THR A OG1   1 
ATOM   8009  C  CG2   . THR A 1  1028 ? 159.841 70.056  4.194   1.00 114.42 ? 1028 THR A CG2   1 
ATOM   8010  N  N     . ARG A 1  1029 ? 156.878 70.816  6.562   1.00 100.58 ? 1029 ARG A N     1 
ATOM   8011  C  CA    . ARG A 1  1029 ? 156.770 71.029  8.007   1.00 101.15 ? 1029 ARG A CA    1 
ATOM   8012  C  C     . ARG A 1  1029 ? 155.884 69.930  8.645   1.00 102.46 ? 1029 ARG A C     1 
ATOM   8013  O  O     . ARG A 1  1029 ? 156.350 69.145  9.469   1.00 102.23 ? 1029 ARG A O     1 
ATOM   8014  C  CB    . ARG A 1  1029 ? 156.177 72.423  8.288   1.00 102.14 ? 1029 ARG A CB    1 
ATOM   8015  C  CG    . ARG A 1  1029 ? 156.159 72.804  9.768   1.00 112.19 ? 1029 ARG A CG    1 
ATOM   8016  C  CD    . ARG A 1  1029 ? 156.876 74.112  10.037  1.00 110.58 ? 1029 ARG A CD    1 
ATOM   8017  N  NE    . ARG A 1  1029 ? 158.217 73.891  10.571  1.00 104.24 ? 1029 ARG A NE    1 
ATOM   8018  C  CZ    . ARG A 1  1029 ? 159.029 74.863  10.969  1.00 125.02 ? 1029 ARG A CZ    1 
ATOM   8019  N  NH1   . ARG A 1  1029 ? 158.643 76.132  10.894  1.00 120.44 ? 1029 ARG A NH1   1 
ATOM   8020  N  NH2   . ARG A 1  1029 ? 160.231 74.575  11.449  1.00 113.31 ? 1029 ARG A NH2   1 
ATOM   8021  N  N     . ARG A 1  1030 ? 154.622 69.866  8.219   1.00 96.75  ? 1030 ARG A N     1 
ATOM   8022  C  CA    . ARG A 1  1030 ? 153.627 68.916  8.698   1.00 95.32  ? 1030 ARG A CA    1 
ATOM   8023  C  C     . ARG A 1  1030 ? 154.110 67.447  8.700   1.00 97.38  ? 1030 ARG A C     1 
ATOM   8024  O  O     . ARG A 1  1030 ? 153.869 66.732  9.675   1.00 95.95  ? 1030 ARG A O     1 
ATOM   8025  C  CB    . ARG A 1  1030 ? 152.321 69.088  7.903   1.00 92.90  ? 1030 ARG A CB    1 
ATOM   8026  C  CG    . ARG A 1  1030 ? 151.105 68.650  8.688   1.00 100.50 ? 1030 ARG A CG    1 
ATOM   8027  C  CD    . ARG A 1  1030 ? 149.808 69.154  8.120   1.00 108.20 ? 1030 ARG A CD    1 
ATOM   8028  N  NE    . ARG A 1  1030 ? 148.701 68.858  9.028   1.00 116.94 ? 1030 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A 1  1030 ? 147.416 69.033  8.737   1.00 129.30 ? 1030 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A 1  1030 ? 147.053 69.488  7.542   1.00 108.15 ? 1030 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A 1  1030 ? 146.480 68.745  9.636   1.00 120.11 ? 1030 ARG A NH2   1 
ATOM   8032  N  N     . VAL A 1  1031 ? 154.808 67.018  7.634   1.00 94.40  ? 1031 VAL A N     1 
ATOM   8033  C  CA    . VAL A 1  1031 ? 155.303 65.639  7.505   1.00 95.11  ? 1031 VAL A CA    1 
ATOM   8034  C  C     . VAL A 1  1031 ? 156.358 65.325  8.555   1.00 100.37 ? 1031 VAL A C     1 
ATOM   8035  O  O     . VAL A 1  1031 ? 156.292 64.280  9.210   1.00 100.10 ? 1031 VAL A O     1 
ATOM   8036  C  CB    . VAL A 1  1031 ? 155.789 65.290  6.063   1.00 98.76  ? 1031 VAL A CB    1 
ATOM   8037  C  CG1   . VAL A 1  1031 ? 156.473 63.923  6.017   1.00 99.48  ? 1031 VAL A CG1   1 
ATOM   8038  C  CG2   . VAL A 1  1031 ? 154.640 65.326  5.061   1.00 96.67  ? 1031 VAL A CG2   1 
ATOM   8039  N  N     . LEU A 1  1032 ? 157.306 66.249  8.717   1.00 98.08  ? 1032 LEU A N     1 
ATOM   8040  C  CA    . LEU A 1  1032 ? 158.444 66.130  9.612   1.00 100.37 ? 1032 LEU A CA    1 
ATOM   8041  C  C     . LEU A 1  1032 ? 158.204 66.420  11.084  1.00 105.67 ? 1032 LEU A C     1 
ATOM   8042  O  O     . LEU A 1  1032 ? 158.763 65.706  11.920  1.00 106.42 ? 1032 LEU A O     1 
ATOM   8043  C  CB    . LEU A 1  1032 ? 159.558 67.044  9.117   1.00 101.52 ? 1032 LEU A CB    1 
ATOM   8044  C  CG    . LEU A 1  1032 ? 160.356 66.550  7.948   1.00 106.43 ? 1032 LEU A CG    1 
ATOM   8045  C  CD1   . LEU A 1  1032 ? 161.084 67.699  7.292   1.00 106.95 ? 1032 LEU A CD1   1 
ATOM   8046  C  CD2   . LEU A 1  1032 ? 161.339 65.490  8.388   1.00 111.52 ? 1032 LEU A CD2   1 
ATOM   8047  N  N     . GLN A 1  1033 ? 157.483 67.522  11.400  1.00 102.44 ? 1033 GLN A N     1 
ATOM   8048  C  CA    . GLN A 1  1033 ? 157.227 67.998  12.765  1.00 104.10 ? 1033 GLN A CA    1 
ATOM   8049  C  C     . GLN A 1  1033 ? 156.043 67.306  13.415  1.00 110.31 ? 1033 GLN A C     1 
ATOM   8050  O  O     . GLN A 1  1033 ? 156.112 66.937  14.594  1.00 112.20 ? 1033 GLN A O     1 
ATOM   8051  C  CB    . GLN A 1  1033 ? 157.032 69.522  12.776  1.00 105.21 ? 1033 GLN A CB    1 
ATOM   8052  C  CG    . GLN A 1  1033 ? 157.191 70.176  14.148  1.00 118.14 ? 1033 GLN A CG    1 
ATOM   8053  C  CD    . GLN A 1  1033 ? 157.952 71.483  14.075  1.00 143.00 ? 1033 GLN A CD    1 
ATOM   8054  O  OE1   . GLN A 1  1033 ? 158.961 71.689  14.770  1.00 143.88 ? 1033 GLN A OE1   1 
ATOM   8055  N  NE2   . GLN A 1  1033 ? 157.498 72.400  13.227  1.00 131.54 ? 1033 GLN A NE2   1 
ATOM   8056  N  N     . GLU A 1  1034 ? 154.951 67.152  12.659  1.00 105.79 ? 1034 GLU A N     1 
ATOM   8057  C  CA    . GLU A 1  1034 ? 153.755 66.522  13.182  1.00 105.62 ? 1034 GLU A CA    1 
ATOM   8058  C  C     . GLU A 1  1034 ? 153.857 64.989  13.139  1.00 110.47 ? 1034 GLU A C     1 
ATOM   8059  O  O     . GLU A 1  1034 ? 154.066 64.371  14.190  1.00 111.52 ? 1034 GLU A O     1 
ATOM   8060  C  CB    . GLU A 1  1034 ? 152.486 67.073  12.491  1.00 105.20 ? 1034 GLU A CB    1 
ATOM   8061  C  CG    . GLU A 1  1034 ? 152.135 68.499  12.904  1.00 117.53 ? 1034 GLU A CG    1 
ATOM   8062  C  CD    . GLU A 1  1034 ? 151.105 69.228  12.058  1.00 137.72 ? 1034 GLU A CD    1 
ATOM   8063  O  OE1   . GLU A 1  1034 ? 149.987 68.692  11.881  1.00 118.05 ? 1034 GLU A OE1   1 
ATOM   8064  O  OE2   . GLU A 1  1034 ? 151.413 70.346  11.581  1.00 139.30 ? 1034 GLU A OE2   1 
ATOM   8065  N  N     . TYR A 1  1035 ? 153.774 64.393  11.922  1.00 105.86 ? 1035 TYR A N     1 
ATOM   8066  C  CA    . TYR A 1  1035 ? 153.755 62.942  11.653  1.00 105.12 ? 1035 TYR A CA    1 
ATOM   8067  C  C     . TYR A 1  1035 ? 155.002 62.184  12.053  1.00 108.16 ? 1035 TYR A C     1 
ATOM   8068  O  O     . TYR A 1  1035 ? 154.903 61.014  12.438  1.00 107.52 ? 1035 TYR A O     1 
ATOM   8069  C  CB    . TYR A 1  1035 ? 153.447 62.646  10.170  1.00 104.63 ? 1035 TYR A CB    1 
ATOM   8070  C  CG    . TYR A 1  1035 ? 152.303 63.428  9.564   1.00 104.71 ? 1035 TYR A CG    1 
ATOM   8071  C  CD1   . TYR A 1  1035 ? 151.218 63.836  10.338  1.00 105.82 ? 1035 TYR A CD1   1 
ATOM   8072  C  CD2   . TYR A 1  1035 ? 152.295 63.749  8.213   1.00 105.03 ? 1035 TYR A CD2   1 
ATOM   8073  C  CE1   . TYR A 1  1035 ? 150.177 64.582  9.791   1.00 105.77 ? 1035 TYR A CE1   1 
ATOM   8074  C  CE2   . TYR A 1  1035 ? 151.250 64.473  7.648   1.00 104.82 ? 1035 TYR A CE2   1 
ATOM   8075  C  CZ    . TYR A 1  1035 ? 150.190 64.890  8.441   1.00 113.10 ? 1035 TYR A CZ    1 
ATOM   8076  O  OH    . TYR A 1  1035 ? 149.141 65.600  7.897   1.00 113.67 ? 1035 TYR A OH    1 
ATOM   8077  N  N     . ARG A 1  1036 ? 156.170 62.836  11.922  1.00 104.77 ? 1036 ARG A N     1 
ATOM   8078  C  CA    . ARG A 1  1036 ? 157.499 62.286  12.216  1.00 106.20 ? 1036 ARG A CA    1 
ATOM   8079  C  C     . ARG A 1  1036 ? 157.768 61.041  11.338  1.00 108.23 ? 1036 ARG A C     1 
ATOM   8080  O  O     . ARG A 1  1036 ? 158.127 59.979  11.852  1.00 109.60 ? 1036 ARG A O     1 
ATOM   8081  C  CB    . ARG A 1  1036 ? 157.707 62.001  13.739  1.00 109.04 ? 1036 ARG A CB    1 
ATOM   8082  C  CG    . ARG A 1  1036 ? 157.335 63.137  14.714  1.00 120.37 ? 1036 ARG A CG    1 
ATOM   8083  C  CD    . ARG A 1  1036 ? 158.242 64.343  14.633  1.00 130.35 ? 1036 ARG A CD    1 
ATOM   8084  N  NE    . ARG A 1  1036 ? 159.615 64.024  15.002  1.00 140.07 ? 1036 ARG A NE    1 
ATOM   8085  C  CZ    . ARG A 1  1036 ? 160.212 64.507  16.078  1.00 156.84 ? 1036 ARG A CZ    1 
ATOM   8086  N  NH1   . ARG A 1  1036 ? 159.569 65.347  16.879  1.00 141.85 ? 1036 ARG A NH1   1 
ATOM   8087  N  NH2   . ARG A 1  1036 ? 161.461 64.166  16.359  1.00 149.41 ? 1036 ARG A NH2   1 
ATOM   8088  N  N     . LEU A 1  1037 ? 157.576 61.175  10.011  1.00 101.07 ? 1037 LEU A N     1 
ATOM   8089  C  CA    . LEU A 1  1037 ? 157.765 60.052  9.096   1.00 99.57  ? 1037 LEU A CA    1 
ATOM   8090  C  C     . LEU A 1  1037 ? 159.199 59.786  8.674   1.00 104.81 ? 1037 LEU A C     1 
ATOM   8091  O  O     . LEU A 1  1037 ? 159.926 60.717  8.341   1.00 104.32 ? 1037 LEU A O     1 
ATOM   8092  C  CB    . LEU A 1  1037 ? 156.899 60.187  7.833   1.00 96.99  ? 1037 LEU A CB    1 
ATOM   8093  C  CG    . LEU A 1  1037 ? 155.386 60.316  7.959   1.00 99.32  ? 1037 LEU A CG    1 
ATOM   8094  C  CD1   . LEU A 1  1037 ? 154.754 60.144  6.618   1.00 98.10  ? 1037 LEU A CD1   1 
ATOM   8095  C  CD2   . LEU A 1  1037 ? 154.796 59.292  8.893   1.00 100.54 ? 1037 LEU A CD2   1 
ATOM   8096  N  N     . THR A 1  1038 ? 159.580 58.493  8.647   1.00 102.74 ? 1038 THR A N     1 
ATOM   8097  C  CA    . THR A 1  1038 ? 160.849 57.988  8.116   1.00 103.71 ? 1038 THR A CA    1 
ATOM   8098  C  C     . THR A 1  1038 ? 160.627 57.893  6.588   1.00 106.35 ? 1038 THR A C     1 
ATOM   8099  O  O     . THR A 1  1038 ? 159.483 57.683  6.161   1.00 104.59 ? 1038 THR A O     1 
ATOM   8100  C  CB    . THR A 1  1038 ? 161.245 56.614  8.754   1.00 113.58 ? 1038 THR A CB    1 
ATOM   8101  O  OG1   . THR A 1  1038 ? 162.161 55.918  7.898   1.00 116.25 ? 1038 THR A OG1   1 
ATOM   8102  C  CG2   . THR A 1  1038 ? 160.052 55.696  9.023   1.00 110.55 ? 1038 THR A CG2   1 
ATOM   8103  N  N     . LYS A 1  1039 ? 161.698 58.051  5.770   1.00 103.00 ? 1039 LYS A N     1 
ATOM   8104  C  CA    . LYS A 1  1039 ? 161.615 57.935  4.304   1.00 101.49 ? 1039 LYS A CA    1 
ATOM   8105  C  C     . LYS A 1  1039 ? 160.764 56.712  3.936   1.00 106.21 ? 1039 LYS A C     1 
ATOM   8106  O  O     . LYS A 1  1039 ? 159.804 56.834  3.175   1.00 104.97 ? 1039 LYS A O     1 
ATOM   8107  C  CB    . LYS A 1  1039 ? 163.028 57.883  3.669   1.00 104.42 ? 1039 LYS A CB    1 
ATOM   8108  C  CG    . LYS A 1  1039 ? 163.102 57.441  2.192   1.00 109.34 ? 1039 LYS A CG    1 
ATOM   8109  C  CD    . LYS A 1  1039 ? 162.659 58.520  1.213   1.00 115.77 ? 1039 LYS A CD    1 
ATOM   8110  C  CE    . LYS A 1  1039 ? 162.673 58.070  -0.227  1.00 123.59 ? 1039 LYS A CE    1 
ATOM   8111  N  NZ    . LYS A 1  1039 ? 161.635 58.793  -1.021  1.00 132.07 ? 1039 LYS A NZ    1 
ATOM   8112  N  N     . GLN A 1  1040 ? 161.070 55.569  4.574   1.00 104.00 ? 1040 GLN A N     1 
ATOM   8113  C  CA    . GLN A 1  1040 ? 160.395 54.284  4.453   1.00 103.23 ? 1040 GLN A CA    1 
ATOM   8114  C  C     . GLN A 1  1040 ? 158.875 54.425  4.559   1.00 103.78 ? 1040 GLN A C     1 
ATOM   8115  O  O     . GLN A 1  1040 ? 158.146 53.932  3.689   1.00 101.98 ? 1040 GLN A O     1 
ATOM   8116  C  CB    . GLN A 1  1040 ? 160.929 53.368  5.561   1.00 106.80 ? 1040 GLN A CB    1 
ATOM   8117  C  CG    . GLN A 1  1040 ? 160.293 51.986  5.607   1.00 117.85 ? 1040 GLN A CG    1 
ATOM   8118  C  CD    . GLN A 1  1040 ? 160.684 51.251  6.856   1.00 131.92 ? 1040 GLN A CD    1 
ATOM   8119  O  OE1   . GLN A 1  1040 ? 160.743 51.821  7.962   1.00 126.71 ? 1040 GLN A OE1   1 
ATOM   8120  N  NE2   . GLN A 1  1040 ? 160.925 49.956  6.706   1.00 121.80 ? 1040 GLN A NE2   1 
ATOM   8121  N  N     . ALA A 1  1041 ? 158.415 55.102  5.628   1.00 99.94  ? 1041 ALA A N     1 
ATOM   8122  C  CA    . ALA A 1  1041 ? 156.999 55.332  5.910   1.00 98.58  ? 1041 ALA A CA    1 
ATOM   8123  C  C     . ALA A 1  1041 ? 156.365 56.245  4.877   1.00 100.31 ? 1041 ALA A C     1 
ATOM   8124  O  O     . ALA A 1  1041 ? 155.249 55.999  4.423   1.00 97.65  ? 1041 ALA A O     1 
ATOM   8125  C  CB    . ALA A 1  1041 ? 156.834 55.921  7.300   1.00 100.02 ? 1041 ALA A CB    1 
ATOM   8126  N  N     . PHE A 1  1042 ? 157.095 57.283  4.494   1.00 97.80  ? 1042 PHE A N     1 
ATOM   8127  C  CA    . PHE A 1  1042 ? 156.643 58.256  3.520   1.00 96.92  ? 1042 PHE A CA    1 
ATOM   8128  C  C     . PHE A 1  1042 ? 156.337 57.634  2.155   1.00 100.53 ? 1042 PHE A C     1 
ATOM   8129  O  O     . PHE A 1  1042 ? 155.323 57.966  1.551   1.00 99.11  ? 1042 PHE A O     1 
ATOM   8130  C  CB    . PHE A 1  1042 ? 157.667 59.394  3.404   1.00 99.56  ? 1042 PHE A CB    1 
ATOM   8131  C  CG    . PHE A 1  1042 ? 157.234 60.537  2.521   1.00 99.58  ? 1042 PHE A CG    1 
ATOM   8132  C  CD1   . PHE A 1  1042 ? 156.196 61.380  2.905   1.00 100.93 ? 1042 PHE A CD1   1 
ATOM   8133  C  CD2   . PHE A 1  1042 ? 157.875 60.781  1.313   1.00 101.63 ? 1042 PHE A CD2   1 
ATOM   8134  C  CE1   . PHE A 1  1042 ? 155.807 62.443  2.095   1.00 100.94 ? 1042 PHE A CE1   1 
ATOM   8135  C  CE2   . PHE A 1  1042 ? 157.495 61.856  0.512   1.00 103.47 ? 1042 PHE A CE2   1 
ATOM   8136  C  CZ    . PHE A 1  1042 ? 156.459 62.676  0.904   1.00 100.40 ? 1042 PHE A CZ    1 
ATOM   8137  N  N     . ASP A 1  1043 ? 157.186 56.721  1.689   1.00 98.10  ? 1043 ASP A N     1 
ATOM   8138  C  CA    . ASP A 1  1043 ? 157.004 56.058  0.401   1.00 97.56  ? 1043 ASP A CA    1 
ATOM   8139  C  C     . ASP A 1  1043 ? 155.789 55.155  0.435   1.00 98.93  ? 1043 ASP A C     1 
ATOM   8140  O  O     . ASP A 1  1043 ? 155.079 55.030  -0.569  1.00 96.51  ? 1043 ASP A O     1 
ATOM   8141  C  CB    . ASP A 1  1043 ? 158.264 55.263  0.047   1.00 101.76 ? 1043 ASP A CB    1 
ATOM   8142  C  CG    . ASP A 1  1043 ? 159.537 56.089  -0.003  1.00 115.01 ? 1043 ASP A CG    1 
ATOM   8143  O  OD1   . ASP A 1  1043 ? 159.438 57.350  -0.032  1.00 115.02 ? 1043 ASP A OD1   1 
ATOM   8144  O  OD2   . ASP A 1  1043 ? 160.631 55.482  -0.035  1.00 123.07 ? 1043 ASP A OD2   1 
ATOM   8145  N  N     . TRP A 1  1044 ? 155.555 54.549  1.614   1.00 96.02  ? 1044 TRP A N     1 
ATOM   8146  C  CA    . TRP A 1  1044 ? 154.427 53.683  1.917   1.00 95.73  ? 1044 TRP A CA    1 
ATOM   8147  C  C     . TRP A 1  1044 ? 153.121 54.517  1.901   1.00 95.00  ? 1044 TRP A C     1 
ATOM   8148  O  O     . TRP A 1  1044 ? 152.130 54.105  1.283   1.00 92.77  ? 1044 TRP A O     1 
ATOM   8149  C  CB    . TRP A 1  1044 ? 154.658 53.015  3.284   1.00 96.80  ? 1044 TRP A CB    1 
ATOM   8150  C  CG    . TRP A 1  1044 ? 153.617 52.009  3.712   1.00 98.35  ? 1044 TRP A CG    1 
ATOM   8151  C  CD1   . TRP A 1  1044 ? 153.667 50.659  3.533   1.00 102.24 ? 1044 TRP A CD1   1 
ATOM   8152  C  CD2   . TRP A 1  1044 ? 152.446 52.262  4.503   1.00 97.68  ? 1044 TRP A CD2   1 
ATOM   8153  N  NE1   . TRP A 1  1044 ? 152.584 50.058  4.130   1.00 101.31 ? 1044 TRP A NE1   1 
ATOM   8154  C  CE2   . TRP A 1  1044 ? 151.824 51.016  4.742   1.00 101.69 ? 1044 TRP A CE2   1 
ATOM   8155  C  CE3   . TRP A 1  1044 ? 151.860 53.421  5.039   1.00 98.37  ? 1044 TRP A CE3   1 
ATOM   8156  C  CZ2   . TRP A 1  1044 ? 150.653 50.893  5.491   1.00 100.70 ? 1044 TRP A CZ2   1 
ATOM   8157  C  CZ3   . TRP A 1  1044 ? 150.692 53.298  5.772   1.00 99.53  ? 1044 TRP A CZ3   1 
ATOM   8158  C  CH2   . TRP A 1  1044 ? 150.104 52.045  5.995   1.00 100.55 ? 1044 TRP A CH2   1 
ATOM   8159  N  N     . VAL A 1  1045 ? 153.142 55.701  2.561   1.00 89.30  ? 1045 VAL A N     1 
ATOM   8160  C  CA    . VAL A 1  1045 ? 152.000 56.616  2.600   1.00 86.47  ? 1045 VAL A CA    1 
ATOM   8161  C  C     . VAL A 1  1045 ? 151.727 57.056  1.169   1.00 89.29  ? 1045 VAL A C     1 
ATOM   8162  O  O     . VAL A 1  1045 ? 150.613 56.890  0.690   1.00 88.59  ? 1045 VAL A O     1 
ATOM   8163  C  CB    . VAL A 1  1045 ? 152.202 57.813  3.583   1.00 89.50  ? 1045 VAL A CB    1 
ATOM   8164  C  CG1   . VAL A 1  1045 ? 151.103 58.869  3.447   1.00 87.25  ? 1045 VAL A CG1   1 
ATOM   8165  C  CG2   . VAL A 1  1045 ? 152.289 57.332  5.024   1.00 90.50  ? 1045 VAL A CG2   1 
ATOM   8166  N  N     . LEU A 1  1046 ? 152.763 57.514  0.465   1.00 86.24  ? 1046 LEU A N     1 
ATOM   8167  C  CA    . LEU A 1  1046 ? 152.651 57.964  -0.913  1.00 85.55  ? 1046 LEU A CA    1 
ATOM   8168  C  C     . LEU A 1  1046 ? 152.068 56.903  -1.853  1.00 91.73  ? 1046 LEU A C     1 
ATOM   8169  O  O     . LEU A 1  1046 ? 151.201 57.234  -2.669  1.00 89.20  ? 1046 LEU A O     1 
ATOM   8170  C  CB    . LEU A 1  1046 ? 153.997 58.507  -1.434  1.00 86.12  ? 1046 LEU A CB    1 
ATOM   8171  C  CG    . LEU A 1  1046 ? 154.455 59.913  -0.978  1.00 89.87  ? 1046 LEU A CG    1 
ATOM   8172  C  CD1   . LEU A 1  1046 ? 155.265 60.568  -2.047  1.00 90.24  ? 1046 LEU A CD1   1 
ATOM   8173  C  CD2   . LEU A 1  1046 ? 153.303 60.840  -0.707  1.00 89.66  ? 1046 LEU A CD2   1 
ATOM   8174  N  N     . SER A 1  1047 ? 152.501 55.630  -1.717  1.00 92.53  ? 1047 SER A N     1 
ATOM   8175  C  CA    . SER A 1  1047 ? 151.973 54.563  -2.577  1.00 93.49  ? 1047 SER A CA    1 
ATOM   8176  C  C     . SER A 1  1047 ? 150.524 54.203  -2.248  1.00 95.91  ? 1047 SER A C     1 
ATOM   8177  O  O     . SER A 1  1047 ? 149.703 53.991  -3.158  1.00 93.82  ? 1047 SER A O     1 
ATOM   8178  C  CB    . SER A 1  1047 ? 152.851 53.316  -2.534  1.00 100.40 ? 1047 SER A CB    1 
ATOM   8179  O  OG    . SER A 1  1047 ? 152.238 52.277  -3.285  1.00 113.25 ? 1047 SER A OG    1 
ATOM   8180  N  N     . ASN A 1  1048 ? 150.221 54.149  -0.942  1.00 92.82  ? 1048 ASN A N     1 
ATOM   8181  C  CA    . ASN A 1  1048 ? 148.893 53.809  -0.469  1.00 91.86  ? 1048 ASN A CA    1 
ATOM   8182  C  C     . ASN A 1  1048 ? 147.888 54.924  -0.712  1.00 93.05  ? 1048 ASN A C     1 
ATOM   8183  O  O     . ASN A 1  1048 ? 146.692 54.675  -0.627  1.00 93.28  ? 1048 ASN A O     1 
ATOM   8184  C  CB    . ASN A 1  1048 ? 148.911 53.327  0.973   1.00 95.22  ? 1048 ASN A CB    1 
ATOM   8185  C  CG    . ASN A 1  1048 ? 149.304 51.875  1.047   1.00 125.18 ? 1048 ASN A CG    1 
ATOM   8186  O  OD1   . ASN A 1  1048 ? 148.504 50.971  0.752   1.00 121.28 ? 1048 ASN A OD1   1 
ATOM   8187  N  ND2   . ASN A 1  1048 ? 150.572 51.626  1.363   1.00 117.31 ? 1048 ASN A ND2   1 
ATOM   8188  N  N     . ILE A 1  1049 ? 148.344 56.117  -1.085  1.00 87.07  ? 1049 ILE A N     1 
ATOM   8189  C  CA    . ILE A 1  1049 ? 147.415 57.175  -1.444  1.00 84.99  ? 1049 ILE A CA    1 
ATOM   8190  C  C     . ILE A 1  1049 ? 147.027 56.892  -2.895  1.00 89.53  ? 1049 ILE A C     1 
ATOM   8191  O  O     . ILE A 1  1049 ? 145.835 56.827  -3.204  1.00 88.35  ? 1049 ILE A O     1 
ATOM   8192  C  CB    . ILE A 1  1049 ? 148.009 58.595  -1.225  1.00 87.42  ? 1049 ILE A CB    1 
ATOM   8193  C  CG1   . ILE A 1  1049 ? 147.896 59.012  0.257   1.00 87.36  ? 1049 ILE A CG1   1 
ATOM   8194  C  CG2   . ILE A 1  1049 ? 147.336 59.629  -2.147  1.00 86.69  ? 1049 ILE A CG2   1 
ATOM   8195  C  CD1   . ILE A 1  1049 ? 148.872 60.047  0.700   1.00 90.74  ? 1049 ILE A CD1   1 
ATOM   8196  N  N     . GLU A 1  1050 ? 148.045 56.658  -3.763  1.00 87.60  ? 1050 GLU A N     1 
ATOM   8197  C  CA    . GLU A 1  1050 ? 147.870 56.378  -5.187  1.00 87.21  ? 1050 GLU A CA    1 
ATOM   8198  C  C     . GLU A 1  1050 ? 146.943 55.206  -5.314  1.00 89.52  ? 1050 GLU A C     1 
ATOM   8199  O  O     . GLU A 1  1050 ? 145.874 55.321  -5.918  1.00 87.16  ? 1050 GLU A O     1 
ATOM   8200  C  CB    . GLU A 1  1050 ? 149.222 56.078  -5.877  1.00 90.00  ? 1050 GLU A CB    1 
ATOM   8201  C  CG    . GLU A 1  1050 ? 149.123 56.068  -7.399  1.00 102.56 ? 1050 GLU A CG    1 
ATOM   8202  C  CD    . GLU A 1  1050 ? 150.349 55.674  -8.206  1.00 129.78 ? 1050 GLU A CD    1 
ATOM   8203  O  OE1   . GLU A 1  1050 ? 151.482 56.031  -7.805  1.00 136.65 ? 1050 GLU A OE1   1 
ATOM   8204  O  OE2   . GLU A 1  1050 ? 150.164 55.085  -9.297  1.00 119.12 ? 1050 GLU A OE2   1 
ATOM   8205  N  N     . ALA A 1  1051 ? 147.322 54.110  -4.654  1.00 87.54  ? 1051 ALA A N     1 
ATOM   8206  C  CA    . ALA A 1  1051 ? 146.574 52.863  -4.639  1.00 88.07  ? 1051 ALA A CA    1 
ATOM   8207  C  C     . ALA A 1  1051 ? 145.107 53.063  -4.335  1.00 87.56  ? 1051 ALA A C     1 
ATOM   8208  O  O     . ALA A 1  1051 ? 144.258 52.715  -5.162  1.00 85.87  ? 1051 ALA A O     1 
ATOM   8209  C  CB    . ALA A 1  1051 ? 147.189 51.908  -3.631  1.00 90.87  ? 1051 ALA A CB    1 
ATOM   8210  N  N     . GLN A 1  1052 ? 144.827 53.660  -3.167  1.00 82.88  ? 1052 GLN A N     1 
ATOM   8211  C  CA    . GLN A 1  1052 ? 143.489 53.914  -2.667  1.00 81.77  ? 1052 GLN A CA    1 
ATOM   8212  C  C     . GLN A 1  1052 ? 142.687 54.823  -3.586  1.00 85.51  ? 1052 GLN A C     1 
ATOM   8213  O  O     . GLN A 1  1052 ? 141.510 54.521  -3.858  1.00 84.26  ? 1052 GLN A O     1 
ATOM   8214  C  CB    . GLN A 1  1052 ? 143.526 54.421  -1.218  1.00 83.18  ? 1052 GLN A CB    1 
ATOM   8215  C  CG    . GLN A 1  1052 ? 143.403 53.287  -0.200  1.00 98.69  ? 1052 GLN A CG    1 
ATOM   8216  C  CD    . GLN A 1  1052 ? 143.898 53.640  1.182   1.00 124.73 ? 1052 GLN A CD    1 
ATOM   8217  O  OE1   . GLN A 1  1052 ? 143.286 54.430  1.927   1.00 118.63 ? 1052 GLN A OE1   1 
ATOM   8218  N  NE2   . GLN A 1  1052 ? 144.989 52.990  1.581   1.00 124.05 ? 1052 GLN A NE2   1 
ATOM   8219  N  N     . PHE A 1  1053 ? 143.337 55.894  -4.113  1.00 82.61  ? 1053 PHE A N     1 
ATOM   8220  C  CA    . PHE A 1  1053 ? 142.705 56.852  -5.027  1.00 81.59  ? 1053 PHE A CA    1 
ATOM   8221  C  C     . PHE A 1  1053 ? 142.144 56.140  -6.233  1.00 86.54  ? 1053 PHE A C     1 
ATOM   8222  O  O     . PHE A 1  1053 ? 140.961 56.281  -6.554  1.00 85.64  ? 1053 PHE A O     1 
ATOM   8223  C  CB    . PHE A 1  1053 ? 143.694 57.937  -5.481  1.00 83.35  ? 1053 PHE A CB    1 
ATOM   8224  C  CG    . PHE A 1  1053 ? 143.076 58.954  -6.410  1.00 84.28  ? 1053 PHE A CG    1 
ATOM   8225  C  CD1   . PHE A 1  1053 ? 142.382 60.050  -5.907  1.00 87.34  ? 1053 PHE A CD1   1 
ATOM   8226  C  CD2   . PHE A 1  1053 ? 143.187 58.821  -7.788  1.00 86.53  ? 1053 PHE A CD2   1 
ATOM   8227  C  CE1   . PHE A 1  1053 ? 141.808 60.996  -6.766  1.00 87.61  ? 1053 PHE A CE1   1 
ATOM   8228  C  CE2   . PHE A 1  1053 ? 142.598 59.758  -8.646  1.00 89.11  ? 1053 PHE A CE2   1 
ATOM   8229  C  CZ    . PHE A 1  1053 ? 141.921 60.845  -8.129  1.00 86.66  ? 1053 PHE A CZ    1 
ATOM   8230  N  N     . LEU A 1  1054 ? 143.009 55.364  -6.889  1.00 83.58  ? 1054 LEU A N     1 
ATOM   8231  C  CA    . LEU A 1  1054 ? 142.678 54.644  -8.099  1.00 82.56  ? 1054 LEU A CA    1 
ATOM   8232  C  C     . LEU A 1  1054 ? 141.468 53.750  -7.914  1.00 83.09  ? 1054 LEU A C     1 
ATOM   8233  O  O     . LEU A 1  1054 ? 140.510 53.928  -8.657  1.00 80.22  ? 1054 LEU A O     1 
ATOM   8234  C  CB    . LEU A 1  1054 ? 143.911 53.914  -8.647  1.00 83.84  ? 1054 LEU A CB    1 
ATOM   8235  C  CG    . LEU A 1  1054 ? 144.992 54.860  -9.214  1.00 88.41  ? 1054 LEU A CG    1 
ATOM   8236  C  CD1   . LEU A 1  1054 ? 146.173 54.101  -9.751  1.00 89.78  ? 1054 LEU A CD1   1 
ATOM   8237  C  CD2   . LEU A 1  1054 ? 144.434 55.733  -10.319 1.00 90.32  ? 1054 LEU A CD2   1 
ATOM   8238  N  N     . ARG A 1  1055 ? 141.443 52.929  -6.849  1.00 80.79  ? 1055 ARG A N     1 
ATOM   8239  C  CA    . ARG A 1  1055 ? 140.301 52.061  -6.516  1.00 81.12  ? 1055 ARG A CA    1 
ATOM   8240  C  C     . ARG A 1  1055 ? 138.995 52.886  -6.338  1.00 84.40  ? 1055 ARG A C     1 
ATOM   8241  O  O     . ARG A 1  1055 ? 137.900 52.450  -6.765  1.00 82.99  ? 1055 ARG A O     1 
ATOM   8242  C  CB    . ARG A 1  1055 ? 140.571 51.284  -5.211  1.00 82.25  ? 1055 ARG A CB    1 
ATOM   8243  C  CG    . ARG A 1  1055 ? 141.806 50.406  -5.216  1.00 96.84  ? 1055 ARG A CG    1 
ATOM   8244  C  CD    . ARG A 1  1055 ? 142.013 49.809  -3.837  1.00 115.78 ? 1055 ARG A CD    1 
ATOM   8245  N  NE    . ARG A 1  1055 ? 143.414 49.457  -3.595  1.00 138.25 ? 1055 ARG A NE    1 
ATOM   8246  C  CZ    . ARG A 1  1055 ? 144.029 49.584  -2.421  1.00 159.80 ? 1055 ARG A CZ    1 
ATOM   8247  N  NH1   . ARG A 1  1055 ? 143.375 50.061  -1.368  1.00 149.48 ? 1055 ARG A NH1   1 
ATOM   8248  N  NH2   . ARG A 1  1055 ? 145.305 49.236  -2.291  1.00 148.56 ? 1055 ARG A NH2   1 
ATOM   8249  N  N     . SER A 1  1056 ? 139.147 54.096  -5.718  1.00 79.80  ? 1056 SER A N     1 
ATOM   8250  C  CA    . SER A 1  1056 ? 138.073 55.027  -5.361  1.00 77.64  ? 1056 SER A CA    1 
ATOM   8251  C  C     . SER A 1  1056 ? 137.244 55.571  -6.560  1.00 80.31  ? 1056 SER A C     1 
ATOM   8252  O  O     . SER A 1  1056 ? 136.067 55.889  -6.354  1.00 78.77  ? 1056 SER A O     1 
ATOM   8253  C  CB    . SER A 1  1056 ? 138.612 56.166  -4.497  1.00 78.56  ? 1056 SER A CB    1 
ATOM   8254  O  OG    . SER A 1  1056 ? 138.993 55.730  -3.199  1.00 80.83  ? 1056 SER A OG    1 
ATOM   8255  N  N     . VAL A 1  1057 ? 137.840 55.640  -7.796  1.00 76.36  ? 1057 VAL A N     1 
ATOM   8256  C  CA    . VAL A 1  1057 ? 137.220 56.102  -9.068  1.00 74.83  ? 1057 VAL A CA    1 
ATOM   8257  C  C     . VAL A 1  1057 ? 136.016 55.208  -9.472  1.00 81.13  ? 1057 VAL A C     1 
ATOM   8258  O  O     . VAL A 1  1057 ? 136.001 54.009  -9.121  1.00 82.25  ? 1057 VAL A O     1 
ATOM   8259  C  CB    . VAL A 1  1057 ? 138.279 56.198  -10.203 1.00 77.60  ? 1057 VAL A CB    1 
ATOM   8260  C  CG1   . VAL A 1  1057 ? 137.703 56.773  -11.492 1.00 76.54  ? 1057 VAL A CG1   1 
ATOM   8261  C  CG2   . VAL A 1  1057 ? 139.478 57.011  -9.763  1.00 77.78  ? 1057 VAL A CG2   1 
ATOM   8262  N  N     . VAL A 1  1058 ? 135.008 55.803  -10.196 1.00 77.10  ? 1058 VAL A N     1 
ATOM   8263  C  CA    . VAL A 1  1058 ? 133.778 55.127  -10.669 1.00 76.42  ? 1058 VAL A CA    1 
ATOM   8264  C  C     . VAL A 1  1058 ? 134.118 54.053  -11.679 1.00 84.47  ? 1058 VAL A C     1 
ATOM   8265  O  O     . VAL A 1  1058 ? 135.127 54.181  -12.402 1.00 86.65  ? 1058 VAL A O     1 
ATOM   8266  C  CB    . VAL A 1  1058 ? 132.750 56.092  -11.291 1.00 78.05  ? 1058 VAL A CB    1 
ATOM   8267  C  CG1   . VAL A 1  1058 ? 131.441 55.388  -11.589 1.00 76.98  ? 1058 VAL A CG1   1 
ATOM   8268  C  CG2   . VAL A 1  1058 ? 132.494 57.253  -10.387 1.00 77.44  ? 1058 VAL A CG2   1 
ATOM   8269  N  N     . HIS A 1  1059 ? 133.242 53.026  -11.772 1.00 79.77  ? 1059 HIS A N     1 
ATOM   8270  C  CA    . HIS A 1  1059 ? 133.419 51.938  -12.720 1.00 79.92  ? 1059 HIS A CA    1 
ATOM   8271  C  C     . HIS A 1  1059 ? 132.541 52.071  -13.974 1.00 79.99  ? 1059 HIS A C     1 
ATOM   8272  O  O     . HIS A 1  1059 ? 131.321 52.074  -13.817 1.00 80.79  ? 1059 HIS A O     1 
ATOM   8273  C  CB    . HIS A 1  1059 ? 133.148 50.614  -12.015 1.00 81.88  ? 1059 HIS A CB    1 
ATOM   8274  C  CG    . HIS A 1  1059 ? 134.290 50.156  -11.182 1.00 86.75  ? 1059 HIS A CG    1 
ATOM   8275  N  ND1   . HIS A 1  1059 ? 134.953 48.980  -11.469 1.00 89.98  ? 1059 HIS A ND1   1 
ATOM   8276  C  CD2   . HIS A 1  1059 ? 134.878 50.751  -10.116 1.00 89.41  ? 1059 HIS A CD2   1 
ATOM   8277  C  CE1   . HIS A 1  1059 ? 135.914 48.884  -10.567 1.00 90.70  ? 1059 HIS A CE1   1 
ATOM   8278  N  NE2   . HIS A 1  1059 ? 135.919 49.937  -9.740  1.00 90.53  ? 1059 HIS A NE2   1 
ATOM   8279  N  N     . PRO A 1  1060 ? 133.094 52.141  -15.219 1.00 72.23  ? 1060 PRO A N     1 
ATOM   8280  C  CA    . PRO A 1  1060 ? 132.228 52.206  -16.407 1.00 71.15  ? 1060 PRO A CA    1 
ATOM   8281  C  C     . PRO A 1  1060 ? 131.249 51.028  -16.478 1.00 75.42  ? 1060 PRO A C     1 
ATOM   8282  O  O     . PRO A 1  1060 ? 131.618 49.838  -16.425 1.00 75.22  ? 1060 PRO A O     1 
ATOM   8283  C  CB    . PRO A 1  1060 ? 133.216 52.249  -17.567 1.00 73.40  ? 1060 PRO A CB    1 
ATOM   8284  C  CG    . PRO A 1  1060 ? 134.429 52.835  -16.977 1.00 78.11  ? 1060 PRO A CG    1 
ATOM   8285  C  CD    . PRO A 1  1060 ? 134.506 52.205  -15.618 1.00 73.73  ? 1060 PRO A CD    1 
ATOM   8286  N  N     . GLY A 1  1061 ? 129.984 51.415  -16.512 1.00 71.68  ? 1061 GLY A N     1 
ATOM   8287  C  CA    . GLY A 1  1061 ? 128.843 50.523  -16.471 1.00 71.84  ? 1061 GLY A CA    1 
ATOM   8288  C  C     . GLY A 1  1061 ? 127.930 50.928  -15.335 1.00 76.04  ? 1061 GLY A C     1 
ATOM   8289  O  O     . GLY A 1  1061 ? 126.718 50.687  -15.403 1.00 74.56  ? 1061 GLY A O     1 
ATOM   8290  N  N     . GLU A 1  1062 ? 128.516 51.590  -14.289 1.00 74.11  ? 1062 GLU A N     1 
ATOM   8291  C  CA    . GLU A 1  1062 ? 127.801 52.041  -13.091 1.00 73.95  ? 1062 GLU A CA    1 
ATOM   8292  C  C     . GLU A 1  1062 ? 126.539 52.722  -13.460 1.00 77.19  ? 1062 GLU A C     1 
ATOM   8293  O  O     . GLU A 1  1062 ? 126.563 53.733  -14.169 1.00 76.51  ? 1062 GLU A O     1 
ATOM   8294  C  CB    . GLU A 1  1062 ? 128.642 52.902  -12.131 1.00 75.39  ? 1062 GLU A CB    1 
ATOM   8295  C  CG    . GLU A 1  1062 ? 129.087 52.151  -10.873 1.00 92.59  ? 1062 GLU A CG    1 
ATOM   8296  C  CD    . GLU A 1  1062 ? 128.085 51.889  -9.752  1.00 125.27 ? 1062 GLU A CD    1 
ATOM   8297  O  OE1   . GLU A 1  1062 ? 127.021 51.270  -10.006 1.00 125.13 ? 1062 GLU A OE1   1 
ATOM   8298  O  OE2   . GLU A 1  1062 ? 128.413 52.233  -8.592  1.00 120.48 ? 1062 GLU A OE2   1 
ATOM   8299  N  N     . MET A 1  1063 ? 125.421 52.117  -13.014 1.00 72.81  ? 1063 MET A N     1 
ATOM   8300  C  CA    . MET A 1  1063 ? 124.069 52.560  -13.316 1.00 71.36  ? 1063 MET A CA    1 
ATOM   8301  C  C     . MET A 1  1063 ? 123.610 53.803  -12.505 1.00 71.32  ? 1063 MET A C     1 
ATOM   8302  O  O     . MET A 1  1063 ? 122.497 53.924  -11.979 1.00 68.93  ? 1063 MET A O     1 
ATOM   8303  C  CB    . MET A 1  1063 ? 123.130 51.379  -13.230 1.00 73.91  ? 1063 MET A CB    1 
ATOM   8304  C  CG    . MET A 1  1063 ? 123.250 50.505  -14.471 1.00 77.94  ? 1063 MET A CG    1 
ATOM   8305  S  SD    . MET A 1  1063 ? 123.494 51.438  -16.020 1.00 81.43  ? 1063 MET A SD    1 
ATOM   8306  C  CE    . MET A 1  1063 ? 121.931 52.463  -16.058 1.00 76.91  ? 1063 MET A CE    1 
ATOM   8307  N  N     . VAL A 1  1064 ? 124.507 54.768  -12.565 1.00 67.43  ? 1064 VAL A N     1 
ATOM   8308  C  CA    . VAL A 1  1064 ? 124.577 56.110  -12.050 1.00 67.58  ? 1064 VAL A CA    1 
ATOM   8309  C  C     . VAL A 1  1064 ? 123.239 56.839  -12.082 1.00 73.83  ? 1064 VAL A C     1 
ATOM   8310  O  O     . VAL A 1  1064 ? 122.984 57.677  -11.199 1.00 74.09  ? 1064 VAL A O     1 
ATOM   8311  C  CB    . VAL A 1  1064 ? 125.635 56.720  -12.979 1.00 72.08  ? 1064 VAL A CB    1 
ATOM   8312  C  CG1   . VAL A 1  1064 ? 125.394 58.187  -13.325 1.00 71.93  ? 1064 VAL A CG1   1 
ATOM   8313  C  CG2   . VAL A 1  1064 ? 127.022 56.457  -12.440 1.00 72.36  ? 1064 VAL A CG2   1 
ATOM   8314  N  N     . GLY A 1  1065 ? 122.419 56.500  -13.094 1.00 70.31  ? 1065 GLY A N     1 
ATOM   8315  C  CA    . GLY A 1  1065 ? 121.091 57.046  -13.331 1.00 69.29  ? 1065 GLY A CA    1 
ATOM   8316  C  C     . GLY A 1  1065 ? 120.117 56.549  -12.299 1.00 71.69  ? 1065 GLY A C     1 
ATOM   8317  O  O     . GLY A 1  1065 ? 119.678 57.335  -11.460 1.00 69.95  ? 1065 GLY A O     1 
ATOM   8318  N  N     . VAL A 1  1066 ? 119.819 55.225  -12.318 1.00 69.44  ? 1066 VAL A N     1 
ATOM   8319  C  CA    . VAL A 1  1066 ? 118.895 54.575  -11.363 1.00 69.84  ? 1066 VAL A CA    1 
ATOM   8320  C  C     . VAL A 1  1066 ? 119.297 54.885  -9.935  1.00 76.27  ? 1066 VAL A C     1 
ATOM   8321  O  O     . VAL A 1  1066 ? 118.449 55.321  -9.140  1.00 76.70  ? 1066 VAL A O     1 
ATOM   8322  C  CB    . VAL A 1  1066 ? 118.728 53.053  -11.601 1.00 73.54  ? 1066 VAL A CB    1 
ATOM   8323  C  CG1   . VAL A 1  1066 ? 117.970 52.374  -10.454 1.00 72.66  ? 1066 VAL A CG1   1 
ATOM   8324  C  CG2   . VAL A 1  1066 ? 118.027 52.808  -12.922 1.00 74.04  ? 1066 VAL A CG2   1 
ATOM   8325  N  N     . LEU A 1  1067 ? 120.605 54.675  -9.629  1.00 72.90  ? 1067 LEU A N     1 
ATOM   8326  C  CA    . LEU A 1  1067 ? 121.234 54.925  -8.333  1.00 72.39  ? 1067 LEU A CA    1 
ATOM   8327  C  C     . LEU A 1  1067 ? 120.730 56.254  -7.760  1.00 76.82  ? 1067 LEU A C     1 
ATOM   8328  O  O     . LEU A 1  1067 ? 120.067 56.270  -6.722  1.00 76.68  ? 1067 LEU A O     1 
ATOM   8329  C  CB    . LEU A 1  1067 ? 122.752 55.021  -8.543  1.00 72.06  ? 1067 LEU A CB    1 
ATOM   8330  C  CG    . LEU A 1  1067 ? 123.663 54.543  -7.434  1.00 76.62  ? 1067 LEU A CG    1 
ATOM   8331  C  CD1   . LEU A 1  1067 ? 123.295 55.114  -6.066  1.00 75.75  ? 1067 LEU A CD1   1 
ATOM   8332  C  CD2   . LEU A 1  1067 ? 123.798 53.018  -7.455  1.00 82.40  ? 1067 LEU A CD2   1 
ATOM   8333  N  N     . ALA A 1  1068 ? 121.009 57.351  -8.489  1.00 72.96  ? 1068 ALA A N     1 
ATOM   8334  C  CA    . ALA A 1  1068 ? 120.643 58.702  -8.133  1.00 72.27  ? 1068 ALA A CA    1 
ATOM   8335  C  C     . ALA A 1  1068 ? 119.146 58.829  -7.827  1.00 75.84  ? 1068 ALA A C     1 
ATOM   8336  O  O     . ALA A 1  1068 ? 118.798 59.455  -6.832  1.00 76.63  ? 1068 ALA A O     1 
ATOM   8337  C  CB    . ALA A 1  1068 ? 121.074 59.661  -9.230  1.00 72.75  ? 1068 ALA A CB    1 
ATOM   8338  N  N     . ALA A 1  1069 ? 118.276 58.168  -8.610  1.00 70.78  ? 1069 ALA A N     1 
ATOM   8339  C  CA    . ALA A 1  1069 ? 116.823 58.236  -8.419  1.00 70.10  ? 1069 ALA A CA    1 
ATOM   8340  C  C     . ALA A 1  1069 ? 116.339 57.586  -7.132  1.00 71.91  ? 1069 ALA A C     1 
ATOM   8341  O  O     . ALA A 1  1069 ? 115.410 58.101  -6.502  1.00 71.04  ? 1069 ALA A O     1 
ATOM   8342  C  CB    . ALA A 1  1069 ? 116.110 57.634  -9.611  1.00 70.81  ? 1069 ALA A CB    1 
ATOM   8343  N  N     . GLN A 1  1070 ? 116.964 56.460  -6.753  1.00 67.60  ? 1070 GLN A N     1 
ATOM   8344  C  CA    . GLN A 1  1070 ? 116.640 55.716  -5.535  1.00 67.95  ? 1070 GLN A CA    1 
ATOM   8345  C  C     . GLN A 1  1070 ? 117.220 56.419  -4.302  1.00 72.60  ? 1070 GLN A C     1 
ATOM   8346  O  O     . GLN A 1  1070 ? 116.655 56.338  -3.212  1.00 71.42  ? 1070 GLN A O     1 
ATOM   8347  C  CB    . GLN A 1  1070 ? 117.230 54.309  -5.596  1.00 69.46  ? 1070 GLN A CB    1 
ATOM   8348  C  CG    . GLN A 1  1070 ? 116.833 53.468  -6.782  1.00 81.77  ? 1070 GLN A CG    1 
ATOM   8349  C  CD    . GLN A 1  1070 ? 117.453 52.116  -6.610  1.00 104.19 ? 1070 GLN A CD    1 
ATOM   8350  O  OE1   . GLN A 1  1070 ? 118.666 51.985  -6.357  1.00 98.87  ? 1070 GLN A OE1   1 
ATOM   8351  N  NE2   . GLN A 1  1070 ? 116.613 51.090  -6.669  1.00 98.63  ? 1070 GLN A NE2   1 
ATOM   8352  N  N     . SER A 1  1071 ? 118.380 57.068  -4.481  1.00 70.92  ? 1071 SER A N     1 
ATOM   8353  C  CA    . SER A 1  1071 ? 119.105 57.808  -3.453  1.00 71.78  ? 1071 SER A CA    1 
ATOM   8354  C  C     . SER A 1  1071 ? 118.335 59.030  -2.956  1.00 77.21  ? 1071 SER A C     1 
ATOM   8355  O  O     . SER A 1  1071 ? 118.567 59.440  -1.826  1.00 78.62  ? 1071 SER A O     1 
ATOM   8356  C  CB    . SER A 1  1071 ? 120.454 58.255  -3.992  1.00 75.53  ? 1071 SER A CB    1 
ATOM   8357  O  OG    . SER A 1  1071 ? 121.193 57.134  -4.444  1.00 87.61  ? 1071 SER A OG    1 
ATOM   8358  N  N     . ILE A 1  1072 ? 117.477 59.642  -3.817  1.00 72.32  ? 1072 ILE A N     1 
ATOM   8359  C  CA    . ILE A 1  1072 ? 116.619 60.794  -3.510  1.00 71.64  ? 1072 ILE A CA    1 
ATOM   8360  C  C     . ILE A 1  1072 ? 115.263 60.213  -3.120  1.00 78.80  ? 1072 ILE A C     1 
ATOM   8361  O  O     . ILE A 1  1072 ? 114.637 60.673  -2.168  1.00 78.59  ? 1072 ILE A O     1 
ATOM   8362  C  CB    . ILE A 1  1072 ? 116.496 61.759  -4.726  1.00 73.31  ? 1072 ILE A CB    1 
ATOM   8363  C  CG1   . ILE A 1  1072 ? 117.880 62.198  -5.250  1.00 73.15  ? 1072 ILE A CG1   1 
ATOM   8364  C  CG2   . ILE A 1  1072 ? 115.657 62.978  -4.370  1.00 73.41  ? 1072 ILE A CG2   1 
ATOM   8365  C  CD1   . ILE A 1  1072 ? 117.913 62.779  -6.672  1.00 76.03  ? 1072 ILE A CD1   1 
ATOM   8366  N  N     . GLY A 1  1073 ? 114.850 59.182  -3.858  1.00 78.48  ? 1073 GLY A N     1 
ATOM   8367  C  CA    . GLY A 1  1073 ? 113.589 58.466  -3.681  1.00 79.97  ? 1073 GLY A CA    1 
ATOM   8368  C  C     . GLY A 1  1073 ? 113.344 57.853  -2.318  1.00 86.76  ? 1073 GLY A C     1 
ATOM   8369  O  O     . GLY A 1  1073 ? 112.428 58.294  -1.618  1.00 86.73  ? 1073 GLY A O     1 
ATOM   8370  N  N     . GLU A 1  1074 ? 114.137 56.800  -1.954  1.00 85.25  ? 1074 GLU A N     1 
ATOM   8371  C  CA    . GLU A 1  1074 ? 114.072 56.070  -0.671  1.00 86.68  ? 1074 GLU A CA    1 
ATOM   8372  C  C     . GLU A 1  1074 ? 113.942 57.037  0.521   1.00 92.31  ? 1074 GLU A C     1 
ATOM   8373  O  O     . GLU A 1  1074 ? 112.924 56.927  1.222   1.00 92.23  ? 1074 GLU A O     1 
ATOM   8374  C  CB    . GLU A 1  1074 ? 115.252 55.072  -0.513  1.00 88.15  ? 1074 GLU A CB    1 
ATOM   8375  C  CG    . GLU A 1  1074 ? 115.342 54.307  0.807   1.00 100.07 ? 1074 GLU A CG    1 
ATOM   8376  C  CD    . GLU A 1  1074 ? 115.932 55.036  2.004   1.00 119.73 ? 1074 GLU A CD    1 
ATOM   8377  O  OE1   . GLU A 1  1074 ? 117.046 55.599  1.884   1.00 94.70  ? 1074 GLU A OE1   1 
ATOM   8378  O  OE2   . GLU A 1  1074 ? 115.285 55.014  3.077   1.00 120.85 ? 1074 GLU A OE2   1 
ATOM   8379  N  N     . PRO A 1  1075 ? 114.888 58.016  0.729   1.00 89.73  ? 1075 PRO A N     1 
ATOM   8380  C  CA    . PRO A 1  1075 ? 114.718 58.977  1.841   1.00 90.99  ? 1075 PRO A CA    1 
ATOM   8381  C  C     . PRO A 1  1075 ? 113.306 59.556  1.920   1.00 95.04  ? 1075 PRO A C     1 
ATOM   8382  O  O     . PRO A 1  1075 ? 112.649 59.332  2.939   1.00 95.92  ? 1075 PRO A O     1 
ATOM   8383  C  CB    . PRO A 1  1075 ? 115.758 60.078  1.559   1.00 92.41  ? 1075 PRO A CB    1 
ATOM   8384  C  CG    . PRO A 1  1075 ? 116.457 59.683  0.343   1.00 95.19  ? 1075 PRO A CG    1 
ATOM   8385  C  CD    . PRO A 1  1075 ? 116.148 58.277  0.002   1.00 90.18  ? 1075 PRO A CD    1 
ATOM   8386  N  N     . ALA A 1  1076 ? 112.824 60.215  0.822   1.00 89.58  ? 1076 ALA A N     1 
ATOM   8387  C  CA    . ALA A 1  1076 ? 111.490 60.799  0.687   1.00 89.29  ? 1076 ALA A CA    1 
ATOM   8388  C  C     . ALA A 1  1076 ? 110.386 59.823  1.108   1.00 97.12  ? 1076 ALA A C     1 
ATOM   8389  O  O     . ALA A 1  1076 ? 109.513 60.226  1.874   1.00 96.35  ? 1076 ALA A O     1 
ATOM   8390  C  CB    . ALA A 1  1076 ? 111.270 61.256  -0.740  1.00 88.60  ? 1076 ALA A CB    1 
ATOM   8391  N  N     . THR A 1  1077 ? 110.462 58.529  0.641   1.00 97.88  ? 1077 THR A N     1 
ATOM   8392  C  CA    . THR A 1  1077 ? 109.506 57.427  0.899   1.00 99.91  ? 1077 THR A CA    1 
ATOM   8393  C  C     . THR A 1  1077 ? 109.550 56.990  2.360   1.00 110.61 ? 1077 THR A C     1 
ATOM   8394  O  O     . THR A 1  1077 ? 108.538 56.546  2.895   1.00 110.63 ? 1077 THR A O     1 
ATOM   8395  C  CB    . THR A 1  1077 ? 109.679 56.253  -0.111  1.00 104.46 ? 1077 THR A CB    1 
ATOM   8396  O  OG1   . THR A 1  1077 ? 109.542 56.741  -1.450  1.00 103.38 ? 1077 THR A OG1   1 
ATOM   8397  C  CG2   . THR A 1  1077 ? 108.644 55.138  0.078   1.00 102.16 ? 1077 THR A CG2   1 
ATOM   8398  N  N     . GLN A 1  1078 ? 110.700 57.127  3.009   1.00 113.14 ? 1078 GLN A N     1 
ATOM   8399  C  CA    . GLN A 1  1078 ? 110.788 56.786  4.422   1.00 116.98 ? 1078 GLN A CA    1 
ATOM   8400  C  C     . GLN A 1  1078 ? 110.352 57.980  5.293   1.00 126.19 ? 1078 GLN A C     1 
ATOM   8401  O  O     . GLN A 1  1078 ? 109.603 57.769  6.255   1.00 126.14 ? 1078 GLN A O     1 
ATOM   8402  C  CB    . GLN A 1  1078 ? 112.183 56.263  4.791   1.00 118.66 ? 1078 GLN A CB    1 
ATOM   8403  C  CG    . GLN A 1  1078 ? 112.151 55.213  5.917   1.00 137.08 ? 1078 GLN A CG    1 
ATOM   8404  C  CD    . GLN A 1  1078 ? 111.549 53.875  5.532   1.00 144.77 ? 1078 GLN A CD    1 
ATOM   8405  O  OE1   . GLN A 1  1078 ? 111.601 53.450  4.376   1.00 136.41 ? 1078 GLN A OE1   1 
ATOM   8406  N  NE2   . GLN A 1  1078 ? 111.018 53.157  6.517   1.00 134.79 ? 1078 GLN A NE2   1 
ATOM   8407  N  N     . MET A 1  1079 ? 110.765 59.231  4.899   1.00 126.34 ? 1079 MET A N     1 
ATOM   8408  C  CA    . MET A 1  1079 ? 110.452 60.539  5.510   1.00 129.39 ? 1079 MET A CA    1 
ATOM   8409  C  C     . MET A 1  1079 ? 108.910 60.781  5.561   1.00 139.15 ? 1079 MET A C     1 
ATOM   8410  O  O     . MET A 1  1079 ? 108.477 61.843  6.033   1.00 141.12 ? 1079 MET A O     1 
ATOM   8411  C  CB    . MET A 1  1079 ? 111.276 61.701  4.829   1.00 131.28 ? 1079 MET A CB    1 
ATOM   8412  C  CG    . MET A 1  1079 ? 110.483 62.868  4.086   1.00 135.36 ? 1079 MET A CG    1 
ATOM   8413  S  SD    . MET A 1  1079 ? 111.500 64.005  3.019   1.00 138.44 ? 1079 MET A SD    1 
ATOM   8414  C  CE    . MET A 1  1079 ? 111.260 65.583  3.814   1.00 136.37 ? 1079 MET A CE    1 
ATOM   8415  N  N     . THR A 1  1080 ? 108.096 59.752  5.133   1.00 136.97 ? 1080 THR A N     1 
ATOM   8416  C  CA    . THR A 1  1080 ? 106.619 59.705  5.146   1.00 137.90 ? 1080 THR A CA    1 
ATOM   8417  C  C     . THR A 1  1080 ? 106.060 58.446  5.835   1.00 143.35 ? 1080 THR A C     1 
ATOM   8418  O  O     . THR A 1  1080 ? 105.134 58.587  6.640   1.00 144.87 ? 1080 THR A O     1 
ATOM   8419  C  CB    . THR A 1  1080 ? 105.976 59.907  3.739   1.00 143.53 ? 1080 THR A CB    1 
ATOM   8420  O  OG1   . THR A 1  1080 ? 104.562 59.692  3.816   1.00 143.60 ? 1080 THR A OG1   1 
ATOM   8421  C  CG2   . THR A 1  1080 ? 106.533 58.986  2.689   1.00 139.04 ? 1080 THR A CG2   1 
ATOM   8422  N  N     . LEU A 1  1081 ? 106.588 57.231  5.498   1.00 139.14 ? 1081 LEU A N     1 
ATOM   8423  C  CA    . LEU A 1  1081 ? 106.105 55.931  6.010   1.00 139.27 ? 1081 LEU A CA    1 
ATOM   8424  C  C     . LEU A 1  1081 ? 106.057 55.837  7.538   1.00 147.49 ? 1081 LEU A C     1 
ATOM   8425  O  O     . LEU A 1  1081 ? 105.084 55.308  8.075   1.00 147.91 ? 1081 LEU A O     1 
ATOM   8426  C  CB    . LEU A 1  1081 ? 106.881 54.733  5.415   1.00 137.18 ? 1081 LEU A CB    1 
ATOM   8427  C  CG    . LEU A 1  1081 ? 106.260 54.093  4.169   1.00 138.60 ? 1081 LEU A CG    1 
ATOM   8428  C  CD1   . LEU A 1  1081 ? 107.294 53.383  3.351   1.00 136.45 ? 1081 LEU A CD1   1 
ATOM   8429  C  CD2   . LEU A 1  1081 ? 105.125 53.155  4.527   1.00 140.33 ? 1081 LEU A CD2   1 
ATOM   8430  N  N     . ASN A 1  1082 ? 107.071 56.393  8.228   1.00 146.53 ? 1082 ASN A N     1 
ATOM   8431  C  CA    . ASN A 1  1082 ? 107.174 56.394  9.693   1.00 148.91 ? 1082 ASN A CA    1 
ATOM   8432  C  C     . ASN A 1  1082 ? 106.273 57.497  10.349  1.00 155.22 ? 1082 ASN A C     1 
ATOM   8433  O  O     . ASN A 1  1082 ? 106.350 58.670  9.955   1.00 154.89 ? 1082 ASN A O     1 
ATOM   8434  C  CB    . ASN A 1  1082 ? 108.659 56.542  10.135  1.00 149.32 ? 1082 ASN A CB    1 
ATOM   8435  C  CG    . ASN A 1  1082 ? 109.704 55.732  9.368   1.00 163.90 ? 1082 ASN A CG    1 
ATOM   8436  O  OD1   . ASN A 1  1082 ? 109.407 54.933  8.465   1.00 157.60 ? 1082 ASN A OD1   1 
ATOM   8437  N  ND2   . ASN A 1  1082 ? 110.972 55.937  9.713   1.00 151.53 ? 1082 ASN A ND2   1 
ATOM   8438  N  N     . THR A 1  1083 ? 105.420 57.105  11.339  1.00 153.00 ? 1083 THR A N     1 
ATOM   8439  C  CA    . THR A 1  1083 ? 104.522 58.012  12.079  1.00 160.27 ? 1083 THR A CA    1 
ATOM   8440  C  C     . THR A 1  1083 ? 105.315 58.948  13.019  1.00 190.06 ? 1083 THR A C     1 
ATOM   8441  O  O     . THR A 1  1083 ? 106.435 58.644  13.436  1.00 149.68 ? 1083 THR A O     1 
ATOM   8442  C  CB    . THR A 1  1083 ? 103.402 57.218  12.798  1.00 163.79 ? 1083 THR A CB    1 
ATOM   8443  O  OG1   . THR A 1  1083 ? 102.597 56.552  11.825  1.00 158.82 ? 1083 THR A OG1   1 
ATOM   8444  C  CG2   . THR A 1  1083 ? 102.505 58.100  13.669  1.00 162.73 ? 1083 THR A CG2   1 
ATOM   8445  N  N     . VAL A 1  1094 ? 106.220 78.399  5.119   1.00 139.19 ? 1094 VAL A N     1 
ATOM   8446  C  CA    . VAL A 1  1094 ? 107.007 78.061  3.921   1.00 137.41 ? 1094 VAL A CA    1 
ATOM   8447  C  C     . VAL A 1  1094 ? 106.900 76.577  3.547   1.00 141.88 ? 1094 VAL A C     1 
ATOM   8448  O  O     . VAL A 1  1094 ? 107.245 75.717  4.362   1.00 141.85 ? 1094 VAL A O     1 
ATOM   8449  C  CB    . VAL A 1  1094 ? 108.493 78.513  3.977   1.00 140.43 ? 1094 VAL A CB    1 
ATOM   8450  C  CG1   . VAL A 1  1094 ? 109.231 78.171  2.675   1.00 137.53 ? 1094 VAL A CG1   1 
ATOM   8451  C  CG2   . VAL A 1  1094 ? 108.603 80.004  4.288   1.00 142.75 ? 1094 VAL A CG2   1 
ATOM   8452  N  N     . THR A 1  1095 ? 106.475 76.290  2.290   1.00 137.52 ? 1095 THR A N     1 
ATOM   8453  C  CA    . THR A 1  1095 ? 106.335 74.934  1.752   1.00 134.85 ? 1095 THR A CA    1 
ATOM   8454  C  C     . THR A 1  1095 ? 107.647 74.198  1.814   1.00 136.76 ? 1095 THR A C     1 
ATOM   8455  O  O     . THR A 1  1095 ? 108.691 74.779  1.499   1.00 136.54 ? 1095 THR A O     1 
ATOM   8456  C  CB    . THR A 1  1095 ? 105.694 74.922  0.362   1.00 138.66 ? 1095 THR A CB    1 
ATOM   8457  O  OG1   . THR A 1  1095 ? 106.265 75.938  -0.475  1.00 134.63 ? 1095 THR A OG1   1 
ATOM   8458  C  CG2   . THR A 1  1095 ? 104.193 75.056  0.436   1.00 139.06 ? 1095 THR A CG2   1 
ATOM   8459  N  N     . SER A 1  1096 ? 107.596 72.948  2.308   1.00 131.60 ? 1096 SER A N     1 
ATOM   8460  C  CA    . SER A 1  1096 ? 108.754 72.069  2.509   1.00 129.53 ? 1096 SER A CA    1 
ATOM   8461  C  C     . SER A 1  1096 ? 108.328 70.596  2.593   1.00 128.23 ? 1096 SER A C     1 
ATOM   8462  O  O     . SER A 1  1096 ? 107.161 70.308  2.882   1.00 128.58 ? 1096 SER A O     1 
ATOM   8463  C  CB    . SER A 1  1096 ? 109.528 72.478  3.762   1.00 136.25 ? 1096 SER A CB    1 
ATOM   8464  O  OG    . SER A 1  1096 ? 108.636 72.846  4.805   1.00 151.71 ? 1096 SER A OG    1 
ATOM   8465  N  N     . GLY A 1  1097 ? 109.288 69.697  2.357   1.00 119.48 ? 1097 GLY A N     1 
ATOM   8466  C  CA    . GLY A 1  1097 ? 109.080 68.253  2.345   1.00 116.50 ? 1097 GLY A CA    1 
ATOM   8467  C  C     . GLY A 1  1097 ? 108.462 67.781  1.043   1.00 115.19 ? 1097 GLY A C     1 
ATOM   8468  O  O     . GLY A 1  1097 ? 108.597 68.458  0.017   1.00 114.21 ? 1097 GLY A O     1 
ATOM   8469  N  N     . VAL A 1  1098 ? 107.757 66.624  1.087   1.00 108.51 ? 1098 VAL A N     1 
ATOM   8470  C  CA    . VAL A 1  1098 ? 107.028 65.993  -0.028  1.00 106.18 ? 1098 VAL A CA    1 
ATOM   8471  C  C     . VAL A 1  1098 ? 106.275 67.029  -0.913  1.00 107.59 ? 1098 VAL A C     1 
ATOM   8472  O  O     . VAL A 1  1098 ? 106.531 67.025  -2.123  1.00 106.70 ? 1098 VAL A O     1 
ATOM   8473  C  CB    . VAL A 1  1098 ? 106.113 64.863  0.498   1.00 110.53 ? 1098 VAL A CB    1 
ATOM   8474  C  CG1   . VAL A 1  1098 ? 104.901 64.625  -0.404  1.00 110.06 ? 1098 VAL A CG1   1 
ATOM   8475  C  CG2   . VAL A 1  1098 ? 106.910 63.581  0.713   1.00 109.69 ? 1098 VAL A CG2   1 
ATOM   8476  N  N     . PRO A 1  1099 ? 105.430 67.959  -0.366  1.00 102.60 ? 1099 PRO A N     1 
ATOM   8477  C  CA    . PRO A 1  1099 ? 104.787 68.966  -1.230  1.00 101.70 ? 1099 PRO A CA    1 
ATOM   8478  C  C     . PRO A 1  1099 ? 105.745 69.869  -2.009  1.00 99.95  ? 1099 PRO A C     1 
ATOM   8479  O  O     . PRO A 1  1099 ? 105.477 70.102  -3.188  1.00 98.95  ? 1099 PRO A O     1 
ATOM   8480  C  CB    . PRO A 1  1099 ? 103.947 69.789  -0.251  1.00 105.83 ? 1099 PRO A CB    1 
ATOM   8481  C  CG    . PRO A 1  1099 ? 104.572 69.565  1.071   1.00 111.08 ? 1099 PRO A CG    1 
ATOM   8482  C  CD    . PRO A 1  1099 ? 104.989 68.136  1.033   1.00 105.32 ? 1099 PRO A CD    1 
ATOM   8483  N  N     . ARG A 1  1100 ? 106.832 70.392  -1.373  1.00 92.88  ? 1100 ARG A N     1 
ATOM   8484  C  CA    . ARG A 1  1100 ? 107.776 71.237  -2.108  1.00 90.76  ? 1100 ARG A CA    1 
ATOM   8485  C  C     . ARG A 1  1100 ? 108.556 70.393  -3.073  1.00 91.25  ? 1100 ARG A C     1 
ATOM   8486  O  O     . ARG A 1  1100 ? 108.800 70.856  -4.177  1.00 91.36  ? 1100 ARG A O     1 
ATOM   8487  C  CB    . ARG A 1  1100 ? 108.700 72.100  -1.227  1.00 89.45  ? 1100 ARG A CB    1 
ATOM   8488  C  CG    . ARG A 1  1100 ? 109.891 72.712  -2.006  1.00 95.88  ? 1100 ARG A CG    1 
ATOM   8489  C  CD    . ARG A 1  1100 ? 110.116 74.197  -1.806  1.00 107.40 ? 1100 ARG A CD    1 
ATOM   8490  N  NE    . ARG A 1  1100 ? 110.806 74.834  -2.936  1.00 108.50 ? 1100 ARG A NE    1 
ATOM   8491  C  CZ    . ARG A 1  1100 ? 110.188 75.363  -3.991  1.00 118.61 ? 1100 ARG A CZ    1 
ATOM   8492  N  NH1   . ARG A 1  1100 ? 108.865 75.300  -4.097  1.00 108.85 ? 1100 ARG A NH1   1 
ATOM   8493  N  NH2   . ARG A 1  1100 ? 110.887 75.940  -4.957  1.00 97.00  ? 1100 ARG A NH2   1 
ATOM   8494  N  N     . LEU A 1  1101 ? 108.919 69.155  -2.701  1.00 85.01  ? 1101 LEU A N     1 
ATOM   8495  C  CA    . LEU A 1  1101 ? 109.645 68.281  -3.628  1.00 82.82  ? 1101 LEU A CA    1 
ATOM   8496  C  C     . LEU A 1  1101 ? 108.793 68.056  -4.878  1.00 87.95  ? 1101 LEU A C     1 
ATOM   8497  O  O     . LEU A 1  1101 ? 109.331 68.119  -5.993  1.00 87.32  ? 1101 LEU A O     1 
ATOM   8498  C  CB    . LEU A 1  1101 ? 110.045 66.956  -2.969  1.00 81.36  ? 1101 LEU A CB    1 
ATOM   8499  C  CG    . LEU A 1  1101 ? 110.641 65.881  -3.863  1.00 82.72  ? 1101 LEU A CG    1 
ATOM   8500  C  CD1   . LEU A 1  1101 ? 112.084 66.156  -4.184  1.00 81.52  ? 1101 LEU A CD1   1 
ATOM   8501  C  CD2   . LEU A 1  1101 ? 110.512 64.566  -3.217  1.00 84.20  ? 1101 LEU A CD2   1 
ATOM   8502  N  N     . LYS A 1  1102 ? 107.457 67.876  -4.689  1.00 85.49  ? 1102 LYS A N     1 
ATOM   8503  C  CA    . LYS A 1  1102 ? 106.498 67.736  -5.784  1.00 85.71  ? 1102 LYS A CA    1 
ATOM   8504  C  C     . LYS A 1  1102 ? 106.569 69.018  -6.668  1.00 91.23  ? 1102 LYS A C     1 
ATOM   8505  O  O     . LYS A 1  1102 ? 106.849 68.904  -7.866  1.00 90.68  ? 1102 LYS A O     1 
ATOM   8506  C  CB    . LYS A 1  1102 ? 105.083 67.460  -5.245  1.00 89.15  ? 1102 LYS A CB    1 
ATOM   8507  C  CG    . LYS A 1  1102 ? 104.413 66.257  -5.891  1.00 107.68 ? 1102 LYS A CG    1 
ATOM   8508  C  CD    . LYS A 1  1102 ? 102.886 66.314  -5.828  1.00 126.22 ? 1102 LYS A CD    1 
ATOM   8509  C  CE    . LYS A 1  1102 ? 102.259 65.339  -6.807  1.00 144.75 ? 1102 LYS A CE    1 
ATOM   8510  N  NZ    . LYS A 1  1102 ? 100.776 65.457  -6.850  1.00 157.33 ? 1102 LYS A NZ    1 
ATOM   8511  N  N     . GLU A 1  1103 ? 106.453 70.227  -6.041  1.00 88.64  ? 1103 GLU A N     1 
ATOM   8512  C  CA    . GLU A 1  1103 ? 106.587 71.558  -6.669  1.00 89.14  ? 1103 GLU A CA    1 
ATOM   8513  C  C     . GLU A 1  1103 ? 107.800 71.540  -7.627  1.00 91.05  ? 1103 GLU A C     1 
ATOM   8514  O  O     . GLU A 1  1103 ? 107.621 71.732  -8.833  1.00 90.75  ? 1103 GLU A O     1 
ATOM   8515  C  CB    . GLU A 1  1103 ? 106.819 72.646  -5.568  1.00 91.93  ? 1103 GLU A CB    1 
ATOM   8516  C  CG    . GLU A 1  1103 ? 105.875 73.844  -5.534  1.00 104.89 ? 1103 GLU A CG    1 
ATOM   8517  C  CD    . GLU A 1  1103 ? 105.451 74.323  -4.149  1.00 125.56 ? 1103 GLU A CD    1 
ATOM   8518  O  OE1   . GLU A 1  1103 ? 104.638 73.622  -3.505  1.00 120.99 ? 1103 GLU A OE1   1 
ATOM   8519  O  OE2   . GLU A 1  1103 ? 105.901 75.412  -3.721  1.00 116.07 ? 1103 GLU A OE2   1 
ATOM   8520  N  N     . ILE A 1  1104 ? 109.019 71.221  -7.074  1.00 85.58  ? 1104 ILE A N     1 
ATOM   8521  C  CA    . ILE A 1  1104 ? 110.332 71.193  -7.748  1.00 83.34  ? 1104 ILE A CA    1 
ATOM   8522  C  C     . ILE A 1  1104 ? 110.338 70.247  -8.939  1.00 87.98  ? 1104 ILE A C     1 
ATOM   8523  O  O     . ILE A 1  1104 ? 110.588 70.690  -10.061 1.00 88.02  ? 1104 ILE A O     1 
ATOM   8524  C  CB    . ILE A 1  1104 ? 111.563 70.926  -6.805  1.00 84.16  ? 1104 ILE A CB    1 
ATOM   8525  C  CG1   . ILE A 1  1104 ? 111.561 71.773  -5.532  1.00 84.04  ? 1104 ILE A CG1   1 
ATOM   8526  C  CG2   . ILE A 1  1104 ? 112.862 71.153  -7.555  1.00 84.16  ? 1104 ILE A CG2   1 
ATOM   8527  C  CD1   . ILE A 1  1104 ? 112.356 71.173  -4.413  1.00 82.63  ? 1104 ILE A CD1   1 
ATOM   8528  N  N     . LEU A 1  1105 ? 110.086 68.955  -8.697  1.00 84.80  ? 1105 LEU A N     1 
ATOM   8529  C  CA    . LEU A 1  1105 ? 110.108 67.953  -9.759  1.00 84.71  ? 1105 LEU A CA    1 
ATOM   8530  C  C     . LEU A 1  1105 ? 109.116 68.257  -10.870 1.00 91.23  ? 1105 LEU A C     1 
ATOM   8531  O  O     . LEU A 1  1105 ? 109.437 68.044  -12.039 1.00 91.53  ? 1105 LEU A O     1 
ATOM   8532  C  CB    . LEU A 1  1105 ? 109.934 66.525  -9.216  1.00 83.77  ? 1105 LEU A CB    1 
ATOM   8533  C  CG    . LEU A 1  1105 ? 111.061 66.036  -8.305  1.00 87.07  ? 1105 LEU A CG    1 
ATOM   8534  C  CD1   . LEU A 1  1105 ? 110.629 64.832  -7.512  1.00 86.61  ? 1105 LEU A CD1   1 
ATOM   8535  C  CD2   . LEU A 1  1105 ? 112.315 65.746  -9.091  1.00 87.66  ? 1105 LEU A CD2   1 
ATOM   8536  N  N     . ASN A 1  1106 ? 107.960 68.834  -10.524 1.00 88.60  ? 1106 ASN A N     1 
ATOM   8537  C  CA    . ASN A 1  1106 ? 106.964 69.184  -11.527 1.00 89.23  ? 1106 ASN A CA    1 
ATOM   8538  C  C     . ASN A 1  1106 ? 107.265 70.501  -12.202 1.00 93.69  ? 1106 ASN A C     1 
ATOM   8539  O  O     . ASN A 1  1106 ? 106.546 70.851  -13.146 1.00 94.43  ? 1106 ASN A O     1 
ATOM   8540  C  CB    . ASN A 1  1106 ? 105.563 69.226  -10.912 1.00 92.28  ? 1106 ASN A CB    1 
ATOM   8541  C  CG    . ASN A 1  1106 ? 105.113 67.899  -10.377 1.00 123.92 ? 1106 ASN A CG    1 
ATOM   8542  O  OD1   . ASN A 1  1106 ? 105.213 66.867  -11.039 1.00 118.41 ? 1106 ASN A OD1   1 
ATOM   8543  N  ND2   . ASN A 1  1106 ? 104.593 67.901  -9.166  1.00 120.29 ? 1106 ASN A ND2   1 
ATOM   8544  N  N     . VAL A 1  1107 ? 108.313 71.245  -11.727 1.00 89.81  ? 1107 VAL A N     1 
ATOM   8545  C  CA    . VAL A 1  1107 ? 108.668 72.609  -12.186 1.00 90.57  ? 1107 VAL A CA    1 
ATOM   8546  C  C     . VAL A 1  1107 ? 107.324 73.342  -12.239 1.00 98.14  ? 1107 VAL A C     1 
ATOM   8547  O  O     . VAL A 1  1107 ? 106.827 73.716  -13.314 1.00 98.22  ? 1107 VAL A O     1 
ATOM   8548  C  CB    . VAL A 1  1107 ? 109.511 72.709  -13.496 1.00 92.94  ? 1107 VAL A CB    1 
ATOM   8549  C  CG1   . VAL A 1  1107 ? 109.861 74.152  -13.817 1.00 93.66  ? 1107 VAL A CG1   1 
ATOM   8550  C  CG2   . VAL A 1  1107 ? 110.785 71.891  -13.392 1.00 91.21  ? 1107 VAL A CG2   1 
ATOM   8551  N  N     . ALA A 1  1108 ? 106.660 73.347  -11.063 1.00 96.67  ? 1108 ALA A N     1 
ATOM   8552  C  CA    . ALA A 1  1108 ? 105.343 73.915  -10.861 1.00 98.71  ? 1108 ALA A CA    1 
ATOM   8553  C  C     . ALA A 1  1108 ? 105.461 75.388  -11.059 1.00 106.80 ? 1108 ALA A C     1 
ATOM   8554  O  O     . ALA A 1  1108 ? 106.422 75.989  -10.546 1.00 106.82 ? 1108 ALA A O     1 
ATOM   8555  C  CB    . ALA A 1  1108 ? 104.855 73.609  -9.459  1.00 99.49  ? 1108 ALA A CB    1 
ATOM   8556  N  N     . LYS A 1  1109 ? 104.558 75.976  -11.870 1.00 106.05 ? 1109 LYS A N     1 
ATOM   8557  C  CA    . LYS A 1  1109 ? 104.694 77.404  -12.058 1.00 108.36 ? 1109 LYS A CA    1 
ATOM   8558  C  C     . LYS A 1  1109 ? 104.182 78.121  -10.824 1.00 114.23 ? 1109 LYS A C     1 
ATOM   8559  O  O     . LYS A 1  1109 ? 105.005 78.651  -10.060 1.00 114.07 ? 1109 LYS A O     1 
ATOM   8560  C  CB    . LYS A 1  1109 ? 104.124 77.944  -13.387 1.00 112.57 ? 1109 LYS A CB    1 
ATOM   8561  C  CG    . LYS A 1  1109 ? 104.443 79.463  -13.619 1.00 137.70 ? 1109 LYS A CG    1 
ATOM   8562  C  CD    . LYS A 1  1109 ? 105.953 79.920  -13.371 1.00 143.68 ? 1109 LYS A CD    1 
ATOM   8563  C  CE    . LYS A 1  1109 ? 106.144 81.385  -12.987 1.00 139.62 ? 1109 LYS A CE    1 
ATOM   8564  N  NZ    . LYS A 1  1109 ? 107.055 81.557  -11.815 1.00 132.92 ? 1109 LYS A NZ    1 
ATOM   8565  N  N     . ASN A 1  1110 ? 102.863 78.072  -10.578 1.00 111.87 ? 1110 ASN A N     1 
ATOM   8566  C  CA    . ASN A 1  1110 ? 102.344 78.738  -9.402  1.00 113.45 ? 1110 ASN A CA    1 
ATOM   8567  C  C     . ASN A 1  1110 ? 102.600 77.912  -8.151  1.00 115.61 ? 1110 ASN A C     1 
ATOM   8568  O  O     . ASN A 1  1110 ? 101.862 76.966  -7.846  1.00 115.42 ? 1110 ASN A O     1 
ATOM   8569  C  CB    . ASN A 1  1110 ? 100.907 79.179  -9.579  1.00 119.03 ? 1110 ASN A CB    1 
ATOM   8570  C  CG    . ASN A 1  1110 ? 100.879 80.516  -10.286 1.00 164.85 ? 1110 ASN A CG    1 
ATOM   8571  O  OD1   . ASN A 1  1110 ? 101.229 81.565  -9.715  1.00 164.75 ? 1110 ASN A OD1   1 
ATOM   8572  N  ND2   . ASN A 1  1110 ? 100.598 80.491  -11.582 1.00 161.44 ? 1110 ASN A ND2   1 
ATOM   8573  N  N     . MET A 1  1111 ? 103.740 78.250  -7.490  1.00 110.28 ? 1111 MET A N     1 
ATOM   8574  C  CA    . MET A 1  1111 ? 104.274 77.658  -6.261  1.00 108.90 ? 1111 MET A CA    1 
ATOM   8575  C  C     . MET A 1  1111 ? 103.645 78.275  -5.043  1.00 113.74 ? 1111 MET A C     1 
ATOM   8576  O  O     . MET A 1  1111 ? 103.220 79.421  -5.115  1.00 115.36 ? 1111 MET A O     1 
ATOM   8577  C  CB    . MET A 1  1111 ? 105.808 77.717  -6.213  1.00 110.50 ? 1111 MET A CB    1 
ATOM   8578  C  CG    . MET A 1  1111 ? 106.427 79.108  -6.300  1.00 115.58 ? 1111 MET A CG    1 
ATOM   8579  S  SD    . MET A 1  1111 ? 108.190 79.021  -5.893  1.00 118.43 ? 1111 MET A SD    1 
ATOM   8580  C  CE    . MET A 1  1111 ? 108.102 78.726  -4.119  1.00 115.28 ? 1111 MET A CE    1 
ATOM   8581  N  N     . LYS A 1  1112 ? 103.556 77.531  -3.937  1.00 110.54 ? 1112 LYS A N     1 
ATOM   8582  C  CA    . LYS A 1  1112 ? 102.813 78.005  -2.776  1.00 113.07 ? 1112 LYS A CA    1 
ATOM   8583  C  C     . LYS A 1  1112 ? 103.485 79.107  -1.954  1.00 120.24 ? 1112 LYS A C     1 
ATOM   8584  O  O     . LYS A 1  1112 ? 102.773 80.030  -1.541  1.00 123.57 ? 1112 LYS A O     1 
ATOM   8585  C  CB    . LYS A 1  1112 ? 102.372 76.857  -1.864  1.00 114.79 ? 1112 LYS A CB    1 
ATOM   8586  C  CG    . LYS A 1  1112 ? 101.058 76.199  -2.301  1.00 126.46 ? 1112 LYS A CG    1 
ATOM   8587  C  CD    . LYS A 1  1112 ? 101.022 74.698  -1.960  1.00 135.88 ? 1112 LYS A CD    1 
ATOM   8588  C  CE    . LYS A 1  1112 ? 101.432 73.803  -3.117  1.00 141.97 ? 1112 LYS A CE    1 
ATOM   8589  N  NZ    . LYS A 1  1112 ? 102.155 72.572  -2.669  1.00 142.01 ? 1112 LYS A NZ    1 
ATOM   8590  N  N     . THR A 1  1113 ? 104.797 79.061  -1.705  1.00 114.92 ? 1113 THR A N     1 
ATOM   8591  C  CA    . THR A 1  1113 ? 105.363 80.131  -0.870  1.00 116.13 ? 1113 THR A CA    1 
ATOM   8592  C  C     . THR A 1  1113 ? 106.444 80.961  -1.571  1.00 119.14 ? 1113 THR A C     1 
ATOM   8593  O  O     . THR A 1  1113 ? 107.579 80.951  -1.102  1.00 119.56 ? 1113 THR A O     1 
ATOM   8594  C  CB    . THR A 1  1113 ? 105.862 79.556  0.467   1.00 127.23 ? 1113 THR A CB    1 
ATOM   8595  O  OG1   . THR A 1  1113 ? 106.806 78.493  0.226   1.00 128.26 ? 1113 THR A OG1   1 
ATOM   8596  C  CG2   . THR A 1  1113 ? 104.720 79.114  1.379   1.00 126.52 ? 1113 THR A CG2   1 
ATOM   8597  N  N     . PRO A 1  1114 ? 106.174 81.713  -2.658  1.00 114.34 ? 1114 PRO A N     1 
ATOM   8598  C  CA    . PRO A 1  1114 ? 107.268 82.452  -3.294  1.00 113.50 ? 1114 PRO A CA    1 
ATOM   8599  C  C     . PRO A 1  1114 ? 107.846 83.481  -2.352  1.00 117.77 ? 1114 PRO A C     1 
ATOM   8600  O  O     . PRO A 1  1114 ? 107.096 84.236  -1.734  1.00 119.80 ? 1114 PRO A O     1 
ATOM   8601  C  CB    . PRO A 1  1114 ? 106.613 83.086  -4.519  1.00 116.32 ? 1114 PRO A CB    1 
ATOM   8602  C  CG    . PRO A 1  1114 ? 105.395 82.287  -4.756  1.00 120.87 ? 1114 PRO A CG    1 
ATOM   8603  C  CD    . PRO A 1  1114 ? 104.916 81.905  -3.397  1.00 116.88 ? 1114 PRO A CD    1 
ATOM   8604  N  N     . SER A 1  1115 ? 109.168 83.416  -2.166  1.00 112.36 ? 1115 SER A N     1 
ATOM   8605  C  CA    . SER A 1  1115 ? 109.934 84.313  -1.308  1.00 113.60 ? 1115 SER A CA    1 
ATOM   8606  C  C     . SER A 1  1115 ? 111.166 84.801  -2.029  1.00 115.23 ? 1115 SER A C     1 
ATOM   8607  O  O     . SER A 1  1115 ? 111.608 84.195  -3.000  1.00 113.16 ? 1115 SER A O     1 
ATOM   8608  C  CB    . SER A 1  1115 ? 110.326 83.632  -0.002  1.00 118.69 ? 1115 SER A CB    1 
ATOM   8609  O  OG    . SER A 1  1115 ? 111.145 84.485  0.788   1.00 133.47 ? 1115 SER A OG    1 
ATOM   8610  N  N     . LEU A 1  1116 ? 111.743 85.878  -1.534  1.00 112.48 ? 1116 LEU A N     1 
ATOM   8611  C  CA    . LEU A 1  1116 ? 112.873 86.494  -2.179  1.00 111.75 ? 1116 LEU A CA    1 
ATOM   8612  C  C     . LEU A 1  1116 ? 113.795 87.124  -1.115  1.00 115.00 ? 1116 LEU A C     1 
ATOM   8613  O  O     . LEU A 1  1116 ? 113.519 88.199  -0.601  1.00 117.49 ? 1116 LEU A O     1 
ATOM   8614  C  CB    . LEU A 1  1116 ? 112.252 87.499  -3.187  1.00 113.51 ? 1116 LEU A CB    1 
ATOM   8615  C  CG    . LEU A 1  1116 ? 113.068 88.489  -3.977  1.00 119.18 ? 1116 LEU A CG    1 
ATOM   8616  C  CD1   . LEU A 1  1116 ? 114.000 87.795  -4.938  1.00 117.30 ? 1116 LEU A CD1   1 
ATOM   8617  C  CD2   . LEU A 1  1116 ? 112.134 89.388  -4.761  1.00 123.33 ? 1116 LEU A CD2   1 
ATOM   8618  N  N     . THR A 1  1117 ? 114.855 86.400  -0.744  1.00 108.02 ? 1117 THR A N     1 
ATOM   8619  C  CA    . THR A 1  1117 ? 115.869 86.808  0.239   1.00 107.64 ? 1117 THR A CA    1 
ATOM   8620  C  C     . THR A 1  1117 ? 116.735 87.960  -0.358  1.00 110.41 ? 1117 THR A C     1 
ATOM   8621  O  O     . THR A 1  1117 ? 117.432 87.750  -1.349  1.00 107.21 ? 1117 THR A O     1 
ATOM   8622  C  CB    . THR A 1  1117 ? 116.615 85.536  0.702   1.00 112.94 ? 1117 THR A CB    1 
ATOM   8623  O  OG1   . THR A 1  1117 ? 115.651 84.613  1.221   1.00 113.69 ? 1117 THR A OG1   1 
ATOM   8624  C  CG2   . THR A 1  1117 ? 117.675 85.801  1.740   1.00 110.43 ? 1117 THR A CG2   1 
ATOM   8625  N  N     . VAL A 1  1118 ? 116.630 89.184  0.216   1.00 110.26 ? 1118 VAL A N     1 
ATOM   8626  C  CA    . VAL A 1  1118 ? 117.308 90.398  -0.282  1.00 111.99 ? 1118 VAL A CA    1 
ATOM   8627  C  C     . VAL A 1  1118 ? 118.399 90.924  0.677   1.00 117.92 ? 1118 VAL A C     1 
ATOM   8628  O  O     . VAL A 1  1118 ? 118.105 91.451  1.755   1.00 118.61 ? 1118 VAL A O     1 
ATOM   8629  C  CB    . VAL A 1  1118 ? 116.337 91.542  -0.728  1.00 118.17 ? 1118 VAL A CB    1 
ATOM   8630  C  CG1   . VAL A 1  1118 ? 115.574 91.156  -1.991  1.00 117.10 ? 1118 VAL A CG1   1 
ATOM   8631  C  CG2   . VAL A 1  1118 ? 115.365 91.960  0.373   1.00 119.93 ? 1118 VAL A CG2   1 
ATOM   8632  N  N     . TYR A 1  1119 ? 119.666 90.790  0.234   1.00 114.99 ? 1119 TYR A N     1 
ATOM   8633  C  CA    . TYR A 1  1119 ? 120.867 91.187  0.966   1.00 116.06 ? 1119 TYR A CA    1 
ATOM   8634  C  C     . TYR A 1  1119 ? 121.193 92.609  0.688   1.00 124.66 ? 1119 TYR A C     1 
ATOM   8635  O  O     . TYR A 1  1119 ? 120.976 93.077  -0.430  1.00 124.72 ? 1119 TYR A O     1 
ATOM   8636  C  CB    . TYR A 1  1119 ? 122.046 90.291  0.590   1.00 114.70 ? 1119 TYR A CB    1 
ATOM   8637  C  CG    . TYR A 1  1119 ? 121.817 88.838  0.943   1.00 113.97 ? 1119 TYR A CG    1 
ATOM   8638  C  CD1   . TYR A 1  1119 ? 122.042 88.371  2.233   1.00 115.01 ? 1119 TYR A CD1   1 
ATOM   8639  C  CD2   . TYR A 1  1119 ? 121.335 87.938  0.000   1.00 113.79 ? 1119 TYR A CD2   1 
ATOM   8640  C  CE1   . TYR A 1  1119 ? 121.828 87.035  2.568   1.00 114.31 ? 1119 TYR A CE1   1 
ATOM   8641  C  CE2   . TYR A 1  1119 ? 121.123 86.598  0.320   1.00 113.73 ? 1119 TYR A CE2   1 
ATOM   8642  C  CZ    . TYR A 1  1119 ? 121.369 86.148  1.608   1.00 121.80 ? 1119 TYR A CZ    1 
ATOM   8643  O  OH    . TYR A 1  1119 ? 121.157 84.825  1.941   1.00 122.08 ? 1119 TYR A OH    1 
ATOM   8644  N  N     . LEU A 1  1120 ? 121.711 93.305  1.708   1.00 125.36 ? 1120 LEU A N     1 
ATOM   8645  C  CA    . LEU A 1  1120 ? 122.052 94.734  1.654   1.00 129.04 ? 1120 LEU A CA    1 
ATOM   8646  C  C     . LEU A 1  1120 ? 123.437 95.011  1.074   1.00 136.08 ? 1120 LEU A C     1 
ATOM   8647  O  O     . LEU A 1  1120 ? 124.295 94.125  1.102   1.00 134.75 ? 1120 LEU A O     1 
ATOM   8648  C  CB    . LEU A 1  1120 ? 121.963 95.318  3.069   1.00 131.06 ? 1120 LEU A CB    1 
ATOM   8649  C  CG    . LEU A 1  1120 ? 120.784 96.226  3.378   1.00 137.86 ? 1120 LEU A CG    1 
ATOM   8650  C  CD1   . LEU A 1  1120 ? 119.462 95.499  3.243   1.00 136.95 ? 1120 LEU A CD1   1 
ATOM   8651  C  CD2   . LEU A 1  1120 ? 120.889 96.731  4.783   1.00 142.26 ? 1120 LEU A CD2   1 
ATOM   8652  N  N     . GLU A 1  1121 ? 123.659 96.256  0.576   1.00 135.92 ? 1121 GLU A N     1 
ATOM   8653  C  CA    . GLU A 1  1121 ? 124.924 96.747  0.003   1.00 136.46 ? 1121 GLU A CA    1 
ATOM   8654  C  C     . GLU A 1  1121 ? 126.076 96.469  0.965   1.00 141.01 ? 1121 GLU A C     1 
ATOM   8655  O  O     . GLU A 1  1121 ? 125.906 96.684  2.167   1.00 142.09 ? 1121 GLU A O     1 
ATOM   8656  C  CB    . GLU A 1  1121 ? 124.833 98.253  -0.240  1.00 141.31 ? 1121 GLU A CB    1 
ATOM   8657  C  CG    . GLU A 1  1121 ? 125.486 98.710  -1.524  1.00 155.24 ? 1121 GLU A CG    1 
ATOM   8658  C  CD    . GLU A 1  1121 ? 124.816 99.941  -2.103  1.00 187.29 ? 1121 GLU A CD    1 
ATOM   8659  O  OE1   . GLU A 1  1121 ? 125.051 101.053 -1.572  1.00 177.74 ? 1121 GLU A OE1   1 
ATOM   8660  O  OE2   . GLU A 1  1121 ? 124.035 99.789  -3.071  1.00 187.55 ? 1121 GLU A OE2   1 
ATOM   8661  N  N     . PRO A 1  1122 ? 127.236 95.971  0.474   1.00 136.75 ? 1122 PRO A N     1 
ATOM   8662  C  CA    . PRO A 1  1122 ? 128.350 95.618  1.386   1.00 136.61 ? 1122 PRO A CA    1 
ATOM   8663  C  C     . PRO A 1  1122 ? 128.703 96.635  2.497   1.00 144.99 ? 1122 PRO A C     1 
ATOM   8664  O  O     . PRO A 1  1122 ? 128.875 96.248  3.660   1.00 143.85 ? 1122 PRO A O     1 
ATOM   8665  C  CB    . PRO A 1  1122 ? 129.516 95.388  0.425   1.00 136.73 ? 1122 PRO A CB    1 
ATOM   8666  C  CG    . PRO A 1  1122 ? 128.861 94.854  -0.803  1.00 139.22 ? 1122 PRO A CG    1 
ATOM   8667  C  CD    . PRO A 1  1122 ? 127.562 95.616  -0.924  1.00 136.58 ? 1122 PRO A CD    1 
ATOM   8668  N  N     . GLY A 1  1123 ? 128.744 97.916  2.155   1.00 145.29 ? 1123 GLY A N     1 
ATOM   8669  C  CA    . GLY A 1  1123 ? 129.052 98.958  3.124   1.00 148.94 ? 1123 GLY A CA    1 
ATOM   8670  C  C     . GLY A 1  1123 ? 127.876 99.397  3.974   1.00 157.22 ? 1123 GLY A C     1 
ATOM   8671  O  O     . GLY A 1  1123 ? 127.855 100.536 4.447   1.00 159.75 ? 1123 GLY A O     1 
ATOM   8672  N  N     . HIS A 1  1124 ? 126.888 98.511  4.177   1.00 153.46 ? 1124 HIS A N     1 
ATOM   8673  C  CA    . HIS A 1  1124 ? 125.685 98.809  4.958   1.00 156.10 ? 1124 HIS A CA    1 
ATOM   8674  C  C     . HIS A 1  1124 ? 125.136 97.583  5.701   1.00 159.81 ? 1124 HIS A C     1 
ATOM   8675  O  O     . HIS A 1  1124 ? 124.150 97.720  6.429   1.00 161.49 ? 1124 HIS A O     1 
ATOM   8676  C  CB    . HIS A 1  1124 ? 124.588 99.397  4.050   1.00 158.11 ? 1124 HIS A CB    1 
ATOM   8677  C  CG    . HIS A 1  1124 ? 124.918 100.733 3.469   1.00 164.12 ? 1124 HIS A CG    1 
ATOM   8678  N  ND1   . HIS A 1  1124 ? 124.754 101.899 4.199   1.00 169.32 ? 1124 HIS A ND1   1 
ATOM   8679  C  CD2   . HIS A 1  1124 ? 125.396 101.047 2.242   1.00 165.34 ? 1124 HIS A CD2   1 
ATOM   8680  C  CE1   . HIS A 1  1124 ? 125.129 102.880 3.394   1.00 170.12 ? 1124 HIS A CE1   1 
ATOM   8681  N  NE2   . HIS A 1  1124 ? 125.523 102.416 2.205   1.00 168.21 ? 1124 HIS A NE2   1 
ATOM   8682  N  N     . ALA A 1  1125 ? 125.764 96.396  5.505   1.00 153.87 ? 1125 ALA A N     1 
ATOM   8683  C  CA    . ALA A 1  1125 ? 125.407 95.090  6.078   1.00 151.61 ? 1125 ALA A CA    1 
ATOM   8684  C  C     . ALA A 1  1125 ? 124.726 95.135  7.455   1.00 157.86 ? 1125 ALA A C     1 
ATOM   8685  O  O     . ALA A 1  1125 ? 123.627 94.608  7.608   1.00 155.60 ? 1125 ALA A O     1 
ATOM   8686  C  CB    . ALA A 1  1125 ? 126.640 94.201  6.133   1.00 149.99 ? 1125 ALA A CB    1 
ATOM   8687  N  N     . ALA A 1  1126 ? 125.362 95.800  8.434   1.00 159.11 ? 1126 ALA A N     1 
ATOM   8688  C  CA    . ALA A 1  1126 ? 124.862 95.920  9.803   1.00 161.86 ? 1126 ALA A CA    1 
ATOM   8689  C  C     . ALA A 1  1126 ? 123.996 97.165  10.081  1.00 170.71 ? 1126 ALA A C     1 
ATOM   8690  O  O     . ALA A 1  1126 ? 123.339 97.193  11.123  1.00 172.64 ? 1126 ALA A O     1 
ATOM   8691  C  CB    . ALA A 1  1126 ? 126.020 95.853  10.783  1.00 163.35 ? 1126 ALA A CB    1 
ATOM   8692  N  N     . ASP A 1  1127 ? 123.986 98.180  9.173   1.00 169.94 ? 1127 ASP A N     1 
ATOM   8693  C  CA    . ASP A 1  1127 ? 123.172 99.398  9.321   1.00 173.94 ? 1127 ASP A CA    1 
ATOM   8694  C  C     . ASP A 1  1127 ? 121.690 99.047  9.223   1.00 179.26 ? 1127 ASP A C     1 
ATOM   8695  O  O     . ASP A 1  1127 ? 121.150 98.930  8.121   1.00 176.95 ? 1127 ASP A O     1 
ATOM   8696  C  CB    . ASP A 1  1127 ? 123.562 100.480 8.284   1.00 177.03 ? 1127 ASP A CB    1 
ATOM   8697  C  CG    . ASP A 1  1127 ? 122.774 101.792 8.339   1.00 186.61 ? 1127 ASP A CG    1 
ATOM   8698  O  OD1   . ASP A 1  1127 ? 122.113 102.056 9.376   1.00 187.42 ? 1127 ASP A OD1   1 
ATOM   8699  O  OD2   . ASP A 1  1127 ? 122.868 102.582 7.372   1.00 190.65 ? 1127 ASP A OD2   1 
ATOM   8700  N  N     . GLN A 1  1128 ? 121.042 98.871  10.393  1.00 131.15 ? 1128 GLN A N     1 
ATOM   8701  C  CA    . GLN A 1  1128 ? 119.626 98.502  10.514  1.00 130.93 ? 1128 GLN A CA    1 
ATOM   8702  C  C     . GLN A 1  1128 ? 118.738 99.551  9.872   1.00 135.98 ? 1128 GLN A C     1 
ATOM   8703  O  O     . GLN A 1  1128 ? 117.699 99.207  9.309   1.00 132.77 ? 1128 GLN A O     1 
ATOM   8704  C  CB    . GLN A 1  1128 ? 119.236 98.174  11.989  1.00 135.49 ? 1128 GLN A CB    1 
ATOM   8705  C  CG    . GLN A 1  1128 ? 118.204 99.085  12.683  1.00 156.42 ? 1128 GLN A CG    1 
ATOM   8706  C  CD    . GLN A 1  1128 ? 117.095 98.366  13.438  1.00 177.77 ? 1128 GLN A CD    1 
ATOM   8707  O  OE1   . GLN A 1  1128 ? 116.593 97.316  13.027  1.00 171.27 ? 1128 GLN A OE1   1 
ATOM   8708  N  NE2   . GLN A 1  1128 ? 116.600 98.982  14.506  1.00 174.17 ? 1128 GLN A NE2   1 
ATOM   8709  N  N     . GLU A 1  1129 ? 119.180 100.824 9.919   1.00 137.65 ? 1129 GLU A N     1 
ATOM   8710  C  CA    . GLU A 1  1129 ? 118.449 101.941 9.340   1.00 138.55 ? 1129 GLU A CA    1 
ATOM   8711  C  C     . GLU A 1  1129 ? 118.365 101.849 7.821   1.00 140.58 ? 1129 GLU A C     1 
ATOM   8712  O  O     . GLU A 1  1129 ? 117.297 102.121 7.276   1.00 139.75 ? 1129 GLU A O     1 
ATOM   8713  C  CB    . GLU A 1  1129 ? 118.989 103.304 9.811   1.00 143.92 ? 1129 GLU A CB    1 
ATOM   8714  C  CG    . GLU A 1  1129 ? 118.023 104.068 10.713  1.00 158.10 ? 1129 GLU A CG    1 
ATOM   8715  C  CD    . GLU A 1  1129 ? 116.585 104.250 10.245  1.00 180.01 ? 1129 GLU A CD    1 
ATOM   8716  O  OE1   . GLU A 1  1129 ? 116.362 104.537 9.045   1.00 167.55 ? 1129 GLU A OE1   1 
ATOM   8717  O  OE2   . GLU A 1  1129 ? 115.678 104.128 11.099  1.00 179.81 ? 1129 GLU A OE2   1 
ATOM   8718  N  N     . GLN A 1  1130 ? 119.459 101.408 7.149   1.00 135.73 ? 1130 GLN A N     1 
ATOM   8719  C  CA    . GLN A 1  1130 ? 119.519 101.219 5.690   1.00 132.64 ? 1130 GLN A CA    1 
ATOM   8720  C  C     . GLN A 1  1130 ? 118.472 100.176 5.259   1.00 130.82 ? 1130 GLN A C     1 
ATOM   8721  O  O     . GLN A 1  1130 ? 117.778 100.348 4.251   1.00 128.32 ? 1130 GLN A O     1 
ATOM   8722  C  CB    . GLN A 1  1130 ? 120.936 100.768 5.277   1.00 134.00 ? 1130 GLN A CB    1 
ATOM   8723  C  CG    . GLN A 1  1130 ? 121.081 100.393 3.800   1.00 154.12 ? 1130 GLN A CG    1 
ATOM   8724  C  CD    . GLN A 1  1130 ? 121.590 101.505 2.917   1.00 182.00 ? 1130 GLN A CD    1 
ATOM   8725  O  OE1   . GLN A 1  1130 ? 121.486 102.709 3.225   1.00 181.06 ? 1130 GLN A OE1   1 
ATOM   8726  N  NE2   . GLN A 1  1130 ? 122.132 101.108 1.772   1.00 174.05 ? 1130 GLN A NE2   1 
ATOM   8727  N  N     . ALA A 1  1131 ? 118.357 99.115  6.056   1.00 125.75 ? 1131 ALA A N     1 
ATOM   8728  C  CA    . ALA A 1  1131 ? 117.430 98.028  5.821   1.00 123.24 ? 1131 ALA A CA    1 
ATOM   8729  C  C     . ALA A 1  1131 ? 115.984 98.511  5.872   1.00 125.15 ? 1131 ALA A C     1 
ATOM   8730  O  O     . ALA A 1  1131 ? 115.222 98.202  4.956   1.00 122.00 ? 1131 ALA A O     1 
ATOM   8731  C  CB    . ALA A 1  1131 ? 117.679 96.916  6.829   1.00 124.70 ? 1131 ALA A CB    1 
ATOM   8732  N  N     . LYS A 1  1132 ? 115.639 99.332  6.896   1.00 123.97 ? 1132 LYS A N     1 
ATOM   8733  C  CA    . LYS A 1  1132 ? 114.302 99.910  7.102   1.00 124.64 ? 1132 LYS A CA    1 
ATOM   8734  C  C     . LYS A 1  1132 ? 113.853 100.683 5.865   1.00 128.05 ? 1132 LYS A C     1 
ATOM   8735  O  O     . LYS A 1  1132 ? 112.673 100.613 5.502   1.00 126.67 ? 1132 LYS A O     1 
ATOM   8736  C  CB    . LYS A 1  1132 ? 114.267 100.853 8.326   1.00 130.66 ? 1132 LYS A CB    1 
ATOM   8737  C  CG    . LYS A 1  1132 ? 114.554 100.214 9.689   1.00 145.68 ? 1132 LYS A CG    1 
ATOM   8738  C  CD    . LYS A 1  1132 ? 114.236 101.175 10.854  1.00 157.06 ? 1132 LYS A CD    1 
ATOM   8739  C  CE    . LYS A 1  1132 ? 114.968 100.811 12.125  1.00 161.68 ? 1132 LYS A CE    1 
ATOM   8740  N  NZ    . LYS A 1  1132 ? 114.641 101.710 13.263  1.00 169.73 ? 1132 LYS A NZ    1 
ATOM   8741  N  N     . LEU A 1  1133 ? 114.809 101.416 5.223   1.00 125.35 ? 1133 LEU A N     1 
ATOM   8742  C  CA    . LEU A 1  1133 ? 114.594 102.229 4.019   1.00 124.67 ? 1133 LEU A CA    1 
ATOM   8743  C  C     . LEU A 1  1133 ? 114.240 101.332 2.846   1.00 127.70 ? 1133 LEU A C     1 
ATOM   8744  O  O     . LEU A 1  1133 ? 113.239 101.590 2.177   1.00 127.44 ? 1133 LEU A O     1 
ATOM   8745  C  CB    . LEU A 1  1133 ? 115.801 103.134 3.667   1.00 125.82 ? 1133 LEU A CB    1 
ATOM   8746  C  CG    . LEU A 1  1133 ? 116.591 103.781 4.818   1.00 132.65 ? 1133 LEU A CG    1 
ATOM   8747  C  CD1   . LEU A 1  1133 ? 117.879 104.416 4.320   1.00 134.05 ? 1133 LEU A CD1   1 
ATOM   8748  C  CD2   . LEU A 1  1133 ? 115.742 104.747 5.652   1.00 136.45 ? 1133 LEU A CD2   1 
ATOM   8749  N  N     . ILE A 1  1134 ? 115.015 100.249 2.629   1.00 123.15 ? 1134 ILE A N     1 
ATOM   8750  C  CA    . ILE A 1  1134 ? 114.731 99.311  1.540   1.00 120.86 ? 1134 ILE A CA    1 
ATOM   8751  C  C     . ILE A 1  1134 ? 113.389 98.630  1.790   1.00 124.90 ? 1134 ILE A C     1 
ATOM   8752  O  O     . ILE A 1  1134 ? 112.532 98.644  0.904   1.00 123.15 ? 1134 ILE A O     1 
ATOM   8753  C  CB    . ILE A 1  1134 ? 115.895 98.322  1.232   1.00 122.30 ? 1134 ILE A CB    1 
ATOM   8754  C  CG1   . ILE A 1  1134 ? 117.180 99.089  0.860   1.00 123.39 ? 1134 ILE A CG1   1 
ATOM   8755  C  CG2   . ILE A 1  1134 ? 115.508 97.391  0.082   1.00 120.52 ? 1134 ILE A CG2   1 
ATOM   8756  C  CD1   . ILE A 1  1134 ? 118.388 98.619  1.520   1.00 130.97 ? 1134 ILE A CD1   1 
ATOM   8757  N  N     . ARG A 1  1135 ? 113.185 98.130  3.029   1.00 123.76 ? 1135 ARG A N     1 
ATOM   8758  C  CA    . ARG A 1  1135 ? 111.964 97.462  3.497   1.00 124.22 ? 1135 ARG A CA    1 
ATOM   8759  C  C     . ARG A 1  1135 ? 110.733 98.235  3.037   1.00 129.55 ? 1135 ARG A C     1 
ATOM   8760  O  O     . ARG A 1  1135 ? 109.836 97.634  2.437   1.00 128.33 ? 1135 ARG A O     1 
ATOM   8761  C  CB    . ARG A 1  1135 ? 111.980 97.325  5.036   1.00 125.77 ? 1135 ARG A CB    1 
ATOM   8762  C  CG    . ARG A 1  1135 ? 110.990 96.314  5.584   1.00 133.29 ? 1135 ARG A CG    1 
ATOM   8763  C  CD    . ARG A 1  1135 ? 110.394 96.778  6.896   1.00 143.46 ? 1135 ARG A CD    1 
ATOM   8764  N  NE    . ARG A 1  1135 ? 109.087 96.161  7.125   1.00 154.35 ? 1135 ARG A NE    1 
ATOM   8765  C  CZ    . ARG A 1  1135 ? 107.928 96.682  6.726   1.00 166.35 ? 1135 ARG A CZ    1 
ATOM   8766  N  NH1   . ARG A 1  1135 ? 107.899 97.850  6.094   1.00 153.99 ? 1135 ARG A NH1   1 
ATOM   8767  N  NH2   . ARG A 1  1135 ? 106.790 96.041  6.962   1.00 148.99 ? 1135 ARG A NH2   1 
ATOM   8768  N  N     . SER A 1  1136 ? 110.742 99.581  3.260   1.00 127.81 ? 1136 SER A N     1 
ATOM   8769  C  CA    . SER A 1  1136 ? 109.680 100.523 2.888   1.00 128.05 ? 1136 SER A CA    1 
ATOM   8770  C  C     . SER A 1  1136 ? 109.609 100.736 1.372   1.00 130.10 ? 1136 SER A C     1 
ATOM   8771  O  O     . SER A 1  1136 ? 108.504 100.797 0.816   1.00 129.61 ? 1136 SER A O     1 
ATOM   8772  C  CB    . SER A 1  1136 ? 109.868 101.862 3.607   1.00 133.67 ? 1136 SER A CB    1 
ATOM   8773  O  OG    . SER A 1  1136 ? 110.574 102.838 2.850   1.00 142.24 ? 1136 SER A OG    1 
ATOM   8774  N  N     . ALA A 1  1137 ? 110.800 100.853 0.721   1.00 125.07 ? 1137 ALA A N     1 
ATOM   8775  C  CA    . ALA A 1  1137 ? 110.999 101.112 -0.715  1.00 123.75 ? 1137 ALA A CA    1 
ATOM   8776  C  C     . ALA A 1  1137 ? 110.607 99.966  -1.643  1.00 122.77 ? 1137 ALA A C     1 
ATOM   8777  O  O     . ALA A 1  1137 ? 110.429 100.182 -2.850  1.00 121.59 ? 1137 ALA A O     1 
ATOM   8778  C  CB    . ALA A 1  1137 ? 112.444 101.510 -0.972  1.00 125.34 ? 1137 ALA A CB    1 
ATOM   8779  N  N     . ILE A 1  1138 ? 110.481 98.758  -1.090  1.00 116.76 ? 1138 ILE A N     1 
ATOM   8780  C  CA    . ILE A 1  1138 ? 110.130 97.602  -1.888  1.00 115.19 ? 1138 ILE A CA    1 
ATOM   8781  C  C     . ILE A 1  1138 ? 108.702 97.086  -1.581  1.00 120.04 ? 1138 ILE A C     1 
ATOM   8782  O  O     . ILE A 1  1138 ? 108.006 96.729  -2.531  1.00 119.41 ? 1138 ILE A O     1 
ATOM   8783  C  CB    . ILE A 1  1138 ? 111.219 96.499  -1.813  1.00 117.19 ? 1138 ILE A CB    1 
ATOM   8784  C  CG1   . ILE A 1  1138 ? 111.422 95.946  -0.378  1.00 117.74 ? 1138 ILE A CG1   1 
ATOM   8785  C  CG2   . ILE A 1  1138 ? 112.536 97.006  -2.411  1.00 117.23 ? 1138 ILE A CG2   1 
ATOM   8786  C  CD1   . ILE A 1  1138 ? 112.016 94.521  -0.315  1.00 125.21 ? 1138 ILE A CD1   1 
ATOM   8787  N  N     . GLU A 1  1139 ? 108.248 97.077  -0.290  1.00 117.88 ? 1139 GLU A N     1 
ATOM   8788  C  CA    . GLU A 1  1139 ? 106.906 96.583  0.091   1.00 118.14 ? 1139 GLU A CA    1 
ATOM   8789  C  C     . GLU A 1  1139 ? 105.791 97.356  -0.590  1.00 121.89 ? 1139 GLU A C     1 
ATOM   8790  O  O     . GLU A 1  1139 ? 105.565 98.524  -0.269  1.00 122.47 ? 1139 GLU A O     1 
ATOM   8791  C  CB    . GLU A 1  1139 ? 106.688 96.528  1.622   1.00 120.43 ? 1139 GLU A CB    1 
ATOM   8792  C  CG    . GLU A 1  1139 ? 105.545 95.603  2.028   1.00 129.95 ? 1139 GLU A CG    1 
ATOM   8793  C  CD    . GLU A 1  1139 ? 105.180 95.520  3.502   1.00 148.90 ? 1139 GLU A CD    1 
ATOM   8794  O  OE1   . GLU A 1  1139 ? 106.073 95.241  4.335   1.00 131.52 ? 1139 GLU A OE1   1 
ATOM   8795  O  OE2   . GLU A 1  1139 ? 103.973 95.640  3.810   1.00 147.37 ? 1139 GLU A OE2   1 
ATOM   8796  N  N     . HIS A 1  1140 ? 105.123 96.689  -1.548  1.00 117.70 ? 1140 HIS A N     1 
ATOM   8797  C  CA    . HIS A 1  1140 ? 104.020 97.207  -2.352  1.00 118.29 ? 1140 HIS A CA    1 
ATOM   8798  C  C     . HIS A 1  1140 ? 102.810 97.627  -1.515  1.00 122.96 ? 1140 HIS A C     1 
ATOM   8799  O  O     . HIS A 1  1140 ? 102.179 96.811  -0.831  1.00 122.46 ? 1140 HIS A O     1 
ATOM   8800  C  CB    . HIS A 1  1140 ? 103.638 96.207  -3.447  1.00 119.78 ? 1140 HIS A CB    1 
ATOM   8801  C  CG    . HIS A 1  1140 ? 102.448 96.582  -4.266  1.00 124.52 ? 1140 HIS A CG    1 
ATOM   8802  N  ND1   . HIS A 1  1140 ? 102.576 97.333  -5.422  1.00 126.89 ? 1140 HIS A ND1   1 
ATOM   8803  C  CD2   . HIS A 1  1140 ? 101.147 96.249  -4.099  1.00 127.49 ? 1140 HIS A CD2   1 
ATOM   8804  C  CE1   . HIS A 1  1140 ? 101.351 97.462  -5.899  1.00 127.60 ? 1140 HIS A CE1   1 
ATOM   8805  N  NE2   . HIS A 1  1140 ? 100.457 96.827  -5.135  1.00 128.27 ? 1140 HIS A NE2   1 
ATOM   8806  N  N     . THR A 1  1141 ? 102.500 98.933  -1.607  1.00 120.68 ? 1141 THR A N     1 
ATOM   8807  C  CA    . THR A 1  1141 ? 101.419 99.631  -0.918  1.00 121.25 ? 1141 THR A CA    1 
ATOM   8808  C  C     . THR A 1  1141 ? 100.412 100.187 -1.925  1.00 125.18 ? 1141 THR A C     1 
ATOM   8809  O  O     . THR A 1  1141 ? 100.798 100.859 -2.884  1.00 123.90 ? 1141 THR A O     1 
ATOM   8810  C  CB    . THR A 1  1141 ? 102.000 100.719 -0.007  1.00 128.72 ? 1141 THR A CB    1 
ATOM   8811  O  OG1   . THR A 1  1141 ? 103.017 100.141 0.812   1.00 129.36 ? 1141 THR A OG1   1 
ATOM   8812  C  CG2   . THR A 1  1141 ? 100.945 101.372 0.873   1.00 128.76 ? 1141 THR A CG2   1 
ATOM   8813  N  N     . THR A 1  1142 ? 99.122  99.862  -1.701  1.00 122.92 ? 1142 THR A N     1 
ATOM   8814  C  CA    . THR A 1  1142 ? 97.960  100.286 -2.491  1.00 123.45 ? 1142 THR A CA    1 
ATOM   8815  C  C     . THR A 1  1142 ? 97.154  101.260 -1.663  1.00 127.05 ? 1142 THR A C     1 
ATOM   8816  O  O     . THR A 1  1142 ? 97.149  101.156 -0.432  1.00 126.64 ? 1142 THR A O     1 
ATOM   8817  C  CB    . THR A 1  1142 ? 97.048  99.094  -2.816  1.00 131.89 ? 1142 THR A CB    1 
ATOM   8818  O  OG1   . THR A 1  1142 ? 96.955  98.253  -1.662  1.00 131.27 ? 1142 THR A OG1   1 
ATOM   8819  C  CG2   . THR A 1  1142 ? 97.504  98.315  -4.044  1.00 129.91 ? 1142 THR A CG2   1 
ATOM   8820  N  N     . LEU A 1  1143 ? 96.425  102.175 -2.329  1.00 123.39 ? 1143 LEU A N     1 
ATOM   8821  C  CA    . LEU A 1  1143 ? 95.582  103.139 -1.635  1.00 123.66 ? 1143 LEU A CA    1 
ATOM   8822  C  C     . LEU A 1  1143 ? 94.620  102.404 -0.711  1.00 126.64 ? 1143 LEU A C     1 
ATOM   8823  O  O     . LEU A 1  1143 ? 94.420  102.833 0.422   1.00 127.01 ? 1143 LEU A O     1 
ATOM   8824  C  CB    . LEU A 1  1143 ? 94.823  104.015 -2.634  1.00 124.55 ? 1143 LEU A CB    1 
ATOM   8825  C  CG    . LEU A 1  1143 ? 93.820  104.994 -2.039  1.00 130.49 ? 1143 LEU A CG    1 
ATOM   8826  C  CD1   . LEU A 1  1143 ? 94.512  106.133 -1.332  1.00 130.83 ? 1143 LEU A CD1   1 
ATOM   8827  C  CD2   . LEU A 1  1143 ? 92.892  105.508 -3.094  1.00 134.62 ? 1143 LEU A CD2   1 
ATOM   8828  N  N     . LYS A 1  1144 ? 94.110  101.247 -1.173  1.00 121.96 ? 1144 LYS A N     1 
ATOM   8829  C  CA    . LYS A 1  1144 ? 93.200  100.371 -0.444  1.00 122.58 ? 1144 LYS A CA    1 
ATOM   8830  C  C     . LYS A 1  1144 ? 93.660  100.101 0.992   1.00 126.21 ? 1144 LYS A C     1 
ATOM   8831  O  O     . LYS A 1  1144 ? 92.835  100.109 1.912   1.00 126.23 ? 1144 LYS A O     1 
ATOM   8832  C  CB    . LYS A 1  1144 ? 93.027  99.047  -1.209  1.00 125.45 ? 1144 LYS A CB    1 
ATOM   8833  C  CG    . LYS A 1  1144 ? 91.597  98.513  -1.180  1.00 142.28 ? 1144 LYS A CG    1 
ATOM   8834  C  CD    . LYS A 1  1144 ? 91.481  97.084  -1.704  1.00 148.94 ? 1144 LYS A CD    1 
ATOM   8835  C  CE    . LYS A 1  1144 ? 90.111  96.512  -1.426  1.00 151.50 ? 1144 LYS A CE    1 
ATOM   8836  N  NZ    . LYS A 1  1144 ? 90.128  95.032  -1.474  1.00 157.11 ? 1144 LYS A NZ    1 
ATOM   8837  N  N     . SER A 1  1145 ? 94.985  99.902  1.180   1.00 122.85 ? 1145 SER A N     1 
ATOM   8838  C  CA    . SER A 1  1145 ? 95.587  99.591  2.482   1.00 123.32 ? 1145 SER A CA    1 
ATOM   8839  C  C     . SER A 1  1145 ? 95.539  100.752 3.487   1.00 128.11 ? 1145 SER A C     1 
ATOM   8840  O  O     . SER A 1  1145 ? 95.450  100.500 4.691   1.00 129.17 ? 1145 SER A O     1 
ATOM   8841  C  CB    . SER A 1  1145 ? 97.010  99.049  2.323   1.00 124.24 ? 1145 SER A CB    1 
ATOM   8842  O  OG    . SER A 1  1145 ? 97.920  100.019 1.841   1.00 129.00 ? 1145 SER A OG    1 
ATOM   8843  N  N     . VAL A 1  1146 ? 95.540  102.003 3.004   1.00 123.99 ? 1146 VAL A N     1 
ATOM   8844  C  CA    . VAL A 1  1146 ? 95.530  103.171 3.891   1.00 125.13 ? 1146 VAL A CA    1 
ATOM   8845  C  C     . VAL A 1  1146 ? 94.146  103.859 4.016   1.00 129.97 ? 1146 VAL A C     1 
ATOM   8846  O  O     . VAL A 1  1146 ? 94.026  104.819 4.790   1.00 130.73 ? 1146 VAL A O     1 
ATOM   8847  C  CB    . VAL A 1  1146 ? 96.639  104.181 3.512   1.00 128.69 ? 1146 VAL A CB    1 
ATOM   8848  C  CG1   . VAL A 1  1146 ? 98.021  103.550 3.659   1.00 127.78 ? 1146 VAL A CG1   1 
ATOM   8849  C  CG2   . VAL A 1  1146 ? 96.439  104.736 2.104   1.00 127.56 ? 1146 VAL A CG2   1 
ATOM   8850  N  N     . THR A 1  1147 ? 93.110  103.350 3.290   1.00 125.93 ? 1147 THR A N     1 
ATOM   8851  C  CA    . THR A 1  1147 ? 91.743  103.903 3.292   1.00 126.49 ? 1147 THR A CA    1 
ATOM   8852  C  C     . THR A 1  1147 ? 90.815  103.249 4.328   1.00 130.52 ? 1147 THR A C     1 
ATOM   8853  O  O     . THR A 1  1147 ? 90.795  102.022 4.469   1.00 129.45 ? 1147 THR A O     1 
ATOM   8854  C  CB    . THR A 1  1147 ? 91.108  103.868 1.881   1.00 132.71 ? 1147 THR A CB    1 
ATOM   8855  O  OG1   . THR A 1  1147 ? 92.094  104.062 0.865   1.00 129.97 ? 1147 THR A OG1   1 
ATOM   8856  C  CG2   . THR A 1  1147 ? 89.975  104.885 1.717   1.00 132.18 ? 1147 THR A CG2   1 
ATOM   8857  N  N     . ILE A 1  1148 ? 90.035  104.086 5.038   1.00 128.67 ? 1148 ILE A N     1 
ATOM   8858  C  CA    . ILE A 1  1148 ? 89.059  103.607 6.015   1.00 130.90 ? 1148 ILE A CA    1 
ATOM   8859  C  C     . ILE A 1  1148 ? 87.752  103.360 5.283   1.00 134.77 ? 1148 ILE A C     1 
ATOM   8860  O  O     . ILE A 1  1148 ? 87.190  102.272 5.407   1.00 136.24 ? 1148 ILE A O     1 
ATOM   8861  C  CB    . ILE A 1  1148 ? 88.855  104.505 7.276   1.00 136.47 ? 1148 ILE A CB    1 
ATOM   8862  C  CG1   . ILE A 1  1148 ? 90.182  105.081 7.819   1.00 136.64 ? 1148 ILE A CG1   1 
ATOM   8863  C  CG2   . ILE A 1  1148 ? 88.101  103.717 8.366   1.00 140.19 ? 1148 ILE A CG2   1 
ATOM   8864  C  CD1   . ILE A 1  1148 ? 90.045  106.223 8.856   1.00 144.63 ? 1148 ILE A CD1   1 
ATOM   8865  N  N     . ALA A 1  1149 ? 87.277  104.373 4.518   1.00 129.20 ? 1149 ALA A N     1 
ATOM   8866  C  CA    . ALA A 1  1149 ? 86.033  104.348 3.743   1.00 128.98 ? 1149 ALA A CA    1 
ATOM   8867  C  C     . ALA A 1  1149 ? 86.061  105.382 2.611   1.00 131.71 ? 1149 ALA A C     1 
ATOM   8868  O  O     . ALA A 1  1149 ? 86.789  106.370 2.703   1.00 130.97 ? 1149 ALA A O     1 
ATOM   8869  C  CB    . ALA A 1  1149 ? 84.855  104.646 4.658   1.00 132.29 ? 1149 ALA A CB    1 
ATOM   8870  N  N     . SER A 1  1150 ? 85.259  105.155 1.551   1.00 128.07 ? 1150 SER A N     1 
ATOM   8871  C  CA    . SER A 1  1150 ? 85.085  106.095 0.438   1.00 127.09 ? 1150 SER A CA    1 
ATOM   8872  C  C     . SER A 1  1150 ? 83.605  106.472 0.394   1.00 133.24 ? 1150 SER A C     1 
ATOM   8873  O  O     . SER A 1  1150 ? 82.747  105.648 0.720   1.00 134.90 ? 1150 SER A O     1 
ATOM   8874  C  CB    . SER A 1  1150 ? 85.557  105.507 -0.892  1.00 128.50 ? 1150 SER A CB    1 
ATOM   8875  O  OG    . SER A 1  1150 ? 84.690  104.533 -1.452  1.00 135.11 ? 1150 SER A OG    1 
ATOM   8876  N  N     . GLU A 1  1151 ? 83.305  107.725 0.069   1.00 129.56 ? 1151 GLU A N     1 
ATOM   8877  C  CA    . GLU A 1  1151 ? 81.927  108.201 0.035   1.00 130.71 ? 1151 GLU A CA    1 
ATOM   8878  C  C     . GLU A 1  1151 ? 81.680  109.063 -1.171  1.00 134.23 ? 1151 GLU A C     1 
ATOM   8879  O  O     . GLU A 1  1151 ? 82.549  109.841 -1.578  1.00 132.57 ? 1151 GLU A O     1 
ATOM   8880  C  CB    . GLU A 1  1151 ? 81.594  109.020 1.290   1.00 133.39 ? 1151 GLU A CB    1 
ATOM   8881  C  CG    . GLU A 1  1151 ? 81.576  108.245 2.592   1.00 141.45 ? 1151 GLU A CG    1 
ATOM   8882  C  CD    . GLU A 1  1151 ? 81.529  109.129 3.821   1.00 153.70 ? 1151 GLU A CD    1 
ATOM   8883  O  OE1   . GLU A 1  1151 ? 82.336  110.084 3.904   1.00 135.44 ? 1151 GLU A OE1   1 
ATOM   8884  O  OE2   . GLU A 1  1151 ? 80.701  108.846 4.717   1.00 145.59 ? 1151 GLU A OE2   1 
ATOM   8885  N  N     . ILE A 1  1152 ? 80.480  108.945 -1.730  1.00 132.09 ? 1152 ILE A N     1 
ATOM   8886  C  CA    . ILE A 1  1152 ? 80.085  109.794 -2.836  1.00 132.36 ? 1152 ILE A CA    1 
ATOM   8887  C  C     . ILE A 1  1152 ? 79.086  110.797 -2.288  1.00 136.95 ? 1152 ILE A C     1 
ATOM   8888  O  O     . ILE A 1  1152 ? 78.077  110.413 -1.694  1.00 137.63 ? 1152 ILE A O     1 
ATOM   8889  C  CB    . ILE A 1  1152 ? 79.645  109.034 -4.112  1.00 136.01 ? 1152 ILE A CB    1 
ATOM   8890  C  CG1   . ILE A 1  1152 ? 80.871  108.356 -4.766  1.00 134.79 ? 1152 ILE A CG1   1 
ATOM   8891  C  CG2   . ILE A 1  1152 ? 78.956  109.988 -5.109  1.00 138.47 ? 1152 ILE A CG2   1 
ATOM   8892  C  CD1   . ILE A 1  1152 ? 80.551  107.311 -5.845  1.00 144.27 ? 1152 ILE A CD1   1 
ATOM   8893  N  N     . TYR A 1  1153 ? 79.437  112.081 -2.411  1.00 133.40 ? 1153 TYR A N     1 
ATOM   8894  C  CA    . TYR A 1  1153 ? 78.660  113.214 -1.941  1.00 134.92 ? 1153 TYR A CA    1 
ATOM   8895  C  C     . TYR A 1  1153 ? 78.192  114.065 -3.095  1.00 140.34 ? 1153 TYR A C     1 
ATOM   8896  O  O     . TYR A 1  1153 ? 78.933  114.239 -4.071  1.00 139.71 ? 1153 TYR A O     1 
ATOM   8897  C  CB    . TYR A 1  1153 ? 79.516  114.087 -1.015  1.00 135.91 ? 1153 TYR A CB    1 
ATOM   8898  C  CG    . TYR A 1  1153 ? 79.581  113.580 0.402   1.00 137.78 ? 1153 TYR A CG    1 
ATOM   8899  C  CD1   . TYR A 1  1153 ? 78.585  113.891 1.319   1.00 140.31 ? 1153 TYR A CD1   1 
ATOM   8900  C  CD2   . TYR A 1  1153 ? 80.636  112.785 0.831   1.00 138.71 ? 1153 TYR A CD2   1 
ATOM   8901  C  CE1   . TYR A 1  1153 ? 78.638  113.424 2.631   1.00 141.89 ? 1153 TYR A CE1   1 
ATOM   8902  C  CE2   . TYR A 1  1153 ? 80.703  112.317 2.141   1.00 140.45 ? 1153 TYR A CE2   1 
ATOM   8903  C  CZ    . TYR A 1  1153 ? 79.701  112.640 3.038   1.00 147.01 ? 1153 TYR A CZ    1 
ATOM   8904  O  OH    . TYR A 1  1153 ? 79.762  112.194 4.334   1.00 148.05 ? 1153 TYR A OH    1 
ATOM   8905  N  N     . TYR A 1  1154 ? 76.975  114.618 -2.979  1.00 138.15 ? 1154 TYR A N     1 
ATOM   8906  C  CA    . TYR A 1  1154 ? 76.494  115.551 -3.974  1.00 139.33 ? 1154 TYR A CA    1 
ATOM   8907  C  C     . TYR A 1  1154 ? 76.772  116.939 -3.414  1.00 146.58 ? 1154 TYR A C     1 
ATOM   8908  O  O     . TYR A 1  1154 ? 76.010  117.454 -2.589  1.00 147.78 ? 1154 TYR A O     1 
ATOM   8909  C  CB    . TYR A 1  1154 ? 75.012  115.353 -4.340  1.00 141.47 ? 1154 TYR A CB    1 
ATOM   8910  C  CG    . TYR A 1  1154 ? 74.479  116.444 -5.252  1.00 144.28 ? 1154 TYR A CG    1 
ATOM   8911  C  CD1   . TYR A 1  1154 ? 74.900  116.544 -6.575  1.00 146.50 ? 1154 TYR A CD1   1 
ATOM   8912  C  CD2   . TYR A 1  1154 ? 73.592  117.405 -4.778  1.00 146.34 ? 1154 TYR A CD2   1 
ATOM   8913  C  CE1   . TYR A 1  1154 ? 74.447  117.571 -7.403  1.00 148.71 ? 1154 TYR A CE1   1 
ATOM   8914  C  CE2   . TYR A 1  1154 ? 73.111  118.419 -5.606  1.00 148.70 ? 1154 TYR A CE2   1 
ATOM   8915  C  CZ    . TYR A 1  1154 ? 73.540  118.497 -6.918  1.00 154.33 ? 1154 TYR A CZ    1 
ATOM   8916  O  OH    . TYR A 1  1154 ? 73.083  119.504 -7.733  1.00 155.49 ? 1154 TYR A OH    1 
ATOM   8917  N  N     . ASP A 1  1155 ? 77.916  117.507 -3.816  1.00 144.17 ? 1155 ASP A N     1 
ATOM   8918  C  CA    . ASP A 1  1155 ? 78.352  118.845 -3.435  1.00 146.03 ? 1155 ASP A CA    1 
ATOM   8919  C  C     . ASP A 1  1155 ? 78.282  119.670 -4.735  1.00 151.68 ? 1155 ASP A C     1 
ATOM   8920  O  O     . ASP A 1  1155 ? 79.236  119.657 -5.521  1.00 151.41 ? 1155 ASP A O     1 
ATOM   8921  C  CB    . ASP A 1  1155 ? 79.770  118.785 -2.852  1.00 146.96 ? 1155 ASP A CB    1 
ATOM   8922  C  CG    . ASP A 1  1155 ? 80.083  119.861 -1.836  1.00 161.01 ? 1155 ASP A CG    1 
ATOM   8923  O  OD1   . ASP A 1  1155 ? 79.540  121.002 -1.974  1.00 164.12 ? 1155 ASP A OD1   1 
ATOM   8924  O  OD2   . ASP A 1  1155 ? 80.880  119.582 -0.916  1.00 165.27 ? 1155 ASP A OD2   1 
ATOM   8925  N  N     . PRO A 1  1156 ? 77.112  120.291 -5.034  1.00 149.18 ? 1156 PRO A N     1 
ATOM   8926  C  CA    . PRO A 1  1156 ? 76.938  120.949 -6.342  1.00 150.38 ? 1156 PRO A CA    1 
ATOM   8927  C  C     . PRO A 1  1156 ? 77.869  122.111 -6.655  1.00 154.54 ? 1156 PRO A C     1 
ATOM   8928  O  O     . PRO A 1  1156 ? 78.116  122.348 -7.833  1.00 154.76 ? 1156 PRO A O     1 
ATOM   8929  C  CB    . PRO A 1  1156 ? 75.471  121.388 -6.344  1.00 154.13 ? 1156 PRO A CB    1 
ATOM   8930  C  CG    . PRO A 1  1156 ? 75.051  121.374 -4.931  1.00 158.47 ? 1156 PRO A CG    1 
ATOM   8931  C  CD    . PRO A 1  1156 ? 75.862  120.324 -4.249  1.00 151.49 ? 1156 PRO A CD    1 
ATOM   8932  N  N     . ASP A 1  1157 ? 78.358  122.843 -5.649  1.00 151.81 ? 1157 ASP A N     1 
ATOM   8933  C  CA    . ASP A 1  1157 ? 79.275  123.942 -5.939  1.00 154.23 ? 1157 ASP A CA    1 
ATOM   8934  C  C     . ASP A 1  1157 ? 80.675  123.474 -5.609  1.00 158.41 ? 1157 ASP A C     1 
ATOM   8935  O  O     . ASP A 1  1157 ? 80.854  122.899 -4.532  1.00 157.11 ? 1157 ASP A O     1 
ATOM   8936  C  CB    . ASP A 1  1157 ? 78.931  125.210 -5.150  1.00 158.63 ? 1157 ASP A CB    1 
ATOM   8937  C  CG    . ASP A 1  1157 ? 79.542  126.462 -5.747  1.00 169.27 ? 1157 ASP A CG    1 
ATOM   8938  O  OD1   . ASP A 1  1157 ? 80.783  126.635 -5.635  1.00 173.31 ? 1157 ASP A OD1   1 
ATOM   8939  O  OD2   . ASP A 1  1157 ? 78.786  127.267 -6.330  1.00 172.11 ? 1157 ASP A OD2   1 
ATOM   8940  N  N     . PRO A 1  1158 ? 81.679  123.652 -6.505  1.00 155.89 ? 1158 PRO A N     1 
ATOM   8941  C  CA    . PRO A 1  1158 ? 83.026  123.160 -6.171  1.00 154.04 ? 1158 PRO A CA    1 
ATOM   8942  C  C     . PRO A 1  1158 ? 83.742  124.037 -5.157  1.00 159.10 ? 1158 PRO A C     1 
ATOM   8943  O  O     . PRO A 1  1158 ? 84.316  123.499 -4.203  1.00 156.27 ? 1158 PRO A O     1 
ATOM   8944  C  CB    . PRO A 1  1158 ? 83.736  123.075 -7.524  1.00 156.42 ? 1158 PRO A CB    1 
ATOM   8945  C  CG    . PRO A 1  1158 ? 83.028  124.053 -8.389  1.00 164.13 ? 1158 PRO A CG    1 
ATOM   8946  C  CD    . PRO A 1  1158 ? 81.645  124.292 -7.838  1.00 159.92 ? 1158 PRO A CD    1 
ATOM   8947  N  N     . ARG A 1  1159 ? 83.652  125.380 -5.338  1.00 159.57 ? 1159 ARG A N     1 
ATOM   8948  C  CA    . ARG A 1  1159 ? 84.266  126.397 -4.490  1.00 162.24 ? 1159 ARG A CA    1 
ATOM   8949  C  C     . ARG A 1  1159 ? 83.837  126.259 -3.027  1.00 166.16 ? 1159 ARG A C     1 
ATOM   8950  O  O     . ARG A 1  1159 ? 84.687  126.339 -2.144  1.00 166.07 ? 1159 ARG A O     1 
ATOM   8951  C  CB    . ARG A 1  1159 ? 83.997  127.811 -5.040  1.00 166.18 ? 1159 ARG A CB    1 
ATOM   8952  C  CG    . ARG A 1  1159 ? 84.872  128.904 -4.407  1.00 179.84 ? 1159 ARG A CG    1 
ATOM   8953  C  CD    . ARG A 1  1159 ? 86.112  129.232 -5.231  1.00 186.69 ? 1159 ARG A CD    1 
ATOM   8954  N  NE    . ARG A 1  1159 ? 87.334  129.336 -4.420  1.00 188.39 ? 1159 ARG A NE    1 
ATOM   8955  C  CZ    . ARG A 1  1159 ? 87.785  130.458 -3.860  1.00 197.47 ? 1159 ARG A CZ    1 
ATOM   8956  N  NH1   . ARG A 1  1159 ? 87.106  131.593 -3.987  1.00 193.05 ? 1159 ARG A NH1   1 
ATOM   8957  N  NH2   . ARG A 1  1159 ? 88.909  130.450 -3.156  1.00 185.59 ? 1159 ARG A NH2   1 
ATOM   8958  N  N     . SER A 1  1160 ? 82.544  126.019 -2.772  1.00 162.74 ? 1160 SER A N     1 
ATOM   8959  C  CA    . SER A 1  1160 ? 82.051  125.840 -1.406  1.00 163.01 ? 1160 SER A CA    1 
ATOM   8960  C  C     . SER A 1  1160 ? 81.605  124.392 -1.139  1.00 163.54 ? 1160 SER A C     1 
ATOM   8961  O  O     . SER A 1  1160 ? 80.995  123.751 -1.996  1.00 161.56 ? 1160 SER A O     1 
ATOM   8962  C  CB    . SER A 1  1160 ? 80.972  126.867 -1.052  1.00 170.43 ? 1160 SER A CB    1 
ATOM   8963  O  OG    . SER A 1  1160 ? 79.868  126.883 -1.943  1.00 179.00 ? 1160 SER A OG    1 
ATOM   8964  N  N     . THR A 1  1161 ? 81.919  123.886 0.058   1.00 159.28 ? 1161 THR A N     1 
ATOM   8965  C  CA    . THR A 1  1161 ? 81.632  122.515 0.467   1.00 156.17 ? 1161 THR A CA    1 
ATOM   8966  C  C     . THR A 1  1161 ? 80.543  122.411 1.560   1.00 160.23 ? 1161 THR A C     1 
ATOM   8967  O  O     . THR A 1  1161 ? 80.658  123.049 2.608   1.00 162.55 ? 1161 THR A O     1 
ATOM   8968  C  CB    . THR A 1  1161 ? 82.961  121.864 0.866   1.00 164.91 ? 1161 THR A CB    1 
ATOM   8969  O  OG1   . THR A 1  1161 ? 83.790  121.801 -0.298  1.00 166.29 ? 1161 THR A OG1   1 
ATOM   8970  C  CG2   . THR A 1  1161 ? 82.797  120.483 1.485   1.00 160.44 ? 1161 THR A CG2   1 
ATOM   8971  N  N     . VAL A 1  1162 ? 79.523  121.548 1.319   1.00 153.91 ? 1162 VAL A N     1 
ATOM   8972  C  CA    . VAL A 1  1162 ? 78.399  121.217 2.220   1.00 153.78 ? 1162 VAL A CA    1 
ATOM   8973  C  C     . VAL A 1  1162 ? 78.924  120.703 3.583   1.00 157.38 ? 1162 VAL A C     1 
ATOM   8974  O  O     . VAL A 1  1162 ? 78.318  120.973 4.625   1.00 158.39 ? 1162 VAL A O     1 
ATOM   8975  C  CB    . VAL A 1  1162 ? 77.477  120.154 1.559   1.00 155.42 ? 1162 VAL A CB    1 
ATOM   8976  C  CG1   . VAL A 1  1162 ? 76.234  119.878 2.405   1.00 156.57 ? 1162 VAL A CG1   1 
ATOM   8977  C  CG2   . VAL A 1  1162 ? 77.086  120.560 0.140   1.00 155.06 ? 1162 VAL A CG2   1 
ATOM   8978  N  N     . ILE A 1  1163 ? 80.054  119.961 3.547   1.00 152.48 ? 1163 ILE A N     1 
ATOM   8979  C  CA    . I