data_4BY7
# 
_entry.id   4BY7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BY7         
PDBE  EBI-57711    
WWPDB D_1290057711 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4BXX unspecified 'ARRESTED RNA POLYMERASE II-BYE1 COMPLEX'                          
PDB 4BXZ unspecified 'RNA POLYMERASE II-BYE1 COMPLEX'                                   
PDB 4BY1 unspecified 'ELONGATING RNA POLYMERASE II-BYE1 TLD COMPLEX SOAKED WITH AMPCPP' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BY7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kinkelin, K.'     1 
'Wozniak, G.G.'    2 
'Rothbart, S.B.'   3 
'Lidschreiber, M.' 4 
'Strahl, B.D.'     5 
'Cramer, P.'       6 
# 
_citation.id                        primary 
_citation.title                     'Structures of RNA polymerase II complexes with Bye1, a chromatin-binding PHF3/DIDO homologue.' 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_volume            110 
_citation.page_first                15277 
_citation.page_last                 15282 
_citation.year                      2013 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24003114 
_citation.pdbx_database_id_DOI      10.1073/pnas.1311010110 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kinkelin, K.'     1 ? 
primary 'Wozniak, G.G.'    2 ? 
primary 'Rothbart, S.B.'   3 ? 
primary 'Lidschreiber, M.' 4 ? 
primary 'Strahl, B.D.'     5 ? 
primary 'Cramer, P.'       6 ? 
# 
_cell.entry_id           4BY7 
_cell.length_a           222.500 
_cell.length_b           390.680 
_cell.length_c           281.970 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BY7 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1'                                               191821.578 1 
2.7.7.6 ? ?                   ?                         
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                                               138937.297 1 
2.7.7.6 ? ?                   ?                         
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                                               35330.457  1 ? ? ? 
?                         
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4'                                               25451.191  1 ? ? ? 
?                         
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1'                               25117.094  1 ? ? ? 
?                         
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2'                               17931.834  1 ? ? ? 
?                         
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7'                                               19081.053  1 ? ? ? 
?                         
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3'                               16551.443  1 ? ? ? 
?                         
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                                               14308.161  1 ? ? ? 
?                         
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5'                               8290.732   1 ? ? ? 
?                         
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'                                              13633.493  1 ? ? ? 
?                         
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4'                               7729.969   1 ? ? ? 
?                         
13 polymer     syn 
;, 5'-D(*DAP*AP*AP*GP*TP*AP*CP*TP*TP*GP*AP*GP*CP*DTP)-3'
;
4303.828   1 ?       ? ?                   'DNA NON-TEMPLATE STRAND' 
14 polymer     syn "5'-R(*UP*UP*CP*GP*AP*CP*CP*AP*GP*GP*AP)-3'"                                                3506.154   1 ? ? ? 
'RNA TEMPLATE STRAND'     
15 polymer     syn 
;5'-D(*DAP*GP*CP*TP*CP*AP*AP*GP*TP*AP*CP*TP*TP*DAP *TP*TP*CP*CP*BP*GP*GP*TP*CP*AP*TP*T)-3'
;
7992.995   1 ?       ? ?                   'DNA TEMPLATE STRAND'     
16 polymer     man 'TRANSCRIPTION FACTOR BYE1'                                                                 17094.592  1 ? ? 
'TFIIS-LIKE DOMAIN' ?                         
17 non-polymer syn 'ZINC ION'                                                                                  65.409     8 ? ? ? 
?                         
18 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     1 ? ? ? 
?                         
19 non-polymer syn '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID'                                       238.305    2 ? ? ? 
?                         
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA POLYMERASE II SUBUNIT 1, RNA POLYMERASE II SUBUNIT B1, DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT, RNA POLYMERASE II SUBUNIT B220
;
2  'RNA POLYMERASE II SUBUNIT 2, B150, DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE' 
3  'RNA POLYMERASE II SUBUNIT 3, RNA POLYMERASE II SUBUNIT B3, B44.5, DNA-DIRECTED RNA POLYMERASE II 45 KDA POLYPEPTIDE' 
4  'RNA POLYMERASE II SUBUNIT B4, B32, DNA-DIRECTED RNA POLYMER ASE II 32 KDA POLYPEPTIDE' 
5  'RNA POLYMERASES I, II, AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I, II, AND III 27 KDA POLYPEPTIDE' 
6  'RNA POLYMERASES I, II, AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I, II, AND III 23 KDA POLYPEPTIDE' 
7  'RNA POLYMERASE II SUBUNIT B7, B16' 
8  
'RNA POLYMERASES I, II, AND III SUBUNIT ABC3, ABC14.4, ABC14 .5, DNA-DIRECTED RNA POLYMERASES I, II, AND III 14.5 KDA POLYPEPTI DE' 
9  
'RNA POLYMERASE II SUBUNIT B9, B12.6, DNA-DIRECTED RNA POLYMERASE II 14.2 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBU NIT 9' 
10 
'RNA POLYMERASES I, II, AND III SUBUNIT ABC5, ABC10-BETA, AB C8, DNA-DIRECTED RNA POLYMERASES I, II, AND III 8.3 KDA POLYPEPTID E' 
11 'RNA POLYMERASE II SUBUNIT B11, B13.6, DNA-DIRECTED RNA POLY MERASE II 13.6 KDA POLYPEPTIDE' 
12 'RNA POLYMERASES I, II, AND III SUBUNIT ABC4, ABC10-ALPHA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSLATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSLATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 polydeoxyribonucleotide no no  '(DA)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)(DG)(DC)(DT)' AAAGTACTTGAGCT N ? 
14 polyribonucleotide      no no  UUCGACCAGGA UUCGACCAGGA P ? 
15 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DA)(DT)(DT)(DC)(DC)(BRU)
(DG)(DG)(DT)(DC)(DA)(DT)(DT)
;
AGCTCAAGTACTTATTCCUGGTCATT T ? 
16 'polypeptide(L)'        no no  
;TRKDFESEKEHKLRYNAEKMFSTLFSKFIVPETIEAKLYELPDGKDVISISQEFAHNLEEELYKACLNVEFGTLDKIYTE
KVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIVEVPDK
;
;TRKDFESEKEHKLRYNAEKMFSTLFSKFIVPETIEAKLYELPDGKDVISISQEFAHNLEEELYKACLNVEFGTLDKIYTE
KVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEKRDKIILENFIVEVPDK
;
X ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   LEU n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DA  n 
13 2    DA  n 
13 3    DA  n 
13 4    DG  n 
13 5    DT  n 
13 6    DA  n 
13 7    DC  n 
13 8    DT  n 
13 9    DT  n 
13 10   DG  n 
13 11   DA  n 
13 12   DG  n 
13 13   DC  n 
13 14   DT  n 
14 1    U   n 
14 2    U   n 
14 3    C   n 
14 4    G   n 
14 5    A   n 
14 6    C   n 
14 7    C   n 
14 8    A   n 
14 9    G   n 
14 10   G   n 
14 11   A   n 
15 1    DA  n 
15 2    DG  n 
15 3    DC  n 
15 4    DT  n 
15 5    DC  n 
15 6    DA  n 
15 7    DA  n 
15 8    DG  n 
15 9    DT  n 
15 10   DA  n 
15 11   DC  n 
15 12   DT  n 
15 13   DT  n 
15 14   DA  n 
15 15   DT  n 
15 16   DT  n 
15 17   DC  n 
15 18   DC  n 
15 19   BRU n 
15 20   DG  n 
15 21   DG  n 
15 22   DT  n 
15 23   DC  n 
15 24   DA  n 
15 25   DT  n 
15 26   DT  n 
16 1    THR n 
16 2    ARG n 
16 3    LYS n 
16 4    ASP n 
16 5    PHE n 
16 6    GLU n 
16 7    SER n 
16 8    GLU n 
16 9    LYS n 
16 10   GLU n 
16 11   HIS n 
16 12   LYS n 
16 13   LEU n 
16 14   ARG n 
16 15   TYR n 
16 16   ASN n 
16 17   ALA n 
16 18   GLU n 
16 19   LYS n 
16 20   MET n 
16 21   PHE n 
16 22   SER n 
16 23   THR n 
16 24   LEU n 
16 25   PHE n 
16 26   SER n 
16 27   LYS n 
16 28   PHE n 
16 29   ILE n 
16 30   VAL n 
16 31   PRO n 
16 32   GLU n 
16 33   THR n 
16 34   ILE n 
16 35   GLU n 
16 36   ALA n 
16 37   LYS n 
16 38   LEU n 
16 39   TYR n 
16 40   GLU n 
16 41   LEU n 
16 42   PRO n 
16 43   ASP n 
16 44   GLY n 
16 45   LYS n 
16 46   ASP n 
16 47   VAL n 
16 48   ILE n 
16 49   SER n 
16 50   ILE n 
16 51   SER n 
16 52   GLN n 
16 53   GLU n 
16 54   PHE n 
16 55   ALA n 
16 56   HIS n 
16 57   ASN n 
16 58   LEU n 
16 59   GLU n 
16 60   GLU n 
16 61   GLU n 
16 62   LEU n 
16 63   TYR n 
16 64   LYS n 
16 65   ALA n 
16 66   CYS n 
16 67   LEU n 
16 68   ASN n 
16 69   VAL n 
16 70   GLU n 
16 71   PHE n 
16 72   GLY n 
16 73   THR n 
16 74   LEU n 
16 75   ASP n 
16 76   LYS n 
16 77   ILE n 
16 78   TYR n 
16 79   THR n 
16 80   GLU n 
16 81   LYS n 
16 82   VAL n 
16 83   ARG n 
16 84   SER n 
16 85   LEU n 
16 86   TYR n 
16 87   SER n 
16 88   ASN n 
16 89   LEU n 
16 90   LYS n 
16 91   ASP n 
16 92   LYS n 
16 93   LYS n 
16 94   ASN n 
16 95   LEU n 
16 96   GLU n 
16 97   LEU n 
16 98   LYS n 
16 99   ALA n 
16 100  HIS n 
16 101  VAL n 
16 102  VAL n 
16 103  GLU n 
16 104  GLY n 
16 105  LYS n 
16 106  LEU n 
16 107  PRO n 
16 108  LEU n 
16 109  ASN n 
16 110  LYS n 
16 111  LEU n 
16 112  VAL n 
16 113  ASN n 
16 114  MET n 
16 115  ASN n 
16 116  ALA n 
16 117  SER n 
16 118  GLU n 
16 119  LEU n 
16 120  ALA n 
16 121  ASN n 
16 122  PRO n 
16 123  ASP n 
16 124  LEU n 
16 125  GLN n 
16 126  GLU n 
16 127  PHE n 
16 128  LYS n 
16 129  GLU n 
16 130  LYS n 
16 131  ARG n 
16 132  ASP n 
16 133  LYS n 
16 134  ILE n 
16 135  ILE n 
16 136  LEU n 
16 137  GLU n 
16 138  ASN n 
16 139  PHE n 
16 140  ILE n 
16 141  VAL n 
16 142  GLU n 
16 143  VAL n 
16 144  PRO n 
16 145  ASP n 
16 146  LYS n 
# 
_entity_src_gen.entity_id                          16 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;BAKER'S YEAST
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SACCHAROMYCES CEREVISIAE' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              RIL 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       POPINF 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
14 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
15 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  1  ? ? P04050 ? 
2  UNP RPB2_YEAST  2  ? ? P08518 ? 
3  UNP RPB3_YEAST  3  ? ? P16370 ? 
4  UNP RPB4_YEAST  4  ? ? P20433 ? 
5  UNP RPAB1_YEAST 5  ? ? P20434 ? 
6  UNP RPAB2_YEAST 6  ? ? P20435 ? 
7  UNP RPB7_YEAST  7  ? ? P34087 ? 
8  UNP RPAB3_YEAST 8  ? ? P20436 ? 
9  UNP RPB9_YEAST  9  ? ? P27999 ? 
10 UNP RPAB5_YEAST 10 ? ? P22139 ? 
11 UNP RPAB4_YEAST 12 ? ? P40422 ? 
12 UNP RPB11_YEAST 11 ? ? P38902 ? 
13 UNP BYE1_YEAST  16 ? ? P36106 ? 
14 PDB 4BY7        13 ? ? 4BY7   ? 
15 PDB 4BY7        14 ? ? 4BY7   ? 
16 PDB 4BY7        15 ? ? 4BY7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4BY7 A 1 ? 1733 ? P04050 1   ? 1733 ? 1   1733 
2  2  4BY7 B 1 ? 1224 ? P08518 1   ? 1224 ? 1   1224 
3  3  4BY7 C 1 ? 318  ? P16370 1   ? 318  ? 1   318  
4  4  4BY7 D 1 ? 221  ? P20433 1   ? 221  ? 1   221  
5  5  4BY7 E 1 ? 215  ? P20434 1   ? 215  ? 1   215  
6  6  4BY7 F 1 ? 155  ? P20435 1   ? 155  ? 1   155  
7  7  4BY7 G 1 ? 171  ? P34087 1   ? 171  ? 1   171  
8  8  4BY7 H 1 ? 146  ? P20436 1   ? 146  ? 1   146  
9  9  4BY7 I 1 ? 122  ? P27999 1   ? 122  ? 1   122  
10 10 4BY7 J 1 ? 70   ? P22139 1   ? 70   ? 1   70   
11 11 4BY7 L 1 ? 70   ? P40422 1   ? 70   ? 1   70   
12 12 4BY7 K 1 ? 120  ? P38902 1   ? 120  ? 1   120  
13 13 4BY7 X 1 ? 146  ? P36106 225 ? 370  ? 225 370  
14 14 4BY7 N 1 ? 14   ? 4BY7   3   ? 16   ? 3   16   
15 15 4BY7 P 1 ? 11   ? 4BY7   1   ? 11   ? 1   11   
16 16 4BY7 T 1 ? 26   ? 4BY7   1   ? 26   ? 1   26   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                          ?     'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                               ?     'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                              ?     'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                            ?     'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                       ?     'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"            ?     'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                           ?     'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                              ?     'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                  ?     'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                   ?     'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                  ?     'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                          ?     'C10 H15 N2 O8 P'   322.208 
EPE non-polymer         . '4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID' HEPES 'C8 H18 N2 O4 S'    238.305 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                          ?     'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                             ?     'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                       ?     'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                               ?     'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                             ?     'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                            ?     'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                               ?     'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                ?     'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                            ?     'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                       ?     'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                         ?     'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                               ?     'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                ?     'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                             ?     'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                            ?     'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                              ?     'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                            ?     'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                                ?     'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                            ?     'Zn 2'              65.409  
# 
_exptl.entry_id          4BY7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.2 
_exptl_crystal.density_percent_sol   76 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;5-7% PEG6000, 50 MM HEPES PH 7.0, 200 MM AMMONIUM ACETATE, 300 MM SODIUM ACETATE, 5 MM TCEP, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 293 K
;
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-12-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'FIXED-EXIT LN2 COOLED DOUBLE CRYSTAL MONOCHROMATOR SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.91887 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.91887 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BY7 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.84 
_reflns.d_resolution_high            3.15 
_reflns.number_obs                   210346 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.12 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.97 
_reflns.B_iso_Wilson_estimate        124.39 
_reflns.pdbx_redundancy              7.66 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.15 
_reflns_shell.d_res_low              3.23 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.60 
_reflns_shell.pdbx_redundancy        7.74 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BY7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     210346 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.84 
_refine.ls_d_res_high                            3.15 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.1899 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1894 
_refine.ls_R_factor_R_free                       0.2119 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.90 
_refine.ls_number_reflns_R_free                  4003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9299 
_refine.correlation_coeff_Fo_to_Fc_free          0.9135 
_refine.B_iso_mean                               115.07 
_refine.aniso_B[1][1]                            14.8634 
_refine.aniso_B[2][2]                            16.7326 
_refine.aniso_B[3][3]                            -31.5960 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1WCM' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.390 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.264 
_refine.pdbx_overall_SU_R_Blow_DPI               0.363 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.255 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4BY7 
_refine_analyze.Luzzati_coordinate_error_obs    0.760 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        32200 
_refine_hist.pdbx_number_atoms_nucleic_acid   988 
_refine_hist.pdbx_number_atoms_ligand         39 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               33227 
_refine_hist.d_res_high                       3.15 
_refine_hist.d_res_low                        48.84 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  33940 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.22  ? 2.00  46052 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  12102 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  893   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  4711  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 33940 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  3     'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           2.76  ? ?     ?     'X-RAY DIFFRACTION' ?            
t_other_torsion           23.21 ? ?     ?     'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  4471  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? 1.00  86    'X-RAY DIFFRACTION' HARMONIC     
t_utility_angle           ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?     'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  38765 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.15 
_refine_ls_shell.d_res_low                        3.23 
_refine_ls_shell.number_reflns_R_work             15303 
_refine_ls_shell.R_factor_R_work                  0.2873 
_refine_ls_shell.percent_reflns_obs               99.98 
_refine_ls_shell.R_factor_R_free                  0.3091 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            0.99 
_refine_ls_shell.number_reflns_R_free             153 
_refine_ls_shell.number_reflns_all                15456 
_refine_ls_shell.R_factor_all                     0.2876 
# 
_struct.entry_id                  4BY7 
_struct.title                     'elongating RNA Polymerase II-Bye1 TLD complex' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB4, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4, TRANSCRIPTION FACTOR BYE1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BY7 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'RNA POLYMERASE II, BYE1, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 17 ? 
S  N N 18 ? 
T  N N 19 ? 
U  N N 17 ? 
V  N N 17 ? 
W  N N 19 ? 
X  N N 17 ? 
Y  N N 17 ? 
Z  N N 17 ? 
AA N N 17 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? GLU A 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   3   ASN A 119  ? ALA A 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   4   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   5   SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  10  ALA A 288  ? ASP A 305  ? ALA A 288  ASP A 305  1 ? 18 
HELX_P HELX_P11  11  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  12  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  13  LYS A 368  ? LEU A 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P14  14  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  15  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  16  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  17  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P18  18  VAL A 507  ? GLN A 510  ? VAL A 507  GLN A 510  5 ? 4  
HELX_P HELX_P19  19  VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P20  20  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P21  21  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P22  22  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  23  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P24  24  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P25  25  GLY A 665  ? ILE A 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P26  26  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  27  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  28  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P29  29  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  30  THR A 809  ? LYS A 830  ? THR A 809  LYS A 830  1 ? 22 
HELX_P HELX_P31  31  THR A 831  ? GLU A 846  ? THR A 831  GLU A 846  1 ? 16 
HELX_P HELX_P32  32  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P33  33  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P34  34  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P35  35  GLU A 914  ? SER A 917  ? GLU A 914  SER A 917  5 ? 4  
HELX_P HELX_P36  36  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P37  37  ASN A 959  ? HIS A 972  ? ASN A 959  HIS A 972  1 ? 14 
HELX_P HELX_P38  38  THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P39  39  ASN A 1004 ? VAL A 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P40  40  VAL A 1015 ? LEU A 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P41  41  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P42  42  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P43  43  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P44  44  SER A 1096 ? ASN A 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P45  45  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P46  46  ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P47  47  ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P48  48  THR A 1208 ? GLN A 1218 ? THR A 1208 GLN A 1218 1 ? 11 
HELX_P HELX_P49  49  ASP A 1257 ? ASN A 1270 ? ASP A 1257 ASN A 1270 1 ? 14 
HELX_P HELX_P50  50  ASN A 1312 ? THR A 1318 ? ASN A 1312 THR A 1318 1 ? 7  
HELX_P HELX_P51  51  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P52  52  GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P53  53  ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P54  54  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P55  55  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P56  56  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P57  57  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P58  58  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P59  59  ASP A 1446 ? VAL A 1451 ? ASP A 1446 VAL A 1451 1 ? 6  
HELX_P HELX_P60  60  ASP B 29   ? GLY B 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P61  61  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P62  62  TYR B 57   ? ILE B 63   ? TYR B 57   ILE B 63   1 ? 7  
HELX_P HELX_P63  63  TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P64  64  CYS B 179  ? GLU B 183  ? CYS B 179  GLU B 183  5 ? 5  
HELX_P HELX_P65  65  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P66  66  ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P67  67  GLU B 296  ? CYS B 302  ? GLU B 296  CYS B 302  1 ? 7  
HELX_P HELX_P68  68  ASP B 307  ? MET B 313  ? ASP B 307  MET B 313  1 ? 7  
HELX_P HELX_P69  69  LEU B 314  ? PHE B 322  ? LEU B 314  PHE B 322  1 ? 9  
HELX_P HELX_P70  70  ASP B 326  ? ARG B 337  ? ASP B 326  ARG B 337  1 ? 12 
HELX_P HELX_P71  71  LYS B 344  ? GLU B 359  ? LYS B 344  GLU B 359  1 ? 16 
HELX_P HELX_P72  72  GLU B 371  ? LEU B 390  ? GLU B 371  LEU B 390  1 ? 20 
HELX_P HELX_P73  73  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P74  74  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P75  75  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P76  76  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P77  77  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P78  78  PRO B 551  ? TRP B 561  ? PRO B 551  TRP B 561  1 ? 11 
HELX_P HELX_P79  79  ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P80  80  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P81  81  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P82  82  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P83  83  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P84  84  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P85  85  PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P86  86  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P87  87  ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P88  88  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P89  89  ASN B 1013 ? ILE B 1017 ? ASN B 1013 ILE B 1017 5 ? 5  
HELX_P HELX_P90  90  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P91  91  THR B 1051 ? GLU B 1061 ? THR B 1051 GLU B 1061 1 ? 11 
HELX_P HELX_P92  92  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P93  93  GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P94  94  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P95  95  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P96  96  TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P97  97  ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P98  98  ALA C 59   ? LEU C 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P99  99  ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P100 100 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P101 101 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P102 102 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P103 103 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P104 104 PRO C 239  ? GLN C 267  ? PRO C 239  GLN C 267  1 ? 29 
HELX_P HELX_P105 105 SER D 53   ? GLN D 74   ? SER D 53   GLN D 74   1 ? 22 
HELX_P HELX_P106 106 LYS D 121  ? THR D 134  ? LYS D 121  THR D 134  1 ? 14 
HELX_P HELX_P107 107 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P108 108 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P109 109 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P110 110 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P111 111 PRO D 196  ? LYS D 201  ? PRO D 196  LYS D 201  5 ? 6  
HELX_P HELX_P112 112 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P113 113 MET E 1    ? ARG E 26   ? MET E 1    ARG E 26   1 ? 26 
HELX_P HELX_P114 114 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P115 115 PRO E 38   ? CYS E 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P116 116 GLN E 54   ? SER E 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P117 117 THR E 65   ? PHE E 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P118 118 GLY E 89   ? LYS E 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P119 119 SER E 119  ? ILE E 127  ? SER E 119  ILE E 127  5 ? 9  
HELX_P HELX_P120 120 GLU E 137  ? VAL E 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P121 121 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P122 122 SER E 157  ? TYR E 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P123 123 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P124 124 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P125 125 PRO F 75   ? ARG F 79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P126 126 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P127 127 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P128 128 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P129 129 ARG G 21   ? GLU G 35   ? ARG G 21   GLU G 35   1 ? 15 
HELX_P HELX_P130 130 ASP G 50   ? ILE G 54   ? ASP G 50   ILE G 54   5 ? 5  
HELX_P HELX_P131 131 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P132 132 TYR H 129  ? ASN H 133  ? TYR H 129  ASN H 133  5 ? 5  
HELX_P HELX_P133 133 VAL I 59   ? ASP I 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P134 134 LYS J 17   ? GLU J 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P135 135 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P136 136 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P137 137 LEU J 56   ? LEU J 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P138 138 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P139 139 ASP K 39   ? LEU K 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P140 140 ASP K 82   ? ASN K 110  ? ASP K 82   ASN K 110  1 ? 29 
HELX_P HELX_P141 141 LYS P 9    ? PHE P 28   ? LYS X 233  PHE X 252  1 ? 20 
HELX_P HELX_P142 142 ILE P 29   ? GLU P 35   ? ILE X 253  GLU X 259  1 ? 7  
HELX_P HELX_P143 143 VAL P 47   ? GLU P 60   ? VAL X 271  GLU X 284  1 ? 14 
HELX_P HELX_P144 144 GLU P 60   ? CYS P 66   ? GLU X 284  CYS X 290  1 ? 7  
HELX_P HELX_P145 145 ILE P 77   ? ASP P 91   ? ILE X 301  ASP X 315  1 ? 15 
HELX_P HELX_P146 146 LEU P 95   ? GLY P 104  ? LEU X 319  GLY X 328  1 ? 10 
HELX_P HELX_P147 147 PRO P 107  ? ASN P 113  ? PRO X 331  ASN X 337  1 ? 7  
HELX_P HELX_P148 148 ASN P 121  ? LEU P 136  ? ASN X 345  LEU X 360  1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? Q  ZN  .  ZN    ? ? ? 1_555 A CYS 110  SG    ? ? A ZN  2456 A CYS 110  1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc2  metalc ? ? Q  ZN  .  ZN    ? ? ? 1_555 A CYS 167  SG    ? ? A ZN  2456 A CYS 167  1_555 ? ? ? ? ? ? ?            2.235 ? 
metalc3  metalc ? ? Q  ZN  .  ZN    ? ? ? 1_555 A CYS 107  SG    ? ? A ZN  2456 A CYS 107  1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc4  metalc ? ? Q  ZN  .  ZN    ? ? ? 1_555 A CYS 148  SG    ? ? A ZN  2456 A CYS 148  1_555 ? ? ? ? ? ? ?            2.365 ? 
metalc5  metalc ? ? R  ZN  .  ZN    ? ? ? 1_555 A CYS 67   SG    ? ? A ZN  2457 A CYS 67   1_555 ? ? ? ? ? ? ?            2.215 ? 
metalc6  metalc ? ? R  ZN  .  ZN    ? ? ? 1_555 A CYS 70   SG    ? ? A ZN  2457 A CYS 70   1_555 ? ? ? ? ? ? ?            2.567 ? 
metalc7  metalc ? ? R  ZN  .  ZN    ? ? ? 1_555 A HIS 80   NE2   ? ? A ZN  2457 A HIS 80   1_555 ? ? ? ? ? ? ?            2.115 ? 
metalc8  metalc ? ? R  ZN  .  ZN    ? ? ? 1_555 A CYS 77   SG    ? ? A ZN  2457 A CYS 77   1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc9  metalc ? ? S  MG  .  MG    ? ? ? 1_555 A ASP 483  OD2   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.356 ? 
metalc10 metalc ? ? S  MG  .  MG    ? ? ? 1_555 N A   11   "O3'" ? ? A MG  2458 P A   11   1_555 ? ? ? ? ? ? ?            1.973 ? 
metalc11 metalc ? ? S  MG  .  MG    ? ? ? 1_555 A ASP 481  OD2   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            1.974 ? 
metalc12 metalc ? ? S  MG  .  MG    ? ? ? 1_555 A ASP 485  OD1   ? ? A MG  2458 A ASP 485  1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc13 metalc ? ? S  MG  .  MG    ? ? ? 1_555 A ASP 483  OD1   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            1.922 ? 
metalc14 metalc ? ? U  ZN  .  ZN    ? ? ? 1_555 B CYS 1163 SG    ? ? B ZN  2225 B CYS 1163 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc15 metalc ? ? U  ZN  .  ZN    ? ? ? 1_555 B CYS 1166 SG    ? ? B ZN  2225 B CYS 1166 1_555 ? ? ? ? ? ? ?            2.246 ? 
metalc16 metalc ? ? U  ZN  .  ZN    ? ? ? 1_555 B CYS 1182 SG    ? ? B ZN  2225 B CYS 1182 1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc17 metalc ? ? U  ZN  .  ZN    ? ? ? 1_555 B CYS 1185 SG    ? ? B ZN  2225 B CYS 1185 1_555 ? ? ? ? ? ? ?            2.351 ? 
metalc18 metalc ? ? V  ZN  .  ZN    ? ? ? 1_555 C CYS 86   SG    ? ? C ZN  1269 C CYS 86   1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc19 metalc ? ? V  ZN  .  ZN    ? ? ? 1_555 C CYS 92   SG    ? ? C ZN  1269 C CYS 92   1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc20 metalc ? ? V  ZN  .  ZN    ? ? ? 1_555 C CYS 95   SG    ? ? C ZN  1269 C CYS 95   1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc21 metalc ? ? V  ZN  .  ZN    ? ? ? 1_555 C CYS 88   SG    ? ? C ZN  1269 C CYS 88   1_555 ? ? ? ? ? ? ?            2.312 ? 
metalc22 metalc ? ? X  ZN  .  ZN    ? ? ? 1_555 I CYS 7    SG    ? ? I ZN  1121 I CYS 7    1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc23 metalc ? ? X  ZN  .  ZN    ? ? ? 1_555 I CYS 32   SG    ? ? I ZN  1121 I CYS 32   1_555 ? ? ? ? ? ? ?            2.241 ? 
metalc24 metalc ? ? X  ZN  .  ZN    ? ? ? 1_555 I CYS 29   SG    ? ? I ZN  1121 I CYS 29   1_555 ? ? ? ? ? ? ?            2.370 ? 
metalc25 metalc ? ? X  ZN  .  ZN    ? ? ? 1_555 I CYS 10   SG    ? ? I ZN  1121 I CYS 10   1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc26 metalc ? ? Y  ZN  .  ZN    ? ? ? 1_555 I CYS 78   SG    ? ? I ZN  1122 I CYS 78   1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc27 metalc ? ? Y  ZN  .  ZN    ? ? ? 1_555 I CYS 75   SG    ? ? I ZN  1122 I CYS 75   1_555 ? ? ? ? ? ? ?            2.410 ? 
metalc28 metalc ? ? Y  ZN  .  ZN    ? ? ? 1_555 I CYS 103  SG    ? ? I ZN  1122 I CYS 103  1_555 ? ? ? ? ? ? ?            2.413 ? 
metalc29 metalc ? ? Y  ZN  .  ZN    ? ? ? 1_555 I CYS 106  SG    ? ? I ZN  1122 I CYS 106  1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc30 metalc ? ? Z  ZN  .  ZN    ? ? ? 1_555 J CYS 10   SG    ? ? J ZN  1066 J CYS 10   1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc31 metalc ? ? Z  ZN  .  ZN    ? ? ? 1_555 J CYS 45   SG    ? ? J ZN  1066 J CYS 45   1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc32 metalc ? ? Z  ZN  .  ZN    ? ? ? 1_555 J CYS 46   SG    ? ? J ZN  1066 J CYS 46   1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc33 metalc ? ? Z  ZN  .  ZN    ? ? ? 1_555 J CYS 7    SG    ? ? J ZN  1066 J CYS 7    1_555 ? ? ? ? ? ? ?            2.357 ? 
metalc34 metalc ? ? AA ZN  .  ZN    ? ? ? 1_555 L CYS 34   SG    ? ? L ZN  1071 L CYS 34   1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc35 metalc ? ? AA ZN  .  ZN    ? ? ? 1_555 L CYS 51   SG    ? ? L ZN  1071 L CYS 51   1_555 ? ? ? ? ? ? ?            2.426 ? 
metalc36 metalc ? ? AA ZN  .  ZN    ? ? ? 1_555 L CYS 48   SG    ? ? L ZN  1071 L CYS 48   1_555 ? ? ? ? ? ? ?            2.363 ? 
metalc37 metalc ? ? AA ZN  .  ZN    ? ? ? 1_555 L CYS 31   SG    ? ? L ZN  1071 L CYS 31   1_555 ? ? ? ? ? ? ?            2.479 ? 
covale1  covale ? ? O  DC  18 "O3'" ? ? ? 1_555 O BRU 19   P     ? ? T DC  18   T BRU 19   1_555 ? ? ? ? ? ? ?            1.598 ? 
covale2  covale ? ? O  BRU 19 "O3'" ? ? ? 1_555 O DG  20   P     ? ? T BRU 19   T DG  20   1_555 ? ? ? ? ? ? ?            1.599 ? 
hydrog1  hydrog ? ? M  DA  2  N1    ? ? ? 1_555 O DT  13   N3    ? ? N DA  4    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? M  DA  2  N6    ? ? ? 1_555 O DT  13   O4    ? ? N DA  4    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? M  DA  3  N1    ? ? ? 1_555 O DT  12   N3    ? ? N DA  5    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? M  DA  3  N6    ? ? ? 1_555 O DT  12   O4    ? ? N DA  5    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? M  DG  4  N1    ? ? ? 1_555 O DC  11   N3    ? ? N DG  6    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? M  DG  4  N2    ? ? ? 1_555 O DC  11   O2    ? ? N DG  6    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? M  DG  4  O6    ? ? ? 1_555 O DC  11   N4    ? ? N DG  6    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? M  DT  5  N3    ? ? ? 1_555 O DA  10   N1    ? ? N DT  7    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? M  DT  5  O4    ? ? ? 1_555 O DA  10   N6    ? ? N DT  7    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? M  DA  6  N1    ? ? ? 1_555 O DT  9    N3    ? ? N DA  8    T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? M  DA  6  N6    ? ? ? 1_555 O DT  9    O4    ? ? N DA  8    T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? M  DC  7  N3    ? ? ? 1_555 O DG  8    N1    ? ? N DC  9    T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? M  DC  7  N4    ? ? ? 1_555 O DG  8    O6    ? ? N DC  9    T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? M  DC  7  O2    ? ? ? 1_555 O DG  8    N2    ? ? N DC  9    T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? M  DT  8  N3    ? ? ? 1_555 O DA  7    N1    ? ? N DT  10   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? M  DT  8  O4    ? ? ? 1_555 O DA  7    N6    ? ? N DT  10   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? M  DT  9  N3    ? ? ? 1_555 O DA  6    N1    ? ? N DT  11   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? M  DT  9  O4    ? ? ? 1_555 O DA  6    N6    ? ? N DT  11   T DA  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? M  DG  10 N1    ? ? ? 1_555 O DC  5    N3    ? ? N DG  12   T DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? M  DG  10 N2    ? ? ? 1_555 O DC  5    O2    ? ? N DG  12   T DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? M  DG  10 O6    ? ? ? 1_555 O DC  5    N4    ? ? N DG  12   T DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? M  DA  11 N1    ? ? ? 1_555 O DT  4    N3    ? ? N DA  13   T DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? M  DA  11 N6    ? ? ? 1_555 O DT  4    O4    ? ? N DA  13   T DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? M  DG  12 N1    ? ? ? 1_555 O DC  3    N3    ? ? N DG  14   T DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? M  DG  12 N2    ? ? ? 1_555 O DC  3    O2    ? ? N DG  14   T DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? M  DG  12 O6    ? ? ? 1_555 O DC  3    N4    ? ? N DG  14   T DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? M  DC  13 N3    ? ? ? 1_555 O DG  2    N1    ? ? N DC  15   T DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? M  DC  13 N4    ? ? ? 1_555 O DG  2    O6    ? ? N DC  15   T DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? M  DC  13 O2    ? ? ? 1_555 O DG  2    N2    ? ? N DC  15   T DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? N  G   4  N1    ? ? ? 1_555 O DC  23   N3    ? ? P G   4    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? N  G   4  N2    ? ? ? 1_555 O DC  23   O2    ? ? P G   4    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? N  G   4  O6    ? ? ? 1_555 O DC  23   N4    ? ? P G   4    T DC  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? N  G   4  N1    ? ? ? 1_555 O DA  24   N7    ? ? P G   4    T DA  24   1_555 ? ? ? ? ? ? TYPE_9_PAIR  ?     ? 
hydrog34 hydrog ? ? N  G   4  O6    ? ? ? 1_555 O DA  24   N6    ? ? P G   4    T DA  24   1_555 ? ? ? ? ? ? TYPE_9_PAIR  ?     ? 
hydrog35 hydrog ? ? N  A   5  N1    ? ? ? 1_555 O DT  22   N3    ? ? P A   5    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? N  A   5  N6    ? ? ? 1_555 O DT  22   O4    ? ? P A   5    T DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? N  C   6  N3    ? ? ? 1_555 O DG  21   N1    ? ? P C   6    T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? N  C   6  N4    ? ? ? 1_555 O DG  21   O6    ? ? P C   6    T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? N  C   6  O2    ? ? ? 1_555 O DG  21   N2    ? ? P C   6    T DG  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? N  C   7  N3    ? ? ? 1_555 O DG  20   N1    ? ? P C   7    T DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? N  C   7  N4    ? ? ? 1_555 O DG  20   O6    ? ? P C   7    T DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? N  C   7  O2    ? ? ? 1_555 O DG  20   N2    ? ? P C   7    T DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? N  A   8  N1    ? ? ? 1_555 O BRU 19   N3    ? ? P A   8    T BRU 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? N  A   8  N6    ? ? ? 1_555 O BRU 19   O4    ? ? P A   8    T BRU 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? N  G   9  N1    ? ? ? 1_555 O DC  18   N3    ? ? P G   9    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? N  G   9  N2    ? ? ? 1_555 O DC  18   O2    ? ? P G   9    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? N  G   9  O6    ? ? ? 1_555 O DC  18   N4    ? ? P G   9    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? N  G   10 N1    ? ? ? 1_555 O DC  17   N3    ? ? P G   10   T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? N  G   10 N2    ? ? ? 1_555 O DC  17   O2    ? ? P G   10   T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? N  G   10 O6    ? ? ? 1_555 O DC  17   N4    ? ? P G   10   T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? N  A   11 N1    ? ? ? 1_555 O DT  16   N3    ? ? P A   11   T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? N  A   11 N6    ? ? ? 1_555 O DT  16   O4    ? ? P A   11   T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 447  A . ? GLN 447  A PRO 448  A ? PRO 448  A 1 1.03  
2  LEU 1176 A . ? LEU 1176 A LEU 1177 A ? LEU 1177 A 1 -0.94 
3  LEU 1177 A . ? LEU 1177 A ASP 1178 A ? ASP 1178 A 1 2.57  
4  ALA 1181 A . ? ALA 1181 A GLU 1182 A ? GLU 1182 A 1 -5.11 
5  THR 339  B . ? THR 339  B ALA 340  B ? ALA 340  B 1 8.06  
6  GLY 467  B . ? GLY 467  B GLU 468  B ? GLU 468  B 1 4.73  
7  LYS 470  B . ? LYS 470  B LYS 471  B ? LYS 471  B 1 0.38  
8  PRO 128  E . ? PRO 128  E PRO 129  E ? PRO 129  E 1 1.11  
9  ASN 126  G . ? ASN 126  G PRO 127  G ? PRO 127  G 1 3.48  
10 LYS 92   P . ? LYS 316  X LYS 93   P ? LYS 317  X 1 -1.83 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 3  ? 
AE ? 2  ? 
AF ? 14 ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 3  ? 
AK ? 2  ? 
AL ? 3  ? 
AM ? 2  ? 
AN ? 4  ? 
AO ? 2  ? 
AP ? 5  ? 
DA ? 7  ? 
DB ? 5  ? 
BA ? 3  ? 
BB ? 2  ? 
BC ? 3  ? 
BD ? 4  ? 
BE ? 5  ? 
BF ? 2  ? 
BG ? 2  ? 
BH ? 2  ? 
BI ? 4  ? 
BJ ? 4  ? 
BK ? 5  ? 
BL ? 5  ? 
BM ? 2  ? 
BN ? 14 ? 
BO ? 2  ? 
BP ? 2  ? 
BQ ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
CD ? 2  ? 
DC ? 2  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
GA ? 12 ? 
GB ? 3  ? 
HA ? 16 ? 
IA ? 3  ? 
IB ? 4  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DA 5 6 ? anti-parallel 
DA 6 7 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? anti-parallel 
DB 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? parallel      
BD 3 4 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BE 4 5 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? parallel      
BH 1 2 ? anti-parallel 
BI 1 2 ? parallel      
BI 2 3 ? anti-parallel 
BI 3 4 ? parallel      
BJ 1 2 ? parallel      
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BK 1 2 ? anti-parallel 
BK 2 3 ? anti-parallel 
BK 3 4 ? parallel      
BK 4 5 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BM 1 2 ? parallel      
BN 1 2 ? anti-parallel 
BN 3 4 ? parallel      
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BN 7 8 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BQ 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? parallel      
GA 1 2 ? anti-parallel 
GA 6 7 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
HA 1 2 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 8 9 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA 2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
AA 3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
AB 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AB 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AC 1 ASP A 151  ? PRO A 153  ? ASP A 151  PRO A 153  
AC 2 LEU A 161  ? SER A 163  ? LEU A 161  SER A 163  
AD 1 ARG A 175  ? ASP A 177  ? ARG A 175  ASP A 177  
AD 2 LYS A 180  ? TRP A 185  ? LYS A 180  TRP A 185  
AD 3 GLU A 198  ? LEU A 202  ? GLU A 198  LEU A 202  
AE 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AE 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AF 1 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AF 2 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AF 3 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AF 4 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AF 5 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AF 6 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AF 7 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AF 8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AG 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AG 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AG 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AG 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AH 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AH 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AI 1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
AI 2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
AJ 1 LEU A 588  ? GLN A 589  ? LEU A 588  GLN A 589  
AJ 2 LEU A 606  ? ILE A 607  ? LEU A 606  ILE A 607  
AJ 3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
AK 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AK 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AL 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AL 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AL 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AM 1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
AM 2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
AN 1 GLU A 1280 ? PRO A 1292 ? GLU A 1280 PRO A 1292 
AN 2 TYR A 1298 ? ASP A 1309 ? TYR A 1298 ASP A 1309 
AN 3 SER A 1115 ? TYR A 1119 ? SER A 1115 TYR A 1119 
AN 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AO 1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
AO 2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
AP 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AP 2 LEU A 1236 ? VAL A 1242 ? LEU A 1236 VAL A 1242 
AP 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AP 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AP 5 LEU I 42   ? ARG I 45   ? LEU I 42   ARG I 45   
DA 1 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
DA 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
DA 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
DA 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
DA 5 ASP A 1442 ? ILE A 1445 ? ASP A 1442 ILE A 1445 
DA 6 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
DA 7 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
DB 1 ILE D 48   ? ALA D 49   ? ILE D 48   ALA D 49   
DB 2 PHE G 3    ? LEU G 13   ? PHE G 3    LEU G 13   
DB 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
DB 4 GLY G 43   ? VAL G 48   ? GLY G 43   VAL G 48   
DB 5 CYS G 38   ? THR G 39   ? CYS G 38   THR G 39   
BA 1 PHE B 92   ? VAL B 97   ? PHE B 92   VAL B 97   
BA 2 SER B 125  ? VAL B 132  ? SER B 125  VAL B 132  
BA 3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
BB 1 MET B 101  ? VAL B 102  ? MET B 101  VAL B 102  
BB 2 HIS B 110  ? ALA B 111  ? HIS B 110  ALA B 111  
BC 1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
BC 2 SER B 208  ? LEU B 212  ? SER B 208  LEU B 212  
BC 3 SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
BD 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
BD 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
BD 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
BD 4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
BE 1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
BE 2 ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
BE 3 SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
BE 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
BE 5 ILE B 280  ? PRO B 281  ? ILE B 280  PRO B 281  
BF 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
BF 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BG 1 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BG 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BH 1 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BH 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BI 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BI 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BI 4 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BJ 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BJ 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BJ 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BJ 4 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BK 1 GLU B 564  ? PRO B 565  ? GLU B 564  PRO B 565  
BK 2 TRP B 586  ? HIS B 590  ? TRP B 586  HIS B 590  
BK 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
BK 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
BK 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
BL 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
BL 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
BL 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
BL 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
BL 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
BM 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
BM 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
BN 1 GLN B 821  ? ILE B 827  ? GLN B 821  ILE B 827  
BN 2 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
BN 3 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
BN 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
BN 5 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
BN 6 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
BN 7 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
BN 8 GLN B 821  ? ILE B 827  ? GLN B 821  ILE B 827  
BO 1 THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
BO 2 LYS B 914  ? THR B 915  ? LYS B 914  THR B 915  
BP 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
BP 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
BQ 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
BQ 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
CA 1 VAL C 8    ? ALA C 13   ? VAL C 8    ALA C 13   
CA 2 ASN C 17   ? LEU C 22   ? ASN C 17   LEU C 22   
CA 3 PHE C 228  ? GLU C 233  ? PHE C 228  GLU C 233  
CA 4 GLU C 177  ? TYR C 180  ? GLU C 177  TYR C 180  
CB 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
CB 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
CB 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
CB 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
CB 5 VAL L 65   ? PHE L 67   ? VAL L 65   PHE L 67   
CC 1 LEU C 72   ? SER C 74   ? LEU C 72   SER C 74   
CC 2 ILE C 129  ? PRO C 132  ? ILE C 129  PRO C 132  
CD 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
CD 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
DC 1 LYS D 36   ? ILE D 38   ? LYS D 36   ILE D 38   
DC 2 GLU D 44   ? GLU D 46   ? GLU D 44   GLU D 46   
EA 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
EA 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
EA 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
EA 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
EB 1 SER E 87   ? VAL E 88   ? SER E 87   VAL E 88   
EB 2 ASN E 115  ? ILE E 116  ? ASN E 115  ILE E 116  
EC 1 LYS E 152  ? ARG E 155  ? LYS E 152  ARG E 155  
EC 2 VAL E 195  ? ARG E 200  ? VAL E 195  ARG E 200  
EC 3 TYR E 208  ? MET E 215  ? TYR E 208  MET E 215  
EC 4 ARG E 177  ? GLN E 179  ? ARG E 177  GLN E 179  
GA 1 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
GA 2 ARG G 142  ? ILE G 151  ? ARG G 142  ILE G 151  
GA 3 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
GA 4 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
GA 5 HIS G 158  ? SER G 162  ? HIS G 158  SER G 162  
GA 6 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
GA 7 ARG G 142  ? ILE G 151  ? ARG G 142  ILE G 151  
GB 1 THR G 120  ? ASN G 122  ? THR G 120  ASN G 122  
GB 2 SER G 129  ? GLN G 131  ? SER G 129  GLN G 131  
GB 3 VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
HA 1 ASP H 7    ? ASP H 16   ? ASP H 7    ASP H 16   
HA 2 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
HA 3 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
HA 4 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
HA 5 TYR H 95   ? GLU H 106  ? TYR H 95   GLU H 106  
HA 6 ALA H 140  ? ARG H 145  ? ALA H 140  ARG H 145  
HA 7 ILE H 112  ? PHE H 118  ? ILE H 112  PHE H 118  
HA 8 LEU H 121  ? GLU H 126  ? LEU H 121  GLU H 126  
HA 9 SER H 54   ? THR H 58   ? SER H 54   THR H 58   
IA 1 LEU I 14   ? ASP I 19   ? LEU I 14   ASP I 19   
IA 2 ARG I 24   ? CYS I 29   ? ARG I 24   CYS I 29   
IA 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
IB 1 ARG I 70   ? SER I 71   ? ARG I 70   SER I 71   
IB 2 ASN I 83   ? GLN I 87   ? ASN I 83   GLN I 87   
IB 3 LEU I 99   ? CYS I 103  ? LEU I 99   CYS I 103  
IB 4 ILE I 109  ? THR I 111  ? ILE I 109  THR I 111  
KA 1 LEU K 19   ? PRO K 23   ? LEU K 19   PRO K 23   
KA 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
KA 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
KA 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1419 ? N ASP A 1419 O VAL A 17   ? O VAL A 17   
AA 2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AB 1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AC 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AD 1 2 N ASP A 177  ? N ASP A 177  O LYS A 180  ? O LYS A 180  
AD 2 3 N TRP A 185  ? N TRP A 185  O GLU A 198  ? O GLU A 198  
AE 1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
AF 1 2 N ARG A 350  ? N ARG A 350  O HIS B 1104 ? O HIS B 1104 
AF 3 4 N VAL A 364  ? N VAL A 364  O ARG A 459  ? O ARG A 459  
AF 4 5 N HIS A 458  ? N HIS A 458  O VAL A 442  ? O VAL A 442  
AF 5 6 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AF 6 7 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AF 7 8 N ARG B 1106 ? N ARG B 1106 O SER A 348  ? O SER A 348  
AG 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AG 2 3 O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AG 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AH 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AI 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AJ 1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
AJ 2 3 O LEU A 606  ? O LEU A 606  N ILE A 613  ? N ILE A 613  
AK 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AL 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AL 2 3 O THR A 856  ? O THR A 856  N ILE A 864  ? N ILE A 864  
AM 1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AN 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
AN 2 3 N THR A 1308 ? N THR A 1308 O LEU A 1116 ? O LEU A 1116 
AN 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AO 1 2 O THR A 1141 ? O THR A 1141 N LEU A 1273 ? N LEU A 1273 
AP 1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AP 2 3 N CYS A 1240 ? N CYS A 1240 O LEU A 1193 ? O LEU A 1193 
AP 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AP 4 5 O ILE A 1152 ? O ILE A 1152 N VAL I 43   ? N VAL I 43   
DA 1 2 N ILE D 48   ? N ILE D 48   O ILE G 4    ? O ILE G 4    
DA 2 3 N LEU G 13   ? N LEU G 13   O ALA G 68   ? O ALA G 68   
DA 3 4 N GLU G 69   ? N GLU G 69   O ARG G 60   ? O ARG G 60   
DA 4 5 N ILE G 61   ? N ILE G 61   O VAL A 1443 ? O VAL A 1443 
DA 5 6 N MET A 1444 ? N MET A 1444 O VAL F 133  ? O VAL F 133  
DA 6 7 N ARG F 136  ? N ARG F 136  O GLU F 144  ? O GLU F 144  
DB 1 2 N ILE D 48   ? N ILE D 48   O ILE G 4    ? O ILE G 4    
DB 2 3 N LEU G 13   ? N LEU G 13   O ALA G 68   ? O ALA G 68   
DB 3 4 O PHE G 79   ? O PHE G 79   N TYR G 44   ? N TYR G 44   
DB 4 5 N GLY G 43   ? N GLY G 43   O THR G 39   ? O THR G 39   
BA 1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
BA 2 3 N VAL B 130  ? N VAL B 130  O VAL B 165  ? O VAL B 165  
BB 1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
BC 1 2 N ILE B 205  ? N ILE B 205  O SER B 208  ? O SER B 208  
BC 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
BD 1 2 N ASP B 407  ? N ASP B 407  O GLN B 215  ? O GLN B 215  
BD 2 3 N ALA B 214  ? N ALA B 214  O ARG B 497  ? O ARG B 497  
BD 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
BE 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
BE 2 3 N SER B 242  ? N SER B 242  O SER B 252  ? O SER B 252  
BE 3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
BE 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
BF 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
BG 1 2 N GLU B 650  ? N GLU B 650  O GLU B 641  ? O GLU B 641  
BH 1 2 N ILE B 693  ? N ILE B 693  O ARG B 635  ? O ARG B 635  
BI 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BI 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BI 3 4 N GLU B 641  ? N GLU B 641  O GLU B 650  ? O GLU B 650  
BJ 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BJ 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BJ 3 4 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
BK 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
BK 2 3 N HIS B 590  ? N HIS B 590  O THR B 578  ? O THR B 578  
BK 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
BK 4 5 N PHE B 627  ? N PHE B 627  O SER B 614  ? O SER B 614  
BL 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
BL 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
BL 3 4 N ARG B 969  ? N ARG B 969  O ILE B 948  ? O ILE B 948  
BL 4 5 N GLY B 947  ? N GLY B 947  O VAL B 905  ? O VAL B 905  
BM 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
BN 1 2 N ILE B 827  ? N ILE B 827  O PHE B 1086 ? O PHE B 1086 
BN 3 4 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
BN 4 5 N GLY B 988  ? N GLY B 988  O PHE B 980  ? O PHE B 980  
BN 5 6 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
BN 7 8 N TYR B 1092 ? N TYR B 1092 O GLN B 821  ? O GLN B 821  
BO 1 2 N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
BP 1 2 N ILE B 911  ? N ILE B 911  O THR B 939  ? O THR B 939  
BQ 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
CA 1 2 N ARG C 11   ? N ARG C 11   O ASP C 19   ? O ASP C 19   
CA 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
CA 3 4 N ASN C 231  ? N ASN C 231  O GLU C 177  ? O GLU C 177  
CB 1 2 N VAL C 119  ? N VAL C 119  O THR C 100  ? O THR C 100  
CB 2 3 N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
CB 3 4 N GLY C 162  ? N GLY C 162  O THR C 43   ? O THR C 43   
CB 4 5 N VAL C 51   ? N VAL C 51   O VAL L 65   ? O VAL L 65   
CC 1 2 O GLN C 73   ? O GLN C 73   N GLY C 130  ? N GLY C 130  
CD 1 2 O VAL C 113  ? O VAL C 113  N ILE C 144  ? N ILE C 144  
DC 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
EA 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
EA 2 3 N TRP E 79   ? N TRP E 79   O THR E 107  ? O THR E 107  
EA 3 4 N GLY E 108  ? N GLY E 108  O THR E 131  ? O THR E 131  
EB 1 2 N VAL E 88   ? N VAL E 88   O ASN E 115  ? O ASN E 115  
EC 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
EC 2 3 N ARG E 200  ? N ARG E 200  O TYR E 208  ? O TYR E 208  
EC 3 4 N MET E 215  ? N MET E 215  O ILE E 178  ? O ILE E 178  
GA 1 2 N GLY G 89   ? N GLY G 89   O ILE G 143  ? O ILE G 143  
GA 6 7 N GLY G 169  ? N GLY G 169  O ARG G 144  ? O ARG G 144  
GB 1 2 N ASN G 122  ? N ASN G 122  O SER G 129  ? O SER G 129  
GB 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
HA 1 2 N PHE H 10   ? N PHE H 10   O LEU H 55   ? O LEU H 55   
HA 5 6 N GLY H 99   ? N GLY H 99   O ALA H 140  ? O ALA H 140  
HA 8 9 N ARG H 145  ? N ARG H 145  O THR H 56   ? O THR H 56   
IA 1 2 N ASP I 19   ? N ASP I 19   O ARG I 24   ? O ARG I 24   
IA 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
IB 1 2 N SER I 71   ? N SER I 71   O ASN I 83   ? O ASN I 83   
IB 2 3 N PHE I 86   ? N PHE I 86   O PHE I 100  ? O PHE I 100  
IB 3 4 N PHE I 101  ? N PHE I 101  O PHE I 110  ? O PHE I 110  
KA 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
KA 2 3 N PHE K 35   ? N PHE K 35   O PHE K 71   ? O PHE K 71   
KA 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE EPE A 2459' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2456'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2457'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 2458'  
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 2225'  
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 1269'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 1121'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 1122'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN J 1066'  
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN L 1071'  
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 2456'  
BC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EPE G 1172' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ARG A 28   ? ARG A 28   . ? 1_555 ? 
2  AC1 11 ALA A 29   ? ALA A 29   . ? 1_555 ? 
3  AC1 11 SER A 31   ? SER A 31   . ? 1_555 ? 
4  AC1 11 LYS A 34   ? LYS A 34   . ? 1_555 ? 
5  AC1 11 ARG A 36   ? ARG A 36   . ? 1_555 ? 
6  AC1 11 HIS A 83   ? HIS A 83   . ? 1_555 ? 
7  AC1 11 ALA D 188  ? ALA D 188  . ? 3_654 ? 
8  AC1 11 ASP D 189  ? ASP D 189  . ? 3_654 ? 
9  AC1 11 ASP D 204  ? ASP D 204  . ? 3_654 ? 
10 AC1 11 GLU D 208  ? GLU D 208  . ? 3_654 ? 
11 AC1 11 EPE W .    ? EPE G 1172 . ? 3_654 ? 
12 AC2 4  CYS A 107  ? CYS A 107  . ? 1_555 ? 
13 AC2 4  CYS A 110  ? CYS A 110  . ? 1_555 ? 
14 AC2 4  CYS A 148  ? CYS A 148  . ? 1_555 ? 
15 AC2 4  CYS A 167  ? CYS A 167  . ? 1_555 ? 
16 AC3 4  CYS A 67   ? CYS A 67   . ? 1_555 ? 
17 AC3 4  CYS A 70   ? CYS A 70   . ? 1_555 ? 
18 AC3 4  CYS A 77   ? CYS A 77   . ? 1_555 ? 
19 AC3 4  HIS A 80   ? HIS A 80   . ? 1_555 ? 
20 AC4 4  ASP A 481  ? ASP A 481  . ? 1_555 ? 
21 AC4 4  ASP A 483  ? ASP A 483  . ? 1_555 ? 
22 AC4 4  ASP A 485  ? ASP A 485  . ? 1_555 ? 
23 AC4 4  A   N 11   ? A   P 11   . ? 1_555 ? 
24 AC5 4  CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
25 AC5 4  CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
26 AC5 4  CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
27 AC5 4  CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
28 AC6 4  CYS C 86   ? CYS C 86   . ? 1_555 ? 
29 AC6 4  CYS C 88   ? CYS C 88   . ? 1_555 ? 
30 AC6 4  CYS C 92   ? CYS C 92   . ? 1_555 ? 
31 AC6 4  CYS C 95   ? CYS C 95   . ? 1_555 ? 
32 AC7 4  CYS I 7    ? CYS I 7    . ? 1_555 ? 
33 AC7 4  CYS I 10   ? CYS I 10   . ? 1_555 ? 
34 AC7 4  CYS I 29   ? CYS I 29   . ? 1_555 ? 
35 AC7 4  CYS I 32   ? CYS I 32   . ? 1_555 ? 
36 AC8 4  CYS I 75   ? CYS I 75   . ? 1_555 ? 
37 AC8 4  CYS I 78   ? CYS I 78   . ? 1_555 ? 
38 AC8 4  CYS I 103  ? CYS I 103  . ? 1_555 ? 
39 AC8 4  CYS I 106  ? CYS I 106  . ? 1_555 ? 
40 AC9 4  CYS J 7    ? CYS J 7    . ? 1_555 ? 
41 AC9 4  CYS J 10   ? CYS J 10   . ? 1_555 ? 
42 AC9 4  CYS J 45   ? CYS J 45   . ? 1_555 ? 
43 AC9 4  CYS J 46   ? CYS J 46   . ? 1_555 ? 
44 BC1 4  CYS L 31   ? CYS L 31   . ? 1_555 ? 
45 BC1 4  CYS L 34   ? CYS L 34   . ? 1_555 ? 
46 BC1 4  CYS L 48   ? CYS L 48   . ? 1_555 ? 
47 BC1 4  CYS L 51   ? CYS L 51   . ? 1_555 ? 
48 BC2 4  CYS A 107  ? CYS A 107  . ? 1_555 ? 
49 BC2 4  CYS A 110  ? CYS A 110  . ? 1_555 ? 
50 BC2 4  CYS A 148  ? CYS A 148  . ? 1_555 ? 
51 BC2 4  CYS A 167  ? CYS A 167  . ? 1_555 ? 
52 BC3 7  ALA A 29   ? ALA A 29   . ? 3_654 ? 
53 BC3 7  SER A 31   ? SER A 31   . ? 3_654 ? 
54 BC3 7  VAL A 32   ? VAL A 32   . ? 3_654 ? 
55 BC3 7  LYS A 34   ? LYS A 34   . ? 3_654 ? 
56 BC3 7  EPE T .    ? EPE A 2459 . ? 3_654 ? 
57 BC3 7  ASP D 189  ? ASP D 189  . ? 1_555 ? 
58 BC3 7  TYR G 167  ? TYR G 167  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BY7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BY7 
_atom_sites.fract_transf_matrix[1][1]   0.004494 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002560 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003546 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
H  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . VAL A  1  2    ? 112.521 27.514  -24.897 1.00 122.20 ? 2    VAL A N     1 
ATOM   2     C  CA    . VAL A  1  2    ? 112.411 28.749  -25.688 1.00 121.95 ? 2    VAL A CA    1 
ATOM   3     C  C     . VAL A  1  2    ? 111.983 28.396  -27.151 1.00 123.94 ? 2    VAL A C     1 
ATOM   4     O  O     . VAL A  1  2    ? 112.822 27.940  -27.948 1.00 125.17 ? 2    VAL A O     1 
ATOM   5     C  CB    . VAL A  1  2    ? 113.674 29.689  -25.567 1.00 126.10 ? 2    VAL A CB    1 
ATOM   6     C  CG1   . VAL A  1  2    ? 114.969 29.056  -26.093 1.00 126.16 ? 2    VAL A CG1   1 
ATOM   7     C  CG2   . VAL A  1  2    ? 113.432 31.046  -26.206 1.00 126.12 ? 2    VAL A CG2   1 
ATOM   8     N  N     . GLY A  1  3    ? 110.669 28.542  -27.444 1.00 115.55 ? 3    GLY A N     1 
ATOM   9     C  CA    . GLY A  1  3    ? 110.063 28.196  -28.734 1.00 112.83 ? 3    GLY A CA    1 
ATOM   10    C  C     . GLY A  1  3    ? 109.943 26.695  -28.947 1.00 110.97 ? 3    GLY A C     1 
ATOM   11    O  O     . GLY A  1  3    ? 108.956 26.263  -29.538 1.00 110.94 ? 3    GLY A O     1 
ATOM   12    N  N     . GLN A  1  4    ? 110.964 25.890  -28.439 1.00 102.65 ? 4    GLN A N     1 
ATOM   13    C  CA    . GLN A  1  4    ? 111.203 24.422  -28.403 1.00 99.70  ? 4    GLN A CA    1 
ATOM   14    C  C     . GLN A  1  4    ? 111.401 23.777  -29.760 1.00 99.18  ? 4    GLN A C     1 
ATOM   15    O  O     . GLN A  1  4    ? 110.621 24.063  -30.657 1.00 100.25 ? 4    GLN A O     1 
ATOM   16    C  CB    . GLN A  1  4    ? 110.103 23.685  -27.633 1.00 100.68 ? 4    GLN A CB    1 
ATOM   17    C  CG    . GLN A  1  4    ? 110.254 23.781  -26.133 1.00 118.28 ? 4    GLN A CG    1 
ATOM   18    C  CD    . GLN A  1  4    ? 111.127 22.680  -25.606 1.00 144.77 ? 4    GLN A CD    1 
ATOM   19    O  OE1   . GLN A  1  4    ? 112.361 22.720  -25.723 1.00 142.31 ? 4    GLN A OE1   1 
ATOM   20    N  NE2   . GLN A  1  4    ? 110.496 21.674  -25.009 1.00 137.22 ? 4    GLN A NE2   1 
ATOM   21    N  N     . GLN A  1  5    ? 112.392 22.873  -29.915 1.00 91.70  ? 5    GLN A N     1 
ATOM   22    C  CA    . GLN A  1  5    ? 112.672 22.147  -31.187 1.00 91.14  ? 5    GLN A CA    1 
ATOM   23    C  C     . GLN A  1  5    ? 113.679 22.910  -32.082 1.00 90.58  ? 5    GLN A C     1 
ATOM   24    O  O     . GLN A  1  5    ? 113.563 24.113  -32.224 1.00 89.26  ? 5    GLN A O     1 
ATOM   25    C  CB    . GLN A  1  5    ? 111.361 21.776  -31.938 1.00 93.24  ? 5    GLN A CB    1 
ATOM   26    C  CG    . GLN A  1  5    ? 111.491 21.097  -33.306 1.00 119.35 ? 5    GLN A CG    1 
ATOM   27    C  CD    . GLN A  1  5    ? 110.148 20.943  -34.012 1.00 138.82 ? 5    GLN A CD    1 
ATOM   28    O  OE1   . GLN A  1  5    ? 109.081 21.355  -33.500 1.00 134.23 ? 5    GLN A OE1   1 
ATOM   29    N  NE2   . GLN A  1  5    ? 110.175 20.345  -35.215 1.00 121.38 ? 5    GLN A NE2   1 
ATOM   30    N  N     . TYR A  1  6    ? 114.683 22.218  -32.644 1.00 85.36  ? 6    TYR A N     1 
ATOM   31    C  CA    . TYR A  1  6    ? 115.731 22.864  -33.439 1.00 84.96  ? 6    TYR A CA    1 
ATOM   32    C  C     . TYR A  1  6    ? 115.260 23.473  -34.739 1.00 87.75  ? 6    TYR A C     1 
ATOM   33    O  O     . TYR A  1  6    ? 114.637 22.785  -35.545 1.00 89.63  ? 6    TYR A O     1 
ATOM   34    C  CB    . TYR A  1  6    ? 116.911 21.902  -33.716 1.00 86.78  ? 6    TYR A CB    1 
ATOM   35    C  CG    . TYR A  1  6    ? 117.921 22.405  -34.736 1.00 89.22  ? 6    TYR A CG    1 
ATOM   36    C  CD1   . TYR A  1  6    ? 118.857 23.380  -34.400 1.00 91.72  ? 6    TYR A CD1   1 
ATOM   37    C  CD2   . TYR A  1  6    ? 117.943 21.902  -36.032 1.00 90.50  ? 6    TYR A CD2   1 
ATOM   38    C  CE1   . TYR A  1  6    ? 119.784 23.850  -35.334 1.00 93.69  ? 6    TYR A CE1   1 
ATOM   39    C  CE2   . TYR A  1  6    ? 118.855 22.374  -36.979 1.00 91.80  ? 6    TYR A CE2   1 
ATOM   40    C  CZ    . TYR A  1  6    ? 119.780 23.341  -36.623 1.00 98.60  ? 6    TYR A CZ    1 
ATOM   41    O  OH    . TYR A  1  6    ? 120.684 23.804  -37.550 1.00 98.86  ? 6    TYR A OH    1 
ATOM   42    N  N     . SER A  1  7    ? 115.652 24.728  -34.984 1.00 80.74  ? 7    SER A N     1 
ATOM   43    C  CA    . SER A  1  7    ? 115.400 25.399  -36.243 1.00 80.09  ? 7    SER A CA    1 
ATOM   44    C  C     . SER A  1  7    ? 116.748 25.711  -36.862 1.00 83.78  ? 7    SER A C     1 
ATOM   45    O  O     . SER A  1  7    ? 117.641 26.213  -36.172 1.00 83.43  ? 7    SER A O     1 
ATOM   46    C  CB    . SER A  1  7    ? 114.597 26.675  -36.041 1.00 82.66  ? 7    SER A CB    1 
ATOM   47    O  OG    . SER A  1  7    ? 114.545 27.406  -37.257 1.00 89.49  ? 7    SER A OG    1 
ATOM   48    N  N     . SER A  1  8    ? 116.904 25.418  -38.163 1.00 80.15  ? 8    SER A N     1 
ATOM   49    C  CA    . SER A  1  8    ? 118.162 25.656  -38.869 1.00 79.83  ? 8    SER A CA    1 
ATOM   50    C  C     . SER A  1  8    ? 118.416 27.120  -39.153 1.00 82.94  ? 8    SER A C     1 
ATOM   51    O  O     . SER A  1  8    ? 119.506 27.449  -39.622 1.00 83.62  ? 8    SER A O     1 
ATOM   52    C  CB    . SER A  1  8    ? 118.194 24.876  -40.173 1.00 84.58  ? 8    SER A CB    1 
ATOM   53    O  OG    . SER A  1  8    ? 117.217 25.374  -41.071 1.00 95.08  ? 8    SER A OG    1 
ATOM   54    N  N     . ALA A  1  9    ? 117.398 27.994  -38.913 1.00 77.82  ? 9    ALA A N     1 
ATOM   55    C  CA    . ALA A  1  9    ? 117.447 29.444  -39.144 1.00 76.81  ? 9    ALA A CA    1 
ATOM   56    C  C     . ALA A  1  9    ? 118.498 30.106  -38.262 1.00 78.86  ? 9    ALA A C     1 
ATOM   57    O  O     . ALA A  1  9    ? 118.688 29.682  -37.118 1.00 79.39  ? 9    ALA A O     1 
ATOM   58    C  CB    . ALA A  1  9    ? 116.081 30.066  -38.887 1.00 77.28  ? 9    ALA A CB    1 
ATOM   59    N  N     . PRO A  1  10   ? 119.216 31.122  -38.767 1.00 73.94  ? 10   PRO A N     1 
ATOM   60    C  CA    . PRO A  1  10   ? 120.251 31.765  -37.942 1.00 73.35  ? 10   PRO A CA    1 
ATOM   61    C  C     . PRO A  1  10   ? 119.692 32.591  -36.789 1.00 76.57  ? 10   PRO A C     1 
ATOM   62    O  O     . PRO A  1  10   ? 118.807 33.416  -37.000 1.00 76.76  ? 10   PRO A O     1 
ATOM   63    C  CB    . PRO A  1  10   ? 121.012 32.633  -38.940 1.00 76.26  ? 10   PRO A CB    1 
ATOM   64    C  CG    . PRO A  1  10   ? 120.027 32.934  -40.013 1.00 81.76  ? 10   PRO A CG    1 
ATOM   65    C  CD    . PRO A  1  10   ? 119.139 31.727  -40.109 1.00 77.16  ? 10   PRO A CD    1 
ATOM   66    N  N     . LEU A  1  11   ? 120.200 32.352  -35.570 1.00 72.20  ? 11   LEU A N     1 
ATOM   67    C  CA    . LEU A  1  11   ? 119.758 33.077  -34.384 1.00 70.95  ? 11   LEU A CA    1 
ATOM   68    C  C     . LEU A  1  11   ? 120.469 34.414  -34.274 1.00 76.20  ? 11   LEU A C     1 
ATOM   69    O  O     . LEU A  1  11   ? 121.698 34.463  -34.184 1.00 77.15  ? 11   LEU A O     1 
ATOM   70    C  CB    . LEU A  1  11   ? 119.952 32.244  -33.109 1.00 69.78  ? 11   LEU A CB    1 
ATOM   71    C  CG    . LEU A  1  11   ? 119.660 32.937  -31.785 1.00 73.21  ? 11   LEU A CG    1 
ATOM   72    C  CD1   . LEU A  1  11   ? 118.188 32.960  -31.492 1.00 73.42  ? 11   LEU A CD1   1 
ATOM   73    C  CD2   . LEU A  1  11   ? 120.358 32.244  -30.658 1.00 75.88  ? 11   LEU A CD2   1 
ATOM   74    N  N     . ARG A  1  12   ? 119.686 35.490  -34.262 1.00 71.99  ? 12   ARG A N     1 
ATOM   75    C  CA    . ARG A  1  12   ? 120.180 36.852  -34.148 1.00 72.05  ? 12   ARG A CA    1 
ATOM   76    C  C     . ARG A  1  12   ? 119.347 37.631  -33.115 1.00 75.88  ? 12   ARG A C     1 
ATOM   77    O  O     . ARG A  1  12   ? 118.259 37.188  -32.723 1.00 74.63  ? 12   ARG A O     1 
ATOM   78    C  CB    . ARG A  1  12   ? 120.133 37.552  -35.515 1.00 73.99  ? 12   ARG A CB    1 
ATOM   79    C  CG    . ARG A  1  12   ? 121.174 37.101  -36.524 1.00 86.45  ? 12   ARG A CG    1 
ATOM   80    C  CD    . ARG A  1  12   ? 121.462 38.256  -37.446 1.00 97.44  ? 12   ARG A CD    1 
ATOM   81    N  NE    . ARG A  1  12   ? 122.064 37.850  -38.713 1.00 108.67 ? 12   ARG A NE    1 
ATOM   82    C  CZ    . ARG A  1  12   ? 122.166 38.650  -39.772 1.00 127.93 ? 12   ARG A CZ    1 
ATOM   83    N  NH1   . ARG A  1  12   ? 121.676 39.884  -39.730 1.00 110.69 ? 12   ARG A NH1   1 
ATOM   84    N  NH2   . ARG A  1  12   ? 122.723 38.209  -40.893 1.00 122.88 ? 12   ARG A NH2   1 
ATOM   85    N  N     . THR A  1  13   ? 119.885 38.776  -32.653 1.00 72.68  ? 13   THR A N     1 
ATOM   86    C  CA    . THR A  1  13   ? 119.211 39.659  -31.700 1.00 71.71  ? 13   THR A CA    1 
ATOM   87    C  C     . THR A  1  13   ? 118.673 40.862  -32.464 1.00 75.51  ? 13   THR A C     1 
ATOM   88    O  O     . THR A  1  13   ? 119.275 41.250  -33.476 1.00 77.16  ? 13   THR A O     1 
ATOM   89    C  CB    . THR A  1  13   ? 120.164 40.117  -30.594 1.00 79.32  ? 13   THR A CB    1 
ATOM   90    O  OG1   . THR A  1  13   ? 121.263 40.806  -31.180 1.00 85.09  ? 13   THR A OG1   1 
ATOM   91    C  CG2   . THR A  1  13   ? 120.660 38.984  -29.744 1.00 75.66  ? 13   THR A CG2   1 
ATOM   92    N  N     . VAL A  1  14   ? 117.542 41.438  -31.983 1.00 69.89  ? 14   VAL A N     1 
ATOM   93    C  CA    . VAL A  1  14   ? 116.862 42.612  -32.535 1.00 69.68  ? 14   VAL A CA    1 
ATOM   94    C  C     . VAL A  1  14   ? 117.749 43.821  -32.231 1.00 74.37  ? 14   VAL A C     1 
ATOM   95    O  O     . VAL A  1  14   ? 118.153 44.022  -31.082 1.00 73.71  ? 14   VAL A O     1 
ATOM   96    C  CB    . VAL A  1  14   ? 115.404 42.767  -32.008 1.00 72.87  ? 14   VAL A CB    1 
ATOM   97    C  CG1   . VAL A  1  14   ? 114.774 44.089  -32.463 1.00 73.29  ? 14   VAL A CG1   1 
ATOM   98    C  CG2   . VAL A  1  14   ? 114.530 41.585  -32.435 1.00 72.28  ? 14   VAL A CG2   1 
ATOM   99    N  N     . LYS A  1  15   ? 118.129 44.559  -33.286 1.00 71.53  ? 15   LYS A N     1 
ATOM   100   C  CA    . LYS A  1  15   ? 119.030 45.710  -33.201 1.00 71.55  ? 15   LYS A CA    1 
ATOM   101   C  C     . LYS A  1  15   ? 118.277 47.026  -33.467 1.00 77.37  ? 15   LYS A C     1 
ATOM   102   O  O     . LYS A  1  15   ? 118.722 48.086  -33.029 1.00 78.21  ? 15   LYS A O     1 
ATOM   103   C  CB    . LYS A  1  15   ? 120.228 45.553  -34.183 1.00 73.65  ? 15   LYS A CB    1 
ATOM   104   C  CG    . LYS A  1  15   ? 120.968 44.193  -34.149 1.00 86.17  ? 15   LYS A CG    1 
ATOM   105   C  CD    . LYS A  1  15   ? 122.034 44.043  -33.040 1.00 95.08  ? 15   LYS A CD    1 
ATOM   106   C  CE    . LYS A  1  15   ? 123.379 44.620  -33.427 1.00 107.27 ? 15   LYS A CE    1 
ATOM   107   N  NZ    . LYS A  1  15   ? 124.219 44.963  -32.246 1.00 114.89 ? 15   LYS A NZ    1 
ATOM   108   N  N     . GLU A  1  16   ? 117.146 46.956  -34.185 1.00 73.51  ? 16   GLU A N     1 
ATOM   109   C  CA    . GLU A  1  16   ? 116.341 48.115  -34.551 1.00 73.73  ? 16   GLU A CA    1 
ATOM   110   C  C     . GLU A  1  16   ? 114.861 47.755  -34.628 1.00 77.22  ? 16   GLU A C     1 
ATOM   111   O  O     . GLU A  1  16   ? 114.507 46.686  -35.139 1.00 77.64  ? 16   GLU A O     1 
ATOM   112   C  CB    . GLU A  1  16   ? 116.788 48.639  -35.922 1.00 76.13  ? 16   GLU A CB    1 
ATOM   113   C  CG    . GLU A  1  16   ? 117.855 49.712  -35.878 1.00 85.11  ? 16   GLU A CG    1 
ATOM   114   C  CD    . GLU A  1  16   ? 118.464 50.063  -37.221 1.00 103.63 ? 16   GLU A CD    1 
ATOM   115   O  OE1   . GLU A  1  16   ? 117.954 49.584  -38.264 1.00 89.20  ? 16   GLU A OE1   1 
ATOM   116   O  OE2   . GLU A  1  16   ? 119.458 50.828  -37.223 1.00 94.94  ? 16   GLU A OE2   1 
ATOM   117   N  N     . VAL A  1  17   ? 113.999 48.655  -34.155 1.00 72.19  ? 17   VAL A N     1 
ATOM   118   C  CA    . VAL A  1  17   ? 112.562 48.439  -34.234 1.00 71.78  ? 17   VAL A CA    1 
ATOM   119   C  C     . VAL A  1  17   ? 112.036 49.538  -35.118 1.00 77.34  ? 17   VAL A C     1 
ATOM   120   O  O     . VAL A  1  17   ? 112.091 50.708  -34.734 1.00 78.40  ? 17   VAL A O     1 
ATOM   121   C  CB    . VAL A  1  17   ? 111.841 48.360  -32.866 1.00 74.34  ? 17   VAL A CB    1 
ATOM   122   C  CG1   . VAL A  1  17   ? 110.352 48.103  -33.055 1.00 73.74  ? 17   VAL A CG1   1 
ATOM   123   C  CG2   . VAL A  1  17   ? 112.462 47.279  -31.980 1.00 73.45  ? 17   VAL A CG2   1 
ATOM   124   N  N     . GLN A  1  18   ? 111.591 49.169  -36.330 1.00 73.27  ? 18   GLN A N     1 
ATOM   125   C  CA    . GLN A  1  18   ? 111.082 50.108  -37.322 1.00 73.42  ? 18   GLN A CA    1 
ATOM   126   C  C     . GLN A  1  18   ? 109.570 50.174  -37.257 1.00 78.59  ? 18   GLN A C     1 
ATOM   127   O  O     . GLN A  1  18   ? 108.877 49.286  -37.763 1.00 79.73  ? 18   GLN A O     1 
ATOM   128   C  CB    . GLN A  1  18   ? 111.571 49.743  -38.738 1.00 75.13  ? 18   GLN A CB    1 
ATOM   129   C  CG    . GLN A  1  18   ? 111.098 50.688  -39.842 1.00 86.33  ? 18   GLN A CG    1 
ATOM   130   C  CD    . GLN A  1  18   ? 111.709 52.057  -39.742 1.00 101.81 ? 18   GLN A CD    1 
ATOM   131   O  OE1   . GLN A  1  18   ? 111.125 52.975  -39.158 1.00 92.44  ? 18   GLN A OE1   1 
ATOM   132   N  NE2   . GLN A  1  18   ? 112.905 52.215  -40.299 1.00 96.71  ? 18   GLN A NE2   1 
ATOM   133   N  N     . PHE A  1  19   ? 109.053 51.218  -36.602 1.00 73.93  ? 19   PHE A N     1 
ATOM   134   C  CA    . PHE A  1  19   ? 107.618 51.430  -36.506 1.00 72.69  ? 19   PHE A CA    1 
ATOM   135   C  C     . PHE A  1  19   ? 107.106 51.962  -37.847 1.00 80.13  ? 19   PHE A C     1 
ATOM   136   O  O     . PHE A  1  19   ? 107.865 52.569  -38.621 1.00 80.32  ? 19   PHE A O     1 
ATOM   137   C  CB    . PHE A  1  19   ? 107.277 52.376  -35.350 1.00 72.77  ? 19   PHE A CB    1 
ATOM   138   C  CG    . PHE A  1  19   ? 107.449 51.712  -34.021 1.00 72.29  ? 19   PHE A CG    1 
ATOM   139   C  CD1   . PHE A  1  19   ? 106.527 50.776  -33.568 1.00 74.35  ? 19   PHE A CD1   1 
ATOM   140   C  CD2   . PHE A  1  19   ? 108.568 51.962  -33.243 1.00 74.02  ? 19   PHE A CD2   1 
ATOM   141   C  CE1   . PHE A  1  19   ? 106.704 50.128  -32.342 1.00 73.74  ? 19   PHE A CE1   1 
ATOM   142   C  CE2   . PHE A  1  19   ? 108.748 51.306  -32.013 1.00 75.38  ? 19   PHE A CE2   1 
ATOM   143   C  CZ    . PHE A  1  19   ? 107.809 50.405  -31.568 1.00 72.02  ? 19   PHE A CZ    1 
ATOM   144   N  N     . GLY A  1  20   ? 105.839 51.682  -38.119 1.00 77.61  ? 20   GLY A N     1 
ATOM   145   C  CA    . GLY A  1  20   ? 105.173 52.087  -39.346 1.00 78.48  ? 20   GLY A CA    1 
ATOM   146   C  C     . GLY A  1  20   ? 103.697 51.761  -39.326 1.00 81.70  ? 20   GLY A C     1 
ATOM   147   O  O     . GLY A  1  20   ? 103.144 51.432  -38.275 1.00 80.21  ? 20   GLY A O     1 
ATOM   148   N  N     . LEU A  1  21   ? 103.059 51.850  -40.502 1.00 78.74  ? 21   LEU A N     1 
ATOM   149   C  CA    . LEU A  1  21   ? 101.642 51.578  -40.706 1.00 77.94  ? 21   LEU A CA    1 
ATOM   150   C  C     . LEU A  1  21   ? 101.457 50.568  -41.820 1.00 82.42  ? 21   LEU A C     1 
ATOM   151   O  O     . LEU A  1  21   ? 102.156 50.630  -42.836 1.00 83.59  ? 21   LEU A O     1 
ATOM   152   C  CB    . LEU A  1  21   ? 100.889 52.875  -41.057 1.00 78.29  ? 21   LEU A CB    1 
ATOM   153   C  CG    . LEU A  1  21   ? 100.719 53.907  -39.952 1.00 81.44  ? 21   LEU A CG    1 
ATOM   154   C  CD1   . LEU A  1  21   ? 99.979  55.133  -40.476 1.00 81.84  ? 21   LEU A CD1   1 
ATOM   155   C  CD2   . LEU A  1  21   ? 100.011 53.305  -38.730 1.00 81.97  ? 21   LEU A CD2   1 
ATOM   156   N  N     . PHE A  1  22   ? 100.494 49.658  -41.650 1.00 77.75  ? 22   PHE A N     1 
ATOM   157   C  CA    . PHE A  1  22   ? 100.185 48.670  -42.673 1.00 78.27  ? 22   PHE A CA    1 
ATOM   158   C  C     . PHE A  1  22   ? 99.487  49.290  -43.909 1.00 86.38  ? 22   PHE A C     1 
ATOM   159   O  O     . PHE A  1  22   ? 98.509  50.044  -43.761 1.00 88.19  ? 22   PHE A O     1 
ATOM   160   C  CB    . PHE A  1  22   ? 99.274  47.588  -42.093 1.00 79.06  ? 22   PHE A CB    1 
ATOM   161   C  CG    . PHE A  1  22   ? 99.933  46.342  -41.545 1.00 79.51  ? 22   PHE A CG    1 
ATOM   162   C  CD1   . PHE A  1  22   ? 100.788 45.582  -42.334 1.00 81.79  ? 22   PHE A CD1   1 
ATOM   163   C  CD2   . PHE A  1  22   ? 99.607  45.864  -40.280 1.00 80.56  ? 22   PHE A CD2   1 
ATOM   164   C  CE1   . PHE A  1  22   ? 101.357 44.413  -41.842 1.00 81.57  ? 22   PHE A CE1   1 
ATOM   165   C  CE2   . PHE A  1  22   ? 100.174 44.688  -39.793 1.00 82.18  ? 22   PHE A CE2   1 
ATOM   166   C  CZ    . PHE A  1  22   ? 101.037 43.967  -40.580 1.00 80.21  ? 22   PHE A CZ    1 
ATOM   167   N  N     . SER A  1  23   ? 99.983  48.968  -45.123 1.00 82.41  ? 23   SER A N     1 
ATOM   168   C  CA    . SER A  1  23   ? 99.308  49.351  -46.365 1.00 82.96  ? 23   SER A CA    1 
ATOM   169   C  C     . SER A  1  23   ? 98.211  48.277  -46.547 1.00 86.26  ? 23   SER A C     1 
ATOM   170   O  O     . SER A  1  23   ? 98.449  47.140  -46.122 1.00 85.08  ? 23   SER A O     1 
ATOM   171   C  CB    . SER A  1  23   ? 100.267 49.293  -47.547 1.00 87.42  ? 23   SER A CB    1 
ATOM   172   O  OG    . SER A  1  23   ? 101.203 48.234  -47.450 1.00 95.39  ? 23   SER A OG    1 
ATOM   173   N  N     . PRO A  1  24   ? 97.010  48.561  -47.119 1.00 83.34  ? 24   PRO A N     1 
ATOM   174   C  CA    . PRO A  1  24   ? 96.004  47.486  -47.256 1.00 83.26  ? 24   PRO A CA    1 
ATOM   175   C  C     . PRO A  1  24   ? 96.605  46.314  -48.015 1.00 88.99  ? 24   PRO A C     1 
ATOM   176   O  O     . PRO A  1  24   ? 96.424  45.162  -47.628 1.00 89.25  ? 24   PRO A O     1 
ATOM   177   C  CB    . PRO A  1  24   ? 94.863  48.142  -48.043 1.00 86.19  ? 24   PRO A CB    1 
ATOM   178   C  CG    . PRO A  1  24   ? 95.060  49.590  -47.886 1.00 91.14  ? 24   PRO A CG    1 
ATOM   179   C  CD    . PRO A  1  24   ? 96.528  49.827  -47.704 1.00 86.20  ? 24   PRO A CD    1 
ATOM   180   N  N     . GLU A  1  25   ? 97.417  46.645  -49.036 1.00 85.79  ? 25   GLU A N     1 
ATOM   181   C  CA    . GLU A  1  25   ? 98.157  45.763  -49.928 1.00 85.27  ? 25   GLU A CA    1 
ATOM   182   C  C     . GLU A  1  25   ? 99.027  44.770  -49.139 1.00 89.22  ? 25   GLU A C     1 
ATOM   183   O  O     . GLU A  1  25   ? 99.049  43.582  -49.484 1.00 89.98  ? 25   GLU A O     1 
ATOM   184   C  CB    . GLU A  1  25   ? 99.008  46.611  -50.882 1.00 86.92  ? 25   GLU A CB    1 
ATOM   185   C  CG    . GLU A  1  25   ? 98.198  47.488  -51.827 1.00 96.64  ? 25   GLU A CG    1 
ATOM   186   C  CD    . GLU A  1  25   ? 97.694  48.826  -51.309 1.00 123.99 ? 25   GLU A CD    1 
ATOM   187   O  OE1   . GLU A  1  25   ? 98.511  49.606  -50.767 1.00 122.33 ? 25   GLU A OE1   1 
ATOM   188   O  OE2   . GLU A  1  25   ? 96.491  49.120  -51.507 1.00 121.86 ? 25   GLU A OE2   1 
ATOM   189   N  N     . GLU A  1  26   ? 99.703  45.253  -48.056 1.00 83.57  ? 26   GLU A N     1 
ATOM   190   C  CA    . GLU A  1  26   ? 100.567 44.447  -47.174 1.00 81.00  ? 26   GLU A CA    1 
ATOM   191   C  C     . GLU A  1  26   ? 99.734  43.510  -46.321 1.00 82.36  ? 26   GLU A C     1 
ATOM   192   O  O     . GLU A  1  26   ? 100.129 42.354  -46.145 1.00 80.06  ? 26   GLU A O     1 
ATOM   193   C  CB    . GLU A  1  26   ? 101.471 45.337  -46.283 1.00 81.28  ? 26   GLU A CB    1 
ATOM   194   C  CG    . GLU A  1  26   ? 102.470 44.571  -45.419 1.00 89.40  ? 26   GLU A CG    1 
ATOM   195   C  CD    . GLU A  1  26   ? 103.599 45.328  -44.735 1.00 107.28 ? 26   GLU A CD    1 
ATOM   196   O  OE1   . GLU A  1  26   ? 103.516 46.573  -44.601 1.00 107.34 ? 26   GLU A OE1   1 
ATOM   197   O  OE2   . GLU A  1  26   ? 104.564 44.655  -44.303 1.00 91.47  ? 26   GLU A OE2   1 
ATOM   198   N  N     . VAL A  1  27   ? 98.590  44.018  -45.777 1.00 79.16  ? 27   VAL A N     1 
ATOM   199   C  CA    . VAL A  1  27   ? 97.672  43.265  -44.905 1.00 78.35  ? 27   VAL A CA    1 
ATOM   200   C  C     . VAL A  1  27   ? 97.195  42.020  -45.628 1.00 84.27  ? 27   VAL A C     1 
ATOM   201   O  O     . VAL A  1  27   ? 97.225  40.925  -45.049 1.00 83.42  ? 27   VAL A O     1 
ATOM   202   C  CB    . VAL A  1  27   ? 96.487  44.103  -44.387 1.00 81.90  ? 27   VAL A CB    1 
ATOM   203   C  CG1   . VAL A  1  27   ? 95.563  43.253  -43.529 1.00 81.47  ? 27   VAL A CG1   1 
ATOM   204   C  CG2   . VAL A  1  27   ? 96.958  45.331  -43.619 1.00 80.94  ? 27   VAL A CG2   1 
ATOM   205   N  N     . ARG A  1  28   ? 96.796  42.200  -46.911 1.00 82.40  ? 28   ARG A N     1 
ATOM   206   C  CA    . ARG A  1  28   ? 96.358  41.139  -47.793 1.00 83.49  ? 28   ARG A CA    1 
ATOM   207   C  C     . ARG A  1  28   ? 97.530  40.206  -48.041 1.00 89.79  ? 28   ARG A C     1 
ATOM   208   O  O     . ARG A  1  28   ? 97.376  39.007  -47.846 1.00 90.91  ? 28   ARG A O     1 
ATOM   209   C  CB    . ARG A  1  28   ? 95.833  41.703  -49.121 1.00 87.23  ? 28   ARG A CB    1 
ATOM   210   C  CG    . ARG A  1  28   ? 94.322  41.962  -49.153 1.00 106.48 ? 28   ARG A CG    1 
ATOM   211   C  CD    . ARG A  1  28   ? 93.806  42.410  -50.519 1.00 124.34 ? 28   ARG A CD    1 
ATOM   212   N  NE    . ARG A  1  28   ? 94.150  43.806  -50.830 1.00 143.42 ? 28   ARG A NE    1 
ATOM   213   C  CZ    . ARG A  1  28   ? 93.362  44.856  -50.601 1.00 161.90 ? 28   ARG A CZ    1 
ATOM   214   N  NH1   . ARG A  1  28   ? 92.169  44.693  -50.042 1.00 149.38 ? 28   ARG A NH1   1 
ATOM   215   N  NH2   . ARG A  1  28   ? 93.764  46.080  -50.929 1.00 149.65 ? 28   ARG A NH2   1 
ATOM   216   N  N     . ALA A  1  29   ? 98.715  40.748  -48.400 1.00 86.56  ? 29   ALA A N     1 
ATOM   217   C  CA    . ALA A  1  29   ? 99.926  39.971  -48.693 1.00 85.95  ? 29   ALA A CA    1 
ATOM   218   C  C     . ALA A  1  29   ? 100.345 38.972  -47.581 1.00 88.20  ? 29   ALA A C     1 
ATOM   219   O  O     . ALA A  1  29   ? 100.611 37.801  -47.878 1.00 87.19  ? 29   ALA A O     1 
ATOM   220   C  CB    . ALA A  1  29   ? 101.065 40.910  -49.034 1.00 86.92  ? 29   ALA A CB    1 
ATOM   221   N  N     . ILE A  1  30   ? 100.321 39.436  -46.307 1.00 83.90  ? 30   ILE A N     1 
ATOM   222   C  CA    . ILE A  1  30   ? 100.660 38.714  -45.068 1.00 81.69  ? 30   ILE A CA    1 
ATOM   223   C  C     . ILE A  1  30   ? 99.574  37.681  -44.666 1.00 83.62  ? 30   ILE A C     1 
ATOM   224   O  O     . ILE A  1  30   ? 99.885  36.710  -43.966 1.00 84.50  ? 30   ILE A O     1 
ATOM   225   C  CB    . ILE A  1  30   ? 100.957 39.805  -43.956 1.00 83.82  ? 30   ILE A CB    1 
ATOM   226   C  CG1   . ILE A  1  30   ? 102.463 39.937  -43.685 1.00 84.89  ? 30   ILE A CG1   1 
ATOM   227   C  CG2   . ILE A  1  30   ? 100.176 39.692  -42.634 1.00 81.64  ? 30   ILE A CG2   1 
ATOM   228   C  CD1   . ILE A  1  30   ? 103.405 40.698  -44.917 1.00 98.00  ? 30   ILE A CD1   1 
ATOM   229   N  N     . SER A  1  31   ? 98.322  37.884  -45.117 1.00 76.69  ? 31   SER A N     1 
ATOM   230   C  CA    . SER A  1  31   ? 97.167  37.083  -44.719 1.00 75.65  ? 31   SER A CA    1 
ATOM   231   C  C     . SER A  1  31   ? 97.125  35.627  -45.171 1.00 79.42  ? 31   SER A C     1 
ATOM   232   O  O     . SER A  1  31   ? 97.086  35.372  -46.352 1.00 82.32  ? 31   SER A O     1 
ATOM   233   C  CB    . SER A  1  31   ? 95.887  37.771  -45.166 1.00 80.57  ? 31   SER A CB    1 
ATOM   234   O  OG    . SER A  1  31   ? 94.796  36.867  -45.138 1.00 91.15  ? 31   SER A OG    1 
ATOM   235   N  N     . VAL A  1  32   ? 96.967  34.688  -44.239 1.00 74.43  ? 32   VAL A N     1 
ATOM   236   C  CA    . VAL A  1  32   ? 96.839  33.250  -44.542 1.00 74.06  ? 32   VAL A CA    1 
ATOM   237   C  C     . VAL A  1  32   ? 95.394  32.853  -44.869 1.00 79.51  ? 32   VAL A C     1 
ATOM   238   O  O     . VAL A  1  32   ? 95.175  31.732  -45.328 1.00 79.98  ? 32   VAL A O     1 
ATOM   239   C  CB    . VAL A  1  32   ? 97.389  32.331  -43.416 1.00 76.55  ? 32   VAL A CB    1 
ATOM   240   C  CG1   . VAL A  1  32   ? 98.847  32.627  -43.117 1.00 76.25  ? 32   VAL A CG1   1 
ATOM   241   C  CG2   . VAL A  1  32   ? 96.534  32.407  -42.154 1.00 75.41  ? 32   VAL A CG2   1 
ATOM   242   N  N     . ALA A  1  33   ? 94.409  33.720  -44.529 1.00 76.29  ? 33   ALA A N     1 
ATOM   243   C  CA    . ALA A  1  33   ? 92.978  33.452  -44.692 1.00 76.28  ? 33   ALA A CA    1 
ATOM   244   C  C     . ALA A  1  33   ? 92.146  34.699  -44.907 1.00 80.92  ? 33   ALA A C     1 
ATOM   245   O  O     . ALA A  1  33   ? 92.463  35.785  -44.434 1.00 79.57  ? 33   ALA A O     1 
ATOM   246   C  CB    . ALA A  1  33   ? 92.444  32.673  -43.498 1.00 76.07  ? 33   ALA A CB    1 
ATOM   247   N  N     . LYS A  1  34   ? 91.038  34.490  -45.581 1.00 80.18  ? 34   LYS A N     1 
ATOM   248   C  CA    . LYS A  1  34   ? 90.023  35.445  -46.004 1.00 82.15  ? 34   LYS A CA    1 
ATOM   249   C  C     . LYS A  1  34   ? 88.839  35.249  -45.058 1.00 90.01  ? 34   LYS A C     1 
ATOM   250   O  O     . LYS A  1  34   ? 88.094  34.265  -45.187 1.00 91.67  ? 34   LYS A O     1 
ATOM   251   C  CB    . LYS A  1  34   ? 89.624  35.112  -47.456 1.00 86.27  ? 34   LYS A CB    1 
ATOM   252   C  CG    . LYS A  1  34   ? 90.130  33.707  -48.018 1.00 92.23  ? 34   LYS A CG    1 
ATOM   253   C  CD    . LYS A  1  34   ? 91.659  33.588  -48.448 1.00 75.34  ? 34   LYS A CD    1 
ATOM   254   C  CE    . LYS A  1  34   ? 91.951  32.498  -49.414 1.00 42.18  ? 34   LYS A CE    1 
ATOM   255   N  NZ    . LYS A  1  34   ? 90.995  31.385  -49.258 1.00 44.76  ? 34   LYS A NZ    1 
ATOM   256   N  N     . ILE A  1  35   ? 88.713  36.133  -44.052 1.00 86.08  ? 35   ILE A N     1 
ATOM   257   C  CA    . ILE A  1  35   ? 87.675  36.031  -43.032 1.00 85.09  ? 35   ILE A CA    1 
ATOM   258   C  C     . ILE A  1  35   ? 86.371  36.607  -43.598 1.00 91.28  ? 35   ILE A C     1 
ATOM   259   O  O     . ILE A  1  35   ? 86.319  37.781  -43.992 1.00 90.13  ? 35   ILE A O     1 
ATOM   260   C  CB    . ILE A  1  35   ? 88.182  36.609  -41.680 1.00 86.43  ? 35   ILE A CB    1 
ATOM   261   C  CG1   . ILE A  1  35   ? 89.056  35.566  -40.952 1.00 85.08  ? 35   ILE A CG1   1 
ATOM   262   C  CG2   . ILE A  1  35   ? 87.065  37.049  -40.758 1.00 87.53  ? 35   ILE A CG2   1 
ATOM   263   C  CD1   . ILE A  1  35   ? 90.467  35.334  -41.528 1.00 91.63  ? 35   ILE A CD1   1 
ATOM   264   N  N     . ARG A  1  36   ? 85.354  35.716  -43.735 1.00 90.18  ? 36   ARG A N     1 
ATOM   265   C  CA    . ARG A  1  36   ? 84.062  36.031  -44.354 1.00 91.92  ? 36   ARG A CA    1 
ATOM   266   C  C     . ARG A  1  36   ? 82.839  35.802  -43.462 1.00 97.57  ? 36   ARG A C     1 
ATOM   267   O  O     . ARG A  1  36   ? 81.824  36.483  -43.639 1.00 97.52  ? 36   ARG A O     1 
ATOM   268   C  CB    . ARG A  1  36   ? 83.887  35.231  -45.658 1.00 92.10  ? 36   ARG A CB    1 
ATOM   269   C  CG    . ARG A  1  36   ? 84.803  35.656  -46.805 1.00 100.90 ? 36   ARG A CG    1 
ATOM   270   C  CD    . ARG A  1  36   ? 84.883  34.614  -47.920 1.00 104.54 ? 36   ARG A CD    1 
ATOM   271   N  NE    . ARG A  1  36   ? 85.727  33.473  -47.548 1.00 103.79 ? 36   ARG A NE    1 
ATOM   272   C  CZ    . ARG A  1  36   ? 86.695  32.971  -48.307 1.00 112.68 ? 36   ARG A CZ    1 
ATOM   273   N  NH1   . ARG A  1  36   ? 86.949  33.491  -49.496 1.00 99.27  ? 36   ARG A NH1   1 
ATOM   274   N  NH2   . ARG A  1  36   ? 87.413  31.939  -47.883 1.00 98.40  ? 36   ARG A NH2   1 
ATOM   275   N  N     . PHE A  1  37   ? 82.895  34.827  -42.556 1.00 94.75  ? 37   PHE A N     1 
ATOM   276   C  CA    . PHE A  1  37   ? 81.713  34.556  -41.740 1.00 95.64  ? 37   PHE A CA    1 
ATOM   277   C  C     . PHE A  1  37   ? 81.889  34.936  -40.283 1.00 100.32 ? 37   PHE A C     1 
ATOM   278   O  O     . PHE A  1  37   ? 82.925  34.591  -39.716 1.00 99.65  ? 37   PHE A O     1 
ATOM   279   C  CB    . PHE A  1  37   ? 81.283  33.091  -41.864 1.00 97.83  ? 37   PHE A CB    1 
ATOM   280   C  CG    . PHE A  1  37   ? 81.483  32.524  -43.243 1.00 100.22 ? 37   PHE A CG    1 
ATOM   281   C  CD1   . PHE A  1  37   ? 80.895  33.121  -44.351 1.00 104.01 ? 37   PHE A CD1   1 
ATOM   282   C  CD2   . PHE A  1  37   ? 82.231  31.375  -43.433 1.00 102.26 ? 37   PHE A CD2   1 
ATOM   283   C  CE1   . PHE A  1  37   ? 81.105  32.612  -45.626 1.00 105.74 ? 37   PHE A CE1   1 
ATOM   284   C  CE2   . PHE A  1  37   ? 82.437  30.863  -44.707 1.00 105.91 ? 37   PHE A CE2   1 
ATOM   285   C  CZ    . PHE A  1  37   ? 81.863  31.480  -45.795 1.00 105.02 ? 37   PHE A CZ    1 
ATOM   286   N  N     . PRO A  1  38   ? 80.902  35.611  -39.635 1.00 97.18  ? 38   PRO A N     1 
ATOM   287   C  CA    . PRO A  1  38   ? 81.072  35.965  -38.219 1.00 96.45  ? 38   PRO A CA    1 
ATOM   288   C  C     . PRO A  1  38   ? 81.119  34.735  -37.314 1.00 102.26 ? 38   PRO A C     1 
ATOM   289   O  O     . PRO A  1  38   ? 81.766  34.777  -36.267 1.00 102.00 ? 38   PRO A O     1 
ATOM   290   C  CB    . PRO A  1  38   ? 79.887  36.889  -37.934 1.00 98.53  ? 38   PRO A CB    1 
ATOM   291   C  CG    . PRO A  1  38   ? 78.882  36.531  -38.931 1.00 103.86 ? 38   PRO A CG    1 
ATOM   292   C  CD    . PRO A  1  38   ? 79.609  36.095  -40.153 1.00 99.76  ? 38   PRO A CD    1 
ATOM   293   N  N     . GLU A  1  39   ? 80.505  33.625  -37.768 1.00 100.07 ? 39   GLU A N     1 
ATOM   294   C  CA    . GLU A  1  39   ? 80.459  32.317  -37.108 1.00 100.01 ? 39   GLU A CA    1 
ATOM   295   C  C     . GLU A  1  39   ? 81.861  31.800  -36.766 1.00 104.83 ? 39   GLU A C     1 
ATOM   296   O  O     . GLU A  1  39   ? 82.801  32.043  -37.513 1.00 104.08 ? 39   GLU A O     1 
ATOM   297   C  CB    . GLU A  1  39   ? 79.734  31.302  -38.009 1.00 102.39 ? 39   GLU A CB    1 
ATOM   298   C  CG    . GLU A  1  39   ? 78.241  31.560  -38.182 1.00 115.79 ? 39   GLU A CG    1 
ATOM   299   C  CD    . GLU A  1  39   ? 77.805  32.678  -39.116 1.00 138.12 ? 39   GLU A CD    1 
ATOM   300   O  OE1   . GLU A  1  39   ? 78.239  32.687  -40.290 1.00 125.47 ? 39   GLU A OE1   1 
ATOM   301   O  OE2   . GLU A  1  39   ? 76.975  33.512  -38.687 1.00 137.03 ? 39   GLU A OE2   1 
ATOM   302   N  N     . THR A  1  40   ? 81.998  31.108  -35.633 1.00 103.57 ? 40   THR A N     1 
ATOM   303   C  CA    . THR A  1  40   ? 83.263  30.550  -35.163 1.00 103.86 ? 40   THR A CA    1 
ATOM   304   C  C     . THR A  1  40   ? 83.498  29.156  -35.729 1.00 112.44 ? 40   THR A C     1 
ATOM   305   O  O     . THR A  1  40   ? 84.607  28.883  -36.202 1.00 110.73 ? 40   THR A O     1 
ATOM   306   C  CB    . THR A  1  40   ? 83.318  30.626  -33.633 1.00 112.00 ? 40   THR A CB    1 
ATOM   307   O  OG1   . THR A  1  40   ? 83.613  31.971  -33.264 1.00 111.79 ? 40   THR A OG1   1 
ATOM   308   C  CG2   . THR A  1  40   ? 84.350  29.687  -33.014 1.00 109.93 ? 40   THR A CG2   1 
ATOM   309   N  N     . MET A  1  41   ? 82.466  28.274  -35.681 1.00 114.79 ? 41   MET A N     1 
ATOM   310   C  CA    . MET A  1  41   ? 82.594  26.900  -36.173 1.00 117.84 ? 41   MET A CA    1 
ATOM   311   C  C     . MET A  1  41   ? 81.290  26.233  -36.627 1.00 130.35 ? 41   MET A C     1 
ATOM   312   O  O     . MET A  1  41   ? 80.557  26.804  -37.438 1.00 130.84 ? 41   MET A O     1 
ATOM   313   C  CB    . MET A  1  41   ? 83.313  26.008  -35.146 1.00 119.20 ? 41   MET A CB    1 
ATOM   314   C  CG    . MET A  1  41   ? 82.816  26.119  -33.729 1.00 122.07 ? 41   MET A CG    1 
ATOM   315   S  SD    . MET A  1  41   ? 84.216  25.927  -32.613 1.00 125.07 ? 41   MET A SD    1 
ATOM   316   C  CE    . MET A  1  41   ? 84.727  24.260  -32.990 1.00 121.75 ? 41   MET A CE    1 
ATOM   317   N  N     . ASP A  1  42   ? 81.064  24.981  -36.134 1.00 132.95 ? 42   ASP A N     1 
ATOM   318   C  CA    . ASP A  1  42   ? 79.954  24.041  -36.348 1.00 136.09 ? 42   ASP A CA    1 
ATOM   319   C  C     . ASP A  1  42   ? 79.488  24.025  -37.795 1.00 146.11 ? 42   ASP A C     1 
ATOM   320   O  O     . ASP A  1  42   ? 78.542  24.733  -38.170 1.00 146.51 ? 42   ASP A O     1 
ATOM   321   C  CB    . ASP A  1  42   ? 78.775  24.229  -35.346 1.00 137.90 ? 42   ASP A CB    1 
ATOM   322   C  CG    . ASP A  1  42   ? 78.948  23.655  -33.932 1.00 141.25 ? 42   ASP A CG    1 
ATOM   323   O  OD1   . ASP A  1  42   ? 79.847  22.802  -33.733 1.00 139.31 ? 42   ASP A OD1   1 
ATOM   324   O  OD2   . ASP A  1  42   ? 78.176  24.053  -33.032 1.00 144.68 ? 42   ASP A OD2   1 
ATOM   325   N  N     . GLU A  1  43   ? 80.194  23.227  -38.612 1.00 146.71 ? 43   GLU A N     1 
ATOM   326   C  CA    . GLU A  1  43   ? 79.870  23.019  -40.023 1.00 149.91 ? 43   GLU A CA    1 
ATOM   327   C  C     . GLU A  1  43   ? 78.626  22.098  -39.988 1.00 158.54 ? 43   GLU A C     1 
ATOM   328   O  O     . GLU A  1  43   ? 78.735  20.883  -40.202 1.00 159.00 ? 43   GLU A O     1 
ATOM   329   C  CB    . GLU A  1  43   ? 81.048  22.356  -40.791 1.00 151.49 ? 43   GLU A CB    1 
ATOM   330   C  CG    . GLU A  1  43   ? 82.456  22.769  -40.374 1.00 163.09 ? 43   GLU A CG    1 
ATOM   331   C  CD    . GLU A  1  43   ? 83.264  21.693  -39.665 1.00 183.05 ? 43   GLU A CD    1 
ATOM   332   O  OE1   . GLU A  1  43   ? 82.828  21.243  -38.581 1.00 176.82 ? 43   GLU A OE1   1 
ATOM   333   O  OE2   . GLU A  1  43   ? 84.345  21.320  -40.176 1.00 172.69 ? 43   GLU A OE2   1 
ATOM   334   N  N     . THR A  1  44   ? 77.452  22.696  -39.642 1.00 157.26 ? 44   THR A N     1 
ATOM   335   C  CA    . THR A  1  44   ? 76.149  22.055  -39.416 1.00 158.51 ? 44   THR A CA    1 
ATOM   336   C  C     . THR A  1  44   ? 76.268  21.160  -38.139 1.00 161.58 ? 44   THR A C     1 
ATOM   337   O  O     . THR A  1  44   ? 76.202  19.927  -38.232 1.00 161.84 ? 44   THR A O     1 
ATOM   338   C  CB    . THR A  1  44   ? 75.569  21.367  -40.707 1.00 169.99 ? 44   THR A CB    1 
ATOM   339   O  OG1   . THR A  1  44   ? 75.834  22.165  -41.867 1.00 170.62 ? 44   THR A OG1   1 
ATOM   340   C  CG2   . THR A  1  44   ? 74.066  21.090  -40.609 1.00 169.38 ? 44   THR A CG2   1 
ATOM   341   N  N     . GLN A  1  45   ? 76.501  21.811  -36.955 1.00 156.15 ? 45   GLN A N     1 
ATOM   342   C  CA    . GLN A  1  45   ? 76.636  21.221  -35.601 1.00 154.70 ? 45   GLN A CA    1 
ATOM   343   C  C     . GLN A  1  45   ? 78.027  20.595  -35.304 1.00 155.43 ? 45   GLN A C     1 
ATOM   344   O  O     . GLN A  1  45   ? 78.411  20.523  -34.131 1.00 154.11 ? 45   GLN A O     1 
ATOM   345   C  CB    . GLN A  1  45   ? 75.501  20.204  -35.282 1.00 156.97 ? 45   GLN A CB    1 
ATOM   346   C  CG    . GLN A  1  45   ? 75.101  20.098  -33.797 1.00 172.00 ? 45   GLN A CG    1 
ATOM   347   C  CD    . GLN A  1  45   ? 75.737  18.936  -33.054 1.00 187.48 ? 45   GLN A CD    1 
ATOM   348   O  OE1   . GLN A  1  45   ? 76.524  19.121  -32.117 1.00 181.77 ? 45   GLN A OE1   1 
ATOM   349   N  NE2   . GLN A  1  45   ? 75.367  17.713  -33.409 1.00 177.28 ? 45   GLN A NE2   1 
ATOM   350   N  N     . THR A  1  46   ? 78.760  20.131  -36.341 1.00 150.34 ? 46   THR A N     1 
ATOM   351   C  CA    . THR A  1  46   ? 80.073  19.486  -36.191 1.00 148.67 ? 46   THR A CA    1 
ATOM   352   C  C     . THR A  1  46   ? 81.080  20.408  -35.499 1.00 148.59 ? 46   THR A C     1 
ATOM   353   O  O     . THR A  1  46   ? 81.493  21.409  -36.084 1.00 148.45 ? 46   THR A O     1 
ATOM   354   C  CB    . THR A  1  46   ? 80.586  18.943  -37.547 1.00 161.01 ? 46   THR A CB    1 
ATOM   355   O  OG1   . THR A  1  46   ? 79.577  18.142  -38.166 1.00 163.91 ? 46   THR A OG1   1 
ATOM   356   C  CG2   . THR A  1  46   ? 81.886  18.136  -37.415 1.00 159.70 ? 46   THR A CG2   1 
ATOM   357   N  N     . ARG A  1  47   ? 81.465  20.069  -34.252 1.00 141.40 ? 47   ARG A N     1 
ATOM   358   C  CA    . ARG A  1  47   ? 82.425  20.851  -33.473 1.00 138.68 ? 47   ARG A CA    1 
ATOM   359   C  C     . ARG A  1  47   ? 83.858  20.761  -34.077 1.00 137.57 ? 47   ARG A C     1 
ATOM   360   O  O     . ARG A  1  47   ? 84.673  19.917  -33.695 1.00 136.48 ? 47   ARG A O     1 
ATOM   361   C  CB    . ARG A  1  47   ? 82.355  20.483  -31.977 1.00 139.60 ? 47   ARG A CB    1 
ATOM   362   C  CG    . ARG A  1  47   ? 82.969  21.521  -31.033 1.00 153.10 ? 47   ARG A CG    1 
ATOM   363   C  CD    . ARG A  1  47   ? 83.276  20.934  -29.658 1.00 165.81 ? 47   ARG A CD    1 
ATOM   364   N  NE    . ARG A  1  47   ? 84.485  21.512  -29.060 1.00 172.92 ? 47   ARG A NE    1 
ATOM   365   C  CZ    . ARG A  1  47   ? 85.687  20.936  -29.067 1.00 184.90 ? 47   ARG A CZ    1 
ATOM   366   N  NH1   . ARG A  1  47   ? 85.858  19.746  -29.635 1.00 170.01 ? 47   ARG A NH1   1 
ATOM   367   N  NH2   . ARG A  1  47   ? 86.723  21.542  -28.504 1.00 170.49 ? 47   ARG A NH2   1 
ATOM   368   N  N     . ALA A  1  48   ? 84.106  21.630  -35.078 1.00 130.71 ? 48   ALA A N     1 
ATOM   369   C  CA    . ALA A  1  48   ? 85.341  21.838  -35.842 1.00 128.03 ? 48   ALA A CA    1 
ATOM   370   C  C     . ALA A  1  48   ? 85.204  23.215  -36.529 1.00 126.61 ? 48   ALA A C     1 
ATOM   371   O  O     . ALA A  1  48   ? 84.162  23.496  -37.133 1.00 127.39 ? 48   ALA A O     1 
ATOM   372   C  CB    . ALA A  1  48   ? 85.528  20.730  -36.879 1.00 129.39 ? 48   ALA A CB    1 
ATOM   373   N  N     . LYS A  1  49   ? 86.234  24.078  -36.381 1.00 117.27 ? 49   LYS A N     1 
ATOM   374   C  CA    . LYS A  1  49   ? 86.345  25.462  -36.894 1.00 114.82 ? 49   LYS A CA    1 
ATOM   375   C  C     . LYS A  1  49   ? 85.870  25.642  -38.343 1.00 114.82 ? 49   LYS A C     1 
ATOM   376   O  O     . LYS A  1  49   ? 86.152  24.784  -39.175 1.00 115.40 ? 49   LYS A O     1 
ATOM   377   C  CB    . LYS A  1  49   ? 87.793  25.974  -36.747 1.00 116.99 ? 49   LYS A CB    1 
ATOM   378   C  CG    . LYS A  1  49   ? 88.500  25.583  -35.433 1.00 134.21 ? 49   LYS A CG    1 
ATOM   379   C  CD    . LYS A  1  49   ? 90.020  25.767  -35.499 1.00 139.42 ? 49   LYS A CD    1 
ATOM   380   C  CE    . LYS A  1  49   ? 90.792  24.614  -34.900 1.00 140.74 ? 49   LYS A CE    1 
ATOM   381   N  NZ    . LYS A  1  49   ? 92.232  24.655  -35.277 1.00 139.67 ? 49   LYS A NZ    1 
ATOM   382   N  N     . ILE A  1  50   ? 85.170  26.757  -38.642 1.00 108.08 ? 50   ILE A N     1 
ATOM   383   C  CA    . ILE A  1  50   ? 84.616  27.111  -39.972 1.00 107.58 ? 50   ILE A CA    1 
ATOM   384   C  C     . ILE A  1  50   ? 85.699  27.694  -40.945 1.00 109.55 ? 50   ILE A C     1 
ATOM   385   O  O     . ILE A  1  50   ? 86.714  28.201  -40.469 1.00 108.96 ? 50   ILE A O     1 
ATOM   386   C  CB    . ILE A  1  50   ? 83.413  28.101  -39.757 1.00 110.69 ? 50   ILE A CB    1 
ATOM   387   C  CG1   . ILE A  1  50   ? 82.458  28.163  -40.988 1.00 111.77 ? 50   ILE A CG1   1 
ATOM   388   C  CG2   . ILE A  1  50   ? 83.898  29.505  -39.333 1.00 111.17 ? 50   ILE A CG2   1 
ATOM   389   C  CD1   . ILE A  1  50   ? 81.175  29.053  -40.841 1.00 112.85 ? 50   ILE A CD1   1 
ATOM   390   N  N     . GLY A  1  51   ? 85.447  27.661  -42.267 1.00 104.47 ? 51   GLY A N     1 
ATOM   391   C  CA    . GLY A  1  51   ? 86.315  28.259  -43.281 1.00 103.04 ? 51   GLY A CA    1 
ATOM   392   C  C     . GLY A  1  51   ? 86.210  29.783  -43.329 1.00 105.26 ? 51   GLY A C     1 
ATOM   393   O  O     . GLY A  1  51   ? 86.895  30.422  -44.122 1.00 105.57 ? 51   GLY A O     1 
ATOM   394   N  N     . GLY A  1  52   ? 85.381  30.371  -42.461 1.00 100.39 ? 52   GLY A N     1 
ATOM   395   C  CA    . GLY A  1  52   ? 85.133  31.809  -42.340 1.00 99.67  ? 52   GLY A CA    1 
ATOM   396   C  C     . GLY A  1  52   ? 85.967  32.535  -41.304 1.00 101.52 ? 52   GLY A C     1 
ATOM   397   O  O     . GLY A  1  52   ? 86.880  33.238  -41.720 1.00 102.70 ? 52   GLY A O     1 
ATOM   398   N  N     . LEU A  1  53   ? 85.640  32.447  -39.956 1.00 94.18  ? 53   LEU A N     1 
ATOM   399   C  CA    . LEU A  1  53   ? 86.423  33.065  -38.841 1.00 91.67  ? 53   LEU A CA    1 
ATOM   400   C  C     . LEU A  1  53   ? 87.210  31.960  -38.139 1.00 96.32  ? 53   LEU A C     1 
ATOM   401   O  O     . LEU A  1  53   ? 86.981  30.784  -38.437 1.00 97.44  ? 53   LEU A O     1 
ATOM   402   C  CB    . LEU A  1  53   ? 85.579  33.878  -37.814 1.00 90.79  ? 53   LEU A CB    1 
ATOM   403   C  CG    . LEU A  1  53   ? 86.265  35.078  -37.081 1.00 93.02  ? 53   LEU A CG    1 
ATOM   404   C  CD1   . LEU A  1  53   ? 85.255  36.145  -36.619 1.00 92.07  ? 53   LEU A CD1   1 
ATOM   405   C  CD2   . LEU A  1  53   ? 86.992  34.628  -35.875 1.00 93.68  ? 53   LEU A CD2   1 
ATOM   406   N  N     . ASN A  1  54   ? 88.092  32.341  -37.186 1.00 91.02  ? 54   ASN A N     1 
ATOM   407   C  CA    . ASN A  1  54   ? 89.106  31.567  -36.455 1.00 89.80  ? 54   ASN A CA    1 
ATOM   408   C  C     . ASN A  1  54   ? 89.274  30.083  -37.006 1.00 91.92  ? 54   ASN A C     1 
ATOM   409   O  O     . ASN A  1  54   ? 88.422  29.208  -36.927 1.00 90.46  ? 54   ASN A O     1 
ATOM   410   C  CB    . ASN A  1  54   ? 89.031  31.678  -34.908 1.00 88.61  ? 54   ASN A CB    1 
ATOM   411   C  CG    . ASN A  1  54   ? 88.039  30.917  -34.092 1.00 109.03 ? 54   ASN A CG    1 
ATOM   412   O  OD1   . ASN A  1  54   ? 87.147  30.242  -34.595 1.00 119.07 ? 54   ASN A OD1   1 
ATOM   413   N  ND2   . ASN A  1  54   ? 88.170  31.059  -32.779 1.00 89.61  ? 54   ASN A ND2   1 
ATOM   414   N  N     . ASP A  1  55   ? 90.486  29.897  -37.530 1.00 87.94  ? 55   ASP A N     1 
ATOM   415   C  CA    . ASP A  1  55   ? 91.133  28.906  -38.357 1.00 87.67  ? 55   ASP A CA    1 
ATOM   416   C  C     . ASP A  1  55   ? 90.375  28.636  -39.584 1.00 93.45  ? 55   ASP A C     1 
ATOM   417   O  O     . ASP A  1  55   ? 90.160  27.486  -39.995 1.00 92.49  ? 55   ASP A O     1 
ATOM   418   C  CB    . ASP A  1  55   ? 91.653  27.594  -37.762 1.00 88.60  ? 55   ASP A CB    1 
ATOM   419   C  CG    . ASP A  1  55   ? 92.315  26.708  -38.866 1.00 83.30  ? 55   ASP A CG    1 
ATOM   420   O  OD1   . ASP A  1  55   ? 93.460  27.060  -39.332 1.00 75.08  ? 55   ASP A OD1   1 
ATOM   421   O  OD2   . ASP A  1  55   ? 91.632  25.750  -39.357 1.00 79.47  ? 55   ASP A OD2   1 
ATOM   422   N  N     . PRO A  1  56   ? 90.236  29.701  -40.354 1.00 93.32  ? 56   PRO A N     1 
ATOM   423   C  CA    . PRO A  1  56   ? 89.945  29.507  -41.768 1.00 95.06  ? 56   PRO A CA    1 
ATOM   424   C  C     . PRO A  1  56   ? 91.353  29.267  -42.386 1.00 98.48  ? 56   PRO A C     1 
ATOM   425   O  O     . PRO A  1  56   ? 91.447  29.485  -43.592 1.00 98.89  ? 56   PRO A O     1 
ATOM   426   C  CB    . PRO A  1  56   ? 89.392  30.867  -42.211 1.00 97.78  ? 56   PRO A CB    1 
ATOM   427   C  CG    . PRO A  1  56   ? 89.672  31.822  -41.030 1.00 101.87 ? 56   PRO A CG    1 
ATOM   428   C  CD    . PRO A  1  56   ? 90.546  31.111  -40.071 1.00 95.60  ? 56   PRO A CD    1 
ATOM   429   N  N     . ARG A  1  57   ? 92.462  28.904  -41.504 1.00 91.63  ? 57   ARG A N     1 
ATOM   430   C  CA    . ARG A  1  57   ? 93.942  28.597  -41.654 1.00 88.12  ? 57   ARG A CA    1 
ATOM   431   C  C     . ARG A  1  57   ? 94.918  29.373  -40.622 1.00 86.97  ? 57   ARG A C     1 
ATOM   432   O  O     . ARG A  1  57   ? 96.129  29.364  -40.812 1.00 85.40  ? 57   ARG A O     1 
ATOM   433   C  CB    . ARG A  1  57   ? 94.447  28.801  -43.112 1.00 84.45  ? 57   ARG A CB    1 
ATOM   434   C  CG    . ARG A  1  57   ? 93.844  27.872  -44.178 1.00 82.96  ? 57   ARG A CG    1 
ATOM   435   C  CD    . ARG A  1  57   ? 93.611  28.639  -45.474 1.00 92.09  ? 57   ARG A CD    1 
ATOM   436   N  NE    . ARG A  1  57   ? 92.237  28.554  -45.994 1.00 102.27 ? 57   ARG A NE    1 
ATOM   437   C  CZ    . ARG A  1  57   ? 91.551  29.585  -46.497 1.00 122.58 ? 57   ARG A CZ    1 
ATOM   438   N  NH1   . ARG A  1  57   ? 92.074  30.802  -46.497 1.00 113.85 ? 57   ARG A NH1   1 
ATOM   439   N  NH2   . ARG A  1  57   ? 90.317  29.412  -46.951 1.00 111.52 ? 57   ARG A NH2   1 
ATOM   440   N  N     . LEU A  1  58   ? 94.398  29.994  -39.538 1.00 80.80  ? 58   LEU A N     1 
ATOM   441   C  CA    . LEU A  1  58   ? 95.155  30.897  -38.630 1.00 78.54  ? 58   LEU A CA    1 
ATOM   442   C  C     . LEU A  1  58   ? 95.970  30.331  -37.460 1.00 82.52  ? 58   LEU A C     1 
ATOM   443   O  O     . LEU A  1  58   ? 96.724  31.076  -36.825 1.00 79.17  ? 58   LEU A O     1 
ATOM   444   C  CB    . LEU A  1  58   ? 94.203  31.932  -37.981 1.00 77.83  ? 58   LEU A CB    1 
ATOM   445   C  CG    . LEU A  1  58   ? 93.148  32.685  -38.783 1.00 81.50  ? 58   LEU A CG    1 
ATOM   446   C  CD1   . LEU A  1  58   ? 92.232  33.450  -37.861 1.00 80.69  ? 58   LEU A CD1   1 
ATOM   447   C  CD2   . LEU A  1  58   ? 93.754  33.603  -39.816 1.00 82.27  ? 58   LEU A CD2   1 
ATOM   448   N  N     . GLY A  1  59   ? 95.699  29.105  -37.071 1.00 83.74  ? 59   GLY A N     1 
ATOM   449   C  CA    . GLY A  1  59   ? 96.331  28.504  -35.903 1.00 84.71  ? 59   GLY A CA    1 
ATOM   450   C  C     . GLY A  1  59   ? 95.441  27.444  -35.304 1.00 95.41  ? 59   GLY A C     1 
ATOM   451   O  O     . GLY A  1  59   ? 94.303  27.273  -35.751 1.00 95.16  ? 59   GLY A O     1 
ATOM   452   N  N     . SER A  1  60   ? 95.925  26.743  -34.270 1.00 98.09  ? 60   SER A N     1 
ATOM   453   C  CA    . SER A  1  60   ? 95.137  25.650  -33.703 1.00 101.18 ? 60   SER A CA    1 
ATOM   454   C  C     . SER A  1  60   ? 94.382  25.929  -32.383 1.00 110.05 ? 60   SER A C     1 
ATOM   455   O  O     . SER A  1  60   ? 94.652  26.894  -31.658 1.00 108.93 ? 60   SER A O     1 
ATOM   456   C  CB    . SER A  1  60   ? 96.008  24.408  -33.527 1.00 105.83 ? 60   SER A CB    1 
ATOM   457   O  OG    . SER A  1  60   ? 95.230  23.219  -33.499 1.00 116.45 ? 60   SER A OG    1 
ATOM   458   N  N     . ILE A  1  61   ? 93.379  25.048  -32.151 1.00 110.95 ? 61   ILE A N     1 
ATOM   459   C  CA    . ILE A  1  61   ? 92.516  24.786  -30.989 1.00 112.08 ? 61   ILE A CA    1 
ATOM   460   C  C     . ILE A  1  61   ? 92.559  23.210  -30.844 1.00 123.38 ? 61   ILE A C     1 
ATOM   461   O  O     . ILE A  1  61   ? 92.976  22.538  -31.795 1.00 124.51 ? 61   ILE A O     1 
ATOM   462   C  CB    . ILE A  1  61   ? 91.059  25.314  -31.180 1.00 114.61 ? 61   ILE A CB    1 
ATOM   463   C  CG1   . ILE A  1  61   ? 91.025  26.741  -31.794 1.00 113.96 ? 61   ILE A CG1   1 
ATOM   464   C  CG2   . ILE A  1  61   ? 90.278  25.236  -29.845 1.00 115.03 ? 61   ILE A CG2   1 
ATOM   465   C  CD1   . ILE A  1  61   ? 89.650  27.262  -32.189 1.00 114.58 ? 61   ILE A CD1   1 
ATOM   466   N  N     . ASP A  1  62   ? 92.193  22.633  -29.666 1.00 123.57 ? 62   ASP A N     1 
ATOM   467   C  CA    . ASP A  1  62   ? 92.125  21.169  -29.400 1.00 125.29 ? 62   ASP A CA    1 
ATOM   468   C  C     . ASP A  1  62   ? 93.508  20.429  -29.390 1.00 129.86 ? 62   ASP A C     1 
ATOM   469   O  O     . ASP A  1  62   ? 93.543  19.206  -29.170 1.00 130.75 ? 62   ASP A O     1 
ATOM   470   C  CB    . ASP A  1  62   ? 91.127  20.480  -30.400 1.00 128.99 ? 62   ASP A CB    1 
ATOM   471   C  CG    . ASP A  1  62   ? 90.741  19.011  -30.172 1.00 145.88 ? 62   ASP A CG    1 
ATOM   472   O  OD1   . ASP A  1  62   ? 90.624  18.593  -28.986 1.00 154.93 ? 62   ASP A OD1   1 
ATOM   473   O  OD2   . ASP A  1  62   ? 90.513  18.292  -31.180 1.00 146.55 ? 62   ASP A OD2   1 
ATOM   474   N  N     . ARG A  1  63   ? 94.634  21.165  -29.558 1.00 124.88 ? 63   ARG A N     1 
ATOM   475   C  CA    . ARG A  1  63   ? 95.985  20.590  -29.649 1.00 124.21 ? 63   ARG A CA    1 
ATOM   476   C  C     . ARG A  1  63   ? 96.020  19.509  -30.763 1.00 128.91 ? 63   ARG A C     1 
ATOM   477   O  O     . ARG A  1  63   ? 96.067  18.295  -30.509 1.00 127.34 ? 63   ARG A O     1 
ATOM   478   C  CB    . ARG A  1  63   ? 96.548  20.087  -28.307 1.00 123.26 ? 63   ARG A CB    1 
ATOM   479   C  CG    . ARG A  1  63   ? 96.557  21.118  -27.184 1.00 136.07 ? 63   ARG A CG    1 
ATOM   480   C  CD    . ARG A  1  63   ? 95.491  20.808  -26.132 1.00 156.35 ? 63   ARG A CD    1 
ATOM   481   N  NE    . ARG A  1  63   ? 95.744  19.554  -25.402 1.00 167.89 ? 63   ARG A NE    1 
ATOM   482   C  CZ    . ARG A  1  63   ? 94.823  18.628  -25.130 1.00 177.06 ? 63   ARG A CZ    1 
ATOM   483   N  NH1   . ARG A  1  63   ? 93.563  18.797  -25.518 1.00 162.17 ? 63   ARG A NH1   1 
ATOM   484   N  NH2   . ARG A  1  63   ? 95.156  17.527  -24.469 1.00 158.57 ? 63   ARG A NH2   1 
ATOM   485   N  N     . ASN A  1  64   ? 95.855  20.007  -32.002 1.00 126.63 ? 64   ASN A N     1 
ATOM   486   C  CA    . ASN A  1  64   ? 95.914  19.295  -33.275 1.00 126.52 ? 64   ASN A CA    1 
ATOM   487   C  C     . ASN A  1  64   ? 97.008  20.009  -34.022 1.00 128.84 ? 64   ASN A C     1 
ATOM   488   O  O     . ASN A  1  64   ? 96.855  21.202  -34.300 1.00 126.92 ? 64   ASN A O     1 
ATOM   489   C  CB    . ASN A  1  64   ? 94.610  19.440  -34.067 1.00 125.76 ? 64   ASN A CB    1 
ATOM   490   C  CG    . ASN A  1  64   ? 93.407  18.891  -33.376 1.00 147.92 ? 64   ASN A CG    1 
ATOM   491   O  OD1   . ASN A  1  64   ? 93.498  18.014  -32.507 1.00 146.55 ? 64   ASN A OD1   1 
ATOM   492   N  ND2   . ASN A  1  64   ? 92.249  19.402  -33.747 1.00 137.82 ? 64   ASN A ND2   1 
ATOM   493   N  N     . LEU A  1  65   ? 98.131  19.298  -34.322 1.00 125.76 ? 65   LEU A N     1 
ATOM   494   C  CA    . LEU A  1  65   ? 99.282  19.846  -35.063 1.00 124.70 ? 65   LEU A CA    1 
ATOM   495   C  C     . LEU A  1  65   ? 98.725  20.676  -36.194 1.00 124.93 ? 65   LEU A C     1 
ATOM   496   O  O     . LEU A  1  65   ? 99.083  21.849  -36.324 1.00 123.59 ? 65   LEU A O     1 
ATOM   497   C  CB    . LEU A  1  65   ? 100.254 18.739  -35.577 1.00 125.21 ? 65   LEU A CB    1 
ATOM   498   C  CG    . LEU A  1  65   ? 101.575 18.540  -34.768 1.00 129.26 ? 65   LEU A CG    1 
ATOM   499   C  CD1   . LEU A  1  65   ? 101.360 17.681  -33.509 1.00 128.79 ? 65   LEU A CD1   1 
ATOM   500   C  CD2   . LEU A  1  65   ? 102.668 17.918  -35.626 1.00 131.80 ? 65   LEU A CD2   1 
ATOM   501   N  N     . LYS A  1  66   ? 97.686  20.129  -36.857 1.00 120.33 ? 66   LYS A N     1 
ATOM   502   C  CA    . LYS A  1  66   ? 96.982  20.808  -37.933 1.00 120.14 ? 66   LYS A CA    1 
ATOM   503   C  C     . LYS A  1  66   ? 96.800  22.294  -37.643 1.00 119.03 ? 66   LYS A C     1 
ATOM   504   O  O     . LYS A  1  66   ? 96.080  22.715  -36.731 1.00 118.62 ? 66   LYS A O     1 
ATOM   505   C  CB    . LYS A  1  66   ? 95.645  20.124  -38.344 1.00 123.67 ? 66   LYS A CB    1 
ATOM   506   C  CG    . LYS A  1  66   ? 95.287  20.300  -39.848 1.00 129.44 ? 66   LYS A CG    1 
ATOM   507   C  CD    . LYS A  1  66   ? 94.476  21.588  -40.176 1.00 128.32 ? 66   LYS A CD    1 
ATOM   508   C  CE    . LYS A  1  66   ? 94.753  22.134  -41.563 1.00 114.38 ? 66   LYS A CE    1 
ATOM   509   N  NZ    . LYS A  1  66   ? 94.039  23.413  -41.813 1.00 99.87  ? 66   LYS A NZ    1 
ATOM   510   N  N     . CYS A  1  67   ? 97.590  23.048  -38.378 1.00 110.55 ? 67   CYS A N     1 
ATOM   511   C  CA    . CYS A  1  67   ? 97.593  24.469  -38.482 1.00 107.51 ? 67   CYS A CA    1 
ATOM   512   C  C     . CYS A  1  67   ? 97.934  24.619  -39.935 1.00 113.03 ? 67   CYS A C     1 
ATOM   513   O  O     . CYS A  1  67   ? 99.111  24.525  -40.270 1.00 113.07 ? 67   CYS A O     1 
ATOM   514   C  CB    . CYS A  1  67   ? 98.660  25.090  -37.587 1.00 104.90 ? 67   CYS A CB    1 
ATOM   515   S  SG    . CYS A  1  67   ? 99.088  26.792  -38.040 1.00 107.68 ? 67   CYS A SG    1 
ATOM   516   N  N     . GLN A  1  68   ? 96.921  24.741  -40.813 1.00 111.20 ? 68   GLN A N     1 
ATOM   517   C  CA    . GLN A  1  68   ? 97.103  24.973  -42.256 1.00 113.65 ? 68   GLN A CA    1 
ATOM   518   C  C     . GLN A  1  68   ? 98.324  24.263  -42.916 1.00 125.03 ? 68   GLN A C     1 
ATOM   519   O  O     . GLN A  1  68   ? 99.027  24.892  -43.729 1.00 126.49 ? 68   GLN A O     1 
ATOM   520   C  CB    . GLN A  1  68   ? 97.158  26.498  -42.565 1.00 114.40 ? 68   GLN A CB    1 
ATOM   521   C  CG    . GLN A  1  68   ? 98.026  27.367  -41.632 1.00 101.66 ? 68   GLN A CG    1 
ATOM   522   C  CD    . GLN A  1  68   ? 99.438  27.621  -42.073 1.00 88.05  ? 68   GLN A CD    1 
ATOM   523   O  OE1   . GLN A  1  68   ? 100.302 26.715  -42.099 1.00 64.77  ? 68   GLN A OE1   1 
ATOM   524   N  NE2   . GLN A  1  68   ? 99.720  28.900  -42.327 1.00 77.00  ? 68   GLN A NE2   1 
ATOM   525   N  N     . THR A  1  69   ? 98.563  22.946  -42.578 1.00 124.17 ? 69   THR A N     1 
ATOM   526   C  CA    . THR A  1  69   ? 99.680  22.057  -43.047 1.00 124.18 ? 69   THR A CA    1 
ATOM   527   C  C     . THR A  1  69   ? 101.000 22.280  -42.205 1.00 122.93 ? 69   THR A C     1 
ATOM   528   O  O     . THR A  1  69   ? 101.663 21.280  -41.881 1.00 121.34 ? 69   THR A O     1 
ATOM   529   C  CB    . THR A  1  69   ? 99.948  22.099  -44.622 1.00 139.88 ? 69   THR A CB    1 
ATOM   530   O  OG1   . THR A  1  69   ? 98.732  22.251  -45.379 1.00 141.32 ? 69   THR A OG1   1 
ATOM   531   C  CG2   . THR A  1  69   ? 100.717 20.867  -45.140 1.00 140.03 ? 69   THR A CG2   1 
ATOM   532   N  N     . CYS A  1  70   ? 101.343 23.591  -41.842 1.00 115.41 ? 70   CYS A N     1 
ATOM   533   C  CA    . CYS A  1  70   ? 102.530 24.059  -41.079 1.00 111.28 ? 70   CYS A CA    1 
ATOM   534   C  C     . CYS A  1  70   ? 102.764 23.251  -39.815 1.00 111.70 ? 70   CYS A C     1 
ATOM   535   O  O     . CYS A  1  70   ? 103.873 23.262  -39.294 1.00 110.50 ? 70   CYS A O     1 
ATOM   536   C  CB    . CYS A  1  70   ? 102.489 25.569  -40.808 1.00 109.85 ? 70   CYS A CB    1 
ATOM   537   S  SG    . CYS A  1  70   ? 102.468 26.059  -39.053 1.00 112.11 ? 70   CYS A SG    1 
ATOM   538   N  N     . GLN A  1  71   ? 101.762 22.459  -39.410 1.00 107.51 ? 71   GLN A N     1 
ATOM   539   C  CA    . GLN A  1  71   ? 101.755 21.598  -38.238 1.00 107.76 ? 71   GLN A CA    1 
ATOM   540   C  C     . GLN A  1  71   ? 102.219 22.364  -37.002 1.00 111.02 ? 71   GLN A C     1 
ATOM   541   O  O     . GLN A  1  71   ? 101.557 23.320  -36.581 1.00 111.65 ? 71   GLN A O     1 
ATOM   542   C  CB    . GLN A  1  71   ? 102.484 20.233  -38.430 1.00 110.16 ? 71   GLN A CB    1 
ATOM   543   C  CG    . GLN A  1  71   ? 103.767 20.174  -39.298 1.00 146.36 ? 71   GLN A CG    1 
ATOM   544   C  CD    . GLN A  1  71   ? 105.080 19.985  -38.546 1.00 176.50 ? 71   GLN A CD    1 
ATOM   545   O  OE1   . GLN A  1  71   ? 105.139 19.438  -37.429 1.00 174.29 ? 71   GLN A OE1   1 
ATOM   546   N  NE2   . GLN A  1  71   ? 106.181 20.380  -39.187 1.00 168.08 ? 71   GLN A NE2   1 
ATOM   547   N  N     . GLU A  1  72   ? 103.355 21.959  -36.442 1.00 105.40 ? 72   GLU A N     1 
ATOM   548   C  CA    . GLU A  1  72   ? 104.000 22.538  -35.275 1.00 103.03 ? 72   GLU A CA    1 
ATOM   549   C  C     . GLU A  1  72   ? 103.174 22.364  -33.975 1.00 104.51 ? 72   GLU A C     1 
ATOM   550   O  O     . GLU A  1  72   ? 103.674 21.724  -33.040 1.00 103.61 ? 72   GLU A O     1 
ATOM   551   C  CB    . GLU A  1  72   ? 104.425 24.001  -35.529 1.00 103.71 ? 72   GLU A CB    1 
ATOM   552   C  CG    . GLU A  1  72   ? 105.484 24.185  -36.616 1.00 108.08 ? 72   GLU A CG    1 
ATOM   553   C  CD    . GLU A  1  72   ? 106.583 23.142  -36.742 1.00 114.17 ? 72   GLU A CD    1 
ATOM   554   O  OE1   . GLU A  1  72   ? 107.006 22.590  -35.699 1.00 95.35  ? 72   GLU A OE1   1 
ATOM   555   O  OE2   . GLU A  1  72   ? 107.019 22.874  -37.887 1.00 104.32 ? 72   GLU A OE2   1 
ATOM   556   N  N     . GLY A  1  73   ? 101.949 22.893  -33.929 1.00 99.03  ? 73   GLY A N     1 
ATOM   557   C  CA    . GLY A  1  73   ? 101.124 22.806  -32.734 1.00 98.36  ? 73   GLY A CA    1 
ATOM   558   C  C     . GLY A  1  73   ? 101.409 23.941  -31.770 1.00 101.49 ? 73   GLY A C     1 
ATOM   559   O  O     . GLY A  1  73   ? 102.514 24.491  -31.747 1.00 100.88 ? 73   GLY A O     1 
ATOM   560   N  N     . MET A  1  74   ? 100.408 24.264  -30.952 1.00 97.67  ? 74   MET A N     1 
ATOM   561   C  CA    . MET A  1  74   ? 100.322 25.387  -30.015 1.00 97.52  ? 74   MET A CA    1 
ATOM   562   C  C     . MET A  1  74   ? 101.672 25.947  -29.516 1.00 99.34  ? 74   MET A C     1 
ATOM   563   O  O     . MET A  1  74   ? 101.967 27.115  -29.784 1.00 98.23  ? 74   MET A O     1 
ATOM   564   C  CB    . MET A  1  74   ? 99.402  25.055  -28.830 1.00 100.30 ? 74   MET A CB    1 
ATOM   565   C  CG    . MET A  1  74   ? 98.071  24.460  -29.246 1.00 105.62 ? 74   MET A CG    1 
ATOM   566   S  SD    . MET A  1  74   ? 96.653  25.493  -28.833 1.00 110.76 ? 74   MET A SD    1 
ATOM   567   C  CE    . MET A  1  74   ? 95.371  24.298  -28.973 1.00 107.91 ? 74   MET A CE    1 
ATOM   568   N  N     . ASN A  1  75   ? 102.475 25.136  -28.795 1.00 94.89  ? 75   ASN A N     1 
ATOM   569   C  CA    . ASN A  1  75   ? 103.762 25.585  -28.261 1.00 93.88  ? 75   ASN A CA    1 
ATOM   570   C  C     . ASN A  1  75   ? 104.758 25.377  -29.358 1.00 96.20  ? 75   ASN A C     1 
ATOM   571   O  O     . ASN A  1  75   ? 105.388 24.306  -29.446 1.00 97.74  ? 75   ASN A O     1 
ATOM   572   C  CB    . ASN A  1  75   ? 104.148 24.832  -26.963 1.00 98.19  ? 75   ASN A CB    1 
ATOM   573   C  CG    . ASN A  1  75   ? 105.464 25.283  -26.348 1.00 136.70 ? 75   ASN A CG    1 
ATOM   574   O  OD1   . ASN A  1  75   ? 106.552 24.887  -26.790 1.00 129.51 ? 75   ASN A OD1   1 
ATOM   575   N  ND2   . ASN A  1  75   ? 105.397 26.113  -25.304 1.00 133.32 ? 75   ASN A ND2   1 
ATOM   576   N  N     . GLU A  1  76   ? 104.799 26.372  -30.270 1.00 88.77  ? 76   GLU A N     1 
ATOM   577   C  CA    . GLU A  1  76   ? 105.630 26.478  -31.484 1.00 86.69  ? 76   GLU A CA    1 
ATOM   578   C  C     . GLU A  1  76   ? 104.963 27.410  -32.473 1.00 87.13  ? 76   GLU A C     1 
ATOM   579   O  O     . GLU A  1  76   ? 105.562 28.406  -32.894 1.00 87.87  ? 76   GLU A O     1 
ATOM   580   C  CB    . GLU A  1  76   ? 105.920 25.122  -32.152 1.00 88.05  ? 76   GLU A CB    1 
ATOM   581   C  CG    . GLU A  1  76   ? 106.909 25.210  -33.293 1.00 97.67  ? 76   GLU A CG    1 
ATOM   582   C  CD    . GLU A  1  76   ? 108.147 26.037  -33.036 1.00 113.88 ? 76   GLU A CD    1 
ATOM   583   O  OE1   . GLU A  1  76   ? 109.040 25.533  -32.323 1.00 83.20  ? 76   GLU A OE1   1 
ATOM   584   O  OE2   . GLU A  1  76   ? 108.240 27.171  -33.564 1.00 119.99 ? 76   GLU A OE2   1 
ATOM   585   N  N     . CYS A  1  77   ? 103.721 27.103  -32.832 1.00 80.23  ? 77   CYS A N     1 
ATOM   586   C  CA    . CYS A  1  77   ? 102.974 27.943  -33.751 1.00 79.09  ? 77   CYS A CA    1 
ATOM   587   C  C     . CYS A  1  77   ? 102.740 29.363  -33.220 1.00 81.90  ? 77   CYS A C     1 
ATOM   588   O  O     . CYS A  1  77   ? 101.972 29.547  -32.258 1.00 81.82  ? 77   CYS A O     1 
ATOM   589   C  CB    . CYS A  1  77   ? 101.660 27.281  -34.158 1.00 79.03  ? 77   CYS A CB    1 
ATOM   590   S  SG    . CYS A  1  77   ? 100.744 28.194  -35.424 1.00 83.20  ? 77   CYS A SG    1 
ATOM   591   N  N     . PRO A  1  78   ? 103.327 30.408  -33.852 1.00 77.81  ? 78   PRO A N     1 
ATOM   592   C  CA    . PRO A  1  78   ? 102.911 31.768  -33.475 1.00 77.56  ? 78   PRO A CA    1 
ATOM   593   C  C     . PRO A  1  78   ? 101.564 31.890  -34.177 1.00 83.46  ? 78   PRO A C     1 
ATOM   594   O  O     . PRO A  1  78   ? 101.160 30.976  -34.904 1.00 84.31  ? 78   PRO A O     1 
ATOM   595   C  CB    . PRO A  1  78   ? 103.957 32.656  -34.152 1.00 78.85  ? 78   PRO A CB    1 
ATOM   596   C  CG    . PRO A  1  78   ? 104.333 31.899  -35.393 1.00 83.17  ? 78   PRO A CG    1 
ATOM   597   C  CD    . PRO A  1  78   ? 104.183 30.421  -35.062 1.00 79.05  ? 78   PRO A CD    1 
ATOM   598   N  N     . GLY A  1  79   ? 100.887 32.986  -34.069 1.00 80.19  ? 79   GLY A N     1 
ATOM   599   C  CA    . GLY A  1  79   ? 99.676  32.973  -34.873 1.00 81.07  ? 79   GLY A CA    1 
ATOM   600   C  C     . GLY A  1  79   ? 99.914  33.264  -36.350 1.00 85.27  ? 79   GLY A C     1 
ATOM   601   O  O     . GLY A  1  79   ? 101.024 33.634  -36.765 1.00 85.99  ? 79   GLY A O     1 
ATOM   602   N  N     . HIS A  1  80   ? 98.871  33.100  -37.156 1.00 80.30  ? 80   HIS A N     1 
ATOM   603   C  CA    . HIS A  1  80   ? 98.918  33.492  -38.563 1.00 79.89  ? 80   HIS A CA    1 
ATOM   604   C  C     . HIS A  1  80   ? 97.775  34.477  -38.784 1.00 83.64  ? 80   HIS A C     1 
ATOM   605   O  O     . HIS A  1  80   ? 96.641  34.207  -38.397 1.00 83.15  ? 80   HIS A O     1 
ATOM   606   C  CB    . HIS A  1  80   ? 98.880  32.297  -39.520 1.00 80.68  ? 80   HIS A CB    1 
ATOM   607   C  CG    . HIS A  1  80   ? 99.979  31.320  -39.274 1.00 83.33  ? 80   HIS A CG    1 
ATOM   608   N  ND1   . HIS A  1  80   ? 101.288 31.619  -39.585 1.00 84.85  ? 80   HIS A ND1   1 
ATOM   609   C  CD2   . HIS A  1  80   ? 99.931  30.095  -38.697 1.00 84.42  ? 80   HIS A CD2   1 
ATOM   610   C  CE1   . HIS A  1  80   ? 101.990 30.564  -39.204 1.00 83.72  ? 80   HIS A CE1   1 
ATOM   611   N  NE2   . HIS A  1  80   ? 101.214 29.626  -38.656 1.00 83.70  ? 80   HIS A NE2   1 
ATOM   612   N  N     . PHE A  1  81   ? 98.095  35.666  -39.279 1.00 80.38  ? 81   PHE A N     1 
ATOM   613   C  CA    . PHE A  1  81   ? 97.081  36.685  -39.495 1.00 80.62  ? 81   PHE A CA    1 
ATOM   614   C  C     . PHE A  1  81   ? 96.226  36.364  -40.736 1.00 85.59  ? 81   PHE A C     1 
ATOM   615   O  O     . PHE A  1  81   ? 96.674  35.652  -41.641 1.00 85.33  ? 81   PHE A O     1 
ATOM   616   C  CB    . PHE A  1  81   ? 97.743  38.072  -39.620 1.00 82.23  ? 81   PHE A CB    1 
ATOM   617   C  CG    . PHE A  1  81   ? 97.899  38.829  -38.323 1.00 82.09  ? 81   PHE A CG    1 
ATOM   618   C  CD1   . PHE A  1  81   ? 98.925  38.517  -37.436 1.00 83.50  ? 81   PHE A CD1   1 
ATOM   619   C  CD2   . PHE A  1  81   ? 97.047  39.879  -38.006 1.00 83.57  ? 81   PHE A CD2   1 
ATOM   620   C  CE1   . PHE A  1  81   ? 99.073  39.221  -36.238 1.00 83.29  ? 81   PHE A CE1   1 
ATOM   621   C  CE2   . PHE A  1  81   ? 97.210  40.597  -36.818 1.00 85.36  ? 81   PHE A CE2   1 
ATOM   622   C  CZ    . PHE A  1  81   ? 98.209  40.250  -35.934 1.00 82.32  ? 81   PHE A CZ    1 
ATOM   623   N  N     . GLY A  1  82   ? 94.996  36.870  -40.725 1.00 81.87  ? 82   GLY A N     1 
ATOM   624   C  CA    . GLY A  1  82   ? 94.036  36.784  -41.816 1.00 82.18  ? 82   GLY A CA    1 
ATOM   625   C  C     . GLY A  1  82   ? 93.652  38.201  -42.187 1.00 86.05  ? 82   GLY A C     1 
ATOM   626   O  O     . GLY A  1  82   ? 94.396  39.142  -41.866 1.00 86.23  ? 82   GLY A O     1 
ATOM   627   N  N     . HIS A  1  83   ? 92.498  38.384  -42.844 1.00 81.46  ? 83   HIS A N     1 
ATOM   628   C  CA    . HIS A  1  83   ? 92.040  39.731  -43.197 1.00 81.37  ? 83   HIS A CA    1 
ATOM   629   C  C     . HIS A  1  83   ? 90.542  39.803  -43.457 1.00 88.40  ? 83   HIS A C     1 
ATOM   630   O  O     . HIS A  1  83   ? 89.917  38.785  -43.763 1.00 88.64  ? 83   HIS A O     1 
ATOM   631   C  CB    . HIS A  1  83   ? 92.840  40.333  -44.371 1.00 81.77  ? 83   HIS A CB    1 
ATOM   632   C  CG    . HIS A  1  83   ? 92.513  39.733  -45.695 1.00 85.62  ? 83   HIS A CG    1 
ATOM   633   N  ND1   . HIS A  1  83   ? 91.859  40.458  -46.666 1.00 88.47  ? 83   HIS A ND1   1 
ATOM   634   C  CD2   . HIS A  1  83   ? 92.727  38.482  -46.157 1.00 86.87  ? 83   HIS A CD2   1 
ATOM   635   C  CE1   . HIS A  1  83   ? 91.718  39.638  -47.694 1.00 88.23  ? 83   HIS A CE1   1 
ATOM   636   N  NE2   . HIS A  1  83   ? 92.233  38.440  -47.432 1.00 87.85  ? 83   HIS A NE2   1 
ATOM   637   N  N     . ILE A  1  84   ? 89.962  41.005  -43.300 1.00 86.36  ? 84   ILE A N     1 
ATOM   638   C  CA    . ILE A  1  84   ? 88.553  41.244  -43.586 1.00 87.36  ? 84   ILE A CA    1 
ATOM   639   C  C     . ILE A  1  84   ? 88.483  42.545  -44.383 1.00 90.66  ? 84   ILE A C     1 
ATOM   640   O  O     . ILE A  1  84   ? 88.810  43.615  -43.865 1.00 89.52  ? 84   ILE A O     1 
ATOM   641   C  CB    . ILE A  1  84   ? 87.506  41.101  -42.400 1.00 90.44  ? 84   ILE A CB    1 
ATOM   642   C  CG1   . ILE A  1  84   ? 86.106  41.656  -42.772 1.00 93.47  ? 84   ILE A CG1   1 
ATOM   643   C  CG2   . ILE A  1  84   ? 87.962  41.681  -41.087 1.00 88.63  ? 84   ILE A CG2   1 
ATOM   644   C  CD1   . ILE A  1  84   ? 85.396  41.081  -44.208 1.00 112.72 ? 84   ILE A CD1   1 
ATOM   645   N  N     . ASP A  1  85   ? 88.117  42.408  -45.681 1.00 88.12  ? 85   ASP A N     1 
ATOM   646   C  CA    . ASP A  1  85   ? 88.002  43.505  -46.644 1.00 89.12  ? 85   ASP A CA    1 
ATOM   647   C  C     . ASP A  1  85   ? 86.781  44.366  -46.320 1.00 93.98  ? 85   ASP A C     1 
ATOM   648   O  O     . ASP A  1  85   ? 85.637  43.910  -46.464 1.00 95.08  ? 85   ASP A O     1 
ATOM   649   C  CB    . ASP A  1  85   ? 87.947  42.970  -48.095 1.00 91.97  ? 85   ASP A CB    1 
ATOM   650   C  CG    . ASP A  1  85   ? 89.274  42.504  -48.668 1.00 100.13 ? 85   ASP A CG    1 
ATOM   651   O  OD1   . ASP A  1  85   ? 90.248  43.293  -48.628 1.00 100.25 ? 85   ASP A OD1   1 
ATOM   652   O  OD2   . ASP A  1  85   ? 89.330  41.360  -49.193 1.00 103.33 ? 85   ASP A OD2   1 
ATOM   653   N  N     . LEU A  1  86   ? 87.029  45.596  -45.840 1.00 89.46  ? 86   LEU A N     1 
ATOM   654   C  CA    . LEU A  1  86   ? 85.974  46.538  -45.457 1.00 89.55  ? 86   LEU A CA    1 
ATOM   655   C  C     . LEU A  1  86   ? 85.219  47.064  -46.678 1.00 95.00  ? 86   LEU A C     1 
ATOM   656   O  O     . LEU A  1  86   ? 85.841  47.353  -47.703 1.00 95.77  ? 86   LEU A O     1 
ATOM   657   C  CB    . LEU A  1  86   ? 86.521  47.689  -44.586 1.00 88.73  ? 86   LEU A CB    1 
ATOM   658   C  CG    . LEU A  1  86   ? 87.396  47.293  -43.385 1.00 91.38  ? 86   LEU A CG    1 
ATOM   659   C  CD1   . LEU A  1  86   ? 88.106  48.500  -42.813 1.00 91.30  ? 86   LEU A CD1   1 
ATOM   660   C  CD2   . LEU A  1  86   ? 86.596  46.576  -42.310 1.00 91.84  ? 86   LEU A CD2   1 
ATOM   661   N  N     . ALA A  1  87   ? 83.878  47.133  -46.576 1.00 91.60  ? 87   ALA A N     1 
ATOM   662   C  CA    . ALA A  1  87   ? 82.950  47.560  -47.626 1.00 93.03  ? 87   ALA A CA    1 
ATOM   663   C  C     . ALA A  1  87   ? 83.092  49.040  -47.999 1.00 98.23  ? 87   ALA A C     1 
ATOM   664   O  O     . ALA A  1  87   ? 82.855  49.415  -49.158 1.00 98.36  ? 87   ALA A O     1 
ATOM   665   C  CB    . ALA A  1  87   ? 81.521  47.252  -47.206 1.00 94.09  ? 87   ALA A CB    1 
ATOM   666   N  N     . LYS A  1  88   ? 83.471  49.872  -47.003 1.00 94.93  ? 88   LYS A N     1 
ATOM   667   C  CA    . LYS A  1  88   ? 83.705  51.317  -47.112 1.00 95.25  ? 88   LYS A CA    1 
ATOM   668   C  C     . LYS A  1  88   ? 84.924  51.671  -46.255 1.00 97.59  ? 88   LYS A C     1 
ATOM   669   O  O     . LYS A  1  88   ? 85.137  50.989  -45.249 1.00 95.70  ? 88   LYS A O     1 
ATOM   670   C  CB    . LYS A  1  88   ? 82.478  52.109  -46.624 1.00 98.14  ? 88   LYS A CB    1 
ATOM   671   C  CG    . LYS A  1  88   ? 81.369  52.249  -47.667 1.00 115.88 ? 88   LYS A CG    1 
ATOM   672   C  CD    . LYS A  1  88   ? 81.417  53.603  -48.389 1.00 126.89 ? 88   LYS A CD    1 
ATOM   673   C  CE    . LYS A  1  88   ? 80.186  53.854  -49.226 1.00 137.37 ? 88   LYS A CE    1 
ATOM   674   N  NZ    . LYS A  1  88   ? 80.225  55.182  -49.898 1.00 146.72 ? 88   LYS A NZ    1 
ATOM   675   N  N     . PRO A  1  89   ? 85.753  52.691  -46.606 1.00 94.79  ? 89   PRO A N     1 
ATOM   676   C  CA    . PRO A  1  89   ? 86.888  53.028  -45.735 1.00 93.43  ? 89   PRO A CA    1 
ATOM   677   C  C     . PRO A  1  89   ? 86.399  53.601  -44.407 1.00 98.27  ? 89   PRO A C     1 
ATOM   678   O  O     . PRO A  1  89   ? 85.294  54.163  -44.303 1.00 99.65  ? 89   PRO A O     1 
ATOM   679   C  CB    . PRO A  1  89   ? 87.690  54.040  -46.553 1.00 95.63  ? 89   PRO A CB    1 
ATOM   680   C  CG    . PRO A  1  89   ? 86.701  54.682  -47.403 1.00 102.09 ? 89   PRO A CG    1 
ATOM   681   C  CD    . PRO A  1  89   ? 85.672  53.625  -47.746 1.00 98.14  ? 89   PRO A CD    1 
ATOM   682   N  N     . VAL A  1  90   ? 87.208  53.398  -43.380 1.00 92.56  ? 90   VAL A N     1 
ATOM   683   C  CA    . VAL A  1  90   ? 86.902  53.789  -42.020 1.00 90.98  ? 90   VAL A CA    1 
ATOM   684   C  C     . VAL A  1  90   ? 88.155  54.435  -41.424 1.00 94.81  ? 90   VAL A C     1 
ATOM   685   O  O     . VAL A  1  90   ? 89.259  54.136  -41.873 1.00 94.53  ? 90   VAL A O     1 
ATOM   686   C  CB    . VAL A  1  90   ? 86.434  52.496  -41.300 1.00 93.05  ? 90   VAL A CB    1 
ATOM   687   C  CG1   . VAL A  1  90   ? 86.832  52.456  -39.839 1.00 91.79  ? 90   VAL A CG1   1 
ATOM   688   C  CG2   . VAL A  1  90   ? 84.936  52.280  -41.472 1.00 93.24  ? 90   VAL A CG2   1 
ATOM   689   N  N     . PHE A  1  91   ? 87.992  55.366  -40.474 1.00 91.60  ? 91   PHE A N     1 
ATOM   690   C  CA    . PHE A  1  91   ? 89.148  55.993  -39.831 1.00 90.86  ? 91   PHE A CA    1 
ATOM   691   C  C     . PHE A  1  91   ? 89.676  55.067  -38.753 1.00 92.37  ? 91   PHE A C     1 
ATOM   692   O  O     . PHE A  1  91   ? 88.889  54.370  -38.114 1.00 92.17  ? 91   PHE A O     1 
ATOM   693   C  CB    . PHE A  1  91   ? 88.762  57.307  -39.117 1.00 93.22  ? 91   PHE A CB    1 
ATOM   694   C  CG    . PHE A  1  91   ? 88.232  58.471  -39.915 1.00 96.75  ? 91   PHE A CG    1 
ATOM   695   C  CD1   . PHE A  1  91   ? 88.855  58.874  -41.093 1.00 100.83 ? 91   PHE A CD1   1 
ATOM   696   C  CD2   . PHE A  1  91   ? 87.166  59.227  -39.442 1.00 100.20 ? 91   PHE A CD2   1 
ATOM   697   C  CE1   . PHE A  1  91   ? 88.382  59.979  -41.812 1.00 103.17 ? 91   PHE A CE1   1 
ATOM   698   C  CE2   . PHE A  1  91   ? 86.692  60.331  -40.163 1.00 104.43 ? 91   PHE A CE2   1 
ATOM   699   C  CZ    . PHE A  1  91   ? 87.309  60.703  -41.337 1.00 103.05 ? 91   PHE A CZ    1 
ATOM   700   N  N     . HIS A  1  92   ? 90.987  55.112  -38.490 1.00 86.90  ? 92   HIS A N     1 
ATOM   701   C  CA    . HIS A  1  92   ? 91.583  54.407  -37.352 1.00 84.99  ? 92   HIS A CA    1 
ATOM   702   C  C     . HIS A  1  92   ? 91.320  55.377  -36.162 1.00 89.59  ? 92   HIS A C     1 
ATOM   703   O  O     . HIS A  1  92   ? 91.608  56.575  -36.289 1.00 90.20  ? 92   HIS A O     1 
ATOM   704   C  CB    . HIS A  1  92   ? 93.095  54.202  -37.586 1.00 84.44  ? 92   HIS A CB    1 
ATOM   705   C  CG    . HIS A  1  92   ? 93.837  53.552  -36.455 1.00 85.92  ? 92   HIS A CG    1 
ATOM   706   N  ND1   . HIS A  1  92   ? 94.562  52.394  -36.643 1.00 86.67  ? 92   HIS A ND1   1 
ATOM   707   C  CD2   . HIS A  1  92   ? 93.991  53.953  -35.172 1.00 86.53  ? 92   HIS A CD2   1 
ATOM   708   C  CE1   . HIS A  1  92   ? 95.111  52.118  -35.472 1.00 84.65  ? 92   HIS A CE1   1 
ATOM   709   N  NE2   . HIS A  1  92   ? 94.798  53.028  -34.559 1.00 84.98  ? 92   HIS A NE2   1 
ATOM   710   N  N     . VAL A  1  93   ? 90.723  54.890  -35.050 1.00 85.10  ? 93   VAL A N     1 
ATOM   711   C  CA    . VAL A  1  93   ? 90.401  55.746  -33.887 1.00 84.55  ? 93   VAL A CA    1 
ATOM   712   C  C     . VAL A  1  93   ? 91.553  56.606  -33.431 1.00 90.12  ? 93   VAL A C     1 
ATOM   713   O  O     . VAL A  1  93   ? 91.366  57.797  -33.164 1.00 91.19  ? 93   VAL A O     1 
ATOM   714   C  CB    . VAL A  1  93   ? 89.851  54.997  -32.666 1.00 86.81  ? 93   VAL A CB    1 
ATOM   715   C  CG1   . VAL A  1  93   ? 88.372  55.222  -32.516 1.00 87.03  ? 93   VAL A CG1   1 
ATOM   716   C  CG2   . VAL A  1  93   ? 90.215  53.523  -32.682 1.00 85.91  ? 93   VAL A CG2   1 
ATOM   717   N  N     . GLY A  1  94   ? 92.721  55.977  -33.314 1.00 85.69  ? 94   GLY A N     1 
ATOM   718   C  CA    . GLY A  1  94   ? 93.946  56.601  -32.846 1.00 84.96  ? 94   GLY A CA    1 
ATOM   719   C  C     . GLY A  1  94   ? 94.482  57.695  -33.736 1.00 89.80  ? 94   GLY A C     1 
ATOM   720   O  O     . GLY A  1  94   ? 95.290  58.494  -33.267 1.00 91.32  ? 94   GLY A O     1 
ATOM   721   N  N     . PHE A  1  95   ? 94.054  57.751  -35.014 1.00 85.08  ? 95   PHE A N     1 
ATOM   722   C  CA    . PHE A  1  95   ? 94.558  58.751  -35.956 1.00 84.70  ? 95   PHE A CA    1 
ATOM   723   C  C     . PHE A  1  95   ? 93.504  59.751  -36.422 1.00 88.69  ? 95   PHE A C     1 
ATOM   724   O  O     . PHE A  1  95   ? 93.783  60.510  -37.351 1.00 89.10  ? 95   PHE A O     1 
ATOM   725   C  CB    . PHE A  1  95   ? 95.263  58.081  -37.164 1.00 86.31  ? 95   PHE A CB    1 
ATOM   726   C  CG    . PHE A  1  95   ? 96.418  57.172  -36.805 1.00 86.64  ? 95   PHE A CG    1 
ATOM   727   C  CD1   . PHE A  1  95   ? 97.550  57.671  -36.173 1.00 88.81  ? 95   PHE A CD1   1 
ATOM   728   C  CD2   . PHE A  1  95   ? 96.370  55.815  -37.091 1.00 88.59  ? 95   PHE A CD2   1 
ATOM   729   C  CE1   . PHE A  1  95   ? 98.594  56.821  -35.800 1.00 88.47  ? 95   PHE A CE1   1 
ATOM   730   C  CE2   . PHE A  1  95   ? 97.416  54.965  -36.714 1.00 90.06  ? 95   PHE A CE2   1 
ATOM   731   C  CZ    . PHE A  1  95   ? 98.526  55.476  -36.087 1.00 87.37  ? 95   PHE A CZ    1 
ATOM   732   N  N     . ILE A  1  96   ? 92.321  59.803  -35.770 1.00 84.60  ? 96   ILE A N     1 
ATOM   733   C  CA    . ILE A  1  96   ? 91.278  60.768  -36.164 1.00 85.67  ? 96   ILE A CA    1 
ATOM   734   C  C     . ILE A  1  96   ? 91.790  62.225  -36.018 1.00 91.75  ? 96   ILE A C     1 
ATOM   735   O  O     . ILE A  1  96   ? 91.514  63.068  -36.877 1.00 92.61  ? 96   ILE A O     1 
ATOM   736   C  CB    . ILE A  1  96   ? 89.913  60.517  -35.467 1.00 88.08  ? 96   ILE A CB    1 
ATOM   737   C  CG1   . ILE A  1  96   ? 89.335  59.158  -35.903 1.00 88.35  ? 96   ILE A CG1   1 
ATOM   738   C  CG2   . ILE A  1  96   ? 88.913  61.651  -35.758 1.00 88.85  ? 96   ILE A CG2   1 
ATOM   739   C  CD1   . ILE A  1  96   ? 88.135  58.674  -35.131 1.00 95.98  ? 96   ILE A CD1   1 
ATOM   740   N  N     . ALA A  1  97   ? 92.588  62.484  -34.970 1.00 88.25  ? 97   ALA A N     1 
ATOM   741   C  CA    . ALA A  1  97   ? 93.179  63.789  -34.715 1.00 88.54  ? 97   ALA A CA    1 
ATOM   742   C  C     . ALA A  1  97   ? 94.151  64.147  -35.828 1.00 93.61  ? 97   ALA A C     1 
ATOM   743   O  O     . ALA A  1  97   ? 94.019  65.240  -36.398 1.00 96.01  ? 97   ALA A O     1 
ATOM   744   C  CB    . ALA A  1  97   ? 93.900  63.780  -33.381 1.00 88.34  ? 97   ALA A CB    1 
ATOM   745   N  N     . LYS A  1  98   ? 95.107  63.223  -36.158 1.00 87.35  ? 98   LYS A N     1 
ATOM   746   C  CA    . LYS A  1  98   ? 96.101  63.446  -37.214 1.00 86.72  ? 98   LYS A CA    1 
ATOM   747   C  C     . LYS A  1  98   ? 95.421  63.611  -38.575 1.00 92.27  ? 98   LYS A C     1 
ATOM   748   O  O     . LYS A  1  98   ? 95.713  64.589  -39.273 1.00 92.52  ? 98   LYS A O     1 
ATOM   749   C  CB    . LYS A  1  98   ? 97.208  62.375  -37.231 1.00 86.84  ? 98   LYS A CB    1 
ATOM   750   C  CG    . LYS A  1  98   ? 98.583  62.936  -37.617 1.00 89.13  ? 98   LYS A CG    1 
ATOM   751   C  CD    . LYS A  1  98   ? 99.732  62.335  -36.810 1.00 92.50  ? 98   LYS A CD    1 
ATOM   752   C  CE    . LYS A  1  98   ? 100.877 63.304  -36.602 1.00 102.56 ? 98   LYS A CE    1 
ATOM   753   N  NZ    . LYS A  1  98   ? 101.920 63.214  -37.670 1.00 114.99 ? 98   LYS A NZ    1 
ATOM   754   N  N     . ILE A  1  99   ? 94.438  62.726  -38.902 1.00 88.25  ? 99   ILE A N     1 
ATOM   755   C  CA    . ILE A  1  99   ? 93.672  62.815  -40.149 1.00 88.62  ? 99   ILE A CA    1 
ATOM   756   C  C     . ILE A  1  99   ? 93.140  64.244  -40.280 1.00 94.92  ? 99   ILE A C     1 
ATOM   757   O  O     . ILE A  1  99   ? 93.374  64.881  -41.312 1.00 96.33  ? 99   ILE A O     1 
ATOM   758   C  CB    . ILE A  1  99   ? 92.553  61.739  -40.240 1.00 90.68  ? 99   ILE A CB    1 
ATOM   759   C  CG1   . ILE A  1  99   ? 93.131  60.350  -40.565 1.00 88.73  ? 99   ILE A CG1   1 
ATOM   760   C  CG2   . ILE A  1  99   ? 91.511  62.127  -41.287 1.00 93.69  ? 99   ILE A CG2   1 
ATOM   761   C  CD1   . ILE A  1  99   ? 92.300  59.212  -40.107 1.00 82.40  ? 99   ILE A CD1   1 
ATOM   762   N  N     . LYS A  1  100  ? 92.504  64.764  -39.197 1.00 91.39  ? 100  LYS A N     1 
ATOM   763   C  CA    . LYS A  1  100  ? 91.957  66.125  -39.130 1.00 92.18  ? 100  LYS A CA    1 
ATOM   764   C  C     . LYS A  1  100  ? 93.060  67.159  -39.359 1.00 95.81  ? 100  LYS A C     1 
ATOM   765   O  O     . LYS A  1  100  ? 92.917  68.004  -40.240 1.00 96.17  ? 100  LYS A O     1 
ATOM   766   C  CB    . LYS A  1  100  ? 91.200  66.373  -37.805 1.00 93.79  ? 100  LYS A CB    1 
ATOM   767   C  CG    . LYS A  1  100  ? 90.445  67.705  -37.767 1.00 102.75 ? 100  LYS A CG    1 
ATOM   768   C  CD    . LYS A  1  100  ? 89.666  67.925  -36.468 1.00 102.87 ? 100  LYS A CD    1 
ATOM   769   C  CE    . LYS A  1  100  ? 89.284  69.372  -36.263 1.00 101.69 ? 100  LYS A CE    1 
ATOM   770   N  NZ    . LYS A  1  100  ? 90.473  70.218  -35.968 1.00 104.84 ? 100  LYS A NZ    1 
ATOM   771   N  N     . LYS A  1  101  ? 94.178  67.048  -38.622 1.00 91.33  ? 101  LYS A N     1 
ATOM   772   C  CA    . LYS A  1  101  ? 95.312  67.966  -38.768 1.00 91.49  ? 101  LYS A CA    1 
ATOM   773   C  C     . LYS A  1  101  ? 95.863  68.013  -40.200 1.00 95.96  ? 101  LYS A C     1 
ATOM   774   O  O     . LYS A  1  101  ? 96.057  69.106  -40.727 1.00 96.10  ? 101  LYS A O     1 
ATOM   775   C  CB    . LYS A  1  101  ? 96.421  67.667  -37.743 1.00 92.37  ? 101  LYS A CB    1 
ATOM   776   C  CG    . LYS A  1  101  ? 96.022  68.039  -36.316 1.00 101.79 ? 101  LYS A CG    1 
ATOM   777   C  CD    . LYS A  1  101  ? 97.178  68.658  -35.545 1.00 103.73 ? 101  LYS A CD    1 
ATOM   778   C  CE    . LYS A  1  101  ? 96.777  69.047  -34.148 1.00 102.59 ? 101  LYS A CE    1 
ATOM   779   N  NZ    . LYS A  1  101  ? 97.886  69.736  -33.452 1.00 107.39 ? 101  LYS A NZ    1 
ATOM   780   N  N     . VAL A  1  102  ? 96.064  66.835  -40.837 1.00 92.35  ? 102  VAL A N     1 
ATOM   781   C  CA    . VAL A  1  102  ? 96.568  66.700  -42.214 1.00 92.55  ? 102  VAL A CA    1 
ATOM   782   C  C     . VAL A  1  102  ? 95.589  67.356  -43.197 1.00 98.72  ? 102  VAL A C     1 
ATOM   783   O  O     . VAL A  1  102  ? 96.024  68.030  -44.135 1.00 99.05  ? 102  VAL A O     1 
ATOM   784   C  CB    . VAL A  1  102  ? 96.891  65.229  -42.589 1.00 94.99  ? 102  VAL A CB    1 
ATOM   785   C  CG1   . VAL A  1  102  ? 97.466  65.133  -44.000 1.00 95.50  ? 102  VAL A CG1   1 
ATOM   786   C  CG2   . VAL A  1  102  ? 97.846  64.590  -41.578 1.00 93.12  ? 102  VAL A CG2   1 
ATOM   787   N  N     . CYS A  1  103  ? 94.272  67.200  -42.945 1.00 96.56  ? 103  CYS A N     1 
ATOM   788   C  CA    . CYS A  1  103  ? 93.217  67.820  -43.748 1.00 98.60  ? 103  CYS A CA    1 
ATOM   789   C  C     . CYS A  1  103  ? 93.346  69.335  -43.676 1.00 102.29 ? 103  CYS A C     1 
ATOM   790   O  O     . CYS A  1  103  ? 93.225  70.003  -44.697 1.00 103.57 ? 103  CYS A O     1 
ATOM   791   C  CB    . CYS A  1  103  ? 91.840  67.365  -43.280 1.00 99.51  ? 103  CYS A CB    1 
ATOM   792   S  SG    . CYS A  1  103  ? 91.330  65.751  -43.915 1.00 103.43 ? 103  CYS A SG    1 
ATOM   793   N  N     . GLU A  1  104  ? 93.640  69.859  -42.472 1.00 97.41  ? 104  GLU A N     1 
ATOM   794   C  CA    . GLU A  1  104  ? 93.834  71.278  -42.181 1.00 97.90  ? 104  GLU A CA    1 
ATOM   795   C  C     . GLU A  1  104  ? 95.164  71.852  -42.737 1.00 106.48 ? 104  GLU A C     1 
ATOM   796   O  O     . GLU A  1  104  ? 95.363  73.068  -42.685 1.00 108.36 ? 104  GLU A O     1 
ATOM   797   C  CB    . GLU A  1  104  ? 93.692  71.547  -40.671 1.00 97.51  ? 104  GLU A CB    1 
ATOM   798   C  CG    . GLU A  1  104  ? 92.290  71.292  -40.156 1.00 102.53 ? 104  GLU A CG    1 
ATOM   799   C  CD    . GLU A  1  104  ? 92.101  71.340  -38.655 1.00 126.34 ? 104  GLU A CD    1 
ATOM   800   O  OE1   . GLU A  1  104  ? 92.978  70.834  -37.917 1.00 123.26 ? 104  GLU A OE1   1 
ATOM   801   O  OE2   . GLU A  1  104  ? 91.031  71.822  -38.218 1.00 128.14 ? 104  GLU A OE2   1 
ATOM   802   N  N     . CYS A  1  105  ? 96.046  70.996  -43.298 1.00 104.00 ? 105  CYS A N     1 
ATOM   803   C  CA    . CYS A  1  105  ? 97.345  71.396  -43.871 1.00 104.68 ? 105  CYS A CA    1 
ATOM   804   C  C     . CYS A  1  105  ? 97.344  71.462  -45.397 1.00 110.80 ? 105  CYS A C     1 
ATOM   805   O  O     . CYS A  1  105  ? 98.101  72.222  -46.002 1.00 110.55 ? 105  CYS A O     1 
ATOM   806   C  CB    . CYS A  1  105  ? 98.441  70.452  -43.384 1.00 103.37 ? 105  CYS A CB    1 
ATOM   807   S  SG    . CYS A  1  105  ? 98.823  70.605  -41.627 1.00 105.84 ? 105  CYS A SG    1 
ATOM   808   N  N     . VAL A  1  106  ? 96.540  70.596  -45.998 1.00 108.79 ? 106  VAL A N     1 
ATOM   809   C  CA    . VAL A  1  106  ? 96.454  70.313  -47.416 1.00 110.00 ? 106  VAL A CA    1 
ATOM   810   C  C     . VAL A  1  106  ? 95.153  70.857  -48.035 1.00 116.02 ? 106  VAL A C     1 
ATOM   811   O  O     . VAL A  1  106  ? 94.169  71.069  -47.319 1.00 115.92 ? 106  VAL A O     1 
ATOM   812   C  CB    . VAL A  1  106  ? 96.642  68.754  -47.509 1.00 112.58 ? 106  VAL A CB    1 
ATOM   813   C  CG1   . VAL A  1  106  ? 95.787  68.077  -48.580 1.00 113.09 ? 106  VAL A CG1   1 
ATOM   814   C  CG2   . VAL A  1  106  ? 98.118  68.374  -47.634 1.00 111.80 ? 106  VAL A CG2   1 
ATOM   815   N  N     . CYS A  1  107  ? 95.165  71.107  -49.361 1.00 114.23 ? 107  CYS A N     1 
ATOM   816   C  CA    . CYS A  1  107  ? 93.976  71.539  -50.092 1.00 115.92 ? 107  CYS A CA    1 
ATOM   817   C  C     . CYS A  1  107  ? 93.035  70.343  -50.155 1.00 119.63 ? 107  CYS A C     1 
ATOM   818   O  O     . CYS A  1  107  ? 93.414  69.299  -50.694 1.00 118.32 ? 107  CYS A O     1 
ATOM   819   C  CB    . CYS A  1  107  ? 94.331  72.043  -51.492 1.00 117.88 ? 107  CYS A CB    1 
ATOM   820   S  SG    . CYS A  1  107  ? 92.919  72.151  -52.633 1.00 123.46 ? 107  CYS A SG    1 
ATOM   821   N  N     . MET A  1  108  ? 91.816  70.494  -49.616 1.00 117.37 ? 108  MET A N     1 
ATOM   822   C  CA    . MET A  1  108  ? 90.808  69.435  -49.621 1.00 117.72 ? 108  MET A CA    1 
ATOM   823   C  C     . MET A  1  108  ? 90.249  69.122  -51.015 1.00 124.76 ? 108  MET A C     1 
ATOM   824   O  O     . MET A  1  108  ? 89.221  68.446  -51.123 1.00 124.90 ? 108  MET A O     1 
ATOM   825   C  CB    . MET A  1  108  ? 89.680  69.729  -48.619 1.00 119.86 ? 108  MET A CB    1 
ATOM   826   C  CG    . MET A  1  108  ? 90.046  69.388  -47.189 1.00 122.04 ? 108  MET A CG    1 
ATOM   827   S  SD    . MET A  1  108  ? 90.898  67.795  -46.938 1.00 124.58 ? 108  MET A SD    1 
ATOM   828   C  CE    . MET A  1  108  ? 89.575  66.621  -47.340 1.00 121.24 ? 108  MET A CE    1 
ATOM   829   N  N     . HIS A  1  109  ? 90.959  69.553  -52.075 1.00 123.09 ? 109  HIS A N     1 
ATOM   830   C  CA    . HIS A  1  109  ? 90.554  69.313  -53.450 1.00 124.82 ? 109  HIS A CA    1 
ATOM   831   C  C     . HIS A  1  109  ? 91.681  68.801  -54.354 1.00 127.81 ? 109  HIS A C     1 
ATOM   832   O  O     . HIS A  1  109  ? 91.428  67.865  -55.118 1.00 127.91 ? 109  HIS A O     1 
ATOM   833   C  CB    . HIS A  1  109  ? 89.891  70.556  -54.045 1.00 128.16 ? 109  HIS A CB    1 
ATOM   834   C  CG    . HIS A  1  109  ? 89.406  70.343  -55.439 1.00 133.86 ? 109  HIS A CG    1 
ATOM   835   N  ND1   . HIS A  1  109  ? 90.159  70.739  -56.531 1.00 137.16 ? 109  HIS A ND1   1 
ATOM   836   C  CD2   . HIS A  1  109  ? 88.287  69.724  -55.878 1.00 136.72 ? 109  HIS A CD2   1 
ATOM   837   C  CE1   . HIS A  1  109  ? 89.462  70.380  -57.596 1.00 138.10 ? 109  HIS A CE1   1 
ATOM   838   N  NE2   . HIS A  1  109  ? 88.327  69.766  -57.253 1.00 138.19 ? 109  HIS A NE2   1 
ATOM   839   N  N     . CYS A  1  110  ? 92.900  69.412  -54.302 1.00 122.88 ? 110  CYS A N     1 
ATOM   840   C  CA    . CYS A  1  110  ? 94.025  69.005  -55.163 1.00 122.17 ? 110  CYS A CA    1 
ATOM   841   C  C     . CYS A  1  110  ? 95.169  68.279  -54.424 1.00 123.43 ? 110  CYS A C     1 
ATOM   842   O  O     . CYS A  1  110  ? 95.995  67.640  -55.083 1.00 122.87 ? 110  CYS A O     1 
ATOM   843   C  CB    . CYS A  1  110  ? 94.549  70.178  -55.988 1.00 124.04 ? 110  CYS A CB    1 
ATOM   844   S  SG    . CYS A  1  110  ? 95.498  71.402  -55.051 1.00 127.44 ? 110  CYS A SG    1 
ATOM   845   N  N     . GLY A  1  111  ? 95.201  68.372  -53.093 1.00 118.32 ? 111  GLY A N     1 
ATOM   846   C  CA    . GLY A  1  111  ? 96.201  67.707  -52.262 1.00 116.21 ? 111  GLY A CA    1 
ATOM   847   C  C     . GLY A  1  111  ? 97.469  68.492  -51.990 1.00 120.00 ? 111  GLY A C     1 
ATOM   848   O  O     . GLY A  1  111  ? 98.352  68.013  -51.269 1.00 118.42 ? 111  GLY A O     1 
ATOM   849   N  N     . LYS A  1  112  ? 97.579  69.695  -52.568 1.00 118.02 ? 112  LYS A N     1 
ATOM   850   C  CA    . LYS A  1  112  ? 98.747  70.554  -52.382 1.00 118.10 ? 112  LYS A CA    1 
ATOM   851   C  C     . LYS A  1  112  ? 98.719  71.180  -50.990 1.00 122.60 ? 112  LYS A C     1 
ATOM   852   O  O     . LYS A  1  112  ? 97.649  71.599  -50.535 1.00 122.82 ? 112  LYS A O     1 
ATOM   853   C  CB    . LYS A  1  112  ? 98.787  71.651  -53.458 1.00 121.78 ? 112  LYS A CB    1 
ATOM   854   C  CG    . LYS A  1  112  ? 100.178 72.205  -53.727 1.00 126.26 ? 112  LYS A CG    1 
ATOM   855   C  CD    . LYS A  1  112  ? 100.199 73.039  -54.998 1.00 130.41 ? 112  LYS A CD    1 
ATOM   856   C  CE    . LYS A  1  112  ? 101.601 73.378  -55.447 1.00 135.06 ? 112  LYS A CE    1 
ATOM   857   N  NZ    . LYS A  1  112  ? 102.200 74.481  -54.644 1.00 142.30 ? 112  LYS A NZ    1 
ATOM   858   N  N     . LEU A  1  113  ? 99.897  71.226  -50.315 1.00 118.37 ? 113  LEU A N     1 
ATOM   859   C  CA    . LEU A  1  113  ? 100.093 71.840  -48.994 1.00 117.13 ? 113  LEU A CA    1 
ATOM   860   C  C     . LEU A  1  113  ? 99.688  73.323  -49.098 1.00 122.62 ? 113  LEU A C     1 
ATOM   861   O  O     . LEU A  1  113  ? 100.170 74.026  -49.996 1.00 123.15 ? 113  LEU A O     1 
ATOM   862   C  CB    . LEU A  1  113  ? 101.575 71.737  -48.590 1.00 116.17 ? 113  LEU A CB    1 
ATOM   863   C  CG    . LEU A  1  113  ? 101.932 70.959  -47.329 1.00 118.51 ? 113  LEU A CG    1 
ATOM   864   C  CD1   . LEU A  1  113  ? 103.402 70.671  -47.297 1.00 117.69 ? 113  LEU A CD1   1 
ATOM   865   C  CD2   . LEU A  1  113  ? 101.577 71.732  -46.079 1.00 120.92 ? 113  LEU A CD2   1 
ATOM   866   N  N     . LEU A  1  114  ? 98.775  73.776  -48.210 1.00 119.18 ? 114  LEU A N     1 
ATOM   867   C  CA    . LEU A  1  114  ? 98.214  75.134  -48.193 1.00 120.24 ? 114  LEU A CA    1 
ATOM   868   C  C     . LEU A  1  114  ? 99.271  76.237  -48.217 1.00 126.89 ? 114  LEU A C     1 
ATOM   869   O  O     . LEU A  1  114  ? 99.007  77.318  -48.761 1.00 129.49 ? 114  LEU A O     1 
ATOM   870   C  CB    . LEU A  1  114  ? 97.223  75.333  -47.042 1.00 119.34 ? 114  LEU A CB    1 
ATOM   871   C  CG    . LEU A  1  114  ? 95.904  74.576  -47.193 1.00 123.77 ? 114  LEU A CG    1 
ATOM   872   C  CD1   . LEU A  1  114  ? 95.213  74.395  -45.862 1.00 123.17 ? 114  LEU A CD1   1 
ATOM   873   C  CD2   . LEU A  1  114  ? 94.987  75.253  -48.165 1.00 126.87 ? 114  LEU A CD2   1 
ATOM   874   N  N     . LEU A  1  115  ? 100.472 75.953  -47.690 1.00 121.87 ? 115  LEU A N     1 
ATOM   875   C  CA    . LEU A  1  115  ? 101.608 76.870  -47.743 1.00 122.33 ? 115  LEU A CA    1 
ATOM   876   C  C     . LEU A  1  115  ? 102.807 76.162  -48.375 1.00 126.79 ? 115  LEU A C     1 
ATOM   877   O  O     . LEU A  1  115  ? 102.797 74.935  -48.480 1.00 125.10 ? 115  LEU A O     1 
ATOM   878   C  CB    . LEU A  1  115  ? 101.930 77.479  -46.370 1.00 121.53 ? 115  LEU A CB    1 
ATOM   879   C  CG    . LEU A  1  115  ? 100.987 78.604  -45.937 1.00 127.36 ? 115  LEU A CG    1 
ATOM   880   C  CD1   . LEU A  1  115  ? 100.743 78.586  -44.451 1.00 126.40 ? 115  LEU A CD1   1 
ATOM   881   C  CD2   . LEU A  1  115  ? 101.506 79.953  -46.365 1.00 131.89 ? 115  LEU A CD2   1 
ATOM   882   N  N     . ASP A  1  116  ? 103.796 76.931  -48.872 1.00 125.71 ? 116  ASP A N     1 
ATOM   883   C  CA    . ASP A  1  116  ? 104.985 76.379  -49.529 1.00 125.98 ? 116  ASP A CA    1 
ATOM   884   C  C     . ASP A  1  116  ? 106.205 77.302  -49.441 1.00 133.14 ? 116  ASP A C     1 
ATOM   885   O  O     . ASP A  1  116  ? 106.217 78.237  -48.636 1.00 132.79 ? 116  ASP A O     1 
ATOM   886   C  CB    . ASP A  1  116  ? 104.676 75.970  -50.993 1.00 128.41 ? 116  ASP A CB    1 
ATOM   887   C  CG    . ASP A  1  116  ? 104.371 77.085  -51.981 1.00 133.17 ? 116  ASP A CG    1 
ATOM   888   O  OD1   . ASP A  1  116  ? 103.797 78.118  -51.562 1.00 133.32 ? 116  ASP A OD1   1 
ATOM   889   O  OD2   . ASP A  1  116  ? 104.625 76.887  -53.184 1.00 137.25 ? 116  ASP A OD2   1 
ATOM   890   N  N     . GLU A  1  117  ? 107.228 77.028  -50.277 1.00 132.45 ? 117  GLU A N     1 
ATOM   891   C  CA    . GLU A  1  117  ? 108.504 77.749  -50.393 1.00 133.76 ? 117  GLU A CA    1 
ATOM   892   C  C     . GLU A  1  117  ? 108.338 79.260  -50.628 1.00 141.90 ? 117  GLU A C     1 
ATOM   893   O  O     . GLU A  1  117  ? 109.282 80.018  -50.400 1.00 142.26 ? 117  GLU A O     1 
ATOM   894   C  CB    . GLU A  1  117  ? 109.359 77.122  -51.512 1.00 135.49 ? 117  GLU A CB    1 
ATOM   895   C  CG    . GLU A  1  117  ? 110.050 75.818  -51.134 1.00 145.79 ? 117  GLU A CG    1 
ATOM   896   C  CD    . GLU A  1  117  ? 109.200 74.597  -50.808 1.00 167.75 ? 117  GLU A CD    1 
ATOM   897   O  OE1   . GLU A  1  117  ? 108.054 74.502  -51.306 1.00 167.44 ? 117  GLU A OE1   1 
ATOM   898   O  OE2   . GLU A  1  117  ? 109.696 73.723  -50.060 1.00 155.18 ? 117  GLU A OE2   1 
ATOM   899   N  N     . HIS A  1  118  ? 107.137 79.698  -51.062 1.00 140.85 ? 118  HIS A N     1 
ATOM   900   C  CA    . HIS A  1  118  ? 106.841 81.108  -51.324 1.00 142.86 ? 118  HIS A CA    1 
ATOM   901   C  C     . HIS A  1  118  ? 106.326 81.868  -50.064 1.00 146.72 ? 118  HIS A C     1 
ATOM   902   O  O     . HIS A  1  118  ? 105.668 82.911  -50.194 1.00 148.42 ? 118  HIS A O     1 
ATOM   903   C  CB    . HIS A  1  118  ? 105.890 81.273  -52.536 1.00 145.17 ? 118  HIS A CB    1 
ATOM   904   C  CG    . HIS A  1  118  ? 106.297 80.524  -53.771 1.00 148.96 ? 118  HIS A CG    1 
ATOM   905   N  ND1   . HIS A  1  118  ? 107.587 80.587  -54.269 1.00 151.22 ? 118  HIS A ND1   1 
ATOM   906   C  CD2   . HIS A  1  118  ? 105.553 79.745  -54.590 1.00 150.70 ? 118  HIS A CD2   1 
ATOM   907   C  CE1   . HIS A  1  118  ? 107.591 79.827  -55.353 1.00 150.94 ? 118  HIS A CE1   1 
ATOM   908   N  NE2   . HIS A  1  118  ? 106.388 79.304  -55.588 1.00 151.00 ? 118  HIS A NE2   1 
ATOM   909   N  N     . ASN A  1  119  ? 106.666 81.366  -48.855 1.00 140.05 ? 119  ASN A N     1 
ATOM   910   C  CA    . ASN A  1  119  ? 106.329 82.002  -47.581 1.00 138.71 ? 119  ASN A CA    1 
ATOM   911   C  C     . ASN A  1  119  ? 107.511 81.846  -46.620 1.00 141.97 ? 119  ASN A C     1 
ATOM   912   O  O     . ASN A  1  119  ? 107.988 80.724  -46.421 1.00 140.55 ? 119  ASN A O     1 
ATOM   913   C  CB    . ASN A  1  119  ? 105.027 81.448  -46.991 1.00 134.89 ? 119  ASN A CB    1 
ATOM   914   C  CG    . ASN A  1  119  ? 104.547 82.198  -45.767 1.00 145.81 ? 119  ASN A CG    1 
ATOM   915   O  OD1   . ASN A  1  119  ? 105.218 82.258  -44.733 1.00 137.00 ? 119  ASN A OD1   1 
ATOM   916   N  ND2   . ASN A  1  119  ? 103.361 82.778  -45.845 1.00 135.70 ? 119  ASN A ND2   1 
ATOM   917   N  N     . GLU A  1  120  ? 107.986 82.978  -46.039 1.00 139.05 ? 120  GLU A N     1 
ATOM   918   C  CA    . GLU A  1  120  ? 109.130 83.028  -45.111 1.00 137.81 ? 120  GLU A CA    1 
ATOM   919   C  C     . GLU A  1  120  ? 108.913 82.211  -43.838 1.00 137.80 ? 120  GLU A C     1 
ATOM   920   O  O     . GLU A  1  120  ? 109.829 81.494  -43.420 1.00 136.25 ? 120  GLU A O     1 
ATOM   921   C  CB    . GLU A  1  120  ? 109.542 84.479  -44.776 1.00 140.51 ? 120  GLU A CB    1 
ATOM   922   C  CG    . GLU A  1  120  ? 111.031 84.773  -44.949 1.00 153.93 ? 120  GLU A CG    1 
ATOM   923   C  CD    . GLU A  1  120  ? 112.003 84.073  -44.011 1.00 181.44 ? 120  GLU A CD    1 
ATOM   924   O  OE1   . GLU A  1  120  ? 111.954 84.347  -42.789 1.00 179.27 ? 120  GLU A OE1   1 
ATOM   925   O  OE2   . GLU A  1  120  ? 112.838 83.277  -44.500 1.00 177.85 ? 120  GLU A OE2   1 
ATOM   926   N  N     . LEU A  1  121  ? 107.705 82.304  -43.236 1.00 132.27 ? 121  LEU A N     1 
ATOM   927   C  CA    . LEU A  1  121  ? 107.342 81.554  -42.028 1.00 129.67 ? 121  LEU A CA    1 
ATOM   928   C  C     . LEU A  1  121  ? 107.346 80.046  -42.321 1.00 132.09 ? 121  LEU A C     1 
ATOM   929   O  O     . LEU A  1  121  ? 107.794 79.257  -41.480 1.00 130.17 ? 121  LEU A O     1 
ATOM   930   C  CB    . LEU A  1  121  ? 105.961 81.979  -41.510 1.00 129.55 ? 121  LEU A CB    1 
ATOM   931   C  CG    . LEU A  1  121  ? 105.825 83.368  -40.906 1.00 134.32 ? 121  LEU A CG    1 
ATOM   932   C  CD1   . LEU A  1  121  ? 104.447 83.926  -41.168 1.00 135.41 ? 121  LEU A CD1   1 
ATOM   933   C  CD2   . LEU A  1  121  ? 106.104 83.350  -39.418 1.00 134.32 ? 121  LEU A CD2   1 
ATOM   934   N  N     . MET A  1  122  ? 106.869 79.662  -43.535 1.00 128.67 ? 122  MET A N     1 
ATOM   935   C  CA    . MET A  1  122  ? 106.814 78.278  -44.016 1.00 127.00 ? 122  MET A CA    1 
ATOM   936   C  C     . MET A  1  122  ? 108.220 77.700  -44.218 1.00 129.98 ? 122  MET A C     1 
ATOM   937   O  O     . MET A  1  122  ? 108.467 76.568  -43.796 1.00 128.51 ? 122  MET A O     1 
ATOM   938   C  CB    . MET A  1  122  ? 105.963 78.168  -45.297 1.00 130.01 ? 122  MET A CB    1 
ATOM   939   C  CG    . MET A  1  122  ? 105.673 76.733  -45.730 1.00 132.15 ? 122  MET A CG    1 
ATOM   940   S  SD    . MET A  1  122  ? 104.849 75.700  -44.489 1.00 133.65 ? 122  MET A SD    1 
ATOM   941   C  CE    . MET A  1  122  ? 104.637 74.221  -45.419 1.00 129.78 ? 122  MET A CE    1 
ATOM   942   N  N     . ARG A  1  123  ? 109.140 78.489  -44.825 1.00 126.70 ? 123  ARG A N     1 
ATOM   943   C  CA    . ARG A  1  123  ? 110.542 78.111  -45.063 1.00 125.68 ? 123  ARG A CA    1 
ATOM   944   C  C     . ARG A  1  123  ? 111.290 77.862  -43.748 1.00 127.14 ? 123  ARG A C     1 
ATOM   945   O  O     . ARG A  1  123  ? 112.207 77.035  -43.714 1.00 125.31 ? 123  ARG A O     1 
ATOM   946   C  CB    . ARG A  1  123  ? 111.257 79.175  -45.903 1.00 126.61 ? 123  ARG A CB    1 
ATOM   947   C  CG    . ARG A  1  123  ? 110.962 79.058  -47.387 1.00 135.31 ? 123  ARG A CG    1 
ATOM   948   C  CD    . ARG A  1  123  ? 111.770 80.052  -48.188 1.00 147.12 ? 123  ARG A CD    1 
ATOM   949   N  NE    . ARG A  1  123  ? 111.049 81.310  -48.383 1.00 157.39 ? 123  ARG A NE    1 
ATOM   950   C  CZ    . ARG A  1  123  ? 111.440 82.484  -47.901 1.00 169.99 ? 123  ARG A CZ    1 
ATOM   951   N  NH1   . ARG A  1  123  ? 112.557 82.580  -47.189 1.00 156.85 ? 123  ARG A NH1   1 
ATOM   952   N  NH2   . ARG A  1  123  ? 110.725 83.576  -48.136 1.00 156.17 ? 123  ARG A NH2   1 
ATOM   953   N  N     . GLN A  1  124  ? 110.873 78.570  -42.670 1.00 123.21 ? 124  GLN A N     1 
ATOM   954   C  CA    . GLN A  1  124  ? 111.397 78.443  -41.307 1.00 121.56 ? 124  GLN A CA    1 
ATOM   955   C  C     . GLN A  1  124  ? 110.933 77.108  -40.689 1.00 122.02 ? 124  GLN A C     1 
ATOM   956   O  O     . GLN A  1  124  ? 111.728 76.417  -40.035 1.00 119.52 ? 124  GLN A O     1 
ATOM   957   C  CB    . GLN A  1  124  ? 110.935 79.630  -40.438 1.00 123.40 ? 124  GLN A CB    1 
ATOM   958   C  CG    . GLN A  1  124  ? 111.820 80.872  -40.567 1.00 145.94 ? 124  GLN A CG    1 
ATOM   959   C  CD    . GLN A  1  124  ? 111.482 81.986  -39.588 1.00 168.78 ? 124  GLN A CD    1 
ATOM   960   O  OE1   . GLN A  1  124  ? 111.627 83.180  -39.901 1.00 162.85 ? 124  GLN A OE1   1 
ATOM   961   N  NE2   . GLN A  1  124  ? 111.066 81.635  -38.366 1.00 160.27 ? 124  GLN A NE2   1 
ATOM   962   N  N     . ALA A  1  125  ? 109.638 76.761  -40.906 1.00 117.41 ? 125  ALA A N     1 
ATOM   963   C  CA    . ALA A  1  125  ? 109.013 75.528  -40.434 1.00 115.12 ? 125  ALA A CA    1 
ATOM   964   C  C     . ALA A  1  125  ? 109.617 74.319  -41.147 1.00 117.64 ? 125  ALA A C     1 
ATOM   965   O  O     . ALA A  1  125  ? 110.042 73.377  -40.478 1.00 116.43 ? 125  ALA A O     1 
ATOM   966   C  CB    . ALA A  1  125  ? 107.510 75.580  -40.651 1.00 116.10 ? 125  ALA A CB    1 
ATOM   967   N  N     . LEU A  1  126  ? 109.719 74.372  -42.492 1.00 114.31 ? 126  LEU A N     1 
ATOM   968   C  CA    . LEU A  1  126  ? 110.296 73.302  -43.317 1.00 113.70 ? 126  LEU A CA    1 
ATOM   969   C  C     . LEU A  1  126  ? 111.745 73.003  -42.944 1.00 117.90 ? 126  LEU A C     1 
ATOM   970   O  O     . LEU A  1  126  ? 112.206 71.869  -43.103 1.00 117.04 ? 126  LEU A O     1 
ATOM   971   C  CB    . LEU A  1  126  ? 110.200 73.648  -44.809 1.00 115.02 ? 126  LEU A CB    1 
ATOM   972   C  CG    . LEU A  1  126  ? 108.798 73.679  -45.410 1.00 119.94 ? 126  LEU A CG    1 
ATOM   973   C  CD1   . LEU A  1  126  ? 108.771 74.524  -46.660 1.00 121.42 ? 126  LEU A CD1   1 
ATOM   974   C  CD2   . LEU A  1  126  ? 108.270 72.274  -45.674 1.00 121.67 ? 126  LEU A CD2   1 
ATOM   975   N  N     . ALA A  1  127  ? 112.442 74.020  -42.416 1.00 115.04 ? 127  ALA A N     1 
ATOM   976   C  CA    . ALA A  1  127  ? 113.834 73.940  -41.981 1.00 114.28 ? 127  ALA A CA    1 
ATOM   977   C  C     . ALA A  1  127  ? 114.036 73.096  -40.715 1.00 113.97 ? 127  ALA A C     1 
ATOM   978   O  O     . ALA A  1  127  ? 115.155 72.618  -40.493 1.00 113.03 ? 127  ALA A O     1 
ATOM   979   C  CB    . ALA A  1  127  ? 114.390 75.339  -41.772 1.00 116.21 ? 127  ALA A CB    1 
ATOM   980   N  N     . ILE A  1  128  ? 112.969 72.916  -39.889 1.00 107.50 ? 128  ILE A N     1 
ATOM   981   C  CA    . ILE A  1  128  ? 113.029 72.140  -38.640 1.00 104.50 ? 128  ILE A CA    1 
ATOM   982   C  C     . ILE A  1  128  ? 113.434 70.692  -38.905 1.00 106.81 ? 128  ILE A C     1 
ATOM   983   O  O     . ILE A  1  128  ? 112.720 69.960  -39.595 1.00 106.26 ? 128  ILE A O     1 
ATOM   984   C  CB    . ILE A  1  128  ? 111.739 72.251  -37.795 1.00 106.18 ? 128  ILE A CB    1 
ATOM   985   C  CG1   . ILE A  1  128  ? 111.497 73.694  -37.350 1.00 106.31 ? 128  ILE A CG1   1 
ATOM   986   C  CG2   . ILE A  1  128  ? 111.785 71.302  -36.589 1.00 105.84 ? 128  ILE A CG2   1 
ATOM   987   C  CD1   . ILE A  1  128  ? 110.073 74.019  -37.112 1.00 108.53 ? 128  ILE A CD1   1 
ATOM   988   N  N     . LYS A  1  129  ? 114.600 70.305  -38.369 1.00 102.35 ? 129  LYS A N     1 
ATOM   989   C  CA    . LYS A  1  129  ? 115.175 68.964  -38.514 1.00 101.41 ? 129  LYS A CA    1 
ATOM   990   C  C     . LYS A  1  129  ? 114.286 67.890  -37.858 1.00 103.72 ? 129  LYS A C     1 
ATOM   991   O  O     . LYS A  1  129  ? 114.055 66.840  -38.465 1.00 103.15 ? 129  LYS A O     1 
ATOM   992   C  CB    . LYS A  1  129  ? 116.612 68.918  -37.946 1.00 103.20 ? 129  LYS A CB    1 
ATOM   993   C  CG    . LYS A  1  129  ? 117.564 70.004  -38.469 1.00 110.34 ? 129  LYS A CG    1 
ATOM   994   C  CD    . LYS A  1  129  ? 118.221 69.621  -39.798 1.00 118.15 ? 129  LYS A CD    1 
ATOM   995   C  CE    . LYS A  1  129  ? 118.971 70.770  -40.434 1.00 128.87 ? 129  LYS A CE    1 
ATOM   996   N  NZ    . LYS A  1  129  ? 118.056 71.821  -40.964 1.00 135.57 ? 129  LYS A NZ    1 
ATOM   997   N  N     . ASP A  1  130  ? 113.762 68.189  -36.643 1.00 98.93  ? 130  ASP A N     1 
ATOM   998   C  CA    . ASP A  1  130  ? 112.879 67.346  -35.826 1.00 97.49  ? 130  ASP A CA    1 
ATOM   999   C  C     . ASP A  1  130  ? 111.527 67.197  -36.528 1.00 100.56 ? 130  ASP A C     1 
ATOM   1000  O  O     . ASP A  1  130  ? 110.809 68.190  -36.633 1.00 101.84 ? 130  ASP A O     1 
ATOM   1001  C  CB    . ASP A  1  130  ? 112.684 68.024  -34.453 1.00 99.34  ? 130  ASP A CB    1 
ATOM   1002  C  CG    . ASP A  1  130  ? 112.100 67.165  -33.340 1.00 112.15 ? 130  ASP A CG    1 
ATOM   1003  O  OD1   . ASP A  1  130  ? 111.060 66.495  -33.577 1.00 111.55 ? 130  ASP A OD1   1 
ATOM   1004  O  OD2   . ASP A  1  130  ? 112.617 67.240  -32.207 1.00 121.32 ? 130  ASP A OD2   1 
ATOM   1005  N  N     . SER A  1  131  ? 111.173 65.975  -36.994 1.00 94.99  ? 131  SER A N     1 
ATOM   1006  C  CA    . SER A  1  131  ? 109.922 65.708  -37.733 1.00 94.89  ? 131  SER A CA    1 
ATOM   1007  C  C     . SER A  1  131  ? 108.606 66.052  -36.981 1.00 96.98  ? 131  SER A C     1 
ATOM   1008  O  O     . SER A  1  131  ? 107.703 66.626  -37.579 1.00 97.24  ? 131  SER A O     1 
ATOM   1009  C  CB    . SER A  1  131  ? 109.880 64.269  -38.234 1.00 98.89  ? 131  SER A CB    1 
ATOM   1010  O  OG    . SER A  1  131  ? 109.859 63.344  -37.159 1.00 112.83 ? 131  SER A OG    1 
ATOM   1011  N  N     . LYS A  1  132  ? 108.508 65.729  -35.692 1.00 91.99  ? 132  LYS A N     1 
ATOM   1012  C  CA    . LYS A  1  132  ? 107.313 65.982  -34.877 1.00 91.24  ? 132  LYS A CA    1 
ATOM   1013  C  C     . LYS A  1  132  ? 107.106 67.469  -34.600 1.00 96.13  ? 132  LYS A C     1 
ATOM   1014  O  O     . LYS A  1  132  ? 105.963 67.921  -34.501 1.00 96.23  ? 132  LYS A O     1 
ATOM   1015  C  CB    . LYS A  1  132  ? 107.391 65.216  -33.545 1.00 92.16  ? 132  LYS A CB    1 
ATOM   1016  C  CG    . LYS A  1  132  ? 107.867 63.773  -33.669 1.00 98.74  ? 132  LYS A CG    1 
ATOM   1017  C  CD    . LYS A  1  132  ? 107.586 62.970  -32.412 1.00 99.48  ? 132  LYS A CD    1 
ATOM   1018  C  CE    . LYS A  1  132  ? 107.672 61.494  -32.676 1.00 94.37  ? 132  LYS A CE    1 
ATOM   1019  N  NZ    . LYS A  1  132  ? 106.560 61.058  -33.551 1.00 94.86  ? 132  LYS A NZ    1 
ATOM   1020  N  N     . LYS A  1  133  ? 108.216 68.211  -34.436 1.00 93.42  ? 133  LYS A N     1 
ATOM   1021  C  CA    . LYS A  1  133  ? 108.220 69.652  -34.177 1.00 94.68  ? 133  LYS A CA    1 
ATOM   1022  C  C     . LYS A  1  133  ? 107.951 70.426  -35.469 1.00 100.74 ? 133  LYS A C     1 
ATOM   1023  O  O     . LYS A  1  133  ? 107.226 71.427  -35.441 1.00 101.78 ? 133  LYS A O     1 
ATOM   1024  C  CB    . LYS A  1  133  ? 109.537 70.095  -33.516 1.00 97.08  ? 133  LYS A CB    1 
ATOM   1025  C  CG    . LYS A  1  133  ? 109.657 69.676  -32.046 1.00 107.47 ? 133  LYS A CG    1 
ATOM   1026  C  CD    . LYS A  1  133  ? 110.976 70.146  -31.440 1.00 117.90 ? 133  LYS A CD    1 
ATOM   1027  C  CE    . LYS A  1  133  ? 111.259 69.529  -30.091 1.00 125.18 ? 133  LYS A CE    1 
ATOM   1028  N  NZ    . LYS A  1  133  ? 112.724 69.434  -29.828 1.00 130.35 ? 133  LYS A NZ    1 
ATOM   1029  N  N     . ARG A  1  134  ? 108.523 69.940  -36.600 1.00 97.13  ? 134  ARG A N     1 
ATOM   1030  C  CA    . ARG A  1  134  ? 108.343 70.464  -37.962 1.00 98.11  ? 134  ARG A CA    1 
ATOM   1031  C  C     . ARG A  1  134  ? 106.887 70.314  -38.366 1.00 103.07 ? 134  ARG A C     1 
ATOM   1032  O  O     . ARG A  1  134  ? 106.355 71.236  -38.975 1.00 104.77 ? 134  ARG A O     1 
ATOM   1033  C  CB    . ARG A  1  134  ? 109.235 69.691  -38.942 1.00 97.29  ? 134  ARG A CB    1 
ATOM   1034  C  CG    . ARG A  1  134  ? 109.082 69.999  -40.427 1.00 99.96  ? 134  ARG A CG    1 
ATOM   1035  C  CD    . ARG A  1  134  ? 109.445 68.769  -41.250 1.00 105.45 ? 134  ARG A CD    1 
ATOM   1036  N  NE    . ARG A  1  134  ? 110.701 68.126  -40.849 1.00 116.88 ? 134  ARG A NE    1 
ATOM   1037  C  CZ    . ARG A  1  134  ? 110.981 66.838  -41.035 1.00 137.34 ? 134  ARG A CZ    1 
ATOM   1038  N  NH1   . ARG A  1  134  ? 110.094 66.035  -41.615 1.00 127.13 ? 134  ARG A NH1   1 
ATOM   1039  N  NH2   . ARG A  1  134  ? 112.146 66.340  -40.635 1.00 125.22 ? 134  ARG A NH2   1 
ATOM   1040  N  N     . PHE A  1  135  ? 106.241 69.166  -38.033 1.00 98.01  ? 135  PHE A N     1 
ATOM   1041  C  CA    . PHE A  1  135  ? 104.831 68.950  -38.345 1.00 97.94  ? 135  PHE A CA    1 
ATOM   1042  C  C     . PHE A  1  135  ? 103.978 69.923  -37.533 1.00 103.86 ? 135  PHE A C     1 
ATOM   1043  O  O     . PHE A  1  135  ? 103.105 70.587  -38.101 1.00 104.59 ? 135  PHE A O     1 
ATOM   1044  C  CB    . PHE A  1  135  ? 104.398 67.496  -38.092 1.00 98.24  ? 135  PHE A CB    1 
ATOM   1045  C  CG    . PHE A  1  135  ? 102.903 67.268  -38.218 1.00 99.74  ? 135  PHE A CG    1 
ATOM   1046  C  CD1   . PHE A  1  135  ? 102.335 66.935  -39.439 1.00 103.51 ? 135  PHE A CD1   1 
ATOM   1047  C  CD2   . PHE A  1  135  ? 102.066 67.392  -37.114 1.00 100.49 ? 135  PHE A CD2   1 
ATOM   1048  C  CE1   . PHE A  1  135  ? 100.955 66.740  -39.555 1.00 104.16 ? 135  PHE A CE1   1 
ATOM   1049  C  CE2   . PHE A  1  135  ? 100.690 67.201  -37.235 1.00 103.10 ? 135  PHE A CE2   1 
ATOM   1050  C  CZ    . PHE A  1  135  ? 100.144 66.873  -38.452 1.00 101.94 ? 135  PHE A CZ    1 
ATOM   1051  N  N     . ALA A  1  136  ? 104.236 70.007  -36.209 1.00 100.60 ? 136  ALA A N     1 
ATOM   1052  C  CA    . ALA A  1  136  ? 103.511 70.890  -35.292 1.00 101.21 ? 136  ALA A CA    1 
ATOM   1053  C  C     . ALA A  1  136  ? 103.561 72.358  -35.763 1.00 106.99 ? 136  ALA A C     1 
ATOM   1054  O  O     . ALA A  1  136  ? 102.537 73.046  -35.734 1.00 107.97 ? 136  ALA A O     1 
ATOM   1055  C  CB    . ALA A  1  136  ? 104.077 70.760  -33.886 1.00 101.00 ? 136  ALA A CB    1 
ATOM   1056  N  N     . ALA A  1  137  ? 104.730 72.803  -36.253 1.00 102.85 ? 137  ALA A N     1 
ATOM   1057  C  CA    . ALA A  1  137  ? 104.922 74.149  -36.757 1.00 104.01 ? 137  ALA A CA    1 
ATOM   1058  C  C     . ALA A  1  137  ? 104.189 74.386  -38.082 1.00 109.18 ? 137  ALA A C     1 
ATOM   1059  O  O     . ALA A  1  137  ? 103.587 75.451  -38.247 1.00 110.46 ? 137  ALA A O     1 
ATOM   1060  C  CB    . ALA A  1  137  ? 106.399 74.431  -36.913 1.00 104.97 ? 137  ALA A CB    1 
ATOM   1061  N  N     . ILE A  1  138  ? 104.234 73.399  -39.015 1.00 104.83 ? 138  ILE A N     1 
ATOM   1062  C  CA    . ILE A  1  138  ? 103.578 73.462  -40.330 1.00 105.62 ? 138  ILE A CA    1 
ATOM   1063  C  C     . ILE A  1  138  ? 102.066 73.603  -40.165 1.00 111.58 ? 138  ILE A C     1 
ATOM   1064  O  O     . ILE A  1  138  ? 101.477 74.489  -40.775 1.00 112.90 ? 138  ILE A O     1 
ATOM   1065  C  CB    . ILE A  1  138  ? 103.991 72.275  -41.261 1.00 107.95 ? 138  ILE A CB    1 
ATOM   1066  C  CG1   . ILE A  1  138  ? 105.356 72.543  -41.921 1.00 108.59 ? 138  ILE A CG1   1 
ATOM   1067  C  CG2   . ILE A  1  138  ? 102.930 71.968  -42.337 1.00 109.30 ? 138  ILE A CG2   1 
ATOM   1068  C  CD1   . ILE A  1  138  ? 106.118 71.270  -42.421 1.00 113.42 ? 138  ILE A CD1   1 
ATOM   1069  N  N     . TRP A  1  139  ? 101.450 72.757  -39.321 1.00 108.30 ? 139  TRP A N     1 
ATOM   1070  C  CA    . TRP A  1  139  ? 100.012 72.790  -39.065 1.00 108.76 ? 139  TRP A CA    1 
ATOM   1071  C  C     . TRP A  1  139  ? 99.554  74.143  -38.543 1.00 113.64 ? 139  TRP A C     1 
ATOM   1072  O  O     . TRP A  1  139  ? 98.587  74.687  -39.070 1.00 114.24 ? 139  TRP A O     1 
ATOM   1073  C  CB    . TRP A  1  139  ? 99.594  71.660  -38.123 1.00 106.20 ? 139  TRP A CB    1 
ATOM   1074  C  CG    . TRP A  1  139  ? 98.152  71.709  -37.708 1.00 107.51 ? 139  TRP A CG    1 
ATOM   1075  C  CD1   . TRP A  1  139  ? 97.071  71.305  -38.436 1.00 111.07 ? 139  TRP A CD1   1 
ATOM   1076  C  CD2   . TRP A  1  139  ? 97.642  72.152  -36.445 1.00 106.95 ? 139  TRP A CD2   1 
ATOM   1077  N  NE1   . TRP A  1  139  ? 95.919  71.463  -37.701 1.00 110.52 ? 139  TRP A NE1   1 
ATOM   1078  C  CE2   . TRP A  1  139  ? 96.241  71.972  -36.470 1.00 111.27 ? 139  TRP A CE2   1 
ATOM   1079  C  CE3   . TRP A  1  139  ? 98.237  72.666  -35.282 1.00 107.57 ? 139  TRP A CE3   1 
ATOM   1080  C  CZ2   . TRP A  1  139  ? 95.430  72.276  -35.376 1.00 110.42 ? 139  TRP A CZ2   1 
ATOM   1081  C  CZ3   . TRP A  1  139  ? 97.430  72.972  -34.201 1.00 108.88 ? 139  TRP A CZ3   1 
ATOM   1082  C  CH2   . TRP A  1  139  ? 96.045  72.782  -34.255 1.00 109.93 ? 139  TRP A CH2   1 
ATOM   1083  N  N     . THR A  1  140  ? 100.281 74.699  -37.553 1.00 109.82 ? 140  THR A N     1 
ATOM   1084  C  CA    . THR A  1  140  ? 100.033 76.002  -36.934 1.00 110.37 ? 140  THR A CA    1 
ATOM   1085  C  C     . THR A  1  140  ? 99.810  77.087  -38.011 1.00 116.74 ? 140  THR A C     1 
ATOM   1086  O  O     . THR A  1  140  ? 98.831  77.841  -37.943 1.00 117.74 ? 140  THR A O     1 
ATOM   1087  C  CB    . THR A  1  140  ? 101.164 76.290  -35.937 1.00 115.51 ? 140  THR A CB    1 
ATOM   1088  O  OG1   . THR A  1  140  ? 101.044 75.358  -34.867 1.00 115.13 ? 140  THR A OG1   1 
ATOM   1089  C  CG2   . THR A  1  140  ? 101.119 77.688  -35.372 1.00 113.75 ? 140  THR A CG2   1 
ATOM   1090  N  N     . LEU A  1  141  ? 100.680 77.106  -39.032 1.00 113.34 ? 141  LEU A N     1 
ATOM   1091  C  CA    . LEU A  1  141  ? 100.613 78.049  -40.145 1.00 114.43 ? 141  LEU A CA    1 
ATOM   1092  C  C     . LEU A  1  141  ? 99.449  77.761  -41.097 1.00 118.58 ? 141  LEU A C     1 
ATOM   1093  O  O     . LEU A  1  141  ? 98.600  78.626  -41.292 1.00 120.11 ? 141  LEU A O     1 
ATOM   1094  C  CB    . LEU A  1  141  ? 101.942 78.047  -40.924 1.00 114.66 ? 141  LEU A CB    1 
ATOM   1095  C  CG    . LEU A  1  141  ? 103.161 78.625  -40.207 1.00 119.32 ? 141  LEU A CG    1 
ATOM   1096  C  CD1   . LEU A  1  141  ? 104.445 78.111  -40.821 1.00 119.21 ? 141  LEU A CD1   1 
ATOM   1097  C  CD2   . LEU A  1  141  ? 103.139 80.147  -40.219 1.00 123.51 ? 141  LEU A CD2   1 
ATOM   1098  N  N     . CYS A  1  142  ? 99.408  76.540  -41.659 1.00 113.17 ? 142  CYS A N     1 
ATOM   1099  C  CA    . CYS A  1  142  ? 98.462  76.070  -42.669 1.00 113.06 ? 142  CYS A CA    1 
ATOM   1100  C  C     . CYS A  1  142  ? 97.007  75.933  -42.204 1.00 115.77 ? 142  CYS A C     1 
ATOM   1101  O  O     . CYS A  1  142  ? 96.118  75.968  -43.061 1.00 116.12 ? 142  CYS A O     1 
ATOM   1102  C  CB    . CYS A  1  142  ? 98.960  74.770  -43.288 1.00 112.66 ? 142  CYS A CB    1 
ATOM   1103  S  SG    . CYS A  1  142  ? 100.590 74.902  -44.073 1.00 116.91 ? 142  CYS A SG    1 
ATOM   1104  N  N     . LYS A  1  143  ? 96.745  75.777  -40.889 1.00 110.93 ? 143  LYS A N     1 
ATOM   1105  C  CA    . LYS A  1  143  ? 95.365  75.605  -40.397 1.00 110.53 ? 143  LYS A CA    1 
ATOM   1106  C  C     . LYS A  1  143  ? 94.460  76.784  -40.761 1.00 117.36 ? 143  LYS A C     1 
ATOM   1107  O  O     . LYS A  1  143  ? 93.291  76.577  -41.103 1.00 117.22 ? 143  LYS A O     1 
ATOM   1108  C  CB    . LYS A  1  143  ? 95.300  75.273  -38.884 1.00 110.60 ? 143  LYS A CB    1 
ATOM   1109  C  CG    . LYS A  1  143  ? 95.851  76.341  -37.938 1.00 114.39 ? 143  LYS A CG    1 
ATOM   1110  C  CD    . LYS A  1  143  ? 95.922  75.849  -36.498 1.00 117.33 ? 143  LYS A CD    1 
ATOM   1111  C  CE    . LYS A  1  143  ? 96.591  76.859  -35.596 1.00 120.45 ? 143  LYS A CE    1 
ATOM   1112  N  NZ    . LYS A  1  143  ? 96.930  76.284  -34.268 1.00 121.88 ? 143  LYS A NZ    1 
ATOM   1113  N  N     . THR A  1  144  ? 95.041  78.004  -40.744 1.00 115.82 ? 144  THR A N     1 
ATOM   1114  C  CA    . THR A  1  144  ? 94.397  79.289  -41.025 1.00 117.29 ? 144  THR A CA    1 
ATOM   1115  C  C     . THR A  1  144  ? 94.345  79.645  -42.522 1.00 123.49 ? 144  THR A C     1 
ATOM   1116  O  O     . THR A  1  144  ? 93.580  80.543  -42.884 1.00 125.42 ? 144  THR A O     1 
ATOM   1117  C  CB    . THR A  1  144  ? 95.048  80.408  -40.194 1.00 125.28 ? 144  THR A CB    1 
ATOM   1118  O  OG1   . THR A  1  144  ? 96.456  80.439  -40.448 1.00 126.66 ? 144  THR A OG1   1 
ATOM   1119  C  CG2   . THR A  1  144  ? 94.782  80.262  -38.695 1.00 121.42 ? 144  THR A CG2   1 
ATOM   1120  N  N     . LYS A  1  145  ? 95.133  78.963  -43.392 1.00 119.82 ? 145  LYS A N     1 
ATOM   1121  C  CA    . LYS A  1  145  ? 95.088  79.231  -44.839 1.00 121.37 ? 145  LYS A CA    1 
ATOM   1122  C  C     . LYS A  1  145  ? 93.795  78.621  -45.377 1.00 126.63 ? 145  LYS A C     1 
ATOM   1123  O  O     . LYS A  1  145  ? 93.687  77.396  -45.480 1.00 125.54 ? 145  LYS A O     1 
ATOM   1124  C  CB    . LYS A  1  145  ? 96.333  78.696  -45.571 1.00 123.16 ? 145  LYS A CB    1 
ATOM   1125  C  CG    . LYS A  1  145  ? 97.115  79.774  -46.325 1.00 133.28 ? 145  LYS A CG    1 
ATOM   1126  C  CD    . LYS A  1  145  ? 96.826  79.763  -47.819 1.00 140.94 ? 145  LYS A CD    1 
ATOM   1127  C  CE    . LYS A  1  145  ? 97.739  80.672  -48.610 1.00 150.18 ? 145  LYS A CE    1 
ATOM   1128  N  NZ    . LYS A  1  145  ? 97.383  82.110  -48.462 1.00 154.42 ? 145  LYS A NZ    1 
ATOM   1129  N  N     . MET A  1  146  ? 92.782  79.478  -45.627 1.00 124.63 ? 146  MET A N     1 
ATOM   1130  C  CA    . MET A  1  146  ? 91.453  79.036  -46.045 1.00 124.78 ? 146  MET A CA    1 
ATOM   1131  C  C     . MET A  1  146  ? 91.232  78.993  -47.561 1.00 129.44 ? 146  MET A C     1 
ATOM   1132  O  O     . MET A  1  146  ? 90.084  78.890  -48.018 1.00 129.99 ? 146  MET A O     1 
ATOM   1133  C  CB    . MET A  1  146  ? 90.376  79.874  -45.351 1.00 127.68 ? 146  MET A CB    1 
ATOM   1134  C  CG    . MET A  1  146  ? 89.605  79.091  -44.306 1.00 129.76 ? 146  MET A CG    1 
ATOM   1135  S  SD    . MET A  1  146  ? 90.633  78.501  -42.944 1.00 131.19 ? 146  MET A SD    1 
ATOM   1136  C  CE    . MET A  1  146  ? 89.385  78.028  -41.781 1.00 126.84 ? 146  MET A CE    1 
ATOM   1137  N  N     . VAL A  1  147  ? 92.328  79.013  -48.335 1.00 125.24 ? 147  VAL A N     1 
ATOM   1138  C  CA    . VAL A  1  147  ? 92.263  78.924  -49.788 1.00 126.06 ? 147  VAL A CA    1 
ATOM   1139  C  C     . VAL A  1  147  ? 93.568  78.358  -50.363 1.00 130.15 ? 147  VAL A C     1 
ATOM   1140  O  O     . VAL A  1  147  ? 94.667  78.714  -49.922 1.00 128.71 ? 147  VAL A O     1 
ATOM   1141  C  CB    . VAL A  1  147  ? 91.809  80.256  -50.466 1.00 131.52 ? 147  VAL A CB    1 
ATOM   1142  C  CG1   . VAL A  1  147  ? 92.838  81.376  -50.318 1.00 131.56 ? 147  VAL A CG1   1 
ATOM   1143  C  CG2   . VAL A  1  147  ? 91.424  80.045  -51.924 1.00 132.77 ? 147  VAL A CG2   1 
ATOM   1144  N  N     . CYS A  1  148  ? 93.432  77.437  -51.324 1.00 128.14 ? 148  CYS A N     1 
ATOM   1145  C  CA    . CYS A  1  148  ? 94.569  76.889  -52.039 1.00 128.59 ? 148  CYS A CA    1 
ATOM   1146  C  C     . CYS A  1  148  ? 94.966  78.043  -52.941 1.00 138.57 ? 148  CYS A C     1 
ATOM   1147  O  O     . CYS A  1  148  ? 94.111  78.580  -53.648 1.00 140.16 ? 148  CYS A O     1 
ATOM   1148  C  CB    . CYS A  1  148  ? 94.153  75.664  -52.846 1.00 128.58 ? 148  CYS A CB    1 
ATOM   1149  S  SG    . CYS A  1  148  ? 95.504  74.906  -53.781 1.00 132.25 ? 148  CYS A SG    1 
ATOM   1150  N  N     . GLU A  1  149  ? 96.199  78.525  -52.827 1.00 137.78 ? 149  GLU A N     1 
ATOM   1151  C  CA    . GLU A  1  149  ? 96.575  79.684  -53.627 1.00 140.44 ? 149  GLU A CA    1 
ATOM   1152  C  C     . GLU A  1  149  ? 97.017  79.320  -55.045 1.00 146.87 ? 149  GLU A C     1 
ATOM   1153  O  O     . GLU A  1  149  ? 97.686  78.306  -55.262 1.00 145.55 ? 149  GLU A O     1 
ATOM   1154  C  CB    . GLU A  1  149  ? 97.612  80.554  -52.907 1.00 141.80 ? 149  GLU A CB    1 
ATOM   1155  C  CG    . GLU A  1  149  ? 97.373  82.048  -53.086 1.00 158.11 ? 149  GLU A CG    1 
ATOM   1156  C  CD    . GLU A  1  149  ? 96.177  82.667  -52.379 1.00 182.79 ? 149  GLU A CD    1 
ATOM   1157  O  OE1   . GLU A  1  149  ? 95.883  82.261  -51.230 1.00 173.61 ? 149  GLU A OE1   1 
ATOM   1158  O  OE2   . GLU A  1  149  ? 95.575  83.605  -52.954 1.00 176.17 ? 149  GLU A OE2   1 
ATOM   1159  N  N     . THR A  1  150  ? 96.590  80.148  -56.010 1.00 146.49 ? 150  THR A N     1 
ATOM   1160  C  CA    . THR A  1  150  ? 96.891  80.025  -57.436 1.00 147.97 ? 150  THR A CA    1 
ATOM   1161  C  C     . THR A  1  150  ? 98.197  80.729  -57.733 1.00 154.56 ? 150  THR A C     1 
ATOM   1162  O  O     . THR A  1  150  ? 99.090  80.146  -58.348 1.00 153.00 ? 150  THR A O     1 
ATOM   1163  C  CB    . THR A  1  150  ? 95.764  80.648  -58.267 1.00 154.20 ? 150  THR A CB    1 
ATOM   1164  O  OG1   . THR A  1  150  ? 95.300  81.842  -57.626 1.00 152.21 ? 150  THR A OG1   1 
ATOM   1165  C  CG2   . THR A  1  150  ? 94.620  79.696  -58.491 1.00 152.14 ? 150  THR A CG2   1 
ATOM   1166  N  N     . ASP A  1  151  ? 98.292  81.993  -57.283 1.00 155.29 ? 151  ASP A N     1 
ATOM   1167  C  CA    . ASP A  1  151  ? 99.429  82.887  -57.461 1.00 157.71 ? 151  ASP A CA    1 
ATOM   1168  C  C     . ASP A  1  151  ? 99.774  83.561  -56.123 1.00 163.32 ? 151  ASP A C     1 
ATOM   1169  O  O     . ASP A  1  151  ? 98.880  83.997  -55.389 1.00 162.22 ? 151  ASP A O     1 
ATOM   1170  C  CB    . ASP A  1  151  ? 99.110  83.958  -58.529 1.00 162.76 ? 151  ASP A CB    1 
ATOM   1171  C  CG    . ASP A  1  151  ? 98.644  83.443  -59.891 1.00 178.15 ? 151  ASP A CG    1 
ATOM   1172  O  OD1   . ASP A  1  151  ? 97.441  83.110  -60.024 1.00 179.02 ? 151  ASP A OD1   1 
ATOM   1173  O  OD2   . ASP A  1  151  ? 99.453  83.478  -60.848 1.00 186.34 ? 151  ASP A OD2   1 
ATOM   1174  N  N     . VAL A  1  152  ? 101.080 83.642  -55.823 1.00 162.36 ? 152  VAL A N     1 
ATOM   1175  C  CA    . VAL A  1  152  ? 101.653 84.226  -54.602 1.00 162.88 ? 152  VAL A CA    1 
ATOM   1176  C  C     . VAL A  1  152  ? 102.724 85.273  -54.995 1.00 171.65 ? 152  VAL A C     1 
ATOM   1177  O  O     . VAL A  1  152  ? 103.476 85.008  -55.939 1.00 172.09 ? 152  VAL A O     1 
ATOM   1178  C  CB    . VAL A  1  152  ? 102.247 83.093  -53.714 1.00 164.76 ? 152  VAL A CB    1 
ATOM   1179  C  CG1   . VAL A  1  152  ? 103.128 83.633  -52.588 1.00 163.75 ? 152  VAL A CG1   1 
ATOM   1180  C  CG2   . VAL A  1  152  ? 101.146 82.210  -53.145 1.00 163.55 ? 152  VAL A CG2   1 
ATOM   1181  N  N     . PRO A  1  153  ? 102.837 86.440  -54.294 1.00 171.11 ? 153  PRO A N     1 
ATOM   1182  C  CA    . PRO A  1  153  ? 103.883 87.421  -54.657 1.00 173.16 ? 153  PRO A CA    1 
ATOM   1183  C  C     . PRO A  1  153  ? 105.293 86.824  -54.653 1.00 178.42 ? 153  PRO A C     1 
ATOM   1184  O  O     . PRO A  1  153  ? 105.708 86.234  -53.652 1.00 176.08 ? 153  PRO A O     1 
ATOM   1185  C  CB    . PRO A  1  153  ? 103.718 88.528  -53.605 1.00 174.93 ? 153  PRO A CB    1 
ATOM   1186  C  CG    . PRO A  1  153  ? 102.957 87.888  -52.484 1.00 177.24 ? 153  PRO A CG    1 
ATOM   1187  C  CD    . PRO A  1  153  ? 102.035 86.924  -53.152 1.00 172.39 ? 153  PRO A CD    1 
ATOM   1188  N  N     . SER A  1  154  ? 105.995 86.933  -55.805 1.00 178.21 ? 154  SER A N     1 
ATOM   1189  C  CA    . SER A  1  154  ? 107.342 86.396  -56.043 1.00 178.59 ? 154  SER A CA    1 
ATOM   1190  C  C     . SER A  1  154  ? 108.397 86.841  -55.022 1.00 185.04 ? 154  SER A C     1 
ATOM   1191  O  O     . SER A  1  154  ? 108.315 87.953  -54.491 1.00 185.43 ? 154  SER A O     1 
ATOM   1192  C  CB    . SER A  1  154  ? 107.805 86.707  -57.461 1.00 183.53 ? 154  SER A CB    1 
ATOM   1193  O  OG    . SER A  1  154  ? 107.730 88.095  -57.737 1.00 193.81 ? 154  SER A OG    1 
ATOM   1194  N  N     . GLU A  1  155  ? 109.382 85.946  -54.756 1.00 182.38 ? 155  GLU A N     1 
ATOM   1195  C  CA    . GLU A  1  155  ? 110.495 86.097  -53.802 1.00 181.98 ? 155  GLU A CA    1 
ATOM   1196  C  C     . GLU A  1  155  ? 111.304 87.395  -53.960 1.00 188.94 ? 155  GLU A C     1 
ATOM   1197  O  O     . GLU A  1  155  ? 111.569 88.063  -52.958 1.00 188.42 ? 155  GLU A O     1 
ATOM   1198  C  CB    . GLU A  1  155  ? 111.428 84.872  -53.852 1.00 182.02 ? 155  GLU A CB    1 
ATOM   1199  C  CG    . GLU A  1  155  ? 110.792 83.579  -53.362 1.00 189.65 ? 155  GLU A CG    1 
ATOM   1200  C  CD    . GLU A  1  155  ? 111.563 82.296  -53.625 1.00 206.73 ? 155  GLU A CD    1 
ATOM   1201  O  OE1   . GLU A  1  155  ? 112.686 82.364  -54.178 1.00 200.39 ? 155  GLU A OE1   1 
ATOM   1202  O  OE2   . GLU A  1  155  ? 111.036 81.214  -53.278 1.00 193.44 ? 155  GLU A OE2   1 
ATOM   1203  N  N     . ASP A  1  156  ? 111.695 87.747  -55.202 1.00 188.25 ? 156  ASP A N     1 
ATOM   1204  C  CA    . ASP A  1  156  ? 112.467 88.963  -55.471 1.00 190.03 ? 156  ASP A CA    1 
ATOM   1205  C  C     . ASP A  1  156  ? 111.579 90.223  -55.393 1.00 196.03 ? 156  ASP A C     1 
ATOM   1206  O  O     . ASP A  1  156  ? 111.578 90.886  -54.351 1.00 195.14 ? 156  ASP A O     1 
ATOM   1207  C  CB    . ASP A  1  156  ? 113.244 88.859  -56.807 1.00 193.18 ? 156  ASP A CB    1 
ATOM   1208  C  CG    . ASP A  1  156  ? 114.723 89.219  -56.727 1.00 202.38 ? 156  ASP A CG    1 
ATOM   1209  O  OD1   . ASP A  1  156  ? 115.442 88.613  -55.895 1.00 201.13 ? 156  ASP A OD1   1 
ATOM   1210  O  OD2   . ASP A  1  156  ? 115.175 90.057  -57.543 1.00 208.34 ? 156  ASP A OD2   1 
ATOM   1211  N  N     . ASP A  1  157  ? 110.802 90.526  -56.463 1.00 194.53 ? 157  ASP A N     1 
ATOM   1212  C  CA    . ASP A  1  157  ? 109.915 91.694  -56.533 1.00 195.83 ? 157  ASP A CA    1 
ATOM   1213  C  C     . ASP A  1  157  ? 108.430 91.314  -56.284 1.00 199.73 ? 157  ASP A C     1 
ATOM   1214  O  O     . ASP A  1  157  ? 107.783 90.794  -57.200 1.00 200.25 ? 157  ASP A O     1 
ATOM   1215  C  CB    . ASP A  1  157  ? 110.091 92.422  -57.881 1.00 199.83 ? 157  ASP A CB    1 
ATOM   1216  C  CG    . ASP A  1  157  ? 109.819 93.914  -57.837 1.00 211.39 ? 157  ASP A CG    1 
ATOM   1217  O  OD1   . ASP A  1  157  ? 108.784 94.314  -57.259 1.00 211.70 ? 157  ASP A OD1   1 
ATOM   1218  O  OD2   . ASP A  1  157  ? 110.625 94.680  -58.409 1.00 216.36 ? 157  ASP A OD2   1 
ATOM   1219  N  N     . PRO A  1  158  ? 107.860 91.590  -55.074 1.00 194.82 ? 158  PRO A N     1 
ATOM   1220  C  CA    . PRO A  1  158  ? 106.458 91.199  -54.803 1.00 193.57 ? 158  PRO A CA    1 
ATOM   1221  C  C     . PRO A  1  158  ? 105.365 92.024  -55.514 1.00 197.46 ? 158  PRO A C     1 
ATOM   1222  O  O     . PRO A  1  158  ? 104.180 91.749  -55.295 1.00 196.57 ? 158  PRO A O     1 
ATOM   1223  C  CB    . PRO A  1  158  ? 106.345 91.297  -53.269 1.00 193.80 ? 158  PRO A CB    1 
ATOM   1224  C  CG    . PRO A  1  158  ? 107.759 91.449  -52.764 1.00 197.80 ? 158  PRO A CG    1 
ATOM   1225  C  CD    . PRO A  1  158  ? 108.479 92.163  -53.863 1.00 195.53 ? 158  PRO A CD    1 
ATOM   1226  N  N     . THR A  1  159  ? 105.744 92.999  -56.379 1.00 194.64 ? 159  THR A N     1 
ATOM   1227  C  CA    . THR A  1  159  ? 104.804 93.822  -57.161 1.00 195.97 ? 159  THR A CA    1 
ATOM   1228  C  C     . THR A  1  159  ? 104.005 92.925  -58.134 1.00 198.45 ? 159  THR A C     1 
ATOM   1229  O  O     . THR A  1  159  ? 102.784 93.073  -58.242 1.00 198.78 ? 159  THR A O     1 
ATOM   1230  C  CB    . THR A  1  159  ? 105.549 94.968  -57.872 1.00 205.84 ? 159  THR A CB    1 
ATOM   1231  O  OG1   . THR A  1  159  ? 106.377 95.643  -56.925 1.00 205.16 ? 159  THR A OG1   1 
ATOM   1232  C  CG2   . THR A  1  159  ? 104.606 95.969  -58.540 1.00 206.06 ? 159  THR A CG2   1 
ATOM   1233  N  N     . GLN A  1  160  ? 104.705 91.987  -58.815 1.00 192.92 ? 160  GLN A N     1 
ATOM   1234  C  CA    . GLN A  1  160  ? 104.125 91.003  -59.735 1.00 191.64 ? 160  GLN A CA    1 
ATOM   1235  C  C     . GLN A  1  160  ? 104.051 89.616  -59.052 1.00 190.81 ? 160  GLN A C     1 
ATOM   1236  O  O     . GLN A  1  160  ? 105.023 89.172  -58.426 1.00 189.04 ? 160  GLN A O     1 
ATOM   1237  C  CB    . GLN A  1  160  ? 104.912 90.941  -61.057 1.00 194.03 ? 160  GLN A CB    1 
ATOM   1238  C  CG    . GLN A  1  160  ? 104.227 91.671  -62.213 1.00 207.78 ? 160  GLN A CG    1 
ATOM   1239  C  CD    . GLN A  1  160  ? 104.653 93.116  -62.380 1.00 223.20 ? 160  GLN A CD    1 
ATOM   1240  O  OE1   . GLN A  1  160  ? 104.768 93.888  -61.418 1.00 219.91 ? 160  GLN A OE1   1 
ATOM   1241  N  NE2   . GLN A  1  160  ? 104.841 93.535  -63.623 1.00 215.92 ? 160  GLN A NE2   1 
ATOM   1242  N  N     . LEU A  1  161  ? 102.884 88.953  -59.161 1.00 184.39 ? 161  LEU A N     1 
ATOM   1243  C  CA    . LEU A  1  161  ? 102.616 87.650  -58.554 1.00 180.42 ? 161  LEU A CA    1 
ATOM   1244  C  C     . LEU A  1  161  ? 102.959 86.480  -59.482 1.00 180.78 ? 161  LEU A C     1 
ATOM   1245  O  O     . LEU A  1  161  ? 102.674 86.529  -60.682 1.00 181.73 ? 161  LEU A O     1 
ATOM   1246  C  CB    . LEU A  1  161  ? 101.154 87.576  -58.082 1.00 180.04 ? 161  LEU A CB    1 
ATOM   1247  C  CG    . LEU A  1  161  ? 100.838 88.227  -56.729 1.00 183.74 ? 161  LEU A CG    1 
ATOM   1248  C  CD1   . LEU A  1  161  ? 100.548 89.718  -56.872 1.00 185.73 ? 161  LEU A CD1   1 
ATOM   1249  C  CD2   . LEU A  1  161  ? 99.657  87.548  -56.068 1.00 184.95 ? 161  LEU A CD2   1 
ATOM   1250  N  N     . VAL A  1  162  ? 103.572 85.428  -58.908 1.00 172.94 ? 162  VAL A N     1 
ATOM   1251  C  CA    . VAL A  1  162  ? 103.997 84.210  -59.606 1.00 170.92 ? 162  VAL A CA    1 
ATOM   1252  C  C     . VAL A  1  162  ? 103.108 83.015  -59.212 1.00 170.22 ? 162  VAL A C     1 
ATOM   1253  O  O     . VAL A  1  162  ? 102.846 82.818  -58.023 1.00 168.38 ? 162  VAL A O     1 
ATOM   1254  C  CB    . VAL A  1  162  ? 105.520 83.961  -59.387 1.00 173.81 ? 162  VAL A CB    1 
ATOM   1255  C  CG1   . VAL A  1  162  ? 105.910 82.493  -59.571 1.00 172.23 ? 162  VAL A CG1   1 
ATOM   1256  C  CG2   . VAL A  1  162  ? 106.350 84.857  -60.300 1.00 175.49 ? 162  VAL A CG2   1 
ATOM   1257  N  N     . SER A  1  163  ? 102.642 82.233  -60.218 1.00 164.68 ? 163  SER A N     1 
ATOM   1258  C  CA    . SER A  1  163  ? 101.801 81.046  -60.033 1.00 161.96 ? 163  SER A CA    1 
ATOM   1259  C  C     . SER A  1  163  ? 102.568 79.944  -59.316 1.00 160.37 ? 163  SER A C     1 
ATOM   1260  O  O     . SER A  1  163  ? 103.585 79.468  -59.831 1.00 159.42 ? 163  SER A O     1 
ATOM   1261  C  CB    . SER A  1  163  ? 101.285 80.531  -61.373 1.00 166.74 ? 163  SER A CB    1 
ATOM   1262  O  OG    . SER A  1  163  ? 99.931  80.896  -61.576 1.00 177.23 ? 163  SER A OG    1 
ATOM   1263  N  N     . ARG A  1  164  ? 102.095 79.566  -58.109 1.00 152.98 ? 164  ARG A N     1 
ATOM   1264  C  CA    . ARG A  1  164  ? 102.726 78.522  -57.292 1.00 149.31 ? 164  ARG A CA    1 
ATOM   1265  C  C     . ARG A  1  164  ? 102.435 77.114  -57.812 1.00 150.12 ? 164  ARG A C     1 
ATOM   1266  O  O     . ARG A  1  164  ? 103.232 76.200  -57.587 1.00 148.12 ? 164  ARG A O     1 
ATOM   1267  C  CB    . ARG A  1  164  ? 102.398 78.660  -55.793 1.00 145.87 ? 164  ARG A CB    1 
ATOM   1268  C  CG    . ARG A  1  164  ? 100.933 78.801  -55.434 1.00 147.56 ? 164  ARG A CG    1 
ATOM   1269  C  CD    . ARG A  1  164  ? 100.766 78.677  -53.936 1.00 145.40 ? 164  ARG A CD    1 
ATOM   1270  N  NE    . ARG A  1  164  ? 100.316 77.342  -53.550 1.00 142.80 ? 164  ARG A NE    1 
ATOM   1271  C  CZ    . ARG A  1  164  ? 99.893  77.016  -52.335 1.00 146.52 ? 164  ARG A CZ    1 
ATOM   1272  N  NH1   . ARG A  1  164  ? 99.868  77.925  -51.367 1.00 129.10 ? 164  ARG A NH1   1 
ATOM   1273  N  NH2   . ARG A  1  164  ? 99.484  75.780  -52.079 1.00 126.98 ? 164  ARG A NH2   1 
ATOM   1274  N  N     . GLY A  1  165  ? 101.327 76.973  -58.532 1.00 146.15 ? 165  GLY A N     1 
ATOM   1275  C  CA    . GLY A  1  165  ? 100.921 75.714  -59.142 1.00 145.09 ? 165  GLY A CA    1 
ATOM   1276  C  C     . GLY A  1  165  ? 99.791  75.009  -58.429 1.00 146.01 ? 165  GLY A C     1 
ATOM   1277  O  O     . GLY A  1  165  ? 99.739  73.776  -58.419 1.00 144.79 ? 165  GLY A O     1 
ATOM   1278  N  N     . GLY A  1  166  ? 98.888  75.786  -57.846 1.00 141.14 ? 166  GLY A N     1 
ATOM   1279  C  CA    . GLY A  1  166  ? 97.745  75.244  -57.131 1.00 139.63 ? 166  GLY A CA    1 
ATOM   1280  C  C     . GLY A  1  166  ? 96.431  75.768  -57.648 1.00 144.54 ? 166  GLY A C     1 
ATOM   1281  O  O     . GLY A  1  166  ? 96.400  76.798  -58.324 1.00 145.90 ? 166  GLY A O     1 
ATOM   1282  N  N     . CYS A  1  167  ? 95.328  75.064  -57.317 1.00 140.59 ? 167  CYS A N     1 
ATOM   1283  C  CA    . CYS A  1  167  ? 93.966  75.475  -57.683 1.00 141.62 ? 167  CYS A CA    1 
ATOM   1284  C  C     . CYS A  1  167  ? 93.549  76.671  -56.793 1.00 144.86 ? 167  CYS A C     1 
ATOM   1285  O  O     . CYS A  1  167  ? 94.345  77.107  -55.960 1.00 144.11 ? 167  CYS A O     1 
ATOM   1286  C  CB    . CYS A  1  167  ? 92.987  74.303  -57.583 1.00 141.15 ? 167  CYS A CB    1 
ATOM   1287  S  SG    . CYS A  1  167  ? 92.586  73.791  -55.891 1.00 142.68 ? 167  CYS A SG    1 
ATOM   1288  N  N     . GLY A  1  168  ? 92.356  77.219  -56.995 1.00 141.08 ? 168  GLY A N     1 
ATOM   1289  C  CA    . GLY A  1  168  ? 91.916  78.368  -56.210 1.00 140.82 ? 168  GLY A CA    1 
ATOM   1290  C  C     . GLY A  1  168  ? 90.748  78.101  -55.291 1.00 143.36 ? 168  GLY A C     1 
ATOM   1291  O  O     . GLY A  1  168  ? 90.080  79.045  -54.859 1.00 143.69 ? 168  GLY A O     1 
ATOM   1292  N  N     . ASN A  1  169  ? 90.499  76.819  -54.984 1.00 138.25 ? 169  ASN A N     1 
ATOM   1293  C  CA    . ASN A  1  169  ? 89.369  76.389  -54.166 1.00 137.18 ? 169  ASN A CA    1 
ATOM   1294  C  C     . ASN A  1  169  ? 89.490  76.766  -52.701 1.00 138.32 ? 169  ASN A C     1 
ATOM   1295  O  O     . ASN A  1  169  ? 90.588  76.760  -52.136 1.00 136.62 ? 169  ASN A O     1 
ATOM   1296  C  CB    . ASN A  1  169  ? 89.109  74.892  -54.330 1.00 138.59 ? 169  ASN A CB    1 
ATOM   1297  C  CG    . ASN A  1  169  ? 88.736  74.492  -55.742 1.00 169.60 ? 169  ASN A CG    1 
ATOM   1298  O  OD1   . ASN A  1  169  ? 87.798  75.028  -56.356 1.00 165.37 ? 169  ASN A OD1   1 
ATOM   1299  N  ND2   . ASN A  1  169  ? 89.464  73.533  -56.287 1.00 162.92 ? 169  ASN A ND2   1 
ATOM   1300  N  N     . THR A  1  170  ? 88.338  77.101  -52.099 1.00 134.10 ? 170  THR A N     1 
ATOM   1301  C  CA    . THR A  1  170  ? 88.212  77.482  -50.696 1.00 132.60 ? 170  THR A CA    1 
ATOM   1302  C  C     . THR A  1  170  ? 88.289  76.250  -49.806 1.00 134.42 ? 170  THR A C     1 
ATOM   1303  O  O     . THR A  1  170  ? 87.721  75.194  -50.120 1.00 133.84 ? 170  THR A O     1 
ATOM   1304  C  CB    . THR A  1  170  ? 86.907  78.230  -50.457 1.00 140.46 ? 170  THR A CB    1 
ATOM   1305  O  OG1   . THR A  1  170  ? 86.644  79.083  -51.568 1.00 143.40 ? 170  THR A OG1   1 
ATOM   1306  C  CG2   . THR A  1  170  ? 86.920  79.027  -49.156 1.00 137.59 ? 170  THR A CG2   1 
ATOM   1307  N  N     . GLN A  1  171  ? 88.972  76.406  -48.677 1.00 128.79 ? 171  GLN A N     1 
ATOM   1308  C  CA    . GLN A  1  171  ? 89.158  75.340  -47.722 1.00 126.00 ? 171  GLN A CA    1 
ATOM   1309  C  C     . GLN A  1  171  ? 88.138  75.377  -46.581 1.00 128.35 ? 171  GLN A C     1 
ATOM   1310  O  O     . GLN A  1  171  ? 87.779  76.458  -46.115 1.00 128.14 ? 171  GLN A O     1 
ATOM   1311  C  CB    . GLN A  1  171  ? 90.611  75.337  -47.225 1.00 126.11 ? 171  GLN A CB    1 
ATOM   1312  C  CG    . GLN A  1  171  ? 91.435  74.146  -47.737 1.00 136.79 ? 171  GLN A CG    1 
ATOM   1313  C  CD    . GLN A  1  171  ? 91.424  74.014  -49.240 1.00 150.25 ? 171  GLN A CD    1 
ATOM   1314  O  OE1   . GLN A  1  171  ? 92.119  74.728  -49.956 1.00 147.19 ? 171  GLN A OE1   1 
ATOM   1315  N  NE2   . GLN A  1  171  ? 90.607  73.115  -49.752 1.00 140.69 ? 171  GLN A NE2   1 
ATOM   1316  N  N     . PRO A  1  172  ? 87.635  74.204  -46.137 1.00 124.36 ? 172  PRO A N     1 
ATOM   1317  C  CA    . PRO A  1  172  ? 86.655  74.196  -45.038 1.00 123.82 ? 172  PRO A CA    1 
ATOM   1318  C  C     . PRO A  1  172  ? 87.252  74.467  -43.669 1.00 125.18 ? 172  PRO A C     1 
ATOM   1319  O  O     . PRO A  1  172  ? 88.462  74.359  -43.474 1.00 123.73 ? 172  PRO A O     1 
ATOM   1320  C  CB    . PRO A  1  172  ? 86.130  72.757  -45.053 1.00 124.91 ? 172  PRO A CB    1 
ATOM   1321  C  CG    . PRO A  1  172  ? 87.253  71.950  -45.583 1.00 128.48 ? 172  PRO A CG    1 
ATOM   1322  C  CD    . PRO A  1  172  ? 87.937  72.829  -46.596 1.00 125.23 ? 172  PRO A CD    1 
ATOM   1323  N  N     . THR A  1  173  ? 86.375  74.745  -42.707 1.00 121.17 ? 173  THR A N     1 
ATOM   1324  C  CA    . THR A  1  173  ? 86.752  74.897  -41.317 1.00 119.97 ? 173  THR A CA    1 
ATOM   1325  C  C     . THR A  1  173  ? 86.279  73.572  -40.725 1.00 122.47 ? 173  THR A C     1 
ATOM   1326  O  O     . THR A  1  173  ? 85.079  73.390  -40.474 1.00 122.66 ? 173  THR A O     1 
ATOM   1327  C  CB    . THR A  1  173  ? 86.137  76.157  -40.690 1.00 131.56 ? 173  THR A CB    1 
ATOM   1328  O  OG1   . THR A  1  173  ? 86.123  77.219  -41.649 1.00 138.49 ? 173  THR A OG1   1 
ATOM   1329  C  CG2   . THR A  1  173  ? 86.879  76.599  -39.439 1.00 127.59 ? 173  THR A CG2   1 
ATOM   1330  N  N     . ILE A  1  174  ? 87.213  72.603  -40.629 1.00 116.50 ? 174  ILE A N     1 
ATOM   1331  C  CA    . ILE A  1  174  ? 86.915  71.254  -40.154 1.00 114.20 ? 174  ILE A CA    1 
ATOM   1332  C  C     . ILE A  1  174  ? 86.797  71.217  -38.648 1.00 116.36 ? 174  ILE A C     1 
ATOM   1333  O  O     . ILE A  1  174  ? 87.607  71.820  -37.939 1.00 115.65 ? 174  ILE A O     1 
ATOM   1334  C  CB    . ILE A  1  174  ? 87.904  70.182  -40.701 1.00 116.01 ? 174  ILE A CB    1 
ATOM   1335  C  CG1   . ILE A  1  174  ? 88.192  70.396  -42.198 1.00 117.29 ? 174  ILE A CG1   1 
ATOM   1336  C  CG2   . ILE A  1  174  ? 87.384  68.754  -40.451 1.00 115.38 ? 174  ILE A CG2   1 
ATOM   1337  C  CD1   . ILE A  1  174  ? 89.555  70.050  -42.606 1.00 121.57 ? 174  ILE A CD1   1 
ATOM   1338  N  N     . ARG A  1  175  ? 85.770  70.509  -38.172 1.00 112.11 ? 175  ARG A N     1 
ATOM   1339  C  CA    . ARG A  1  175  ? 85.500  70.274  -36.759 1.00 111.03 ? 175  ARG A CA    1 
ATOM   1340  C  C     . ARG A  1  175  ? 85.048  68.811  -36.549 1.00 112.69 ? 175  ARG A C     1 
ATOM   1341  O  O     . ARG A  1  175  ? 84.425  68.235  -37.444 1.00 113.07 ? 175  ARG A O     1 
ATOM   1342  C  CB    . ARG A  1  175  ? 84.514  71.317  -36.178 1.00 114.06 ? 175  ARG A CB    1 
ATOM   1343  C  CG    . ARG A  1  175  ? 83.098  71.339  -36.779 1.00 130.04 ? 175  ARG A CG    1 
ATOM   1344  C  CD    . ARG A  1  175  ? 82.045  71.765  -35.755 1.00 146.10 ? 175  ARG A CD    1 
ATOM   1345  N  NE    . ARG A  1  175  ? 81.932  70.806  -34.646 1.00 159.22 ? 175  ARG A NE    1 
ATOM   1346  C  CZ    . ARG A  1  175  ? 81.024  70.863  -33.675 1.00 173.49 ? 175  ARG A CZ    1 
ATOM   1347  N  NH1   . ARG A  1  175  ? 80.118  71.835  -33.657 1.00 163.95 ? 175  ARG A NH1   1 
ATOM   1348  N  NH2   . ARG A  1  175  ? 81.010  69.943  -32.717 1.00 154.13 ? 175  ARG A NH2   1 
ATOM   1349  N  N     . LYS A  1  176  ? 85.397  68.204  -35.395 1.00 106.18 ? 176  LYS A N     1 
ATOM   1350  C  CA    . LYS A  1  176  ? 85.048  66.816  -35.076 1.00 104.31 ? 176  LYS A CA    1 
ATOM   1351  C  C     . LYS A  1  176  ? 83.658  66.719  -34.451 1.00 108.90 ? 176  LYS A C     1 
ATOM   1352  O  O     . LYS A  1  176  ? 83.315  67.525  -33.586 1.00 109.05 ? 176  LYS A O     1 
ATOM   1353  C  CB    . LYS A  1  176  ? 86.097  66.216  -34.122 1.00 104.88 ? 176  LYS A CB    1 
ATOM   1354  C  CG    . LYS A  1  176  ? 86.134  64.686  -34.081 1.00 111.11 ? 176  LYS A CG    1 
ATOM   1355  C  CD    . LYS A  1  176  ? 87.210  64.147  -33.139 1.00 112.14 ? 176  LYS A CD    1 
ATOM   1356  C  CE    . LYS A  1  176  ? 86.662  63.804  -31.774 1.00 125.78 ? 176  LYS A CE    1 
ATOM   1357  N  NZ    . LYS A  1  176  ? 87.555  62.866  -31.042 1.00 136.65 ? 176  LYS A NZ    1 
ATOM   1358  N  N     . ASP A  1  177  ? 82.865  65.728  -34.885 1.00 105.92 ? 177  ASP A N     1 
ATOM   1359  C  CA    . ASP A  1  177  ? 81.527  65.444  -34.357 1.00 106.41 ? 177  ASP A CA    1 
ATOM   1360  C  C     . ASP A  1  177  ? 81.446  63.928  -34.142 1.00 108.71 ? 177  ASP A C     1 
ATOM   1361  O  O     . ASP A  1  177  ? 80.964  63.188  -35.007 1.00 108.42 ? 177  ASP A O     1 
ATOM   1362  C  CB    . ASP A  1  177  ? 80.426  65.964  -35.303 1.00 110.53 ? 177  ASP A CB    1 
ATOM   1363  C  CG    . ASP A  1  177  ? 79.032  65.970  -34.693 1.00 127.03 ? 177  ASP A CG    1 
ATOM   1364  O  OD1   . ASP A  1  177  ? 78.392  64.891  -34.654 1.00 128.05 ? 177  ASP A OD1   1 
ATOM   1365  O  OD2   . ASP A  1  177  ? 78.567  67.060  -34.284 1.00 135.40 ? 177  ASP A OD2   1 
ATOM   1366  N  N     . GLY A  1  178  ? 81.986  63.483  -33.007 1.00 103.80 ? 178  GLY A N     1 
ATOM   1367  C  CA    . GLY A  1  178  ? 82.078  62.071  -32.655 1.00 102.16 ? 178  GLY A CA    1 
ATOM   1368  C  C     . GLY A  1  178  ? 83.199  61.427  -33.448 1.00 103.84 ? 178  GLY A C     1 
ATOM   1369  O  O     . GLY A  1  178  ? 84.362  61.823  -33.305 1.00 102.51 ? 178  GLY A O     1 
ATOM   1370  N  N     . LEU A  1  179  ? 82.839  60.476  -34.340 1.00 99.05  ? 179  LEU A N     1 
ATOM   1371  C  CA    . LEU A  1  179  ? 83.774  59.778  -35.237 1.00 97.51  ? 179  LEU A CA    1 
ATOM   1372  C  C     . LEU A  1  179  ? 83.743  60.366  -36.682 1.00 104.00 ? 179  LEU A C     1 
ATOM   1373  O  O     . LEU A  1  179  ? 84.311  59.772  -37.608 1.00 103.27 ? 179  LEU A O     1 
ATOM   1374  C  CB    . LEU A  1  179  ? 83.461  58.267  -35.263 1.00 96.14  ? 179  LEU A CB    1 
ATOM   1375  C  CG    . LEU A  1  179  ? 83.515  57.503  -33.940 1.00 98.64  ? 179  LEU A CG    1 
ATOM   1376  C  CD1   . LEU A  1  179  ? 83.002  56.084  -34.112 1.00 98.36  ? 179  LEU A CD1   1 
ATOM   1377  C  CD2   . LEU A  1  179  ? 84.912  57.481  -33.365 1.00 98.85  ? 179  LEU A CD2   1 
ATOM   1378  N  N     . LYS A  1  180  ? 83.087  61.535  -36.858 1.00 102.80 ? 180  LYS A N     1 
ATOM   1379  C  CA    . LYS A  1  180  ? 82.920  62.203  -38.148 1.00 104.45 ? 180  LYS A CA    1 
ATOM   1380  C  C     . LYS A  1  180  ? 83.566  63.590  -38.186 1.00 111.49 ? 180  LYS A C     1 
ATOM   1381  O  O     . LYS A  1  180  ? 83.584  64.287  -37.169 1.00 111.38 ? 180  LYS A O     1 
ATOM   1382  C  CB    . LYS A  1  180  ? 81.428  62.280  -38.528 1.00 107.18 ? 180  LYS A CB    1 
ATOM   1383  C  CG    . LYS A  1  180  ? 80.797  60.922  -38.839 1.00 116.24 ? 180  LYS A CG    1 
ATOM   1384  C  CD    . LYS A  1  180  ? 79.385  61.052  -39.416 1.00 127.62 ? 180  LYS A CD    1 
ATOM   1385  C  CE    . LYS A  1  180  ? 78.744  59.700  -39.667 1.00 137.03 ? 180  LYS A CE    1 
ATOM   1386  N  NZ    . LYS A  1  180  ? 77.349  59.813  -40.186 1.00 139.89 ? 180  LYS A NZ    1 
ATOM   1387  N  N     . LEU A  1  181  ? 84.097  63.984  -39.364 1.00 109.74 ? 181  LEU A N     1 
ATOM   1388  C  CA    . LEU A  1  181  ? 84.723  65.293  -39.573 1.00 110.48 ? 181  LEU A CA    1 
ATOM   1389  C  C     . LEU A  1  181  ? 83.814  66.154  -40.461 1.00 118.72 ? 181  LEU A C     1 
ATOM   1390  O  O     . LEU A  1  181  ? 83.471  65.732  -41.565 1.00 119.22 ? 181  LEU A O     1 
ATOM   1391  C  CB    . LEU A  1  181  ? 86.133  65.155  -40.188 1.00 109.69 ? 181  LEU A CB    1 
ATOM   1392  C  CG    . LEU A  1  181  ? 87.225  64.494  -39.342 1.00 111.81 ? 181  LEU A CG    1 
ATOM   1393  C  CD1   . LEU A  1  181  ? 88.487  64.315  -40.141 1.00 111.42 ? 181  LEU A CD1   1 
ATOM   1394  C  CD2   . LEU A  1  181  ? 87.543  65.305  -38.115 1.00 113.09 ? 181  LEU A CD2   1 
ATOM   1395  N  N     . VAL A  1  182  ? 83.401  67.344  -39.965 1.00 118.08 ? 182  VAL A N     1 
ATOM   1396  C  CA    . VAL A  1  182  ? 82.475  68.265  -40.655 1.00 120.50 ? 182  VAL A CA    1 
ATOM   1397  C  C     . VAL A  1  182  ? 83.124  69.617  -41.023 1.00 127.49 ? 182  VAL A C     1 
ATOM   1398  O  O     . VAL A  1  182  ? 83.679  70.294  -40.153 1.00 127.22 ? 182  VAL A O     1 
ATOM   1399  C  CB    . VAL A  1  182  ? 81.167  68.458  -39.840 1.00 124.59 ? 182  VAL A CB    1 
ATOM   1400  C  CG1   . VAL A  1  182  ? 80.196  69.403  -40.548 1.00 126.39 ? 182  VAL A CG1   1 
ATOM   1401  C  CG2   . VAL A  1  182  ? 80.496  67.120  -39.534 1.00 123.47 ? 182  VAL A CG2   1 
ATOM   1402  N  N     . GLY A  1  183  ? 83.005  69.999  -42.295 1.00 126.11 ? 183  GLY A N     1 
ATOM   1403  C  CA    . GLY A  1  183  ? 83.557  71.243  -42.817 1.00 127.53 ? 183  GLY A CA    1 
ATOM   1404  C  C     . GLY A  1  183  ? 82.529  72.338  -43.002 1.00 135.20 ? 183  GLY A C     1 
ATOM   1405  O  O     . GLY A  1  183  ? 81.344  72.049  -43.189 1.00 135.89 ? 183  GLY A O     1 
ATOM   1406  N  N     . SER A  1  184  ? 82.987  73.611  -42.970 1.00 133.34 ? 184  SER A N     1 
ATOM   1407  C  CA    . SER A  1  184  ? 82.139  74.801  -43.139 1.00 134.78 ? 184  SER A CA    1 
ATOM   1408  C  C     . SER A  1  184  ? 82.811  75.908  -43.991 1.00 139.97 ? 184  SER A C     1 
ATOM   1409  O  O     . SER A  1  184  ? 83.520  76.784  -43.478 1.00 139.02 ? 184  SER A O     1 
ATOM   1410  C  CB    . SER A  1  184  ? 81.657  75.328  -41.787 1.00 137.61 ? 184  SER A CB    1 
ATOM   1411  O  OG    . SER A  1  184  ? 80.743  76.402  -41.928 1.00 146.58 ? 184  SER A OG    1 
ATOM   1412  N  N     . TRP A  1  185  ? 82.558  75.845  -45.305 1.00 138.33 ? 185  TRP A N     1 
ATOM   1413  C  CA    . TRP A  1  185  ? 83.046  76.769  -46.332 1.00 139.92 ? 185  TRP A CA    1 
ATOM   1414  C  C     . TRP A  1  185  ? 82.190  78.073  -46.348 1.00 143.55 ? 185  TRP A C     1 
ATOM   1415  O  O     . TRP A  1  185  ? 81.181  78.146  -45.642 1.00 142.87 ? 185  TRP A O     1 
ATOM   1416  C  CB    . TRP A  1  185  ? 82.965  76.079  -47.711 1.00 140.01 ? 185  TRP A CB    1 
ATOM   1417  C  CG    . TRP A  1  185  ? 83.753  74.806  -47.877 1.00 140.05 ? 185  TRP A CG    1 
ATOM   1418  C  CD1   . TRP A  1  185  ? 84.912  74.651  -48.582 1.00 142.97 ? 185  TRP A CD1   1 
ATOM   1419  C  CD2   . TRP A  1  185  ? 83.358  73.487  -47.460 1.00 138.77 ? 185  TRP A CD2   1 
ATOM   1420  N  NE1   . TRP A  1  185  ? 85.284  73.325  -48.599 1.00 141.33 ? 185  TRP A NE1   1 
ATOM   1421  C  CE2   . TRP A  1  185  ? 84.345  72.588  -47.924 1.00 142.02 ? 185  TRP A CE2   1 
ATOM   1422  C  CE3   . TRP A  1  185  ? 82.276  72.979  -46.719 1.00 139.64 ? 185  TRP A CE3   1 
ATOM   1423  C  CZ2   . TRP A  1  185  ? 84.297  71.214  -47.646 1.00 140.07 ? 185  TRP A CZ2   1 
ATOM   1424  C  CZ3   . TRP A  1  185  ? 82.230  71.620  -46.446 1.00 139.95 ? 185  TRP A CZ3   1 
ATOM   1425  C  CH2   . TRP A  1  185  ? 83.236  70.755  -46.897 1.00 139.78 ? 185  TRP A CH2   1 
ATOM   1426  N  N     . LYS A  1  186  ? 82.576  79.086  -47.164 1.00 140.15 ? 186  LYS A N     1 
ATOM   1427  C  CA    . LYS A  1  186  ? 81.829  80.344  -47.267 1.00 157.80 ? 186  LYS A CA    1 
ATOM   1428  C  C     . LYS A  1  186  ? 81.703  80.871  -48.713 1.00 186.36 ? 186  LYS A C     1 
ATOM   1429  O  O     . LYS A  1  186  ? 80.695  81.489  -49.081 1.00 145.32 ? 186  LYS A O     1 
ATOM   1430  C  CB    . LYS A  1  186  ? 82.425  81.405  -46.327 1.00 159.76 ? 186  LYS A CB    1 
ATOM   1431  C  CG    . LYS A  1  186  ? 81.442  82.513  -45.948 1.00 175.01 ? 186  LYS A CG    1 
ATOM   1432  C  CD    . LYS A  1  186  ? 80.470  82.090  -44.854 1.00 181.66 ? 186  LYS A CD    1 
ATOM   1433  C  CE    . LYS A  1  186  ? 79.330  83.061  -44.727 1.00 186.47 ? 186  LYS A CE    1 
ATOM   1434  N  NZ    . LYS A  1  186  ? 78.567  82.849  -43.472 1.00 190.34 ? 186  LYS A NZ    1 
ATOM   1435  N  N     . ASP A  1  195  ? 77.266  85.603  -44.223 1.00 173.37 ? 195  ASP A N     1 
ATOM   1436  C  CA    . ASP A  1  195  ? 76.009  85.470  -44.954 1.00 174.52 ? 195  ASP A CA    1 
ATOM   1437  C  C     . ASP A  1  195  ? 75.666  83.992  -45.249 1.00 177.04 ? 195  ASP A C     1 
ATOM   1438  O  O     . ASP A  1  195  ? 75.504  83.607  -46.414 1.00 177.69 ? 195  ASP A O     1 
ATOM   1439  C  CB    . ASP A  1  195  ? 76.020  86.340  -46.233 1.00 178.33 ? 195  ASP A CB    1 
ATOM   1440  C  CG    . ASP A  1  195  ? 74.652  86.823  -46.690 1.00 189.04 ? 195  ASP A CG    1 
ATOM   1441  O  OD1   . ASP A  1  195  ? 73.803  85.970  -47.038 1.00 189.35 ? 195  ASP A OD1   1 
ATOM   1442  O  OD2   . ASP A  1  195  ? 74.447  88.055  -46.745 1.00 195.67 ? 195  ASP A OD2   1 
ATOM   1443  N  N     . GLU A  1  196  ? 75.554  83.174  -44.167 1.00 170.90 ? 196  GLU A N     1 
ATOM   1444  C  CA    . GLU A  1  196  ? 75.186  81.745  -44.148 1.00 168.88 ? 196  GLU A CA    1 
ATOM   1445  C  C     . GLU A  1  196  ? 76.253  80.805  -44.815 1.00 169.87 ? 196  GLU A C     1 
ATOM   1446  O  O     . GLU A  1  196  ? 76.399  80.809  -46.043 1.00 170.38 ? 196  GLU A O     1 
ATOM   1447  C  CB    . GLU A  1  196  ? 73.764  81.535  -44.737 1.00 171.58 ? 196  GLU A CB    1 
ATOM   1448  C  CG    . GLU A  1  196  ? 73.205  80.125  -44.646 1.00 180.80 ? 196  GLU A CG    1 
ATOM   1449  C  CD    . GLU A  1  196  ? 73.206  79.365  -45.959 1.00 200.27 ? 196  GLU A CD    1 
ATOM   1450  O  OE1   . GLU A  1  196  ? 72.602  79.860  -46.939 1.00 187.86 ? 196  GLU A OE1   1 
ATOM   1451  O  OE2   . GLU A  1  196  ? 73.795  78.260  -46.001 1.00 195.57 ? 196  GLU A OE2   1 
ATOM   1452  N  N     . PRO A  1  197  ? 76.963  79.956  -44.014 1.00 162.84 ? 197  PRO A N     1 
ATOM   1453  C  CA    . PRO A  1  197  ? 77.955  79.035  -44.602 1.00 160.72 ? 197  PRO A CA    1 
ATOM   1454  C  C     . PRO A  1  197  ? 77.392  77.662  -45.028 1.00 161.70 ? 197  PRO A C     1 
ATOM   1455  O  O     . PRO A  1  197  ? 76.355  77.218  -44.521 1.00 161.02 ? 197  PRO A O     1 
ATOM   1456  C  CB    . PRO A  1  197  ? 79.005  78.899  -43.489 1.00 160.58 ? 197  PRO A CB    1 
ATOM   1457  C  CG    . PRO A  1  197  ? 78.334  79.372  -42.224 1.00 165.12 ? 197  PRO A CG    1 
ATOM   1458  C  CD    . PRO A  1  197  ? 76.935  79.816  -42.545 1.00 162.72 ? 197  PRO A CD    1 
ATOM   1459  N  N     . GLU A  1  198  ? 78.097  76.992  -45.971 1.00 155.87 ? 198  GLU A N     1 
ATOM   1460  C  CA    . GLU A  1  198  ? 77.768  75.661  -46.507 1.00 153.98 ? 198  GLU A CA    1 
ATOM   1461  C  C     . GLU A  1  198  ? 78.317  74.598  -45.544 1.00 151.79 ? 198  GLU A C     1 
ATOM   1462  O  O     . GLU A  1  198  ? 79.514  74.608  -45.246 1.00 150.16 ? 198  GLU A O     1 
ATOM   1463  C  CB    . GLU A  1  198  ? 78.376  75.496  -47.922 1.00 156.17 ? 198  GLU A CB    1 
ATOM   1464  C  CG    . GLU A  1  198  ? 78.200  74.123  -48.561 1.00 166.38 ? 198  GLU A CG    1 
ATOM   1465  C  CD    . GLU A  1  198  ? 78.964  73.900  -49.855 1.00 183.88 ? 198  GLU A CD    1 
ATOM   1466  O  OE1   . GLU A  1  198  ? 78.676  74.612  -50.846 1.00 180.67 ? 198  GLU A OE1   1 
ATOM   1467  O  OE2   . GLU A  1  198  ? 79.837  73.001  -49.886 1.00 165.82 ? 198  GLU A OE2   1 
ATOM   1468  N  N     . LEU A  1  199  ? 77.449  73.694  -45.055 1.00 144.85 ? 199  LEU A N     1 
ATOM   1469  C  CA    . LEU A  1  199  ? 77.864  72.659  -44.105 1.00 141.39 ? 199  LEU A CA    1 
ATOM   1470  C  C     . LEU A  1  199  ? 77.568  71.240  -44.545 1.00 140.98 ? 199  LEU A C     1 
ATOM   1471  O  O     . LEU A  1  199  ? 76.416  70.905  -44.831 1.00 141.54 ? 199  LEU A O     1 
ATOM   1472  C  CB    . LEU A  1  199  ? 77.270  72.912  -42.721 1.00 141.04 ? 199  LEU A CB    1 
ATOM   1473  C  CG    . LEU A  1  199  ? 78.139  73.743  -41.810 1.00 145.52 ? 199  LEU A CG    1 
ATOM   1474  C  CD1   . LEU A  1  199  ? 77.387  74.960  -41.313 1.00 147.01 ? 199  LEU A CD1   1 
ATOM   1475  C  CD2   . LEU A  1  199  ? 78.686  72.902  -40.668 1.00 146.13 ? 199  LEU A CD2   1 
ATOM   1476  N  N     . ARG A  1  200  ? 78.620  70.399  -44.579 1.00 132.94 ? 200  ARG A N     1 
ATOM   1477  C  CA    . ARG A  1  200  ? 78.536  68.983  -44.940 1.00 130.26 ? 200  ARG A CA    1 
ATOM   1478  C  C     . ARG A  1  200  ? 79.641  68.151  -44.304 1.00 128.99 ? 200  ARG A C     1 
ATOM   1479  O  O     . ARG A  1  200  ? 80.736  68.656  -44.024 1.00 127.84 ? 200  ARG A O     1 
ATOM   1480  C  CB    . ARG A  1  200  ? 78.475  68.768  -46.468 1.00 129.89 ? 200  ARG A CB    1 
ATOM   1481  C  CG    . ARG A  1  200  ? 79.796  68.916  -47.201 1.00 133.38 ? 200  ARG A CG    1 
ATOM   1482  C  CD    . ARG A  1  200  ? 79.944  67.849  -48.262 1.00 138.01 ? 200  ARG A CD    1 
ATOM   1483  N  NE    . ARG A  1  200  ? 81.339  67.684  -48.663 1.00 144.31 ? 200  ARG A NE    1 
ATOM   1484  C  CZ    . ARG A  1  200  ? 81.953  68.429  -49.577 1.00 160.21 ? 200  ARG A CZ    1 
ATOM   1485  N  NH1   . ARG A  1  200  ? 81.300  69.406  -50.199 1.00 151.36 ? 200  ARG A NH1   1 
ATOM   1486  N  NH2   . ARG A  1  200  ? 83.227  68.209  -49.870 1.00 145.00 ? 200  ARG A NH2   1 
ATOM   1487  N  N     . VAL A  1  201  ? 79.343  66.865  -44.096 1.00 122.39 ? 201  VAL A N     1 
ATOM   1488  C  CA    . VAL A  1  201  ? 80.268  65.892  -43.524 1.00 119.34 ? 201  VAL A CA    1 
ATOM   1489  C  C     . VAL A  1  201  ? 81.278  65.511  -44.600 1.00 121.46 ? 201  VAL A C     1 
ATOM   1490  O  O     . VAL A  1  201  ? 80.885  65.196  -45.728 1.00 122.83 ? 201  VAL A O     1 
ATOM   1491  C  CB    . VAL A  1  201  ? 79.510  64.648  -42.990 1.00 122.01 ? 201  VAL A CB    1 
ATOM   1492  C  CG1   . VAL A  1  201  ? 80.471  63.580  -42.474 1.00 120.02 ? 201  VAL A CG1   1 
ATOM   1493  C  CG2   . VAL A  1  201  ? 78.506  65.036  -41.910 1.00 121.93 ? 201  VAL A CG2   1 
ATOM   1494  N  N     . LEU A  1  202  ? 82.573  65.575  -44.263 1.00 114.84 ? 202  LEU A N     1 
ATOM   1495  C  CA    . LEU A  1  202  ? 83.637  65.167  -45.171 1.00 113.91 ? 202  LEU A CA    1 
ATOM   1496  C  C     . LEU A  1  202  ? 83.678  63.643  -45.102 1.00 116.54 ? 202  LEU A C     1 
ATOM   1497  O  O     . LEU A  1  202  ? 83.873  63.085  -44.013 1.00 115.89 ? 202  LEU A O     1 
ATOM   1498  C  CB    . LEU A  1  202  ? 84.996  65.751  -44.746 1.00 113.09 ? 202  LEU A CB    1 
ATOM   1499  C  CG    . LEU A  1  202  ? 85.180  67.264  -44.808 1.00 118.95 ? 202  LEU A CG    1 
ATOM   1500  C  CD1   . LEU A  1  202  ? 86.403  67.677  -44.034 1.00 118.06 ? 202  LEU A CD1   1 
ATOM   1501  C  CD2   . LEU A  1  202  ? 85.326  67.754  -46.239 1.00 124.01 ? 202  LEU A CD2   1 
ATOM   1502  N  N     . SER A  1  203  ? 83.443  62.967  -46.242 1.00 112.14 ? 203  SER A N     1 
ATOM   1503  C  CA    . SER A  1  203  ? 83.424  61.502  -46.304 1.00 110.37 ? 203  SER A CA    1 
ATOM   1504  C  C     . SER A  1  203  ? 84.809  60.879  -46.098 1.00 111.53 ? 203  SER A C     1 
ATOM   1505  O  O     . SER A  1  203  ? 85.826  61.555  -46.273 1.00 110.41 ? 203  SER A O     1 
ATOM   1506  C  CB    . SER A  1  203  ? 82.812  61.025  -47.618 1.00 114.73 ? 203  SER A CB    1 
ATOM   1507  O  OG    . SER A  1  203  ? 83.752  60.996  -48.679 1.00 122.75 ? 203  SER A OG    1 
ATOM   1508  N  N     . THR A  1  204  ? 84.843  59.587  -45.729 1.00 106.69 ? 204  THR A N     1 
ATOM   1509  C  CA    . THR A  1  204  ? 86.101  58.859  -45.550 1.00 105.03 ? 204  THR A CA    1 
ATOM   1510  C  C     . THR A  1  204  ? 86.801  58.736  -46.917 1.00 108.71 ? 204  THR A C     1 
ATOM   1511  O  O     . THR A  1  204  ? 88.016  58.923  -46.998 1.00 108.03 ? 204  THR A O     1 
ATOM   1512  C  CB    . THR A  1  204  ? 85.869  57.491  -44.897 1.00 111.90 ? 204  THR A CB    1 
ATOM   1513  O  OG1   . THR A  1  204  ? 84.584  57.452  -44.268 1.00 115.55 ? 204  THR A OG1   1 
ATOM   1514  C  CG2   . THR A  1  204  ? 86.955  57.137  -43.906 1.00 106.75 ? 204  THR A CG2   1 
ATOM   1515  N  N     . GLU A  1  205  ? 86.016  58.486  -47.990 1.00 105.22 ? 205  GLU A N     1 
ATOM   1516  C  CA    . GLU A  1  205  ? 86.508  58.347  -49.358 1.00 105.69 ? 205  GLU A CA    1 
ATOM   1517  C  C     . GLU A  1  205  ? 87.146  59.647  -49.842 1.00 110.48 ? 205  GLU A C     1 
ATOM   1518  O  O     . GLU A  1  205  ? 88.224  59.592  -50.448 1.00 111.10 ? 205  GLU A O     1 
ATOM   1519  C  CB    . GLU A  1  205  ? 85.396  57.898  -50.317 1.00 108.47 ? 205  GLU A CB    1 
ATOM   1520  C  CG    . GLU A  1  205  ? 84.720  56.595  -49.934 1.00 120.84 ? 205  GLU A CG    1 
ATOM   1521  C  CD    . GLU A  1  205  ? 83.440  56.786  -49.143 1.00 149.26 ? 205  GLU A CD    1 
ATOM   1522  O  OE1   . GLU A  1  205  ? 82.379  56.983  -49.780 1.00 155.35 ? 205  GLU A OE1   1 
ATOM   1523  O  OE2   . GLU A  1  205  ? 83.496  56.755  -47.890 1.00 137.62 ? 205  GLU A OE2   1 
ATOM   1524  N  N     . GLU A  1  206  ? 86.498  60.816  -49.548 1.00 105.94 ? 206  GLU A N     1 
ATOM   1525  C  CA    . GLU A  1  206  ? 86.978  62.169  -49.888 1.00 105.32 ? 206  GLU A CA    1 
ATOM   1526  C  C     . GLU A  1  206  ? 88.382  62.360  -49.312 1.00 106.40 ? 206  GLU A C     1 
ATOM   1527  O  O     . GLU A  1  206  ? 89.332  62.606  -50.060 1.00 106.69 ? 206  GLU A O     1 
ATOM   1528  C  CB    . GLU A  1  206  ? 86.064  63.238  -49.269 1.00 107.00 ? 206  GLU A CB    1 
ATOM   1529  C  CG    . GLU A  1  206  ? 84.919  63.706  -50.140 1.00 119.92 ? 206  GLU A CG    1 
ATOM   1530  C  CD    . GLU A  1  206  ? 84.003  64.691  -49.444 1.00 139.80 ? 206  GLU A CD    1 
ATOM   1531  O  OE1   . GLU A  1  206  ? 84.496  65.467  -48.594 1.00 126.51 ? 206  GLU A OE1   1 
ATOM   1532  O  OE2   . GLU A  1  206  ? 82.790  64.695  -49.756 1.00 139.13 ? 206  GLU A OE2   1 
ATOM   1533  N  N     . ILE A  1  207  ? 88.500  62.181  -47.973 1.00 99.09  ? 207  ILE A N     1 
ATOM   1534  C  CA    . ILE A  1  207  ? 89.724  62.307  -47.199 1.00 96.20  ? 207  ILE A CA    1 
ATOM   1535  C  C     . ILE A  1  207  ? 90.776  61.344  -47.726 1.00 99.38  ? 207  ILE A C     1 
ATOM   1536  O  O     . ILE A  1  207  ? 91.910  61.780  -47.940 1.00 99.88  ? 207  ILE A O     1 
ATOM   1537  C  CB    . ILE A  1  207  ? 89.445  62.171  -45.683 1.00 97.30  ? 207  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A  1  207  ? 88.575  63.340  -45.197 1.00 98.06  ? 207  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A  1  207  ? 90.742  62.124  -44.893 1.00 96.80  ? 207  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A  1  207  ? 87.925  63.165  -43.880 1.00 103.48 ? 207  ILE A CD1   1 
ATOM   1541  N  N     . LEU A  1  208  ? 90.393  60.061  -48.000 1.00 94.12  ? 208  LEU A N     1 
ATOM   1542  C  CA    . LEU A  1  208  ? 91.307  59.041  -48.541 1.00 92.62  ? 208  LEU A CA    1 
ATOM   1543  C  C     . LEU A  1  208  ? 91.913  59.504  -49.859 1.00 98.93  ? 208  LEU A C     1 
ATOM   1544  O  O     . LEU A  1  208  ? 93.139  59.580  -49.966 1.00 98.04  ? 208  LEU A O     1 
ATOM   1545  C  CB    . LEU A  1  208  ? 90.608  57.691  -48.761 1.00 91.66  ? 208  LEU A CB    1 
ATOM   1546  C  CG    . LEU A  1  208  ? 91.380  56.415  -48.419 1.00 93.61  ? 208  LEU A CG    1 
ATOM   1547  C  CD1   . LEU A  1  208  ? 90.702  55.212  -49.003 1.00 94.02  ? 208  LEU A CD1   1 
ATOM   1548  C  CD2   . LEU A  1  208  ? 92.789  56.438  -48.911 1.00 93.33  ? 208  LEU A CD2   1 
ATOM   1549  N  N     . ASN A  1  209  ? 91.057  59.829  -50.845 1.00 97.56  ? 209  ASN A N     1 
ATOM   1550  C  CA    . ASN A  1  209  ? 91.517  60.282  -52.145 1.00 99.36  ? 209  ASN A CA    1 
ATOM   1551  C  C     . ASN A  1  209  ? 92.366  61.559  -52.054 1.00 105.94 ? 209  ASN A C     1 
ATOM   1552  O  O     . ASN A  1  209  ? 93.356  61.679  -52.791 1.00 106.54 ? 209  ASN A O     1 
ATOM   1553  C  CB    . ASN A  1  209  ? 90.360  60.447  -53.110 1.00 99.76  ? 209  ASN A CB    1 
ATOM   1554  C  CG    . ASN A  1  209  ? 90.824  60.820  -54.487 1.00 119.29 ? 209  ASN A CG    1 
ATOM   1555  O  OD1   . ASN A  1  209  ? 90.554  61.921  -54.963 1.00 114.65 ? 209  ASN A OD1   1 
ATOM   1556  N  ND2   . ASN A  1  209  ? 91.638  59.962  -55.102 1.00 110.14 ? 209  ASN A ND2   1 
ATOM   1557  N  N     . ILE A  1  210  ? 91.998  62.492  -51.135 1.00 102.28 ? 210  ILE A N     1 
ATOM   1558  C  CA    . ILE A  1  210  ? 92.746  63.734  -50.924 1.00 102.04 ? 210  ILE A CA    1 
ATOM   1559  C  C     . ILE A  1  210  ? 94.130  63.403  -50.365 1.00 104.76 ? 210  ILE A C     1 
ATOM   1560  O  O     . ILE A  1  210  ? 95.119  63.946  -50.853 1.00 105.12 ? 210  ILE A O     1 
ATOM   1561  C  CB    . ILE A  1  210  ? 91.945  64.791  -50.106 1.00 105.31 ? 210  ILE A CB    1 
ATOM   1562  C  CG1   . ILE A  1  210  ? 91.110  65.716  -51.042 1.00 107.97 ? 210  ILE A CG1   1 
ATOM   1563  C  CG2   . ILE A  1  210  ? 92.866  65.661  -49.243 1.00 105.01 ? 210  ILE A CG2   1 
ATOM   1564  C  CD1   . ILE A  1  210  ? 89.869  65.120  -51.856 1.00 115.49 ? 210  ILE A CD1   1 
ATOM   1565  N  N     . PHE A  1  211  ? 94.200  62.457  -49.406 1.00 99.52  ? 211  PHE A N     1 
ATOM   1566  C  CA    . PHE A  1  211  ? 95.455  62.003  -48.821 1.00 97.66  ? 211  PHE A CA    1 
ATOM   1567  C  C     . PHE A  1  211  ? 96.289  61.308  -49.887 1.00 104.17 ? 211  PHE A C     1 
ATOM   1568  O  O     . PHE A  1  211  ? 97.469  61.623  -50.035 1.00 104.19 ? 211  PHE A O     1 
ATOM   1569  C  CB    . PHE A  1  211  ? 95.208  61.089  -47.613 1.00 97.31  ? 211  PHE A CB    1 
ATOM   1570  C  CG    . PHE A  1  211  ? 94.843  61.791  -46.321 1.00 97.99  ? 211  PHE A CG    1 
ATOM   1571  C  CD1   . PHE A  1  211  ? 94.607  63.164  -46.292 1.00 101.30 ? 211  PHE A CD1   1 
ATOM   1572  C  CD2   . PHE A  1  211  ? 94.734  61.080  -45.132 1.00 98.87  ? 211  PHE A CD2   1 
ATOM   1573  C  CE1   . PHE A  1  211  ? 94.243  63.806  -45.102 1.00 101.67 ? 211  PHE A CE1   1 
ATOM   1574  C  CE2   . PHE A  1  211  ? 94.370  61.725  -43.939 1.00 101.10 ? 211  PHE A CE2   1 
ATOM   1575  C  CZ    . PHE A  1  211  ? 94.129  63.083  -43.933 1.00 99.74  ? 211  PHE A CZ    1 
ATOM   1576  N  N     . LYS A  1  212  ? 95.644  60.447  -50.703 1.00 102.06 ? 212  LYS A N     1 
ATOM   1577  C  CA    . LYS A  1  212  ? 96.258  59.710  -51.812 1.00 102.23 ? 212  LYS A CA    1 
ATOM   1578  C  C     . LYS A  1  212  ? 96.926  60.625  -52.842 1.00 108.30 ? 212  LYS A C     1 
ATOM   1579  O  O     . LYS A  1  212  ? 97.774  60.160  -53.598 1.00 108.08 ? 212  LYS A O     1 
ATOM   1580  C  CB    . LYS A  1  212  ? 95.220  58.813  -52.493 1.00 104.33 ? 212  LYS A CB    1 
ATOM   1581  C  CG    . LYS A  1  212  ? 95.063  57.451  -51.843 1.00 109.28 ? 212  LYS A CG    1 
ATOM   1582  C  CD    . LYS A  1  212  ? 93.878  56.714  -52.437 1.00 118.87 ? 212  LYS A CD    1 
ATOM   1583  C  CE    . LYS A  1  212  ? 93.918  55.228  -52.190 1.00 129.62 ? 212  LYS A CE    1 
ATOM   1584  N  NZ    . LYS A  1  212  ? 92.575  54.610  -52.378 1.00 140.84 ? 212  LYS A NZ    1 
ATOM   1585  N  N     . HIS A  1  213  ? 96.555  61.923  -52.849 1.00 106.90 ? 213  HIS A N     1 
ATOM   1586  C  CA    . HIS A  1  213  ? 97.081  62.947  -53.754 1.00 108.69 ? 213  HIS A CA    1 
ATOM   1587  C  C     . HIS A  1  213  ? 98.133  63.865  -53.118 1.00 111.39 ? 213  HIS A C     1 
ATOM   1588  O  O     . HIS A  1  213  ? 98.588  64.806  -53.767 1.00 112.67 ? 213  HIS A O     1 
ATOM   1589  C  CB    . HIS A  1  213  ? 95.931  63.762  -54.368 1.00 111.52 ? 213  HIS A CB    1 
ATOM   1590  C  CG    . HIS A  1  213  ? 95.211  63.051  -55.470 1.00 116.60 ? 213  HIS A CG    1 
ATOM   1591  N  ND1   . HIS A  1  213  ? 95.312  61.675  -55.639 1.00 118.04 ? 213  HIS A ND1   1 
ATOM   1592  C  CD2   . HIS A  1  213  ? 94.390  63.550  -56.424 1.00 120.74 ? 213  HIS A CD2   1 
ATOM   1593  C  CE1   . HIS A  1  213  ? 94.558  61.388  -56.685 1.00 119.16 ? 213  HIS A CE1   1 
ATOM   1594  N  NE2   . HIS A  1  213  ? 93.982  62.484  -57.192 1.00 121.08 ? 213  HIS A NE2   1 
ATOM   1595  N  N     . ILE A  1  214  ? 98.530  63.596  -51.868 1.00 105.33 ? 214  ILE A N     1 
ATOM   1596  C  CA    . ILE A  1  214  ? 99.568  64.390  -51.210 1.00 104.17 ? 214  ILE A CA    1 
ATOM   1597  C  C     . ILE A  1  214  ? 100.919 63.850  -51.707 1.00 107.79 ? 214  ILE A C     1 
ATOM   1598  O  O     . ILE A  1  214  ? 101.186 62.642  -51.594 1.00 106.27 ? 214  ILE A O     1 
ATOM   1599  C  CB    . ILE A  1  214  ? 99.442  64.393  -49.652 1.00 105.39 ? 214  ILE A CB    1 
ATOM   1600  C  CG1   . ILE A  1  214  ? 98.053  64.881  -49.191 1.00 105.35 ? 214  ILE A CG1   1 
ATOM   1601  C  CG2   . ILE A  1  214  ? 100.559 65.225  -49.007 1.00 106.18 ? 214  ILE A CG2   1 
ATOM   1602  C  CD1   . ILE A  1  214  ? 97.738  64.643  -47.741 1.00 107.54 ? 214  ILE A CD1   1 
ATOM   1603  N  N     . SER A  1  215  ? 101.747 64.741  -52.290 1.00 104.98 ? 215  SER A N     1 
ATOM   1604  C  CA    . SER A  1  215  ? 103.063 64.381  -52.827 1.00 104.45 ? 215  SER A CA    1 
ATOM   1605  C  C     . SER A  1  215  ? 104.019 63.910  -51.745 1.00 105.58 ? 215  SER A C     1 
ATOM   1606  O  O     . SER A  1  215  ? 103.940 64.383  -50.612 1.00 103.98 ? 215  SER A O     1 
ATOM   1607  C  CB    . SER A  1  215  ? 103.679 65.562  -53.563 1.00 109.39 ? 215  SER A CB    1 
ATOM   1608  O  OG    . SER A  1  215  ? 104.015 66.604  -52.664 1.00 118.35 ? 215  SER A OG    1 
ATOM   1609  N  N     . VAL A  1  216  ? 104.947 63.010  -52.108 1.00 101.39 ? 216  VAL A N     1 
ATOM   1610  C  CA    . VAL A  1  216  ? 105.972 62.484  -51.202 1.00 99.39  ? 216  VAL A CA    1 
ATOM   1611  C  C     . VAL A  1  216  ? 106.689 63.642  -50.502 1.00 105.77 ? 216  VAL A C     1 
ATOM   1612  O  O     . VAL A  1  216  ? 106.765 63.630  -49.280 1.00 104.77 ? 216  VAL A O     1 
ATOM   1613  C  CB    . VAL A  1  216  ? 106.945 61.507  -51.909 1.00 102.14 ? 216  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A  1  216  ? 108.086 61.088  -50.992 1.00 100.26 ? 216  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A  1  216  ? 106.207 60.283  -52.440 1.00 101.88 ? 216  VAL A CG2   1 
ATOM   1616  N  N     . LYS A  1  217  ? 107.118 64.681  -51.257 1.00 105.36 ? 217  LYS A N     1 
ATOM   1617  C  CA    . LYS A  1  217  ? 107.779 65.860  -50.685 1.00 105.77 ? 217  LYS A CA    1 
ATOM   1618  C  C     . LYS A  1  217  ? 106.939 66.493  -49.584 1.00 108.46 ? 217  LYS A C     1 
ATOM   1619  O  O     . LYS A  1  217  ? 107.456 66.716  -48.483 1.00 106.93 ? 217  LYS A O     1 
ATOM   1620  C  CB    . LYS A  1  217  ? 108.143 66.892  -51.765 1.00 110.41 ? 217  LYS A CB    1 
ATOM   1621  C  CG    . LYS A  1  217  ? 109.565 66.702  -52.275 1.00 132.21 ? 217  LYS A CG    1 
ATOM   1622  C  CD    . LYS A  1  217  ? 110.138 67.952  -52.924 1.00 144.89 ? 217  LYS A CD    1 
ATOM   1623  C  CE    . LYS A  1  217  ? 111.540 67.702  -53.429 1.00 155.28 ? 217  LYS A CE    1 
ATOM   1624  N  NZ    . LYS A  1  217  ? 111.998 68.779  -54.344 1.00 165.03 ? 217  LYS A NZ    1 
ATOM   1625  N  N     . ASP A  1  218  ? 105.632 66.700  -49.867 1.00 104.75 ? 218  ASP A N     1 
ATOM   1626  C  CA    . ASP A  1  218  ? 104.660 67.294  -48.954 1.00 104.03 ? 218  ASP A CA    1 
ATOM   1627  C  C     . ASP A  1  218  ? 104.349 66.431  -47.741 1.00 103.75 ? 218  ASP A C     1 
ATOM   1628  O  O     . ASP A  1  218  ? 104.282 66.971  -46.634 1.00 103.27 ? 218  ASP A O     1 
ATOM   1629  C  CB    . ASP A  1  218  ? 103.355 67.666  -49.685 1.00 107.76 ? 218  ASP A CB    1 
ATOM   1630  C  CG    . ASP A  1  218  ? 103.392 68.944  -50.506 1.00 122.66 ? 218  ASP A CG    1 
ATOM   1631  O  OD1   . ASP A  1  218  ? 104.423 69.669  -50.443 1.00 122.98 ? 218  ASP A OD1   1 
ATOM   1632  O  OD2   . ASP A  1  218  ? 102.381 69.235  -51.195 1.00 130.97 ? 218  ASP A OD2   1 
ATOM   1633  N  N     . PHE A  1  219  ? 104.125 65.110  -47.926 1.00 96.52  ? 219  PHE A N     1 
ATOM   1634  C  CA    . PHE A  1  219  ? 103.811 64.295  -46.764 1.00 92.93  ? 219  PHE A CA    1 
ATOM   1635  C  C     . PHE A  1  219  ? 105.045 64.008  -45.937 1.00 95.10  ? 219  PHE A C     1 
ATOM   1636  O  O     . PHE A  1  219  ? 104.894 63.928  -44.723 1.00 94.64  ? 219  PHE A O     1 
ATOM   1637  C  CB    . PHE A  1  219  ? 102.989 63.039  -47.071 1.00 93.65  ? 219  PHE A CB    1 
ATOM   1638  C  CG    . PHE A  1  219  ? 103.563 61.890  -47.862 1.00 94.54  ? 219  PHE A CG    1 
ATOM   1639  C  CD1   . PHE A  1  219  ? 104.583 61.107  -47.340 1.00 96.20  ? 219  PHE A CD1   1 
ATOM   1640  C  CD2   . PHE A  1  219  ? 102.959 61.471  -49.040 1.00 97.39  ? 219  PHE A CD2   1 
ATOM   1641  C  CE1   . PHE A  1  219  ? 105.078 60.013  -48.049 1.00 96.76  ? 219  PHE A CE1   1 
ATOM   1642  C  CE2   . PHE A  1  219  ? 103.430 60.351  -49.730 1.00 99.71  ? 219  PHE A CE2   1 
ATOM   1643  C  CZ    . PHE A  1  219  ? 104.492 59.635  -49.234 1.00 96.38  ? 219  PHE A CZ    1 
ATOM   1644  N  N     . THR A  1  220  ? 106.268 63.931  -46.551 1.00 90.49  ? 220  THR A N     1 
ATOM   1645  C  CA    . THR A  1  220  ? 107.503 63.744  -45.770 1.00 89.00  ? 220  THR A CA    1 
ATOM   1646  C  C     . THR A  1  220  ? 107.895 65.081  -45.115 1.00 94.81  ? 220  THR A C     1 
ATOM   1647  O  O     . THR A  1  220  ? 108.690 65.072  -44.173 1.00 94.73  ? 220  THR A O     1 
ATOM   1648  C  CB    . THR A  1  220  ? 108.668 63.030  -46.503 1.00 92.80  ? 220  THR A CB    1 
ATOM   1649  O  OG1   . THR A  1  220  ? 109.237 63.879  -47.486 1.00 100.89 ? 220  THR A OG1   1 
ATOM   1650  C  CG2   . THR A  1  220  ? 108.288 61.664  -47.093 1.00 87.97  ? 220  THR A CG2   1 
ATOM   1651  N  N     . SER A  1  221  ? 107.290 66.220  -45.567 1.00 92.71  ? 221  SER A N     1 
ATOM   1652  C  CA    . SER A  1  221  ? 107.462 67.546  -44.951 1.00 92.59  ? 221  SER A CA    1 
ATOM   1653  C  C     . SER A  1  221  ? 106.696 67.514  -43.648 1.00 95.44  ? 221  SER A C     1 
ATOM   1654  O  O     . SER A  1  221  ? 107.184 68.016  -42.646 1.00 93.98  ? 221  SER A O     1 
ATOM   1655  C  CB    . SER A  1  221  ? 106.946 68.662  -45.850 1.00 96.67  ? 221  SER A CB    1 
ATOM   1656  O  OG    . SER A  1  221  ? 107.947 68.987  -46.797 1.00 107.15 ? 221  SER A OG    1 
ATOM   1657  N  N     . LEU A  1  222  ? 105.524 66.841  -43.651 1.00 92.72  ? 222  LEU A N     1 
ATOM   1658  C  CA    . LEU A  1  222  ? 104.722 66.530  -42.465 1.00 92.21  ? 222  LEU A CA    1 
ATOM   1659  C  C     . LEU A  1  222  ? 105.451 65.281  -41.852 1.00 98.56  ? 222  LEU A C     1 
ATOM   1660  O  O     . LEU A  1  222  ? 106.409 64.783  -42.456 1.00 99.22  ? 222  LEU A O     1 
ATOM   1661  C  CB    . LEU A  1  222  ? 103.273 66.222  -42.892 1.00 92.27  ? 222  LEU A CB    1 
ATOM   1662  C  CG    . LEU A  1  222  ? 102.566 67.318  -43.730 1.00 97.30  ? 222  LEU A CG    1 
ATOM   1663  C  CD1   . LEU A  1  222  ? 101.540 66.722  -44.677 1.00 97.77  ? 222  LEU A CD1   1 
ATOM   1664  C  CD2   . LEU A  1  222  ? 101.929 68.380  -42.854 1.00 97.63  ? 222  LEU A CD2   1 
ATOM   1665  N  N     . GLY A  1  223  ? 105.067 64.794  -40.680 1.00 95.50  ? 223  GLY A N     1 
ATOM   1666  C  CA    . GLY A  1  223  ? 105.831 63.688  -40.075 1.00 95.12  ? 223  GLY A CA    1 
ATOM   1667  C  C     . GLY A  1  223  ? 105.932 62.325  -40.769 1.00 98.92  ? 223  GLY A C     1 
ATOM   1668  O  O     . GLY A  1  223  ? 106.506 61.385  -40.194 1.00 97.18  ? 223  GLY A O     1 
ATOM   1669  N  N     . PHE A  1  224  ? 105.421 62.208  -42.024 1.00 94.85  ? 224  PHE A N     1 
ATOM   1670  C  CA    . PHE A  1  224  ? 105.244 60.946  -42.737 1.00 93.30  ? 224  PHE A CA    1 
ATOM   1671  C  C     . PHE A  1  224  ? 106.488 60.423  -43.442 1.00 96.97  ? 224  PHE A C     1 
ATOM   1672  O  O     . PHE A  1  224  ? 107.505 61.120  -43.488 1.00 97.69  ? 224  PHE A O     1 
ATOM   1673  C  CB    . PHE A  1  224  ? 104.022 61.030  -43.662 1.00 95.34  ? 224  PHE A CB    1 
ATOM   1674  C  CG    . PHE A  1  224  ? 102.793 61.167  -42.783 1.00 95.96  ? 224  PHE A CG    1 
ATOM   1675  C  CD1   . PHE A  1  224  ? 102.191 60.043  -42.222 1.00 96.08  ? 224  PHE A CD1   1 
ATOM   1676  C  CD2   . PHE A  1  224  ? 102.330 62.422  -42.396 1.00 99.39  ? 224  PHE A CD2   1 
ATOM   1677  C  CE1   . PHE A  1  224  ? 101.118 60.171  -41.339 1.00 98.21  ? 224  PHE A CE1   1 
ATOM   1678  C  CE2   . PHE A  1  224  ? 101.261 62.546  -41.502 1.00 99.69  ? 224  PHE A CE2   1 
ATOM   1679  C  CZ    . PHE A  1  224  ? 100.661 61.420  -40.984 1.00 97.06  ? 224  PHE A CZ    1 
ATOM   1680  N  N     . ASN A  1  225  ? 106.431 59.116  -43.834 1.00 91.68  ? 225  ASN A N     1 
ATOM   1681  C  CA    . ASN A  1  225  ? 107.491 58.322  -44.468 1.00 90.87  ? 225  ASN A CA    1 
ATOM   1682  C  C     . ASN A  1  225  ? 106.943 57.473  -45.625 1.00 95.87  ? 225  ASN A C     1 
ATOM   1683  O  O     . ASN A  1  225  ? 106.189 56.515  -45.413 1.00 94.51  ? 225  ASN A O     1 
ATOM   1684  C  CB    . ASN A  1  225  ? 108.140 57.410  -43.427 1.00 88.23  ? 225  ASN A CB    1 
ATOM   1685  C  CG    . ASN A  1  225  ? 109.381 56.658  -43.862 1.00 99.69  ? 225  ASN A CG    1 
ATOM   1686  O  OD1   . ASN A  1  225  ? 110.429 56.736  -43.216 1.00 90.26  ? 225  ASN A OD1   1 
ATOM   1687  N  ND2   . ASN A  1  225  ? 109.295 55.865  -44.914 1.00 86.97  ? 225  ASN A ND2   1 
ATOM   1688  N  N     . GLU A  1  226  ? 107.401 57.793  -46.841 1.00 94.22  ? 226  GLU A N     1 
ATOM   1689  C  CA    . GLU A  1  226  ? 107.044 57.178  -48.123 1.00 94.68  ? 226  GLU A CA    1 
ATOM   1690  C  C     . GLU A  1  226  ? 107.014 55.645  -48.128 1.00 97.82  ? 226  GLU A C     1 
ATOM   1691  O  O     . GLU A  1  226  ? 106.211 55.053  -48.861 1.00 98.21  ? 226  GLU A O     1 
ATOM   1692  C  CB    . GLU A  1  226  ? 108.012 57.701  -49.181 1.00 96.99  ? 226  GLU A CB    1 
ATOM   1693  C  CG    . GLU A  1  226  ? 107.708 57.267  -50.596 1.00 108.41 ? 226  GLU A CG    1 
ATOM   1694  C  CD    . GLU A  1  226  ? 108.879 57.465  -51.531 1.00 131.91 ? 226  GLU A CD    1 
ATOM   1695  O  OE1   . GLU A  1  226  ? 110.028 57.553  -51.037 1.00 115.78 ? 226  GLU A OE1   1 
ATOM   1696  O  OE2   . GLU A  1  226  ? 108.645 57.520  -52.761 1.00 132.63 ? 226  GLU A OE2   1 
ATOM   1697  N  N     . VAL A  1  227  ? 107.891 55.019  -47.318 1.00 92.47  ? 227  VAL A N     1 
ATOM   1698  C  CA    . VAL A  1  227  ? 108.065 53.567  -47.211 1.00 91.27  ? 227  VAL A CA    1 
ATOM   1699  C  C     . VAL A  1  227  ? 107.176 52.948  -46.148 1.00 93.46  ? 227  VAL A C     1 
ATOM   1700  O  O     . VAL A  1  227  ? 106.442 51.999  -46.434 1.00 93.20  ? 227  VAL A O     1 
ATOM   1701  C  CB    . VAL A  1  227  ? 109.546 53.167  -46.919 1.00 94.44  ? 227  VAL A CB    1 
ATOM   1702  C  CG1   . VAL A  1  227  ? 109.783 51.687  -47.179 1.00 93.96  ? 227  VAL A CG1   1 
ATOM   1703  C  CG2   . VAL A  1  227  ? 110.546 54.016  -47.689 1.00 95.09  ? 227  VAL A CG2   1 
ATOM   1704  N  N     . PHE A  1  228  ? 107.308 53.443  -44.907 1.00 88.34  ? 228  PHE A N     1 
ATOM   1705  C  CA    . PHE A  1  228  ? 106.699 52.870  -43.717 1.00 86.63  ? 228  PHE A CA    1 
ATOM   1706  C  C     . PHE A  1  228  ? 105.370 53.462  -43.256 1.00 89.85  ? 228  PHE A C     1 
ATOM   1707  O  O     . PHE A  1  228  ? 104.600 52.719  -42.649 1.00 89.91  ? 228  PHE A O     1 
ATOM   1708  C  CB    . PHE A  1  228  ? 107.707 52.907  -42.569 1.00 87.06  ? 228  PHE A CB    1 
ATOM   1709  C  CG    . PHE A  1  228  ? 108.976 52.169  -42.929 1.00 87.96  ? 228  PHE A CG    1 
ATOM   1710  C  CD1   . PHE A  1  228  ? 109.007 50.778  -42.963 1.00 90.23  ? 228  PHE A CD1   1 
ATOM   1711  C  CD2   . PHE A  1  228  ? 110.131 52.860  -43.251 1.00 89.17  ? 228  PHE A CD2   1 
ATOM   1712  C  CE1   . PHE A  1  228  ? 110.165 50.099  -43.335 1.00 90.03  ? 228  PHE A CE1   1 
ATOM   1713  C  CE2   . PHE A  1  228  ? 111.293 52.177  -43.596 1.00 91.41  ? 228  PHE A CE2   1 
ATOM   1714  C  CZ    . PHE A  1  228  ? 111.297 50.804  -43.648 1.00 88.88  ? 228  PHE A CZ    1 
ATOM   1715  N  N     . SER A  1  229  ? 105.102 54.761  -43.490 1.00 84.81  ? 229  SER A N     1 
ATOM   1716  C  CA    . SER A  1  229  ? 103.845 55.371  -43.055 1.00 83.86  ? 229  SER A CA    1 
ATOM   1717  C  C     . SER A  1  229  ? 103.416 56.568  -43.907 1.00 89.09  ? 229  SER A C     1 
ATOM   1718  O  O     . SER A  1  229  ? 103.866 57.696  -43.691 1.00 89.21  ? 229  SER A O     1 
ATOM   1719  C  CB    . SER A  1  229  ? 103.880 55.730  -41.574 1.00 84.55  ? 229  SER A CB    1 
ATOM   1720  O  OG    . SER A  1  229  ? 104.838 56.739  -41.315 1.00 90.41  ? 229  SER A OG    1 
ATOM   1721  N  N     . ARG A  1  230  ? 102.555 56.293  -44.892 1.00 85.72  ? 230  ARG A N     1 
ATOM   1722  C  CA    . ARG A  1  230  ? 101.983 57.278  -45.797 1.00 86.75  ? 230  ARG A CA    1 
ATOM   1723  C  C     . ARG A  1  230  ? 100.666 57.741  -45.149 1.00 91.28  ? 230  ARG A C     1 
ATOM   1724  O  O     . ARG A  1  230  ? 100.003 56.898  -44.553 1.00 91.33  ? 230  ARG A O     1 
ATOM   1725  C  CB    . ARG A  1  230  ? 101.714 56.628  -47.162 1.00 86.57  ? 230  ARG A CB    1 
ATOM   1726  C  CG    . ARG A  1  230  ? 102.974 56.273  -47.945 1.00 93.77  ? 230  ARG A CG    1 
ATOM   1727  C  CD    . ARG A  1  230  ? 102.637 55.519  -49.219 1.00 98.96  ? 230  ARG A CD    1 
ATOM   1728  N  NE    . ARG A  1  230  ? 103.600 55.770  -50.287 1.00 106.37 ? 230  ARG A NE    1 
ATOM   1729  C  CZ    . ARG A  1  230  ? 103.432 56.691  -51.231 1.00 126.68 ? 230  ARG A CZ    1 
ATOM   1730  N  NH1   . ARG A  1  230  ? 102.332 57.439  -51.252 1.00 107.94 ? 230  ARG A NH1   1 
ATOM   1731  N  NH2   . ARG A  1  230  ? 104.360 56.873  -52.162 1.00 122.47 ? 230  ARG A NH2   1 
ATOM   1732  N  N     . PRO A  1  231  ? 100.254 59.032  -45.226 1.00 87.52  ? 231  PRO A N     1 
ATOM   1733  C  CA    . PRO A  1  231  ? 99.012  59.456  -44.559 1.00 87.12  ? 231  PRO A CA    1 
ATOM   1734  C  C     . PRO A  1  231  ? 97.773  58.601  -44.815 1.00 92.34  ? 231  PRO A C     1 
ATOM   1735  O  O     . PRO A  1  231  ? 97.062  58.274  -43.866 1.00 90.84  ? 231  PRO A O     1 
ATOM   1736  C  CB    . PRO A  1  231  ? 98.818  60.885  -45.063 1.00 89.78  ? 231  PRO A CB    1 
ATOM   1737  C  CG    . PRO A  1  231  ? 100.171 61.367  -45.293 1.00 94.23  ? 231  PRO A CG    1 
ATOM   1738  C  CD    . PRO A  1  231  ? 100.927 60.187  -45.848 1.00 89.94  ? 231  PRO A CD    1 
ATOM   1739  N  N     . GLU A  1  232  ? 97.541  58.199  -46.075 1.00 91.00  ? 232  GLU A N     1 
ATOM   1740  C  CA    . GLU A  1  232  ? 96.380  57.398  -46.480 1.00 91.24  ? 232  GLU A CA    1 
ATOM   1741  C  C     . GLU A  1  232  ? 96.236  56.068  -45.722 1.00 93.36  ? 232  GLU A C     1 
ATOM   1742  O  O     . GLU A  1  232  ? 95.144  55.499  -45.710 1.00 93.44  ? 232  GLU A O     1 
ATOM   1743  C  CB    . GLU A  1  232  ? 96.374  57.170  -48.006 1.00 94.02  ? 232  GLU A CB    1 
ATOM   1744  C  CG    . GLU A  1  232  ? 97.476  56.253  -48.525 1.00 102.94 ? 232  GLU A CG    1 
ATOM   1745  C  CD    . GLU A  1  232  ? 98.527  56.936  -49.371 1.00 121.03 ? 232  GLU A CD    1 
ATOM   1746  O  OE1   . GLU A  1  232  ? 99.081  57.969  -48.929 1.00 116.67 ? 232  GLU A OE1   1 
ATOM   1747  O  OE2   . GLU A  1  232  ? 98.813  56.420  -50.474 1.00 115.96 ? 232  GLU A OE2   1 
ATOM   1748  N  N     . TRP A  1  233  ? 97.324  55.581  -45.095 1.00 88.79  ? 233  TRP A N     1 
ATOM   1749  C  CA    . TRP A  1  233  ? 97.315  54.327  -44.332 1.00 88.18  ? 233  TRP A CA    1 
ATOM   1750  C  C     . TRP A  1  233  ? 96.711  54.486  -42.928 1.00 89.56  ? 233  TRP A C     1 
ATOM   1751  O  O     . TRP A  1  233  ? 96.530  53.484  -42.224 1.00 89.24  ? 233  TRP A O     1 
ATOM   1752  C  CB    . TRP A  1  233  ? 98.712  53.667  -44.287 1.00 87.05  ? 233  TRP A CB    1 
ATOM   1753  C  CG    . TRP A  1  233  ? 99.270  53.262  -45.630 1.00 89.40  ? 233  TRP A CG    1 
ATOM   1754  C  CD1   . TRP A  1  233  ? 98.567  52.994  -46.770 1.00 93.40  ? 233  TRP A CD1   1 
ATOM   1755  C  CD2   . TRP A  1  233  ? 100.653 53.070  -45.959 1.00 89.33  ? 233  TRP A CD2   1 
ATOM   1756  N  NE1   . TRP A  1  233  ? 99.426  52.662  -47.790 1.00 93.34  ? 233  TRP A NE1   1 
ATOM   1757  C  CE2   . TRP A  1  233  ? 100.715 52.714  -47.324 1.00 94.09  ? 233  TRP A CE2   1 
ATOM   1758  C  CE3   . TRP A  1  233  ? 101.852 53.156  -45.230 1.00 89.95  ? 233  TRP A CE3   1 
ATOM   1759  C  CZ2   . TRP A  1  233  ? 101.926 52.422  -47.967 1.00 93.48  ? 233  TRP A CZ2   1 
ATOM   1760  C  CZ3   . TRP A  1  233  ? 103.052 52.887  -45.875 1.00 91.45  ? 233  TRP A CZ3   1 
ATOM   1761  C  CH2   . TRP A  1  233  ? 103.081 52.517  -47.223 1.00 92.91  ? 233  TRP A CH2   1 
ATOM   1762  N  N     . MET A  1  234  ? 96.379  55.745  -42.537 1.00 83.65  ? 234  MET A N     1 
ATOM   1763  C  CA    . MET A  1  234  ? 95.713  56.076  -41.275 1.00 81.42  ? 234  MET A CA    1 
ATOM   1764  C  C     . MET A  1  234  ? 94.222  55.821  -41.462 1.00 85.06  ? 234  MET A C     1 
ATOM   1765  O  O     . MET A  1  234  ? 93.455  55.933  -40.501 1.00 84.73  ? 234  MET A O     1 
ATOM   1766  C  CB    . MET A  1  234  ? 95.919  57.544  -40.894 1.00 83.68  ? 234  MET A CB    1 
ATOM   1767  C  CG    . MET A  1  234  ? 97.304  57.873  -40.431 1.00 86.44  ? 234  MET A CG    1 
ATOM   1768  S  SD    . MET A  1  234  ? 97.413  59.567  -39.803 1.00 90.91  ? 234  MET A SD    1 
ATOM   1769  C  CE    . MET A  1  234  ? 97.174  60.525  -41.317 1.00 89.36  ? 234  MET A CE    1 
ATOM   1770  N  N     . ILE A  1  235  ? 93.815  55.494  -42.717 1.00 81.49  ? 235  ILE A N     1 
ATOM   1771  C  CA    . ILE A  1  235  ? 92.444  55.175  -43.139 1.00 80.94  ? 235  ILE A CA    1 
ATOM   1772  C  C     . ILE A  1  235  ? 92.373  53.687  -43.502 1.00 85.98  ? 235  ILE A C     1 
ATOM   1773  O  O     . ILE A  1  235  ? 92.896  53.273  -44.544 1.00 87.75  ? 235  ILE A O     1 
ATOM   1774  C  CB    . ILE A  1  235  ? 91.940  56.109  -44.273 1.00 83.72  ? 235  ILE A CB    1 
ATOM   1775  C  CG1   . ILE A  1  235  ? 91.927  57.564  -43.788 1.00 83.49  ? 235  ILE A CG1   1 
ATOM   1776  C  CG2   . ILE A  1  235  ? 90.558  55.677  -44.732 1.00 84.35  ? 235  ILE A CG2   1 
ATOM   1777  C  CD1   . ILE A  1  235  ? 91.793  58.554  -44.811 1.00 89.29  ? 235  ILE A CD1   1 
ATOM   1778  N  N     . LEU A  1  236  ? 91.738  52.900  -42.626 1.00 80.72  ? 236  LEU A N     1 
ATOM   1779  C  CA    . LEU A  1  236  ? 91.582  51.453  -42.753 1.00 80.41  ? 236  LEU A CA    1 
ATOM   1780  C  C     . LEU A  1  236  ? 90.657  51.030  -43.915 1.00 89.10  ? 236  LEU A C     1 
ATOM   1781  O  O     . LEU A  1  236  ? 89.514  51.485  -44.022 1.00 89.83  ? 236  LEU A O     1 
ATOM   1782  C  CB    . LEU A  1  236  ? 91.142  50.842  -41.412 1.00 78.72  ? 236  LEU A CB    1 
ATOM   1783  C  CG    . LEU A  1  236  ? 91.963  51.281  -40.196 1.00 80.96  ? 236  LEU A CG    1 
ATOM   1784  C  CD1   . LEU A  1  236  ? 91.444  50.662  -38.966 1.00 79.79  ? 236  LEU A CD1   1 
ATOM   1785  C  CD2   . LEU A  1  236  ? 93.415  50.907  -40.341 1.00 82.19  ? 236  LEU A CD2   1 
ATOM   1786  N  N     . THR A  1  237  ? 91.193  50.165  -44.795 1.00 87.64  ? 237  THR A N     1 
ATOM   1787  C  CA    . THR A  1  237  ? 90.571  49.654  -46.019 1.00 88.83  ? 237  THR A CA    1 
ATOM   1788  C  C     . THR A  1  237  ? 90.454  48.135  -45.934 1.00 93.61  ? 237  THR A C     1 
ATOM   1789  O  O     . THR A  1  237  ? 89.425  47.567  -46.284 1.00 94.84  ? 237  THR A O     1 
ATOM   1790  C  CB    . THR A  1  237  ? 91.448  50.111  -47.192 1.00 95.74  ? 237  THR A CB    1 
ATOM   1791  O  OG1   . THR A  1  237  ? 91.217  51.500  -47.403 1.00 94.34  ? 237  THR A OG1   1 
ATOM   1792  C  CG2   . THR A  1  237  ? 91.231  49.308  -48.481 1.00 96.15  ? 237  THR A CG2   1 
ATOM   1793  N  N     . CYS A  1  238  ? 91.531  47.491  -45.506 1.00 88.80  ? 238  CYS A N     1 
ATOM   1794  C  CA    . CYS A  1  238  ? 91.620  46.061  -45.330 1.00 87.94  ? 238  CYS A CA    1 
ATOM   1795  C  C     . CYS A  1  238  ? 92.041  45.887  -43.874 1.00 90.31  ? 238  CYS A C     1 
ATOM   1796  O  O     . CYS A  1  238  ? 93.079  46.417  -43.461 1.00 90.08  ? 238  CYS A O     1 
ATOM   1797  C  CB    . CYS A  1  238  ? 92.649  45.482  -46.296 1.00 88.73  ? 238  CYS A CB    1 
ATOM   1798  S  SG    . CYS A  1  238  ? 92.856  43.691  -46.167 1.00 92.09  ? 238  CYS A SG    1 
ATOM   1799  N  N     . LEU A  1  239  ? 91.204  45.224  -43.074 1.00 85.33  ? 239  LEU A N     1 
ATOM   1800  C  CA    . LEU A  1  239  ? 91.489  45.056  -41.650 1.00 83.45  ? 239  LEU A CA    1 
ATOM   1801  C  C     . LEU A  1  239  ? 92.240  43.744  -41.330 1.00 87.99  ? 239  LEU A C     1 
ATOM   1802  O  O     . LEU A  1  239  ? 91.753  42.674  -41.710 1.00 89.12  ? 239  LEU A O     1 
ATOM   1803  C  CB    . LEU A  1  239  ? 90.183  45.155  -40.844 1.00 82.79  ? 239  LEU A CB    1 
ATOM   1804  C  CG    . LEU A  1  239  ? 90.311  45.272  -39.338 1.00 85.07  ? 239  LEU A CG    1 
ATOM   1805  C  CD1   . LEU A  1  239  ? 90.504  46.719  -38.923 1.00 85.12  ? 239  LEU A CD1   1 
ATOM   1806  C  CD2   . LEU A  1  239  ? 89.093  44.715  -38.668 1.00 85.54  ? 239  LEU A CD2   1 
ATOM   1807  N  N     . PRO A  1  240  ? 93.403  43.778  -40.623 1.00 82.10  ? 240  PRO A N     1 
ATOM   1808  C  CA    . PRO A  1  240  ? 94.061  42.507  -40.274 1.00 80.38  ? 240  PRO A CA    1 
ATOM   1809  C  C     . PRO A  1  240  ? 93.314  41.772  -39.163 1.00 83.78  ? 240  PRO A C     1 
ATOM   1810  O  O     . PRO A  1  240  ? 92.935  42.375  -38.132 1.00 83.09  ? 240  PRO A O     1 
ATOM   1811  C  CB    . PRO A  1  240  ? 95.478  42.914  -39.860 1.00 80.87  ? 240  PRO A CB    1 
ATOM   1812  C  CG    . PRO A  1  240  ? 95.424  44.358  -39.592 1.00 85.73  ? 240  PRO A CG    1 
ATOM   1813  C  CD    . PRO A  1  240  ? 94.127  44.939  -40.065 1.00 82.72  ? 240  PRO A CD    1 
ATOM   1814  N  N     . VAL A  1  241  ? 93.062  40.472  -39.410 1.00 79.14  ? 241  VAL A N     1 
ATOM   1815  C  CA    . VAL A  1  241  ? 92.402  39.584  -38.456 1.00 77.99  ? 241  VAL A CA    1 
ATOM   1816  C  C     . VAL A  1  241  ? 93.480  38.883  -37.596 1.00 81.00  ? 241  VAL A C     1 
ATOM   1817  O  O     . VAL A  1  241  ? 94.200  38.023  -38.133 1.00 81.59  ? 241  VAL A O     1 
ATOM   1818  C  CB    . VAL A  1  241  ? 91.442  38.575  -39.134 1.00 81.76  ? 241  VAL A CB    1 
ATOM   1819  C  CG1   . VAL A  1  241  ? 90.890  37.563  -38.130 1.00 80.40  ? 241  VAL A CG1   1 
ATOM   1820  C  CG2   . VAL A  1  241  ? 90.310  39.297  -39.840 1.00 82.66  ? 241  VAL A CG2   1 
ATOM   1821  N  N     . PRO A  1  242  ? 93.605  39.234  -36.277 1.00 73.96  ? 242  PRO A N     1 
ATOM   1822  C  CA    . PRO A  1  242  ? 94.609  38.570  -35.426 1.00 71.86  ? 242  PRO A CA    1 
ATOM   1823  C  C     . PRO A  1  242  ? 94.327  37.085  -35.213 1.00 75.25  ? 242  PRO A C     1 
ATOM   1824  O  O     . PRO A  1  242  ? 93.174  36.661  -35.240 1.00 75.46  ? 242  PRO A O     1 
ATOM   1825  C  CB    . PRO A  1  242  ? 94.564  39.368  -34.126 1.00 72.75  ? 242  PRO A CB    1 
ATOM   1826  C  CG    . PRO A  1  242  ? 93.231  39.974  -34.101 1.00 77.65  ? 242  PRO A CG    1 
ATOM   1827  C  CD    . PRO A  1  242  ? 92.848  40.244  -35.513 1.00 74.53  ? 242  PRO A CD    1 
ATOM   1828  N  N     . PRO A  1  243  ? 95.369  36.264  -35.044 1.00 72.29  ? 243  PRO A N     1 
ATOM   1829  C  CA    . PRO A  1  243  ? 95.144  34.811  -34.899 1.00 72.95  ? 243  PRO A CA    1 
ATOM   1830  C  C     . PRO A  1  243  ? 94.610  34.369  -33.531 1.00 79.44  ? 243  PRO A C     1 
ATOM   1831  O  O     . PRO A  1  243  ? 94.810  35.111  -32.567 1.00 80.28  ? 243  PRO A O     1 
ATOM   1832  C  CB    . PRO A  1  243  ? 96.534  34.237  -35.131 1.00 73.71  ? 243  PRO A CB    1 
ATOM   1833  C  CG    . PRO A  1  243  ? 97.451  35.313  -34.648 1.00 76.75  ? 243  PRO A CG    1 
ATOM   1834  C  CD    . PRO A  1  243  ? 96.808  36.591  -35.034 1.00 73.04  ? 243  PRO A CD    1 
ATOM   1835  N  N     . PRO A  1  244  ? 94.043  33.133  -33.398 1.00 75.97  ? 244  PRO A N     1 
ATOM   1836  C  CA    . PRO A  1  244  ? 93.571  32.657  -32.080 1.00 75.03  ? 244  PRO A CA    1 
ATOM   1837  C  C     . PRO A  1  244  ? 94.465  32.961  -30.867 1.00 79.51  ? 244  PRO A C     1 
ATOM   1838  O  O     . PRO A  1  244  ? 93.886  33.458  -29.908 1.00 79.84  ? 244  PRO A O     1 
ATOM   1839  C  CB    . PRO A  1  244  ? 93.408  31.156  -32.282 1.00 76.53  ? 244  PRO A CB    1 
ATOM   1840  C  CG    . PRO A  1  244  ? 93.082  31.018  -33.695 1.00 82.22  ? 244  PRO A CG    1 
ATOM   1841  C  CD    . PRO A  1  244  ? 93.750  32.137  -34.448 1.00 78.09  ? 244  PRO A CD    1 
ATOM   1842  N  N     . PRO A  1  245  ? 95.821  32.791  -30.848 1.00 75.32  ? 245  PRO A N     1 
ATOM   1843  C  CA    . PRO A  1  245  ? 96.583  33.116  -29.620 1.00 74.46  ? 245  PRO A CA    1 
ATOM   1844  C  C     . PRO A  1  245  ? 96.335  34.489  -29.002 1.00 79.29  ? 245  PRO A C     1 
ATOM   1845  O  O     . PRO A  1  245  ? 96.466  34.624  -27.780 1.00 80.23  ? 245  PRO A O     1 
ATOM   1846  C  CB    . PRO A  1  245  ? 98.047  32.960  -30.038 1.00 75.83  ? 245  PRO A CB    1 
ATOM   1847  C  CG    . PRO A  1  245  ? 98.037  32.759  -31.502 1.00 81.05  ? 245  PRO A CG    1 
ATOM   1848  C  CD    . PRO A  1  245  ? 96.712  32.194  -31.858 1.00 77.07  ? 245  PRO A CD    1 
ATOM   1849  N  N     . VAL A  1  246  ? 95.984  35.492  -29.833 1.00 74.98  ? 246  VAL A N     1 
ATOM   1850  C  CA    . VAL A  1  246  ? 95.678  36.865  -29.407 1.00 74.28  ? 246  VAL A CA    1 
ATOM   1851  C  C     . VAL A  1  246  ? 94.290  36.893  -28.716 1.00 80.72  ? 246  VAL A C     1 
ATOM   1852  O  O     . VAL A  1  246  ? 94.109  37.587  -27.715 1.00 79.69  ? 246  VAL A O     1 
ATOM   1853  C  CB    . VAL A  1  246  ? 95.747  37.872  -30.598 1.00 76.76  ? 246  VAL A CB    1 
ATOM   1854  C  CG1   . VAL A  1  246  ? 95.663  39.315  -30.116 1.00 75.95  ? 246  VAL A CG1   1 
ATOM   1855  C  CG2   . VAL A  1  246  ? 97.005  37.673  -31.414 1.00 76.21  ? 246  VAL A CG2   1 
ATOM   1856  N  N     . ARG A  1  247  ? 93.330  36.124  -29.250 1.00 79.66  ? 247  ARG A N     1 
ATOM   1857  C  CA    . ARG A  1  247  ? 91.949  36.064  -28.767 1.00 81.43  ? 247  ARG A CA    1 
ATOM   1858  C  C     . ARG A  1  247  ? 91.503  34.617  -28.426 1.00 90.89  ? 247  ARG A C     1 
ATOM   1859  O  O     . ARG A  1  247  ? 90.546  34.107  -29.041 1.00 91.44  ? 247  ARG A O     1 
ATOM   1860  C  CB    . ARG A  1  247  ? 91.017  36.713  -29.811 1.00 81.11  ? 247  ARG A CB    1 
ATOM   1861  C  CG    . ARG A  1  247  ? 91.473  36.471  -31.237 1.00 81.45  ? 247  ARG A CG    1 
ATOM   1862  C  CD    . ARG A  1  247  ? 90.555  37.097  -32.240 1.00 77.13  ? 247  ARG A CD    1 
ATOM   1863  N  NE    . ARG A  1  247  ? 90.782  36.518  -33.561 1.00 79.04  ? 247  ARG A NE    1 
ATOM   1864  C  CZ    . ARG A  1  247  ? 90.177  35.423  -34.006 1.00 97.19  ? 247  ARG A CZ    1 
ATOM   1865  N  NH1   . ARG A  1  247  ? 89.306  34.776  -33.237 1.00 88.10  ? 247  ARG A NH1   1 
ATOM   1866  N  NH2   . ARG A  1  247  ? 90.434  34.965  -35.226 1.00 84.02  ? 247  ARG A NH2   1 
ATOM   1867  N  N     . PRO A  1  248  ? 92.176  33.929  -27.453 1.00 90.10  ? 248  PRO A N     1 
ATOM   1868  C  CA    . PRO A  1  248  ? 91.803  32.539  -27.169 1.00 91.12  ? 248  PRO A CA    1 
ATOM   1869  C  C     . PRO A  1  248  ? 90.404  32.370  -26.584 1.00 102.89 ? 248  PRO A C     1 
ATOM   1870  O  O     . PRO A  1  248  ? 89.887  33.240  -25.876 1.00 102.54 ? 248  PRO A O     1 
ATOM   1871  C  CB    . PRO A  1  248  ? 92.917  32.047  -26.245 1.00 91.11  ? 248  PRO A CB    1 
ATOM   1872  C  CG    . PRO A  1  248  ? 93.468  33.250  -25.635 1.00 94.34  ? 248  PRO A CG    1 
ATOM   1873  C  CD    . PRO A  1  248  ? 93.330  34.343  -26.625 1.00 90.47  ? 248  PRO A CD    1 
ATOM   1874  N  N     . SER A  1  249  ? 89.778  31.254  -26.956 1.00 106.00 ? 249  SER A N     1 
ATOM   1875  C  CA    . SER A  1  249  ? 88.447  30.854  -26.530 1.00 109.14 ? 249  SER A CA    1 
ATOM   1876  C  C     . SER A  1  249  ? 88.561  30.165  -25.188 1.00 119.52 ? 249  SER A C     1 
ATOM   1877  O  O     . SER A  1  249  ? 89.423  29.294  -25.018 1.00 118.38 ? 249  SER A O     1 
ATOM   1878  C  CB    . SER A  1  249  ? 87.846  29.885  -27.545 1.00 113.79 ? 249  SER A CB    1 
ATOM   1879  O  OG    . SER A  1  249  ? 88.433  28.596  -27.470 1.00 123.87 ? 249  SER A OG    1 
ATOM   1880  N  N     . ILE A  1  250  ? 87.691  30.536  -24.239 1.00 122.31 ? 250  ILE A N     1 
ATOM   1881  C  CA    . ILE A  1  250  ? 87.698  29.903  -22.919 1.00 124.63 ? 250  ILE A CA    1 
ATOM   1882  C  C     . ILE A  1  250  ? 86.697  28.738  -22.899 1.00 135.14 ? 250  ILE A C     1 
ATOM   1883  O  O     . ILE A  1  250  ? 85.497  28.948  -23.095 1.00 135.62 ? 250  ILE A O     1 
ATOM   1884  C  CB    . ILE A  1  250  ? 87.516  30.891  -21.726 1.00 127.69 ? 250  ILE A CB    1 
ATOM   1885  C  CG1   . ILE A  1  250  ? 88.441  32.121  -21.843 1.00 128.06 ? 250  ILE A CG1   1 
ATOM   1886  C  CG2   . ILE A  1  250  ? 87.737  30.174  -20.389 1.00 128.12 ? 250  ILE A CG2   1 
ATOM   1887  C  CD1   . ILE A  1  250  ? 87.742  33.409  -22.309 1.00 137.96 ? 250  ILE A CD1   1 
ATOM   1888  N  N     . SER A  1  251  ? 87.206  27.510  -22.685 1.00 135.83 ? 251  SER A N     1 
ATOM   1889  C  CA    . SER A  1  251  ? 86.405  26.281  -22.606 1.00 138.02 ? 251  SER A CA    1 
ATOM   1890  C  C     . SER A  1  251  ? 85.973  26.065  -21.141 1.00 145.46 ? 251  SER A C     1 
ATOM   1891  O  O     . SER A  1  251  ? 86.799  26.235  -20.237 1.00 144.78 ? 251  SER A O     1 
ATOM   1892  C  CB    . SER A  1  251  ? 87.209  25.089  -23.125 1.00 141.41 ? 251  SER A CB    1 
ATOM   1893  O  OG    . SER A  1  251  ? 87.715  25.327  -24.430 1.00 148.26 ? 251  SER A OG    1 
ATOM   1894  N  N     . PHE A  1  252  ? 84.684  25.734  -20.900 1.00 144.76 ? 252  PHE A N     1 
ATOM   1895  C  CA    . PHE A  1  252  ? 84.199  25.574  -19.529 1.00 145.79 ? 252  PHE A CA    1 
ATOM   1896  C  C     . PHE A  1  252  ? 83.459  24.234  -19.287 1.00 154.35 ? 252  PHE A C     1 
ATOM   1897  O  O     . PHE A  1  252  ? 82.421  24.193  -18.614 1.00 154.68 ? 252  PHE A O     1 
ATOM   1898  C  CB    . PHE A  1  252  ? 83.384  26.801  -19.065 1.00 147.59 ? 252  PHE A CB    1 
ATOM   1899  C  CG    . PHE A  1  252  ? 82.326  27.399  -19.969 1.00 149.63 ? 252  PHE A CG    1 
ATOM   1900  C  CD1   . PHE A  1  252  ? 82.678  28.056  -21.142 1.00 152.50 ? 252  PHE A CD1   1 
ATOM   1901  C  CD2   . PHE A  1  252  ? 80.996  27.446  -19.569 1.00 152.22 ? 252  PHE A CD2   1 
ATOM   1902  C  CE1   . PHE A  1  252  ? 81.705  28.648  -21.952 1.00 153.92 ? 252  PHE A CE1   1 
ATOM   1903  C  CE2   . PHE A  1  252  ? 80.025  28.056  -20.372 1.00 155.53 ? 252  PHE A CE2   1 
ATOM   1904  C  CZ    . PHE A  1  252  ? 80.386  28.648  -21.560 1.00 153.51 ? 252  PHE A CZ    1 
ATOM   1905  N  N     . ASN A  1  253  ? 84.089  23.134  -19.782 1.00 153.49 ? 253  ASN A N     1 
ATOM   1906  C  CA    . ASN A  1  253  ? 83.763  21.691  -19.726 1.00 154.73 ? 253  ASN A CA    1 
ATOM   1907  C  C     . ASN A  1  253  ? 84.453  20.999  -20.915 1.00 159.82 ? 253  ASN A C     1 
ATOM   1908  O  O     . ASN A  1  253  ? 85.536  20.427  -20.754 1.00 159.21 ? 253  ASN A O     1 
ATOM   1909  C  CB    . ASN A  1  253  ? 82.246  21.387  -19.687 1.00 157.72 ? 253  ASN A CB    1 
ATOM   1910  C  CG    . ASN A  1  253  ? 81.714  20.987  -18.319 1.00 188.24 ? 253  ASN A CG    1 
ATOM   1911  O  OD1   . ASN A  1  253  ? 81.970  21.630  -17.286 1.00 181.06 ? 253  ASN A OD1   1 
ATOM   1912  N  ND2   . ASN A  1  253  ? 80.927  19.919  -18.287 1.00 183.39 ? 253  ASN A ND2   1 
ATOM   1913  N  N     . GLU A  1  254  ? 83.833  21.108  -22.109 1.00 157.19 ? 254  GLU A N     1 
ATOM   1914  C  CA    . GLU A  1  254  ? 84.254  20.619  -23.432 1.00 157.34 ? 254  GLU A CA    1 
ATOM   1915  C  C     . GLU A  1  254  ? 83.092  20.881  -24.388 1.00 160.41 ? 254  GLU A C     1 
ATOM   1916  O  O     . GLU A  1  254  ? 83.294  21.439  -25.471 1.00 160.38 ? 254  GLU A O     1 
ATOM   1917  C  CB    . GLU A  1  254  ? 84.662  19.129  -23.437 1.00 159.12 ? 254  GLU A CB    1 
ATOM   1918  C  CG    . GLU A  1  254  ? 86.077  18.895  -23.944 1.00 170.98 ? 254  GLU A CG    1 
ATOM   1919  C  CD    . GLU A  1  254  ? 86.184  18.002  -25.165 1.00 194.84 ? 254  GLU A CD    1 
ATOM   1920  O  OE1   . GLU A  1  254  ? 86.058  16.766  -25.008 1.00 192.42 ? 254  GLU A OE1   1 
ATOM   1921  O  OE2   . GLU A  1  254  ? 86.410  18.534  -26.276 1.00 187.11 ? 254  GLU A OE2   1 
ATOM   1922  N  N     . SER A  1  255  ? 81.862  20.529  -23.948 1.00 155.60 ? 255  SER A N     1 
ATOM   1923  C  CA    . SER A  1  255  ? 80.618  20.770  -24.682 1.00 155.14 ? 255  SER A CA    1 
ATOM   1924  C  C     . SER A  1  255  ? 80.170  22.248  -24.505 1.00 155.60 ? 255  SER A C     1 
ATOM   1925  O  O     . SER A  1  255  ? 79.175  22.675  -25.104 1.00 155.78 ? 255  SER A O     1 
ATOM   1926  C  CB    . SER A  1  255  ? 79.530  19.785  -24.245 1.00 159.26 ? 255  SER A CB    1 
ATOM   1927  O  OG    . SER A  1  255  ? 79.445  19.638  -22.836 1.00 167.62 ? 255  SER A OG    1 
ATOM   1928  N  N     . GLN A  1  256  ? 80.943  23.028  -23.700 1.00 148.21 ? 256  GLN A N     1 
ATOM   1929  C  CA    . GLN A  1  256  ? 80.714  24.445  -23.410 1.00 145.76 ? 256  GLN A CA    1 
ATOM   1930  C  C     . GLN A  1  256  ? 81.666  25.360  -24.195 1.00 143.59 ? 256  GLN A C     1 
ATOM   1931  O  O     . GLN A  1  256  ? 82.888  25.331  -24.013 1.00 141.78 ? 256  GLN A O     1 
ATOM   1932  C  CB    . GLN A  1  256  ? 80.743  24.717  -21.900 1.00 146.51 ? 256  GLN A CB    1 
ATOM   1933  C  CG    . GLN A  1  256  ? 79.365  24.589  -21.256 1.00 156.63 ? 256  GLN A CG    1 
ATOM   1934  C  CD    . GLN A  1  256  ? 79.384  23.739  -20.012 1.00 169.82 ? 256  GLN A CD    1 
ATOM   1935  O  OE1   . GLN A  1  256  ? 79.493  24.236  -18.878 1.00 160.42 ? 256  GLN A OE1   1 
ATOM   1936  N  NE2   . GLN A  1  256  ? 79.223  22.438  -20.204 1.00 163.38 ? 256  GLN A NE2   1 
ATOM   1937  N  N     . ARG A  1  257  ? 81.047  26.154  -25.089 1.00 136.83 ? 257  ARG A N     1 
ATOM   1938  C  CA    . ARG A  1  257  ? 81.554  27.127  -26.078 1.00 134.38 ? 257  ARG A CA    1 
ATOM   1939  C  C     . ARG A  1  257  ? 82.659  28.114  -25.569 1.00 129.40 ? 257  ARG A C     1 
ATOM   1940  O  O     . ARG A  1  257  ? 83.835  27.739  -25.514 1.00 127.08 ? 257  ARG A O     1 
ATOM   1941  C  CB    . ARG A  1  257  ? 80.348  27.905  -26.682 1.00 136.94 ? 257  ARG A CB    1 
ATOM   1942  C  CG    . ARG A  1  257  ? 79.055  27.893  -25.829 1.00 146.10 ? 257  ARG A CG    1 
ATOM   1943  C  CD    . ARG A  1  257  ? 77.932  28.736  -26.414 1.00 155.61 ? 257  ARG A CD    1 
ATOM   1944  N  NE    . ARG A  1  257  ? 77.293  28.102  -27.572 1.00 165.30 ? 257  ARG A NE    1 
ATOM   1945  C  CZ    . ARG A  1  257  ? 76.318  28.655  -28.290 1.00 181.01 ? 257  ARG A CZ    1 
ATOM   1946  N  NH1   . ARG A  1  257  ? 75.853  29.860  -27.976 1.00 169.06 ? 257  ARG A NH1   1 
ATOM   1947  N  NH2   . ARG A  1  257  ? 75.801  28.008  -29.327 1.00 167.68 ? 257  ARG A NH2   1 
ATOM   1948  N  N     . GLY A  1  258  ? 82.258  29.364  -25.304 1.00 121.26 ? 258  GLY A N     1 
ATOM   1949  C  CA    . GLY A  1  258  ? 83.072  30.453  -24.767 1.00 118.20 ? 258  GLY A CA    1 
ATOM   1950  C  C     . GLY A  1  258  ? 84.120  31.066  -25.667 1.00 115.91 ? 258  GLY A C     1 
ATOM   1951  O  O     . GLY A  1  258  ? 85.125  30.423  -25.965 1.00 115.40 ? 258  GLY A O     1 
ATOM   1952  N  N     . GLU A  1  259  ? 83.925  32.340  -26.047 1.00 107.68 ? 259  GLU A N     1 
ATOM   1953  C  CA    . GLU A  1  259  ? 84.858  33.074  -26.904 1.00 105.00 ? 259  GLU A CA    1 
ATOM   1954  C  C     . GLU A  1  259  ? 85.290  34.400  -26.295 1.00 105.20 ? 259  GLU A C     1 
ATOM   1955  O  O     . GLU A  1  259  ? 84.567  34.978  -25.481 1.00 104.74 ? 259  GLU A O     1 
ATOM   1956  C  CB    . GLU A  1  259  ? 84.291  33.289  -28.323 1.00 106.67 ? 259  GLU A CB    1 
ATOM   1957  C  CG    . GLU A  1  259  ? 84.317  32.060  -29.221 1.00 112.45 ? 259  GLU A CG    1 
ATOM   1958  C  CD    . GLU A  1  259  ? 85.664  31.541  -29.695 1.00 128.25 ? 259  GLU A CD    1 
ATOM   1959  O  OE1   . GLU A  1  259  ? 86.667  32.294  -29.655 1.00 129.42 ? 259  GLU A OE1   1 
ATOM   1960  O  OE2   . GLU A  1  259  ? 85.712  30.359  -30.106 1.00 115.03 ? 259  GLU A OE2   1 
ATOM   1961  N  N     . ASP A  1  260  ? 86.472  34.880  -26.712 1.00 98.93  ? 260  ASP A N     1 
ATOM   1962  C  CA    . ASP A  1  260  ? 87.094  36.127  -26.277 1.00 97.12  ? 260  ASP A CA    1 
ATOM   1963  C  C     . ASP A  1  260  ? 86.309  37.357  -26.741 1.00 99.51  ? 260  ASP A C     1 
ATOM   1964  O  O     . ASP A  1  260  ? 85.588  37.282  -27.727 1.00 99.73  ? 260  ASP A O     1 
ATOM   1965  C  CB    . ASP A  1  260  ? 88.516  36.189  -26.832 1.00 98.36  ? 260  ASP A CB    1 
ATOM   1966  C  CG    . ASP A  1  260  ? 89.406  37.144  -26.085 1.00 106.34 ? 260  ASP A CG    1 
ATOM   1967  O  OD1   . ASP A  1  260  ? 89.292  38.369  -26.319 1.00 105.76 ? 260  ASP A OD1   1 
ATOM   1968  O  OD2   . ASP A  1  260  ? 90.216  36.672  -25.263 1.00 113.02 ? 260  ASP A OD2   1 
ATOM   1969  N  N     . ASP A  1  261  ? 86.469  38.491  -26.044 1.00 95.01  ? 261  ASP A N     1 
ATOM   1970  C  CA    . ASP A  1  261  ? 85.808  39.747  -26.391 1.00 95.45  ? 261  ASP A CA    1 
ATOM   1971  C  C     . ASP A  1  261  ? 86.154  40.171  -27.817 1.00 97.84  ? 261  ASP A C     1 
ATOM   1972  O  O     . ASP A  1  261  ? 85.257  40.552  -28.572 1.00 99.08  ? 261  ASP A O     1 
ATOM   1973  C  CB    . ASP A  1  261  ? 86.206  40.863  -25.407 1.00 97.73  ? 261  ASP A CB    1 
ATOM   1974  C  CG    . ASP A  1  261  ? 85.324  40.994  -24.177 1.00 116.44 ? 261  ASP A CG    1 
ATOM   1975  O  OD1   . ASP A  1  261  ? 84.727  39.971  -23.758 1.00 119.34 ? 261  ASP A OD1   1 
ATOM   1976  O  OD2   . ASP A  1  261  ? 85.256  42.114  -23.610 1.00 121.92 ? 261  ASP A OD2   1 
ATOM   1977  N  N     . LEU A  1  262  ? 87.451  40.070  -28.192 1.00 90.86  ? 262  LEU A N     1 
ATOM   1978  C  CA    . LEU A  1  262  ? 87.949  40.444  -29.517 1.00 89.07  ? 262  LEU A CA    1 
ATOM   1979  C  C     . LEU A  1  262  ? 87.305  39.634  -30.620 1.00 92.04  ? 262  LEU A C     1 
ATOM   1980  O  O     . LEU A  1  262  ? 87.012  40.197  -31.672 1.00 92.36  ? 262  LEU A O     1 
ATOM   1981  C  CB    . LEU A  1  262  ? 89.484  40.374  -29.601 1.00 87.69  ? 262  LEU A CB    1 
ATOM   1982  C  CG    . LEU A  1  262  ? 90.291  41.409  -28.800 1.00 90.68  ? 262  LEU A CG    1 
ATOM   1983  C  CD1   . LEU A  1  262  ? 91.726  41.416  -29.246 1.00 90.00  ? 262  LEU A CD1   1 
ATOM   1984  C  CD2   . LEU A  1  262  ? 89.732  42.829  -28.956 1.00 93.13  ? 262  LEU A CD2   1 
ATOM   1985  N  N     . THR A  1  263  ? 87.038  38.332  -30.370 1.00 87.13  ? 263  THR A N     1 
ATOM   1986  C  CA    . THR A  1  263  ? 86.365  37.450  -31.329 1.00 86.75  ? 263  THR A CA    1 
ATOM   1987  C  C     . THR A  1  263  ? 84.939  37.955  -31.589 1.00 90.55  ? 263  THR A C     1 
ATOM   1988  O  O     . THR A  1  263  ? 84.546  38.108  -32.742 1.00 91.35  ? 263  THR A O     1 
ATOM   1989  C  CB    . THR A  1  263  ? 86.448  35.985  -30.887 1.00 90.27  ? 263  THR A CB    1 
ATOM   1990  O  OG1   . THR A  1  263  ? 87.827  35.621  -30.722 1.00 90.16  ? 263  THR A OG1   1 
ATOM   1991  C  CG2   . THR A  1  263  ? 85.779  35.042  -31.876 1.00 86.78  ? 263  THR A CG2   1 
ATOM   1992  N  N     . PHE A  1  264  ? 84.207  38.293  -30.527 1.00 86.49  ? 264  PHE A N     1 
ATOM   1993  C  CA    . PHE A  1  264  ? 82.860  38.818  -30.655 1.00 87.61  ? 264  PHE A CA    1 
ATOM   1994  C  C     . PHE A  1  264  ? 82.820  40.164  -31.363 1.00 91.26  ? 264  PHE A C     1 
ATOM   1995  O  O     . PHE A  1  264  ? 81.916  40.378  -32.174 1.00 92.59  ? 264  PHE A O     1 
ATOM   1996  C  CB    . PHE A  1  264  ? 82.142  38.864  -29.298 1.00 90.10  ? 264  PHE A CB    1 
ATOM   1997  C  CG    . PHE A  1  264  ? 81.823  37.510  -28.682 1.00 92.65  ? 264  PHE A CG    1 
ATOM   1998  C  CD1   . PHE A  1  264  ? 81.170  36.522  -29.421 1.00 96.31  ? 264  PHE A CD1   1 
ATOM   1999  C  CD2   . PHE A  1  264  ? 82.130  37.242  -27.348 1.00 95.17  ? 264  PHE A CD2   1 
ATOM   2000  C  CE1   . PHE A  1  264  ? 80.867  35.280  -28.849 1.00 97.24  ? 264  PHE A CE1   1 
ATOM   2001  C  CE2   . PHE A  1  264  ? 81.818  36.000  -26.775 1.00 97.93  ? 264  PHE A CE2   1 
ATOM   2002  C  CZ    . PHE A  1  264  ? 81.184  35.032  -27.528 1.00 96.46  ? 264  PHE A CZ    1 
ATOM   2003  N  N     . LYS A  1  265  ? 83.817  41.052  -31.109 1.00 85.64  ? 265  LYS A N     1 
ATOM   2004  C  CA    . LYS A  1  265  ? 83.870  42.363  -31.767 1.00 85.10  ? 265  LYS A CA    1 
ATOM   2005  C  C     . LYS A  1  265  ? 84.278  42.239  -33.199 1.00 88.49  ? 265  LYS A C     1 
ATOM   2006  O  O     . LYS A  1  265  ? 83.831  43.047  -34.010 1.00 89.70  ? 265  LYS A O     1 
ATOM   2007  C  CB    . LYS A  1  265  ? 84.705  43.393  -31.007 1.00 86.97  ? 265  LYS A CB    1 
ATOM   2008  C  CG    . LYS A  1  265  ? 83.861  44.148  -29.981 1.00 122.10 ? 265  LYS A CG    1 
ATOM   2009  C  CD    . LYS A  1  265  ? 83.280  43.208  -28.838 1.00 144.57 ? 265  LYS A CD    1 
ATOM   2010  C  CE    . LYS A  1  265  ? 81.795  42.839  -28.917 1.00 154.29 ? 265  LYS A CE    1 
ATOM   2011  N  NZ    . LYS A  1  265  ? 81.378  41.842  -27.884 1.00 151.73 ? 265  LYS A NZ    1 
ATOM   2012  N  N     . LEU A  1  266  ? 85.040  41.179  -33.547 1.00 82.49  ? 266  LEU A N     1 
ATOM   2013  C  CA    . LEU A  1  266  ? 85.387  40.945  -34.943 1.00 81.63  ? 266  LEU A CA    1 
ATOM   2014  C  C     . LEU A  1  266  ? 84.133  40.470  -35.662 1.00 86.44  ? 266  LEU A C     1 
ATOM   2015  O  O     . LEU A  1  266  ? 83.843  40.965  -36.750 1.00 87.98  ? 266  LEU A O     1 
ATOM   2016  C  CB    . LEU A  1  266  ? 86.581  39.990  -35.127 1.00 80.21  ? 266  LEU A CB    1 
ATOM   2017  C  CG    . LEU A  1  266  ? 87.957  40.601  -34.820 1.00 82.82  ? 266  LEU A CG    1 
ATOM   2018  C  CD1   . LEU A  1  266  ? 88.973  39.547  -34.630 1.00 82.18  ? 266  LEU A CD1   1 
ATOM   2019  C  CD2   . LEU A  1  266  ? 88.410  41.567  -35.892 1.00 83.66  ? 266  LEU A CD2   1 
ATOM   2020  N  N     . ALA A  1  267  ? 83.315  39.632  -34.994 1.00 80.90  ? 267  ALA A N     1 
ATOM   2021  C  CA    . ALA A  1  267  ? 82.059  39.168  -35.559 1.00 81.05  ? 267  ALA A CA    1 
ATOM   2022  C  C     . ALA A  1  267  ? 81.121  40.352  -35.772 1.00 85.88  ? 267  ALA A C     1 
ATOM   2023  O  O     . ALA A  1  267  ? 80.458  40.406  -36.794 1.00 85.78  ? 267  ALA A O     1 
ATOM   2024  C  CB    . ALA A  1  267  ? 81.425  38.142  -34.650 1.00 81.48  ? 267  ALA A CB    1 
ATOM   2025  N  N     . ASP A  1  268  ? 81.119  41.330  -34.845 1.00 83.44  ? 268  ASP A N     1 
ATOM   2026  C  CA    . ASP A  1  268  ? 80.299  42.544  -34.947 1.00 84.46  ? 268  ASP A CA    1 
ATOM   2027  C  C     . ASP A  1  268  ? 80.735  43.409  -36.128 1.00 86.99  ? 268  ASP A C     1 
ATOM   2028  O  O     . ASP A  1  268  ? 79.870  43.886  -36.870 1.00 87.10  ? 268  ASP A O     1 
ATOM   2029  C  CB    . ASP A  1  268  ? 80.320  43.348  -33.633 1.00 86.45  ? 268  ASP A CB    1 
ATOM   2030  C  CG    . ASP A  1  268  ? 79.452  42.782  -32.522 1.00 103.70 ? 268  ASP A CG    1 
ATOM   2031  O  OD1   . ASP A  1  268  ? 78.516  41.998  -32.832 1.00 106.11 ? 268  ASP A OD1   1 
ATOM   2032  O  OD2   . ASP A  1  268  ? 79.679  43.151  -31.344 1.00 110.35 ? 268  ASP A OD2   1 
ATOM   2033  N  N     . ILE A  1  269  ? 82.077  43.586  -36.313 1.00 81.74  ? 269  ILE A N     1 
ATOM   2034  C  CA    . ILE A  1  269  ? 82.669  44.334  -37.435 1.00 81.57  ? 269  ILE A CA    1 
ATOM   2035  C  C     . ILE A  1  269  ? 82.208  43.634  -38.712 1.00 86.09  ? 269  ILE A C     1 
ATOM   2036  O  O     . ILE A  1  269  ? 81.587  44.258  -39.573 1.00 87.37  ? 269  ILE A O     1 
ATOM   2037  C  CB    . ILE A  1  269  ? 84.231  44.426  -37.373 1.00 83.25  ? 269  ILE A CB    1 
ATOM   2038  C  CG1   . ILE A  1  269  ? 84.723  45.340  -36.236 1.00 82.57  ? 269  ILE A CG1   1 
ATOM   2039  C  CG2   . ILE A  1  269  ? 84.820  44.892  -38.718 1.00 83.85  ? 269  ILE A CG2   1 
ATOM   2040  C  CD1   . ILE A  1  269  ? 86.137  44.930  -35.685 1.00 86.16  ? 269  ILE A CD1   1 
ATOM   2041  N  N     . LEU A  1  270  ? 82.462  42.326  -38.784 1.00 81.39  ? 270  LEU A N     1 
ATOM   2042  C  CA    . LEU A  1  270  ? 82.094  41.455  -39.888 1.00 82.13  ? 270  LEU A CA    1 
ATOM   2043  C  C     . LEU A  1  270  ? 80.588  41.577  -40.200 1.00 88.64  ? 270  LEU A C     1 
ATOM   2044  O  O     . LEU A  1  270  ? 80.233  41.871  -41.339 1.00 88.97  ? 270  LEU A O     1 
ATOM   2045  C  CB    . LEU A  1  270  ? 82.492  40.022  -39.504 1.00 81.25  ? 270  LEU A CB    1 
ATOM   2046  C  CG    . LEU A  1  270  ? 82.736  38.964  -40.572 1.00 86.20  ? 270  LEU A CG    1 
ATOM   2047  C  CD1   . LEU A  1  270  ? 83.210  39.543  -41.866 1.00 86.70  ? 270  LEU A CD1   1 
ATOM   2048  C  CD2   . LEU A  1  270  ? 83.743  37.963  -40.079 1.00 87.96  ? 270  LEU A CD2   1 
ATOM   2049  N  N     . LYS A  1  271  ? 79.722  41.466  -39.176 1.00 86.46  ? 271  LYS A N     1 
ATOM   2050  C  CA    . LYS A  1  271  ? 78.272  41.589  -39.328 1.00 88.20  ? 271  LYS A CA    1 
ATOM   2051  C  C     . LYS A  1  271  ? 77.871  42.956  -39.918 1.00 94.73  ? 271  LYS A C     1 
ATOM   2052  O  O     . LYS A  1  271  ? 77.091  42.993  -40.879 1.00 95.71  ? 271  LYS A O     1 
ATOM   2053  C  CB    . LYS A  1  271  ? 77.547  41.309  -37.997 1.00 89.98  ? 271  LYS A CB    1 
ATOM   2054  C  CG    . LYS A  1  271  ? 77.409  39.824  -37.656 1.00 94.71  ? 271  LYS A CG    1 
ATOM   2055  C  CD    . LYS A  1  271  ? 76.858  39.615  -36.241 1.00 96.66  ? 271  LYS A CD    1 
ATOM   2056  C  CE    . LYS A  1  271  ? 76.814  38.160  -35.852 1.00 96.89  ? 271  LYS A CE    1 
ATOM   2057  N  NZ    . LYS A  1  271  ? 76.368  37.987  -34.451 1.00 103.78 ? 271  LYS A NZ    1 
ATOM   2058  N  N     . ALA A  1  272  ? 78.449  44.064  -39.376 1.00 91.21  ? 272  ALA A N     1 
ATOM   2059  C  CA    . ALA A  1  272  ? 78.208  45.444  -39.834 1.00 92.09  ? 272  ALA A CA    1 
ATOM   2060  C  C     . ALA A  1  272  ? 78.680  45.661  -41.279 1.00 96.43  ? 272  ALA A C     1 
ATOM   2061  O  O     . ALA A  1  272  ? 78.093  46.470  -42.006 1.00 96.84  ? 272  ALA A O     1 
ATOM   2062  C  CB    . ALA A  1  272  ? 78.903  46.434  -38.910 1.00 92.09  ? 272  ALA A CB    1 
ATOM   2063  N  N     . ASN A  1  273  ? 79.752  44.935  -41.672 1.00 92.12  ? 273  ASN A N     1 
ATOM   2064  C  CA    . ASN A  1  273  ? 80.367  44.957  -42.996 1.00 92.17  ? 273  ASN A CA    1 
ATOM   2065  C  C     . ASN A  1  273  ? 79.514  44.195  -43.997 1.00 97.34  ? 273  ASN A C     1 
ATOM   2066  O  O     . ASN A  1  273  ? 79.362  44.656  -45.122 1.00 98.39  ? 273  ASN A O     1 
ATOM   2067  C  CB    . ASN A  1  273  ? 81.765  44.351  -42.937 1.00 90.49  ? 273  ASN A CB    1 
ATOM   2068  C  CG    . ASN A  1  273  ? 82.608  44.635  -44.145 1.00 110.68 ? 273  ASN A CG    1 
ATOM   2069  O  OD1   . ASN A  1  273  ? 82.879  45.788  -44.468 1.00 100.78 ? 273  ASN A OD1   1 
ATOM   2070  N  ND2   . ASN A  1  273  ? 83.082  43.586  -44.809 1.00 104.75 ? 273  ASN A ND2   1 
ATOM   2071  N  N     . ILE A  1  274  ? 78.972  43.026  -43.602 1.00 94.07  ? 274  ILE A N     1 
ATOM   2072  C  CA    . ILE A  1  274  ? 78.116  42.207  -44.464 1.00 95.24  ? 274  ILE A CA    1 
ATOM   2073  C  C     . ILE A  1  274  ? 76.856  42.997  -44.825 1.00 102.87 ? 274  ILE A C     1 
ATOM   2074  O  O     . ILE A  1  274  ? 76.487  43.015  -45.997 1.00 104.05 ? 274  ILE A O     1 
ATOM   2075  C  CB    . ILE A  1  274  ? 77.825  40.799  -43.863 1.00 97.28  ? 274  ILE A CB    1 
ATOM   2076  C  CG1   . ILE A  1  274  ? 79.123  39.981  -43.759 1.00 96.50  ? 274  ILE A CG1   1 
ATOM   2077  C  CG2   . ILE A  1  274  ? 76.791  40.025  -44.699 1.00 98.85  ? 274  ILE A CG2   1 
ATOM   2078  C  CD1   . ILE A  1  274  ? 79.180  38.981  -42.625 1.00 102.93 ? 274  ILE A CD1   1 
ATOM   2079  N  N     . SER A  1  275  ? 76.243  43.697  -43.841 1.00 100.78 ? 275  SER A N     1 
ATOM   2080  C  CA    . SER A  1  275  ? 75.055  44.521  -44.067 1.00 102.65 ? 275  SER A CA    1 
ATOM   2081  C  C     . SER A  1  275  ? 75.370  45.650  -45.046 1.00 108.99 ? 275  SER A C     1 
ATOM   2082  O  O     . SER A  1  275  ? 74.639  45.811  -46.019 1.00 111.28 ? 275  SER A O     1 
ATOM   2083  C  CB    . SER A  1  275  ? 74.501  45.071  -42.752 1.00 106.78 ? 275  SER A CB    1 
ATOM   2084  O  OG    . SER A  1  275  ? 74.846  46.429  -42.506 1.00 117.61 ? 275  SER A OG    1 
ATOM   2085  N  N     . LEU A  1  276  ? 76.481  46.387  -44.820 1.00 104.55 ? 276  LEU A N     1 
ATOM   2086  C  CA    . LEU A  1  276  ? 76.921  47.497  -45.665 1.00 105.05 ? 276  LEU A CA    1 
ATOM   2087  C  C     . LEU A  1  276  ? 77.139  47.092  -47.128 1.00 112.33 ? 276  LEU A C     1 
ATOM   2088  O  O     . LEU A  1  276  ? 76.671  47.798  -48.018 1.00 113.44 ? 276  LEU A O     1 
ATOM   2089  C  CB    . LEU A  1  276  ? 78.165  48.165  -45.067 1.00 103.56 ? 276  LEU A CB    1 
ATOM   2090  C  CG    . LEU A  1  276  ? 78.713  49.413  -45.756 1.00 108.60 ? 276  LEU A CG    1 
ATOM   2091  C  CD1   . LEU A  1  276  ? 77.665  50.520  -45.866 1.00 109.64 ? 276  LEU A CD1   1 
ATOM   2092  C  CD2   . LEU A  1  276  ? 79.926  49.925  -45.023 1.00 109.98 ? 276  LEU A CD2   1 
ATOM   2093  N  N     . GLU A  1  277  ? 77.802  45.946  -47.371 1.00 110.31 ? 277  GLU A N     1 
ATOM   2094  C  CA    . GLU A  1  277  ? 78.057  45.412  -48.713 1.00 112.12 ? 277  GLU A CA    1 
ATOM   2095  C  C     . GLU A  1  277  ? 76.739  44.966  -49.375 1.00 118.70 ? 277  GLU A C     1 
ATOM   2096  O  O     . GLU A  1  277  ? 76.578  45.151  -50.586 1.00 120.13 ? 277  GLU A O     1 
ATOM   2097  C  CB    . GLU A  1  277  ? 79.062  44.246  -48.646 1.00 112.77 ? 277  GLU A CB    1 
ATOM   2098  C  CG    . GLU A  1  277  ? 79.548  43.735  -49.999 1.00 128.94 ? 277  GLU A CG    1 
ATOM   2099  C  CD    . GLU A  1  277  ? 79.242  42.279  -50.319 1.00 157.66 ? 277  GLU A CD    1 
ATOM   2100  O  OE1   . GLU A  1  277  ? 79.402  41.411  -49.425 1.00 150.10 ? 277  GLU A OE1   1 
ATOM   2101  O  OE2   . GLU A  1  277  ? 78.884  42.000  -51.487 1.00 153.10 ? 277  GLU A OE2   1 
ATOM   2102  N  N     . THR A  1  278  ? 75.803  44.388  -48.574 1.00 114.95 ? 278  THR A N     1 
ATOM   2103  C  CA    . THR A  1  278  ? 74.486  43.923  -49.028 1.00 115.75 ? 278  THR A CA    1 
ATOM   2104  C  C     . THR A  1  278  ? 73.662  45.115  -49.508 1.00 121.53 ? 278  THR A C     1 
ATOM   2105  O  O     . THR A  1  278  ? 73.249  45.101  -50.660 1.00 122.65 ? 278  THR A O     1 
ATOM   2106  C  CB    . THR A  1  278  ? 73.794  43.029  -47.966 1.00 119.62 ? 278  THR A CB    1 
ATOM   2107  O  OG1   . THR A  1  278  ? 74.380  41.723  -47.978 1.00 115.71 ? 278  THR A OG1   1 
ATOM   2108  C  CG2   . THR A  1  278  ? 72.298  42.895  -48.183 1.00 119.09 ? 278  THR A CG2   1 
ATOM   2109  N  N     . LEU A  1  279  ? 73.483  46.163  -48.665 1.00 118.55 ? 279  LEU A N     1 
ATOM   2110  C  CA    . LEU A  1  279  ? 72.729  47.378  -49.020 1.00 120.28 ? 279  LEU A CA    1 
ATOM   2111  C  C     . LEU A  1  279  ? 73.286  48.059  -50.265 1.00 129.61 ? 279  LEU A C     1 
ATOM   2112  O  O     . LEU A  1  279  ? 72.513  48.583  -51.067 1.00 130.59 ? 279  LEU A O     1 
ATOM   2113  C  CB    . LEU A  1  279  ? 72.677  48.400  -47.867 1.00 118.98 ? 279  LEU A CB    1 
ATOM   2114  C  CG    . LEU A  1  279  ? 72.111  47.963  -46.520 1.00 121.65 ? 279  LEU A CG    1 
ATOM   2115  C  CD1   . LEU A  1  279  ? 72.113  49.114  -45.550 1.00 120.99 ? 279  LEU A CD1   1 
ATOM   2116  C  CD2   . LEU A  1  279  ? 70.708  47.413  -46.644 1.00 124.88 ? 279  LEU A CD2   1 
ATOM   2117  N  N     . GLU A  1  280  ? 74.627  48.033  -50.423 1.00 129.23 ? 280  GLU A N     1 
ATOM   2118  C  CA    . GLU A  1  280  ? 75.349  48.624  -51.550 1.00 131.79 ? 280  GLU A CA    1 
ATOM   2119  C  C     . GLU A  1  280  ? 75.046  47.933  -52.884 1.00 142.86 ? 280  GLU A C     1 
ATOM   2120  O  O     . GLU A  1  280  ? 74.532  48.589  -53.795 1.00 143.86 ? 280  GLU A O     1 
ATOM   2121  C  CB    . GLU A  1  280  ? 76.862  48.673  -51.276 1.00 131.53 ? 280  GLU A CB    1 
ATOM   2122  C  CG    . GLU A  1  280  ? 77.280  49.878  -50.457 1.00 139.21 ? 280  GLU A CG    1 
ATOM   2123  C  CD    . GLU A  1  280  ? 78.751  50.227  -50.541 1.00 156.54 ? 280  GLU A CD    1 
ATOM   2124  O  OE1   . GLU A  1  280  ? 79.194  50.676  -51.622 1.00 152.68 ? 280  GLU A OE1   1 
ATOM   2125  O  OE2   . GLU A  1  280  ? 79.457  50.076  -49.518 1.00 146.20 ? 280  GLU A OE2   1 
ATOM   2126  N  N     . HIS A  1  281  ? 75.350  46.616  -52.990 1.00 143.64 ? 281  HIS A N     1 
ATOM   2127  C  CA    . HIS A  1  281  ? 75.138  45.812  -54.203 1.00 146.95 ? 281  HIS A CA    1 
ATOM   2128  C  C     . HIS A  1  281  ? 73.667  45.636  -54.564 1.00 153.80 ? 281  HIS A C     1 
ATOM   2129  O  O     . HIS A  1  281  ? 73.345  45.530  -55.751 1.00 154.97 ? 281  HIS A O     1 
ATOM   2130  C  CB    . HIS A  1  281  ? 75.852  44.459  -54.117 1.00 147.84 ? 281  HIS A CB    1 
ATOM   2131  C  CG    . HIS A  1  281  ? 77.346  44.543  -54.256 1.00 151.40 ? 281  HIS A CG    1 
ATOM   2132  N  ND1   . HIS A  1  281  ? 77.955  44.668  -55.500 1.00 154.48 ? 281  HIS A ND1   1 
ATOM   2133  C  CD2   . HIS A  1  281  ? 78.310  44.489  -53.303 1.00 152.04 ? 281  HIS A CD2   1 
ATOM   2134  C  CE1   . HIS A  1  281  ? 79.258  44.704  -55.259 1.00 152.94 ? 281  HIS A CE1   1 
ATOM   2135  N  NE2   . HIS A  1  281  ? 79.521  44.590  -53.954 1.00 151.78 ? 281  HIS A NE2   1 
ATOM   2136  N  N     . ASN A  1  282  ? 72.777  45.628  -53.548 1.00 151.05 ? 282  ASN A N     1 
ATOM   2137  C  CA    . ASN A  1  282  ? 71.326  45.547  -53.735 1.00 152.67 ? 282  ASN A CA    1 
ATOM   2138  C  C     . ASN A  1  282  ? 70.789  46.968  -53.952 1.00 159.31 ? 282  ASN A C     1 
ATOM   2139  O  O     . ASN A  1  282  ? 71.580  47.901  -54.144 1.00 158.55 ? 282  ASN A O     1 
ATOM   2140  C  CB    . ASN A  1  282  ? 70.643  44.891  -52.519 1.00 151.54 ? 282  ASN A CB    1 
ATOM   2141  C  CG    . ASN A  1  282  ? 70.932  43.421  -52.313 1.00 171.91 ? 282  ASN A CG    1 
ATOM   2142  O  OD1   . ASN A  1  282  ? 71.541  42.735  -53.149 1.00 166.35 ? 282  ASN A OD1   1 
ATOM   2143  N  ND2   . ASN A  1  282  ? 70.465  42.895  -51.190 1.00 161.70 ? 282  ASN A ND2   1 
ATOM   2144  N  N     . GLY A  1  283  ? 69.460  47.111  -53.930 1.00 158.36 ? 283  GLY A N     1 
ATOM   2145  C  CA    . GLY A  1  283  ? 68.769  48.386  -54.087 1.00 159.69 ? 283  GLY A CA    1 
ATOM   2146  C  C     . GLY A  1  283  ? 69.245  49.389  -53.059 1.00 162.68 ? 283  GLY A C     1 
ATOM   2147  O  O     . GLY A  1  283  ? 68.797  49.358  -51.910 1.00 161.44 ? 283  GLY A O     1 
ATOM   2148  N  N     . ALA A  1  284  ? 70.221  50.228  -53.469 1.00 159.03 ? 284  ALA A N     1 
ATOM   2149  C  CA    . ALA A  1  284  ? 70.876  51.260  -52.668 1.00 157.82 ? 284  ALA A CA    1 
ATOM   2150  C  C     . ALA A  1  284  ? 69.853  52.268  -52.101 1.00 162.57 ? 284  ALA A C     1 
ATOM   2151  O  O     . ALA A  1  284  ? 69.339  53.095  -52.862 1.00 164.17 ? 284  ALA A O     1 
ATOM   2152  C  CB    . ALA A  1  284  ? 71.927  51.972  -53.513 1.00 158.83 ? 284  ALA A CB    1 
ATOM   2153  N  N     . PRO A  1  285  ? 69.511  52.203  -50.785 1.00 157.45 ? 285  PRO A N     1 
ATOM   2154  C  CA    . PRO A  1  285  ? 68.501  53.125  -50.243 1.00 157.73 ? 285  PRO A CA    1 
ATOM   2155  C  C     . PRO A  1  285  ? 69.052  54.482  -49.785 1.00 161.41 ? 285  PRO A C     1 
ATOM   2156  O  O     . PRO A  1  285  ? 68.326  55.234  -49.137 1.00 161.16 ? 285  PRO A O     1 
ATOM   2157  C  CB    . PRO A  1  285  ? 67.855  52.318  -49.104 1.00 158.55 ? 285  PRO A CB    1 
ATOM   2158  C  CG    . PRO A  1  285  ? 68.706  51.046  -48.956 1.00 161.84 ? 285  PRO A CG    1 
ATOM   2159  C  CD    . PRO A  1  285  ? 69.964  51.272  -49.738 1.00 157.23 ? 285  PRO A CD    1 
ATOM   2160  N  N     . HIS A  1  286  ? 70.318  54.811  -50.172 1.00 157.98 ? 286  HIS A N     1 
ATOM   2161  C  CA    . HIS A  1  286  ? 71.080  56.061  -49.949 1.00 157.93 ? 286  HIS A CA    1 
ATOM   2162  C  C     . HIS A  1  286  ? 71.270  56.473  -48.466 1.00 158.24 ? 286  HIS A C     1 
ATOM   2163  O  O     . HIS A  1  286  ? 72.410  56.539  -48.019 1.00 156.57 ? 286  HIS A O     1 
ATOM   2164  C  CB    . HIS A  1  286  ? 70.528  57.265  -50.762 1.00 161.45 ? 286  HIS A CB    1 
ATOM   2165  C  CG    . HIS A  1  286  ? 69.553  56.927  -51.860 1.00 167.35 ? 286  HIS A CG    1 
ATOM   2166  N  ND1   . HIS A  1  286  ? 69.965  56.311  -53.035 1.00 170.05 ? 286  HIS A ND1   1 
ATOM   2167  C  CD2   . HIS A  1  286  ? 68.217  57.148  -51.931 1.00 170.80 ? 286  HIS A CD2   1 
ATOM   2168  C  CE1   . HIS A  1  286  ? 68.871  56.168  -53.771 1.00 171.16 ? 286  HIS A CE1   1 
ATOM   2169  N  NE2   . HIS A  1  286  ? 67.795  56.657  -53.149 1.00 172.00 ? 286  HIS A NE2   1 
ATOM   2170  N  N     . HIS A  1  287  ? 70.175  56.789  -47.735 1.00 153.60 ? 287  HIS A N     1 
ATOM   2171  C  CA    . HIS A  1  287  ? 70.162  57.242  -46.329 1.00 151.49 ? 287  HIS A CA    1 
ATOM   2172  C  C     . HIS A  1  287  ? 70.155  56.098  -45.299 1.00 148.52 ? 287  HIS A C     1 
ATOM   2173  O  O     . HIS A  1  287  ? 70.102  56.348  -44.091 1.00 146.05 ? 287  HIS A O     1 
ATOM   2174  C  CB    . HIS A  1  287  ? 69.003  58.231  -46.064 1.00 154.35 ? 287  HIS A CB    1 
ATOM   2175  C  CG    . HIS A  1  287  ? 67.972  58.291  -47.157 1.00 160.32 ? 287  HIS A CG    1 
ATOM   2176  N  ND1   . HIS A  1  287  ? 68.189  59.021  -48.318 1.00 163.62 ? 287  HIS A ND1   1 
ATOM   2177  C  CD2   . HIS A  1  287  ? 66.753  57.704  -47.233 1.00 163.29 ? 287  HIS A CD2   1 
ATOM   2178  C  CE1   . HIS A  1  287  ? 67.102  58.853  -49.057 1.00 164.76 ? 287  HIS A CE1   1 
ATOM   2179  N  NE2   . HIS A  1  287  ? 66.209  58.071  -48.447 1.00 164.92 ? 287  HIS A NE2   1 
ATOM   2180  N  N     . ALA A  1  288  ? 70.208  54.853  -45.793 1.00 142.39 ? 288  ALA A N     1 
ATOM   2181  C  CA    . ALA A  1  288  ? 70.277  53.625  -45.008 1.00 139.79 ? 288  ALA A CA    1 
ATOM   2182  C  C     . ALA A  1  288  ? 71.698  53.118  -45.105 1.00 140.37 ? 288  ALA A C     1 
ATOM   2183  O  O     . ALA A  1  288  ? 72.150  52.357  -44.247 1.00 138.57 ? 288  ALA A O     1 
ATOM   2184  C  CB    . ALA A  1  288  ? 69.325  52.589  -45.572 1.00 141.21 ? 288  ALA A CB    1 
ATOM   2185  N  N     . ILE A  1  289  ? 72.403  53.549  -46.159 1.00 136.10 ? 289  ILE A N     1 
ATOM   2186  C  CA    . ILE A  1  289  ? 73.797  53.212  -46.399 1.00 134.69 ? 289  ILE A CA    1 
ATOM   2187  C  C     . ILE A  1  289  ? 74.670  54.013  -45.424 1.00 137.00 ? 289  ILE A C     1 
ATOM   2188  O  O     . ILE A  1  289  ? 75.450  53.414  -44.681 1.00 135.22 ? 289  ILE A O     1 
ATOM   2189  C  CB    . ILE A  1  289  ? 74.185  53.447  -47.882 1.00 139.04 ? 289  ILE A CB    1 
ATOM   2190  C  CG1   . ILE A  1  289  ? 73.388  52.520  -48.817 1.00 140.63 ? 289  ILE A CG1   1 
ATOM   2191  C  CG2   . ILE A  1  289  ? 75.698  53.274  -48.095 1.00 139.09 ? 289  ILE A CG2   1 
ATOM   2192  C  CD1   . ILE A  1  289  ? 73.323  52.994  -50.253 1.00 150.60 ? 289  ILE A CD1   1 
ATOM   2193  N  N     . GLU A  1  290  ? 74.504  55.360  -45.400 1.00 133.72 ? 290  GLU A N     1 
ATOM   2194  C  CA    . GLU A  1  290  ? 75.254  56.275  -44.524 1.00 132.45 ? 290  GLU A CA    1 
ATOM   2195  C  C     . GLU A  1  290  ? 75.031  55.989  -43.032 1.00 133.62 ? 290  GLU A C     1 
ATOM   2196  O  O     . GLU A  1  290  ? 75.801  56.470  -42.200 1.00 132.75 ? 290  GLU A O     1 
ATOM   2197  C  CB    . GLU A  1  290  ? 75.012  57.763  -44.868 1.00 135.23 ? 290  GLU A CB    1 
ATOM   2198  C  CG    . GLU A  1  290  ? 73.565  58.167  -45.115 1.00 150.54 ? 290  GLU A CG    1 
ATOM   2199  C  CD    . GLU A  1  290  ? 73.309  59.055  -46.324 1.00 179.38 ? 290  GLU A CD    1 
ATOM   2200  O  OE1   . GLU A  1  290  ? 74.058  58.952  -47.324 1.00 177.55 ? 290  GLU A OE1   1 
ATOM   2201  O  OE2   . GLU A  1  290  ? 72.311  59.811  -46.295 1.00 175.16 ? 290  GLU A OE2   1 
ATOM   2202  N  N     . GLU A  1  291  ? 74.015  55.164  -42.715 1.00 128.50 ? 291  GLU A N     1 
ATOM   2203  C  CA    . GLU A  1  291  ? 73.683  54.705  -41.370 1.00 126.55 ? 291  GLU A CA    1 
ATOM   2204  C  C     . GLU A  1  291  ? 74.451  53.400  -41.083 1.00 127.10 ? 291  GLU A C     1 
ATOM   2205  O  O     . GLU A  1  291  ? 74.972  53.229  -39.976 1.00 125.20 ? 291  GLU A O     1 
ATOM   2206  C  CB    . GLU A  1  291  ? 72.168  54.480  -41.246 1.00 128.94 ? 291  GLU A CB    1 
ATOM   2207  C  CG    . GLU A  1  291  ? 71.667  54.471  -39.811 1.00 139.98 ? 291  GLU A CG    1 
ATOM   2208  C  CD    . GLU A  1  291  ? 70.185  54.204  -39.621 1.00 164.22 ? 291  GLU A CD    1 
ATOM   2209  O  OE1   . GLU A  1  291  ? 69.364  54.827  -40.335 1.00 166.22 ? 291  GLU A OE1   1 
ATOM   2210  O  OE2   . GLU A  1  291  ? 69.845  53.389  -38.732 1.00 150.10 ? 291  GLU A OE2   1 
ATOM   2211  N  N     . ALA A  1  292  ? 74.520  52.489  -42.083 1.00 122.55 ? 292  ALA A N     1 
ATOM   2212  C  CA    . ALA A  1  292  ? 75.213  51.197  -41.988 1.00 120.46 ? 292  ALA A CA    1 
ATOM   2213  C  C     . ALA A  1  292  ? 76.722  51.373  -42.018 1.00 120.51 ? 292  ALA A C     1 
ATOM   2214  O  O     . ALA A  1  292  ? 77.441  50.559  -41.425 1.00 118.23 ? 292  ALA A O     1 
ATOM   2215  C  CB    . ALA A  1  292  ? 74.779  50.286  -43.122 1.00 122.17 ? 292  ALA A CB    1 
ATOM   2216  N  N     . GLU A  1  293  ? 77.193  52.433  -42.732 1.00 115.98 ? 293  GLU A N     1 
ATOM   2217  C  CA    . GLU A  1  293  ? 78.603  52.814  -42.883 1.00 114.06 ? 293  GLU A CA    1 
ATOM   2218  C  C     . GLU A  1  293  ? 79.153  53.293  -41.542 1.00 114.52 ? 293  GLU A C     1 
ATOM   2219  O  O     . GLU A  1  293  ? 80.215  52.829  -41.126 1.00 113.28 ? 293  GLU A O     1 
ATOM   2220  C  CB    . GLU A  1  293  ? 78.776  53.899  -43.965 1.00 116.50 ? 293  GLU A CB    1 
ATOM   2221  C  CG    . GLU A  1  293  ? 80.226  54.138  -44.368 1.00 125.75 ? 293  GLU A CG    1 
ATOM   2222  C  CD    . GLU A  1  293  ? 80.502  55.282  -45.329 1.00 146.57 ? 293  GLU A CD    1 
ATOM   2223  O  OE1   . GLU A  1  293  ? 79.595  55.645  -46.116 1.00 132.97 ? 293  GLU A OE1   1 
ATOM   2224  O  OE2   . GLU A  1  293  ? 81.644  55.799  -45.313 1.00 144.89 ? 293  GLU A OE2   1 
ATOM   2225  N  N     . SER A  1  294  ? 78.407  54.184  -40.850 1.00 108.84 ? 294  SER A N     1 
ATOM   2226  C  CA    . SER A  1  294  ? 78.785  54.722  -39.540 1.00 106.18 ? 294  SER A CA    1 
ATOM   2227  C  C     . SER A  1  294  ? 78.716  53.675  -38.410 1.00 104.07 ? 294  SER A C     1 
ATOM   2228  O  O     . SER A  1  294  ? 79.341  53.867  -37.362 1.00 103.17 ? 294  SER A O     1 
ATOM   2229  C  CB    . SER A  1  294  ? 77.989  55.980  -39.204 1.00 111.28 ? 294  SER A CB    1 
ATOM   2230  O  OG    . SER A  1  294  ? 76.651  55.914  -39.667 1.00 123.28 ? 294  SER A OG    1 
ATOM   2231  N  N     . LEU A  1  295  ? 78.004  52.557  -38.633 1.00 96.48  ? 295  LEU A N     1 
ATOM   2232  C  CA    . LEU A  1  295  ? 77.964  51.479  -37.653 1.00 93.64  ? 295  LEU A CA    1 
ATOM   2233  C  C     . LEU A  1  295  ? 79.272  50.694  -37.758 1.00 96.44  ? 295  LEU A C     1 
ATOM   2234  O  O     . LEU A  1  295  ? 79.857  50.343  -36.727 1.00 95.45  ? 295  LEU A O     1 
ATOM   2235  C  CB    . LEU A  1  295  ? 76.749  50.562  -37.865 1.00 93.54  ? 295  LEU A CB    1 
ATOM   2236  C  CG    . LEU A  1  295  ? 76.722  49.243  -37.076 1.00 95.59  ? 295  LEU A CG    1 
ATOM   2237  C  CD1   . LEU A  1  295  ? 76.644  49.480  -35.591 1.00 94.64  ? 295  LEU A CD1   1 
ATOM   2238  C  CD2   . LEU A  1  295  ? 75.580  48.385  -37.507 1.00 97.62  ? 295  LEU A CD2   1 
ATOM   2239  N  N     . LEU A  1  296  ? 79.728  50.427  -39.005 1.00 92.18  ? 296  LEU A N     1 
ATOM   2240  C  CA    . LEU A  1  296  ? 80.992  49.743  -39.261 1.00 90.34  ? 296  LEU A CA    1 
ATOM   2241  C  C     . LEU A  1  296  ? 82.117  50.561  -38.626 1.00 94.56  ? 296  LEU A C     1 
ATOM   2242  O  O     . LEU A  1  296  ? 82.920  49.986  -37.894 1.00 93.92  ? 296  LEU A O     1 
ATOM   2243  C  CB    . LEU A  1  296  ? 81.235  49.568  -40.770 1.00 90.63  ? 296  LEU A CB    1 
ATOM   2244  C  CG    . LEU A  1  296  ? 82.535  48.866  -41.187 1.00 93.23  ? 296  LEU A CG    1 
ATOM   2245  C  CD1   . LEU A  1  296  ? 82.634  47.470  -40.608 1.00 91.64  ? 296  LEU A CD1   1 
ATOM   2246  C  CD2   . LEU A  1  296  ? 82.651  48.799  -42.687 1.00 96.08  ? 296  LEU A CD2   1 
ATOM   2247  N  N     . GLN A  1  297  ? 82.125  51.912  -38.843 1.00 90.70  ? 297  GLN A N     1 
ATOM   2248  C  CA    . GLN A  1  297  ? 83.101  52.850  -38.272 1.00 89.01  ? 297  GLN A CA    1 
ATOM   2249  C  C     . GLN A  1  297  ? 83.094  52.763  -36.765 1.00 92.78  ? 297  GLN A C     1 
ATOM   2250  O  O     . GLN A  1  297  ? 84.161  52.798  -36.163 1.00 91.10  ? 297  GLN A O     1 
ATOM   2251  C  CB    . GLN A  1  297  ? 82.844  54.292  -38.749 1.00 90.81  ? 297  GLN A CB    1 
ATOM   2252  C  CG    . GLN A  1  297  ? 83.583  55.407  -37.988 1.00 91.26  ? 297  GLN A CG    1 
ATOM   2253  C  CD    . GLN A  1  297  ? 85.077  55.446  -38.228 1.00 99.59  ? 297  GLN A CD    1 
ATOM   2254  O  OE1   . GLN A  1  297  ? 85.584  56.244  -39.026 1.00 95.39  ? 297  GLN A OE1   1 
ATOM   2255  N  NE2   . GLN A  1  297  ? 85.825  54.651  -37.476 1.00 79.78  ? 297  GLN A NE2   1 
ATOM   2256  N  N     . PHE A  1  298  ? 81.903  52.604  -36.159 1.00 91.06  ? 298  PHE A N     1 
ATOM   2257  C  CA    . PHE A  1  298  ? 81.776  52.467  -34.715 1.00 90.85  ? 298  PHE A CA    1 
ATOM   2258  C  C     . PHE A  1  298  ? 82.440  51.189  -34.220 1.00 95.60  ? 298  PHE A C     1 
ATOM   2259  O  O     . PHE A  1  298  ? 83.173  51.240  -33.240 1.00 94.86  ? 298  PHE A O     1 
ATOM   2260  C  CB    . PHE A  1  298  ? 80.307  52.511  -34.274 1.00 93.34  ? 298  PHE A CB    1 
ATOM   2261  C  CG    . PHE A  1  298  ? 80.096  52.153  -32.817 1.00 94.36  ? 298  PHE A CG    1 
ATOM   2262  C  CD1   . PHE A  1  298  ? 80.215  53.117  -31.822 1.00 97.70  ? 298  PHE A CD1   1 
ATOM   2263  C  CD2   . PHE A  1  298  ? 79.774  50.853  -32.442 1.00 96.12  ? 298  PHE A CD2   1 
ATOM   2264  C  CE1   . PHE A  1  298  ? 80.022  52.787  -30.479 1.00 97.78  ? 298  PHE A CE1   1 
ATOM   2265  C  CE2   . PHE A  1  298  ? 79.590  50.523  -31.098 1.00 98.17  ? 298  PHE A CE2   1 
ATOM   2266  C  CZ    . PHE A  1  298  ? 79.706  51.494  -30.128 1.00 96.14  ? 298  PHE A CZ    1 
ATOM   2267  N  N     . HIS A  1  299  ? 82.158  50.048  -34.863 1.00 92.93  ? 299  HIS A N     1 
ATOM   2268  C  CA    . HIS A  1  299  ? 82.708  48.763  -34.449 1.00 92.30  ? 299  HIS A CA    1 
ATOM   2269  C  C     . HIS A  1  299  ? 84.214  48.603  -34.703 1.00 95.78  ? 299  HIS A C     1 
ATOM   2270  O  O     . HIS A  1  299  ? 84.878  47.893  -33.944 1.00 95.60  ? 299  HIS A O     1 
ATOM   2271  C  CB    . HIS A  1  299  ? 81.923  47.613  -35.068 1.00 93.85  ? 299  HIS A CB    1 
ATOM   2272  C  CG    . HIS A  1  299  ? 80.683  47.274  -34.312 1.00 97.68  ? 299  HIS A CG    1 
ATOM   2273  N  ND1   . HIS A  1  299  ? 79.449  47.251  -34.931 1.00 100.73 ? 299  HIS A ND1   1 
ATOM   2274  C  CD2   . HIS A  1  299  ? 80.527  46.951  -33.008 1.00 98.91  ? 299  HIS A CD2   1 
ATOM   2275  C  CE1   . HIS A  1  299  ? 78.586  46.898  -33.994 1.00 100.17 ? 299  HIS A CE1   1 
ATOM   2276  N  NE2   . HIS A  1  299  ? 79.190  46.714  -32.819 1.00 99.49  ? 299  HIS A NE2   1 
ATOM   2277  N  N     . VAL A  1  300  ? 84.756  49.246  -35.753 1.00 91.01  ? 300  VAL A N     1 
ATOM   2278  C  CA    . VAL A  1  300  ? 86.191  49.183  -36.040 1.00 88.99  ? 300  VAL A CA    1 
ATOM   2279  C  C     . VAL A  1  300  ? 86.884  50.106  -35.033 1.00 92.84  ? 300  VAL A C     1 
ATOM   2280  O  O     . VAL A  1  300  ? 87.939  49.763  -34.508 1.00 92.33  ? 300  VAL A O     1 
ATOM   2281  C  CB    . VAL A  1  300  ? 86.523  49.524  -37.517 1.00 92.36  ? 300  VAL A CB    1 
ATOM   2282  C  CG1   . VAL A  1  300  ? 88.020  49.612  -37.742 1.00 91.26  ? 300  VAL A CG1   1 
ATOM   2283  C  CG2   . VAL A  1  300  ? 85.919  48.500  -38.464 1.00 92.56  ? 300  VAL A CG2   1 
ATOM   2284  N  N     . ALA A  1  301  ? 86.242  51.243  -34.721 1.00 89.88  ? 301  ALA A N     1 
ATOM   2285  C  CA    . ALA A  1  301  ? 86.722  52.240  -33.765 1.00 89.22  ? 301  ALA A CA    1 
ATOM   2286  C  C     . ALA A  1  301  ? 86.822  51.640  -32.376 1.00 92.37  ? 301  ALA A C     1 
ATOM   2287  O  O     . ALA A  1  301  ? 87.886  51.617  -31.764 1.00 90.77  ? 301  ALA A O     1 
ATOM   2288  C  CB    . ALA A  1  301  ? 85.753  53.421  -33.731 1.00 90.80  ? 301  ALA A CB    1 
ATOM   2289  N  N     . THR A  1  302  ? 85.696  51.103  -31.923 1.00 89.75  ? 302  THR A N     1 
ATOM   2290  C  CA    . THR A  1  302  ? 85.434  50.537  -30.620 1.00 88.65  ? 302  THR A CA    1 
ATOM   2291  C  C     . THR A  1  302  ? 86.306  49.269  -30.322 1.00 92.62  ? 302  THR A C     1 
ATOM   2292  O  O     . THR A  1  302  ? 86.674  49.068  -29.161 1.00 91.90  ? 302  THR A O     1 
ATOM   2293  C  CB    . THR A  1  302  ? 83.916  50.372  -30.540 1.00 92.95  ? 302  THR A CB    1 
ATOM   2294  O  OG1   . THR A  1  302  ? 83.449  51.134  -29.435 1.00 96.19  ? 302  THR A OG1   1 
ATOM   2295  C  CG2   . THR A  1  302  ? 83.412  48.917  -30.561 1.00 89.23  ? 302  THR A CG2   1 
ATOM   2296  N  N     . TYR A  1  303  ? 86.674  48.466  -31.349 1.00 88.70  ? 303  TYR A N     1 
ATOM   2297  C  CA    . TYR A  1  303  ? 87.469  47.241  -31.174 1.00 87.18  ? 303  TYR A CA    1 
ATOM   2298  C  C     . TYR A  1  303  ? 88.912  47.565  -30.797 1.00 90.92  ? 303  TYR A C     1 
ATOM   2299  O  O     . TYR A  1  303  ? 89.531  46.822  -30.026 1.00 90.40  ? 303  TYR A O     1 
ATOM   2300  C  CB    . TYR A  1  303  ? 87.327  46.345  -32.423 1.00 88.13  ? 303  TYR A CB    1 
ATOM   2301  C  CG    . TYR A  1  303  ? 88.506  45.502  -32.875 1.00 87.98  ? 303  TYR A CG    1 
ATOM   2302  C  CD1   . TYR A  1  303  ? 88.657  44.187  -32.436 1.00 88.43  ? 303  TYR A CD1   1 
ATOM   2303  C  CD2   . TYR A  1  303  ? 89.350  45.943  -33.887 1.00 88.94  ? 303  TYR A CD2   1 
ATOM   2304  C  CE1   . TYR A  1  303  ? 89.671  43.365  -32.936 1.00 86.60  ? 303  TYR A CE1   1 
ATOM   2305  C  CE2   . TYR A  1  303  ? 90.374  45.137  -34.383 1.00 89.53  ? 303  TYR A CE2   1 
ATOM   2306  C  CZ    . TYR A  1  303  ? 90.527  43.844  -33.911 1.00 92.97  ? 303  TYR A CZ    1 
ATOM   2307  O  OH    . TYR A  1  303  ? 91.548  43.070  -34.412 1.00 90.96  ? 303  TYR A OH    1 
ATOM   2308  N  N     . MET A  1  304  ? 89.415  48.707  -31.289 1.00 86.92  ? 304  MET A N     1 
ATOM   2309  C  CA    . MET A  1  304  ? 90.765  49.172  -31.009 1.00 85.67  ? 304  MET A CA    1 
ATOM   2310  C  C     . MET A  1  304  ? 90.792  49.992  -29.723 1.00 90.85  ? 304  MET A C     1 
ATOM   2311  O  O     . MET A  1  304  ? 91.618  49.707  -28.863 1.00 90.69  ? 304  MET A O     1 
ATOM   2312  C  CB    . MET A  1  304  ? 91.349  49.952  -32.198 1.00 88.13  ? 304  MET A CB    1 
ATOM   2313  C  CG    . MET A  1  304  ? 91.486  49.111  -33.449 1.00 91.62  ? 304  MET A CG    1 
ATOM   2314  S  SD    . MET A  1  304  ? 92.457  49.865  -34.765 1.00 96.01  ? 304  MET A SD    1 
ATOM   2315  C  CE    . MET A  1  304  ? 91.268  51.122  -35.323 1.00 93.92  ? 304  MET A CE    1 
ATOM   2316  N  N     . ASP A  1  305  ? 89.881  50.982  -29.572 1.00 87.47  ? 305  ASP A N     1 
ATOM   2317  C  CA    . ASP A  1  305  ? 89.798  51.847  -28.390 1.00 86.74  ? 305  ASP A CA    1 
ATOM   2318  C  C     . ASP A  1  305  ? 88.342  51.988  -28.005 1.00 90.18  ? 305  ASP A C     1 
ATOM   2319  O  O     . ASP A  1  305  ? 87.574  52.542  -28.775 1.00 90.12  ? 305  ASP A O     1 
ATOM   2320  C  CB    . ASP A  1  305  ? 90.442  53.225  -28.684 1.00 89.36  ? 305  ASP A CB    1 
ATOM   2321  C  CG    . ASP A  1  305  ? 90.435  54.268  -27.566 1.00 102.07 ? 305  ASP A CG    1 
ATOM   2322  O  OD1   . ASP A  1  305  ? 90.112  53.908  -26.414 1.00 104.13 ? 305  ASP A OD1   1 
ATOM   2323  O  OD2   . ASP A  1  305  ? 90.847  55.426  -27.827 1.00 106.24 ? 305  ASP A OD2   1 
ATOM   2324  N  N     . ASN A  1  306  ? 87.953  51.453  -26.839 1.00 87.70  ? 306  ASN A N     1 
ATOM   2325  C  CA    . ASN A  1  306  ? 86.571  51.491  -26.341 1.00 88.42  ? 306  ASN A CA    1 
ATOM   2326  C  C     . ASN A  1  306  ? 86.433  52.427  -25.165 1.00 93.58  ? 306  ASN A C     1 
ATOM   2327  O  O     . ASN A  1  306  ? 85.543  52.266  -24.336 1.00 93.60  ? 306  ASN A O     1 
ATOM   2328  C  CB    . ASN A  1  306  ? 86.052  50.092  -25.982 1.00 87.22  ? 306  ASN A CB    1 
ATOM   2329  C  CG    . ASN A  1  306  ? 84.549  50.028  -25.826 1.00 99.33  ? 306  ASN A CG    1 
ATOM   2330  O  OD1   . ASN A  1  306  ? 83.814  50.937  -26.227 1.00 95.30  ? 306  ASN A OD1   1 
ATOM   2331  N  ND2   . ASN A  1  306  ? 84.063  48.966  -25.210 1.00 86.18  ? 306  ASN A ND2   1 
ATOM   2332  N  N     . ASP A  1  307  ? 87.321  53.404  -25.088 1.00 91.05  ? 307  ASP A N     1 
ATOM   2333  C  CA    . ASP A  1  307  ? 87.307  54.408  -24.039 1.00 91.46  ? 307  ASP A CA    1 
ATOM   2334  C  C     . ASP A  1  307  ? 87.366  55.765  -24.744 1.00 95.43  ? 307  ASP A C     1 
ATOM   2335  O  O     . ASP A  1  307  ? 88.269  56.574  -24.512 1.00 95.85  ? 307  ASP A O     1 
ATOM   2336  C  CB    . ASP A  1  307  ? 88.464  54.162  -23.049 1.00 92.98  ? 307  ASP A CB    1 
ATOM   2337  C  CG    . ASP A  1  307  ? 88.406  52.797  -22.383 1.00 110.10 ? 307  ASP A CG    1 
ATOM   2338  O  OD1   . ASP A  1  307  ? 87.388  52.511  -21.699 1.00 111.88 ? 307  ASP A OD1   1 
ATOM   2339  O  OD2   . ASP A  1  307  ? 89.370  52.003  -22.562 1.00 116.59 ? 307  ASP A OD2   1 
ATOM   2340  N  N     . ILE A  1  308  ? 86.403  55.975  -25.656 1.00 91.16  ? 308  ILE A N     1 
ATOM   2341  C  CA    . ILE A  1  308  ? 86.304  57.171  -26.487 1.00 91.59  ? 308  ILE A CA    1 
ATOM   2342  C  C     . ILE A  1  308  ? 85.543  58.282  -25.743 1.00 99.27  ? 308  ILE A C     1 
ATOM   2343  O  O     . ILE A  1  308  ? 84.596  57.978  -25.011 1.00 99.64  ? 308  ILE A O     1 
ATOM   2344  C  CB    . ILE A  1  308  ? 85.651  56.787  -27.856 1.00 94.23  ? 308  ILE A CB    1 
ATOM   2345  C  CG1   . ILE A  1  308  ? 86.548  55.841  -28.685 1.00 92.52  ? 308  ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A  1  308  ? 85.264  58.010  -28.680 1.00 96.28  ? 308  ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A  1  308  ? 85.801  55.028  -29.754 1.00 92.07  ? 308  ILE A CD1   1 
ATOM   2348  N  N     . ALA A  1  309  ? 85.956  59.559  -25.946 1.00 98.01  ? 309  ALA A N     1 
ATOM   2349  C  CA    . ALA A  1  309  ? 85.325  60.762  -25.397 1.00 99.97  ? 309  ALA A CA    1 
ATOM   2350  C  C     . ALA A  1  309  ? 83.785  60.847  -25.709 1.00 111.36 ? 309  ALA A C     1 
ATOM   2351  O  O     . ALA A  1  309  ? 82.990  61.161  -24.814 1.00 111.45 ? 309  ALA A O     1 
ATOM   2352  C  CB    . ALA A  1  309  ? 86.039  61.986  -25.923 1.00 100.84 ? 309  ALA A CB    1 
ATOM   2353  N  N     . GLY A  1  310  ? 83.394  60.533  -26.955 1.00 112.49 ? 310  GLY A N     1 
ATOM   2354  C  CA    . GLY A  1  310  ? 81.999  60.488  -27.407 1.00 114.50 ? 310  GLY A CA    1 
ATOM   2355  C  C     . GLY A  1  310  ? 81.248  59.312  -26.805 1.00 120.36 ? 310  GLY A C     1 
ATOM   2356  O  O     . GLY A  1  310  ? 81.220  58.211  -27.368 1.00 118.48 ? 310  GLY A O     1 
ATOM   2357  N  N     . GLN A  1  311  ? 80.666  59.580  -25.626 1.00 120.27 ? 311  GLN A N     1 
ATOM   2358  C  CA    . GLN A  1  311  ? 79.911  58.769  -24.650 1.00 121.43 ? 311  GLN A CA    1 
ATOM   2359  C  C     . GLN A  1  311  ? 79.646  57.243  -24.986 1.00 125.00 ? 311  GLN A C     1 
ATOM   2360  O  O     . GLN A  1  311  ? 80.123  56.445  -24.179 1.00 124.03 ? 311  GLN A O     1 
ATOM   2361  C  CB    . GLN A  1  311  ? 78.580  59.464  -24.254 1.00 124.48 ? 311  GLN A CB    1 
ATOM   2362  C  CG    . GLN A  1  311  ? 78.737  60.441  -23.071 1.00 146.88 ? 311  GLN A CG    1 
ATOM   2363  C  CD    . GLN A  1  311  ? 77.597  61.432  -22.912 1.00 168.09 ? 311  GLN A CD    1 
ATOM   2364  O  OE1   . GLN A  1  311  ? 77.537  62.469  -23.589 1.00 163.86 ? 311  GLN A OE1   1 
ATOM   2365  N  NE2   . GLN A  1  311  ? 76.711  61.176  -21.955 1.00 159.44 ? 311  GLN A NE2   1 
ATOM   2366  N  N     . PRO A  1  312  ? 78.876  56.777  -26.020 1.00 121.43 ? 312  PRO A N     1 
ATOM   2367  C  CA    . PRO A  1  312  ? 78.647  55.319  -26.166 1.00 120.25 ? 312  PRO A CA    1 
ATOM   2368  C  C     . PRO A  1  312  ? 79.873  54.450  -25.917 1.00 121.03 ? 312  PRO A C     1 
ATOM   2369  O  O     . PRO A  1  312  ? 80.946  54.721  -26.466 1.00 120.86 ? 312  PRO A O     1 
ATOM   2370  C  CB    . PRO A  1  312  ? 78.101  55.167  -27.594 1.00 123.03 ? 312  PRO A CB    1 
ATOM   2371  C  CG    . PRO A  1  312  ? 78.160  56.533  -28.203 1.00 128.88 ? 312  PRO A CG    1 
ATOM   2372  C  CD    . PRO A  1  312  ? 78.160  57.514  -27.077 1.00 124.44 ? 312  PRO A CD    1 
ATOM   2373  N  N     . GLN A  1  313  ? 79.730  53.451  -25.039 1.00 114.70 ? 313  GLN A N     1 
ATOM   2374  C  CA    . GLN A  1  313  ? 80.867  52.625  -24.676 1.00 112.87 ? 313  GLN A CA    1 
ATOM   2375  C  C     . GLN A  1  313  ? 80.757  51.173  -25.116 1.00 117.82 ? 313  GLN A C     1 
ATOM   2376  O  O     . GLN A  1  313  ? 81.400  50.306  -24.519 1.00 117.05 ? 313  GLN A O     1 
ATOM   2377  C  CB    . GLN A  1  313  ? 81.148  52.726  -23.172 1.00 112.95 ? 313  GLN A CB    1 
ATOM   2378  C  CG    . GLN A  1  313  ? 82.640  52.786  -22.864 1.00 105.65 ? 313  GLN A CG    1 
ATOM   2379  C  CD    . GLN A  1  313  ? 83.034  52.209  -21.529 1.00 110.48 ? 313  GLN A CD    1 
ATOM   2380  O  OE1   . GLN A  1  313  ? 82.200  51.768  -20.725 1.00 105.78 ? 313  GLN A OE1   1 
ATOM   2381  N  NE2   . GLN A  1  313  ? 84.333  52.217  -21.260 1.00 96.47  ? 313  GLN A NE2   1 
ATOM   2382  N  N     . ALA A  1  314  ? 79.989  50.898  -26.177 1.00 115.83 ? 314  ALA A N     1 
ATOM   2383  C  CA    . ALA A  1  314  ? 79.844  49.544  -26.723 1.00 116.36 ? 314  ALA A CA    1 
ATOM   2384  C  C     . ALA A  1  314  ? 79.594  48.452  -25.652 1.00 123.62 ? 314  ALA A C     1 
ATOM   2385  O  O     . ALA A  1  314  ? 80.056  47.318  -25.795 1.00 122.92 ? 314  ALA A O     1 
ATOM   2386  C  CB    . ALA A  1  314  ? 81.061  49.196  -27.579 1.00 116.27 ? 314  ALA A CB    1 
ATOM   2387  N  N     . LEU A  1  315  ? 78.865  48.806  -24.579 1.00 123.44 ? 315  LEU A N     1 
ATOM   2388  C  CA    . LEU A  1  315  ? 78.531  47.908  -23.468 1.00 124.17 ? 315  LEU A CA    1 
ATOM   2389  C  C     . LEU A  1  315  ? 77.850  46.651  -24.024 1.00 129.90 ? 315  LEU A C     1 
ATOM   2390  O  O     . LEU A  1  315  ? 76.694  46.721  -24.456 1.00 131.25 ? 315  LEU A O     1 
ATOM   2391  C  CB    . LEU A  1  315  ? 77.602  48.607  -22.440 1.00 125.11 ? 315  LEU A CB    1 
ATOM   2392  C  CG    . LEU A  1  315  ? 77.990  50.016  -21.963 1.00 130.88 ? 315  LEU A CG    1 
ATOM   2393  C  CD1   . LEU A  1  315  ? 77.178  51.091  -22.690 1.00 132.48 ? 315  LEU A CD1   1 
ATOM   2394  C  CD2   . LEU A  1  315  ? 77.781  50.162  -20.466 1.00 134.13 ? 315  LEU A CD2   1 
ATOM   2395  N  N     . GLN A  1  316  ? 78.595  45.528  -24.091 1.00 125.71 ? 316  GLN A N     1 
ATOM   2396  C  CA    . GLN A  1  316  ? 78.062  44.256  -24.588 1.00 126.11 ? 316  GLN A CA    1 
ATOM   2397  C  C     . GLN A  1  316  ? 77.051  43.663  -23.587 1.00 131.98 ? 316  GLN A C     1 
ATOM   2398  O  O     . GLN A  1  316  ? 77.279  43.762  -22.379 1.00 131.76 ? 316  GLN A O     1 
ATOM   2399  C  CB    . GLN A  1  316  ? 79.204  43.293  -24.978 1.00 126.48 ? 316  GLN A CB    1 
ATOM   2400  C  CG    . GLN A  1  316  ? 79.116  41.850  -24.485 1.00 136.53 ? 316  GLN A CG    1 
ATOM   2401  C  CD    . GLN A  1  316  ? 79.912  41.653  -23.226 1.00 151.75 ? 316  GLN A CD    1 
ATOM   2402  O  OE1   . GLN A  1  316  ? 81.120  41.904  -23.180 1.00 144.20 ? 316  GLN A OE1   1 
ATOM   2403  N  NE2   . GLN A  1  316  ? 79.260  41.158  -22.185 1.00 147.09 ? 316  GLN A NE2   1 
ATOM   2404  N  N     . LYS A  1  317  ? 75.921  43.094  -24.100 1.00 129.66 ? 317  LYS A N     1 
ATOM   2405  C  CA    . LYS A  1  317  ? 74.809  42.509  -23.330 1.00 129.75 ? 317  LYS A CA    1 
ATOM   2406  C  C     . LYS A  1  317  ? 75.278  41.740  -22.095 1.00 130.60 ? 317  LYS A C     1 
ATOM   2407  O  O     . LYS A  1  317  ? 75.833  40.639  -22.195 1.00 129.20 ? 317  LYS A O     1 
ATOM   2408  C  CB    . LYS A  1  317  ? 73.882  41.653  -24.215 1.00 133.85 ? 317  LYS A CB    1 
ATOM   2409  C  CG    . LYS A  1  317  ? 72.445  41.566  -23.693 1.00 153.70 ? 317  LYS A CG    1 
ATOM   2410  C  CD    . LYS A  1  317  ? 71.555  40.735  -24.622 1.00 166.27 ? 317  LYS A CD    1 
ATOM   2411  C  CE    . LYS A  1  317  ? 70.113  40.670  -24.171 1.00 176.06 ? 317  LYS A CE    1 
ATOM   2412  N  NZ    . LYS A  1  317  ? 69.293  39.820  -25.077 1.00 184.92 ? 317  LYS A NZ    1 
ATOM   2413  N  N     . SER A  1  318  ? 75.102  42.414  -20.944 1.00 125.78 ? 318  SER A N     1 
ATOM   2414  C  CA    . SER A  1  318  ? 75.429  42.097  -19.548 1.00 124.66 ? 318  SER A CA    1 
ATOM   2415  C  C     . SER A  1  318  ? 75.745  43.418  -18.830 1.00 128.75 ? 318  SER A C     1 
ATOM   2416  O  O     . SER A  1  318  ? 75.577  43.527  -17.614 1.00 129.08 ? 318  SER A O     1 
ATOM   2417  C  CB    . SER A  1  318  ? 76.607  41.127  -19.420 1.00 126.51 ? 318  SER A CB    1 
ATOM   2418  O  OG    . SER A  1  318  ? 77.844  41.687  -19.828 1.00 134.09 ? 318  SER A OG    1 
ATOM   2419  N  N     . GLY A  1  319  ? 76.170  44.412  -19.601 1.00 124.69 ? 319  GLY A N     1 
ATOM   2420  C  CA    . GLY A  1  319  ? 76.543  45.725  -19.092 1.00 124.19 ? 319  GLY A CA    1 
ATOM   2421  C  C     . GLY A  1  319  ? 78.038  45.935  -19.168 1.00 126.51 ? 319  GLY A C     1 
ATOM   2422  O  O     . GLY A  1  319  ? 78.495  47.079  -19.198 1.00 126.68 ? 319  GLY A O     1 
ATOM   2423  N  N     . ARG A  1  320  ? 78.809  44.819  -19.211 1.00 121.04 ? 320  ARG A N     1 
ATOM   2424  C  CA    . ARG A  1  320  ? 80.271  44.782  -19.310 1.00 119.32 ? 320  ARG A CA    1 
ATOM   2425  C  C     . ARG A  1  320  ? 80.732  45.549  -20.585 1.00 120.34 ? 320  ARG A C     1 
ATOM   2426  O  O     . ARG A  1  320  ? 80.322  45.191  -21.695 1.00 120.51 ? 320  ARG A O     1 
ATOM   2427  C  CB    . ARG A  1  320  ? 80.765  43.317  -19.275 1.00 121.05 ? 320  ARG A CB    1 
ATOM   2428  C  CG    . ARG A  1  320  ? 82.267  43.133  -19.030 1.00 138.18 ? 320  ARG A CG    1 
ATOM   2429  C  CD    . ARG A  1  320  ? 83.063  43.128  -20.333 1.00 155.12 ? 320  ARG A CD    1 
ATOM   2430  N  NE    . ARG A  1  320  ? 84.088  42.084  -20.366 1.00 164.39 ? 320  ARG A NE    1 
ATOM   2431  C  CZ    . ARG A  1  320  ? 83.898  40.858  -20.846 1.00 179.77 ? 320  ARG A CZ    1 
ATOM   2432  N  NH1   . ARG A  1  320  ? 82.716  40.505  -21.338 1.00 168.35 ? 320  ARG A NH1   1 
ATOM   2433  N  NH2   . ARG A  1  320  ? 84.889  39.977  -20.841 1.00 166.86 ? 320  ARG A NH2   1 
ATOM   2434  N  N     . PRO A  1  321  ? 81.562  46.612  -20.421 1.00 113.76 ? 321  PRO A N     1 
ATOM   2435  C  CA    . PRO A  1  321  ? 81.921  47.472  -21.559 1.00 112.92 ? 321  PRO A CA    1 
ATOM   2436  C  C     . PRO A  1  321  ? 82.569  46.859  -22.817 1.00 115.06 ? 321  PRO A C     1 
ATOM   2437  O  O     . PRO A  1  321  ? 82.216  47.358  -23.886 1.00 117.29 ? 321  PRO A O     1 
ATOM   2438  C  CB    . PRO A  1  321  ? 82.860  48.497  -20.931 1.00 113.86 ? 321  PRO A CB    1 
ATOM   2439  C  CG    . PRO A  1  321  ? 82.370  48.620  -19.552 1.00 118.39 ? 321  PRO A CG    1 
ATOM   2440  C  CD    . PRO A  1  321  ? 82.048  47.207  -19.160 1.00 114.19 ? 321  PRO A CD    1 
ATOM   2441  N  N     . VAL A  1  322  ? 83.498  45.857  -22.738 1.00 106.24 ? 322  VAL A N     1 
ATOM   2442  C  CA    . VAL A  1  322  ? 84.242  45.247  -23.889 1.00 103.65 ? 322  VAL A CA    1 
ATOM   2443  C  C     . VAL A  1  322  ? 85.719  45.653  -23.871 1.00 106.01 ? 322  VAL A C     1 
ATOM   2444  O  O     . VAL A  1  322  ? 86.032  46.848  -23.979 1.00 106.30 ? 322  VAL A O     1 
ATOM   2445  C  CB    . VAL A  1  322  ? 83.627  45.431  -25.309 1.00 106.27 ? 322  VAL A CB    1 
ATOM   2446  C  CG1   . VAL A  1  322  ? 84.679  45.333  -26.408 1.00 105.28 ? 322  VAL A CG1   1 
ATOM   2447  C  CG2   . VAL A  1  322  ? 82.526  44.428  -25.543 1.00 106.32 ? 322  VAL A CG2   1 
ATOM   2448  N  N     . LYS A  1  323  ? 86.625  44.657  -23.754 1.00 100.24 ? 323  LYS A N     1 
ATOM   2449  C  CA    . LYS A  1  323  ? 88.064  44.923  -23.711 1.00 98.83  ? 323  LYS A CA    1 
ATOM   2450  C  C     . LYS A  1  323  ? 88.600  45.308  -25.081 1.00 100.22 ? 323  LYS A C     1 
ATOM   2451  O  O     . LYS A  1  323  ? 88.669  44.473  -25.986 1.00 101.17 ? 323  LYS A O     1 
ATOM   2452  C  CB    . LYS A  1  323  ? 88.864  43.758  -23.076 1.00 101.34 ? 323  LYS A CB    1 
ATOM   2453  C  CG    . LYS A  1  323  ? 89.076  43.880  -21.557 1.00 128.93 ? 323  LYS A CG    1 
ATOM   2454  C  CD    . LYS A  1  323  ? 87.792  43.581  -20.701 1.00 145.50 ? 323  LYS A CD    1 
ATOM   2455  C  CE    . LYS A  1  323  ? 87.223  44.815  -20.007 1.00 153.20 ? 323  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A  1  323  ? 85.913  44.561  -19.344 1.00 153.36 ? 323  LYS A NZ    1 
ATOM   2457  N  N     . SER A  1  324  ? 88.938  46.597  -25.243 1.00 92.54  ? 324  SER A N     1 
ATOM   2458  C  CA    . SER A  1  324  ? 89.520  47.136  -26.469 1.00 90.05  ? 324  SER A CA    1 
ATOM   2459  C  C     . SER A  1  324  ? 90.958  46.627  -26.517 1.00 90.13  ? 324  SER A C     1 
ATOM   2460  O  O     . SER A  1  324  ? 91.509  46.306  -25.451 1.00 89.73  ? 324  SER A O     1 
ATOM   2461  C  CB    . SER A  1  324  ? 89.519  48.662  -26.423 1.00 91.43  ? 324  SER A CB    1 
ATOM   2462  O  OG    . SER A  1  324  ? 89.254  49.191  -25.130 1.00 94.94  ? 324  SER A OG    1 
ATOM   2463  N  N     . ILE A  1  325  ? 91.577  46.535  -27.725 1.00 82.81  ? 325  ILE A N     1 
ATOM   2464  C  CA    . ILE A  1  325  ? 92.987  46.121  -27.822 1.00 79.45  ? 325  ILE A CA    1 
ATOM   2465  C  C     . ILE A  1  325  ? 93.840  47.132  -27.020 1.00 79.59  ? 325  ILE A C     1 
ATOM   2466  O  O     . ILE A  1  325  ? 94.736  46.713  -26.295 1.00 78.62  ? 325  ILE A O     1 
ATOM   2467  C  CB    . ILE A  1  325  ? 93.487  45.985  -29.278 1.00 82.30  ? 325  ILE A CB    1 
ATOM   2468  C  CG1   . ILE A  1  325  ? 92.681  44.947  -30.044 1.00 82.84  ? 325  ILE A CG1   1 
ATOM   2469  C  CG2   . ILE A  1  325  ? 94.974  45.629  -29.304 1.00 82.53  ? 325  ILE A CG2   1 
ATOM   2470  C  CD1   . ILE A  1  325  ? 92.950  44.949  -31.543 1.00 90.42  ? 325  ILE A CD1   1 
ATOM   2471  N  N     . ARG A  1  326  ? 93.507  48.449  -27.116 1.00 74.16  ? 326  ARG A N     1 
ATOM   2472  C  CA    . ARG A  1  326  ? 94.172  49.556  -26.436 1.00 72.73  ? 326  ARG A CA    1 
ATOM   2473  C  C     . ARG A  1  326  ? 94.212  49.339  -24.952 1.00 74.93  ? 326  ARG A C     1 
ATOM   2474  O  O     . ARG A  1  326  ? 95.273  49.444  -24.360 1.00 74.06  ? 326  ARG A O     1 
ATOM   2475  C  CB    . ARG A  1  326  ? 93.502  50.892  -26.763 1.00 74.29  ? 326  ARG A CB    1 
ATOM   2476  C  CG    . ARG A  1  326  ? 94.194  52.074  -26.116 1.00 85.05  ? 326  ARG A CG    1 
ATOM   2477  C  CD    . ARG A  1  326  ? 93.471  53.362  -26.369 1.00 93.34  ? 326  ARG A CD    1 
ATOM   2478  N  NE    . ARG A  1  326  ? 94.049  54.467  -25.611 1.00 95.90  ? 326  ARG A NE    1 
ATOM   2479  C  CZ    . ARG A  1  326  ? 93.627  54.855  -24.414 1.00 109.89 ? 326  ARG A CZ    1 
ATOM   2480  N  NH1   . ARG A  1  326  ? 92.624  54.220  -23.816 1.00 93.88  ? 326  ARG A NH1   1 
ATOM   2481  N  NH2   . ARG A  1  326  ? 94.210  55.876  -23.800 1.00 98.89  ? 326  ARG A NH2   1 
ATOM   2482  N  N     . ALA A  1  327  ? 93.073  49.001  -24.359 1.00 72.36  ? 327  ALA A N     1 
ATOM   2483  C  CA    . ALA A  1  327  ? 92.926  48.730  -22.931 1.00 71.94  ? 327  ALA A CA    1 
ATOM   2484  C  C     . ALA A  1  327  ? 93.847  47.625  -22.433 1.00 76.03  ? 327  ALA A C     1 
ATOM   2485  O  O     . ALA A  1  327  ? 94.297  47.702  -21.283 1.00 76.75  ? 327  ALA A O     1 
ATOM   2486  C  CB    . ALA A  1  327  ? 91.488  48.373  -22.622 1.00 73.08  ? 327  ALA A CB    1 
ATOM   2487  N  N     . ARG A  1  328  ? 94.135  46.610  -23.293 1.00 71.75  ? 328  ARG A N     1 
ATOM   2488  C  CA    . ARG A  1  328  ? 95.005  45.463  -22.991 1.00 70.43  ? 328  ARG A CA    1 
ATOM   2489  C  C     . ARG A  1  328  ? 96.459  45.873  -22.709 1.00 76.40  ? 328  ARG A C     1 
ATOM   2490  O  O     . ARG A  1  328  ? 97.146  45.160  -21.976 1.00 77.20  ? 328  ARG A O     1 
ATOM   2491  C  CB    . ARG A  1  328  ? 95.018  44.447  -24.144 1.00 65.61  ? 328  ARG A CB    1 
ATOM   2492  C  CG    . ARG A  1  328  ? 93.777  43.612  -24.362 1.00 61.28  ? 328  ARG A CG    1 
ATOM   2493  C  CD    . ARG A  1  328  ? 94.187  42.544  -25.346 1.00 59.23  ? 328  ARG A CD    1 
ATOM   2494  N  NE    . ARG A  1  328  ? 93.160  41.551  -25.666 1.00 72.14  ? 328  ARG A NE    1 
ATOM   2495  C  CZ    . ARG A  1  328  ? 93.413  40.392  -26.279 1.00 83.80  ? 328  ARG A CZ    1 
ATOM   2496  N  NH1   . ARG A  1  328  ? 94.654  40.073  -26.626 1.00 59.42  ? 328  ARG A NH1   1 
ATOM   2497  N  NH2   . ARG A  1  328  ? 92.429  39.541  -26.541 1.00 74.61  ? 328  ARG A NH2   1 
ATOM   2498  N  N     . LEU A  1  329  ? 96.930  46.988  -23.292 1.00 72.79  ? 329  LEU A N     1 
ATOM   2499  C  CA    . LEU A  1  329  ? 98.321  47.440  -23.157 1.00 72.78  ? 329  LEU A CA    1 
ATOM   2500  C  C     . LEU A  1  329  ? 98.553  48.593  -22.161 1.00 80.48  ? 329  LEU A C     1 
ATOM   2501  O  O     . LEU A  1  329  ? 99.703  48.851  -21.768 1.00 80.49  ? 329  LEU A O     1 
ATOM   2502  C  CB    . LEU A  1  329  ? 98.870  47.849  -24.537 1.00 72.48  ? 329  LEU A CB    1 
ATOM   2503  C  CG    . LEU A  1  329  ? 98.316  47.136  -25.749 1.00 75.95  ? 329  LEU A CG    1 
ATOM   2504  C  CD1   . LEU A  1  329  ? 98.543  47.946  -26.956 1.00 76.10  ? 329  LEU A CD1   1 
ATOM   2505  C  CD2   . LEU A  1  329  ? 98.929  45.772  -25.919 1.00 77.83  ? 329  LEU A CD2   1 
ATOM   2506  N  N     . LYS A  1  330  ? 97.469  49.303  -21.805 1.00 78.72  ? 330  LYS A N     1 
ATOM   2507  C  CA    . LYS A  1  330  ? 97.414  50.472  -20.929 1.00 79.20  ? 330  LYS A CA    1 
ATOM   2508  C  C     . LYS A  1  330  ? 97.985  50.174  -19.542 1.00 84.46  ? 330  LYS A C     1 
ATOM   2509  O  O     . LYS A  1  330  ? 97.653  49.160  -18.935 1.00 83.38  ? 330  LYS A O     1 
ATOM   2510  C  CB    . LYS A  1  330  ? 95.962  50.942  -20.822 1.00 82.57  ? 330  LYS A CB    1 
ATOM   2511  C  CG    . LYS A  1  330  ? 95.668  52.350  -21.324 1.00 91.96  ? 330  LYS A CG    1 
ATOM   2512  C  CD    . LYS A  1  330  ? 94.158  52.665  -21.215 1.00 103.48 ? 330  LYS A CD    1 
ATOM   2513  C  CE    . LYS A  1  330  ? 93.569  52.615  -19.811 1.00 116.12 ? 330  LYS A CE    1 
ATOM   2514  N  NZ    . LYS A  1  330  ? 92.079  52.523  -19.830 1.00 127.66 ? 330  LYS A NZ    1 
ATOM   2515  N  N     . GLY A  1  331  ? 98.828  51.089  -19.081 1.00 83.30  ? 331  GLY A N     1 
ATOM   2516  C  CA    . GLY A  1  331  ? 99.598  51.056  -17.838 1.00 83.54  ? 331  GLY A CA    1 
ATOM   2517  C  C     . GLY A  1  331  ? 99.171  50.244  -16.625 1.00 85.82  ? 331  GLY A C     1 
ATOM   2518  O  O     . GLY A  1  331  ? 98.017  50.322  -16.212 1.00 85.60  ? 331  GLY A O     1 
ATOM   2519  N  N     . LYS A  1  332  ? 100.172 49.578  -15.970 1.00 81.07  ? 332  LYS A N     1 
ATOM   2520  C  CA    . LYS A  1  332  ? 100.131 48.737  -14.758 1.00 80.12  ? 332  LYS A CA    1 
ATOM   2521  C  C     . LYS A  1  332  ? 99.067  47.727  -14.877 1.00 85.27  ? 332  LYS A C     1 
ATOM   2522  O  O     . LYS A  1  332  ? 97.882  48.073  -14.892 1.00 87.79  ? 332  LYS A O     1 
ATOM   2523  C  CB    . LYS A  1  332  ? 99.995  49.528  -13.454 1.00 81.89  ? 332  LYS A CB    1 
ATOM   2524  C  CG    . LYS A  1  332  ? 100.470 48.697  -12.261 1.00 88.79  ? 332  LYS A CG    1 
ATOM   2525  C  CD    . LYS A  1  332  ? 100.066 49.278  -10.924 1.00 96.79  ? 332  LYS A CD    1 
ATOM   2526  C  CE    . LYS A  1  332  ? 100.478 48.345  -9.817  1.00 110.13 ? 332  LYS A CE    1 
ATOM   2527  N  NZ    . LYS A  1  332  ? 99.864  48.716  -8.517  1.00 124.14 ? 332  LYS A NZ    1 
ATOM   2528  N  N     . GLU A  1  333  ? 99.465  46.476  -14.986 1.00 79.53  ? 333  GLU A N     1 
ATOM   2529  C  CA    . GLU A  1  333  ? 98.552  45.364  -15.265 1.00 79.35  ? 333  GLU A CA    1 
ATOM   2530  C  C     . GLU A  1  333  ? 98.430  45.235  -16.799 1.00 82.17  ? 333  GLU A C     1 
ATOM   2531  O  O     . GLU A  1  333  ? 98.269  44.125  -17.299 1.00 83.29  ? 333  GLU A O     1 
ATOM   2532  C  CB    . GLU A  1  333  ? 97.176  45.438  -14.534 1.00 81.24  ? 333  GLU A CB    1 
ATOM   2533  C  CG    . GLU A  1  333  ? 97.244  45.525  -13.006 1.00 93.26  ? 333  GLU A CG    1 
ATOM   2534  C  CD    . GLU A  1  333  ? 96.339  44.629  -12.174 1.00 124.43 ? 333  GLU A CD    1 
ATOM   2535  O  OE1   . GLU A  1  333  ? 95.224  44.282  -12.632 1.00 130.50 ? 333  GLU A OE1   1 
ATOM   2536  O  OE2   . GLU A  1  333  ? 96.744  44.298  -11.037 1.00 118.63 ? 333  GLU A OE2   1 
ATOM   2537  N  N     . GLY A  1  334  ? 98.641  46.337  -17.525 1.00 77.40  ? 334  GLY A N     1 
ATOM   2538  C  CA    . GLY A  1  334  ? 98.685  46.365  -18.986 1.00 77.41  ? 334  GLY A CA    1 
ATOM   2539  C  C     . GLY A  1  334  ? 99.872  45.583  -19.523 1.00 80.67  ? 334  GLY A C     1 
ATOM   2540  O  O     . GLY A  1  334  ? 100.751 45.200  -18.748 1.00 81.14  ? 334  GLY A O     1 
ATOM   2541  N  N     . ARG A  1  335  ? 99.922  45.319  -20.842 1.00 74.85  ? 335  ARG A N     1 
ATOM   2542  C  CA    . ARG A  1  335  ? 100.987 44.474  -21.408 1.00 72.96  ? 335  ARG A CA    1 
ATOM   2543  C  C     . ARG A  1  335  ? 102.388 44.919  -21.081 1.00 74.26  ? 335  ARG A C     1 
ATOM   2544  O  O     . ARG A  1  335  ? 103.197 44.086  -20.696 1.00 72.68  ? 335  ARG A O     1 
ATOM   2545  C  CB    . ARG A  1  335  ? 100.842 44.287  -22.931 1.00 72.07  ? 335  ARG A CB    1 
ATOM   2546  C  CG    . ARG A  1  335  ? 101.564 43.038  -23.451 1.00 71.31  ? 335  ARG A CG    1 
ATOM   2547  C  CD    . ARG A  1  335  ? 100.601 41.958  -23.850 1.00 74.21  ? 335  ARG A CD    1 
ATOM   2548  N  NE    . ARG A  1  335  ? 99.570  41.756  -22.836 1.00 80.32  ? 335  ARG A NE    1 
ATOM   2549  C  CZ    . ARG A  1  335  ? 98.426  41.128  -23.050 1.00 86.94  ? 335  ARG A CZ    1 
ATOM   2550  N  NH1   . ARG A  1  335  ? 98.161  40.610  -24.235 1.00 60.78  ? 335  ARG A NH1   1 
ATOM   2551  N  NH2   . ARG A  1  335  ? 97.539  41.004  -22.072 1.00 81.23  ? 335  ARG A NH2   1 
ATOM   2552  N  N     . ILE A  1  336  ? 102.670 46.221  -21.230 1.00 70.96  ? 336  ILE A N     1 
ATOM   2553  C  CA    . ILE A  1  336  ? 104.007 46.784  -21.066 1.00 69.65  ? 336  ILE A CA    1 
ATOM   2554  C  C     . ILE A  1  336  ? 104.471 46.717  -19.608 1.00 72.89  ? 336  ILE A C     1 
ATOM   2555  O  O     . ILE A  1  336  ? 105.492 46.097  -19.346 1.00 71.82  ? 336  ILE A O     1 
ATOM   2556  C  CB    . ILE A  1  336  ? 104.121 48.201  -21.708 1.00 71.97  ? 336  ILE A CB    1 
ATOM   2557  C  CG1   . ILE A  1  336  ? 103.591 48.201  -23.155 1.00 72.32  ? 336  ILE A CG1   1 
ATOM   2558  C  CG2   . ILE A  1  336  ? 105.544 48.743  -21.681 1.00 71.31  ? 336  ILE A CG2   1 
ATOM   2559  C  CD1   . ILE A  1  336  ? 104.030 47.066  -24.050 1.00 75.57  ? 336  ILE A CD1   1 
ATOM   2560  N  N     . ARG A  1  337  ? 103.725 47.278  -18.674 1.00 69.18  ? 337  ARG A N     1 
ATOM   2561  C  CA    . ARG A  1  337  ? 104.171 47.250  -17.288 1.00 68.67  ? 337  ARG A CA    1 
ATOM   2562  C  C     . ARG A  1  337  ? 103.913 45.909  -16.632 1.00 73.83  ? 337  ARG A C     1 
ATOM   2563  O  O     . ARG A  1  337  ? 104.787 45.386  -15.951 1.00 75.12  ? 337  ARG A O     1 
ATOM   2564  C  CB    . ARG A  1  337  ? 103.506 48.364  -16.469 1.00 68.83  ? 337  ARG A CB    1 
ATOM   2565  C  CG    . ARG A  1  337  ? 103.456 49.708  -17.148 1.00 70.17  ? 337  ARG A CG    1 
ATOM   2566  C  CD    . ARG A  1  337  ? 104.027 50.695  -16.197 1.00 79.34  ? 337  ARG A CD    1 
ATOM   2567  N  NE    . ARG A  1  337  ? 103.048 51.691  -15.761 1.00 94.14  ? 337  ARG A NE    1 
ATOM   2568  C  CZ    . ARG A  1  337  ? 102.664 51.880  -14.502 1.00 93.95  ? 337  ARG A CZ    1 
ATOM   2569  N  NH1   . ARG A  1  337  ? 103.181 51.146  -13.525 1.00 51.23  ? 337  ARG A NH1   1 
ATOM   2570  N  NH2   . ARG A  1  337  ? 101.778 52.823  -14.208 1.00 89.99  ? 337  ARG A NH2   1 
ATOM   2571  N  N     . GLY A  1  338  ? 102.715 45.379  -16.807 1.00 69.99  ? 338  GLY A N     1 
ATOM   2572  C  CA    . GLY A  1  338  ? 102.307 44.129  -16.182 1.00 69.53  ? 338  GLY A CA    1 
ATOM   2573  C  C     . GLY A  1  338  ? 102.944 42.844  -16.671 1.00 72.34  ? 338  GLY A C     1 
ATOM   2574  O  O     . GLY A  1  338  ? 103.151 41.934  -15.865 1.00 74.08  ? 338  GLY A O     1 
ATOM   2575  N  N     . ASN A  1  339  ? 103.215 42.730  -17.981 1.00 65.70  ? 339  ASN A N     1 
ATOM   2576  C  CA    . ASN A  1  339  ? 103.771 41.516  -18.577 1.00 63.50  ? 339  ASN A CA    1 
ATOM   2577  C  C     . ASN A  1  339  ? 105.194 41.670  -19.109 1.00 67.14  ? 339  ASN A C     1 
ATOM   2578  O  O     . ASN A  1  339  ? 105.871 40.653  -19.286 1.00 67.19  ? 339  ASN A O     1 
ATOM   2579  C  CB    . ASN A  1  339  ? 102.862 41.036  -19.704 1.00 59.45  ? 339  ASN A CB    1 
ATOM   2580  C  CG    . ASN A  1  339  ? 101.466 40.700  -19.274 1.00 79.75  ? 339  ASN A CG    1 
ATOM   2581  O  OD1   . ASN A  1  339  ? 101.255 39.839  -18.402 1.00 77.15  ? 339  ASN A OD1   1 
ATOM   2582  N  ND2   . ASN A  1  339  ? 100.479 41.342  -19.905 1.00 66.74  ? 339  ASN A ND2   1 
ATOM   2583  N  N     . LEU A  1  340  ? 105.659 42.916  -19.381 1.00 62.26  ? 340  LEU A N     1 
ATOM   2584  C  CA    . LEU A  1  340  ? 106.968 43.095  -19.994 1.00 60.91  ? 340  LEU A CA    1 
ATOM   2585  C  C     . LEU A  1  340  ? 108.035 43.761  -19.101 1.00 65.83  ? 340  LEU A C     1 
ATOM   2586  O  O     . LEU A  1  340  ? 109.155 43.249  -19.055 1.00 66.92  ? 340  LEU A O     1 
ATOM   2587  C  CB    . LEU A  1  340  ? 106.836 43.804  -21.342 1.00 60.57  ? 340  LEU A CB    1 
ATOM   2588  C  CG    . LEU A  1  340  ? 106.194 42.944  -22.445 1.00 64.40  ? 340  LEU A CG    1 
ATOM   2589  C  CD1   . LEU A  1  340  ? 106.064 43.706  -23.702 1.00 65.42  ? 340  LEU A CD1   1 
ATOM   2590  C  CD2   . LEU A  1  340  ? 106.989 41.682  -22.736 1.00 64.23  ? 340  LEU A CD2   1 
ATOM   2591  N  N     . MET A  1  341  ? 107.722 44.854  -18.400 1.00 62.08  ? 341  MET A N     1 
ATOM   2592  C  CA    . MET A  1  341  ? 108.668 45.504  -17.483 1.00 62.38  ? 341  MET A CA    1 
ATOM   2593  C  C     . MET A  1  341  ? 108.768 44.692  -16.181 1.00 66.56  ? 341  MET A C     1 
ATOM   2594  O  O     . MET A  1  341  ? 109.714 44.888  -15.421 1.00 67.69  ? 341  MET A O     1 
ATOM   2595  C  CB    . MET A  1  341  ? 108.242 46.947  -17.127 1.00 65.73  ? 341  MET A CB    1 
ATOM   2596  C  CG    . MET A  1  341  ? 108.176 47.931  -18.283 1.00 70.72  ? 341  MET A CG    1 
ATOM   2597  S  SD    . MET A  1  341  ? 109.591 47.965  -19.397 1.00 76.32  ? 341  MET A SD    1 
ATOM   2598  C  CE    . MET A  1  341  ? 110.787 48.539  -18.344 1.00 73.42  ? 341  MET A CE    1 
ATOM   2599  N  N     . GLY A  1  342  ? 107.764 43.842  -15.931 1.00 61.37  ? 342  GLY A N     1 
ATOM   2600  C  CA    . GLY A  1  342  ? 107.628 42.950  -14.783 1.00 60.30  ? 342  GLY A CA    1 
ATOM   2601  C  C     . GLY A  1  342  ? 106.873 41.703  -15.207 1.00 65.03  ? 342  GLY A C     1 
ATOM   2602  O  O     . GLY A  1  342  ? 106.131 41.751  -16.193 1.00 65.49  ? 342  GLY A O     1 
ATOM   2603  N  N     . LYS A  1  343  ? 107.045 40.576  -14.474 1.00 60.60  ? 343  LYS A N     1 
ATOM   2604  C  CA    . LYS A  1  343  ? 106.445 39.260  -14.760 1.00 59.98  ? 343  LYS A CA    1 
ATOM   2605  C  C     . LYS A  1  343  ? 106.398 38.460  -13.504 1.00 67.56  ? 343  LYS A C     1 
ATOM   2606  O  O     . LYS A  1  343  ? 107.264 38.644  -12.650 1.00 68.36  ? 343  LYS A O     1 
ATOM   2607  C  CB    . LYS A  1  343  ? 107.415 38.419  -15.622 1.00 60.71  ? 343  LYS A CB    1 
ATOM   2608  C  CG    . LYS A  1  343  ? 107.450 38.693  -17.088 1.00 62.43  ? 343  LYS A CG    1 
ATOM   2609  C  CD    . LYS A  1  343  ? 108.744 38.196  -17.651 1.00 62.74  ? 343  LYS A CD    1 
ATOM   2610  C  CE    . LYS A  1  343  ? 109.156 39.136  -18.746 1.00 70.87  ? 343  LYS A CE    1 
ATOM   2611  N  NZ    . LYS A  1  343  ? 109.117 38.452  -20.041 1.00 79.33  ? 343  LYS A NZ    1 
ATOM   2612  N  N     . ARG A  1  344  ? 105.529 37.434  -13.458 1.00 65.10  ? 344  ARG A N     1 
ATOM   2613  C  CA    . ARG A  1  344  ? 105.580 36.456  -12.371 1.00 64.21  ? 344  ARG A CA    1 
ATOM   2614  C  C     . ARG A  1  344  ? 106.643 35.453  -12.858 1.00 65.56  ? 344  ARG A C     1 
ATOM   2615  O  O     . ARG A  1  344  ? 106.770 35.261  -14.063 1.00 64.99  ? 344  ARG A O     1 
ATOM   2616  C  CB    . ARG A  1  344  ? 104.210 35.829  -12.087 1.00 65.00  ? 344  ARG A CB    1 
ATOM   2617  C  CG    . ARG A  1  344  ? 103.390 36.711  -11.132 1.00 78.04  ? 344  ARG A CG    1 
ATOM   2618  C  CD    . ARG A  1  344  ? 101.980 36.233  -10.886 1.00 88.17  ? 344  ARG A CD    1 
ATOM   2619  N  NE    . ARG A  1  344  ? 101.279 36.010  -12.152 1.00 105.16 ? 344  ARG A NE    1 
ATOM   2620  C  CZ    . ARG A  1  344  ? 100.286 36.765  -12.605 1.00 124.20 ? 344  ARG A CZ    1 
ATOM   2621  N  NH1   . ARG A  1  344  ? 99.838  37.790  -11.886 1.00 117.36 ? 344  ARG A NH1   1 
ATOM   2622  N  NH2   . ARG A  1  344  ? 99.718  36.491  -13.771 1.00 103.82 ? 344  ARG A NH2   1 
ATOM   2623  N  N     . VAL A  1  345  ? 107.508 34.955  -11.968 1.00 60.18  ? 345  VAL A N     1 
ATOM   2624  C  CA    . VAL A  1  345  ? 108.630 34.122  -12.393 1.00 58.60  ? 345  VAL A CA    1 
ATOM   2625  C  C     . VAL A  1  345  ? 108.754 32.743  -11.693 1.00 64.23  ? 345  VAL A C     1 
ATOM   2626  O  O     . VAL A  1  345  ? 108.389 32.593  -10.519 1.00 63.78  ? 345  VAL A O     1 
ATOM   2627  C  CB    . VAL A  1  345  ? 109.949 34.918  -12.270 1.00 60.20  ? 345  VAL A CB    1 
ATOM   2628  C  CG1   . VAL A  1  345  ? 109.973 36.060  -13.260 1.00 59.86  ? 345  VAL A CG1   1 
ATOM   2629  C  CG2   . VAL A  1  345  ? 110.179 35.435  -10.848 1.00 59.46  ? 345  VAL A CG2   1 
ATOM   2630  N  N     . ASP A  1  346  ? 109.315 31.752  -12.436 1.00 60.87  ? 346  ASP A N     1 
ATOM   2631  C  CA    . ASP A  1  346  ? 109.654 30.414  -11.953 1.00 61.02  ? 346  ASP A CA    1 
ATOM   2632  C  C     . ASP A  1  346  ? 110.912 30.543  -11.047 1.00 67.43  ? 346  ASP A C     1 
ATOM   2633  O  O     . ASP A  1  346  ? 111.606 31.572  -11.115 1.00 68.46  ? 346  ASP A O     1 
ATOM   2634  C  CB    . ASP A  1  346  ? 109.995 29.521  -13.144 1.00 62.72  ? 346  ASP A CB    1 
ATOM   2635  C  CG    . ASP A  1  346  ? 108.832 28.980  -13.941 1.00 76.79  ? 346  ASP A CG    1 
ATOM   2636  O  OD1   . ASP A  1  346  ? 107.704 28.982  -13.417 1.00 77.97  ? 346  ASP A OD1   1 
ATOM   2637  O  OD2   . ASP A  1  346  ? 109.072 28.436  -15.049 1.00 85.26  ? 346  ASP A OD2   1 
ATOM   2638  N  N     . PHE A  1  347  ? 111.229 29.503  -10.233 1.00 63.07  ? 347  PHE A N     1 
ATOM   2639  C  CA    . PHE A  1  347  ? 112.389 29.481  -9.317  1.00 62.65  ? 347  PHE A CA    1 
ATOM   2640  C  C     . PHE A  1  347  ? 112.358 30.644  -8.319  1.00 67.62  ? 347  PHE A C     1 
ATOM   2641  O  O     . PHE A  1  347  ? 113.350 31.368  -8.135  1.00 66.68  ? 347  PHE A O     1 
ATOM   2642  C  CB    . PHE A  1  347  ? 113.726 29.376  -10.059 1.00 64.34  ? 347  PHE A CB    1 
ATOM   2643  C  CG    . PHE A  1  347  ? 113.710 28.195  -10.989 1.00 66.88  ? 347  PHE A CG    1 
ATOM   2644  C  CD1   . PHE A  1  347  ? 113.969 26.917  -10.517 1.00 70.17  ? 347  PHE A CD1   1 
ATOM   2645  C  CD2   . PHE A  1  347  ? 113.369 28.350  -12.328 1.00 71.37  ? 347  PHE A CD2   1 
ATOM   2646  C  CE1   . PHE A  1  347  ? 113.876 25.812  -11.361 1.00 74.16  ? 347  PHE A CE1   1 
ATOM   2647  C  CE2   . PHE A  1  347  ? 113.297 27.249  -13.181 1.00 73.32  ? 347  PHE A CE2   1 
ATOM   2648  C  CZ    . PHE A  1  347  ? 113.542 25.984  -12.689 1.00 73.18  ? 347  PHE A CZ    1 
ATOM   2649  N  N     . SER A  1  348  ? 111.187 30.789  -7.666  1.00 64.27  ? 348  SER A N     1 
ATOM   2650  C  CA    . SER A  1  348  ? 110.896 31.810  -6.674  1.00 64.22  ? 348  SER A CA    1 
ATOM   2651  C  C     . SER A  1  348  ? 110.219 31.195  -5.450  1.00 68.02  ? 348  SER A C     1 
ATOM   2652  O  O     . SER A  1  348  ? 109.516 30.197  -5.570  1.00 69.20  ? 348  SER A O     1 
ATOM   2653  C  CB    . SER A  1  348  ? 110.000 32.890  -7.277  1.00 69.08  ? 348  SER A CB    1 
ATOM   2654  O  OG    . SER A  1  348  ? 108.709 32.406  -7.618  1.00 79.61  ? 348  SER A OG    1 
ATOM   2655  N  N     . ALA A  1  349  ? 110.408 31.800  -4.279  1.00 62.34  ? 349  ALA A N     1 
ATOM   2656  C  CA    . ALA A  1  349  ? 109.791 31.339  -3.046  1.00 61.04  ? 349  ALA A CA    1 
ATOM   2657  C  C     . ALA A  1  349  ? 109.562 32.513  -2.122  1.00 64.69  ? 349  ALA A C     1 
ATOM   2658  O  O     . ALA A  1  349  ? 110.340 33.487  -2.130  1.00 65.13  ? 349  ALA A O     1 
ATOM   2659  C  CB    . ALA A  1  349  ? 110.695 30.338  -2.363  1.00 61.51  ? 349  ALA A CB    1 
ATOM   2660  N  N     . ARG A  1  350  ? 108.507 32.412  -1.304  1.00 58.83  ? 350  ARG A N     1 
ATOM   2661  C  CA    . ARG A  1  350  ? 108.142 33.414  -0.303  1.00 57.66  ? 350  ARG A CA    1 
ATOM   2662  C  C     . ARG A  1  350  ? 107.574 32.714  0.940   1.00 61.39  ? 350  ARG A C     1 
ATOM   2663  O  O     . ARG A  1  350  ? 106.879 31.703  0.826   1.00 59.89  ? 350  ARG A O     1 
ATOM   2664  C  CB    . ARG A  1  350  ? 107.139 34.397  -0.901  1.00 55.98  ? 350  ARG A CB    1 
ATOM   2665  C  CG    . ARG A  1  350  ? 106.692 35.515  -0.008  1.00 61.52  ? 350  ARG A CG    1 
ATOM   2666  C  CD    . ARG A  1  350  ? 105.671 36.339  -0.749  1.00 61.57  ? 350  ARG A CD    1 
ATOM   2667  N  NE    . ARG A  1  350  ? 104.976 37.249  0.155   1.00 62.21  ? 350  ARG A NE    1 
ATOM   2668  C  CZ    . ARG A  1  350  ? 105.165 38.560  0.202   1.00 77.44  ? 350  ARG A CZ    1 
ATOM   2669  N  NH1   . ARG A  1  350  ? 106.036 39.143  -0.614  1.00 62.81  ? 350  ARG A NH1   1 
ATOM   2670  N  NH2   . ARG A  1  350  ? 104.488 39.299  1.068   1.00 76.37  ? 350  ARG A NH2   1 
ATOM   2671  N  N     . THR A  1  351  ? 107.936 33.230  2.121   1.00 58.64  ? 351  THR A N     1 
ATOM   2672  C  CA    . THR A  1  351  ? 107.524 32.770  3.450   1.00 58.62  ? 351  THR A CA    1 
ATOM   2673  C  C     . THR A  1  351  ? 107.898 33.823  4.487   1.00 65.12  ? 351  THR A C     1 
ATOM   2674  O  O     . THR A  1  351  ? 108.702 34.734  4.214   1.00 65.63  ? 351  THR A O     1 
ATOM   2675  C  CB    . THR A  1  351  ? 108.130 31.407  3.834   1.00 61.68  ? 351  THR A CB    1 
ATOM   2676  O  OG1   . THR A  1  351  ? 107.494 30.979  5.035   1.00 62.34  ? 351  THR A OG1   1 
ATOM   2677  C  CG2   . THR A  1  351  ? 109.620 31.477  4.099   1.00 60.32  ? 351  THR A CG2   1 
ATOM   2678  N  N     . VAL A  1  352  ? 107.359 33.646  5.701   1.00 61.99  ? 352  VAL A N     1 
ATOM   2679  C  CA    . VAL A  1  352  ? 107.586 34.507  6.851   1.00 61.74  ? 352  VAL A CA    1 
ATOM   2680  C  C     . VAL A  1  352  ? 109.076 34.588  7.214   1.00 70.61  ? 352  VAL A C     1 
ATOM   2681  O  O     . VAL A  1  352  ? 109.812 33.640  6.972   1.00 72.32  ? 352  VAL A O     1 
ATOM   2682  C  CB    . VAL A  1  352  ? 106.722 34.039  8.008   1.00 63.46  ? 352  VAL A CB    1 
ATOM   2683  C  CG1   . VAL A  1  352  ? 106.955 34.895  9.237   1.00 63.79  ? 352  VAL A CG1   1 
ATOM   2684  C  CG2   . VAL A  1  352  ? 105.258 34.055  7.600   1.00 62.66  ? 352  VAL A CG2   1 
ATOM   2685  N  N     . ILE A  1  353  ? 109.533 35.750  7.682   1.00 67.91  ? 353  ILE A N     1 
ATOM   2686  C  CA    . ILE A  1  353  ? 110.930 35.915  8.033   1.00 67.74  ? 353  ILE A CA    1 
ATOM   2687  C  C     . ILE A  1  353  ? 111.106 36.005  9.528   1.00 75.36  ? 353  ILE A C     1 
ATOM   2688  O  O     . ILE A  1  353  ? 110.246 36.543  10.240  1.00 77.19  ? 353  ILE A O     1 
ATOM   2689  C  CB    . ILE A  1  353  ? 111.681 37.039  7.282   1.00 69.27  ? 353  ILE A CB    1 
ATOM   2690  C  CG1   . ILE A  1  353  ? 110.874 38.331  7.180   1.00 68.19  ? 353  ILE A CG1   1 
ATOM   2691  C  CG2   . ILE A  1  353  ? 112.124 36.541  5.930   1.00 69.65  ? 353  ILE A CG2   1 
ATOM   2692  C  CD1   . ILE A  1  353  ? 111.436 39.373  7.940   1.00 68.16  ? 353  ILE A CD1   1 
ATOM   2693  N  N     . SER A  1  354  ? 112.227 35.426  9.986   1.00 71.01  ? 354  SER A N     1 
ATOM   2694  C  CA    . SER A  1  354  ? 112.696 35.354  11.355  1.00 70.37  ? 354  SER A CA    1 
ATOM   2695  C  C     . SER A  1  354  ? 114.183 35.762  11.391  1.00 73.15  ? 354  SER A C     1 
ATOM   2696  O  O     . SER A  1  354  ? 114.866 35.716  10.368  1.00 71.78  ? 354  SER A O     1 
ATOM   2697  C  CB    . SER A  1  354  ? 112.489 33.946  11.896  1.00 72.84  ? 354  SER A CB    1 
ATOM   2698  O  OG    . SER A  1  354  ? 111.156 33.826  12.366  1.00 81.01  ? 354  SER A OG    1 
ATOM   2699  N  N     . GLY A  1  355  ? 114.642 36.227  12.545  1.00 69.71  ? 355  GLY A N     1 
ATOM   2700  C  CA    . GLY A  1  355  ? 116.021 36.650  12.738  1.00 68.96  ? 355  GLY A CA    1 
ATOM   2701  C  C     . GLY A  1  355  ? 116.806 35.602  13.475  1.00 71.74  ? 355  GLY A C     1 
ATOM   2702  O  O     . GLY A  1  355  ? 116.275 34.961  14.390  1.00 72.50  ? 355  GLY A O     1 
ATOM   2703  N  N     . ASP A  1  356  ? 118.069 35.426  13.084  1.00 66.45  ? 356  ASP A N     1 
ATOM   2704  C  CA    . ASP A  1  356  ? 118.926 34.419  13.689  1.00 66.05  ? 356  ASP A CA    1 
ATOM   2705  C  C     . ASP A  1  356  ? 120.311 34.949  14.132  1.00 71.50  ? 356  ASP A C     1 
ATOM   2706  O  O     . ASP A  1  356  ? 121.117 35.266  13.254  1.00 73.07  ? 356  ASP A O     1 
ATOM   2707  C  CB    . ASP A  1  356  ? 119.085 33.260  12.715  1.00 66.59  ? 356  ASP A CB    1 
ATOM   2708  C  CG    . ASP A  1  356  ? 119.380 31.932  13.369  1.00 75.55  ? 356  ASP A CG    1 
ATOM   2709  O  OD1   . ASP A  1  356  ? 120.168 31.908  14.332  1.00 76.33  ? 356  ASP A OD1   1 
ATOM   2710  O  OD2   . ASP A  1  356  ? 118.908 30.905  12.851  1.00 79.42  ? 356  ASP A OD2   1 
ATOM   2711  N  N     . PRO A  1  357  ? 120.646 34.993  15.461  1.00 65.98  ? 357  PRO A N     1 
ATOM   2712  C  CA    . PRO A  1  357  ? 121.991 35.452  15.864  1.00 66.18  ? 357  PRO A CA    1 
ATOM   2713  C  C     . PRO A  1  357  ? 123.137 34.543  15.392  1.00 71.35  ? 357  PRO A C     1 
ATOM   2714  O  O     . PRO A  1  357  ? 124.286 35.008  15.288  1.00 72.28  ? 357  PRO A O     1 
ATOM   2715  C  CB    . PRO A  1  357  ? 121.933 35.469  17.398  1.00 68.67  ? 357  PRO A CB    1 
ATOM   2716  C  CG    . PRO A  1  357  ? 120.515 35.260  17.775  1.00 72.10  ? 357  PRO A CG    1 
ATOM   2717  C  CD    . PRO A  1  357  ? 119.817 34.646  16.632  1.00 67.00  ? 357  PRO A CD    1 
ATOM   2718  N  N     . ASN A  1  358  ? 122.831 33.245  15.103  1.00 65.83  ? 358  ASN A N     1 
ATOM   2719  C  CA    . ASN A  1  358  ? 123.843 32.281  14.688  1.00 64.24  ? 358  ASN A CA    1 
ATOM   2720  C  C     . ASN A  1  358  ? 123.860 32.036  13.169  1.00 69.26  ? 358  ASN A C     1 
ATOM   2721  O  O     . ASN A  1  358  ? 124.214 30.947  12.701  1.00 71.56  ? 358  ASN A O     1 
ATOM   2722  C  CB    . ASN A  1  358  ? 123.732 31.000  15.492  1.00 56.55  ? 358  ASN A CB    1 
ATOM   2723  C  CG    . ASN A  1  358  ? 123.837 31.234  16.982  1.00 75.61  ? 358  ASN A CG    1 
ATOM   2724  O  OD1   . ASN A  1  358  ? 124.768 31.888  17.488  1.00 70.13  ? 358  ASN A OD1   1 
ATOM   2725  N  ND2   . ASN A  1  358  ? 122.860 30.730  17.724  1.00 65.83  ? 358  ASN A ND2   1 
ATOM   2726  N  N     . LEU A  1  359  ? 123.508 33.060  12.394  1.00 62.98  ? 359  LEU A N     1 
ATOM   2727  C  CA    . LEU A  1  359  ? 123.623 33.002  10.943  1.00 61.18  ? 359  LEU A CA    1 
ATOM   2728  C  C     . LEU A  1  359  ? 124.615 34.114  10.565  1.00 68.46  ? 359  LEU A C     1 
ATOM   2729  O  O     . LEU A  1  359  ? 124.661 35.151  11.238  1.00 69.61  ? 359  LEU A O     1 
ATOM   2730  C  CB    . LEU A  1  359  ? 122.284 33.189  10.228  1.00 59.43  ? 359  LEU A CB    1 
ATOM   2731  C  CG    . LEU A  1  359  ? 121.328 32.001  10.055  1.00 62.45  ? 359  LEU A CG    1 
ATOM   2732  C  CD1   . LEU A  1  359  ? 120.390 32.267  8.916   1.00 61.56  ? 359  LEU A CD1   1 
ATOM   2733  C  CD2   . LEU A  1  359  ? 122.038 30.691  9.789   1.00 63.61  ? 359  LEU A CD2   1 
ATOM   2734  N  N     . GLU A  1  360  ? 125.478 33.865  9.572   1.00 64.74  ? 360  GLU A N     1 
ATOM   2735  C  CA    . GLU A  1  360  ? 126.470 34.839  9.160   1.00 64.36  ? 360  GLU A CA    1 
ATOM   2736  C  C     . GLU A  1  360  ? 125.779 35.949  8.358   1.00 71.74  ? 360  GLU A C     1 
ATOM   2737  O  O     . GLU A  1  360  ? 124.744 35.678  7.729   1.00 72.23  ? 360  GLU A O     1 
ATOM   2738  C  CB    . GLU A  1  360  ? 127.606 34.151  8.396   1.00 65.34  ? 360  GLU A CB    1 
ATOM   2739  C  CG    . GLU A  1  360  ? 128.714 33.644  9.312   1.00 78.86  ? 360  GLU A CG    1 
ATOM   2740  C  CD    . GLU A  1  360  ? 129.508 34.667  10.119  1.00 115.09 ? 360  GLU A CD    1 
ATOM   2741  O  OE1   . GLU A  1  360  ? 129.458 35.882  9.796   1.00 121.51 ? 360  GLU A OE1   1 
ATOM   2742  O  OE2   . GLU A  1  360  ? 130.198 34.241  11.077  1.00 107.17 ? 360  GLU A OE2   1 
ATOM   2743  N  N     . LEU A  1  361  ? 126.299 37.207  8.416   1.00 68.33  ? 361  LEU A N     1 
ATOM   2744  C  CA    . LEU A  1  361  ? 125.674 38.342  7.718   1.00 66.67  ? 361  LEU A CA    1 
ATOM   2745  C  C     . LEU A  1  361  ? 125.058 37.955  6.370   1.00 69.46  ? 361  LEU A C     1 
ATOM   2746  O  O     . LEU A  1  361  ? 123.847 38.132  6.172   1.00 69.51  ? 361  LEU A O     1 
ATOM   2747  C  CB    . LEU A  1  361  ? 126.652 39.521  7.562   1.00 66.43  ? 361  LEU A CB    1 
ATOM   2748  C  CG    . LEU A  1  361  ? 126.038 40.887  7.260   1.00 70.10  ? 361  LEU A CG    1 
ATOM   2749  C  CD1   . LEU A  1  361  ? 125.686 41.600  8.529   1.00 70.39  ? 361  LEU A CD1   1 
ATOM   2750  C  CD2   . LEU A  1  361  ? 127.021 41.760  6.524   1.00 73.47  ? 361  LEU A CD2   1 
ATOM   2751  N  N     . ASP A  1  362  ? 125.879 37.310  5.513   1.00 65.14  ? 362  ASP A N     1 
ATOM   2752  C  CA    . ASP A  1  362  ? 125.567 36.923  4.136   1.00 64.76  ? 362  ASP A CA    1 
ATOM   2753  C  C     . ASP A  1  362  ? 124.831 35.586  3.960   1.00 70.05  ? 362  ASP A C     1 
ATOM   2754  O  O     . ASP A  1  362  ? 124.574 35.189  2.821   1.00 72.11  ? 362  ASP A O     1 
ATOM   2755  C  CB    . ASP A  1  362  ? 126.831 36.944  3.271   1.00 66.54  ? 362  ASP A CB    1 
ATOM   2756  C  CG    . ASP A  1  362  ? 127.948 36.035  3.734   1.00 80.98  ? 362  ASP A CG    1 
ATOM   2757  O  OD1   . ASP A  1  362  ? 128.350 36.129  4.925   1.00 82.35  ? 362  ASP A OD1   1 
ATOM   2758  O  OD2   . ASP A  1  362  ? 128.476 35.291  2.901   1.00 89.22  ? 362  ASP A OD2   1 
ATOM   2759  N  N     . GLN A  1  363  ? 124.434 34.915  5.037   1.00 62.95  ? 363  GLN A N     1 
ATOM   2760  C  CA    . GLN A  1  363  ? 123.678 33.695  4.820   1.00 60.77  ? 363  GLN A CA    1 
ATOM   2761  C  C     . GLN A  1  363  ? 122.186 34.030  4.830   1.00 64.54  ? 363  GLN A C     1 
ATOM   2762  O  O     . GLN A  1  363  ? 121.788 35.107  5.287   1.00 66.63  ? 363  GLN A O     1 
ATOM   2763  C  CB    . GLN A  1  363  ? 123.974 32.663  5.917   1.00 62.04  ? 363  GLN A CB    1 
ATOM   2764  C  CG    . GLN A  1  363  ? 125.409 32.195  6.016   1.00 65.22  ? 363  GLN A CG    1 
ATOM   2765  C  CD    . GLN A  1  363  ? 125.538 31.099  7.032   1.00 81.73  ? 363  GLN A CD    1 
ATOM   2766  O  OE1   . GLN A  1  363  ? 125.405 31.300  8.240   1.00 77.90  ? 363  GLN A OE1   1 
ATOM   2767  N  NE2   . GLN A  1  363  ? 125.777 29.898  6.557   1.00 81.58  ? 363  GLN A NE2   1 
ATOM   2768  N  N     . VAL A  1  364  ? 121.369 33.089  4.350   1.00 58.63  ? 364  VAL A N     1 
ATOM   2769  C  CA    . VAL A  1  364  ? 119.912 33.067  4.402   1.00 56.91  ? 364  VAL A CA    1 
ATOM   2770  C  C     . VAL A  1  364  ? 119.478 31.636  4.858   1.00 63.94  ? 364  VAL A C     1 
ATOM   2771  O  O     . VAL A  1  364  ? 119.999 30.625  4.370   1.00 63.89  ? 364  VAL A O     1 
ATOM   2772  C  CB    . VAL A  1  364  ? 119.223 33.551  3.106   1.00 58.27  ? 364  VAL A CB    1 
ATOM   2773  C  CG1   . VAL A  1  364  ? 119.440 32.585  1.950   1.00 57.43  ? 364  VAL A CG1   1 
ATOM   2774  C  CG2   . VAL A  1  364  ? 117.737 33.798  3.328   1.00 57.76  ? 364  VAL A CG2   1 
ATOM   2775  N  N     . GLY A  1  365  ? 118.601 31.580  5.847   1.00 62.00  ? 365  GLY A N     1 
ATOM   2776  C  CA    . GLY A  1  365  ? 118.079 30.327  6.369   1.00 62.68  ? 365  GLY A CA    1 
ATOM   2777  C  C     . GLY A  1  365  ? 116.986 29.850  5.449   1.00 69.25  ? 365  GLY A C     1 
ATOM   2778  O  O     . GLY A  1  365  ? 116.014 30.568  5.224   1.00 70.91  ? 365  GLY A O     1 
ATOM   2779  N  N     . VAL A  1  366  ? 117.155 28.695  4.838   1.00 65.45  ? 366  VAL A N     1 
ATOM   2780  C  CA    . VAL A  1  366  ? 116.132 28.249  3.903   1.00 64.26  ? 366  VAL A CA    1 
ATOM   2781  C  C     . VAL A  1  366  ? 115.404 26.996  4.423   1.00 67.98  ? 366  VAL A C     1 
ATOM   2782  O  O     . VAL A  1  366  ? 116.021 25.936  4.575   1.00 67.91  ? 366  VAL A O     1 
ATOM   2783  C  CB    . VAL A  1  366  ? 116.679 28.086  2.463   1.00 67.04  ? 366  VAL A CB    1 
ATOM   2784  C  CG1   . VAL A  1  366  ? 115.590 27.629  1.502   1.00 66.41  ? 366  VAL A CG1   1 
ATOM   2785  C  CG2   . VAL A  1  366  ? 117.310 29.379  1.973   1.00 66.42  ? 366  VAL A CG2   1 
ATOM   2786  N  N     . PRO A  1  367  ? 114.079 27.115  4.686   1.00 62.97  ? 367  PRO A N     1 
ATOM   2787  C  CA    . PRO A  1  367  ? 113.300 25.941  5.109   1.00 61.64  ? 367  PRO A CA    1 
ATOM   2788  C  C     . PRO A  1  367  ? 113.568 24.766  4.183   1.00 62.24  ? 367  PRO A C     1 
ATOM   2789  O  O     . PRO A  1  367  ? 113.589 24.971  2.969   1.00 59.57  ? 367  PRO A O     1 
ATOM   2790  C  CB    . PRO A  1  367  ? 111.858 26.419  4.939   1.00 63.51  ? 367  PRO A CB    1 
ATOM   2791  C  CG    . PRO A  1  367  ? 111.929 27.892  5.184   1.00 68.48  ? 367  PRO A CG    1 
ATOM   2792  C  CD    . PRO A  1  367  ? 113.221 28.317  4.568   1.00 64.25  ? 367  PRO A CD    1 
ATOM   2793  N  N     . LYS A  1  368  ? 113.805 23.548  4.754   1.00 59.56  ? 368  LYS A N     1 
ATOM   2794  C  CA    . LYS A  1  368  ? 114.077 22.303  4.016   1.00 58.96  ? 368  LYS A CA    1 
ATOM   2795  C  C     . LYS A  1  368  ? 113.098 22.107  2.842   1.00 64.58  ? 368  LYS A C     1 
ATOM   2796  O  O     . LYS A  1  368  ? 113.544 21.800  1.723   1.00 64.55  ? 368  LYS A O     1 
ATOM   2797  C  CB    . LYS A  1  368  ? 114.078 21.074  4.955   1.00 60.43  ? 368  LYS A CB    1 
ATOM   2798  C  CG    . LYS A  1  368  ? 114.621 19.750  4.342   1.00 68.22  ? 368  LYS A CG    1 
ATOM   2799  C  CD    . LYS A  1  368  ? 114.807 18.651  5.436   1.00 81.30  ? 368  LYS A CD    1 
ATOM   2800  C  CE    . LYS A  1  368  ? 115.199 17.235  4.998   1.00 98.20  ? 368  LYS A CE    1 
ATOM   2801  N  NZ    . LYS A  1  368  ? 114.064 16.370  4.512   1.00 104.43 ? 368  LYS A NZ    1 
ATOM   2802  N  N     . SER A  1  369  ? 111.774 22.334  3.092   1.00 60.67  ? 369  SER A N     1 
ATOM   2803  C  CA    . SER A  1  369  ? 110.720 22.164  2.094   1.00 60.53  ? 369  SER A CA    1 
ATOM   2804  C  C     . SER A  1  369  ? 110.932 23.049  0.873   1.00 66.78  ? 369  SER A C     1 
ATOM   2805  O  O     . SER A  1  369  ? 110.747 22.577  -0.255  1.00 67.59  ? 369  SER A O     1 
ATOM   2806  C  CB    . SER A  1  369  ? 109.335 22.336  2.707   1.00 63.84  ? 369  SER A CB    1 
ATOM   2807  O  OG    . SER A  1  369  ? 108.988 23.691  2.928   1.00 77.71  ? 369  SER A OG    1 
ATOM   2808  N  N     . ILE A  1  370  ? 111.416 24.290  1.097   1.00 63.12  ? 370  ILE A N     1 
ATOM   2809  C  CA    . ILE A  1  370  ? 111.717 25.256  0.044   1.00 62.42  ? 370  ILE A CA    1 
ATOM   2810  C  C     . ILE A  1  370  ? 112.931 24.786  -0.729  1.00 68.76  ? 370  ILE A C     1 
ATOM   2811  O  O     . ILE A  1  370  ? 112.931 24.909  -1.955  1.00 70.75  ? 370  ILE A O     1 
ATOM   2812  C  CB    . ILE A  1  370  ? 111.829 26.724  0.561   1.00 65.03  ? 370  ILE A CB    1 
ATOM   2813  C  CG1   . ILE A  1  370  ? 110.452 27.272  1.058   1.00 64.62  ? 370  ILE A CG1   1 
ATOM   2814  C  CG2   . ILE A  1  370  ? 112.428 27.638  -0.496  1.00 64.74  ? 370  ILE A CG2   1 
ATOM   2815  C  CD1   . ILE A  1  370  ? 110.511 28.550  1.826   1.00 61.06  ? 370  ILE A CD1   1 
ATOM   2816  N  N     . ALA A  1  371  ? 113.937 24.192  -0.044  1.00 65.25  ? 371  ALA A N     1 
ATOM   2817  C  CA    . ALA A  1  371  ? 115.142 23.660  -0.713  1.00 64.60  ? 371  ALA A CA    1 
ATOM   2818  C  C     . ALA A  1  371  ? 114.765 22.476  -1.576  1.00 66.89  ? 371  ALA A C     1 
ATOM   2819  O  O     . ALA A  1  371  ? 115.219 22.386  -2.705  1.00 66.08  ? 371  ALA A O     1 
ATOM   2820  C  CB    . ALA A  1  371  ? 116.186 23.243  0.307   1.00 65.63  ? 371  ALA A CB    1 
ATOM   2821  N  N     . LYS A  1  372  ? 113.857 21.628  -1.076  1.00 63.46  ? 372  LYS A N     1 
ATOM   2822  C  CA    . LYS A  1  372  ? 113.375 20.447  -1.783  1.00 63.42  ? 372  LYS A CA    1 
ATOM   2823  C  C     . LYS A  1  372  ? 112.535 20.758  -3.065  1.00 68.45  ? 372  LYS A C     1 
ATOM   2824  O  O     . LYS A  1  372  ? 112.377 19.870  -3.934  1.00 69.24  ? 372  LYS A O     1 
ATOM   2825  C  CB    . LYS A  1  372  ? 112.620 19.523  -0.832  1.00 64.61  ? 372  LYS A CB    1 
ATOM   2826  C  CG    . LYS A  1  372  ? 113.516 18.850  0.203   1.00 69.12  ? 372  LYS A CG    1 
ATOM   2827  C  CD    . LYS A  1  372  ? 113.030 17.456  0.587   1.00 72.43  ? 372  LYS A CD    1 
ATOM   2828  C  CE    . LYS A  1  372  ? 111.688 17.451  1.268   1.00 68.02  ? 372  LYS A CE    1 
ATOM   2829  N  NZ    . LYS A  1  372  ? 111.359 16.120  1.789   1.00 80.98  ? 372  LYS A NZ    1 
ATOM   2830  N  N     . THR A  1  373  ? 112.016 22.012  -3.182  1.00 62.58  ? 373  THR A N     1 
ATOM   2831  C  CA    . THR A  1  373  ? 111.192 22.476  -4.312  1.00 60.94  ? 373  THR A CA    1 
ATOM   2832  C  C     . THR A  1  373  ? 112.053 23.172  -5.333  1.00 63.45  ? 373  THR A C     1 
ATOM   2833  O  O     . THR A  1  373  ? 112.023 22.796  -6.502  1.00 62.03  ? 373  THR A O     1 
ATOM   2834  C  CB    . THR A  1  373  ? 110.139 23.471  -3.833  1.00 64.60  ? 373  THR A CB    1 
ATOM   2835  O  OG1   . THR A  1  373  ? 109.392 22.917  -2.761  1.00 64.81  ? 373  THR A OG1   1 
ATOM   2836  C  CG2   . THR A  1  373  ? 109.228 23.936  -4.940  1.00 63.51  ? 373  THR A CG2   1 
ATOM   2837  N  N     . LEU A  1  374  ? 112.762 24.238  -4.889  1.00 60.52  ? 374  LEU A N     1 
ATOM   2838  C  CA    . LEU A  1  374  ? 113.636 25.069  -5.701  1.00 60.48  ? 374  LEU A CA    1 
ATOM   2839  C  C     . LEU A  1  374  ? 114.824 24.242  -6.161  1.00 66.66  ? 374  LEU A C     1 
ATOM   2840  O  O     . LEU A  1  374  ? 115.584 23.699  -5.346  1.00 67.74  ? 374  LEU A O     1 
ATOM   2841  C  CB    . LEU A  1  374  ? 114.100 26.318  -4.934  1.00 60.28  ? 374  LEU A CB    1 
ATOM   2842  C  CG    . LEU A  1  374  ? 113.045 27.318  -4.485  1.00 64.29  ? 374  LEU A CG    1 
ATOM   2843  C  CD1   . LEU A  1  374  ? 113.677 28.399  -3.672  1.00 64.02  ? 374  LEU A CD1   1 
ATOM   2844  C  CD2   . LEU A  1  374  ? 112.376 27.968  -5.660  1.00 67.29  ? 374  LEU A CD2   1 
ATOM   2845  N  N     . THR A  1  375  ? 114.966 24.144  -7.477  1.00 62.51  ? 375  THR A N     1 
ATOM   2846  C  CA    . THR A  1  375  ? 115.974 23.337  -8.118  1.00 62.52  ? 375  THR A CA    1 
ATOM   2847  C  C     . THR A  1  375  ? 117.061 24.191  -8.827  1.00 67.17  ? 375  THR A C     1 
ATOM   2848  O  O     . THR A  1  375  ? 116.864 25.387  -9.055  1.00 67.38  ? 375  THR A O     1 
ATOM   2849  C  CB    . THR A  1  375  ? 115.216 22.355  -9.019  1.00 70.29  ? 375  THR A CB    1 
ATOM   2850  O  OG1   . THR A  1  375  ? 115.744 21.063  -8.799  1.00 78.04  ? 375  THR A OG1   1 
ATOM   2851  C  CG2   . THR A  1  375  ? 115.217 22.729  -10.517 1.00 66.74  ? 375  THR A CG2   1 
ATOM   2852  N  N     . TYR A  1  376  ? 118.217 23.574  -9.130  1.00 63.08  ? 376  TYR A N     1 
ATOM   2853  C  CA    . TYR A  1  376  ? 119.312 24.184  -9.878  1.00 62.30  ? 376  TYR A CA    1 
ATOM   2854  C  C     . TYR A  1  376  ? 119.818 23.187  -10.951 1.00 67.50  ? 376  TYR A C     1 
ATOM   2855  O  O     . TYR A  1  376  ? 120.126 22.046  -10.601 1.00 67.73  ? 376  TYR A O     1 
ATOM   2856  C  CB    . TYR A  1  376  ? 120.458 24.670  -8.978  1.00 62.59  ? 376  TYR A CB    1 
ATOM   2857  C  CG    . TYR A  1  376  ? 121.601 25.244  -9.787  1.00 64.81  ? 376  TYR A CG    1 
ATOM   2858  C  CD1   . TYR A  1  376  ? 121.590 26.572  -10.202 1.00 66.76  ? 376  TYR A CD1   1 
ATOM   2859  C  CD2   . TYR A  1  376  ? 122.661 24.439  -10.209 1.00 65.99  ? 376  TYR A CD2   1 
ATOM   2860  C  CE1   . TYR A  1  376  ? 122.605 27.087  -11.017 1.00 66.28  ? 376  TYR A CE1   1 
ATOM   2861  C  CE2   . TYR A  1  376  ? 123.679 24.945  -11.024 1.00 66.44  ? 376  TYR A CE2   1 
ATOM   2862  C  CZ    . TYR A  1  376  ? 123.648 26.271  -11.415 1.00 69.21  ? 376  TYR A CZ    1 
ATOM   2863  O  OH    . TYR A  1  376  ? 124.657 26.785  -12.174 1.00 69.98  ? 376  TYR A OH    1 
ATOM   2864  N  N     . PRO A  1  377  ? 119.940 23.599  -12.240 1.00 64.19  ? 377  PRO A N     1 
ATOM   2865  C  CA    . PRO A  1  377  ? 120.399 22.660  -13.278 1.00 64.76  ? 377  PRO A CA    1 
ATOM   2866  C  C     . PRO A  1  377  ? 121.923 22.568  -13.402 1.00 71.20  ? 377  PRO A C     1 
ATOM   2867  O  O     . PRO A  1  377  ? 122.556 23.258  -14.225 1.00 73.09  ? 377  PRO A O     1 
ATOM   2868  C  CB    . PRO A  1  377  ? 119.769 23.231  -14.540 1.00 66.36  ? 377  PRO A CB    1 
ATOM   2869  C  CG    . PRO A  1  377  ? 119.762 24.712  -14.297 1.00 69.88  ? 377  PRO A CG    1 
ATOM   2870  C  CD    . PRO A  1  377  ? 119.607 24.916  -12.823 1.00 65.22  ? 377  PRO A CD    1 
ATOM   2871  N  N     . GLU A  1  378  ? 122.523 21.712  -12.579 1.00 65.62  ? 378  GLU A N     1 
ATOM   2872  C  CA    . GLU A  1  378  ? 123.956 21.516  -12.609 1.00 64.57  ? 378  GLU A CA    1 
ATOM   2873  C  C     . GLU A  1  378  ? 124.335 20.594  -13.830 1.00 71.43  ? 378  GLU A C     1 
ATOM   2874  O  O     . GLU A  1  378  ? 123.749 19.520  -13.981 1.00 71.34  ? 378  GLU A O     1 
ATOM   2875  C  CB    . GLU A  1  378  ? 124.387 20.968  -11.249 1.00 65.10  ? 378  GLU A CB    1 
ATOM   2876  C  CG    . GLU A  1  378  ? 125.864 20.690  -11.167 1.00 74.76  ? 378  GLU A CG    1 
ATOM   2877  C  CD    . GLU A  1  378  ? 126.518 20.948  -9.832  1.00 97.66  ? 378  GLU A CD    1 
ATOM   2878  O  OE1   . GLU A  1  378  ? 125.996 20.463  -8.804  1.00 87.21  ? 378  GLU A OE1   1 
ATOM   2879  O  OE2   . GLU A  1  378  ? 127.609 21.562  -9.827  1.00 100.73 ? 378  GLU A OE2   1 
ATOM   2880  N  N     . VAL A  1  379  ? 125.248 21.046  -14.732 1.00 69.14  ? 379  VAL A N     1 
ATOM   2881  C  CA    . VAL A  1  379  ? 125.659 20.236  -15.906 1.00 69.86  ? 379  VAL A CA    1 
ATOM   2882  C  C     . VAL A  1  379  ? 126.603 19.117  -15.468 1.00 77.69  ? 379  VAL A C     1 
ATOM   2883  O  O     . VAL A  1  379  ? 127.553 19.387  -14.724 1.00 78.32  ? 379  VAL A O     1 
ATOM   2884  C  CB    . VAL A  1  379  ? 126.286 21.065  -17.073 1.00 72.51  ? 379  VAL A CB    1 
ATOM   2885  C  CG1   . VAL A  1  379  ? 126.899 20.165  -18.141 1.00 71.93  ? 379  VAL A CG1   1 
ATOM   2886  C  CG2   . VAL A  1  379  ? 125.268 22.006  -17.700 1.00 71.80  ? 379  VAL A CG2   1 
ATOM   2887  N  N     . VAL A  1  380  ? 126.361 17.875  -15.966 1.00 75.71  ? 380  VAL A N     1 
ATOM   2888  C  CA    . VAL A  1  380  ? 127.167 16.689  -15.670 1.00 76.46  ? 380  VAL A CA    1 
ATOM   2889  C  C     . VAL A  1  380  ? 128.534 16.832  -16.310 1.00 81.84  ? 380  VAL A C     1 
ATOM   2890  O  O     . VAL A  1  380  ? 128.667 16.936  -17.522 1.00 81.85  ? 380  VAL A O     1 
ATOM   2891  C  CB    . VAL A  1  380  ? 126.470 15.346  -15.982 1.00 80.71  ? 380  VAL A CB    1 
ATOM   2892  C  CG1   . VAL A  1  380  ? 127.459 14.196  -15.905 1.00 81.59  ? 380  VAL A CG1   1 
ATOM   2893  C  CG2   . VAL A  1  380  ? 125.306 15.095  -15.025 1.00 79.90  ? 380  VAL A CG2   1 
ATOM   2894  N  N     . THR A  1  381  ? 129.533 16.907  -15.457 1.00 80.06  ? 381  THR A N     1 
ATOM   2895  C  CA    . THR A  1  381  ? 130.924 17.165  -15.779 1.00 81.00  ? 381  THR A CA    1 
ATOM   2896  C  C     . THR A  1  381  ? 131.750 16.087  -15.056 1.00 85.32  ? 381  THR A C     1 
ATOM   2897  O  O     . THR A  1  381  ? 131.204 15.486  -14.127 1.00 85.61  ? 381  THR A O     1 
ATOM   2898  C  CB    . THR A  1  381  ? 131.195 18.650  -15.372 1.00 94.93  ? 381  THR A CB    1 
ATOM   2899  O  OG1   . THR A  1  381  ? 132.093 19.267  -16.285 1.00 102.07 ? 381  THR A OG1   1 
ATOM   2900  C  CG2   . THR A  1  381  ? 131.656 18.835  -13.930 1.00 91.16  ? 381  THR A CG2   1 
ATOM   2901  N  N     . PRO A  1  382  ? 133.026 15.795  -15.423 1.00 81.56  ? 382  PRO A N     1 
ATOM   2902  C  CA    . PRO A  1  382  ? 133.779 14.764  -14.685 1.00 81.69  ? 382  PRO A CA    1 
ATOM   2903  C  C     . PRO A  1  382  ? 134.050 15.148  -13.241 1.00 86.95  ? 382  PRO A C     1 
ATOM   2904  O  O     . PRO A  1  382  ? 134.134 14.246  -12.408 1.00 86.96  ? 382  PRO A O     1 
ATOM   2905  C  CB    . PRO A  1  382  ? 135.077 14.635  -15.476 1.00 83.85  ? 382  PRO A CB    1 
ATOM   2906  C  CG    . PRO A  1  382  ? 134.794 15.255  -16.794 1.00 88.23  ? 382  PRO A CG    1 
ATOM   2907  C  CD    . PRO A  1  382  ? 133.859 16.370  -16.491 1.00 83.08  ? 382  PRO A CD    1 
ATOM   2908  N  N     . TYR A  1  383  ? 134.125 16.482  -12.935 1.00 83.97  ? 383  TYR A N     1 
ATOM   2909  C  CA    . TYR A  1  383  ? 134.346 16.995  -11.575 1.00 83.79  ? 383  TYR A CA    1 
ATOM   2910  C  C     . TYR A  1  383  ? 133.135 16.781  -10.633 1.00 86.11  ? 383  TYR A C     1 
ATOM   2911  O  O     . TYR A  1  383  ? 133.311 16.873  -9.411  1.00 85.87  ? 383  TYR A O     1 
ATOM   2912  C  CB    . TYR A  1  383  ? 134.816 18.475  -11.528 1.00 85.18  ? 383  TYR A CB    1 
ATOM   2913  C  CG    . TYR A  1  383  ? 135.288 19.090  -12.829 1.00 88.46  ? 383  TYR A CG    1 
ATOM   2914  C  CD1   . TYR A  1  383  ? 136.534 18.771  -13.365 1.00 89.88  ? 383  TYR A CD1   1 
ATOM   2915  C  CD2   . TYR A  1  383  ? 134.553 20.092  -13.452 1.00 90.85  ? 383  TYR A CD2   1 
ATOM   2916  C  CE1   . TYR A  1  383  ? 136.989 19.360  -14.548 1.00 91.04  ? 383  TYR A CE1   1 
ATOM   2917  C  CE2   . TYR A  1  383  ? 134.995 20.691  -14.633 1.00 93.51  ? 383  TYR A CE2   1 
ATOM   2918  C  CZ    . TYR A  1  383  ? 136.213 20.318  -15.185 1.00 101.83 ? 383  TYR A CZ    1 
ATOM   2919  O  OH    . TYR A  1  383  ? 136.635 20.909  -16.365 1.00 105.71 ? 383  TYR A OH    1 
ATOM   2920  N  N     . ASN A  1  384  ? 131.922 16.489  -11.181 1.00 80.89  ? 384  ASN A N     1 
ATOM   2921  C  CA    . ASN A  1  384  ? 130.725 16.286  -10.348 1.00 79.81  ? 384  ASN A CA    1 
ATOM   2922  C  C     . ASN A  1  384  ? 129.902 15.042  -10.675 1.00 82.89  ? 384  ASN A C     1 
ATOM   2923  O  O     . ASN A  1  384  ? 128.855 14.823  -10.048 1.00 82.03  ? 384  ASN A O     1 
ATOM   2924  C  CB    . ASN A  1  384  ? 129.818 17.529  -10.364 1.00 76.83  ? 384  ASN A CB    1 
ATOM   2925  C  CG    . ASN A  1  384  ? 129.090 17.840  -11.648 1.00 81.74  ? 384  ASN A CG    1 
ATOM   2926  O  OD1   . ASN A  1  384  ? 129.046 17.065  -12.602 1.00 62.74  ? 384  ASN A OD1   1 
ATOM   2927  N  ND2   . ASN A  1  384  ? 128.506 19.017  -11.697 1.00 79.30  ? 384  ASN A ND2   1 
ATOM   2928  N  N     . ILE A  1  385  ? 130.352 14.247  -11.658 1.00 78.67  ? 385  ILE A N     1 
ATOM   2929  C  CA    . ILE A  1  385  ? 129.634 13.063  -12.097 1.00 78.24  ? 385  ILE A CA    1 
ATOM   2930  C  C     . ILE A  1  385  ? 129.289 12.159  -10.895 1.00 84.56  ? 385  ILE A C     1 
ATOM   2931  O  O     . ILE A  1  385  ? 128.125 11.781  -10.758 1.00 83.70  ? 385  ILE A O     1 
ATOM   2932  C  CB    . ILE A  1  385  ? 130.399 12.368  -13.255 1.00 81.25  ? 385  ILE A CB    1 
ATOM   2933  C  CG1   . ILE A  1  385  ? 129.440 11.777  -14.350 1.00 80.03  ? 385  ILE A CG1   1 
ATOM   2934  C  CG2   . ILE A  1  385  ? 131.449 11.358  -12.797 1.00 83.99  ? 385  ILE A CG2   1 
ATOM   2935  C  CD1   . ILE A  1  385  ? 128.366 10.822  -14.014 1.00 78.88  ? 385  ILE A CD1   1 
ATOM   2936  N  N     . ASP A  1  386  ? 130.245 11.924  -9.969  1.00 83.36  ? 386  ASP A N     1 
ATOM   2937  C  CA    . ASP A  1  386  ? 129.971 11.070  -8.805  1.00 84.12  ? 386  ASP A CA    1 
ATOM   2938  C  C     . ASP A  1  386  ? 128.992 11.706  -7.819  1.00 84.24  ? 386  ASP A C     1 
ATOM   2939  O  O     . ASP A  1  386  ? 128.105 11.020  -7.301  1.00 82.89  ? 386  ASP A O     1 
ATOM   2940  C  CB    . ASP A  1  386  ? 131.269 10.608  -8.106  1.00 87.85  ? 386  ASP A CB    1 
ATOM   2941  C  CG    . ASP A  1  386  ? 132.246 9.786   -8.958  1.00 106.51 ? 386  ASP A CG    1 
ATOM   2942  O  OD1   . ASP A  1  386  ? 131.780 9.007   -9.841  1.00 107.48 ? 386  ASP A OD1   1 
ATOM   2943  O  OD2   . ASP A  1  386  ? 133.467 9.871   -8.703  1.00 116.22 ? 386  ASP A OD2   1 
ATOM   2944  N  N     . ARG A  1  387  ? 129.128 13.024  -7.606  1.00 79.20  ? 387  ARG A N     1 
ATOM   2945  C  CA    . ARG A  1  387  ? 128.274 13.784  -6.697  1.00 78.11  ? 387  ARG A CA    1 
ATOM   2946  C  C     . ARG A  1  387  ? 126.834 13.833  -7.181  1.00 79.60  ? 387  ARG A C     1 
ATOM   2947  O  O     . ARG A  1  387  ? 125.933 13.482  -6.418  1.00 79.82  ? 387  ARG A O     1 
ATOM   2948  C  CB    . ARG A  1  387  ? 128.828 15.192  -6.527  1.00 79.25  ? 387  ARG A CB    1 
ATOM   2949  C  CG    . ARG A  1  387  ? 128.007 16.072  -5.600  1.00 88.32  ? 387  ARG A CG    1 
ATOM   2950  C  CD    . ARG A  1  387  ? 128.771 17.331  -5.226  1.00 93.48  ? 387  ARG A CD    1 
ATOM   2951  N  NE    . ARG A  1  387  ? 129.099 18.158  -6.384  1.00 90.00  ? 387  ARG A NE    1 
ATOM   2952  C  CZ    . ARG A  1  387  ? 128.258 19.019  -6.948  1.00 102.43 ? 387  ARG A CZ    1 
ATOM   2953  N  NH1   . ARG A  1  387  ? 127.024 19.164  -6.471  1.00 83.43  ? 387  ARG A NH1   1 
ATOM   2954  N  NH2   . ARG A  1  387  ? 128.642 19.742  -7.990  1.00 91.10  ? 387  ARG A NH2   1 
ATOM   2955  N  N     . LEU A  1  388  ? 126.626 14.260  -8.448  1.00 73.07  ? 388  LEU A N     1 
ATOM   2956  C  CA    . LEU A  1  388  ? 125.318 14.345  -9.091  1.00 70.62  ? 388  LEU A CA    1 
ATOM   2957  C  C     . LEU A  1  388  ? 124.643 12.986  -9.172  1.00 73.36  ? 388  LEU A C     1 
ATOM   2958  O  O     . LEU A  1  388  ? 123.469 12.902  -8.829  1.00 71.93  ? 388  LEU A O     1 
ATOM   2959  C  CB    . LEU A  1  388  ? 125.426 14.987  -10.468 1.00 69.77  ? 388  LEU A CB    1 
ATOM   2960  C  CG    . LEU A  1  388  ? 125.742 16.463  -10.496 1.00 72.87  ? 388  LEU A CG    1 
ATOM   2961  C  CD1   . LEU A  1  388  ? 125.691 16.963  -11.880 1.00 72.95  ? 388  LEU A CD1   1 
ATOM   2962  C  CD2   . LEU A  1  388  ? 124.742 17.245  -9.710  1.00 74.32  ? 388  LEU A CD2   1 
ATOM   2963  N  N     . THR A  1  389  ? 125.399 11.909  -9.515  1.00 70.82  ? 389  THR A N     1 
ATOM   2964  C  CA    . THR A  1  389  ? 124.854 10.542  -9.503  1.00 71.68  ? 389  THR A CA    1 
ATOM   2965  C  C     . THR A  1  389  ? 124.280 10.221  -8.130  1.00 76.75  ? 389  THR A C     1 
ATOM   2966  O  O     . THR A  1  389  ? 123.206 9.633   -8.054  1.00 76.75  ? 389  THR A O     1 
ATOM   2967  C  CB    . THR A  1  389  ? 125.892 9.479   -9.883  1.00 78.61  ? 389  THR A CB    1 
ATOM   2968  O  OG1   . THR A  1  389  ? 126.431 9.765   -11.171 1.00 82.26  ? 389  THR A OG1   1 
ATOM   2969  C  CG2   . THR A  1  389  ? 125.292 8.099   -9.922  1.00 74.02  ? 389  THR A CG2   1 
ATOM   2970  N  N     . GLN A  1  390  ? 124.975 10.634  -7.055  1.00 73.85  ? 390  GLN A N     1 
ATOM   2971  C  CA    . GLN A  1  390  ? 124.514 10.386  -5.703  1.00 74.48  ? 390  GLN A CA    1 
ATOM   2972  C  C     . GLN A  1  390  ? 123.242 11.161  -5.361  1.00 78.34  ? 390  GLN A C     1 
ATOM   2973  O  O     . GLN A  1  390  ? 122.391 10.609  -4.657  1.00 78.36  ? 390  GLN A O     1 
ATOM   2974  C  CB    . GLN A  1  390  ? 125.633 10.617  -4.673  1.00 76.65  ? 390  GLN A CB    1 
ATOM   2975  C  CG    . GLN A  1  390  ? 125.392 9.959   -3.291  1.00 96.62  ? 390  GLN A CG    1 
ATOM   2976  C  CD    . GLN A  1  390  ? 124.847 8.542   -3.339  1.00 113.61 ? 390  GLN A CD    1 
ATOM   2977  O  OE1   . GLN A  1  390  ? 125.458 7.620   -3.901  1.00 109.12 ? 390  GLN A OE1   1 
ATOM   2978  N  NE2   . GLN A  1  390  ? 123.681 8.346   -2.737  1.00 102.06 ? 390  GLN A NE2   1 
ATOM   2979  N  N     . LEU A  1  391  ? 123.090 12.413  -5.872  1.00 73.97  ? 391  LEU A N     1 
ATOM   2980  C  CA    . LEU A  1  391  ? 121.890 13.224  -5.611  1.00 72.88  ? 391  LEU A CA    1 
ATOM   2981  C  C     . LEU A  1  391  ? 120.653 12.589  -6.275  1.00 76.42  ? 391  LEU A C     1 
ATOM   2982  O  O     . LEU A  1  391  ? 119.675 12.313  -5.583  1.00 76.41  ? 391  LEU A O     1 
ATOM   2983  C  CB    . LEU A  1  391  ? 122.080 14.686  -6.043  1.00 72.34  ? 391  LEU A CB    1 
ATOM   2984  C  CG    . LEU A  1  391  ? 123.177 15.492  -5.332  1.00 77.01  ? 391  LEU A CG    1 
ATOM   2985  C  CD1   . LEU A  1  391  ? 123.439 16.810  -6.027  1.00 76.09  ? 391  LEU A CD1   1 
ATOM   2986  C  CD2   . LEU A  1  391  ? 122.817 15.772  -3.912  1.00 80.42  ? 391  LEU A CD2   1 
ATOM   2987  N  N     . VAL A  1  392  ? 120.751 12.253  -7.579  1.00 72.20  ? 392  VAL A N     1 
ATOM   2988  C  CA    . VAL A  1  392  ? 119.735 11.569  -8.390  1.00 72.21  ? 392  VAL A CA    1 
ATOM   2989  C  C     . VAL A  1  392  ? 119.259 10.270  -7.681  1.00 81.43  ? 392  VAL A C     1 
ATOM   2990  O  O     . VAL A  1  392  ? 118.080 9.887   -7.788  1.00 82.45  ? 392  VAL A O     1 
ATOM   2991  C  CB    . VAL A  1  392  ? 120.335 11.260  -9.780  1.00 75.20  ? 392  VAL A CB    1 
ATOM   2992  C  CG1   . VAL A  1  392  ? 119.422 10.381  -10.611 1.00 74.93  ? 392  VAL A CG1   1 
ATOM   2993  C  CG2   . VAL A  1  392  ? 120.659 12.537  -10.530 1.00 74.59  ? 392  VAL A CG2   1 
ATOM   2994  N  N     . ARG A  1  393  ? 120.186 9.598   -6.960  1.00 79.46  ? 393  ARG A N     1 
ATOM   2995  C  CA    . ARG A  1  393  ? 119.881 8.377   -6.225  1.00 80.15  ? 393  ARG A CA    1 
ATOM   2996  C  C     . ARG A  1  393  ? 118.933 8.691   -5.098  1.00 83.46  ? 393  ARG A C     1 
ATOM   2997  O  O     . ARG A  1  393  ? 117.920 8.005   -4.982  1.00 84.41  ? 393  ARG A O     1 
ATOM   2998  C  CB    . ARG A  1  393  ? 121.149 7.709   -5.685  1.00 84.12  ? 393  ARG A CB    1 
ATOM   2999  C  CG    . ARG A  1  393  ? 121.740 6.683   -6.627  1.00 104.99 ? 393  ARG A CG    1 
ATOM   3000  C  CD    . ARG A  1  393  ? 122.719 5.756   -5.925  1.00 126.19 ? 393  ARG A CD    1 
ATOM   3001  N  NE    . ARG A  1  393  ? 123.442 4.941   -6.904  1.00 141.50 ? 393  ARG A NE    1 
ATOM   3002  C  CZ    . ARG A  1  393  ? 124.668 5.207   -7.344  1.00 154.74 ? 393  ARG A CZ    1 
ATOM   3003  N  NH1   . ARG A  1  393  ? 125.342 6.247   -6.865  1.00 144.55 ? 393  ARG A NH1   1 
ATOM   3004  N  NH2   . ARG A  1  393  ? 125.235 4.428   -8.254  1.00 136.58 ? 393  ARG A NH2   1 
ATOM   3005  N  N     . ASN A  1  394  ? 119.227 9.757   -4.302  1.00 78.43  ? 394  ASN A N     1 
ATOM   3006  C  CA    . ASN A  1  394  ? 118.407 10.224  -3.162  1.00 77.65  ? 394  ASN A CA    1 
ATOM   3007  C  C     . ASN A  1  394  ? 117.030 10.705  -3.647  1.00 79.79  ? 394  ASN A C     1 
ATOM   3008  O  O     . ASN A  1  394  ? 115.990 10.501  -3.001  1.00 76.88  ? 394  ASN A O     1 
ATOM   3009  C  CB    . ASN A  1  394  ? 119.135 11.337  -2.407  1.00 76.28  ? 394  ASN A CB    1 
ATOM   3010  C  CG    . ASN A  1  394  ? 120.541 10.993  -1.988  1.00 100.61 ? 394  ASN A CG    1 
ATOM   3011  O  OD1   . ASN A  1  394  ? 121.033 9.870   -2.164  1.00 99.55  ? 394  ASN A OD1   1 
ATOM   3012  N  ND2   . ASN A  1  394  ? 121.223 11.957  -1.415  1.00 91.76  ? 394  ASN A ND2   1 
ATOM   3013  N  N     . GLY A  1  395  ? 117.056 11.299  -4.825  1.00 77.79  ? 395  GLY A N     1 
ATOM   3014  C  CA    . GLY A  1  395  ? 115.862 11.748  -5.506  1.00 78.12  ? 395  GLY A CA    1 
ATOM   3015  C  C     . GLY A  1  395  ? 115.158 12.934  -4.893  1.00 83.02  ? 395  GLY A C     1 
ATOM   3016  O  O     . GLY A  1  395  ? 115.776 13.783  -4.232  1.00 83.25  ? 395  GLY A O     1 
ATOM   3017  N  N     . PRO A  1  396  ? 113.844 13.009  -5.178  1.00 78.66  ? 396  PRO A N     1 
ATOM   3018  C  CA    . PRO A  1  396  ? 113.062 14.184  -4.784  1.00 78.20  ? 396  PRO A CA    1 
ATOM   3019  C  C     . PRO A  1  396  ? 112.766 14.405  -3.300  1.00 82.72  ? 396  PRO A C     1 
ATOM   3020  O  O     . PRO A  1  396  ? 112.778 15.543  -2.865  1.00 82.28  ? 396  PRO A O     1 
ATOM   3021  C  CB    . PRO A  1  396  ? 111.748 13.983  -5.555  1.00 79.64  ? 396  PRO A CB    1 
ATOM   3022  C  CG    . PRO A  1  396  ? 112.044 12.986  -6.612  1.00 82.94  ? 396  PRO A CG    1 
ATOM   3023  C  CD    . PRO A  1  396  ? 113.040 12.094  -6.012  1.00 79.32  ? 396  PRO A CD    1 
ATOM   3024  N  N     . ASN A  1  397  ? 112.437 13.354  -2.554  1.00 80.55  ? 397  ASN A N     1 
ATOM   3025  C  CA    . ASN A  1  397  ? 111.954 13.461  -1.181  1.00 80.77  ? 397  ASN A CA    1 
ATOM   3026  C  C     . ASN A  1  397  ? 113.036 13.441  -0.088  1.00 84.76  ? 397  ASN A C     1 
ATOM   3027  O  O     . ASN A  1  397  ? 112.717 13.772  1.051   1.00 85.94  ? 397  ASN A O     1 
ATOM   3028  C  CB    . ASN A  1  397  ? 110.896 12.380  -0.923  1.00 85.01  ? 397  ASN A CB    1 
ATOM   3029  C  CG    . ASN A  1  397  ? 110.166 11.919  -2.183  1.00 114.47 ? 397  ASN A CG    1 
ATOM   3030  O  OD1   . ASN A  1  397  ? 110.599 10.984  -2.872  1.00 107.85 ? 397  ASN A OD1   1 
ATOM   3031  N  ND2   . ASN A  1  397  ? 109.079 12.601  -2.548  1.00 105.52 ? 397  ASN A ND2   1 
ATOM   3032  N  N     . GLU A  1  398  ? 114.286 13.044  -0.403  1.00 79.94  ? 398  GLU A N     1 
ATOM   3033  C  CA    . GLU A  1  398  ? 115.426 13.047  0.542   1.00 79.04  ? 398  GLU A CA    1 
ATOM   3034  C  C     . GLU A  1  398  ? 116.010 14.454  0.389   1.00 78.24  ? 398  GLU A C     1 
ATOM   3035  O  O     . GLU A  1  398  ? 115.929 14.907  -0.751  1.00 76.25  ? 398  GLU A O     1 
ATOM   3036  C  CB    . GLU A  1  398  ? 116.490 12.032  0.083   1.00 81.01  ? 398  GLU A CB    1 
ATOM   3037  C  CG    . GLU A  1  398  ? 116.495 10.698  0.804   1.00 95.17  ? 398  GLU A CG    1 
ATOM   3038  C  CD    . GLU A  1  398  ? 117.795 9.931   0.627   1.00 130.40 ? 398  GLU A CD    1 
ATOM   3039  O  OE1   . GLU A  1  398  ? 118.852 10.439  1.073   1.00 118.88 ? 398  GLU A OE1   1 
ATOM   3040  O  OE2   . GLU A  1  398  ? 117.756 8.823   0.039   1.00 134.47 ? 398  GLU A OE2   1 
ATOM   3041  N  N     . HIS A  1  399  ? 116.585 15.160  1.460   1.00 72.27  ? 399  HIS A N     1 
ATOM   3042  C  CA    . HIS A  1  399  ? 117.065 16.491  1.140   1.00 70.22  ? 399  HIS A CA    1 
ATOM   3043  C  C     . HIS A  1  399  ? 118.225 16.488  0.152   1.00 82.46  ? 399  HIS A C     1 
ATOM   3044  O  O     . HIS A  1  399  ? 117.858 16.813  -0.976  1.00 87.61  ? 399  HIS A O     1 
ATOM   3045  C  CB    . HIS A  1  399  ? 117.340 17.522  2.221   1.00 68.68  ? 399  HIS A CB    1 
ATOM   3046  C  CG    . HIS A  1  399  ? 117.954 18.777  1.602   1.00 69.33  ? 399  HIS A CG    1 
ATOM   3047  N  ND1   . HIS A  1  399  ? 117.370 19.408  0.505   1.00 68.81  ? 399  HIS A ND1   1 
ATOM   3048  C  CD2   . HIS A  1  399  ? 119.161 19.354  1.821   1.00 69.12  ? 399  HIS A CD2   1 
ATOM   3049  C  CE1   . HIS A  1  399  ? 118.220 20.344  0.127   1.00 66.70  ? 399  HIS A CE1   1 
ATOM   3050  N  NE2   . HIS A  1  399  ? 119.306 20.354  0.885   1.00 67.38  ? 399  HIS A NE2   1 
ATOM   3051  N  N     . PRO A  1  400  ? 119.571 16.398  0.380   1.00 76.13  ? 400  PRO A N     1 
ATOM   3052  C  CA    . PRO A  1  400  ? 120.449 16.594  -0.799  1.00 74.34  ? 400  PRO A CA    1 
ATOM   3053  C  C     . PRO A  1  400  ? 120.013 15.534  -1.810  1.00 79.01  ? 400  PRO A C     1 
ATOM   3054  O  O     . PRO A  1  400  ? 119.933 14.358  -1.448  1.00 80.83  ? 400  PRO A O     1 
ATOM   3055  C  CB    . PRO A  1  400  ? 121.867 16.513  -0.244  1.00 75.74  ? 400  PRO A CB    1 
ATOM   3056  C  CG    . PRO A  1  400  ? 121.702 16.653  1.245   1.00 80.73  ? 400  PRO A CG    1 
ATOM   3057  C  CD    . PRO A  1  400  ? 120.347 16.090  1.593   1.00 76.78  ? 400  PRO A CD    1 
ATOM   3058  N  N     . GLY A  1  401  ? 119.464 16.000  -2.936  1.00 72.95  ? 401  GLY A N     1 
ATOM   3059  C  CA    . GLY A  1  401  ? 118.885 15.148  -3.968  1.00 72.29  ? 401  GLY A CA    1 
ATOM   3060  C  C     . GLY A  1  401  ? 118.590 15.927  -5.227  1.00 74.90  ? 401  GLY A C     1 
ATOM   3061  O  O     . GLY A  1  401  ? 119.113 17.035  -5.396  1.00 76.09  ? 401  GLY A O     1 
ATOM   3062  N  N     . ALA A  1  402  ? 117.737 15.370  -6.108  1.00 68.22  ? 402  ALA A N     1 
ATOM   3063  C  CA    . ALA A  1  402  ? 117.360 16.002  -7.378  1.00 66.55  ? 402  ALA A CA    1 
ATOM   3064  C  C     . ALA A  1  402  ? 115.900 15.703  -7.777  1.00 69.67  ? 402  ALA A C     1 
ATOM   3065  O  O     . ALA A  1  402  ? 115.307 14.766  -7.261  1.00 70.21  ? 402  ALA A O     1 
ATOM   3066  C  CB    . ALA A  1  402  ? 118.313 15.559  -8.471  1.00 67.36  ? 402  ALA A CB    1 
ATOM   3067  N  N     . LYS A  1  403  ? 115.318 16.499  -8.684  1.00 64.83  ? 403  LYS A N     1 
ATOM   3068  C  CA    . LYS A  1  403  ? 113.938 16.315  -9.147  1.00 63.78  ? 403  LYS A CA    1 
ATOM   3069  C  C     . LYS A  1  403  ? 113.907 15.738  -10.577 1.00 68.57  ? 403  LYS A C     1 
ATOM   3070  O  O     . LYS A  1  403  ? 113.095 14.842  -10.861 1.00 67.76  ? 403  LYS A O     1 
ATOM   3071  C  CB    . LYS A  1  403  ? 113.179 17.656  -9.130  1.00 64.86  ? 403  LYS A CB    1 
ATOM   3072  C  CG    . LYS A  1  403  ? 113.081 18.338  -7.771  1.00 74.48  ? 403  LYS A CG    1 
ATOM   3073  C  CD    . LYS A  1  403  ? 112.300 19.654  -7.823  1.00 76.08  ? 403  LYS A CD    1 
ATOM   3074  C  CE    . LYS A  1  403  ? 110.796 19.471  -7.802  1.00 85.38  ? 403  LYS A CE    1 
ATOM   3075  N  NZ    . LYS A  1  403  ? 110.088 20.734  -7.453  1.00 96.09  ? 403  LYS A NZ    1 
ATOM   3076  N  N     . TYR A  1  404  ? 114.767 16.284  -11.483 1.00 65.28  ? 404  TYR A N     1 
ATOM   3077  C  CA    . TYR A  1  404  ? 114.800 15.903  -12.896 1.00 65.42  ? 404  TYR A CA    1 
ATOM   3078  C  C     . TYR A  1  404  ? 116.186 15.684  -13.467 1.00 70.18  ? 404  TYR A C     1 
ATOM   3079  O  O     . TYR A  1  404  ? 117.131 16.364  -13.077 1.00 69.30  ? 404  TYR A O     1 
ATOM   3080  C  CB    . TYR A  1  404  ? 114.115 16.972  -13.767 1.00 66.05  ? 404  TYR A CB    1 
ATOM   3081  C  CG    . TYR A  1  404  ? 112.660 17.222  -13.456 1.00 67.12  ? 404  TYR A CG    1 
ATOM   3082  C  CD1   . TYR A  1  404  ? 111.658 16.521  -14.116 1.00 69.50  ? 404  TYR A CD1   1 
ATOM   3083  C  CD2   . TYR A  1  404  ? 112.280 18.211  -12.560 1.00 67.77  ? 404  TYR A CD2   1 
ATOM   3084  C  CE1   . TYR A  1  404  ? 110.309 16.758  -13.846 1.00 70.59  ? 404  TYR A CE1   1 
ATOM   3085  C  CE2   . TYR A  1  404  ? 110.938 18.449  -12.272 1.00 69.33  ? 404  TYR A CE2   1 
ATOM   3086  C  CZ    . TYR A  1  404  ? 109.953 17.719  -12.917 1.00 78.70  ? 404  TYR A CZ    1 
ATOM   3087  O  OH    . TYR A  1  404  ? 108.626 17.961  -12.648 1.00 83.36  ? 404  TYR A OH    1 
ATOM   3088  N  N     . VAL A  1  405  ? 116.284 14.784  -14.454 1.00 67.87  ? 405  VAL A N     1 
ATOM   3089  C  CA    . VAL A  1  405  ? 117.522 14.530  -15.174 1.00 68.69  ? 405  VAL A CA    1 
ATOM   3090  C  C     . VAL A  1  405  ? 117.230 14.908  -16.624 1.00 78.80  ? 405  VAL A C     1 
ATOM   3091  O  O     . VAL A  1  405  ? 116.437 14.233  -17.275 1.00 79.63  ? 405  VAL A O     1 
ATOM   3092  C  CB    . VAL A  1  405  ? 118.037 13.073  -15.028 1.00 71.15  ? 405  VAL A CB    1 
ATOM   3093  C  CG1   . VAL A  1  405  ? 119.258 12.815  -15.902 1.00 70.09  ? 405  VAL A CG1   1 
ATOM   3094  C  CG2   . VAL A  1  405  ? 118.345 12.749  -13.578 1.00 71.00  ? 405  VAL A CG2   1 
ATOM   3095  N  N     . ILE A  1  406  ? 117.812 16.023  -17.102 1.00 78.34  ? 406  ILE A N     1 
ATOM   3096  C  CA    . ILE A  1  406  ? 117.645 16.481  -18.479 1.00 79.32  ? 406  ILE A CA    1 
ATOM   3097  C  C     . ILE A  1  406  ? 118.686 15.792  -19.327 1.00 85.97  ? 406  ILE A C     1 
ATOM   3098  O  O     . ILE A  1  406  ? 119.891 15.937  -19.093 1.00 85.12  ? 406  ILE A O     1 
ATOM   3099  C  CB    . ILE A  1  406  ? 117.670 18.028  -18.634 1.00 82.07  ? 406  ILE A CB    1 
ATOM   3100  C  CG1   . ILE A  1  406  ? 116.394 18.661  -18.068 1.00 81.78  ? 406  ILE A CG1   1 
ATOM   3101  C  CG2   . ILE A  1  406  ? 117.844 18.433  -20.105 1.00 83.28  ? 406  ILE A CG2   1 
ATOM   3102  C  CD1   . ILE A  1  406  ? 116.584 19.317  -16.828 1.00 87.02  ? 406  ILE A CD1   1 
ATOM   3103  N  N     . ARG A  1  407  ? 118.207 15.045  -20.319 1.00 85.58  ? 407  ARG A N     1 
ATOM   3104  C  CA    . ARG A  1  407  ? 119.037 14.277  -21.225 1.00 86.87  ? 407  ARG A CA    1 
ATOM   3105  C  C     . ARG A  1  407  ? 119.642 15.132  -22.311 1.00 97.85  ? 407  ARG A C     1 
ATOM   3106  O  O     . ARG A  1  407  ? 119.391 16.340  -22.360 1.00 97.70  ? 407  ARG A O     1 
ATOM   3107  C  CB    . ARG A  1  407  ? 118.203 13.158  -21.823 1.00 82.78  ? 407  ARG A CB    1 
ATOM   3108  C  CG    . ARG A  1  407  ? 118.922 11.856  -21.711 1.00 84.56  ? 407  ARG A CG    1 
ATOM   3109  C  CD    . ARG A  1  407  ? 118.041 10.797  -21.135 1.00 84.52  ? 407  ARG A CD    1 
ATOM   3110  N  NE    . ARG A  1  407  ? 117.461 9.953   -22.173 1.00 88.72  ? 407  ARG A NE    1 
ATOM   3111  C  CZ    . ARG A  1  407  ? 116.259 10.145  -22.699 1.00 114.57 ? 407  ARG A CZ    1 
ATOM   3112  N  NH1   . ARG A  1  407  ? 115.500 11.163  -22.293 1.00 101.56 ? 407  ARG A NH1   1 
ATOM   3113  N  NH2   . ARG A  1  407  ? 115.802 9.327   -23.636 1.00 113.63 ? 407  ARG A NH2   1 
ATOM   3114  N  N     . ASP A  1  408  ? 120.465 14.503  -23.176 1.00 100.34 ? 408  ASP A N     1 
ATOM   3115  C  CA    . ASP A  1  408  ? 121.092 15.109  -24.365 1.00 102.44 ? 408  ASP A CA    1 
ATOM   3116  C  C     . ASP A  1  408  ? 119.960 15.574  -25.303 1.00 107.90 ? 408  ASP A C     1 
ATOM   3117  O  O     . ASP A  1  408  ? 119.993 16.708  -25.781 1.00 106.55 ? 408  ASP A O     1 
ATOM   3118  C  CB    . ASP A  1  408  ? 122.049 14.105  -25.078 1.00 105.80 ? 408  ASP A CB    1 
ATOM   3119  C  CG    . ASP A  1  408  ? 121.699 12.606  -24.978 1.00 123.53 ? 408  ASP A CG    1 
ATOM   3120  O  OD1   . ASP A  1  408  ? 120.516 12.239  -25.238 1.00 124.44 ? 408  ASP A OD1   1 
ATOM   3121  O  OD2   . ASP A  1  408  ? 122.622 11.794  -24.697 1.00 132.06 ? 408  ASP A OD2   1 
ATOM   3122  N  N     . SER A  1  409  ? 118.913 14.707  -25.459 1.00 106.61 ? 409  SER A N     1 
ATOM   3123  C  CA    . SER A  1  409  ? 117.687 14.885  -26.250 1.00 107.24 ? 409  SER A CA    1 
ATOM   3124  C  C     . SER A  1  409  ? 116.906 16.160  -25.877 1.00 113.57 ? 409  SER A C     1 
ATOM   3125  O  O     . SER A  1  409  ? 116.260 16.766  -26.739 1.00 114.66 ? 409  SER A O     1 
ATOM   3126  C  CB    . SER A  1  409  ? 116.782 13.653  -26.120 1.00 109.92 ? 409  SER A CB    1 
ATOM   3127  O  OG    . SER A  1  409  ? 115.807 13.743  -25.087 1.00 115.79 ? 409  SER A OG    1 
ATOM   3128  N  N     . GLY A  1  410  ? 116.968 16.537  -24.604 1.00 109.72 ? 410  GLY A N     1 
ATOM   3129  C  CA    . GLY A  1  410  ? 116.243 17.682  -24.077 1.00 108.97 ? 410  GLY A CA    1 
ATOM   3130  C  C     . GLY A  1  410  ? 115.038 17.273  -23.240 1.00 112.72 ? 410  GLY A C     1 
ATOM   3131  O  O     . GLY A  1  410  ? 114.551 18.106  -22.455 1.00 112.54 ? 410  GLY A O     1 
ATOM   3132  N  N     . ASP A  1  411  ? 114.532 15.982  -23.388 1.00 107.32 ? 411  ASP A N     1 
ATOM   3133  C  CA    . ASP A  1  411  ? 113.363 15.515  -22.604 1.00 105.63 ? 411  ASP A CA    1 
ATOM   3134  C  C     . ASP A  1  411  ? 113.733 15.141  -21.159 1.00 101.92 ? 411  ASP A C     1 
ATOM   3135  O  O     . ASP A  1  411  ? 114.693 14.394  -20.938 1.00 102.30 ? 411  ASP A O     1 
ATOM   3136  C  CB    . ASP A  1  411  ? 112.538 14.391  -23.282 1.00 108.65 ? 411  ASP A CB    1 
ATOM   3137  C  CG    . ASP A  1  411  ? 111.037 14.392  -22.911 1.00 119.32 ? 411  ASP A CG    1 
ATOM   3138  O  OD1   . ASP A  1  411  ? 110.691 14.825  -21.778 1.00 117.67 ? 411  ASP A OD1   1 
ATOM   3139  O  OD2   . ASP A  1  411  ? 110.212 13.967  -23.755 1.00 127.32 ? 411  ASP A OD2   1 
ATOM   3140  N  N     . ARG A  1  412  ? 112.939 15.680  -20.194 1.00 90.57  ? 412  ARG A N     1 
ATOM   3141  C  CA    . ARG A  1  412  ? 113.100 15.550  -18.748 1.00 86.94  ? 412  ARG A CA    1 
ATOM   3142  C  C     . ARG A  1  412  ? 112.711 14.200  -18.190 1.00 86.41  ? 412  ARG A C     1 
ATOM   3143  O  O     . ARG A  1  412  ? 111.597 13.729  -18.430 1.00 87.82  ? 412  ARG A O     1 
ATOM   3144  C  CB    . ARG A  1  412  ? 112.274 16.618  -18.014 1.00 84.23  ? 412  ARG A CB    1 
ATOM   3145  C  CG    . ARG A  1  412  ? 112.773 18.027  -18.211 1.00 91.67  ? 412  ARG A CG    1 
ATOM   3146  C  CD    . ARG A  1  412  ? 112.003 19.065  -17.412 1.00 95.20  ? 412  ARG A CD    1 
ATOM   3147  N  NE    . ARG A  1  412  ? 112.684 20.354  -17.522 1.00 103.57 ? 412  ARG A NE    1 
ATOM   3148  C  CZ    . ARG A  1  412  ? 112.197 21.425  -18.140 1.00 122.01 ? 412  ARG A CZ    1 
ATOM   3149  N  NH1   . ARG A  1  412  ? 110.969 21.407  -18.646 1.00 108.23 ? 412  ARG A NH1   1 
ATOM   3150  N  NH2   . ARG A  1  412  ? 112.913 22.539  -18.214 1.00 114.20 ? 412  ARG A NH2   1 
ATOM   3151  N  N     . ILE A  1  413  ? 113.600 13.609  -17.382 1.00 77.05  ? 413  ILE A N     1 
ATOM   3152  C  CA    . ILE A  1  413  ? 113.320 12.374  -16.660 1.00 74.23  ? 413  ILE A CA    1 
ATOM   3153  C  C     . ILE A  1  413  ? 112.807 12.856  -15.297 1.00 73.86  ? 413  ILE A C     1 
ATOM   3154  O  O     . ILE A  1  413  ? 113.483 13.650  -14.649 1.00 71.66  ? 413  ILE A O     1 
ATOM   3155  C  CB    . ILE A  1  413  ? 114.575 11.474  -16.524 1.00 76.43  ? 413  ILE A CB    1 
ATOM   3156  C  CG1   . ILE A  1  413  ? 115.094 11.001  -17.893 1.00 75.01  ? 413  ILE A CG1   1 
ATOM   3157  C  CG2   . ILE A  1  413  ? 114.308 10.291  -15.567 1.00 77.78  ? 413  ILE A CG2   1 
ATOM   3158  C  CD1   . ILE A  1  413  ? 116.514 10.532  -17.859 1.00 67.27  ? 413  ILE A CD1   1 
ATOM   3159  N  N     . ASP A  1  414  ? 111.604 12.427  -14.895 1.00 69.61  ? 414  ASP A N     1 
ATOM   3160  C  CA    . ASP A  1  414  ? 111.008 12.842  -13.626 1.00 69.23  ? 414  ASP A CA    1 
ATOM   3161  C  C     . ASP A  1  414  ? 111.254 11.764  -12.585 1.00 75.43  ? 414  ASP A C     1 
ATOM   3162  O  O     . ASP A  1  414  ? 110.531 10.763  -12.542 1.00 76.81  ? 414  ASP A O     1 
ATOM   3163  C  CB    . ASP A  1  414  ? 109.509 13.162  -13.777 1.00 70.51  ? 414  ASP A CB    1 
ATOM   3164  C  CG    . ASP A  1  414  ? 108.781 13.652  -12.539 1.00 80.62  ? 414  ASP A CG    1 
ATOM   3165  O  OD1   . ASP A  1  414  ? 109.424 13.750  -11.451 1.00 80.82  ? 414  ASP A OD1   1 
ATOM   3166  O  OD2   . ASP A  1  414  ? 107.584 13.974  -12.655 1.00 87.51  ? 414  ASP A OD2   1 
ATOM   3167  N  N     . LEU A  1  415  ? 112.259 12.010  -11.710 1.00 69.89  ? 415  LEU A N     1 
ATOM   3168  C  CA    . LEU A  1  415  ? 112.730 11.106  -10.666 1.00 67.90  ? 415  LEU A CA    1 
ATOM   3169  C  C     . LEU A  1  415  ? 111.652 10.666  -9.685  1.00 73.67  ? 415  LEU A C     1 
ATOM   3170  O  O     . LEU A  1  415  ? 111.911 9.764   -8.881  1.00 75.15  ? 415  LEU A O     1 
ATOM   3171  C  CB    . LEU A  1  415  ? 113.937 11.704  -9.926  1.00 66.47  ? 415  LEU A CB    1 
ATOM   3172  C  CG    . LEU A  1  415  ? 115.142 12.079  -10.778 1.00 70.07  ? 415  LEU A CG    1 
ATOM   3173  C  CD1   . LEU A  1  415  ? 116.189 12.790  -9.961  1.00 69.59  ? 415  LEU A CD1   1 
ATOM   3174  C  CD2   . LEU A  1  415  ? 115.753 10.861  -11.456 1.00 73.29  ? 415  LEU A CD2   1 
ATOM   3175  N  N     . ARG A  1  416  ? 110.450 11.271  -9.732  1.00 70.24  ? 416  ARG A N     1 
ATOM   3176  C  CA    . ARG A  1  416  ? 109.426 10.852  -8.782  1.00 70.98  ? 416  ARG A CA    1 
ATOM   3177  C  C     . ARG A  1  416  ? 108.473 9.850   -9.397  1.00 75.80  ? 416  ARG A C     1 
ATOM   3178  O  O     . ARG A  1  416  ? 107.685 9.270   -8.661  1.00 76.58  ? 416  ARG A O     1 
ATOM   3179  C  CB    . ARG A  1  416  ? 108.699 12.041  -8.101  1.00 71.55  ? 416  ARG A CB    1 
ATOM   3180  C  CG    . ARG A  1  416  ? 107.600 12.683  -8.902  1.00 83.86  ? 416  ARG A CG    1 
ATOM   3181  C  CD    . ARG A  1  416  ? 106.965 13.837  -8.166  1.00 101.57 ? 416  ARG A CD    1 
ATOM   3182  N  NE    . ARG A  1  416  ? 107.503 15.116  -8.635  1.00 113.94 ? 416  ARG A NE    1 
ATOM   3183  C  CZ    . ARG A  1  416  ? 106.919 15.896  -9.540  1.00 119.50 ? 416  ARG A CZ    1 
ATOM   3184  N  NH1   . ARG A  1  416  ? 105.756 15.546  -10.079 1.00 86.55  ? 416  ARG A NH1   1 
ATOM   3185  N  NH2   . ARG A  1  416  ? 107.488 17.039  -9.903  1.00 113.40 ? 416  ARG A NH2   1 
ATOM   3186  N  N     . TYR A  1  417  ? 108.560 9.623   -10.728 1.00 72.11  ? 417  TYR A N     1 
ATOM   3187  C  CA    . TYR A  1  417  ? 107.706 8.677   -11.454 1.00 71.33  ? 417  TYR A CA    1 
ATOM   3188  C  C     . TYR A  1  417  ? 108.459 7.761   -12.398 1.00 73.41  ? 417  TYR A C     1 
ATOM   3189  O  O     . TYR A  1  417  ? 108.021 6.635   -12.583 1.00 74.08  ? 417  TYR A O     1 
ATOM   3190  C  CB    . TYR A  1  417  ? 106.578 9.394   -12.218 1.00 72.27  ? 417  TYR A CB    1 
ATOM   3191  C  CG    . TYR A  1  417  ? 105.728 10.306  -11.365 1.00 74.54  ? 417  TYR A CG    1 
ATOM   3192  C  CD1   . TYR A  1  417  ? 105.034 9.817   -10.265 1.00 76.76  ? 417  TYR A CD1   1 
ATOM   3193  C  CD2   . TYR A  1  417  ? 105.581 11.654  -11.682 1.00 75.88  ? 417  TYR A CD2   1 
ATOM   3194  C  CE1   . TYR A  1  417  ? 104.258 10.657  -9.463  1.00 78.70  ? 417  TYR A CE1   1 
ATOM   3195  C  CE2   . TYR A  1  417  ? 104.781 12.502  -10.905 1.00 77.06  ? 417  TYR A CE2   1 
ATOM   3196  C  CZ    . TYR A  1  417  ? 104.135 12.002  -9.783  1.00 84.80  ? 417  TYR A CZ    1 
ATOM   3197  O  OH    . TYR A  1  417  ? 103.378 12.824  -8.977  1.00 83.88  ? 417  TYR A OH    1 
ATOM   3198  N  N     . SER A  1  418  ? 109.542 8.231   -13.032 1.00 68.85  ? 418  SER A N     1 
ATOM   3199  C  CA    . SER A  1  418  ? 110.301 7.431   -13.994 1.00 69.69  ? 418  SER A CA    1 
ATOM   3200  C  C     . SER A  1  418  ? 110.692 6.096   -13.417 1.00 75.19  ? 418  SER A C     1 
ATOM   3201  O  O     . SER A  1  418  ? 111.331 6.052   -12.370 1.00 76.66  ? 418  SER A O     1 
ATOM   3202  C  CB    . SER A  1  418  ? 111.549 8.174   -14.459 1.00 74.31  ? 418  SER A CB    1 
ATOM   3203  O  OG    . SER A  1  418  ? 112.373 7.369   -15.293 1.00 82.18  ? 418  SER A OG    1 
ATOM   3204  N  N     . LYS A  1  419  ? 110.303 5.009   -14.088 1.00 71.31  ? 419  LYS A N     1 
ATOM   3205  C  CA    . LYS A  1  419  ? 110.616 3.641   -13.679 1.00 71.42  ? 419  LYS A CA    1 
ATOM   3206  C  C     . LYS A  1  419  ? 112.149 3.383   -13.609 1.00 79.67  ? 419  LYS A C     1 
ATOM   3207  O  O     . LYS A  1  419  ? 112.576 2.372   -13.049 1.00 82.88  ? 419  LYS A O     1 
ATOM   3208  C  CB    . LYS A  1  419  ? 109.947 2.630   -14.628 1.00 72.17  ? 419  LYS A CB    1 
ATOM   3209  C  CG    . LYS A  1  419  ? 110.692 2.473   -15.960 1.00 68.79  ? 419  LYS A CG    1 
ATOM   3210  C  CD    . LYS A  1  419  ? 110.209 1.327   -16.823 1.00 70.24  ? 419  LYS A CD    1 
ATOM   3211  C  CE    . LYS A  1  419  ? 108.897 1.580   -17.516 1.00 65.86  ? 419  LYS A CE    1 
ATOM   3212  N  NZ    . LYS A  1  419  ? 108.998 2.644   -18.533 1.00 70.64  ? 419  LYS A NZ    1 
ATOM   3213  N  N     . ARG A  1  420  ? 112.961 4.275   -14.186 1.00 75.25  ? 420  ARG A N     1 
ATOM   3214  C  CA    . ARG A  1  420  ? 114.413 4.123   -14.201 1.00 74.62  ? 420  ARG A CA    1 
ATOM   3215  C  C     . ARG A  1  420  ? 115.098 5.088   -13.232 1.00 78.48  ? 420  ARG A C     1 
ATOM   3216  O  O     . ARG A  1  420  ? 116.312 5.240   -13.310 1.00 77.43  ? 420  ARG A O     1 
ATOM   3217  C  CB    . ARG A  1  420  ? 114.960 4.280   -15.636 1.00 71.71  ? 420  ARG A CB    1 
ATOM   3218  C  CG    . ARG A  1  420  ? 114.487 3.198   -16.604 1.00 70.51  ? 420  ARG A CG    1 
ATOM   3219  C  CD    . ARG A  1  420  ? 115.360 3.116   -17.834 1.00 73.05  ? 420  ARG A CD    1 
ATOM   3220  N  NE    . ARG A  1  420  ? 116.775 3.026   -17.474 1.00 84.57  ? 420  ARG A NE    1 
ATOM   3221  C  CZ    . ARG A  1  420  ? 117.778 3.035   -18.344 1.00 105.60 ? 420  ARG A CZ    1 
ATOM   3222  N  NH1   . ARG A  1  420  ? 117.536 3.091   -19.648 1.00 89.18  ? 420  ARG A NH1   1 
ATOM   3223  N  NH2   . ARG A  1  420  ? 119.033 2.984   -17.918 1.00 103.95 ? 420  ARG A NH2   1 
ATOM   3224  N  N     . ALA A  1  421  ? 114.339 5.711   -12.294 1.00 76.22  ? 421  ALA A N     1 
ATOM   3225  C  CA    . ALA A  1  421  ? 114.902 6.643   -11.303 1.00 76.72  ? 421  ALA A CA    1 
ATOM   3226  C  C     . ALA A  1  421  ? 116.016 5.979   -10.461 1.00 87.22  ? 421  ALA A C     1 
ATOM   3227  O  O     . ALA A  1  421  ? 116.967 6.662   -10.053 1.00 87.84  ? 421  ALA A O     1 
ATOM   3228  C  CB    . ALA A  1  421  ? 113.814 7.227   -10.414 1.00 76.44  ? 421  ALA A CB    1 
ATOM   3229  N  N     . GLY A  1  422  ? 115.909 4.655   -10.275 1.00 87.07  ? 422  GLY A N     1 
ATOM   3230  C  CA    . GLY A  1  422  ? 116.887 3.842   -9.559  1.00 88.89  ? 422  GLY A CA    1 
ATOM   3231  C  C     . GLY A  1  422  ? 118.144 3.624   -10.378 1.00 96.99  ? 422  GLY A C     1 
ATOM   3232  O  O     . GLY A  1  422  ? 119.254 3.655   -9.841  1.00 97.14  ? 422  GLY A O     1 
ATOM   3233  N  N     . ASP A  1  423  ? 117.965 3.423   -11.698 1.00 96.17  ? 423  ASP A N     1 
ATOM   3234  C  CA    . ASP A  1  423  ? 119.018 3.265   -12.701 1.00 96.89  ? 423  ASP A CA    1 
ATOM   3235  C  C     . ASP A  1  423  ? 119.659 4.643   -12.996 1.00 100.39 ? 423  ASP A C     1 
ATOM   3236  O  O     . ASP A  1  423  ? 120.022 5.373   -12.063 1.00 101.07 ? 423  ASP A O     1 
ATOM   3237  C  CB    . ASP A  1  423  ? 118.412 2.680   -13.990 1.00 99.44  ? 423  ASP A CB    1 
ATOM   3238  C  CG    . ASP A  1  423  ? 119.007 1.363   -14.414 1.00 114.75 ? 423  ASP A CG    1 
ATOM   3239  O  OD1   . ASP A  1  423  ? 120.254 1.241   -14.395 1.00 117.21 ? 423  ASP A OD1   1 
ATOM   3240  O  OD2   . ASP A  1  423  ? 118.233 0.464   -14.810 1.00 120.13 ? 423  ASP A OD2   1 
ATOM   3241  N  N     . ILE A  1  424  ? 119.746 5.011   -14.286 1.00 95.22  ? 424  ILE A N     1 
ATOM   3242  C  CA    . ILE A  1  424  ? 120.333 6.260   -14.801 1.00 94.29  ? 424  ILE A CA    1 
ATOM   3243  C  C     . ILE A  1  424  ? 121.826 6.318   -14.537 1.00 97.95  ? 424  ILE A C     1 
ATOM   3244  O  O     . ILE A  1  424  ? 122.267 6.649   -13.429 1.00 97.53  ? 424  ILE A O     1 
ATOM   3245  C  CB    . ILE A  1  424  ? 119.664 7.640   -14.430 1.00 95.95  ? 424  ILE A CB    1 
ATOM   3246  C  CG1   . ILE A  1  424  ? 118.161 7.573   -14.303 1.00 96.21  ? 424  ILE A CG1   1 
ATOM   3247  C  CG2   . ILE A  1  424  ? 120.063 8.745   -15.419 1.00 95.05  ? 424  ILE A CG2   1 
ATOM   3248  C  CD1   . ILE A  1  424  ? 117.718 8.219   -13.114 1.00 105.45 ? 424  ILE A CD1   1 
ATOM   3249  N  N     . GLN A  1  425  ? 122.596 6.035   -15.579 1.00 94.11  ? 425  GLN A N     1 
ATOM   3250  C  CA    . GLN A  1  425  ? 124.033 6.208   -15.539 1.00 93.91  ? 425  GLN A CA    1 
ATOM   3251  C  C     . GLN A  1  425  ? 124.153 7.561   -16.249 1.00 94.34  ? 425  GLN A C     1 
ATOM   3252  O  O     . GLN A  1  425  ? 123.889 7.650   -17.458 1.00 94.41  ? 425  GLN A O     1 
ATOM   3253  C  CB    . GLN A  1  425  ? 124.805 5.083   -16.283 1.00 96.58  ? 425  GLN A CB    1 
ATOM   3254  C  CG    . GLN A  1  425  ? 124.220 3.650   -16.200 1.00 126.71 ? 425  GLN A CG    1 
ATOM   3255  C  CD    . GLN A  1  425  ? 124.053 3.063   -14.805 1.00 157.57 ? 425  GLN A CD    1 
ATOM   3256  O  OE1   . GLN A  1  425  ? 122.988 2.529   -14.458 1.00 154.56 ? 425  GLN A OE1   1 
ATOM   3257  N  NE2   . GLN A  1  425  ? 125.106 3.092   -13.990 1.00 152.66 ? 425  GLN A NE2   1 
ATOM   3258  N  N     . LEU A  1  426  ? 124.408 8.632   -15.474 1.00 86.88  ? 426  LEU A N     1 
ATOM   3259  C  CA    . LEU A  1  426  ? 124.528 9.976   -16.032 1.00 84.87  ? 426  LEU A CA    1 
ATOM   3260  C  C     . LEU A  1  426  ? 125.672 10.052  -17.050 1.00 88.77  ? 426  LEU A C     1 
ATOM   3261  O  O     . LEU A  1  426  ? 126.662 9.336   -16.919 1.00 90.38  ? 426  LEU A O     1 
ATOM   3262  C  CB    . LEU A  1  426  ? 124.758 11.022  -14.930 1.00 83.75  ? 426  LEU A CB    1 
ATOM   3263  C  CG    . LEU A  1  426  ? 123.713 11.172  -13.850 1.00 86.70  ? 426  LEU A CG    1 
ATOM   3264  C  CD1   . LEU A  1  426  ? 124.198 12.111  -12.797 1.00 86.17  ? 426  LEU A CD1   1 
ATOM   3265  C  CD2   . LEU A  1  426  ? 122.412 11.683  -14.406 1.00 87.88  ? 426  LEU A CD2   1 
ATOM   3266  N  N     . GLN A  1  427  ? 125.531 10.903  -18.061 1.00 83.01  ? 427  GLN A N     1 
ATOM   3267  C  CA    . GLN A  1  427  ? 126.546 11.091  -19.083 1.00 82.48  ? 427  GLN A CA    1 
ATOM   3268  C  C     . GLN A  1  427  ? 126.992 12.531  -19.050 1.00 83.86  ? 427  GLN A C     1 
ATOM   3269  O  O     . GLN A  1  427  ? 126.166 13.385  -18.743 1.00 82.52  ? 427  GLN A O     1 
ATOM   3270  C  CB    . GLN A  1  427  ? 125.960 10.754  -20.455 1.00 84.24  ? 427  GLN A CB    1 
ATOM   3271  C  CG    . GLN A  1  427  ? 126.350 9.371   -20.936 1.00 103.99 ? 427  GLN A CG    1 
ATOM   3272  C  CD    . GLN A  1  427  ? 125.214 8.720   -21.666 1.00 129.12 ? 427  GLN A CD    1 
ATOM   3273  O  OE1   . GLN A  1  427  ? 124.874 9.097   -22.799 1.00 124.48 ? 427  GLN A OE1   1 
ATOM   3274  N  NE2   . GLN A  1  427  ? 124.588 7.737   -21.016 1.00 124.85 ? 427  GLN A NE2   1 
ATOM   3275  N  N     . TYR A  1  428  ? 128.274 12.826  -19.375 1.00 80.12  ? 428  TYR A N     1 
ATOM   3276  C  CA    . TYR A  1  428  ? 128.737 14.220  -19.397 1.00 79.57  ? 428  TYR A CA    1 
ATOM   3277  C  C     . TYR A  1  428  ? 127.909 14.969  -20.419 1.00 81.83  ? 428  TYR A C     1 
ATOM   3278  O  O     . TYR A  1  428  ? 127.569 14.407  -21.457 1.00 82.53  ? 428  TYR A O     1 
ATOM   3279  C  CB    . TYR A  1  428  ? 130.240 14.367  -19.717 1.00 82.05  ? 428  TYR A CB    1 
ATOM   3280  C  CG    . TYR A  1  428  ? 131.183 13.504  -18.899 1.00 85.84  ? 428  TYR A CG    1 
ATOM   3281  C  CD1   . TYR A  1  428  ? 131.143 13.514  -17.508 1.00 88.15  ? 428  TYR A CD1   1 
ATOM   3282  C  CD2   . TYR A  1  428  ? 132.185 12.766  -19.511 1.00 87.83  ? 428  TYR A CD2   1 
ATOM   3283  C  CE1   . TYR A  1  428  ? 132.013 12.726  -16.755 1.00 90.27  ? 428  TYR A CE1   1 
ATOM   3284  C  CE2   . TYR A  1  428  ? 133.083 12.003  -18.767 1.00 89.55  ? 428  TYR A CE2   1 
ATOM   3285  C  CZ    . TYR A  1  428  ? 132.993 11.982  -17.389 1.00 98.52  ? 428  TYR A CZ    1 
ATOM   3286  O  OH    . TYR A  1  428  ? 133.868 11.198  -16.670 1.00 102.11 ? 428  TYR A OH    1 
ATOM   3287  N  N     . GLY A  1  429  ? 127.511 16.181  -20.080 1.00 76.61  ? 429  GLY A N     1 
ATOM   3288  C  CA    . GLY A  1  429  ? 126.661 16.996  -20.941 1.00 75.44  ? 429  GLY A CA    1 
ATOM   3289  C  C     . GLY A  1  429  ? 125.215 17.109  -20.494 1.00 75.85  ? 429  GLY A C     1 
ATOM   3290  O  O     . GLY A  1  429  ? 124.559 18.119  -20.766 1.00 74.86  ? 429  GLY A O     1 
ATOM   3291  N  N     . TRP A  1  430  ? 124.702 16.082  -19.817 1.00 70.83  ? 430  TRP A N     1 
ATOM   3292  C  CA    . TRP A  1  430  ? 123.347 16.086  -19.288 1.00 70.53  ? 430  TRP A CA    1 
ATOM   3293  C  C     . TRP A  1  430  ? 123.249 17.127  -18.170 1.00 74.87  ? 430  TRP A C     1 
ATOM   3294  O  O     . TRP A  1  430  ? 124.258 17.697  -17.747 1.00 75.09  ? 430  TRP A O     1 
ATOM   3295  C  CB    . TRP A  1  430  ? 123.015 14.710  -18.704 1.00 69.79  ? 430  TRP A CB    1 
ATOM   3296  C  CG    . TRP A  1  430  ? 122.891 13.611  -19.710 1.00 71.78  ? 430  TRP A CG    1 
ATOM   3297  C  CD1   . TRP A  1  430  ? 123.394 13.589  -20.979 1.00 75.29  ? 430  TRP A CD1   1 
ATOM   3298  C  CD2   . TRP A  1  430  ? 122.275 12.333  -19.501 1.00 71.88  ? 430  TRP A CD2   1 
ATOM   3299  N  NE1   . TRP A  1  430  ? 123.110 12.384  -21.577 1.00 75.41  ? 430  TRP A NE1   1 
ATOM   3300  C  CE2   . TRP A  1  430  ? 122.405 11.603  -20.699 1.00 76.21  ? 430  TRP A CE2   1 
ATOM   3301  C  CE3   . TRP A  1  430  ? 121.614 11.737  -18.416 1.00 72.86  ? 430  TRP A CE3   1 
ATOM   3302  C  CZ2   . TRP A  1  430  ? 121.897 10.314  -20.844 1.00 75.65  ? 430  TRP A CZ2   1 
ATOM   3303  C  CZ3   . TRP A  1  430  ? 121.100 10.461  -18.569 1.00 74.44  ? 430  TRP A CZ3   1 
ATOM   3304  C  CH2   . TRP A  1  430  ? 121.241 9.766   -19.770 1.00 75.44  ? 430  TRP A CH2   1 
ATOM   3305  N  N     . LYS A  1  431  ? 122.040 17.370  -17.688 1.00 70.18  ? 431  LYS A N     1 
ATOM   3306  C  CA    . LYS A  1  431  ? 121.833 18.305  -16.606 1.00 68.82  ? 431  LYS A CA    1 
ATOM   3307  C  C     . LYS A  1  431  ? 121.115 17.607  -15.456 1.00 72.26  ? 431  LYS A C     1 
ATOM   3308  O  O     . LYS A  1  431  ? 120.201 16.807  -15.670 1.00 71.72  ? 431  LYS A O     1 
ATOM   3309  C  CB    . LYS A  1  431  ? 121.026 19.507  -17.102 1.00 70.75  ? 431  LYS A CB    1 
ATOM   3310  C  CG    . LYS A  1  431  ? 121.895 20.661  -17.567 1.00 84.97  ? 431  LYS A CG    1 
ATOM   3311  C  CD    . LYS A  1  431  ? 121.097 21.768  -18.267 1.00 89.15  ? 431  LYS A CD    1 
ATOM   3312  C  CE    . LYS A  1  431  ? 121.487 21.910  -19.722 1.00 100.07 ? 431  LYS A CE    1 
ATOM   3313  N  NZ    . LYS A  1  431  ? 121.252 20.668  -20.528 1.00 108.96 ? 431  LYS A NZ    1 
ATOM   3314  N  N     . VAL A  1  432  ? 121.548 17.885  -14.234 1.00 68.02  ? 432  VAL A N     1 
ATOM   3315  C  CA    . VAL A  1  432  ? 120.869 17.360  -13.072 1.00 67.47  ? 432  VAL A CA    1 
ATOM   3316  C  C     . VAL A  1  432  ? 120.277 18.544  -12.362 1.00 71.45  ? 432  VAL A C     1 
ATOM   3317  O  O     . VAL A  1  432  ? 120.997 19.439  -11.928 1.00 71.47  ? 432  VAL A O     1 
ATOM   3318  C  CB    . VAL A  1  432  ? 121.715 16.441  -12.168 1.00 71.49  ? 432  VAL A CB    1 
ATOM   3319  C  CG1   . VAL A  1  432  ? 120.974 16.103  -10.873 1.00 70.76  ? 432  VAL A CG1   1 
ATOM   3320  C  CG2   . VAL A  1  432  ? 122.062 15.168  -12.913 1.00 72.02  ? 432  VAL A CG2   1 
ATOM   3321  N  N     . GLU A  1  433  ? 118.947 18.589  -12.336 1.00 67.71  ? 433  GLU A N     1 
ATOM   3322  C  CA    . GLU A  1  433  ? 118.175 19.617  -11.667 1.00 66.38  ? 433  GLU A CA    1 
ATOM   3323  C  C     . GLU A  1  433  ? 118.095 19.162  -10.226 1.00 71.59  ? 433  GLU A C     1 
ATOM   3324  O  O     . GLU A  1  433  ? 117.141 18.499  -9.809  1.00 71.49  ? 433  GLU A O     1 
ATOM   3325  C  CB    . GLU A  1  433  ? 116.798 19.774  -12.308 1.00 67.04  ? 433  GLU A CB    1 
ATOM   3326  C  CG    . GLU A  1  433  ? 116.855 20.544  -13.611 1.00 73.06  ? 433  GLU A CG    1 
ATOM   3327  C  CD    . GLU A  1  433  ? 115.611 21.346  -13.916 1.00 96.21  ? 433  GLU A CD    1 
ATOM   3328  O  OE1   . GLU A  1  433  ? 114.542 21.004  -13.363 1.00 89.17  ? 433  GLU A OE1   1 
ATOM   3329  O  OE2   . GLU A  1  433  ? 115.716 22.348  -14.660 1.00 97.42  ? 433  GLU A OE2   1 
ATOM   3330  N  N     . ARG A  1  434  ? 119.184 19.436  -9.506  1.00 68.57  ? 434  ARG A N     1 
ATOM   3331  C  CA    . ARG A  1  434  ? 119.402 19.089  -8.111  1.00 68.57  ? 434  ARG A CA    1 
ATOM   3332  C  C     . ARG A  1  434  ? 118.786 20.129  -7.190  1.00 72.65  ? 434  ARG A C     1 
ATOM   3333  O  O     . ARG A  1  434  ? 118.655 21.279  -7.614  1.00 73.03  ? 434  ARG A O     1 
ATOM   3334  C  CB    . ARG A  1  434  ? 120.912 18.966  -7.852  1.00 67.01  ? 434  ARG A CB    1 
ATOM   3335  C  CG    . ARG A  1  434  ? 121.759 20.130  -8.355  1.00 60.92  ? 434  ARG A CG    1 
ATOM   3336  C  CD    . ARG A  1  434  ? 123.005 20.288  -7.509  1.00 59.63  ? 434  ARG A CD    1 
ATOM   3337  N  NE    . ARG A  1  434  ? 122.844 21.412  -6.596  1.00 60.56  ? 434  ARG A NE    1 
ATOM   3338  C  CZ    . ARG A  1  434  ? 123.449 22.584  -6.734  1.00 77.57  ? 434  ARG A CZ    1 
ATOM   3339  N  NH1   . ARG A  1  434  ? 124.309 22.786  -7.728  1.00 72.64  ? 434  ARG A NH1   1 
ATOM   3340  N  NH2   . ARG A  1  434  ? 123.214 23.554  -5.879  1.00 58.67  ? 434  ARG A NH2   1 
ATOM   3341  N  N     . HIS A  1  435  ? 118.445 19.755  -5.929  1.00 68.16  ? 435  HIS A N     1 
ATOM   3342  C  CA    . HIS A  1  435  ? 117.881 20.711  -4.972  1.00 68.04  ? 435  HIS A CA    1 
ATOM   3343  C  C     . HIS A  1  435  ? 118.907 21.793  -4.663  1.00 73.73  ? 435  HIS A C     1 
ATOM   3344  O  O     . HIS A  1  435  ? 120.118 21.579  -4.812  1.00 74.59  ? 435  HIS A O     1 
ATOM   3345  C  CB    . HIS A  1  435  ? 117.516 20.058  -3.620  1.00 69.19  ? 435  HIS A CB    1 
ATOM   3346  C  CG    . HIS A  1  435  ? 116.547 18.919  -3.657  1.00 72.57  ? 435  HIS A CG    1 
ATOM   3347  N  ND1   . HIS A  1  435  ? 115.236 19.088  -4.050  1.00 74.20  ? 435  HIS A ND1   1 
ATOM   3348  C  CD2   . HIS A  1  435  ? 116.714 17.645  -3.256  1.00 73.99  ? 435  HIS A CD2   1 
ATOM   3349  C  CE1   . HIS A  1  435  ? 114.668 17.901  -3.926  1.00 73.55  ? 435  HIS A CE1   1 
ATOM   3350  N  NE2   . HIS A  1  435  ? 115.519 17.006  -3.449  1.00 74.08  ? 435  HIS A NE2   1 
ATOM   3351  N  N     . ILE A  1  436  ? 118.414 22.940  -4.197  1.00 69.69  ? 436  ILE A N     1 
ATOM   3352  C  CA    . ILE A  1  436  ? 119.202 24.064  -3.726  1.00 69.71  ? 436  ILE A CA    1 
ATOM   3353  C  C     . ILE A  1  436  ? 119.963 23.562  -2.471  1.00 75.98  ? 436  ILE A C     1 
ATOM   3354  O  O     . ILE A  1  436  ? 119.403 22.787  -1.694  1.00 76.37  ? 436  ILE A O     1 
ATOM   3355  C  CB    . ILE A  1  436  ? 118.186 25.240  -3.528  1.00 72.77  ? 436  ILE A CB    1 
ATOM   3356  C  CG1   . ILE A  1  436  ? 118.421 26.315  -4.544  1.00 74.03  ? 436  ILE A CG1   1 
ATOM   3357  C  CG2   . ILE A  1  436  ? 118.059 25.824  -2.140  1.00 73.34  ? 436  ILE A CG2   1 
ATOM   3358  C  CD1   . ILE A  1  436  ? 118.280 25.785  -5.969  1.00 92.50  ? 436  ILE A CD1   1 
ATOM   3359  N  N     . MET A  1  437  ? 121.270 23.862  -2.366  1.00 73.65  ? 437  MET A N     1 
ATOM   3360  C  CA    . MET A  1  437  ? 122.130 23.388  -1.266  1.00 74.12  ? 437  MET A CA    1 
ATOM   3361  C  C     . MET A  1  437  ? 122.964 24.510  -0.641  1.00 76.32  ? 437  MET A C     1 
ATOM   3362  O  O     . MET A  1  437  ? 123.131 25.588  -1.235  1.00 75.87  ? 437  MET A O     1 
ATOM   3363  C  CB    . MET A  1  437  ? 123.056 22.264  -1.741  1.00 77.50  ? 437  MET A CB    1 
ATOM   3364  C  CG    . MET A  1  437  ? 122.314 21.072  -2.338  1.00 82.61  ? 437  MET A CG    1 
ATOM   3365  S  SD    . MET A  1  437  ? 123.344 19.662  -2.835  1.00 88.60  ? 437  MET A SD    1 
ATOM   3366  C  CE    . MET A  1  437  ? 124.639 20.536  -3.931  1.00 85.24  ? 437  MET A CE    1 
ATOM   3367  N  N     . ASP A  1  438  ? 123.489 24.249  0.576   1.00 70.24  ? 438  ASP A N     1 
ATOM   3368  C  CA    . ASP A  1  438  ? 124.293 25.197  1.336   1.00 67.81  ? 438  ASP A CA    1 
ATOM   3369  C  C     . ASP A  1  438  ? 125.362 25.838  0.486   1.00 69.35  ? 438  ASP A C     1 
ATOM   3370  O  O     . ASP A  1  438  ? 126.107 25.155  -0.203  1.00 68.98  ? 438  ASP A O     1 
ATOM   3371  C  CB    . ASP A  1  438  ? 124.907 24.530  2.571   1.00 69.59  ? 438  ASP A CB    1 
ATOM   3372  C  CG    . ASP A  1  438  ? 123.925 24.143  3.656   1.00 82.15  ? 438  ASP A CG    1 
ATOM   3373  O  OD1   . ASP A  1  438  ? 122.707 24.117  3.376   1.00 83.99  ? 438  ASP A OD1   1 
ATOM   3374  O  OD2   . ASP A  1  438  ? 124.376 23.858  4.791   1.00 89.19  ? 438  ASP A OD2   1 
ATOM   3375  N  N     . ASN A  1  439  ? 125.353 27.165  0.483   1.00 65.49  ? 439  ASN A N     1 
ATOM   3376  C  CA    . ASN A  1  439  ? 126.263 28.121  -0.151  1.00 65.04  ? 439  ASN A CA    1 
ATOM   3377  C  C     . ASN A  1  439  ? 125.963 28.410  -1.615  1.00 70.24  ? 439  ASN A C     1 
ATOM   3378  O  O     . ASN A  1  439  ? 126.742 29.124  -2.261  1.00 70.52  ? 439  ASN A O     1 
ATOM   3379  C  CB    . ASN A  1  439  ? 127.722 27.784  0.056   1.00 61.98  ? 439  ASN A CB    1 
ATOM   3380  C  CG    . ASN A  1  439  ? 128.105 27.798  1.504   1.00 87.24  ? 439  ASN A CG    1 
ATOM   3381  O  OD1   . ASN A  1  439  ? 127.628 28.625  2.322   1.00 79.36  ? 439  ASN A OD1   1 
ATOM   3382  N  ND2   . ASN A  1  439  ? 128.936 26.832  1.854   1.00 82.68  ? 439  ASN A ND2   1 
ATOM   3383  N  N     . ASP A  1  440  ? 124.791 27.989  -2.114  1.00 66.79  ? 440  ASP A N     1 
ATOM   3384  C  CA    . ASP A  1  440  ? 124.421 28.416  -3.458  1.00 66.04  ? 440  ASP A CA    1 
ATOM   3385  C  C     . ASP A  1  440  ? 124.027 29.882  -3.306  1.00 69.29  ? 440  ASP A C     1 
ATOM   3386  O  O     . ASP A  1  440  ? 123.320 30.219  -2.332  1.00 69.56  ? 440  ASP A O     1 
ATOM   3387  C  CB    . ASP A  1  440  ? 123.189 27.676  -3.988  1.00 67.50  ? 440  ASP A CB    1 
ATOM   3388  C  CG    . ASP A  1  440  ? 123.344 26.223  -4.350  1.00 76.34  ? 440  ASP A CG    1 
ATOM   3389  O  OD1   . ASP A  1  440  ? 124.500 25.786  -4.610  1.00 76.24  ? 440  ASP A OD1   1 
ATOM   3390  O  OD2   . ASP A  1  440  ? 122.308 25.524  -4.411  1.00 82.29  ? 440  ASP A OD2   1 
ATOM   3391  N  N     . PRO A  1  441  ? 124.465 30.774  -4.225  1.00 63.85  ? 441  PRO A N     1 
ATOM   3392  C  CA    . PRO A  1  441  ? 124.026 32.166  -4.125  1.00 62.39  ? 441  PRO A CA    1 
ATOM   3393  C  C     . PRO A  1  441  ? 122.571 32.251  -4.610  1.00 65.12  ? 441  PRO A C     1 
ATOM   3394  O  O     . PRO A  1  441  ? 122.213 31.621  -5.616  1.00 64.65  ? 441  PRO A O     1 
ATOM   3395  C  CB    . PRO A  1  441  ? 125.029 32.910  -5.004  1.00 63.89  ? 441  PRO A CB    1 
ATOM   3396  C  CG    . PRO A  1  441  ? 125.432 31.940  -6.026  1.00 68.88  ? 441  PRO A CG    1 
ATOM   3397  C  CD    . PRO A  1  441  ? 125.266 30.554  -5.445  1.00 65.16  ? 441  PRO A CD    1 
ATOM   3398  N  N     . VAL A  1  442  ? 121.714 32.911  -3.815  1.00 60.10  ? 442  VAL A N     1 
ATOM   3399  C  CA    . VAL A  1  442  ? 120.284 33.110  -4.114  1.00 59.00  ? 442  VAL A CA    1 
ATOM   3400  C  C     . VAL A  1  442  ? 119.975 34.612  -3.954  1.00 63.67  ? 442  VAL A C     1 
ATOM   3401  O  O     . VAL A  1  442  ? 120.802 35.319  -3.361  1.00 65.20  ? 442  VAL A O     1 
ATOM   3402  C  CB    . VAL A  1  442  ? 119.351 32.212  -3.267  1.00 61.55  ? 442  VAL A CB    1 
ATOM   3403  C  CG1   . VAL A  1  442  ? 119.551 30.755  -3.600  1.00 60.25  ? 442  VAL A CG1   1 
ATOM   3404  C  CG2   . VAL A  1  442  ? 119.566 32.452  -1.784  1.00 62.06  ? 442  VAL A CG2   1 
ATOM   3405  N  N     . LEU A  1  443  ? 118.848 35.116  -4.505  1.00 57.74  ? 443  LEU A N     1 
ATOM   3406  C  CA    . LEU A  1  443  ? 118.566 36.551  -4.415  1.00 57.83  ? 443  LEU A CA    1 
ATOM   3407  C  C     . LEU A  1  443  ? 117.580 36.785  -3.331  1.00 65.81  ? 443  LEU A C     1 
ATOM   3408  O  O     . LEU A  1  443  ? 116.528 36.170  -3.356  1.00 69.11  ? 443  LEU A O     1 
ATOM   3409  C  CB    . LEU A  1  443  ? 118.033 37.097  -5.752  1.00 57.13  ? 443  LEU A CB    1 
ATOM   3410  C  CG    . LEU A  1  443  ? 118.587 38.424  -6.320  1.00 60.28  ? 443  LEU A CG    1 
ATOM   3411  C  CD1   . LEU A  1  443  ? 117.512 39.409  -6.455  1.00 60.07  ? 443  LEU A CD1   1 
ATOM   3412  C  CD2   . LEU A  1  443  ? 119.713 39.029  -5.498  1.00 60.27  ? 443  LEU A CD2   1 
ATOM   3413  N  N     . PHE A  1  444  ? 117.894 37.618  -2.349  1.00 62.07  ? 444  PHE A N     1 
ATOM   3414  C  CA    . PHE A  1  444  ? 116.931 37.820  -1.267  1.00 62.17  ? 444  PHE A CA    1 
ATOM   3415  C  C     . PHE A  1  444  ? 116.340 39.202  -1.338  1.00 67.00  ? 444  PHE A C     1 
ATOM   3416  O  O     . PHE A  1  444  ? 117.080 40.175  -1.526  1.00 67.05  ? 444  PHE A O     1 
ATOM   3417  C  CB    . PHE A  1  444  ? 117.557 37.529  0.094   1.00 64.13  ? 444  PHE A CB    1 
ATOM   3418  C  CG    . PHE A  1  444  ? 116.617 37.129  1.205   1.00 65.99  ? 444  PHE A CG    1 
ATOM   3419  C  CD1   . PHE A  1  444  ? 115.593 36.225  0.979   1.00 69.26  ? 444  PHE A CD1   1 
ATOM   3420  C  CD2   . PHE A  1  444  ? 116.823 37.577  2.503   1.00 69.06  ? 444  PHE A CD2   1 
ATOM   3421  C  CE1   . PHE A  1  444  ? 114.767 35.807  2.024   1.00 70.93  ? 444  PHE A CE1   1 
ATOM   3422  C  CE2   . PHE A  1  444  ? 115.997 37.162  3.545   1.00 72.03  ? 444  PHE A CE2   1 
ATOM   3423  C  CZ    . PHE A  1  444  ? 114.973 36.280  3.299   1.00 70.26  ? 444  PHE A CZ    1 
ATOM   3424  N  N     . ASN A  1  445  ? 115.004 39.298  -1.197  1.00 62.67  ? 445  ASN A N     1 
ATOM   3425  C  CA    . ASN A  1  445  ? 114.321 40.573  -1.349  1.00 62.10  ? 445  ASN A CA    1 
ATOM   3426  C  C     . ASN A  1  445  ? 113.149 40.798  -0.424  1.00 64.92  ? 445  ASN A C     1 
ATOM   3427  O  O     . ASN A  1  445  ? 112.424 39.862  -0.138  1.00 66.51  ? 445  ASN A O     1 
ATOM   3428  C  CB    . ASN A  1  445  ? 113.883 40.675  -2.828  1.00 64.07  ? 445  ASN A CB    1 
ATOM   3429  C  CG    . ASN A  1  445  ? 112.742 41.589  -3.212  1.00 82.56  ? 445  ASN A CG    1 
ATOM   3430  O  OD1   . ASN A  1  445  ? 111.779 41.154  -3.847  1.00 76.54  ? 445  ASN A OD1   1 
ATOM   3431  N  ND2   . ASN A  1  445  ? 112.880 42.882  -2.956  1.00 73.11  ? 445  ASN A ND2   1 
ATOM   3432  N  N     . ARG A  1  446  ? 112.951 42.044  0.010   1.00 60.55  ? 446  ARG A N     1 
ATOM   3433  C  CA    . ARG A  1  446  ? 111.778 42.511  0.736   1.00 62.06  ? 446  ARG A CA    1 
ATOM   3434  C  C     . ARG A  1  446  ? 111.177 43.705  -0.024  1.00 70.29  ? 446  ARG A C     1 
ATOM   3435  O  O     . ARG A  1  446  ? 111.865 44.724  -0.238  1.00 72.15  ? 446  ARG A O     1 
ATOM   3436  C  CB    . ARG A  1  446  ? 112.054 42.905  2.189   1.00 63.12  ? 446  ARG A CB    1 
ATOM   3437  C  CG    . ARG A  1  446  ? 110.738 43.007  2.977   1.00 69.62  ? 446  ARG A CG    1 
ATOM   3438  C  CD    . ARG A  1  446  ? 110.847 43.793  4.255   1.00 74.07  ? 446  ARG A CD    1 
ATOM   3439  N  NE    . ARG A  1  446  ? 109.598 44.488  4.583   1.00 82.36  ? 446  ARG A NE    1 
ATOM   3440  C  CZ    . ARG A  1  446  ? 109.324 45.746  4.244   1.00 100.72 ? 446  ARG A CZ    1 
ATOM   3441  N  NH1   . ARG A  1  446  ? 110.215 46.471  3.573   1.00 95.16  ? 446  ARG A NH1   1 
ATOM   3442  N  NH2   . ARG A  1  446  ? 108.173 46.298  4.597   1.00 86.91  ? 446  ARG A NH2   1 
ATOM   3443  N  N     . GLN A  1  447  ? 109.890 43.574  -0.411  1.00 66.38  ? 447  GLN A N     1 
ATOM   3444  C  CA    . GLN A  1  447  ? 109.139 44.584  -1.158  1.00 66.35  ? 447  GLN A CA    1 
ATOM   3445  C  C     . GLN A  1  447  ? 108.484 45.594  -0.195  1.00 73.95  ? 447  GLN A C     1 
ATOM   3446  O  O     . GLN A  1  447  ? 108.061 45.162  0.871   1.00 75.18  ? 447  GLN A O     1 
ATOM   3447  C  CB    . GLN A  1  447  ? 108.075 43.900  -2.032  1.00 67.09  ? 447  GLN A CB    1 
ATOM   3448  C  CG    . GLN A  1  447  ? 108.648 43.110  -3.210  1.00 72.68  ? 447  GLN A CG    1 
ATOM   3449  C  CD    . GLN A  1  447  ? 107.964 41.791  -3.473  1.00 90.83  ? 447  GLN A CD    1 
ATOM   3450  O  OE1   . GLN A  1  447  ? 107.676 40.999  -2.565  1.00 90.68  ? 447  GLN A OE1   1 
ATOM   3451  N  NE2   . GLN A  1  447  ? 107.804 41.467  -4.739  1.00 82.36  ? 447  GLN A NE2   1 
ATOM   3452  N  N     . PRO A  1  448  ? 108.369 46.917  -0.481  1.00 72.76  ? 448  PRO A N     1 
ATOM   3453  C  CA    . PRO A  1  448  ? 108.782 47.657  -1.683  1.00 73.45  ? 448  PRO A CA    1 
ATOM   3454  C  C     . PRO A  1  448  ? 110.290 47.676  -1.847  1.00 78.67  ? 448  PRO A C     1 
ATOM   3455  O  O     . PRO A  1  448  ? 111.014 48.020  -0.899  1.00 79.08  ? 448  PRO A O     1 
ATOM   3456  C  CB    . PRO A  1  448  ? 108.247 49.080  -1.419  1.00 75.36  ? 448  PRO A CB    1 
ATOM   3457  C  CG    . PRO A  1  448  ? 107.172 48.900  -0.419  1.00 79.99  ? 448  PRO A CG    1 
ATOM   3458  C  CD    . PRO A  1  448  ? 107.716 47.829  0.470   1.00 75.14  ? 448  PRO A CD    1 
ATOM   3459  N  N     . SER A  1  449  ? 110.755 47.286  -3.048  1.00 74.12  ? 449  SER A N     1 
ATOM   3460  C  CA    . SER A  1  449  ? 112.179 47.289  -3.351  1.00 73.98  ? 449  SER A CA    1 
ATOM   3461  C  C     . SER A  1  449  ? 112.597 48.681  -3.851  1.00 79.63  ? 449  SER A C     1 
ATOM   3462  O  O     . SER A  1  449  ? 112.739 48.888  -5.065  1.00 80.14  ? 449  SER A O     1 
ATOM   3463  C  CB    . SER A  1  449  ? 112.507 46.205  -4.368  1.00 76.19  ? 449  SER A CB    1 
ATOM   3464  O  OG    . SER A  1  449  ? 111.719 45.061  -4.106  1.00 84.40  ? 449  SER A OG    1 
ATOM   3465  N  N     . LEU A  1  450  ? 112.769 49.641  -2.911  1.00 76.70  ? 450  LEU A N     1 
ATOM   3466  C  CA    . LEU A  1  450  ? 113.146 51.044  -3.198  1.00 77.95  ? 450  LEU A CA    1 
ATOM   3467  C  C     . LEU A  1  450  ? 114.663 51.262  -3.376  1.00 84.91  ? 450  LEU A C     1 
ATOM   3468  O  O     . LEU A  1  450  ? 115.092 52.344  -3.781  1.00 85.54  ? 450  LEU A O     1 
ATOM   3469  C  CB    . LEU A  1  450  ? 112.698 51.981  -2.052  1.00 78.31  ? 450  LEU A CB    1 
ATOM   3470  C  CG    . LEU A  1  450  ? 111.352 51.783  -1.382  1.00 82.14  ? 450  LEU A CG    1 
ATOM   3471  C  CD1   . LEU A  1  450  ? 111.431 52.258  0.046   1.00 82.06  ? 450  LEU A CD1   1 
ATOM   3472  C  CD2   . LEU A  1  450  ? 110.231 52.499  -2.151  1.00 83.49  ? 450  LEU A CD2   1 
ATOM   3473  N  N     . HIS A  1  451  ? 115.453 50.248  -3.035  1.00 82.42  ? 451  HIS A N     1 
ATOM   3474  C  CA    . HIS A  1  451  ? 116.902 50.251  -2.965  1.00 82.67  ? 451  HIS A CA    1 
ATOM   3475  C  C     . HIS A  1  451  ? 117.564 49.201  -3.819  1.00 83.20  ? 451  HIS A C     1 
ATOM   3476  O  O     . HIS A  1  451  ? 117.025 48.098  -3.906  1.00 81.86  ? 451  HIS A O     1 
ATOM   3477  C  CB    . HIS A  1  451  ? 117.205 49.754  -1.558  1.00 84.77  ? 451  HIS A CB    1 
ATOM   3478  C  CG    . HIS A  1  451  ? 117.569 50.777  -0.568  1.00 89.32  ? 451  HIS A CG    1 
ATOM   3479  N  ND1   . HIS A  1  451  ? 117.684 50.448  0.764   1.00 91.53  ? 451  HIS A ND1   1 
ATOM   3480  C  CD2   . HIS A  1  451  ? 117.882 52.080  -0.744  1.00 92.75  ? 451  HIS A CD2   1 
ATOM   3481  C  CE1   . HIS A  1  451  ? 118.036 51.564  1.370   1.00 92.80  ? 451  HIS A CE1   1 
ATOM   3482  N  NE2   . HIS A  1  451  ? 118.171 52.579  0.496   1.00 93.56  ? 451  HIS A NE2   1 
ATOM   3483  N  N     . LYS A  1  452  ? 118.841 49.430  -4.236  1.00 78.11  ? 452  LYS A N     1 
ATOM   3484  C  CA    . LYS A  1  452  ? 119.590 48.331  -4.856  1.00 76.40  ? 452  LYS A CA    1 
ATOM   3485  C  C     . LYS A  1  452  ? 119.836 47.297  -3.733  1.00 79.16  ? 452  LYS A C     1 
ATOM   3486  O  O     . LYS A  1  452  ? 119.762 46.104  -3.998  1.00 80.26  ? 452  LYS A O     1 
ATOM   3487  C  CB    . LYS A  1  452  ? 120.883 48.773  -5.599  1.00 77.67  ? 452  LYS A CB    1 
ATOM   3488  C  CG    . LYS A  1  452  ? 122.100 49.173  -4.761  1.00 75.25  ? 452  LYS A CG    1 
ATOM   3489  C  CD    . LYS A  1  452  ? 123.417 48.918  -5.509  1.00 72.68  ? 452  LYS A CD    1 
ATOM   3490  C  CE    . LYS A  1  452  ? 124.501 49.910  -5.166  1.00 74.56  ? 452  LYS A CE    1 
ATOM   3491  N  NZ    . LYS A  1  452  ? 125.855 49.278  -5.080  1.00 84.94  ? 452  LYS A NZ    1 
ATOM   3492  N  N     . MET A  1  453  ? 119.961 47.773  -2.463  1.00 73.06  ? 453  MET A N     1 
ATOM   3493  C  CA    . MET A  1  453  ? 120.134 46.989  -1.231  1.00 72.53  ? 453  MET A CA    1 
ATOM   3494  C  C     . MET A  1  453  ? 118.893 46.210  -0.843  1.00 73.28  ? 453  MET A C     1 
ATOM   3495  O  O     . MET A  1  453  ? 118.966 45.425  0.104   1.00 73.02  ? 453  MET A O     1 
ATOM   3496  C  CB    . MET A  1  453  ? 120.504 47.877  -0.032  1.00 75.95  ? 453  MET A CB    1 
ATOM   3497  C  CG    . MET A  1  453  ? 121.856 48.462  -0.111  1.00 81.19  ? 453  MET A CG    1 
ATOM   3498  S  SD    . MET A  1  453  ? 121.782 49.908  -1.164  1.00 87.06  ? 453  MET A SD    1 
ATOM   3499  C  CE    . MET A  1  453  ? 121.339 51.144  0.024   1.00 84.85  ? 453  MET A CE    1 
ATOM   3500  N  N     . SER A  1  454  ? 117.744 46.458  -1.496  1.00 67.41  ? 454  SER A N     1 
ATOM   3501  C  CA    . SER A  1  454  ? 116.536 45.708  -1.168  1.00 66.80  ? 454  SER A CA    1 
ATOM   3502  C  C     . SER A  1  454  ? 116.591 44.317  -1.805  1.00 69.78  ? 454  SER A C     1 
ATOM   3503  O  O     . SER A  1  454  ? 115.738 43.486  -1.531  1.00 69.79  ? 454  SER A O     1 
ATOM   3504  C  CB    . SER A  1  454  ? 115.283 46.460  -1.593  1.00 69.65  ? 454  SER A CB    1 
ATOM   3505  O  OG    . SER A  1  454  ? 115.014 47.498  -0.672  1.00 77.48  ? 454  SER A OG    1 
ATOM   3506  N  N     . MET A  1  455  ? 117.588 44.074  -2.666  1.00 64.56  ? 455  MET A N     1 
ATOM   3507  C  CA    . MET A  1  455  ? 117.783 42.799  -3.341  1.00 63.63  ? 455  MET A CA    1 
ATOM   3508  C  C     . MET A  1  455  ? 119.253 42.481  -3.184  1.00 66.11  ? 455  MET A C     1 
ATOM   3509  O  O     . MET A  1  455  ? 120.087 43.241  -3.669  1.00 65.90  ? 455  MET A O     1 
ATOM   3510  C  CB    . MET A  1  455  ? 117.412 42.893  -4.830  1.00 65.89  ? 455  MET A CB    1 
ATOM   3511  C  CG    . MET A  1  455  ? 115.989 43.272  -5.095  1.00 69.40  ? 455  MET A CG    1 
ATOM   3512  S  SD    . MET A  1  455  ? 115.540 42.751  -6.757  1.00 73.53  ? 455  MET A SD    1 
ATOM   3513  C  CE    . MET A  1  455  ? 114.594 41.346  -6.377  1.00 69.54  ? 455  MET A CE    1 
ATOM   3514  N  N     . MET A  1  456  ? 119.589 41.429  -2.427  1.00 61.48  ? 456  MET A N     1 
ATOM   3515  C  CA    . MET A  1  456  ? 120.989 41.094  -2.165  1.00 60.82  ? 456  MET A CA    1 
ATOM   3516  C  C     . MET A  1  456  ? 121.219 39.602  -2.235  1.00 67.03  ? 456  MET A C     1 
ATOM   3517  O  O     . MET A  1  456  ? 120.361 38.810  -1.847  1.00 67.18  ? 456  MET A O     1 
ATOM   3518  C  CB    . MET A  1  456  ? 121.457 41.640  -0.803  1.00 62.90  ? 456  MET A CB    1 
ATOM   3519  C  CG    . MET A  1  456  ? 121.369 43.145  -0.677  1.00 65.94  ? 456  MET A CG    1 
ATOM   3520  S  SD    . MET A  1  456  ? 122.232 43.845  0.722   1.00 70.20  ? 456  MET A SD    1 
ATOM   3521  C  CE    . MET A  1  456  ? 121.148 43.410  2.053   1.00 66.60  ? 456  MET A CE    1 
ATOM   3522  N  N     . ALA A  1  457  ? 122.373 39.218  -2.755  1.00 64.05  ? 457  ALA A N     1 
ATOM   3523  C  CA    . ALA A  1  457  ? 122.735 37.824  -2.884  1.00 63.43  ? 457  ALA A CA    1 
ATOM   3524  C  C     . ALA A  1  457  ? 123.176 37.320  -1.528  1.00 68.84  ? 457  ALA A C     1 
ATOM   3525  O  O     . ALA A  1  457  ? 123.950 37.970  -0.826  1.00 70.35  ? 457  ALA A O     1 
ATOM   3526  C  CB    . ALA A  1  457  ? 123.851 37.674  -3.901  1.00 64.10  ? 457  ALA A CB    1 
ATOM   3527  N  N     . HIS A  1  458  ? 122.656 36.175  -1.155  1.00 64.84  ? 458  HIS A N     1 
ATOM   3528  C  CA    . HIS A  1  458  ? 122.933 35.512  0.109   1.00 64.02  ? 458  HIS A CA    1 
ATOM   3529  C  C     . HIS A  1  458  ? 123.312 34.061  -0.199  1.00 67.71  ? 458  HIS A C     1 
ATOM   3530  O  O     . HIS A  1  458  ? 122.806 33.479  -1.174  1.00 68.36  ? 458  HIS A O     1 
ATOM   3531  C  CB    . HIS A  1  458  ? 121.647 35.466  0.968   1.00 63.95  ? 458  HIS A CB    1 
ATOM   3532  C  CG    . HIS A  1  458  ? 121.272 36.715  1.699   1.00 66.65  ? 458  HIS A CG    1 
ATOM   3533  N  ND1   . HIS A  1  458  ? 121.383 36.800  3.069   1.00 68.57  ? 458  HIS A ND1   1 
ATOM   3534  C  CD2   . HIS A  1  458  ? 120.686 37.841  1.244   1.00 67.55  ? 458  HIS A CD2   1 
ATOM   3535  C  CE1   . HIS A  1  458  ? 120.906 37.985  3.398   1.00 67.62  ? 458  HIS A CE1   1 
ATOM   3536  N  NE2   . HIS A  1  458  ? 120.463 38.641  2.334   1.00 67.45  ? 458  HIS A NE2   1 
ATOM   3537  N  N     . ARG A  1  459  ? 124.117 33.457  0.690   1.00 61.65  ? 459  ARG A N     1 
ATOM   3538  C  CA    . ARG A  1  459  ? 124.529 32.062  0.649   1.00 60.25  ? 459  ARG A CA    1 
ATOM   3539  C  C     . ARG A  1  459  ? 123.449 31.257  1.364   1.00 66.85  ? 459  ARG A C     1 
ATOM   3540  O  O     . ARG A  1  459  ? 123.145 31.541  2.531   1.00 68.71  ? 459  ARG A O     1 
ATOM   3541  C  CB    . ARG A  1  459  ? 125.804 31.907  1.478   1.00 57.30  ? 459  ARG A CB    1 
ATOM   3542  C  CG    . ARG A  1  459  ? 127.119 32.160  0.777   1.00 56.87  ? 459  ARG A CG    1 
ATOM   3543  C  CD    . ARG A  1  459  ? 128.176 32.573  1.789   1.00 65.24  ? 459  ARG A CD    1 
ATOM   3544  N  NE    . ARG A  1  459  ? 128.448 31.553  2.806   1.00 81.47  ? 459  ARG A NE    1 
ATOM   3545  C  CZ    . ARG A  1  459  ? 128.546 31.802  4.106   1.00 95.27  ? 459  ARG A CZ    1 
ATOM   3546  N  NH1   . ARG A  1  459  ? 128.411 33.039  4.562   1.00 81.41  ? 459  ARG A NH1   1 
ATOM   3547  N  NH2   . ARG A  1  459  ? 128.788 30.817  4.960   1.00 83.17  ? 459  ARG A NH2   1 
ATOM   3548  N  N     . VAL A  1  460  ? 122.917 30.218  0.721   1.00 62.23  ? 460  VAL A N     1 
ATOM   3549  C  CA    . VAL A  1  460  ? 121.936 29.317  1.349   1.00 61.33  ? 460  VAL A CA    1 
ATOM   3550  C  C     . VAL A  1  460  ? 122.535 28.596  2.612   1.00 65.46  ? 460  VAL A C     1 
ATOM   3551  O  O     . VAL A  1  460  ? 123.753 28.453  2.770   1.00 64.68  ? 460  VAL A O     1 
ATOM   3552  C  CB    . VAL A  1  460  ? 121.403 28.302  0.273   1.00 64.21  ? 460  VAL A CB    1 
ATOM   3553  C  CG1   . VAL A  1  460  ? 120.820 27.031  0.878   1.00 63.77  ? 460  VAL A CG1   1 
ATOM   3554  C  CG2   . VAL A  1  460  ? 120.385 28.954  -0.634  1.00 63.53  ? 460  VAL A CG2   1 
ATOM   3555  N  N     . LYS A  1  461  ? 121.639 28.201  3.510   1.00 62.70  ? 461  LYS A N     1 
ATOM   3556  C  CA    . LYS A  1  461  ? 121.846 27.355  4.666   1.00 62.90  ? 461  LYS A CA    1 
ATOM   3557  C  C     . LYS A  1  461  ? 120.518 26.640  4.854   1.00 68.63  ? 461  LYS A C     1 
ATOM   3558  O  O     . LYS A  1  461  ? 119.548 27.262  5.294   1.00 68.79  ? 461  LYS A O     1 
ATOM   3559  C  CB    . LYS A  1  461  ? 122.219 28.140  5.924   1.00 65.57  ? 461  LYS A CB    1 
ATOM   3560  C  CG    . LYS A  1  461  ? 123.384 27.512  6.694   1.00 85.98  ? 461  LYS A CG    1 
ATOM   3561  C  CD    . LYS A  1  461  ? 123.029 26.305  7.561   1.00 94.51  ? 461  LYS A CD    1 
ATOM   3562  C  CE    . LYS A  1  461  ? 124.081 26.071  8.625   1.00 103.09 ? 461  LYS A CE    1 
ATOM   3563  N  NZ    . LYS A  1  461  ? 123.903 26.979  9.802   1.00 104.88 ? 461  LYS A NZ    1 
ATOM   3564  N  N     . VAL A  1  462  ? 120.433 25.363  4.432   1.00 65.29  ? 462  VAL A N     1 
ATOM   3565  C  CA    . VAL A  1  462  ? 119.196 24.609  4.599   1.00 64.29  ? 462  VAL A CA    1 
ATOM   3566  C  C     . VAL A  1  462  ? 119.012 24.304  6.082   1.00 72.68  ? 462  VAL A C     1 
ATOM   3567  O  O     . VAL A  1  462  ? 119.876 23.694  6.717   1.00 74.14  ? 462  VAL A O     1 
ATOM   3568  C  CB    . VAL A  1  462  ? 119.101 23.386  3.694   1.00 65.87  ? 462  VAL A CB    1 
ATOM   3569  C  CG1   . VAL A  1  462  ? 117.730 22.750  3.809   1.00 65.49  ? 462  VAL A CG1   1 
ATOM   3570  C  CG2   . VAL A  1  462  ? 119.376 23.776  2.255   1.00 64.81  ? 462  VAL A CG2   1 
ATOM   3571  N  N     . ILE A  1  463  ? 117.939 24.851  6.645   1.00 70.16  ? 463  ILE A N     1 
ATOM   3572  C  CA    . ILE A  1  463  ? 117.616 24.746  8.068   1.00 70.73  ? 463  ILE A CA    1 
ATOM   3573  C  C     . ILE A  1  463  ? 116.194 24.172  8.269   1.00 73.60  ? 463  ILE A C     1 
ATOM   3574  O  O     . ILE A  1  463  ? 115.383 24.301  7.343   1.00 73.78  ? 463  ILE A O     1 
ATOM   3575  C  CB    . ILE A  1  463  ? 117.785 26.148  8.764   1.00 73.52  ? 463  ILE A CB    1 
ATOM   3576  C  CG1   . ILE A  1  463  ? 117.075 27.275  8.006   1.00 72.89  ? 463  ILE A CG1   1 
ATOM   3577  C  CG2   . ILE A  1  463  ? 119.247 26.492  8.984   1.00 74.36  ? 463  ILE A CG2   1 
ATOM   3578  C  CD1   . ILE A  1  463  ? 115.888 27.717  8.603   1.00 82.08  ? 463  ILE A CD1   1 
ATOM   3579  N  N     . PRO A  1  464  ? 115.838 23.617  9.468   1.00 67.43  ? 464  PRO A N     1 
ATOM   3580  C  CA    . PRO A  1  464  ? 114.451 23.166  9.682   1.00 67.00  ? 464  PRO A CA    1 
ATOM   3581  C  C     . PRO A  1  464  ? 113.500 24.362  9.872   1.00 74.21  ? 464  PRO A C     1 
ATOM   3582  O  O     . PRO A  1  464  ? 113.935 25.513  9.777   1.00 75.83  ? 464  PRO A O     1 
ATOM   3583  C  CB    . PRO A  1  464  ? 114.558 22.319  10.948  1.00 68.70  ? 464  PRO A CB    1 
ATOM   3584  C  CG    . PRO A  1  464  ? 115.688 22.882  11.674  1.00 72.73  ? 464  PRO A CG    1 
ATOM   3585  C  CD    . PRO A  1  464  ? 116.654 23.410  10.682  1.00 68.14  ? 464  PRO A CD    1 
ATOM   3586  N  N     . TYR A  1  465  ? 112.203 24.105  10.128  1.00 71.20  ? 465  TYR A N     1 
ATOM   3587  C  CA    . TYR A  1  465  ? 111.148 25.116  10.371  1.00 71.22  ? 465  TYR A CA    1 
ATOM   3588  C  C     . TYR A  1  465  ? 110.805 25.933  9.110   1.00 75.70  ? 465  TYR A C     1 
ATOM   3589  O  O     . TYR A  1  465  ? 111.519 25.863  8.107   1.00 75.44  ? 465  TYR A O     1 
ATOM   3590  C  CB    . TYR A  1  465  ? 111.438 25.994  11.596  1.00 71.79  ? 465  TYR A CB    1 
ATOM   3591  C  CG    . TYR A  1  465  ? 111.831 25.150  12.783  1.00 72.13  ? 465  TYR A CG    1 
ATOM   3592  C  CD1   . TYR A  1  465  ? 110.884 24.394  13.467  1.00 73.74  ? 465  TYR A CD1   1 
ATOM   3593  C  CD2   . TYR A  1  465  ? 113.162 25.025  13.161  1.00 73.56  ? 465  TYR A CD2   1 
ATOM   3594  C  CE1   . TYR A  1  465  ? 111.248 23.553  14.516  1.00 75.38  ? 465  TYR A CE1   1 
ATOM   3595  C  CE2   . TYR A  1  465  ? 113.541 24.189  14.210  1.00 76.18  ? 465  TYR A CE2   1 
ATOM   3596  C  CZ    . TYR A  1  465  ? 112.579 23.453  14.890  1.00 83.98  ? 465  TYR A CZ    1 
ATOM   3597  O  OH    . TYR A  1  465  ? 112.939 22.639  15.945  1.00 84.17  ? 465  TYR A OH    1 
ATOM   3598  N  N     . SER A  1  466  ? 109.636 26.593  9.127   1.00 71.29  ? 466  SER A N     1 
ATOM   3599  C  CA    . SER A  1  466  ? 109.073 27.205  7.934   1.00 69.95  ? 466  SER A CA    1 
ATOM   3600  C  C     . SER A  1  466  ? 109.448 28.701  7.665   1.00 72.37  ? 466  SER A C     1 
ATOM   3601  O  O     . SER A  1  466  ? 108.935 29.283  6.708   1.00 72.08  ? 466  SER A O     1 
ATOM   3602  C  CB    . SER A  1  466  ? 107.559 27.013  7.952   1.00 73.98  ? 466  SER A CB    1 
ATOM   3603  O  OG    . SER A  1  466  ? 107.197 25.648  8.128   1.00 84.43  ? 466  SER A OG    1 
ATOM   3604  N  N     . THR A  1  467  ? 110.377 29.294  8.419   1.00 67.46  ? 467  THR A N     1 
ATOM   3605  C  CA    . THR A  1  467  ? 110.730 30.688  8.152   1.00 66.56  ? 467  THR A CA    1 
ATOM   3606  C  C     . THR A  1  467  ? 112.104 30.874  7.521   1.00 72.13  ? 467  THR A C     1 
ATOM   3607  O  O     . THR A  1  467  ? 113.020 30.117  7.856   1.00 74.70  ? 467  THR A O     1 
ATOM   3608  C  CB    . THR A  1  467  ? 110.599 31.568  9.405   1.00 69.09  ? 467  THR A CB    1 
ATOM   3609  O  OG1   . THR A  1  467  ? 111.333 31.038  10.517  1.00 66.68  ? 467  THR A OG1   1 
ATOM   3610  C  CG2   . THR A  1  467  ? 109.177 31.822  9.773   1.00 66.78  ? 467  THR A CG2   1 
ATOM   3611  N  N     . PHE A  1  468  ? 112.259 31.890  6.622   1.00 65.54  ? 468  PHE A N     1 
ATOM   3612  C  CA    . PHE A  1  468  ? 113.566 32.250  6.077   1.00 64.18  ? 468  PHE A CA    1 
ATOM   3613  C  C     . PHE A  1  468  ? 114.183 33.002  7.237   1.00 68.74  ? 468  PHE A C     1 
ATOM   3614  O  O     . PHE A  1  468  ? 113.501 33.854  7.813   1.00 69.50  ? 468  PHE A O     1 
ATOM   3615  C  CB    . PHE A  1  468  ? 113.499 33.236  4.890   1.00 65.14  ? 468  PHE A CB    1 
ATOM   3616  C  CG    . PHE A  1  468  ? 112.990 32.784  3.544   1.00 65.63  ? 468  PHE A CG    1 
ATOM   3617  C  CD1   . PHE A  1  468  ? 113.474 31.628  2.952   1.00 68.28  ? 468  PHE A CD1   1 
ATOM   3618  C  CD2   . PHE A  1  468  ? 112.119 33.582  2.811   1.00 66.70  ? 468  PHE A CD2   1 
ATOM   3619  C  CE1   . PHE A  1  468  ? 113.028 31.231  1.694   1.00 68.49  ? 468  PHE A CE1   1 
ATOM   3620  C  CE2   . PHE A  1  468  ? 111.665 33.178  1.560   1.00 68.69  ? 468  PHE A CE2   1 
ATOM   3621  C  CZ    . PHE A  1  468  ? 112.123 32.008  1.007   1.00 66.78  ? 468  PHE A CZ    1 
ATOM   3622  N  N     . ARG A  1  469  ? 115.431 32.676  7.618   1.00 64.04  ? 469  ARG A N     1 
ATOM   3623  C  CA    . ARG A  1  469  ? 116.100 33.355  8.727   1.00 63.32  ? 469  ARG A CA    1 
ATOM   3624  C  C     . ARG A  1  469  ? 117.174 34.260  8.195   1.00 69.88  ? 469  ARG A C     1 
ATOM   3625  O  O     . ARG A  1  469  ? 117.820 33.911  7.205   1.00 70.59  ? 469  ARG A O     1 
ATOM   3626  C  CB    . ARG A  1  469  ? 116.688 32.385  9.752   1.00 58.60  ? 469  ARG A CB    1 
ATOM   3627  C  CG    . ARG A  1  469  ? 115.994 31.069  9.819   1.00 63.52  ? 469  ARG A CG    1 
ATOM   3628  C  CD    . ARG A  1  469  ? 116.221 30.399  11.138  1.00 73.15  ? 469  ARG A CD    1 
ATOM   3629  N  NE    . ARG A  1  469  ? 114.998 30.456  11.916  1.00 80.22  ? 469  ARG A NE    1 
ATOM   3630  C  CZ    . ARG A  1  469  ? 114.845 31.169  13.022  1.00 91.92  ? 469  ARG A CZ    1 
ATOM   3631  N  NH1   . ARG A  1  469  ? 115.869 31.829  13.542  1.00 72.97  ? 469  ARG A NH1   1 
ATOM   3632  N  NH2   . ARG A  1  469  ? 113.677 31.200  13.635  1.00 87.64  ? 469  ARG A NH2   1 
ATOM   3633  N  N     . LEU A  1  470  ? 117.373 35.426  8.834   1.00 67.19  ? 470  LEU A N     1 
ATOM   3634  C  CA    . LEU A  1  470  ? 118.407 36.375  8.398   1.00 67.13  ? 470  LEU A CA    1 
ATOM   3635  C  C     . LEU A  1  470  ? 119.148 36.998  9.555   1.00 70.90  ? 470  LEU A C     1 
ATOM   3636  O  O     . LEU A  1  470  ? 118.585 37.123  10.643  1.00 70.75  ? 470  LEU A O     1 
ATOM   3637  C  CB    . LEU A  1  470  ? 117.870 37.459  7.426   1.00 66.78  ? 470  LEU A CB    1 
ATOM   3638  C  CG    . LEU A  1  470  ? 116.576 38.178  7.795   1.00 70.60  ? 470  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A  1  470  ? 116.634 39.610  7.456   1.00 69.57  ? 470  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A  1  470  ? 115.454 37.596  7.058   1.00 74.57  ? 470  LEU A CD2   1 
ATOM   3641  N  N     . ASN A  1  471  ? 120.422 37.367  9.326   1.00 68.14  ? 471  ASN A N     1 
ATOM   3642  C  CA    . ASN A  1  471  ? 121.253 38.013  10.343  1.00 69.26  ? 471  ASN A CA    1 
ATOM   3643  C  C     . ASN A  1  471  ? 120.618 39.349  10.673  1.00 74.12  ? 471  ASN A C     1 
ATOM   3644  O  O     . ASN A  1  471  ? 120.138 40.056  9.778   1.00 71.88  ? 471  ASN A O     1 
ATOM   3645  C  CB    . ASN A  1  471  ? 122.678 38.220  9.845   1.00 71.27  ? 471  ASN A CB    1 
ATOM   3646  C  CG    . ASN A  1  471  ? 123.614 38.751  10.895  1.00 84.53  ? 471  ASN A CG    1 
ATOM   3647  O  OD1   . ASN A  1  471  ? 123.592 39.928  11.262  1.00 72.42  ? 471  ASN A OD1   1 
ATOM   3648  N  ND2   . ASN A  1  471  ? 124.458 37.890  11.397  1.00 79.20  ? 471  ASN A ND2   1 
ATOM   3649  N  N     . LEU A  1  472  ? 120.604 39.692  11.964  1.00 72.98  ? 472  LEU A N     1 
ATOM   3650  C  CA    . LEU A  1  472  ? 119.922 40.904  12.397  1.00 72.34  ? 472  LEU A CA    1 
ATOM   3651  C  C     . LEU A  1  472  ? 120.497 42.209  11.873  1.00 77.40  ? 472  LEU A C     1 
ATOM   3652  O  O     . LEU A  1  472  ? 119.729 43.157  11.756  1.00 77.49  ? 472  LEU A O     1 
ATOM   3653  C  CB    . LEU A  1  472  ? 119.750 40.964  13.903  1.00 72.09  ? 472  LEU A CB    1 
ATOM   3654  C  CG    . LEU A  1  472  ? 118.302 40.873  14.210  1.00 75.48  ? 472  LEU A CG    1 
ATOM   3655  C  CD1   . LEU A  1  472  ? 117.924 39.518  14.739  1.00 76.06  ? 472  LEU A CD1   1 
ATOM   3656  C  CD2   . LEU A  1  472  ? 117.830 42.044  14.961  1.00 77.54  ? 472  LEU A CD2   1 
ATOM   3657  N  N     . SER A  1  473  ? 121.792 42.265  11.509  1.00 74.56  ? 473  SER A N     1 
ATOM   3658  C  CA    . SER A  1  473  ? 122.368 43.507  10.990  1.00 74.24  ? 473  SER A CA    1 
ATOM   3659  C  C     . SER A  1  473  ? 121.924 43.823  9.565   1.00 77.98  ? 473  SER A C     1 
ATOM   3660  O  O     . SER A  1  473  ? 121.869 45.003  9.228   1.00 80.54  ? 473  SER A O     1 
ATOM   3661  C  CB    . SER A  1  473  ? 123.879 43.524  11.132  1.00 77.30  ? 473  SER A CB    1 
ATOM   3662  O  OG    . SER A  1  473  ? 124.223 43.782  12.484  1.00 88.13  ? 473  SER A OG    1 
ATOM   3663  N  N     . VAL A  1  474  ? 121.523 42.794  8.777   1.00 71.38  ? 474  VAL A N     1 
ATOM   3664  C  CA    . VAL A  1  474  ? 121.011 42.865  7.395   1.00 70.26  ? 474  VAL A CA    1 
ATOM   3665  C  C     . VAL A  1  474  ? 119.556 43.397  7.343   1.00 76.24  ? 474  VAL A C     1 
ATOM   3666  O  O     . VAL A  1  474  ? 119.055 43.778  6.279   1.00 75.83  ? 474  VAL A O     1 
ATOM   3667  C  CB    . VAL A  1  474  ? 121.172 41.465  6.723   1.00 72.97  ? 474  VAL A CB    1 
ATOM   3668  C  CG1   . VAL A  1  474  ? 119.846 40.825  6.312   1.00 71.34  ? 474  VAL A CG1   1 
ATOM   3669  C  CG2   . VAL A  1  474  ? 122.128 41.528  5.554   1.00 72.74  ? 474  VAL A CG2   1 
ATOM   3670  N  N     . THR A  1  475  ? 118.894 43.407  8.507   1.00 74.14  ? 475  THR A N     1 
ATOM   3671  C  CA    . THR A  1  475  ? 117.521 43.827  8.716   1.00 74.42  ? 475  THR A CA    1 
ATOM   3672  C  C     . THR A  1  475  ? 117.244 45.256  8.175   1.00 80.59  ? 475  THR A C     1 
ATOM   3673  O  O     . THR A  1  475  ? 116.226 45.430  7.510   1.00 81.54  ? 475  THR A O     1 
ATOM   3674  C  CB    . THR A  1  475  ? 117.189 43.616  10.193  1.00 82.77  ? 475  THR A CB    1 
ATOM   3675  O  OG1   . THR A  1  475  ? 116.145 42.652  10.321  1.00 81.91  ? 475  THR A OG1   1 
ATOM   3676  C  CG2   . THR A  1  475  ? 116.895 44.904  10.963  1.00 83.84  ? 475  THR A CG2   1 
ATOM   3677  N  N     . SER A  1  476  ? 118.138 46.252  8.424   1.00 76.79  ? 476  SER A N     1 
ATOM   3678  C  CA    . SER A  1  476  ? 117.932 47.642  7.970   1.00 75.87  ? 476  SER A CA    1 
ATOM   3679  C  C     . SER A  1  476  ? 117.883 47.821  6.439   1.00 76.20  ? 476  SER A C     1 
ATOM   3680  O  O     . SER A  1  476  ? 116.897 48.413  6.000   1.00 75.82  ? 476  SER A O     1 
ATOM   3681  C  CB    . SER A  1  476  ? 118.926 48.625  8.591   1.00 80.47  ? 476  SER A CB    1 
ATOM   3682  O  OG    . SER A  1  476  ? 120.220 48.073  8.791   1.00 93.37  ? 476  SER A OG    1 
ATOM   3683  N  N     . PRO A  1  477  ? 118.850 47.356  5.590   1.00 69.55  ? 477  PRO A N     1 
ATOM   3684  C  CA    . PRO A  1  477  ? 118.723 47.637  4.145   1.00 68.11  ? 477  PRO A CA    1 
ATOM   3685  C  C     . PRO A  1  477  ? 117.421 47.158  3.515   1.00 71.67  ? 477  PRO A C     1 
ATOM   3686  O  O     . PRO A  1  477  ? 116.865 47.849  2.660   1.00 71.18  ? 477  PRO A O     1 
ATOM   3687  C  CB    . PRO A  1  477  ? 119.952 46.982  3.523   1.00 69.47  ? 477  PRO A CB    1 
ATOM   3688  C  CG    . PRO A  1  477  ? 120.573 46.181  4.586   1.00 74.43  ? 477  PRO A CG    1 
ATOM   3689  C  CD    . PRO A  1  477  ? 120.128 46.681  5.890   1.00 70.55  ? 477  PRO A CD    1 
ATOM   3690  N  N     . TYR A  1  478  ? 116.913 45.994  3.984   1.00 68.23  ? 478  TYR A N     1 
ATOM   3691  C  CA    . TYR A  1  478  ? 115.669 45.362  3.532   1.00 66.41  ? 478  TYR A CA    1 
ATOM   3692  C  C     . TYR A  1  478  ? 114.494 46.045  4.173   1.00 72.45  ? 478  TYR A C     1 
ATOM   3693  O  O     . TYR A  1  478  ? 113.380 45.970  3.641   1.00 72.57  ? 478  TYR A O     1 
ATOM   3694  C  CB    . TYR A  1  478  ? 115.652 43.879  3.911   1.00 65.65  ? 478  TYR A CB    1 
ATOM   3695  C  CG    . TYR A  1  478  ? 116.604 43.027  3.108   1.00 66.05  ? 478  TYR A CG    1 
ATOM   3696  C  CD1   . TYR A  1  478  ? 116.566 43.024  1.718   1.00 66.91  ? 478  TYR A CD1   1 
ATOM   3697  C  CD2   . TYR A  1  478  ? 117.482 42.155  3.735   1.00 67.60  ? 478  TYR A CD2   1 
ATOM   3698  C  CE1   . TYR A  1  478  ? 117.407 42.203  0.975   1.00 66.48  ? 478  TYR A CE1   1 
ATOM   3699  C  CE2   . TYR A  1  478  ? 118.317 41.314  3.001   1.00 68.15  ? 478  TYR A CE2   1 
ATOM   3700  C  CZ    . TYR A  1  478  ? 118.280 41.346  1.622   1.00 74.36  ? 478  TYR A CZ    1 
ATOM   3701  O  OH    . TYR A  1  478  ? 119.128 40.542  0.908   1.00 76.14  ? 478  TYR A OH    1 
ATOM   3702  N  N     . ASN A  1  479  ? 114.752 46.723  5.326   1.00 70.15  ? 479  ASN A N     1 
ATOM   3703  C  CA    . ASN A  1  479  ? 113.774 47.429  6.157   1.00 70.53  ? 479  ASN A CA    1 
ATOM   3704  C  C     . ASN A  1  479  ? 112.742 46.409  6.580   1.00 74.12  ? 479  ASN A C     1 
ATOM   3705  O  O     . ASN A  1  479  ? 111.595 46.459  6.147   1.00 74.65  ? 479  ASN A O     1 
ATOM   3706  C  CB    . ASN A  1  479  ? 113.177 48.647  5.420   1.00 73.06  ? 479  ASN A CB    1 
ATOM   3707  C  CG    . ASN A  1  479  ? 112.162 49.417  6.201   1.00 94.18  ? 479  ASN A CG    1 
ATOM   3708  O  OD1   . ASN A  1  479  ? 111.014 49.551  5.774   1.00 90.27  ? 479  ASN A OD1   1 
ATOM   3709  N  ND2   . ASN A  1  479  ? 112.552 49.917  7.368   1.00 87.89  ? 479  ASN A ND2   1 
ATOM   3710  N  N     . ALA A  1  480  ? 113.202 45.415  7.355   1.00 69.65  ? 480  ALA A N     1 
ATOM   3711  C  CA    . ALA A  1  480  ? 112.405 44.297  7.827   1.00 68.72  ? 480  ALA A CA    1 
ATOM   3712  C  C     . ALA A  1  480  ? 112.395 44.243  9.325   1.00 75.48  ? 480  ALA A C     1 
ATOM   3713  O  O     . ALA A  1  480  ? 113.338 44.678  9.964   1.00 76.24  ? 480  ALA A O     1 
ATOM   3714  C  CB    . ALA A  1  480  ? 112.986 43.010  7.284   1.00 68.60  ? 480  ALA A CB    1 
ATOM   3715  N  N     . ASP A  1  481  ? 111.303 43.745  9.879   1.00 74.89  ? 481  ASP A N     1 
ATOM   3716  C  CA    . ASP A  1  481  ? 111.046 43.444  11.290  1.00 76.80  ? 481  ASP A CA    1 
ATOM   3717  C  C     . ASP A  1  481  ? 110.309 42.120  11.202  1.00 81.09  ? 481  ASP A C     1 
ATOM   3718  O  O     . ASP A  1  481  ? 109.831 41.779  10.120  1.00 82.22  ? 481  ASP A O     1 
ATOM   3719  C  CB    . ASP A  1  481  ? 110.226 44.536  12.002  1.00 80.67  ? 481  ASP A CB    1 
ATOM   3720  C  CG    . ASP A  1  481  ? 109.203 45.247  11.130  1.00 107.63 ? 481  ASP A CG    1 
ATOM   3721  O  OD1   . ASP A  1  481  ? 109.610 46.108  10.296  1.00 120.85 ? 481  ASP A OD1   1 
ATOM   3722  O  OD2   . ASP A  1  481  ? 108.012 44.985  11.300  1.00 109.75 ? 481  ASP A OD2   1 
ATOM   3723  N  N     . PHE A  1  482  ? 110.291 41.322  12.252  1.00 75.65  ? 482  PHE A N     1 
ATOM   3724  C  CA    . PHE A  1  482  ? 109.683 40.013  12.111  1.00 74.09  ? 482  PHE A CA    1 
ATOM   3725  C  C     . PHE A  1  482  ? 108.297 39.929  12.747  1.00 78.40  ? 482  PHE A C     1 
ATOM   3726  O  O     . PHE A  1  482  ? 107.942 38.911  13.328  1.00 78.85  ? 482  PHE A O     1 
ATOM   3727  C  CB    . PHE A  1  482  ? 110.653 38.953  12.632  1.00 75.97  ? 482  PHE A CB    1 
ATOM   3728  C  CG    . PHE A  1  482  ? 112.123 39.226  12.378  1.00 76.84  ? 482  PHE A CG    1 
ATOM   3729  C  CD1   . PHE A  1  482  ? 112.673 39.042  11.120  1.00 78.75  ? 482  PHE A CD1   1 
ATOM   3730  C  CD2   . PHE A  1  482  ? 112.969 39.589  13.418  1.00 79.19  ? 482  PHE A CD2   1 
ATOM   3731  C  CE1   . PHE A  1  482  ? 114.038 39.267  10.892  1.00 79.70  ? 482  PHE A CE1   1 
ATOM   3732  C  CE2   . PHE A  1  482  ? 114.331 39.810  13.190  1.00 81.77  ? 482  PHE A CE2   1 
ATOM   3733  C  CZ    . PHE A  1  482  ? 114.854 39.665  11.923  1.00 78.99  ? 482  PHE A CZ    1 
ATOM   3734  N  N     . ASP A  1  483  ? 107.489 40.998  12.594  1.00 75.59  ? 483  ASP A N     1 
ATOM   3735  C  CA    . ASP A  1  483  ? 106.110 41.114  13.106  1.00 75.67  ? 483  ASP A CA    1 
ATOM   3736  C  C     . ASP A  1  483  ? 105.088 40.450  12.157  1.00 78.56  ? 483  ASP A C     1 
ATOM   3737  O  O     . ASP A  1  483  ? 103.897 40.719  12.270  1.00 79.62  ? 483  ASP A O     1 
ATOM   3738  C  CB    . ASP A  1  483  ? 105.737 42.611  13.312  1.00 78.27  ? 483  ASP A CB    1 
ATOM   3739  C  CG    . ASP A  1  483  ? 105.662 43.424  12.022  1.00 95.00  ? 483  ASP A CG    1 
ATOM   3740  O  OD1   . ASP A  1  483  ? 105.919 42.856  10.948  1.00 96.56  ? 483  ASP A OD1   1 
ATOM   3741  O  OD2   . ASP A  1  483  ? 105.427 44.649  12.098  1.00 103.44 ? 483  ASP A OD2   1 
ATOM   3742  N  N     . GLY A  1  484  ? 105.558 39.659  11.198  1.00 73.55  ? 484  GLY A N     1 
ATOM   3743  C  CA    . GLY A  1  484  ? 104.692 39.007  10.228  1.00 73.04  ? 484  GLY A CA    1 
ATOM   3744  C  C     . GLY A  1  484  ? 105.109 39.278  8.805   1.00 77.62  ? 484  GLY A C     1 
ATOM   3745  O  O     . GLY A  1  484  ? 104.376 38.932  7.869   1.00 77.86  ? 484  GLY A O     1 
ATOM   3746  N  N     . ASP A  1  485  ? 106.298 39.902  8.642   1.00 74.24  ? 485  ASP A N     1 
ATOM   3747  C  CA    . ASP A  1  485  ? 106.902 40.239  7.344   1.00 73.56  ? 485  ASP A CA    1 
ATOM   3748  C  C     . ASP A  1  485  ? 107.172 38.939  6.557   1.00 76.05  ? 485  ASP A C     1 
ATOM   3749  O  O     . ASP A  1  485  ? 107.377 37.888  7.161   1.00 76.42  ? 485  ASP A O     1 
ATOM   3750  C  CB    . ASP A  1  485  ? 108.222 41.035  7.537   1.00 75.07  ? 485  ASP A CB    1 
ATOM   3751  C  CG    . ASP A  1  485  ? 108.133 42.565  7.592   1.00 88.68  ? 485  ASP A CG    1 
ATOM   3752  O  OD1   . ASP A  1  485  ? 107.229 43.097  8.303   1.00 91.78  ? 485  ASP A OD1   1 
ATOM   3753  O  OD2   . ASP A  1  485  ? 109.044 43.233  7.049   1.00 92.48  ? 485  ASP A OD2   1 
ATOM   3754  N  N     . GLU A  1  486  ? 107.107 39.006  5.229   1.00 70.34  ? 486  GLU A N     1 
ATOM   3755  C  CA    . GLU A  1  486  ? 107.375 37.874  4.335   1.00 69.29  ? 486  GLU A CA    1 
ATOM   3756  C  C     . GLU A  1  486  ? 108.443 38.332  3.331   1.00 71.74  ? 486  GLU A C     1 
ATOM   3757  O  O     . GLU A  1  486  ? 108.433 39.499  2.901   1.00 72.34  ? 486  GLU A O     1 
ATOM   3758  C  CB    . GLU A  1  486  ? 106.101 37.437  3.570   1.00 70.25  ? 486  GLU A CB    1 
ATOM   3759  C  CG    . GLU A  1  486  ? 105.253 36.374  4.239   1.00 76.42  ? 486  GLU A CG    1 
ATOM   3760  C  CD    . GLU A  1  486  ? 103.916 36.126  3.557   1.00 99.30  ? 486  GLU A CD    1 
ATOM   3761  O  OE1   . GLU A  1  486  ? 103.911 35.749  2.363   1.00 93.47  ? 486  GLU A OE1   1 
ATOM   3762  O  OE2   . GLU A  1  486  ? 102.869 36.290  4.224   1.00 95.61  ? 486  GLU A OE2   1 
ATOM   3763  N  N     . MET A  1  487  ? 109.361 37.445  2.953   1.00 65.53  ? 487  MET A N     1 
ATOM   3764  C  CA    . MET A  1  487  ? 110.368 37.875  1.992   1.00 64.91  ? 487  MET A CA    1 
ATOM   3765  C  C     . MET A  1  487  ? 110.489 36.933  0.810   1.00 71.66  ? 487  MET A C     1 
ATOM   3766  O  O     . MET A  1  487  ? 110.119 35.754  0.919   1.00 73.53  ? 487  MET A O     1 
ATOM   3767  C  CB    . MET A  1  487  ? 111.708 38.130  2.652   1.00 66.88  ? 487  MET A CB    1 
ATOM   3768  C  CG    . MET A  1  487  ? 111.758 39.406  3.395   1.00 70.10  ? 487  MET A CG    1 
ATOM   3769  S  SD    . MET A  1  487  ? 113.469 39.879  3.518   1.00 74.88  ? 487  MET A SD    1 
ATOM   3770  C  CE    . MET A  1  487  ? 113.578 40.019  5.170   1.00 72.39  ? 487  MET A CE    1 
ATOM   3771  N  N     . ASN A  1  488  ? 110.963 37.473  -0.331  1.00 66.29  ? 488  ASN A N     1 
ATOM   3772  C  CA    . ASN A  1  488  ? 111.084 36.772  -1.598  1.00 65.80  ? 488  ASN A CA    1 
ATOM   3773  C  C     . ASN A  1  488  ? 112.483 36.230  -1.842  1.00 69.45  ? 488  ASN A C     1 
ATOM   3774  O  O     . ASN A  1  488  ? 113.464 36.849  -1.411  1.00 71.44  ? 488  ASN A O     1 
ATOM   3775  C  CB    . ASN A  1  488  ? 110.691 37.715  -2.723  1.00 69.47  ? 488  ASN A CB    1 
ATOM   3776  C  CG    . ASN A  1  488  ? 109.203 37.899  -2.927  1.00 93.95  ? 488  ASN A CG    1 
ATOM   3777  O  OD1   . ASN A  1  488  ? 108.379 37.671  -2.027  1.00 70.04  ? 488  ASN A OD1   1 
ATOM   3778  N  ND2   . ASN A  1  488  ? 108.836 38.333  -4.140  1.00 96.00  ? 488  ASN A ND2   1 
ATOM   3779  N  N     . LEU A  1  489  ? 112.580 35.101  -2.569  1.00 62.14  ? 489  LEU A N     1 
ATOM   3780  C  CA    . LEU A  1  489  ? 113.860 34.471  -2.879  1.00 60.84  ? 489  LEU A CA    1 
ATOM   3781  C  C     . LEU A  1  489  ? 113.879 33.955  -4.314  1.00 65.79  ? 489  LEU A C     1 
ATOM   3782  O  O     . LEU A  1  489  ? 113.007 33.169  -4.674  1.00 67.93  ? 489  LEU A O     1 
ATOM   3783  C  CB    . LEU A  1  489  ? 114.085 33.314  -1.908  1.00 60.58  ? 489  LEU A CB    1 
ATOM   3784  C  CG    . LEU A  1  489  ? 115.430 32.647  -1.950  1.00 64.08  ? 489  LEU A CG    1 
ATOM   3785  C  CD1   . LEU A  1  489  ? 116.358 33.307  -0.975  1.00 64.30  ? 489  LEU A CD1   1 
ATOM   3786  C  CD2   . LEU A  1  489  ? 115.301 31.190  -1.627  1.00 64.04  ? 489  LEU A CD2   1 
ATOM   3787  N  N     . HIS A  1  490  ? 114.867 34.375  -5.128  1.00 60.28  ? 490  HIS A N     1 
ATOM   3788  C  CA    . HIS A  1  490  ? 114.995 33.958  -6.530  1.00 59.52  ? 490  HIS A CA    1 
ATOM   3789  C  C     . HIS A  1  490  ? 116.291 33.190  -6.757  1.00 63.08  ? 490  HIS A C     1 
ATOM   3790  O  O     . HIS A  1  490  ? 117.370 33.686  -6.418  1.00 62.92  ? 490  HIS A O     1 
ATOM   3791  C  CB    . HIS A  1  490  ? 114.946 35.160  -7.477  1.00 60.19  ? 490  HIS A CB    1 
ATOM   3792  C  CG    . HIS A  1  490  ? 113.715 35.991  -7.345  1.00 63.52  ? 490  HIS A CG    1 
ATOM   3793  N  ND1   . HIS A  1  490  ? 112.618 35.775  -8.147  1.00 65.16  ? 490  HIS A ND1   1 
ATOM   3794  C  CD2   . HIS A  1  490  ? 113.462 37.030  -6.511  1.00 65.26  ? 490  HIS A CD2   1 
ATOM   3795  C  CE1   . HIS A  1  490  ? 111.731 36.681  -7.774  1.00 64.82  ? 490  HIS A CE1   1 
ATOM   3796  N  NE2   . HIS A  1  490  ? 112.198 37.461  -6.789  1.00 65.07  ? 490  HIS A NE2   1 
ATOM   3797  N  N     . VAL A  1  491  ? 116.181 31.991  -7.349  1.00 58.34  ? 491  VAL A N     1 
ATOM   3798  C  CA    . VAL A  1  491  ? 117.312 31.115  -7.599  1.00 57.32  ? 491  VAL A CA    1 
ATOM   3799  C  C     . VAL A  1  491  ? 117.915 31.341  -8.978  1.00 63.93  ? 491  VAL A C     1 
ATOM   3800  O  O     . VAL A  1  491  ? 117.259 31.049  -9.983  1.00 64.17  ? 491  VAL A O     1 
ATOM   3801  C  CB    . VAL A  1  491  ? 116.975 29.623  -7.394  1.00 59.65  ? 491  VAL A CB    1 
ATOM   3802  C  CG1   . VAL A  1  491  ? 118.241 28.787  -7.444  1.00 59.10  ? 491  VAL A CG1   1 
ATOM   3803  C  CG2   . VAL A  1  491  ? 116.231 29.395  -6.088  1.00 59.36  ? 491  VAL A CG2   1 
ATOM   3804  N  N     . PRO A  1  492  ? 119.200 31.761  -9.061  1.00 61.55  ? 492  PRO A N     1 
ATOM   3805  C  CA    . PRO A  1  492  ? 119.840 31.883  -10.375 1.00 61.39  ? 492  PRO A CA    1 
ATOM   3806  C  C     . PRO A  1  492  ? 119.999 30.479  -10.961 1.00 67.26  ? 492  PRO A C     1 
ATOM   3807  O  O     . PRO A  1  492  ? 120.212 29.556  -10.176 1.00 68.56  ? 492  PRO A O     1 
ATOM   3808  C  CB    . PRO A  1  492  ? 121.178 32.525  -10.032 1.00 63.27  ? 492  PRO A CB    1 
ATOM   3809  C  CG    . PRO A  1  492  ? 121.452 32.126  -8.649  1.00 67.90  ? 492  PRO A CG    1 
ATOM   3810  C  CD    . PRO A  1  492  ? 120.136 32.118  -7.975  1.00 63.36  ? 492  PRO A CD    1 
ATOM   3811  N  N     . GLN A  1  493  ? 119.815 30.288  -12.298 1.00 63.65  ? 493  GLN A N     1 
ATOM   3812  C  CA    . GLN A  1  493  ? 119.876 28.966  -12.967 1.00 62.57  ? 493  GLN A CA    1 
ATOM   3813  C  C     . GLN A  1  493  ? 121.113 28.748  -13.872 1.00 70.40  ? 493  GLN A C     1 
ATOM   3814  O  O     . GLN A  1  493  ? 121.265 27.680  -14.480 1.00 72.31  ? 493  GLN A O     1 
ATOM   3815  C  CB    . GLN A  1  493  ? 118.582 28.716  -13.765 1.00 62.49  ? 493  GLN A CB    1 
ATOM   3816  C  CG    . GLN A  1  493  ? 117.301 28.901  -12.969 1.00 64.34  ? 493  GLN A CG    1 
ATOM   3817  C  CD    . GLN A  1  493  ? 117.122 27.794  -11.968 1.00 90.57  ? 493  GLN A CD    1 
ATOM   3818  O  OE1   . GLN A  1  493  ? 116.945 26.633  -12.338 1.00 97.17  ? 493  GLN A OE1   1 
ATOM   3819  N  NE2   . GLN A  1  493  ? 117.176 28.117  -10.677 1.00 71.36  ? 493  GLN A NE2   1 
ATOM   3820  N  N     . SER A  1  494  ? 121.983 29.753  -13.970 1.00 68.04  ? 494  SER A N     1 
ATOM   3821  C  CA    . SER A  1  494  ? 123.156 29.732  -14.835 1.00 69.35  ? 494  SER A CA    1 
ATOM   3822  C  C     . SER A  1  494  ? 124.387 29.920  -14.006 1.00 76.08  ? 494  SER A C     1 
ATOM   3823  O  O     . SER A  1  494  ? 124.310 30.481  -12.917 1.00 76.10  ? 494  SER A O     1 
ATOM   3824  C  CB    . SER A  1  494  ? 123.062 30.862  -15.867 1.00 75.01  ? 494  SER A CB    1 
ATOM   3825  O  OG    . SER A  1  494  ? 123.991 30.752  -16.938 1.00 90.18  ? 494  SER A OG    1 
ATOM   3826  N  N     . GLU A  1  495  ? 125.538 29.473  -14.525 1.00 74.94  ? 495  GLU A N     1 
ATOM   3827  C  CA    . GLU A  1  495  ? 126.827 29.632  -13.858 1.00 75.17  ? 495  GLU A CA    1 
ATOM   3828  C  C     . GLU A  1  495  ? 127.258 31.122  -13.920 1.00 78.32  ? 495  GLU A C     1 
ATOM   3829  O  O     . GLU A  1  495  ? 127.783 31.670  -12.939 1.00 78.74  ? 495  GLU A O     1 
ATOM   3830  C  CB    . GLU A  1  495  ? 127.871 28.675  -14.457 1.00 76.69  ? 495  GLU A CB    1 
ATOM   3831  C  CG    . GLU A  1  495  ? 128.940 28.271  -13.456 1.00 86.33  ? 495  GLU A CG    1 
ATOM   3832  C  CD    . GLU A  1  495  ? 128.536 27.381  -12.296 1.00 106.14 ? 495  GLU A CD    1 
ATOM   3833  O  OE1   . GLU A  1  495  ? 127.604 26.564  -12.477 1.00 109.37 ? 495  GLU A OE1   1 
ATOM   3834  O  OE2   . GLU A  1  495  ? 129.189 27.457  -11.228 1.00 93.84  ? 495  GLU A OE2   1 
ATOM   3835  N  N     . GLU A  1  496  ? 126.939 31.792  -15.029 1.00 72.44  ? 496  GLU A N     1 
ATOM   3836  C  CA    . GLU A  1  496  ? 127.261 33.211  -15.161 1.00 71.71  ? 496  GLU A CA    1 
ATOM   3837  C  C     . GLU A  1  496  ? 126.311 34.120  -14.398 1.00 71.96  ? 496  GLU A C     1 
ATOM   3838  O  O     . GLU A  1  496  ? 126.626 35.287  -14.145 1.00 71.82  ? 496  GLU A O     1 
ATOM   3839  C  CB    . GLU A  1  496  ? 127.379 33.649  -16.636 1.00 73.29  ? 496  GLU A CB    1 
ATOM   3840  C  CG    . GLU A  1  496  ? 126.303 33.137  -17.569 1.00 82.06  ? 496  GLU A CG    1 
ATOM   3841  C  CD    . GLU A  1  496  ? 126.123 33.965  -18.823 1.00 113.35 ? 496  GLU A CD    1 
ATOM   3842  O  OE1   . GLU A  1  496  ? 127.130 34.482  -19.365 1.00 100.62 ? 496  GLU A OE1   1 
ATOM   3843  O  OE2   . GLU A  1  496  ? 124.957 34.101  -19.260 1.00 122.69 ? 496  GLU A OE2   1 
ATOM   3844  N  N     . THR A  1  497  ? 125.150 33.590  -14.053 1.00 66.19  ? 497  THR A N     1 
ATOM   3845  C  CA    . THR A  1  497  ? 124.096 34.336  -13.386 1.00 65.08  ? 497  THR A CA    1 
ATOM   3846  C  C     . THR A  1  497  ? 124.294 34.281  -11.867 1.00 70.66  ? 497  THR A C     1 
ATOM   3847  O  O     . THR A  1  497  ? 123.932 35.226  -11.163 1.00 69.43  ? 497  THR A O     1 
ATOM   3848  C  CB    . THR A  1  497  ? 122.777 33.843  -13.931 1.00 63.40  ? 497  THR A CB    1 
ATOM   3849  O  OG1   . THR A  1  497  ? 122.022 34.956  -14.345 1.00 71.15  ? 497  THR A OG1   1 
ATOM   3850  C  CG2   . THR A  1  497  ? 122.026 33.020  -12.993 1.00 53.86  ? 497  THR A CG2   1 
ATOM   3851  N  N     . ARG A  1  498  ? 124.908 33.178  -11.380 1.00 68.64  ? 498  ARG A N     1 
ATOM   3852  C  CA    . ARG A  1  498  ? 125.306 32.988  -9.991  1.00 68.38  ? 498  ARG A CA    1 
ATOM   3853  C  C     . ARG A  1  498  ? 126.490 33.937  -9.776  1.00 73.20  ? 498  ARG A C     1 
ATOM   3854  O  O     . ARG A  1  498  ? 126.505 34.659  -8.780  1.00 74.47  ? 498  ARG A O     1 
ATOM   3855  C  CB    . ARG A  1  498  ? 125.815 31.561  -9.763  1.00 67.56  ? 498  ARG A CB    1 
ATOM   3856  C  CG    . ARG A  1  498  ? 124.760 30.520  -9.715  1.00 72.88  ? 498  ARG A CG    1 
ATOM   3857  C  CD    . ARG A  1  498  ? 125.406 29.162  -9.723  1.00 73.31  ? 498  ARG A CD    1 
ATOM   3858  N  NE    . ARG A  1  498  ? 125.133 28.455  -8.476  1.00 71.96  ? 498  ARG A NE    1 
ATOM   3859  C  CZ    . ARG A  1  498  ? 126.078 27.995  -7.671  1.00 85.01  ? 498  ARG A CZ    1 
ATOM   3860  N  NH1   . ARG A  1  498  ? 127.360 28.163  -7.977  1.00 75.33  ? 498  ARG A NH1   1 
ATOM   3861  N  NH2   . ARG A  1  498  ? 125.752 27.369  -6.549  1.00 70.95  ? 498  ARG A NH2   1 
ATOM   3862  N  N     . ALA A  1  499  ? 127.483 33.939  -10.718 1.00 67.92  ? 499  ALA A N     1 
ATOM   3863  C  CA    . ALA A  1  499  ? 128.656 34.806  -10.625 1.00 67.77  ? 499  ALA A CA    1 
ATOM   3864  C  C     . ALA A  1  499  ? 128.225 36.274  -10.480 1.00 73.16  ? 499  ALA A C     1 
ATOM   3865  O  O     . ALA A  1  499  ? 128.755 36.976  -9.625  1.00 73.79  ? 499  ALA A O     1 
ATOM   3866  C  CB    . ALA A  1  499  ? 129.569 34.613  -11.820 1.00 68.48  ? 499  ALA A CB    1 
ATOM   3867  N  N     . GLU A  1  500  ? 127.178 36.700  -11.208 1.00 68.79  ? 500  GLU A N     1 
ATOM   3868  C  CA    . GLU A  1  500  ? 126.659 38.052  -11.059 1.00 67.72  ? 500  GLU A CA    1 
ATOM   3869  C  C     . GLU A  1  500  ? 126.253 38.311  -9.598  1.00 71.24  ? 500  GLU A C     1 
ATOM   3870  O  O     . GLU A  1  500  ? 126.714 39.283  -9.014  1.00 72.09  ? 500  GLU A O     1 
ATOM   3871  C  CB    . GLU A  1  500  ? 125.495 38.293  -12.015 1.00 68.19  ? 500  GLU A CB    1 
ATOM   3872  C  CG    . GLU A  1  500  ? 125.819 39.378  -13.003 1.00 74.53  ? 500  GLU A CG    1 
ATOM   3873  C  CD    . GLU A  1  500  ? 125.106 39.238  -14.327 1.00 90.39  ? 500  GLU A CD    1 
ATOM   3874  O  OE1   . GLU A  1  500  ? 123.854 39.318  -14.335 1.00 75.65  ? 500  GLU A OE1   1 
ATOM   3875  O  OE2   . GLU A  1  500  ? 125.799 39.025  -15.351 1.00 72.57  ? 500  GLU A OE2   1 
ATOM   3876  N  N     . LEU A  1  501  ? 125.483 37.399  -8.988  1.00 65.92  ? 501  LEU A N     1 
ATOM   3877  C  CA    . LEU A  1  501  ? 125.043 37.543  -7.603  1.00 65.30  ? 501  LEU A CA    1 
ATOM   3878  C  C     . LEU A  1  501  ? 126.232 37.600  -6.614  1.00 70.89  ? 501  LEU A C     1 
ATOM   3879  O  O     . LEU A  1  501  ? 126.436 38.620  -5.948  1.00 72.22  ? 501  LEU A O     1 
ATOM   3880  C  CB    . LEU A  1  501  ? 124.070 36.414  -7.240  1.00 64.36  ? 501  LEU A CB    1 
ATOM   3881  C  CG    . LEU A  1  501  ? 122.746 36.376  -7.970  1.00 68.00  ? 501  LEU A CG    1 
ATOM   3882  C  CD1   . LEU A  1  501  ? 121.782 35.482  -7.240  1.00 67.81  ? 501  LEU A CD1   1 
ATOM   3883  C  CD2   . LEU A  1  501  ? 122.130 37.754  -8.073  1.00 70.24  ? 501  LEU A CD2   1 
ATOM   3884  N  N     . SER A  1  502  ? 127.049 36.535  -6.586  1.00 65.02  ? 502  SER A N     1 
ATOM   3885  C  CA    . SER A  1  502  ? 128.213 36.419  -5.724  1.00 63.90  ? 502  SER A CA    1 
ATOM   3886  C  C     . SER A  1  502  ? 129.224 37.529  -5.883  1.00 68.31  ? 502  SER A C     1 
ATOM   3887  O  O     . SER A  1  502  ? 129.782 37.980  -4.884  1.00 68.21  ? 502  SER A O     1 
ATOM   3888  C  CB    . SER A  1  502  ? 128.898 35.073  -5.929  1.00 65.90  ? 502  SER A CB    1 
ATOM   3889  O  OG    . SER A  1  502  ? 129.051 34.723  -7.291  1.00 68.94  ? 502  SER A OG    1 
ATOM   3890  N  N     . GLN A  1  503  ? 129.455 37.984  -7.121  1.00 65.20  ? 503  GLN A N     1 
ATOM   3891  C  CA    . GLN A  1  503  ? 130.486 38.980  -7.394  1.00 65.45  ? 503  GLN A CA    1 
ATOM   3892  C  C     . GLN A  1  503  ? 130.038 40.437  -7.387  1.00 71.42  ? 503  GLN A C     1 
ATOM   3893  O  O     . GLN A  1  503  ? 130.910 41.306  -7.260  1.00 71.61  ? 503  GLN A O     1 
ATOM   3894  C  CB    . GLN A  1  503  ? 131.213 38.678  -8.712  1.00 66.31  ? 503  GLN A CB    1 
ATOM   3895  C  CG    . GLN A  1  503  ? 131.795 37.280  -8.821  1.00 58.59  ? 503  GLN A CG    1 
ATOM   3896  C  CD    . GLN A  1  503  ? 132.528 36.865  -7.589  1.00 79.07  ? 503  GLN A CD    1 
ATOM   3897  O  OE1   . GLN A  1  503  ? 132.038 36.037  -6.805  1.00 73.10  ? 503  GLN A OE1   1 
ATOM   3898  N  NE2   . GLN A  1  503  ? 133.690 37.475  -7.372  1.00 73.91  ? 503  GLN A NE2   1 
ATOM   3899  N  N     . LEU A  1  504  ? 128.718 40.722  -7.510  1.00 68.50  ? 504  LEU A N     1 
ATOM   3900  C  CA    . LEU A  1  504  ? 128.203 42.109  -7.542  1.00 67.96  ? 504  LEU A CA    1 
ATOM   3901  C  C     . LEU A  1  504  ? 127.173 42.407  -6.470  1.00 74.30  ? 504  LEU A C     1 
ATOM   3902  O  O     . LEU A  1  504  ? 127.260 43.458  -5.838  1.00 75.20  ? 504  LEU A O     1 
ATOM   3903  C  CB    . LEU A  1  504  ? 127.601 42.486  -8.919  1.00 66.68  ? 504  LEU A CB    1 
ATOM   3904  C  CG    . LEU A  1  504  ? 128.465 42.327  -10.150 1.00 70.27  ? 504  LEU A CG    1 
ATOM   3905  C  CD1   . LEU A  1  504  ? 127.622 42.157  -11.360 1.00 69.77  ? 504  LEU A CD1   1 
ATOM   3906  C  CD2   . LEU A  1  504  ? 129.359 43.523  -10.359 1.00 73.95  ? 504  LEU A CD2   1 
ATOM   3907  N  N     . CYS A  1  505  ? 126.185 41.506  -6.311  1.00 71.71  ? 505  CYS A N     1 
ATOM   3908  C  CA    . CYS A  1  505  ? 125.010 41.607  -5.444  1.00 72.77  ? 505  CYS A CA    1 
ATOM   3909  C  C     . CYS A  1  505  ? 125.195 41.108  -4.001  1.00 74.22  ? 505  CYS A C     1 
ATOM   3910  O  O     . CYS A  1  505  ? 124.331 41.378  -3.160  1.00 73.55  ? 505  CYS A O     1 
ATOM   3911  C  CB    . CYS A  1  505  ? 123.836 40.895  -6.109  1.00 74.41  ? 505  CYS A CB    1 
ATOM   3912  S  SG    . CYS A  1  505  ? 123.487 41.463  -7.793  1.00 79.31  ? 505  CYS A SG    1 
ATOM   3913  N  N     . ALA A  1  506  ? 126.263 40.342  -3.727  1.00 68.86  ? 506  ALA A N     1 
ATOM   3914  C  CA    . ALA A  1  506  ? 126.538 39.756  -2.413  1.00 67.39  ? 506  ALA A CA    1 
ATOM   3915  C  C     . ALA A  1  506  ? 126.444 40.766  -1.311  1.00 68.77  ? 506  ALA A C     1 
ATOM   3916  O  O     . ALA A  1  506  ? 126.965 41.877  -1.464  1.00 68.73  ? 506  ALA A O     1 
ATOM   3917  C  CB    . ALA A  1  506  ? 127.910 39.131  -2.406  1.00 68.48  ? 506  ALA A CB    1 
ATOM   3918  N  N     . VAL A  1  507  ? 125.767 40.387  -0.205  1.00 62.74  ? 507  VAL A N     1 
ATOM   3919  C  CA    . VAL A  1  507  ? 125.577 41.228  0.986   1.00 61.65  ? 507  VAL A CA    1 
ATOM   3920  C  C     . VAL A  1  507  ? 126.883 41.971  1.425   1.00 66.83  ? 507  VAL A C     1 
ATOM   3921  O  O     . VAL A  1  507  ? 126.848 43.205  1.494   1.00 65.63  ? 507  VAL A O     1 
ATOM   3922  C  CB    . VAL A  1  507  ? 124.939 40.444  2.155   1.00 64.37  ? 507  VAL A CB    1 
ATOM   3923  C  CG1   . VAL A  1  507  ? 124.881 41.291  3.410   1.00 64.49  ? 507  VAL A CG1   1 
ATOM   3924  C  CG2   . VAL A  1  507  ? 123.555 39.943  1.796   1.00 63.71  ? 507  VAL A CG2   1 
ATOM   3925  N  N     . PRO A  1  508  ? 128.044 41.288  1.669   1.00 64.92  ? 508  PRO A N     1 
ATOM   3926  C  CA    . PRO A  1  508  ? 129.233 42.017  2.116   1.00 65.42  ? 508  PRO A CA    1 
ATOM   3927  C  C     . PRO A  1  508  ? 129.634 43.170  1.227   1.00 69.22  ? 508  PRO A C     1 
ATOM   3928  O  O     . PRO A  1  508  ? 130.105 44.182  1.740   1.00 70.93  ? 508  PRO A O     1 
ATOM   3929  C  CB    . PRO A  1  508  ? 130.308 40.934  2.164   1.00 67.25  ? 508  PRO A CB    1 
ATOM   3930  C  CG    . PRO A  1  508  ? 129.562 39.711  2.457   1.00 71.33  ? 508  PRO A CG    1 
ATOM   3931  C  CD    . PRO A  1  508  ? 128.340 39.841  1.617   1.00 66.57  ? 508  PRO A CD    1 
ATOM   3932  N  N     . LEU A  1  509  ? 129.405 43.039  -0.087  1.00 62.94  ? 509  LEU A N     1 
ATOM   3933  C  CA    . LEU A  1  509  ? 129.765 44.081  -1.050  1.00 61.39  ? 509  LEU A CA    1 
ATOM   3934  C  C     . LEU A  1  509  ? 128.950 45.348  -0.844  1.00 69.10  ? 509  LEU A C     1 
ATOM   3935  O  O     . LEU A  1  509  ? 129.465 46.445  -1.059  1.00 70.11  ? 509  LEU A O     1 
ATOM   3936  C  CB    . LEU A  1  509  ? 129.600 43.583  -2.492  1.00 59.03  ? 509  LEU A CB    1 
ATOM   3937  C  CG    . LEU A  1  509  ? 130.374 42.353  -2.909  1.00 59.28  ? 509  LEU A CG    1 
ATOM   3938  C  CD1   . LEU A  1  509  ? 130.093 42.026  -4.308  1.00 56.88  ? 509  LEU A CD1   1 
ATOM   3939  C  CD2   . LEU A  1  509  ? 131.845 42.545  -2.738  1.00 61.00  ? 509  LEU A CD2   1 
ATOM   3940  N  N     . GLN A  1  510  ? 127.707 45.186  -0.373  1.00 66.65  ? 510  GLN A N     1 
ATOM   3941  C  CA    . GLN A  1  510  ? 126.747 46.259  -0.145  1.00 66.97  ? 510  GLN A CA    1 
ATOM   3942  C  C     . GLN A  1  510  ? 126.865 46.979  1.205   1.00 71.46  ? 510  GLN A C     1 
ATOM   3943  O  O     . GLN A  1  510  ? 126.092 47.917  1.433   1.00 71.39  ? 510  GLN A O     1 
ATOM   3944  C  CB    . GLN A  1  510  ? 125.320 45.713  -0.323  1.00 67.98  ? 510  GLN A CB    1 
ATOM   3945  C  CG    . GLN A  1  510  ? 125.030 45.122  -1.704  1.00 73.16  ? 510  GLN A CG    1 
ATOM   3946  C  CD    . GLN A  1  510  ? 125.115 46.164  -2.770  1.00 87.33  ? 510  GLN A CD    1 
ATOM   3947  O  OE1   . GLN A  1  510  ? 124.838 47.356  -2.535  1.00 90.75  ? 510  GLN A OE1   1 
ATOM   3948  N  NE2   . GLN A  1  510  ? 125.530 45.742  -3.958  1.00 68.67  ? 510  GLN A NE2   1 
ATOM   3949  N  N     . ILE A  1  511  ? 127.822 46.566  2.088   1.00 67.54  ? 511  ILE A N     1 
ATOM   3950  C  CA    . ILE A  1  511  ? 127.993 47.141  3.438   1.00 67.24  ? 511  ILE A CA    1 
ATOM   3951  C  C     . ILE A  1  511  ? 128.111 48.665  3.370   1.00 73.56  ? 511  ILE A C     1 
ATOM   3952  O  O     . ILE A  1  511  ? 127.248 49.336  3.919   1.00 73.47  ? 511  ILE A O     1 
ATOM   3953  C  CB    . ILE A  1  511  ? 129.105 46.471  4.299   1.00 69.47  ? 511  ILE A CB    1 
ATOM   3954  C  CG1   . ILE A  1  511  ? 128.700 45.007  4.654   1.00 69.50  ? 511  ILE A CG1   1 
ATOM   3955  C  CG2   . ILE A  1  511  ? 129.348 47.283  5.571   1.00 68.85  ? 511  ILE A CG2   1 
ATOM   3956  C  CD1   . ILE A  1  511  ? 129.803 44.066  5.217   1.00 73.82  ? 511  ILE A CD1   1 
ATOM   3957  N  N     . VAL A  1  512  ? 129.100 49.204  2.651   1.00 72.01  ? 512  VAL A N     1 
ATOM   3958  C  CA    . VAL A  1  512  ? 129.233 50.655  2.509   1.00 72.83  ? 512  VAL A CA    1 
ATOM   3959  C  C     . VAL A  1  512  ? 128.458 51.057  1.236   1.00 79.30  ? 512  VAL A C     1 
ATOM   3960  O  O     . VAL A  1  512  ? 128.812 50.611  0.144   1.00 79.58  ? 512  VAL A O     1 
ATOM   3961  C  CB    . VAL A  1  512  ? 130.706 51.143  2.575   1.00 76.44  ? 512  VAL A CB    1 
ATOM   3962  C  CG1   . VAL A  1  512  ? 130.812 52.629  2.290   1.00 76.67  ? 512  VAL A CG1   1 
ATOM   3963  C  CG2   . VAL A  1  512  ? 131.305 50.846  3.940   1.00 76.60  ? 512  VAL A CG2   1 
ATOM   3964  N  N     . SER A  1  513  ? 127.343 51.815  1.411   1.00 75.78  ? 513  SER A N     1 
ATOM   3965  C  CA    . SER A  1  513  ? 126.413 52.221  0.359   1.00 74.93  ? 513  SER A CA    1 
ATOM   3966  C  C     . SER A  1  513  ? 126.703 53.586  -0.218  1.00 78.66  ? 513  SER A C     1 
ATOM   3967  O  O     . SER A  1  513  ? 126.919 54.536  0.540   1.00 79.23  ? 513  SER A O     1 
ATOM   3968  C  CB    . SER A  1  513  ? 124.972 52.159  0.862   1.00 79.13  ? 513  SER A CB    1 
ATOM   3969  O  OG    . SER A  1  513  ? 124.102 53.084  0.225   1.00 88.04  ? 513  SER A OG    1 
ATOM   3970  N  N     . PRO A  1  514  ? 126.562 53.723  -1.559  1.00 74.37  ? 514  PRO A N     1 
ATOM   3971  C  CA    . PRO A  1  514  ? 126.827 55.014  -2.200  1.00 74.25  ? 514  PRO A CA    1 
ATOM   3972  C  C     . PRO A  1  514  ? 125.722 56.054  -2.052  1.00 77.68  ? 514  PRO A C     1 
ATOM   3973  O  O     . PRO A  1  514  ? 125.877 57.154  -2.570  1.00 77.44  ? 514  PRO A O     1 
ATOM   3974  C  CB    . PRO A  1  514  ? 127.031 54.623  -3.662  1.00 75.60  ? 514  PRO A CB    1 
ATOM   3975  C  CG    . PRO A  1  514  ? 126.162 53.447  -3.849  1.00 78.90  ? 514  PRO A CG    1 
ATOM   3976  C  CD    . PRO A  1  514  ? 126.277 52.683  -2.571  1.00 74.93  ? 514  PRO A CD    1 
ATOM   3977  N  N     . GLN A  1  515  ? 124.615 55.722  -1.375  1.00 74.27  ? 515  GLN A N     1 
ATOM   3978  C  CA    . GLN A  1  515  ? 123.502 56.654  -1.190  1.00 74.66  ? 515  GLN A CA    1 
ATOM   3979  C  C     . GLN A  1  515  ? 124.008 57.879  -0.461  1.00 80.77  ? 515  GLN A C     1 
ATOM   3980  O  O     . GLN A  1  515  ? 123.869 58.998  -0.950  1.00 81.80  ? 515  GLN A O     1 
ATOM   3981  C  CB    . GLN A  1  515  ? 122.400 55.993  -0.354  1.00 75.72  ? 515  GLN A CB    1 
ATOM   3982  C  CG    . GLN A  1  515  ? 121.009 56.588  -0.483  1.00 90.22  ? 515  GLN A CG    1 
ATOM   3983  C  CD    . GLN A  1  515  ? 120.015 55.445  -0.549  1.00 119.82 ? 515  GLN A CD    1 
ATOM   3984  O  OE1   . GLN A  1  515  ? 120.066 54.575  -1.442  1.00 111.99 ? 515  GLN A OE1   1 
ATOM   3985  N  NE2   . GLN A  1  515  ? 119.122 55.386  0.425   1.00 117.35 ? 515  GLN A NE2   1 
ATOM   3986  N  N     . SER A  1  516  ? 124.654 57.652  0.681   1.00 77.49  ? 516  SER A N     1 
ATOM   3987  C  CA    . SER A  1  516  ? 125.125 58.705  1.561   1.00 77.87  ? 516  SER A CA    1 
ATOM   3988  C  C     . SER A  1  516  ? 126.592 58.524  1.914   1.00 80.16  ? 516  SER A C     1 
ATOM   3989  O  O     . SER A  1  516  ? 127.074 59.151  2.863   1.00 81.18  ? 516  SER A O     1 
ATOM   3990  C  CB    . SER A  1  516  ? 124.267 58.712  2.818   1.00 83.50  ? 516  SER A CB    1 
ATOM   3991  O  OG    . SER A  1  516  ? 124.221 57.390  3.336   1.00 101.08 ? 516  SER A OG    1 
ATOM   3992  N  N     . ASN A  1  517  ? 127.314 57.700  1.120   1.00 73.99  ? 517  ASN A N     1 
ATOM   3993  C  CA    . ASN A  1  517  ? 128.742 57.392  1.228   1.00 72.73  ? 517  ASN A CA    1 
ATOM   3994  C  C     . ASN A  1  517  ? 129.134 56.921  2.630   1.00 75.51  ? 517  ASN A C     1 
ATOM   3995  O  O     . ASN A  1  517  ? 130.148 57.350  3.185   1.00 77.55  ? 517  ASN A O     1 
ATOM   3996  C  CB    . ASN A  1  517  ? 129.612 58.570  0.729   1.00 73.82  ? 517  ASN A CB    1 
ATOM   3997  C  CG    . ASN A  1  517  ? 129.492 59.875  1.479   1.00 92.84  ? 517  ASN A CG    1 
ATOM   3998  O  OD1   . ASN A  1  517  ? 130.154 60.106  2.489   1.00 94.37  ? 517  ASN A OD1   1 
ATOM   3999  N  ND2   . ASN A  1  517  ? 128.640 60.759  1.004   1.00 79.99  ? 517  ASN A ND2   1 
ATOM   4000  N  N     . LYS A  1  518  ? 128.315 56.037  3.208   1.00 68.85  ? 518  LYS A N     1 
ATOM   4001  C  CA    . LYS A  1  518  ? 128.547 55.477  4.544   1.00 67.65  ? 518  LYS A CA    1 
ATOM   4002  C  C     . LYS A  1  518  ? 127.951 54.066  4.617   1.00 71.13  ? 518  LYS A C     1 
ATOM   4003  O  O     . LYS A  1  518  ? 127.163 53.712  3.728   1.00 70.82  ? 518  LYS A O     1 
ATOM   4004  C  CB    . LYS A  1  518  ? 127.959 56.396  5.638   1.00 68.76  ? 518  LYS A CB    1 
ATOM   4005  C  CG    . LYS A  1  518  ? 126.435 56.387  5.701   1.00 66.95  ? 518  LYS A CG    1 
ATOM   4006  C  CD    . LYS A  1  518  ? 125.910 56.847  7.047   1.00 68.14  ? 518  LYS A CD    1 
ATOM   4007  C  CE    . LYS A  1  518  ? 124.407 56.776  7.129   1.00 69.87  ? 518  LYS A CE    1 
ATOM   4008  N  NZ    . LYS A  1  518  ? 123.923 55.375  7.311   1.00 90.42  ? 518  LYS A NZ    1 
ATOM   4009  N  N     . PRO A  1  519  ? 128.246 53.246  5.657   1.00 67.13  ? 519  PRO A N     1 
ATOM   4010  C  CA    . PRO A  1  519  ? 127.620 51.921  5.708   1.00 65.75  ? 519  PRO A CA    1 
ATOM   4011  C  C     . PRO A  1  519  ? 126.101 52.005  5.816   1.00 70.55  ? 519  PRO A C     1 
ATOM   4012  O  O     . PRO A  1  519  ? 125.562 52.953  6.378   1.00 70.12  ? 519  PRO A O     1 
ATOM   4013  C  CB    . PRO A  1  519  ? 128.257 51.254  6.930   1.00 67.28  ? 519  PRO A CB    1 
ATOM   4014  C  CG    . PRO A  1  519  ? 128.808 52.337  7.731   1.00 72.76  ? 519  PRO A CG    1 
ATOM   4015  C  CD    . PRO A  1  519  ? 129.160 53.448  6.802   1.00 69.04  ? 519  PRO A CD    1 
ATOM   4016  N  N     . CYS A  1  520  ? 125.417 51.029  5.230   1.00 68.28  ? 520  CYS A N     1 
ATOM   4017  C  CA    . CYS A  1  520  ? 123.971 50.950  5.297   1.00 68.71  ? 520  CYS A CA    1 
ATOM   4018  C  C     . CYS A  1  520  ? 123.502 49.880  6.300   1.00 73.29  ? 520  CYS A C     1 
ATOM   4019  O  O     . CYS A  1  520  ? 122.298 49.604  6.413   1.00 73.82  ? 520  CYS A O     1 
ATOM   4020  C  CB    . CYS A  1  520  ? 123.372 50.747  3.910   1.00 69.02  ? 520  CYS A CB    1 
ATOM   4021  S  SG    . CYS A  1  520  ? 123.510 49.064  3.273   1.00 72.54  ? 520  CYS A SG    1 
ATOM   4022  N  N     . MET A  1  521  ? 124.460 49.280  7.026   1.00 69.33  ? 521  MET A N     1 
ATOM   4023  C  CA    . MET A  1  521  ? 124.190 48.273  8.056   1.00 68.90  ? 521  MET A CA    1 
ATOM   4024  C  C     . MET A  1  521  ? 125.179 48.391  9.197   1.00 76.22  ? 521  MET A C     1 
ATOM   4025  O  O     . MET A  1  521  ? 126.370 48.599  8.955   1.00 78.21  ? 521  MET A O     1 
ATOM   4026  C  CB    . MET A  1  521  ? 124.135 46.841  7.504   1.00 69.56  ? 521  MET A CB    1 
ATOM   4027  C  CG    . MET A  1  521  ? 124.851 46.634  6.211   1.00 71.78  ? 521  MET A CG    1 
ATOM   4028  S  SD    . MET A  1  521  ? 124.298 45.061  5.551   1.00 74.77  ? 521  MET A SD    1 
ATOM   4029  C  CE    . MET A  1  521  ? 124.837 45.182  3.838   1.00 70.57  ? 521  MET A CE    1 
ATOM   4030  N  N     . GLY A  1  522  ? 124.670 48.319  10.422  1.00 71.58  ? 522  GLY A N     1 
ATOM   4031  C  CA    . GLY A  1  522  ? 125.476 48.407  11.632  1.00 71.52  ? 522  GLY A CA    1 
ATOM   4032  C  C     . GLY A  1  522  ? 124.973 47.428  12.660  1.00 75.46  ? 522  GLY A C     1 
ATOM   4033  O  O     . GLY A  1  522  ? 124.068 46.644  12.364  1.00 75.06  ? 522  GLY A O     1 
ATOM   4034  N  N     . ILE A  1  523  ? 125.552 47.454  13.867  1.00 72.53  ? 523  ILE A N     1 
ATOM   4035  C  CA    . ILE A  1  523  ? 125.097 46.595  14.958  1.00 72.60  ? 523  ILE A CA    1 
ATOM   4036  C  C     . ILE A  1  523  ? 123.804 47.209  15.539  1.00 77.40  ? 523  ILE A C     1 
ATOM   4037  O  O     . ILE A  1  523  ? 123.749 48.420  15.778  1.00 77.88  ? 523  ILE A O     1 
ATOM   4038  C  CB    . ILE A  1  523  ? 126.230 46.303  15.980  1.00 76.34  ? 523  ILE A CB    1 
ATOM   4039  C  CG1   . ILE A  1  523  ? 126.956 45.015  15.605  1.00 77.00  ? 523  ILE A CG1   1 
ATOM   4040  C  CG2   . ILE A  1  523  ? 125.731 46.202  17.416  1.00 77.47  ? 523  ILE A CG2   1 
ATOM   4041  C  CD1   . ILE A  1  523  ? 128.229 45.200  14.881  1.00 91.26  ? 523  ILE A CD1   1 
ATOM   4042  N  N     . VAL A  1  524  ? 122.754 46.380  15.703  1.00 73.07  ? 524  VAL A N     1 
ATOM   4043  C  CA    . VAL A  1  524  ? 121.421 46.814  16.132  1.00 72.41  ? 524  VAL A CA    1 
ATOM   4044  C  C     . VAL A  1  524  ? 120.940 46.194  17.455  1.00 76.08  ? 524  VAL A C     1 
ATOM   4045  O  O     . VAL A  1  524  ? 121.741 45.599  18.162  1.00 77.13  ? 524  VAL A O     1 
ATOM   4046  C  CB    . VAL A  1  524  ? 120.427 46.542  14.984  1.00 75.67  ? 524  VAL A CB    1 
ATOM   4047  C  CG1   . VAL A  1  524  ? 120.688 47.473  13.816  1.00 75.39  ? 524  VAL A CG1   1 
ATOM   4048  C  CG2   . VAL A  1  524  ? 120.485 45.087  14.530  1.00 75.10  ? 524  VAL A CG2   1 
ATOM   4049  N  N     . GLN A  1  525  ? 119.630 46.352  17.773  1.00 71.53  ? 525  GLN A N     1 
ATOM   4050  C  CA    . GLN A  1  525  ? 118.854 45.840  18.924  1.00 71.44  ? 525  GLN A CA    1 
ATOM   4051  C  C     . GLN A  1  525  ? 119.694 45.255  20.112  1.00 76.91  ? 525  GLN A C     1 
ATOM   4052  O  O     . GLN A  1  525  ? 120.402 46.014  20.780  1.00 76.72  ? 525  GLN A O     1 
ATOM   4053  C  CB    . GLN A  1  525  ? 117.783 44.816  18.461  1.00 71.36  ? 525  GLN A CB    1 
ATOM   4054  C  CG    . GLN A  1  525  ? 116.634 45.412  17.648  1.00 77.31  ? 525  GLN A CG    1 
ATOM   4055  C  CD    . GLN A  1  525  ? 115.249 45.201  18.231  1.00 97.83  ? 525  GLN A CD    1 
ATOM   4056  O  OE1   . GLN A  1  525  ? 114.961 44.196  18.889  1.00 94.52  ? 525  GLN A OE1   1 
ATOM   4057  N  NE2   . GLN A  1  525  ? 114.328 46.123  17.939  1.00 91.42  ? 525  GLN A NE2   1 
ATOM   4058  N  N     . ASP A  1  526  ? 119.573 43.929  20.385  1.00 74.09  ? 526  ASP A N     1 
ATOM   4059  C  CA    . ASP A  1  526  ? 120.229 43.237  21.491  1.00 75.12  ? 526  ASP A CA    1 
ATOM   4060  C  C     . ASP A  1  526  ? 121.693 43.557  21.586  1.00 79.21  ? 526  ASP A C     1 
ATOM   4061  O  O     . ASP A  1  526  ? 122.119 44.034  22.624  1.00 80.63  ? 526  ASP A O     1 
ATOM   4062  C  CB    . ASP A  1  526  ? 120.034 41.702  21.418  1.00 77.38  ? 526  ASP A CB    1 
ATOM   4063  C  CG    . ASP A  1  526  ? 118.820 41.123  22.121  1.00 92.53  ? 526  ASP A CG    1 
ATOM   4064  O  OD1   . ASP A  1  526  ? 117.933 41.914  22.533  1.00 92.86  ? 526  ASP A OD1   1 
ATOM   4065  O  OD2   . ASP A  1  526  ? 118.735 39.867  22.226  1.00 100.96 ? 526  ASP A OD2   1 
ATOM   4066  N  N     . THR A  1  527  ? 122.456 43.314  20.507  1.00 75.05  ? 527  THR A N     1 
ATOM   4067  C  CA    . THR A  1  527  ? 123.912 43.500  20.421  1.00 75.03  ? 527  THR A CA    1 
ATOM   4068  C  C     . THR A  1  527  ? 124.360 44.930  20.744  1.00 80.27  ? 527  THR A C     1 
ATOM   4069  O  O     . THR A  1  527  ? 125.344 45.098  21.452  1.00 80.79  ? 527  THR A O     1 
ATOM   4070  C  CB    . THR A  1  527  ? 124.416 43.022  19.067  1.00 80.42  ? 527  THR A CB    1 
ATOM   4071  O  OG1   . THR A  1  527  ? 123.702 41.835  18.683  1.00 81.69  ? 527  THR A OG1   1 
ATOM   4072  C  CG2   . THR A  1  527  ? 125.918 42.796  19.048  1.00 77.01  ? 527  THR A CG2   1 
ATOM   4073  N  N     . LEU A  1  528  ? 123.624 45.947  20.265  1.00 76.94  ? 528  LEU A N     1 
ATOM   4074  C  CA    . LEU A  1  528  ? 123.925 47.353  20.530  1.00 77.31  ? 528  LEU A CA    1 
ATOM   4075  C  C     . LEU A  1  528  ? 123.695 47.697  21.986  1.00 84.64  ? 528  LEU A C     1 
ATOM   4076  O  O     . LEU A  1  528  ? 124.481 48.434  22.558  1.00 85.65  ? 528  LEU A O     1 
ATOM   4077  C  CB    . LEU A  1  528  ? 123.091 48.267  19.615  1.00 76.39  ? 528  LEU A CB    1 
ATOM   4078  C  CG    . LEU A  1  528  ? 123.356 49.773  19.661  1.00 80.47  ? 528  LEU A CG    1 
ATOM   4079  C  CD1   . LEU A  1  528  ? 124.845 50.094  19.542  1.00 80.49  ? 528  LEU A CD1   1 
ATOM   4080  C  CD2   . LEU A  1  528  ? 122.580 50.469  18.587  1.00 81.10  ? 528  LEU A CD2   1 
ATOM   4081  N  N     . CYS A  1  529  ? 122.619 47.180  22.581  1.00 83.37  ? 529  CYS A N     1 
ATOM   4082  C  CA    . CYS A  1  529  ? 122.298 47.416  23.983  1.00 85.15  ? 529  CYS A CA    1 
ATOM   4083  C  C     . CYS A  1  529  ? 123.366 46.789  24.871  1.00 88.91  ? 529  CYS A C     1 
ATOM   4084  O  O     . CYS A  1  529  ? 123.878 47.455  25.777  1.00 90.73  ? 529  CYS A O     1 
ATOM   4085  C  CB    . CYS A  1  529  ? 120.907 46.885  24.317  1.00 86.28  ? 529  CYS A CB    1 
ATOM   4086  S  SG    . CYS A  1  529  ? 120.328 47.322  25.978  1.00 92.20  ? 529  CYS A SG    1 
ATOM   4087  N  N     . GLY A  1  530  ? 123.710 45.538  24.564  1.00 82.78  ? 530  GLY A N     1 
ATOM   4088  C  CA    . GLY A  1  530  ? 124.703 44.746  25.275  1.00 82.43  ? 530  GLY A CA    1 
ATOM   4089  C  C     . GLY A  1  530  ? 126.143 45.181  25.079  1.00 85.01  ? 530  GLY A C     1 
ATOM   4090  O  O     . GLY A  1  530  ? 126.965 44.943  25.964  1.00 85.90  ? 530  GLY A O     1 
ATOM   4091  N  N     . ILE A  1  531  ? 126.485 45.786  23.919  1.00 78.56  ? 531  ILE A N     1 
ATOM   4092  C  CA    . ILE A  1  531  ? 127.863 46.219  23.656  1.00 77.17  ? 531  ILE A CA    1 
ATOM   4093  C  C     . ILE A  1  531  ? 128.222 47.431  24.552  1.00 82.73  ? 531  ILE A C     1 
ATOM   4094  O  O     . ILE A  1  531  ? 129.365 47.513  24.997  1.00 84.19  ? 531  ILE A O     1 
ATOM   4095  C  CB    . ILE A  1  531  ? 128.170 46.416  22.145  1.00 78.22  ? 531  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A  1  531  ? 129.674 46.369  21.872  1.00 78.30  ? 531  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A  1  531  ? 127.506 47.659  21.534  1.00 78.31  ? 531  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A  1  531  ? 130.045 46.118  20.443  1.00 79.91  ? 531  ILE A CD1   1 
ATOM   4099  N  N     . ARG A  1  532  ? 127.236 48.313  24.880  1.00 77.84  ? 532  ARG A N     1 
ATOM   4100  C  CA    . ARG A  1  532  ? 127.443 49.448  25.778  1.00 77.91  ? 532  ARG A CA    1 
ATOM   4101  C  C     . ARG A  1  532  ? 127.693 48.875  27.152  1.00 82.73  ? 532  ARG A C     1 
ATOM   4102  O  O     . ARG A  1  532  ? 128.726 49.159  27.741  1.00 83.57  ? 532  ARG A O     1 
ATOM   4103  C  CB    . ARG A  1  532  ? 126.218 50.372  25.817  1.00 78.07  ? 532  ARG A CB    1 
ATOM   4104  C  CG    . ARG A  1  532  ? 126.464 51.617  26.660  1.00 92.12  ? 532  ARG A CG    1 
ATOM   4105  C  CD    . ARG A  1  532  ? 125.210 52.366  27.033  1.00 105.98 ? 532  ARG A CD    1 
ATOM   4106  N  NE    . ARG A  1  532  ? 125.115 52.549  28.481  1.00 117.89 ? 532  ARG A NE    1 
ATOM   4107  C  CZ    . ARG A  1  532  ? 124.403 51.765  29.282  1.00 136.01 ? 532  ARG A CZ    1 
ATOM   4108  N  NH1   . ARG A  1  532  ? 123.713 50.743  28.783  1.00 121.43 ? 532  ARG A NH1   1 
ATOM   4109  N  NH2   . ARG A  1  532  ? 124.369 51.998  30.588  1.00 126.28 ? 532  ARG A NH2   1 
ATOM   4110  N  N     . LYS A  1  533  ? 126.772 48.015  27.626  1.00 79.10  ? 533  LYS A N     1 
ATOM   4111  C  CA    . LYS A  1  533  ? 126.818 47.330  28.918  1.00 79.75  ? 533  LYS A CA    1 
ATOM   4112  C  C     . LYS A  1  533  ? 128.128 46.572  29.079  1.00 84.16  ? 533  LYS A C     1 
ATOM   4113  O  O     . LYS A  1  533  ? 128.762 46.681  30.119  1.00 84.32  ? 533  LYS A O     1 
ATOM   4114  C  CB    . LYS A  1  533  ? 125.619 46.363  29.074  1.00 81.54  ? 533  LYS A CB    1 
ATOM   4115  C  CG    . LYS A  1  533  ? 124.227 47.018  29.158  1.00 84.74  ? 533  LYS A CG    1 
ATOM   4116  C  CD    . LYS A  1  533  ? 123.228 46.196  29.974  1.00 85.73  ? 533  LYS A CD    1 
ATOM   4117  C  CE    . LYS A  1  533  ? 123.483 46.267  31.468  1.00 97.81  ? 533  LYS A CE    1 
ATOM   4118  N  NZ    . LYS A  1  533  ? 122.580 45.360  32.229  1.00 110.85 ? 533  LYS A NZ    1 
ATOM   4119  N  N     . LEU A  1  534  ? 128.554 45.852  28.033  1.00 82.02  ? 534  LEU A N     1 
ATOM   4120  C  CA    . LEU A  1  534  ? 129.791 45.067  28.023  1.00 83.58  ? 534  LEU A CA    1 
ATOM   4121  C  C     . LEU A  1  534  ? 131.030 45.940  28.189  1.00 91.72  ? 534  LEU A C     1 
ATOM   4122  O  O     . LEU A  1  534  ? 131.931 45.578  28.945  1.00 93.48  ? 534  LEU A O     1 
ATOM   4123  C  CB    . LEU A  1  534  ? 129.896 44.200  26.735  1.00 82.26  ? 534  LEU A CB    1 
ATOM   4124  C  CG    . LEU A  1  534  ? 131.160 43.335  26.536  1.00 86.58  ? 534  LEU A CG    1 
ATOM   4125  C  CD1   . LEU A  1  534  ? 131.320 42.288  27.634  1.00 87.53  ? 534  LEU A CD1   1 
ATOM   4126  C  CD2   . LEU A  1  534  ? 131.163 42.684  25.173  1.00 86.12  ? 534  LEU A CD2   1 
ATOM   4127  N  N     . THR A  1  535  ? 131.052 47.100  27.514  1.00 88.81  ? 535  THR A N     1 
ATOM   4128  C  CA    . THR A  1  535  ? 132.200 48.004  27.509  1.00 89.23  ? 535  THR A CA    1 
ATOM   4129  C  C     . THR A  1  535  ? 132.112 49.172  28.508  1.00 95.30  ? 535  THR A C     1 
ATOM   4130  O  O     . THR A  1  535  ? 132.438 50.304  28.142  1.00 96.43  ? 535  THR A O     1 
ATOM   4131  C  CB    . THR A  1  535  ? 132.455 48.502  26.085  1.00 91.98  ? 535  THR A CB    1 
ATOM   4132  O  OG1   . THR A  1  535  ? 131.332 49.265  25.632  1.00 87.18  ? 535  THR A OG1   1 
ATOM   4133  C  CG2   . THR A  1  535  ? 132.769 47.371  25.132  1.00 89.48  ? 535  THR A CG2   1 
ATOM   4134  N  N     . LEU A  1  536  ? 131.709 48.917  29.760  1.00 91.70  ? 536  LEU A N     1 
ATOM   4135  C  CA    . LEU A  1  536  ? 131.705 49.991  30.757  1.00 92.20  ? 536  LEU A CA    1 
ATOM   4136  C  C     . LEU A  1  536  ? 132.968 49.787  31.570  1.00 99.77  ? 536  LEU A C     1 
ATOM   4137  O  O     . LEU A  1  536  ? 133.509 48.669  31.544  1.00 100.31 ? 536  LEU A O     1 
ATOM   4138  C  CB    . LEU A  1  536  ? 130.461 49.935  31.651  1.00 91.95  ? 536  LEU A CB    1 
ATOM   4139  C  CG    . LEU A  1  536  ? 129.100 50.060  30.962  1.00 94.89  ? 536  LEU A CG    1 
ATOM   4140  C  CD1   . LEU A  1  536  ? 127.981 49.777  31.924  1.00 95.40  ? 536  LEU A CD1   1 
ATOM   4141  C  CD2   . LEU A  1  536  ? 128.895 51.430  30.359  1.00 97.09  ? 536  LEU A CD2   1 
ATOM   4142  N  N     . ARG A  1  537  ? 133.483 50.842  32.250  1.00 98.14  ? 537  ARG A N     1 
ATOM   4143  C  CA    . ARG A  1  537  ? 134.701 50.683  33.070  1.00 99.52  ? 537  ARG A CA    1 
ATOM   4144  C  C     . ARG A  1  537  ? 134.466 49.630  34.169  1.00 105.80 ? 537  ARG A C     1 
ATOM   4145  O  O     . ARG A  1  537  ? 135.270 48.709  34.322  1.00 105.66 ? 537  ARG A O     1 
ATOM   4146  C  CB    . ARG A  1  537  ? 135.210 52.024  33.632  1.00 98.59  ? 537  ARG A CB    1 
ATOM   4147  C  CG    . ARG A  1  537  ? 136.569 52.415  33.058  1.00 105.66 ? 537  ARG A CG    1 
ATOM   4148  C  CD    . ARG A  1  537  ? 137.240 53.547  33.815  1.00 119.47 ? 537  ARG A CD    1 
ATOM   4149  N  NE    . ARG A  1  537  ? 136.793 54.864  33.353  1.00 130.27 ? 537  ARG A NE    1 
ATOM   4150  C  CZ    . ARG A  1  537  ? 137.428 55.605  32.449  1.00 141.98 ? 537  ARG A CZ    1 
ATOM   4151  N  NH1   . ARG A  1  537  ? 138.556 55.174  31.898  1.00 131.45 ? 537  ARG A NH1   1 
ATOM   4152  N  NH2   . ARG A  1  537  ? 136.938 56.781  32.085  1.00 123.20 ? 537  ARG A NH2   1 
ATOM   4153  N  N     . ASP A  1  538  ? 133.289 49.709  34.818  1.00 103.72 ? 538  ASP A N     1 
ATOM   4154  C  CA    . ASP A  1  538  ? 132.748 48.821  35.851  1.00 105.11 ? 538  ASP A CA    1 
ATOM   4155  C  C     . ASP A  1  538  ? 132.567 47.322  35.436  1.00 109.62 ? 538  ASP A C     1 
ATOM   4156  O  O     . ASP A  1  538  ? 132.502 46.452  36.311  1.00 110.89 ? 538  ASP A O     1 
ATOM   4157  C  CB    . ASP A  1  538  ? 131.380 49.378  36.275  1.00 107.33 ? 538  ASP A CB    1 
ATOM   4158  C  CG    . ASP A  1  538  ? 131.285 49.808  37.717  1.00 123.89 ? 538  ASP A CG    1 
ATOM   4159  O  OD1   . ASP A  1  538  ? 132.243 50.433  38.213  1.00 127.02 ? 538  ASP A OD1   1 
ATOM   4160  O  OD2   . ASP A  1  538  ? 130.229 49.568  38.335  1.00 131.42 ? 538  ASP A OD2   1 
ATOM   4161  N  N     . THR A  1  539  ? 132.433 47.028  34.131  1.00 104.10 ? 539  THR A N     1 
ATOM   4162  C  CA    . THR A  1  539  ? 132.209 45.664  33.645  1.00 102.61 ? 539  THR A CA    1 
ATOM   4163  C  C     . THR A  1  539  ? 133.529 44.868  33.526  1.00 105.71 ? 539  THR A C     1 
ATOM   4164  O  O     . THR A  1  539  ? 134.390 45.210  32.705  1.00 105.24 ? 539  THR A O     1 
ATOM   4165  C  CB    . THR A  1  539  ? 131.372 45.698  32.350  1.00 107.93 ? 539  THR A CB    1 
ATOM   4166  O  OG1   . THR A  1  539  ? 130.172 46.422  32.616  1.00 110.69 ? 539  THR A OG1   1 
ATOM   4167  C  CG2   . THR A  1  539  ? 130.993 44.315  31.855  1.00 102.90 ? 539  THR A CG2   1 
ATOM   4168  N  N     . PHE A  1  540  ? 133.663 43.804  34.364  1.00 101.39 ? 540  PHE A N     1 
ATOM   4169  C  CA    . PHE A  1  540  ? 134.799 42.867  34.420  1.00 100.58 ? 540  PHE A CA    1 
ATOM   4170  C  C     . PHE A  1  540  ? 134.333 41.423  34.306  1.00 102.63 ? 540  PHE A C     1 
ATOM   4171  O  O     . PHE A  1  540  ? 133.286 41.064  34.838  1.00 103.06 ? 540  PHE A O     1 
ATOM   4172  C  CB    . PHE A  1  540  ? 135.584 43.025  35.718  1.00 103.87 ? 540  PHE A CB    1 
ATOM   4173  C  CG    . PHE A  1  540  ? 136.217 44.376  35.873  1.00 106.27 ? 540  PHE A CG    1 
ATOM   4174  C  CD1   . PHE A  1  540  ? 137.441 44.659  35.282  1.00 108.56 ? 540  PHE A CD1   1 
ATOM   4175  C  CD2   . PHE A  1  540  ? 135.587 45.376  36.605  1.00 109.97 ? 540  PHE A CD2   1 
ATOM   4176  C  CE1   . PHE A  1  540  ? 138.023 45.918  35.419  1.00 112.14 ? 540  PHE A CE1   1 
ATOM   4177  C  CE2   . PHE A  1  540  ? 136.171 46.633  36.749  1.00 111.37 ? 540  PHE A CE2   1 
ATOM   4178  C  CZ    . PHE A  1  540  ? 137.389 46.894  36.162  1.00 110.81 ? 540  PHE A CZ    1 
ATOM   4179  N  N     . ILE A  1  541  ? 135.118 40.587  33.639  1.00 97.05  ? 541  ILE A N     1 
ATOM   4180  C  CA    . ILE A  1  541  ? 134.786 39.186  33.434  1.00 95.83  ? 541  ILE A CA    1 
ATOM   4181  C  C     . ILE A  1  541  ? 135.853 38.277  34.042  1.00 102.16 ? 541  ILE A C     1 
ATOM   4182  O  O     . ILE A  1  541  ? 137.045 38.510  33.817  1.00 102.95 ? 541  ILE A O     1 
ATOM   4183  C  CB    . ILE A  1  541  ? 134.583 38.874  31.928  1.00 96.54  ? 541  ILE A CB    1 
ATOM   4184  C  CG1   . ILE A  1  541  ? 133.717 39.922  31.208  1.00 95.08  ? 541  ILE A CG1   1 
ATOM   4185  C  CG2   . ILE A  1  541  ? 133.972 37.497  31.771  1.00 97.68  ? 541  ILE A CG2   1 
ATOM   4186  C  CD1   . ILE A  1  541  ? 134.271 40.357  29.890  1.00 99.44  ? 541  ILE A CD1   1 
ATOM   4187  N  N     . GLU A  1  542  ? 135.434 37.225  34.783  1.00 98.98  ? 542  GLU A N     1 
ATOM   4188  C  CA    . GLU A  1  542  ? 136.392 36.267  35.339  1.00 99.44  ? 542  GLU A CA    1 
ATOM   4189  C  C     . GLU A  1  542  ? 136.643 35.134  34.342  1.00 100.32 ? 542  GLU A C     1 
ATOM   4190  O  O     . GLU A  1  542  ? 135.863 34.980  33.408  1.00 98.63  ? 542  GLU A O     1 
ATOM   4191  C  CB    . GLU A  1  542  ? 136.043 35.786  36.760  1.00 102.38 ? 542  GLU A CB    1 
ATOM   4192  C  CG    . GLU A  1  542  ? 134.629 35.295  36.991  1.00 114.05 ? 542  GLU A CG    1 
ATOM   4193  C  CD    . GLU A  1  542  ? 134.353 35.072  38.467  1.00 136.58 ? 542  GLU A CD    1 
ATOM   4194  O  OE1   . GLU A  1  542  ? 133.966 36.050  39.148  1.00 118.00 ? 542  GLU A OE1   1 
ATOM   4195  O  OE2   . GLU A  1  542  ? 134.569 33.937  38.954  1.00 142.26 ? 542  GLU A OE2   1 
ATOM   4196  N  N     . LEU A  1  543  ? 137.776 34.409  34.499  1.00 96.76  ? 543  LEU A N     1 
ATOM   4197  C  CA    . LEU A  1  543  ? 138.291 33.346  33.618  1.00 95.67  ? 543  LEU A CA    1 
ATOM   4198  C  C     . LEU A  1  543  ? 137.207 32.462  32.950  1.00 98.58  ? 543  LEU A C     1 
ATOM   4199  O  O     . LEU A  1  543  ? 137.108 32.493  31.723  1.00 96.64  ? 543  LEU A O     1 
ATOM   4200  C  CB    . LEU A  1  543  ? 139.343 32.474  34.345  1.00 96.77  ? 543  LEU A CB    1 
ATOM   4201  C  CG    . LEU A  1  543  ? 140.034 31.359  33.534  1.00 100.39 ? 543  LEU A CG    1 
ATOM   4202  C  CD1   . LEU A  1  543  ? 141.058 31.915  32.590  1.00 100.05 ? 543  LEU A CD1   1 
ATOM   4203  C  CD2   . LEU A  1  543  ? 140.741 30.400  34.440  1.00 103.70 ? 543  LEU A CD2   1 
ATOM   4204  N  N     . ASP A  1  544  ? 136.407 31.708  33.739  1.00 95.96  ? 544  ASP A N     1 
ATOM   4205  C  CA    . ASP A  1  544  ? 135.358 30.796  33.253  1.00 95.41  ? 544  ASP A CA    1 
ATOM   4206  C  C     . ASP A  1  544  ? 134.612 31.308  32.035  1.00 97.30  ? 544  ASP A C     1 
ATOM   4207  O  O     . ASP A  1  544  ? 134.656 30.656  30.987  1.00 97.31  ? 544  ASP A O     1 
ATOM   4208  C  CB    . ASP A  1  544  ? 134.370 30.406  34.367  1.00 98.75  ? 544  ASP A CB    1 
ATOM   4209  C  CG    . ASP A  1  544  ? 133.882 31.579  35.186  1.00 117.39 ? 544  ASP A CG    1 
ATOM   4210  O  OD1   . ASP A  1  544  ? 134.626 32.019  36.093  1.00 121.45 ? 544  ASP A OD1   1 
ATOM   4211  O  OD2   . ASP A  1  544  ? 132.776 32.082  34.898  1.00 124.54 ? 544  ASP A OD2   1 
ATOM   4212  N  N     . GLN A  1  545  ? 133.983 32.492  32.159  1.00 91.46  ? 545  GLN A N     1 
ATOM   4213  C  CA    . GLN A  1  545  ? 133.209 33.140  31.118  1.00 89.29  ? 545  GLN A CA    1 
ATOM   4214  C  C     . GLN A  1  545  ? 134.121 33.620  30.004  1.00 92.74  ? 545  GLN A C     1 
ATOM   4215  O  O     . GLN A  1  545  ? 133.796 33.351  28.848  1.00 92.65  ? 545  GLN A O     1 
ATOM   4216  C  CB    . GLN A  1  545  ? 132.402 34.292  31.707  1.00 90.98  ? 545  GLN A CB    1 
ATOM   4217  C  CG    . GLN A  1  545  ? 131.090 34.630  30.991  1.00 111.27 ? 545  GLN A CG    1 
ATOM   4218  C  CD    . GLN A  1  545  ? 130.458 35.943  31.476  1.00 136.62 ? 545  GLN A CD    1 
ATOM   4219  O  OE1   . GLN A  1  545  ? 129.622 36.551  30.787  1.00 130.84 ? 545  GLN A OE1   1 
ATOM   4220  N  NE2   . GLN A  1  545  ? 130.822 36.426  32.674  1.00 128.67 ? 545  GLN A NE2   1 
ATOM   4221  N  N     . VAL A  1  546  ? 135.284 34.271  30.323  1.00 88.36  ? 546  VAL A N     1 
ATOM   4222  C  CA    . VAL A  1  546  ? 136.246 34.746  29.299  1.00 86.59  ? 546  VAL A CA    1 
ATOM   4223  C  C     . VAL A  1  546  ? 136.569 33.638  28.290  1.00 90.76  ? 546  VAL A C     1 
ATOM   4224  O  O     . VAL A  1  546  ? 136.409 33.855  27.091  1.00 89.61  ? 546  VAL A O     1 
ATOM   4225  C  CB    . VAL A  1  546  ? 137.545 35.363  29.859  1.00 90.22  ? 546  VAL A CB    1 
ATOM   4226  C  CG1   . VAL A  1  546  ? 138.471 35.796  28.730  1.00 88.97  ? 546  VAL A CG1   1 
ATOM   4227  C  CG2   . VAL A  1  546  ? 137.252 36.535  30.773  1.00 90.71  ? 546  VAL A CG2   1 
ATOM   4228  N  N     . LEU A  1  547  ? 136.968 32.449  28.779  1.00 87.89  ? 547  LEU A N     1 
ATOM   4229  C  CA    . LEU A  1  547  ? 137.284 31.308  27.932  1.00 87.27  ? 547  LEU A CA    1 
ATOM   4230  C  C     . LEU A  1  547  ? 136.157 30.997  26.938  1.00 91.65  ? 547  LEU A C     1 
ATOM   4231  O  O     . LEU A  1  547  ? 136.446 30.875  25.742  1.00 91.63  ? 547  LEU A O     1 
ATOM   4232  C  CB    . LEU A  1  547  ? 137.672 30.063  28.754  1.00 88.23  ? 547  LEU A CB    1 
ATOM   4233  C  CG    . LEU A  1  547  ? 138.909 30.149  29.685  1.00 94.18  ? 547  LEU A CG    1 
ATOM   4234  C  CD1   . LEU A  1  547  ? 139.383 28.765  30.074  1.00 95.21  ? 547  LEU A CD1   1 
ATOM   4235  C  CD2   . LEU A  1  547  ? 140.073 30.902  29.054  1.00 95.61  ? 547  LEU A CD2   1 
ATOM   4236  N  N     . ASN A  1  548  ? 134.876 30.935  27.408  1.00 87.44  ? 548  ASN A N     1 
ATOM   4237  C  CA    . ASN A  1  548  ? 133.696 30.653  26.557  1.00 85.25  ? 548  ASN A CA    1 
ATOM   4238  C  C     . ASN A  1  548  ? 133.492 31.739  25.498  1.00 87.26  ? 548  ASN A C     1 
ATOM   4239  O  O     . ASN A  1  548  ? 133.252 31.423  24.327  1.00 85.53  ? 548  ASN A O     1 
ATOM   4240  C  CB    . ASN A  1  548  ? 132.422 30.482  27.396  1.00 83.56  ? 548  ASN A CB    1 
ATOM   4241  C  CG    . ASN A  1  548  ? 132.350 29.208  28.197  1.00 104.20 ? 548  ASN A CG    1 
ATOM   4242  O  OD1   . ASN A  1  548  ? 132.693 28.120  27.730  1.00 97.67  ? 548  ASN A OD1   1 
ATOM   4243  N  ND2   . ASN A  1  548  ? 131.838 29.311  29.410  1.00 99.03  ? 548  ASN A ND2   1 
ATOM   4244  N  N     . MET A  1  549  ? 133.630 33.019  25.924  1.00 83.23  ? 549  MET A N     1 
ATOM   4245  C  CA    . MET A  1  549  ? 133.536 34.223  25.099  1.00 81.25  ? 549  MET A CA    1 
ATOM   4246  C  C     . MET A  1  549  ? 134.608 34.208  24.008  1.00 83.05  ? 549  MET A C     1 
ATOM   4247  O  O     . MET A  1  549  ? 134.299 34.521  22.860  1.00 81.82  ? 549  MET A O     1 
ATOM   4248  C  CB    . MET A  1  549  ? 133.688 35.458  25.971  1.00 84.28  ? 549  MET A CB    1 
ATOM   4249  C  CG    . MET A  1  549  ? 132.502 35.723  26.827  1.00 88.39  ? 549  MET A CG    1 
ATOM   4250  S  SD    . MET A  1  549  ? 132.214 37.492  26.994  1.00 93.24  ? 549  MET A SD    1 
ATOM   4251  C  CE    . MET A  1  549  ? 132.146 37.590  28.668  1.00 91.69  ? 549  MET A CE    1 
ATOM   4252  N  N     . LEU A  1  550  ? 135.850 33.790  24.358  1.00 79.13  ? 550  LEU A N     1 
ATOM   4253  C  CA    . LEU A  1  550  ? 136.972 33.633  23.431  1.00 78.13  ? 550  LEU A CA    1 
ATOM   4254  C  C     . LEU A  1  550  ? 136.685 32.505  22.425  1.00 82.99  ? 550  LEU A C     1 
ATOM   4255  O  O     . LEU A  1  550  ? 136.810 32.732  21.218  1.00 82.34  ? 550  LEU A O     1 
ATOM   4256  C  CB    . LEU A  1  550  ? 138.288 33.351  24.179  1.00 78.80  ? 550  LEU A CB    1 
ATOM   4257  C  CG    . LEU A  1  550  ? 138.976 34.529  24.861  1.00 83.19  ? 550  LEU A CG    1 
ATOM   4258  C  CD1   . LEU A  1  550  ? 140.062 34.052  25.784  1.00 84.09  ? 550  LEU A CD1   1 
ATOM   4259  C  CD2   . LEU A  1  550  ? 139.574 35.469  23.852  1.00 85.17  ? 550  LEU A CD2   1 
ATOM   4260  N  N     . TYR A  1  551  ? 136.252 31.314  22.910  1.00 80.33  ? 551  TYR A N     1 
ATOM   4261  C  CA    . TYR A  1  551  ? 135.930 30.175  22.050  1.00 80.34  ? 551  TYR A CA    1 
ATOM   4262  C  C     . TYR A  1  551  ? 134.853 30.489  21.008  1.00 84.93  ? 551  TYR A C     1 
ATOM   4263  O  O     . TYR A  1  551  ? 134.901 29.938  19.908  1.00 83.91  ? 551  TYR A O     1 
ATOM   4264  C  CB    . TYR A  1  551  ? 135.562 28.933  22.876  1.00 82.64  ? 551  TYR A CB    1 
ATOM   4265  C  CG    . TYR A  1  551  ? 135.474 27.658  22.062  1.00 85.07  ? 551  TYR A CG    1 
ATOM   4266  C  CD1   . TYR A  1  551  ? 136.404 27.378  21.063  1.00 87.35  ? 551  TYR A CD1   1 
ATOM   4267  C  CD2   . TYR A  1  551  ? 134.491 26.705  22.321  1.00 85.79  ? 551  TYR A CD2   1 
ATOM   4268  C  CE1   . TYR A  1  551  ? 136.318 26.214  20.296  1.00 88.39  ? 551  TYR A CE1   1 
ATOM   4269  C  CE2   . TYR A  1  551  ? 134.405 25.526  21.568  1.00 85.96  ? 551  TYR A CE2   1 
ATOM   4270  C  CZ    . TYR A  1  551  ? 135.321 25.289  20.552  1.00 89.87  ? 551  TYR A CZ    1 
ATOM   4271  O  OH    . TYR A  1  551  ? 135.254 24.168  19.762  1.00 83.64  ? 551  TYR A OH    1 
ATOM   4272  N  N     . TRP A  1  552  ? 133.926 31.413  21.343  1.00 82.56  ? 552  TRP A N     1 
ATOM   4273  C  CA    . TRP A  1  552  ? 132.823 31.865  20.495  1.00 81.86  ? 552  TRP A CA    1 
ATOM   4274  C  C     . TRP A  1  552  ? 133.255 32.616  19.232  1.00 88.12  ? 552  TRP A C     1 
ATOM   4275  O  O     . TRP A  1  552  ? 132.573 32.474  18.216  1.00 87.22  ? 552  TRP A O     1 
ATOM   4276  C  CB    . TRP A  1  552  ? 131.818 32.686  21.294  1.00 80.44  ? 552  TRP A CB    1 
ATOM   4277  C  CG    . TRP A  1  552  ? 130.659 31.861  21.756  1.00 81.36  ? 552  TRP A CG    1 
ATOM   4278  C  CD1   . TRP A  1  552  ? 130.432 31.393  23.018  1.00 85.18  ? 552  TRP A CD1   1 
ATOM   4279  C  CD2   . TRP A  1  552  ? 129.599 31.342  20.938  1.00 80.17  ? 552  TRP A CD2   1 
ATOM   4280  N  NE1   . TRP A  1  552  ? 129.290 30.622  23.041  1.00 84.20  ? 552  TRP A NE1   1 
ATOM   4281  C  CE2   . TRP A  1  552  ? 128.749 30.589  21.780  1.00 84.16  ? 552  TRP A CE2   1 
ATOM   4282  C  CE3   . TRP A  1  552  ? 129.269 31.465  19.578  1.00 80.10  ? 552  TRP A CE3   1 
ATOM   4283  C  CZ2   . TRP A  1  552  ? 127.600 29.952  21.304  1.00 82.36  ? 552  TRP A CZ2   1 
ATOM   4284  C  CZ3   . TRP A  1  552  ? 128.129 30.835  19.111  1.00 80.63  ? 552  TRP A CZ3   1 
ATOM   4285  C  CH2   . TRP A  1  552  ? 127.309 30.090  19.968  1.00 81.46  ? 552  TRP A CH2   1 
ATOM   4286  N  N     . VAL A  1  553  ? 134.367 33.406  19.285  1.00 86.62  ? 553  VAL A N     1 
ATOM   4287  C  CA    . VAL A  1  553  ? 134.944 34.116  18.122  1.00 86.28  ? 553  VAL A CA    1 
ATOM   4288  C  C     . VAL A  1  553  ? 135.576 32.998  17.272  1.00 92.18  ? 553  VAL A C     1 
ATOM   4289  O  O     . VAL A  1  553  ? 136.555 32.398  17.741  1.00 93.68  ? 553  VAL A O     1 
ATOM   4290  C  CB    . VAL A  1  553  ? 136.045 35.145  18.517  1.00 90.39  ? 553  VAL A CB    1 
ATOM   4291  C  CG1   . VAL A  1  553  ? 136.499 35.962  17.312  1.00 89.54  ? 553  VAL A CG1   1 
ATOM   4292  C  CG2   . VAL A  1  553  ? 135.607 36.053  19.653  1.00 90.50  ? 553  VAL A CG2   1 
ATOM   4293  N  N     . PRO A  1  554  ? 135.034 32.651  16.075  1.00 87.64  ? 554  PRO A N     1 
ATOM   4294  C  CA    . PRO A  1  554  ? 135.596 31.511  15.318  1.00 87.62  ? 554  PRO A CA    1 
ATOM   4295  C  C     . PRO A  1  554  ? 137.048 31.679  14.850  1.00 94.52  ? 554  PRO A C     1 
ATOM   4296  O  O     . PRO A  1  554  ? 137.834 30.725  14.904  1.00 95.75  ? 554  PRO A O     1 
ATOM   4297  C  CB    . PRO A  1  554  ? 134.616 31.343  14.151  1.00 87.63  ? 554  PRO A CB    1 
ATOM   4298  C  CG    . PRO A  1  554  ? 133.365 32.016  14.603  1.00 91.36  ? 554  PRO A CG    1 
ATOM   4299  C  CD    . PRO A  1  554  ? 133.845 33.192  15.393  1.00 87.70  ? 554  PRO A CD    1 
ATOM   4300  N  N     . ASP A  1  555  ? 137.405 32.905  14.455  1.00 91.63  ? 555  ASP A N     1 
ATOM   4301  C  CA    . ASP A  1  555  ? 138.718 33.299  13.955  1.00 92.48  ? 555  ASP A CA    1 
ATOM   4302  C  C     . ASP A  1  555  ? 139.768 33.418  15.063  1.00 97.29  ? 555  ASP A C     1 
ATOM   4303  O  O     . ASP A  1  555  ? 140.940 33.597  14.733  1.00 98.72  ? 555  ASP A O     1 
ATOM   4304  C  CB    . ASP A  1  555  ? 138.628 34.650  13.194  1.00 94.70  ? 555  ASP A CB    1 
ATOM   4305  C  CG    . ASP A  1  555  ? 137.380 34.842  12.345  1.00 108.78 ? 555  ASP A CG    1 
ATOM   4306  O  OD1   . ASP A  1  555  ? 137.364 34.357  11.184  1.00 109.16 ? 555  ASP A OD1   1 
ATOM   4307  O  OD2   . ASP A  1  555  ? 136.417 35.465  12.843  1.00 116.07 ? 555  ASP A OD2   1 
ATOM   4308  N  N     . TRP A  1  556  ? 139.365 33.368  16.358  1.00 92.40  ? 556  TRP A N     1 
ATOM   4309  C  CA    . TRP A  1  556  ? 140.269 33.489  17.513  1.00 92.33  ? 556  TRP A CA    1 
ATOM   4310  C  C     . TRP A  1  556  ? 141.555 32.660  17.382  1.00 96.05  ? 556  TRP A C     1 
ATOM   4311  O  O     . TRP A  1  556  ? 141.484 31.480  17.050  1.00 95.52  ? 556  TRP A O     1 
ATOM   4312  C  CB    . TRP A  1  556  ? 139.537 33.149  18.818  1.00 91.09  ? 556  TRP A CB    1 
ATOM   4313  C  CG    . TRP A  1  556  ? 140.403 33.215  20.043  1.00 93.11  ? 556  TRP A CG    1 
ATOM   4314  C  CD1   . TRP A  1  556  ? 141.141 34.280  20.472  1.00 96.58  ? 556  TRP A CD1   1 
ATOM   4315  C  CD2   . TRP A  1  556  ? 140.588 32.182  21.017  1.00 93.73  ? 556  TRP A CD2   1 
ATOM   4316  N  NE1   . TRP A  1  556  ? 141.796 33.964  21.637  1.00 97.15  ? 556  TRP A NE1   1 
ATOM   4317  C  CE2   . TRP A  1  556  ? 141.459 32.689  22.006  1.00 98.83  ? 556  TRP A CE2   1 
ATOM   4318  C  CE3   . TRP A  1  556  ? 140.099 30.873  21.154  1.00 94.83  ? 556  TRP A CE3   1 
ATOM   4319  C  CZ2   . TRP A  1  556  ? 141.839 31.939  23.124  1.00 99.42  ? 556  TRP A CZ2   1 
ATOM   4320  C  CZ3   . TRP A  1  556  ? 140.500 30.122  22.248  1.00 97.43  ? 556  TRP A CZ3   1 
ATOM   4321  C  CH2   . TRP A  1  556  ? 141.371 30.648  23.208  1.00 99.29  ? 556  TRP A CH2   1 
ATOM   4322  N  N     . ASP A  1  557  ? 142.718 33.289  17.644  1.00 92.77  ? 557  ASP A N     1 
ATOM   4323  C  CA    . ASP A  1  557  ? 144.063 32.701  17.541  1.00 93.31  ? 557  ASP A CA    1 
ATOM   4324  C  C     . ASP A  1  557  ? 144.371 31.564  18.515  1.00 97.91  ? 557  ASP A C     1 
ATOM   4325  O  O     . ASP A  1  557  ? 145.361 30.862  18.324  1.00 98.64  ? 557  ASP A O     1 
ATOM   4326  C  CB    . ASP A  1  557  ? 145.156 33.789  17.662  1.00 96.27  ? 557  ASP A CB    1 
ATOM   4327  C  CG    . ASP A  1  557  ? 144.937 34.839  18.738  1.00 111.78 ? 557  ASP A CG    1 
ATOM   4328  O  OD1   . ASP A  1  557  ? 144.494 34.474  19.848  1.00 114.48 ? 557  ASP A OD1   1 
ATOM   4329  O  OD2   . ASP A  1  557  ? 145.201 36.024  18.468  1.00 118.10 ? 557  ASP A OD2   1 
ATOM   4330  N  N     . GLY A  1  558  ? 143.562 31.402  19.551  1.00 94.58  ? 558  GLY A N     1 
ATOM   4331  C  CA    . GLY A  1  558  ? 143.786 30.372  20.558  1.00 95.41  ? 558  GLY A CA    1 
ATOM   4332  C  C     . GLY A  1  558  ? 144.681 30.880  21.670  1.00 100.60 ? 558  GLY A C     1 
ATOM   4333  O  O     . GLY A  1  558  ? 145.053 30.115  22.570  1.00 102.18 ? 558  GLY A O     1 
ATOM   4334  N  N     . VAL A  1  559  ? 144.997 32.203  21.624  1.00 95.39  ? 559  VAL A N     1 
ATOM   4335  C  CA    . VAL A  1  559  ? 145.855 32.932  22.573  1.00 95.47  ? 559  VAL A CA    1 
ATOM   4336  C  C     . VAL A  1  559  ? 144.998 33.722  23.591  1.00 98.49  ? 559  VAL A C     1 
ATOM   4337  O  O     . VAL A  1  559  ? 144.383 34.733  23.221  1.00 97.75  ? 559  VAL A O     1 
ATOM   4338  C  CB    . VAL A  1  559  ? 146.888 33.849  21.833  1.00 98.47  ? 559  VAL A CB    1 
ATOM   4339  C  CG1   . VAL A  1  559  ? 147.805 34.580  22.807  1.00 99.11  ? 559  VAL A CG1   1 
ATOM   4340  C  CG2   . VAL A  1  559  ? 147.704 33.067  20.808  1.00 98.17  ? 559  VAL A CG2   1 
ATOM   4341  N  N     . ILE A  1  560  ? 144.976 33.261  24.871  1.00 94.14  ? 560  ILE A N     1 
ATOM   4342  C  CA    . ILE A  1  560  ? 144.243 33.921  25.961  1.00 93.31  ? 560  ILE A CA    1 
ATOM   4343  C  C     . ILE A  1  560  ? 144.937 35.252  26.267  1.00 96.69  ? 560  ILE A C     1 
ATOM   4344  O  O     . ILE A  1  560  ? 146.098 35.238  26.692  1.00 97.41  ? 560  ILE A O     1 
ATOM   4345  C  CB    . ILE A  1  560  ? 144.167 33.060  27.265  1.00 97.35  ? 560  ILE A CB    1 
ATOM   4346  C  CG1   . ILE A  1  560  ? 143.614 31.645  27.026  1.00 97.24  ? 560  ILE A CG1   1 
ATOM   4347  C  CG2   . ILE A  1  560  ? 143.376 33.789  28.358  1.00 98.46  ? 560  ILE A CG2   1 
ATOM   4348  C  CD1   . ILE A  1  560  ? 143.980 30.602  28.141  1.00 104.15 ? 560  ILE A CD1   1 
ATOM   4349  N  N     . PRO A  1  561  ? 144.260 36.408  26.116  1.00 92.34  ? 561  PRO A N     1 
ATOM   4350  C  CA    . PRO A  1  561  ? 144.911 37.681  26.480  1.00 93.14  ? 561  PRO A CA    1 
ATOM   4351  C  C     . PRO A  1  561  ? 145.273 37.771  27.973  1.00 99.22  ? 561  PRO A C     1 
ATOM   4352  O  O     . PRO A  1  561  ? 144.669 37.079  28.805  1.00 98.64  ? 561  PRO A O     1 
ATOM   4353  C  CB    . PRO A  1  561  ? 143.868 38.734  26.097  1.00 93.56  ? 561  PRO A CB    1 
ATOM   4354  C  CG    . PRO A  1  561  ? 142.580 38.013  26.096  1.00 96.82  ? 561  PRO A CG    1 
ATOM   4355  C  CD    . PRO A  1  561  ? 142.888 36.631  25.626  1.00 92.27  ? 561  PRO A CD    1 
ATOM   4356  N  N     . THR A  1  562  ? 146.280 38.600  28.307  1.00 97.42  ? 562  THR A N     1 
ATOM   4357  C  CA    . THR A  1  562  ? 146.675 38.797  29.702  1.00 99.12  ? 562  THR A CA    1 
ATOM   4358  C  C     . THR A  1  562  ? 145.590 39.664  30.363  1.00 102.30 ? 562  THR A C     1 
ATOM   4359  O  O     . THR A  1  562  ? 145.274 40.723  29.806  1.00 101.48 ? 562  THR A O     1 
ATOM   4360  C  CB    . THR A  1  562  ? 148.101 39.386  29.814  1.00 110.76 ? 562  THR A CB    1 
ATOM   4361  O  OG1   . THR A  1  562  ? 149.031 38.429  29.310  1.00 112.68 ? 562  THR A OG1   1 
ATOM   4362  C  CG2   . THR A  1  562  ? 148.493 39.724  31.252  1.00 110.00 ? 562  THR A CG2   1 
ATOM   4363  N  N     . PRO A  1  563  ? 144.988 39.220  31.507  1.00 98.08  ? 563  PRO A N     1 
ATOM   4364  C  CA    . PRO A  1  563  ? 143.941 40.026  32.155  1.00 97.46  ? 563  PRO A CA    1 
ATOM   4365  C  C     . PRO A  1  563  ? 144.447 41.405  32.580  1.00 101.62 ? 563  PRO A C     1 
ATOM   4366  O  O     . PRO A  1  563  ? 145.611 41.515  32.985  1.00 102.26 ? 563  PRO A O     1 
ATOM   4367  C  CB    . PRO A  1  563  ? 143.549 39.168  33.369  1.00 100.00 ? 563  PRO A CB    1 
ATOM   4368  C  CG    . PRO A  1  563  ? 144.730 38.310  33.642  1.00 105.04 ? 563  PRO A CG    1 
ATOM   4369  C  CD    . PRO A  1  563  ? 145.252 37.988  32.280  1.00 99.94  ? 563  PRO A CD    1 
ATOM   4370  N  N     . ALA A  1  564  ? 143.591 42.456  32.470  1.00 97.09  ? 564  ALA A N     1 
ATOM   4371  C  CA    . ALA A  1  564  ? 143.962 43.823  32.877  1.00 97.53  ? 564  ALA A CA    1 
ATOM   4372  C  C     . ALA A  1  564  ? 144.330 43.819  34.339  1.00 102.36 ? 564  ALA A C     1 
ATOM   4373  O  O     . ALA A  1  564  ? 145.315 44.434  34.709  1.00 104.31 ? 564  ALA A O     1 
ATOM   4374  C  CB    . ALA A  1  564  ? 142.820 44.798  32.645  1.00 97.57  ? 564  ALA A CB    1 
ATOM   4375  N  N     . ILE A  1  565  ? 143.567 43.082  35.152  1.00 96.84  ? 565  ILE A N     1 
ATOM   4376  C  CA    . ILE A  1  565  ? 143.791 42.913  36.575  1.00 97.20  ? 565  ILE A CA    1 
ATOM   4377  C  C     . ILE A  1  565  ? 144.328 41.491  36.787  1.00 102.15 ? 565  ILE A C     1 
ATOM   4378  O  O     . ILE A  1  565  ? 143.722 40.511  36.337  1.00 100.55 ? 565  ILE A O     1 
ATOM   4379  C  CB    . ILE A  1  565  ? 142.472 43.224  37.324  1.00 99.53  ? 565  ILE A CB    1 
ATOM   4380  C  CG1   . ILE A  1  565  ? 142.319 44.721  37.533  1.00 100.28 ? 565  ILE A CG1   1 
ATOM   4381  C  CG2   . ILE A  1  565  ? 142.345 42.485  38.628  1.00 100.65 ? 565  ILE A CG2   1 
ATOM   4382  C  CD1   . ILE A  1  565  ? 140.952 45.207  37.312  1.00 107.35 ? 565  ILE A CD1   1 
ATOM   4383  N  N     . ILE A  1  566  ? 145.498 41.402  37.429  1.00 100.67 ? 566  ILE A N     1 
ATOM   4384  C  CA    . ILE A  1  566  ? 146.186 40.150  37.758  1.00 101.38 ? 566  ILE A CA    1 
ATOM   4385  C  C     . ILE A  1  566  ? 146.104 39.929  39.280  1.00 110.38 ? 566  ILE A C     1 
ATOM   4386  O  O     . ILE A  1  566  ? 145.802 38.813  39.712  1.00 110.19 ? 566  ILE A O     1 
ATOM   4387  C  CB    . ILE A  1  566  ? 147.644 40.173  37.205  1.00 103.87 ? 566  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A  1  566  ? 147.628 40.212  35.661  1.00 102.11 ? 566  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A  1  566  ? 148.461 38.981  37.707  1.00 104.85 ? 566  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A  1  566  ? 148.821 40.777  35.013  1.00 106.23 ? 566  ILE A CD1   1 
ATOM   4391  N  N     . LYS A  1  567  ? 146.308 41.040  40.054  1.00 110.69 ? 567  LYS A N     1 
ATOM   4392  C  CA    . LYS A  1  567  ? 146.354 41.268  41.515  1.00 113.26 ? 567  LYS A CA    1 
ATOM   4393  C  C     . LYS A  1  567  ? 145.658 40.198  42.378  1.00 118.86 ? 567  LYS A C     1 
ATOM   4394  O  O     . LYS A  1  567  ? 146.233 39.105  42.435  1.00 119.87 ? 567  LYS A O     1 
ATOM   4395  C  CB    . LYS A  1  567  ? 145.869 42.672  41.901  1.00 117.18 ? 567  LYS A CB    1 
ATOM   4396  C  CG    . LYS A  1  567  ? 144.787 43.315  41.040  1.00 149.94 ? 567  LYS A CG    1 
ATOM   4397  C  CD    . LYS A  1  567  ? 143.910 44.239  41.898  1.00 171.08 ? 567  LYS A CD    1 
ATOM   4398  C  CE    . LYS A  1  567  ? 142.569 44.546  41.282  1.00 191.70 ? 567  LYS A CE    1 
ATOM   4399  N  NZ    . LYS A  1  567  ? 141.745 45.447  42.126  1.00 205.43 ? 567  LYS A NZ    1 
ATOM   4400  N  N     . PRO A  1  568  ? 144.523 40.415  43.118  1.00 115.02 ? 568  PRO A N     1 
ATOM   4401  C  CA    . PRO A  1  568  ? 143.985 39.310  43.911  1.00 115.44 ? 568  PRO A CA    1 
ATOM   4402  C  C     . PRO A  1  568  ? 143.234 38.301  43.048  1.00 117.42 ? 568  PRO A C     1 
ATOM   4403  O  O     . PRO A  1  568  ? 143.331 37.101  43.305  1.00 118.49 ? 568  PRO A O     1 
ATOM   4404  C  CB    . PRO A  1  568  ? 143.052 40.020  44.900  1.00 117.75 ? 568  PRO A CB    1 
ATOM   4405  C  CG    . PRO A  1  568  ? 143.249 41.491  44.699  1.00 121.35 ? 568  PRO A CG    1 
ATOM   4406  C  CD    . PRO A  1  568  ? 143.659 41.596  43.295  1.00 115.29 ? 568  PRO A CD    1 
ATOM   4407  N  N     . LYS A  1  569  ? 142.527 38.784  42.005  1.00 110.52 ? 569  LYS A N     1 
ATOM   4408  C  CA    . LYS A  1  569  ? 141.723 37.958  41.117  1.00 107.79 ? 569  LYS A CA    1 
ATOM   4409  C  C     . LYS A  1  569  ? 142.083 38.231  39.664  1.00 109.45 ? 569  LYS A C     1 
ATOM   4410  O  O     . LYS A  1  569  ? 142.052 39.396  39.275  1.00 108.64 ? 569  LYS A O     1 
ATOM   4411  C  CB    . LYS A  1  569  ? 140.229 38.283  41.352  1.00 108.60 ? 569  LYS A CB    1 
ATOM   4412  C  CG    . LYS A  1  569  ? 139.263 37.163  40.994  1.00 109.36 ? 569  LYS A CG    1 
ATOM   4413  C  CD    . LYS A  1  569  ? 137.816 37.544  41.301  1.00 112.50 ? 569  LYS A CD    1 
ATOM   4414  C  CE    . LYS A  1  569  ? 136.805 36.581  40.714  1.00 123.64 ? 569  LYS A CE    1 
ATOM   4415  N  NZ    . LYS A  1  569  ? 136.750 35.265  41.422  1.00 132.96 ? 569  LYS A NZ    1 
ATOM   4416  N  N     . PRO A  1  570  ? 142.381 37.203  38.826  1.00 104.57 ? 570  PRO A N     1 
ATOM   4417  C  CA    . PRO A  1  570  ? 142.597 37.473  37.392  1.00 102.48 ? 570  PRO A CA    1 
ATOM   4418  C  C     . PRO A  1  570  ? 141.267 37.911  36.780  1.00 103.16 ? 570  PRO A C     1 
ATOM   4419  O  O     . PRO A  1  570  ? 140.285 37.154  36.793  1.00 101.30 ? 570  PRO A O     1 
ATOM   4420  C  CB    . PRO A  1  570  ? 143.088 36.132  36.830  1.00 103.90 ? 570  PRO A CB    1 
ATOM   4421  C  CG    . PRO A  1  570  ? 142.570 35.119  37.752  1.00 109.41 ? 570  PRO A CG    1 
ATOM   4422  C  CD    . PRO A  1  570  ? 142.442 35.759  39.117  1.00 106.60 ? 570  PRO A CD    1 
ATOM   4423  N  N     . LEU A  1  571  ? 141.218 39.179  36.346  1.00 98.73  ? 571  LEU A N     1 
ATOM   4424  C  CA    . LEU A  1  571  ? 140.011 39.789  35.801  1.00 97.29  ? 571  LEU A CA    1 
ATOM   4425  C  C     . LEU A  1  571  ? 140.263 40.520  34.478  1.00 102.07 ? 571  LEU A C     1 
ATOM   4426  O  O     . LEU A  1  571  ? 141.188 41.330  34.379  1.00 102.89 ? 571  LEU A O     1 
ATOM   4427  C  CB    . LEU A  1  571  ? 139.412 40.735  36.852  1.00 97.58  ? 571  LEU A CB    1 
ATOM   4428  C  CG    . LEU A  1  571  ? 137.990 40.466  37.326  1.00 101.28 ? 571  LEU A CG    1 
ATOM   4429  C  CD1   . LEU A  1  571  ? 137.793 39.025  37.774  1.00 101.62 ? 571  LEU A CD1   1 
ATOM   4430  C  CD2   . LEU A  1  571  ? 137.636 41.387  38.471  1.00 104.45 ? 571  LEU A CD2   1 
ATOM   4431  N  N     . TRP A  1  572  ? 139.444 40.208  33.460  1.00 97.09  ? 572  TRP A N     1 
ATOM   4432  C  CA    . TRP A  1  572  ? 139.505 40.792  32.122  1.00 95.37  ? 572  TRP A CA    1 
ATOM   4433  C  C     . TRP A  1  572  ? 138.413 41.832  32.007  1.00 98.04  ? 572  TRP A C     1 
ATOM   4434  O  O     . TRP A  1  572  ? 137.335 41.636  32.550  1.00 97.24  ? 572  TRP A O     1 
ATOM   4435  C  CB    . TRP A  1  572  ? 139.238 39.713  31.065  1.00 92.98  ? 572  TRP A CB    1 
ATOM   4436  C  CG    . TRP A  1  572  ? 140.345 38.728  30.866  1.00 94.38  ? 572  TRP A CG    1 
ATOM   4437  C  CD1   . TRP A  1  572  ? 141.174 38.637  29.785  1.00 96.84  ? 572  TRP A CD1   1 
ATOM   4438  C  CD2   . TRP A  1  572  ? 140.696 37.640  31.735  1.00 95.19  ? 572  TRP A CD2   1 
ATOM   4439  N  NE1   . TRP A  1  572  ? 142.043 37.579  29.940  1.00 97.14  ? 572  TRP A NE1   1 
ATOM   4440  C  CE2   . TRP A  1  572  ? 141.773 36.950  31.130  1.00 99.27  ? 572  TRP A CE2   1 
ATOM   4441  C  CE3   . TRP A  1  572  ? 140.219 37.192  32.980  1.00 97.21  ? 572  TRP A CE3   1 
ATOM   4442  C  CZ2   . TRP A  1  572  ? 142.377 35.837  31.724  1.00 99.23  ? 572  TRP A CZ2   1 
ATOM   4443  C  CZ3   . TRP A  1  572  ? 140.831 36.100  33.575  1.00 99.65  ? 572  TRP A CZ3   1 
ATOM   4444  C  CH2   . TRP A  1  572  ? 141.893 35.434  32.949  1.00 100.29 ? 572  TRP A CH2   1 
ATOM   4445  N  N     . SER A  1  573  ? 138.656 42.917  31.285  1.00 94.80  ? 573  SER A N     1 
ATOM   4446  C  CA    . SER A  1  573  ? 137.600 43.905  31.099  1.00 94.56  ? 573  SER A CA    1 
ATOM   4447  C  C     . SER A  1  573  ? 136.735 43.506  29.884  1.00 98.79  ? 573  SER A C     1 
ATOM   4448  O  O     . SER A  1  573  ? 137.089 42.578  29.136  1.00 98.10  ? 573  SER A O     1 
ATOM   4449  C  CB    . SER A  1  573  ? 138.188 45.300  30.923  1.00 97.43  ? 573  SER A CB    1 
ATOM   4450  O  OG    . SER A  1  573  ? 138.463 45.575  29.560  1.00 102.71 ? 573  SER A OG    1 
ATOM   4451  N  N     . GLY A  1  574  ? 135.606 44.196  29.716  1.00 94.82  ? 574  GLY A N     1 
ATOM   4452  C  CA    . GLY A  1  574  ? 134.701 43.957  28.599  1.00 92.67  ? 574  GLY A CA    1 
ATOM   4453  C  C     . GLY A  1  574  ? 135.375 44.410  27.327  1.00 93.98  ? 574  GLY A C     1 
ATOM   4454  O  O     . GLY A  1  574  ? 135.442 43.653  26.354  1.00 93.15  ? 574  GLY A O     1 
ATOM   4455  N  N     . LYS A  1  575  ? 135.965 45.625  27.378  1.00 88.53  ? 575  LYS A N     1 
ATOM   4456  C  CA    . LYS A  1  575  ? 136.719 46.236  26.283  1.00 86.65  ? 575  LYS A CA    1 
ATOM   4457  C  C     . LYS A  1  575  ? 137.791 45.247  25.808  1.00 90.72  ? 575  LYS A C     1 
ATOM   4458  O  O     . LYS A  1  575  ? 137.888 44.966  24.613  1.00 90.79  ? 575  LYS A O     1 
ATOM   4459  C  CB    . LYS A  1  575  ? 137.371 47.556  26.737  1.00 88.29  ? 575  LYS A CB    1 
ATOM   4460  C  CG    . LYS A  1  575  ? 136.389 48.596  27.252  1.00 87.79  ? 575  LYS A CG    1 
ATOM   4461  C  CD    . LYS A  1  575  ? 137.073 49.916  27.526  1.00 89.92  ? 575  LYS A CD    1 
ATOM   4462  C  CE    . LYS A  1  575  ? 136.104 51.028  27.829  1.00 92.51  ? 575  LYS A CE    1 
ATOM   4463  N  NZ    . LYS A  1  575  ? 135.547 50.922  29.201  1.00 103.10 ? 575  LYS A NZ    1 
ATOM   4464  N  N     . GLN A  1  576  ? 138.520 44.655  26.762  1.00 86.26  ? 576  GLN A N     1 
ATOM   4465  C  CA    . GLN A  1  576  ? 139.568 43.681  26.523  1.00 85.33  ? 576  GLN A CA    1 
ATOM   4466  C  C     . GLN A  1  576  ? 139.091 42.526  25.644  1.00 86.73  ? 576  GLN A C     1 
ATOM   4467  O  O     . GLN A  1  576  ? 139.648 42.307  24.562  1.00 85.47  ? 576  GLN A O     1 
ATOM   4468  C  CB    . GLN A  1  576  ? 140.057 43.130  27.868  1.00 87.70  ? 576  GLN A CB    1 
ATOM   4469  C  CG    . GLN A  1  576  ? 141.555 43.173  28.084  1.00 92.52  ? 576  GLN A CG    1 
ATOM   4470  C  CD    . GLN A  1  576  ? 141.889 42.566  29.420  1.00 111.53 ? 576  GLN A CD    1 
ATOM   4471  O  OE1   . GLN A  1  576  ? 141.424 43.010  30.473  1.00 105.35 ? 576  GLN A OE1   1 
ATOM   4472  N  NE2   . GLN A  1  576  ? 142.650 41.495  29.398  1.00 108.42 ? 576  GLN A NE2   1 
ATOM   4473  N  N     . ILE A  1  577  ? 138.054 41.803  26.090  1.00 82.29  ? 577  ILE A N     1 
ATOM   4474  C  CA    . ILE A  1  577  ? 137.620 40.630  25.344  1.00 80.87  ? 577  ILE A CA    1 
ATOM   4475  C  C     . ILE A  1  577  ? 136.743 41.032  24.090  1.00 83.26  ? 577  ILE A C     1 
ATOM   4476  O  O     . ILE A  1  577  ? 136.723 40.267  23.121  1.00 82.47  ? 577  ILE A O     1 
ATOM   4477  C  CB    . ILE A  1  577  ? 137.011 39.492  26.239  1.00 83.76  ? 577  ILE A CB    1 
ATOM   4478  C  CG1   . ILE A  1  577  ? 135.507 39.591  26.381  1.00 83.91  ? 577  ILE A CG1   1 
ATOM   4479  C  CG2   . ILE A  1  577  ? 137.678 39.369  27.607  1.00 84.50  ? 577  ILE A CG2   1 
ATOM   4480  C  CD1   . ILE A  1  577  ? 134.888 38.627  25.520  1.00 91.59  ? 577  ILE A CD1   1 
ATOM   4481  N  N     . LEU A  1  578  ? 136.090 42.214  24.070  1.00 78.89  ? 578  LEU A N     1 
ATOM   4482  C  CA    . LEU A  1  578  ? 135.375 42.639  22.854  1.00 77.71  ? 578  LEU A CA    1 
ATOM   4483  C  C     . LEU A  1  578  ? 136.406 42.916  21.734  1.00 82.41  ? 578  LEU A C     1 
ATOM   4484  O  O     . LEU A  1  578  ? 136.129 42.651  20.563  1.00 81.64  ? 578  LEU A O     1 
ATOM   4485  C  CB    . LEU A  1  578  ? 134.490 43.895  23.072  1.00 77.52  ? 578  LEU A CB    1 
ATOM   4486  C  CG    . LEU A  1  578  ? 133.979 44.610  21.786  1.00 80.11  ? 578  LEU A CG    1 
ATOM   4487  C  CD1   . LEU A  1  578  ? 132.970 43.768  21.015  1.00 78.46  ? 578  LEU A CD1   1 
ATOM   4488  C  CD2   . LEU A  1  578  ? 133.410 45.947  22.090  1.00 81.64  ? 578  LEU A CD2   1 
ATOM   4489  N  N     . SER A  1  579  ? 137.595 43.425  22.113  1.00 79.26  ? 579  SER A N     1 
ATOM   4490  C  CA    . SER A  1  579  ? 138.692 43.738  21.206  1.00 79.03  ? 579  SER A CA    1 
ATOM   4491  C  C     . SER A  1  579  ? 139.207 42.529  20.405  1.00 83.69  ? 579  SER A C     1 
ATOM   4492  O  O     . SER A  1  579  ? 139.827 42.706  19.337  1.00 83.20  ? 579  SER A O     1 
ATOM   4493  C  CB    . SER A  1  579  ? 139.821 44.407  21.975  1.00 82.87  ? 579  SER A CB    1 
ATOM   4494  O  OG    . SER A  1  579  ? 139.376 45.662  22.460  1.00 90.05  ? 579  SER A OG    1 
ATOM   4495  N  N     . VAL A  1  580  ? 138.934 41.303  20.920  1.00 80.18  ? 580  VAL A N     1 
ATOM   4496  C  CA    . VAL A  1  580  ? 139.313 40.043  20.281  1.00 80.11  ? 580  VAL A CA    1 
ATOM   4497  C  C     . VAL A  1  580  ? 138.559 39.942  18.927  1.00 85.83  ? 580  VAL A C     1 
ATOM   4498  O  O     . VAL A  1  580  ? 139.152 39.500  17.936  1.00 86.81  ? 580  VAL A O     1 
ATOM   4499  C  CB    . VAL A  1  580  ? 139.131 38.795  21.209  1.00 83.72  ? 580  VAL A CB    1 
ATOM   4500  C  CG1   . VAL A  1  580  ? 139.676 37.530  20.561  1.00 82.93  ? 580  VAL A CG1   1 
ATOM   4501  C  CG2   . VAL A  1  580  ? 139.814 39.004  22.553  1.00 84.84  ? 580  VAL A CG2   1 
ATOM   4502  N  N     . ALA A  1  581  ? 137.293 40.434  18.874  1.00 81.05  ? 581  ALA A N     1 
ATOM   4503  C  CA    . ALA A  1  581  ? 136.476 40.447  17.658  1.00 79.78  ? 581  ALA A CA    1 
ATOM   4504  C  C     . ALA A  1  581  ? 136.980 41.446  16.614  1.00 85.58  ? 581  ALA A C     1 
ATOM   4505  O  O     . ALA A  1  581  ? 136.789 41.192  15.414  1.00 85.45  ? 581  ALA A O     1 
ATOM   4506  C  CB    . ALA A  1  581  ? 135.029 40.746  17.993  1.00 79.98  ? 581  ALA A CB    1 
ATOM   4507  N  N     . ILE A  1  582  ? 137.608 42.578  17.073  1.00 82.80  ? 582  ILE A N     1 
ATOM   4508  C  CA    . ILE A  1  582  ? 138.162 43.671  16.243  1.00 82.22  ? 582  ILE A CA    1 
ATOM   4509  C  C     . ILE A  1  582  ? 139.507 43.228  15.658  1.00 88.33  ? 582  ILE A C     1 
ATOM   4510  O  O     . ILE A  1  582  ? 140.408 42.855  16.437  1.00 89.42  ? 582  ILE A O     1 
ATOM   4511  C  CB    . ILE A  1  582  ? 138.275 45.047  16.991  1.00 85.28  ? 582  ILE A CB    1 
ATOM   4512  C  CG1   . ILE A  1  582  ? 136.947 45.434  17.657  1.00 84.82  ? 582  ILE A CG1   1 
ATOM   4513  C  CG2   . ILE A  1  582  ? 138.743 46.171  16.040  1.00 85.17  ? 582  ILE A CG2   1 
ATOM   4514  C  CD1   . ILE A  1  582  ? 137.051 46.365  18.773  1.00 90.65  ? 582  ILE A CD1   1 
ATOM   4515  N  N     . PRO A  1  583  ? 139.653 43.268  14.297  1.00 84.94  ? 583  PRO A N     1 
ATOM   4516  C  CA    . PRO A  1  583  ? 140.910 42.808  13.675  1.00 85.65  ? 583  PRO A CA    1 
ATOM   4517  C  C     . PRO A  1  583  ? 142.086 43.765  13.841  1.00 92.69  ? 583  PRO A C     1 
ATOM   4518  O  O     . PRO A  1  583  ? 141.881 44.955  14.105  1.00 93.25  ? 583  PRO A O     1 
ATOM   4519  C  CB    . PRO A  1  583  ? 140.530 42.586  12.203  1.00 85.97  ? 583  PRO A CB    1 
ATOM   4520  C  CG    . PRO A  1  583  ? 139.394 43.477  11.964  1.00 89.32  ? 583  PRO A CG    1 
ATOM   4521  C  CD    . PRO A  1  583  ? 138.667 43.667  13.270  1.00 85.24  ? 583  PRO A CD    1 
ATOM   4522  N  N     . ASN A  1  584  ? 143.319 43.233  13.684  1.00 89.78  ? 584  ASN A N     1 
ATOM   4523  C  CA    . ASN A  1  584  ? 144.565 43.987  13.800  1.00 90.29  ? 584  ASN A CA    1 
ATOM   4524  C  C     . ASN A  1  584  ? 144.682 45.049  12.719  1.00 94.33  ? 584  ASN A C     1 
ATOM   4525  O  O     . ASN A  1  584  ? 144.075 44.905  11.652  1.00 93.64  ? 584  ASN A O     1 
ATOM   4526  C  CB    . ASN A  1  584  ? 145.755 43.040  13.764  1.00 90.39  ? 584  ASN A CB    1 
ATOM   4527  C  CG    . ASN A  1  584  ? 145.879 42.217  15.015  1.00 116.35 ? 584  ASN A CG    1 
ATOM   4528  O  OD1   . ASN A  1  584  ? 145.626 42.686  16.138  1.00 115.79 ? 584  ASN A OD1   1 
ATOM   4529  N  ND2   . ASN A  1  584  ? 146.285 40.969  14.852  1.00 107.57 ? 584  ASN A ND2   1 
ATOM   4530  N  N     . GLY A  1  585  ? 145.430 46.109  13.017  1.00 91.31  ? 585  GLY A N     1 
ATOM   4531  C  CA    . GLY A  1  585  ? 145.647 47.224  12.103  1.00 91.13  ? 585  GLY A CA    1 
ATOM   4532  C  C     . GLY A  1  585  ? 144.404 48.042  11.826  1.00 94.64  ? 585  GLY A C     1 
ATOM   4533  O  O     . GLY A  1  585  ? 144.209 48.520  10.698  1.00 94.04  ? 585  GLY A O     1 
ATOM   4534  N  N     . ILE A  1  586  ? 143.541 48.181  12.859  1.00 90.73  ? 586  ILE A N     1 
ATOM   4535  C  CA    . ILE A  1  586  ? 142.297 48.955  12.806  1.00 89.55  ? 586  ILE A CA    1 
ATOM   4536  C  C     . ILE A  1  586  ? 142.421 50.107  13.803  1.00 94.20  ? 586  ILE A C     1 
ATOM   4537  O  O     . ILE A  1  586  ? 142.348 49.897  15.012  1.00 93.60  ? 586  ILE A O     1 
ATOM   4538  C  CB    . ILE A  1  586  ? 141.001 48.070  12.964  1.00 91.14  ? 586  ILE A CB    1 
ATOM   4539  C  CG1   . ILE A  1  586  ? 140.790 47.111  11.764  1.00 89.74  ? 586  ILE A CG1   1 
ATOM   4540  C  CG2   . ILE A  1  586  ? 139.738 48.903  13.223  1.00 91.27  ? 586  ILE A CG2   1 
ATOM   4541  C  CD1   . ILE A  1  586  ? 140.496 47.773  10.389  1.00 93.65  ? 586  ILE A CD1   1 
ATOM   4542  N  N     . HIS A  1  587  ? 142.699 51.306  13.285  1.00 92.33  ? 587  HIS A N     1 
ATOM   4543  C  CA    . HIS A  1  587  ? 142.867 52.500  14.103  1.00 93.68  ? 587  HIS A CA    1 
ATOM   4544  C  C     . HIS A  1  587  ? 141.654 53.424  13.946  1.00 95.30  ? 587  HIS A C     1 
ATOM   4545  O  O     . HIS A  1  587  ? 141.254 53.746  12.823  1.00 94.66  ? 587  HIS A O     1 
ATOM   4546  C  CB    . HIS A  1  587  ? 144.199 53.218  13.776  1.00 96.12  ? 587  HIS A CB    1 
ATOM   4547  C  CG    . HIS A  1  587  ? 144.606 54.256  14.787  1.00 101.24 ? 587  HIS A CG    1 
ATOM   4548  N  ND1   . HIS A  1  587  ? 143.993 55.506  14.840  1.00 103.27 ? 587  HIS A ND1   1 
ATOM   4549  C  CD2   . HIS A  1  587  ? 145.561 54.202  15.746  1.00 104.39 ? 587  HIS A CD2   1 
ATOM   4550  C  CE1   . HIS A  1  587  ? 144.575 56.153  15.839  1.00 103.82 ? 587  HIS A CE1   1 
ATOM   4551  N  NE2   . HIS A  1  587  ? 145.530 55.416  16.409  1.00 104.88 ? 587  HIS A NE2   1 
ATOM   4552  N  N     . LEU A  1  588  ? 141.059 53.828  15.078  1.00 90.19  ? 588  LEU A N     1 
ATOM   4553  C  CA    . LEU A  1  588  ? 139.897 54.705  15.121  1.00 88.73  ? 588  LEU A CA    1 
ATOM   4554  C  C     . LEU A  1  588  ? 140.010 55.615  16.336  1.00 95.03  ? 588  LEU A C     1 
ATOM   4555  O  O     . LEU A  1  588  ? 140.250 55.127  17.438  1.00 95.71  ? 588  LEU A O     1 
ATOM   4556  C  CB    . LEU A  1  588  ? 138.634 53.850  15.216  1.00 87.35  ? 588  LEU A CB    1 
ATOM   4557  C  CG    . LEU A  1  588  ? 137.332 54.554  14.936  1.00 91.54  ? 588  LEU A CG    1 
ATOM   4558  C  CD1   . LEU A  1  588  ? 136.520 53.785  13.953  1.00 91.19  ? 588  LEU A CD1   1 
ATOM   4559  C  CD2   . LEU A  1  588  ? 136.523 54.702  16.178  1.00 94.22  ? 588  LEU A CD2   1 
ATOM   4560  N  N     . GLN A  1  589  ? 139.851 56.927  16.139  1.00 92.76  ? 589  GLN A N     1 
ATOM   4561  C  CA    . GLN A  1  589  ? 139.894 57.919  17.214  1.00 94.55  ? 589  GLN A CA    1 
ATOM   4562  C  C     . GLN A  1  589  ? 138.688 58.842  17.036  1.00 100.30 ? 589  GLN A C     1 
ATOM   4563  O  O     . GLN A  1  589  ? 138.503 59.334  15.919  1.00 100.08 ? 589  GLN A O     1 
ATOM   4564  C  CB    . GLN A  1  589  ? 141.210 58.708  17.166  1.00 97.15  ? 589  GLN A CB    1 
ATOM   4565  C  CG    . GLN A  1  589  ? 141.472 59.536  18.422  1.00 116.03 ? 589  GLN A CG    1 
ATOM   4566  C  CD    . GLN A  1  589  ? 142.653 60.445  18.248  1.00 135.19 ? 589  GLN A CD    1 
ATOM   4567  O  OE1   . GLN A  1  589  ? 142.518 61.586  17.781  1.00 130.61 ? 589  GLN A OE1   1 
ATOM   4568  N  NE2   . GLN A  1  589  ? 143.836 59.948  18.603  1.00 126.44 ? 589  GLN A NE2   1 
ATOM   4569  N  N     . ARG A  1  590  ? 137.859 59.068  18.105  1.00 97.85  ? 590  ARG A N     1 
ATOM   4570  C  CA    . ARG A  1  590  ? 136.635 59.870  17.978  1.00 97.90  ? 590  ARG A CA    1 
ATOM   4571  C  C     . ARG A  1  590  ? 136.648 61.235  18.679  1.00 106.02 ? 590  ARG A C     1 
ATOM   4572  O  O     . ARG A  1  590  ? 136.700 62.262  17.972  1.00 107.22 ? 590  ARG A O     1 
ATOM   4573  C  CB    . ARG A  1  590  ? 135.387 59.079  18.398  1.00 95.93  ? 590  ARG A CB    1 
ATOM   4574  C  CG    . ARG A  1  590  ? 134.045 59.805  18.164  1.00 98.48  ? 590  ARG A CG    1 
ATOM   4575  C  CD    . ARG A  1  590  ? 132.938 58.890  17.658  1.00 109.24 ? 590  ARG A CD    1 
ATOM   4576  N  NE    . ARG A  1  590  ? 132.788 57.653  18.437  1.00 117.20 ? 590  ARG A NE    1 
ATOM   4577  C  CZ    . ARG A  1  590  ? 132.081 57.562  19.556  1.00 128.56 ? 590  ARG A CZ    1 
ATOM   4578  N  NH1   . ARG A  1  590  ? 131.453 58.625  20.039  1.00 114.66 ? 590  ARG A NH1   1 
ATOM   4579  N  NH2   . ARG A  1  590  ? 131.995 56.410  20.201  1.00 114.21 ? 590  ARG A NH2   1 
ATOM   4580  N  N     . PHE A  1  591  ? 136.507 61.273  20.022  1.00 103.43 ? 591  PHE A N     1 
ATOM   4581  C  CA    . PHE A  1  591  ? 136.397 62.542  20.771  1.00 105.03 ? 591  PHE A CA    1 
ATOM   4582  C  C     . PHE A  1  591  ? 134.975 63.101  20.681  1.00 109.56 ? 591  PHE A C     1 
ATOM   4583  O  O     . PHE A  1  591  ? 134.547 63.594  19.630  1.00 106.66 ? 591  PHE A O     1 
ATOM   4584  C  CB    . PHE A  1  591  ? 137.430 63.628  20.353  1.00 107.34 ? 591  PHE A CB    1 
ATOM   4585  C  CG    . PHE A  1  591  ? 138.813 63.505  20.939  1.00 109.83 ? 591  PHE A CG    1 
ATOM   4586  C  CD1   . PHE A  1  591  ? 139.759 62.665  20.361  1.00 112.05 ? 591  PHE A CD1   1 
ATOM   4587  C  CD2   . PHE A  1  591  ? 139.185 64.257  22.043  1.00 114.50 ? 591  PHE A CD2   1 
ATOM   4588  C  CE1   . PHE A  1  591  ? 141.039 62.543  20.907  1.00 115.90 ? 591  PHE A CE1   1 
ATOM   4589  C  CE2   . PHE A  1  591  ? 140.469 64.146  22.582  1.00 116.72 ? 591  PHE A CE2   1 
ATOM   4590  C  CZ    . PHE A  1  591  ? 141.387 63.287  22.012  1.00 115.44 ? 591  PHE A CZ    1 
ATOM   4591  N  N     . ASP A  1  592  ? 134.248 62.991  21.801  1.00 109.42 ? 592  ASP A N     1 
ATOM   4592  C  CA    . ASP A  1  592  ? 132.887 63.479  21.976  1.00 110.09 ? 592  ASP A CA    1 
ATOM   4593  C  C     . ASP A  1  592  ? 132.949 64.799  22.763  1.00 116.67 ? 592  ASP A C     1 
ATOM   4594  O  O     . ASP A  1  592  ? 133.659 65.707  22.331  1.00 117.42 ? 592  ASP A O     1 
ATOM   4595  C  CB    . ASP A  1  592  ? 131.998 62.415  22.663  1.00 111.91 ? 592  ASP A CB    1 
ATOM   4596  C  CG    . ASP A  1  592  ? 131.647 61.199  21.818  1.00 123.15 ? 592  ASP A CG    1 
ATOM   4597  O  OD1   . ASP A  1  592  ? 131.490 61.355  20.579  1.00 123.55 ? 592  ASP A OD1   1 
ATOM   4598  O  OD2   . ASP A  1  592  ? 131.451 60.106  22.402  1.00 128.26 ? 592  ASP A OD2   1 
ATOM   4599  N  N     . GLU A  1  593  ? 132.238 64.913  23.899  1.00 114.10 ? 593  GLU A N     1 
ATOM   4600  C  CA    . GLU A  1  593  ? 132.216 66.130  24.688  1.00 115.60 ? 593  GLU A CA    1 
ATOM   4601  C  C     . GLU A  1  593  ? 133.526 66.342  25.447  1.00 122.56 ? 593  GLU A C     1 
ATOM   4602  O  O     . GLU A  1  593  ? 134.505 66.806  24.852  1.00 123.22 ? 593  GLU A O     1 
ATOM   4603  C  CB    . GLU A  1  593  ? 130.977 66.174  25.594  1.00 117.46 ? 593  GLU A CB    1 
ATOM   4604  C  CG    . GLU A  1  593  ? 130.488 67.586  25.904  1.00 133.87 ? 593  GLU A CG    1 
ATOM   4605  C  CD    . GLU A  1  593  ? 129.928 68.438  24.772  1.00 161.24 ? 593  GLU A CD    1 
ATOM   4606  O  OE1   . GLU A  1  593  ? 129.550 67.876  23.716  1.00 152.39 ? 593  GLU A OE1   1 
ATOM   4607  O  OE2   . GLU A  1  593  ? 129.848 69.675  24.956  1.00 161.02 ? 593  GLU A OE2   1 
ATOM   4608  N  N     . GLY A  1  594  ? 133.558 65.986  26.726  1.00 120.55 ? 594  GLY A N     1 
ATOM   4609  C  CA    . GLY A  1  594  ? 134.752 66.158  27.547  1.00 122.04 ? 594  GLY A CA    1 
ATOM   4610  C  C     . GLY A  1  594  ? 135.828 65.111  27.325  1.00 126.24 ? 594  GLY A C     1 
ATOM   4611  O  O     . GLY A  1  594  ? 136.437 64.650  28.296  1.00 127.91 ? 594  GLY A O     1 
ATOM   4612  N  N     . THR A  1  595  ? 136.071 64.716  26.052  1.00 119.71 ? 595  THR A N     1 
ATOM   4613  C  CA    . THR A  1  595  ? 137.076 63.705  25.722  1.00 117.75 ? 595  THR A CA    1 
ATOM   4614  C  C     . THR A  1  595  ? 138.422 64.385  25.728  1.00 120.83 ? 595  THR A C     1 
ATOM   4615  O  O     . THR A  1  595  ? 138.595 65.403  25.048  1.00 119.70 ? 595  THR A O     1 
ATOM   4616  C  CB    . THR A  1  595  ? 136.723 62.970  24.445  1.00 116.50 ? 595  THR A CB    1 
ATOM   4617  O  OG1   . THR A  1  595  ? 135.310 62.810  24.378  1.00 109.05 ? 595  THR A OG1   1 
ATOM   4618  C  CG2   . THR A  1  595  ? 137.395 61.622  24.364  1.00 114.22 ? 595  THR A CG2   1 
ATOM   4619  N  N     . THR A  1  596  ? 139.345 63.870  26.566  1.00 117.96 ? 596  THR A N     1 
ATOM   4620  C  CA    . THR A  1  596  ? 140.643 64.498  26.814  1.00 119.06 ? 596  THR A CA    1 
ATOM   4621  C  C     . THR A  1  596  ? 141.855 63.571  26.753  1.00 123.57 ? 596  THR A C     1 
ATOM   4622  O  O     . THR A  1  596  ? 142.823 63.833  27.481  1.00 126.18 ? 596  THR A O     1 
ATOM   4623  C  CB    . THR A  1  596  ? 140.630 65.166  28.218  1.00 127.78 ? 596  THR A CB    1 
ATOM   4624  O  OG1   . THR A  1  596  ? 140.321 64.187  29.216  1.00 126.11 ? 596  THR A OG1   1 
ATOM   4625  C  CG2   . THR A  1  596  ? 139.688 66.359  28.317  1.00 127.32 ? 596  THR A CG2   1 
ATOM   4626  N  N     . LEU A  1  597  ? 141.840 62.501  25.924  1.00 116.87 ? 597  LEU A N     1 
ATOM   4627  C  CA    . LEU A  1  597  ? 142.960 61.534  25.841  1.00 116.13 ? 597  LEU A CA    1 
ATOM   4628  C  C     . LEU A  1  597  ? 143.119 60.789  27.164  1.00 120.23 ? 597  LEU A C     1 
ATOM   4629  O  O     . LEU A  1  597  ? 144.043 59.996  27.338  1.00 120.13 ? 597  LEU A O     1 
ATOM   4630  C  CB    . LEU A  1  597  ? 144.305 62.197  25.459  1.00 116.89 ? 597  LEU A CB    1 
ATOM   4631  C  CG    . LEU A  1  597  ? 144.911 61.859  24.105  1.00 121.05 ? 597  LEU A CG    1 
ATOM   4632  C  CD1   . LEU A  1  597  ? 146.119 62.725  23.844  1.00 122.26 ? 597  LEU A CD1   1 
ATOM   4633  C  CD2   . LEU A  1  597  ? 145.309 60.395  24.010  1.00 123.79 ? 597  LEU A CD2   1 
ATOM   4634  N  N     . LEU A  1  598  ? 142.229 61.094  28.104  1.00 117.35 ? 598  LEU A N     1 
ATOM   4635  C  CA    . LEU A  1  598  ? 142.134 60.517  29.432  1.00 118.22 ? 598  LEU A CA    1 
ATOM   4636  C  C     . LEU A  1  598  ? 140.651 60.406  29.756  1.00 122.52 ? 598  LEU A C     1 
ATOM   4637  O  O     . LEU A  1  598  ? 140.314 60.185  30.924  1.00 122.99 ? 598  LEU A O     1 
ATOM   4638  C  CB    . LEU A  1  598  ? 142.823 61.422  30.471  1.00 119.86 ? 598  LEU A CB    1 
ATOM   4639  C  CG    . LEU A  1  598  ? 143.877 60.795  31.401  1.00 125.83 ? 598  LEU A CG    1 
ATOM   4640  C  CD1   . LEU A  1  598  ? 144.012 61.601  32.673  1.00 127.79 ? 598  LEU A CD1   1 
ATOM   4641  C  CD2   . LEU A  1  598  ? 143.564 59.354  31.761  1.00 127.56 ? 598  LEU A CD2   1 
ATOM   4642  N  N     . SER A  1  599  ? 139.770 60.541  28.703  1.00 117.73 ? 599  SER A N     1 
ATOM   4643  C  CA    . SER A  1  599  ? 138.298 60.510  28.750  1.00 116.27 ? 599  SER A CA    1 
ATOM   4644  C  C     . SER A  1  599  ? 137.786 60.061  30.113  1.00 118.89 ? 599  SER A C     1 
ATOM   4645  O  O     . SER A  1  599  ? 137.675 58.858  30.386  1.00 117.89 ? 599  SER A O     1 
ATOM   4646  C  CB    . SER A  1  599  ? 137.701 59.693  27.607  1.00 117.91 ? 599  SER A CB    1 
ATOM   4647  O  OG    . SER A  1  599  ? 137.907 58.303  27.787  1.00 126.35 ? 599  SER A OG    1 
ATOM   4648  N  N     . PRO A  1  600  ? 137.632 61.047  31.030  1.00 114.59 ? 600  PRO A N     1 
ATOM   4649  C  CA    . PRO A  1  600  ? 137.230 60.715  32.407  1.00 114.64 ? 600  PRO A CA    1 
ATOM   4650  C  C     . PRO A  1  600  ? 135.808 60.163  32.507  1.00 114.92 ? 600  PRO A C     1 
ATOM   4651  O  O     . PRO A  1  600  ? 135.476 59.452  33.466  1.00 115.52 ? 600  PRO A O     1 
ATOM   4652  C  CB    . PRO A  1  600  ? 137.381 62.047  33.142  1.00 117.92 ? 600  PRO A CB    1 
ATOM   4653  C  CG    . PRO A  1  600  ? 137.211 63.085  32.079  1.00 121.58 ? 600  PRO A CG    1 
ATOM   4654  C  CD    . PRO A  1  600  ? 137.807 62.504  30.847  1.00 116.02 ? 600  PRO A CD    1 
ATOM   4655  N  N     . LYS A  1  601  ? 134.983 60.495  31.501  1.00 106.91 ? 601  LYS A N     1 
ATOM   4656  C  CA    . LYS A  1  601  ? 133.593 60.100  31.396  1.00 104.63 ? 601  LYS A CA    1 
ATOM   4657  C  C     . LYS A  1  601  ? 133.428 58.729  30.740  1.00 106.74 ? 601  LYS A C     1 
ATOM   4658  O  O     . LYS A  1  601  ? 132.339 58.154  30.829  1.00 106.18 ? 601  LYS A O     1 
ATOM   4659  C  CB    . LYS A  1  601  ? 132.846 61.148  30.554  1.00 105.33 ? 601  LYS A CB    1 
ATOM   4660  C  CG    . LYS A  1  601  ? 132.406 62.391  31.310  1.00 110.86 ? 601  LYS A CG    1 
ATOM   4661  C  CD    . LYS A  1  601  ? 131.958 63.460  30.328  1.00 118.69 ? 601  LYS A CD    1 
ATOM   4662  C  CE    . LYS A  1  601  ? 131.210 64.602  30.963  1.00 131.20 ? 601  LYS A CE    1 
ATOM   4663  N  NZ    . LYS A  1  601  ? 130.732 65.569  29.938  1.00 140.30 ? 601  LYS A NZ    1 
ATOM   4664  N  N     . ASP A  1  602  ? 134.509 58.203  30.098  1.00 102.01 ? 602  ASP A N     1 
ATOM   4665  C  CA    . ASP A  1  602  ? 134.561 57.012  29.222  1.00 100.16 ? 602  ASP A CA    1 
ATOM   4666  C  C     . ASP A  1  602  ? 133.738 57.445  28.001  1.00 103.23 ? 602  ASP A C     1 
ATOM   4667  O  O     . ASP A  1  602  ? 132.715 56.869  27.639  1.00 101.62 ? 602  ASP A O     1 
ATOM   4668  C  CB    . ASP A  1  602  ? 134.060 55.706  29.881  1.00 101.20 ? 602  ASP A CB    1 
ATOM   4669  C  CG    . ASP A  1  602  ? 134.762 54.415  29.467  1.00 103.24 ? 602  ASP A CG    1 
ATOM   4670  O  OD1   . ASP A  1  602  ? 135.924 54.486  28.989  1.00 101.93 ? 602  ASP A OD1   1 
ATOM   4671  O  OD2   . ASP A  1  602  ? 134.200 53.329  29.727  1.00 106.59 ? 602  ASP A OD2   1 
ATOM   4672  N  N     . ASN A  1  603  ? 134.168 58.591  27.475  1.00 100.89 ? 603  ASN A N     1 
ATOM   4673  C  CA    . ASN A  1  603  ? 133.644 59.353  26.359  1.00 99.99  ? 603  ASN A CA    1 
ATOM   4674  C  C     . ASN A  1  603  ? 134.455 58.984  25.130  1.00 103.28 ? 603  ASN A C     1 
ATOM   4675  O  O     . ASN A  1  603  ? 135.487 58.313  25.256  1.00 103.38 ? 603  ASN A O     1 
ATOM   4676  C  CB    . ASN A  1  603  ? 133.885 60.839  26.668  1.00 102.32 ? 603  ASN A CB    1 
ATOM   4677  C  CG    . ASN A  1  603  ? 132.667 61.713  26.636  1.00 132.02 ? 603  ASN A CG    1 
ATOM   4678  O  OD1   . ASN A  1  603  ? 131.595 61.340  26.141  1.00 124.12 ? 603  ASN A OD1   1 
ATOM   4679  N  ND2   . ASN A  1  603  ? 132.826 62.927  27.139  1.00 129.11 ? 603  ASN A ND2   1 
ATOM   4680  N  N     . GLY A  1  604  ? 134.014 59.460  23.966  1.00 98.17  ? 604  GLY A N     1 
ATOM   4681  C  CA    . GLY A  1  604  ? 134.697 59.242  22.697  1.00 96.52  ? 604  GLY A CA    1 
ATOM   4682  C  C     . GLY A  1  604  ? 134.995 57.786  22.418  1.00 97.89  ? 604  GLY A C     1 
ATOM   4683  O  O     . GLY A  1  604  ? 134.260 56.894  22.868  1.00 97.09  ? 604  GLY A O     1 
ATOM   4684  N  N     . MET A  1  605  ? 136.108 57.549  21.700  1.00 92.63  ? 605  MET A N     1 
ATOM   4685  C  CA    . MET A  1  605  ? 136.553 56.225  21.275  1.00 90.85  ? 605  MET A CA    1 
ATOM   4686  C  C     . MET A  1  605  ? 137.996 56.261  20.804  1.00 95.41  ? 605  MET A C     1 
ATOM   4687  O  O     . MET A  1  605  ? 138.344 57.104  19.979  1.00 95.05  ? 605  MET A O     1 
ATOM   4688  C  CB    . MET A  1  605  ? 135.671 55.730  20.105  1.00 91.29  ? 605  MET A CB    1 
ATOM   4689  C  CG    . MET A  1  605  ? 135.850 54.270  19.774  1.00 93.62  ? 605  MET A CG    1 
ATOM   4690  S  SD    . MET A  1  605  ? 135.192 53.230  21.073  1.00 97.47  ? 605  MET A SD    1 
ATOM   4691  C  CE    . MET A  1  605  ? 136.607 52.396  21.502  1.00 94.83  ? 605  MET A CE    1 
ATOM   4692  N  N     . LEU A  1  606  ? 138.819 55.317  21.282  1.00 92.18  ? 606  LEU A N     1 
ATOM   4693  C  CA    . LEU A  1  606  ? 140.194 55.167  20.828  1.00 91.96  ? 606  LEU A CA    1 
ATOM   4694  C  C     . LEU A  1  606  ? 140.533 53.704  20.708  1.00 94.27  ? 606  LEU A C     1 
ATOM   4695  O  O     . LEU A  1  606  ? 140.632 53.002  21.717  1.00 93.74  ? 606  LEU A O     1 
ATOM   4696  C  CB    . LEU A  1  606  ? 141.235 55.944  21.664  1.00 93.67  ? 606  LEU A CB    1 
ATOM   4697  C  CG    . LEU A  1  606  ? 142.729 55.778  21.253  1.00 99.04  ? 606  LEU A CG    1 
ATOM   4698  C  CD1   . LEU A  1  606  ? 143.005 56.312  19.846  1.00 98.97  ? 606  LEU A CD1   1 
ATOM   4699  C  CD2   . LEU A  1  606  ? 143.644 56.469  22.223  1.00 101.87 ? 606  LEU A CD2   1 
ATOM   4700  N  N     . ILE A  1  607  ? 140.652 53.244  19.450  1.00 89.77  ? 607  ILE A N     1 
ATOM   4701  C  CA    . ILE A  1  607  ? 141.016 51.876  19.090  1.00 88.87  ? 607  ILE A CA    1 
ATOM   4702  C  C     . ILE A  1  607  ? 142.339 51.959  18.343  1.00 94.32  ? 607  ILE A C     1 
ATOM   4703  O  O     . ILE A  1  607  ? 142.413 52.619  17.306  1.00 92.87  ? 607  ILE A O     1 
ATOM   4704  C  CB    . ILE A  1  607  ? 139.930 51.139  18.253  1.00 89.92  ? 607  ILE A CB    1 
ATOM   4705  C  CG1   . ILE A  1  607  ? 138.533 51.270  18.883  1.00 90.09  ? 607  ILE A CG1   1 
ATOM   4706  C  CG2   . ILE A  1  607  ? 140.313 49.667  18.049  1.00 89.11  ? 607  ILE A CG2   1 
ATOM   4707  C  CD1   . ILE A  1  607  ? 137.345 51.093  17.945  1.00 95.91  ? 607  ILE A CD1   1 
ATOM   4708  N  N     . ILE A  1  608  ? 143.384 51.322  18.896  1.00 93.07  ? 608  ILE A N     1 
ATOM   4709  C  CA    . ILE A  1  608  ? 144.722 51.249  18.306  1.00 93.62  ? 608  ILE A CA    1 
ATOM   4710  C  C     . ILE A  1  608  ? 145.041 49.772  18.080  1.00 97.72  ? 608  ILE A C     1 
ATOM   4711  O  O     . ILE A  1  608  ? 145.009 48.980  19.029  1.00 97.64  ? 608  ILE A O     1 
ATOM   4712  C  CB    . ILE A  1  608  ? 145.811 51.943  19.175  1.00 98.44  ? 608  ILE A CB    1 
ATOM   4713  C  CG1   . ILE A  1  608  ? 145.428 53.398  19.536  1.00 99.53  ? 608  ILE A CG1   1 
ATOM   4714  C  CG2   . ILE A  1  608  ? 147.172 51.891  18.475  1.00 100.11 ? 608  ILE A CG2   1 
ATOM   4715  C  CD1   . ILE A  1  608  ? 146.134 53.975  20.788  1.00 109.34 ? 608  ILE A CD1   1 
ATOM   4716  N  N     . ASP A  1  609  ? 145.327 49.406  16.816  1.00 94.09  ? 609  ASP A N     1 
ATOM   4717  C  CA    . ASP A  1  609  ? 145.692 48.051  16.384  1.00 93.73  ? 609  ASP A CA    1 
ATOM   4718  C  C     . ASP A  1  609  ? 144.598 47.006  16.708  1.00 99.23  ? 609  ASP A C     1 
ATOM   4719  O  O     . ASP A  1  609  ? 144.887 45.832  17.009  1.00 99.31  ? 609  ASP A O     1 
ATOM   4720  C  CB    . ASP A  1  609  ? 147.079 47.662  16.947  1.00 96.22  ? 609  ASP A CB    1 
ATOM   4721  C  CG    . ASP A  1  609  ? 147.779 46.535  16.230  1.00 101.52 ? 609  ASP A CG    1 
ATOM   4722  O  OD1   . ASP A  1  609  ? 147.669 46.463  14.985  1.00 100.32 ? 609  ASP A OD1   1 
ATOM   4723  O  OD2   . ASP A  1  609  ? 148.450 45.729  16.912  1.00 108.18 ? 609  ASP A OD2   1 
ATOM   4724  N  N     . GLY A  1  610  ? 143.343 47.449  16.600  1.00 95.96  ? 610  GLY A N     1 
ATOM   4725  C  CA    . GLY A  1  610  ? 142.170 46.611  16.835  1.00 95.11  ? 610  GLY A CA    1 
ATOM   4726  C  C     . GLY A  1  610  ? 142.033 46.147  18.268  1.00 98.30  ? 610  GLY A C     1 
ATOM   4727  O  O     . GLY A  1  610  ? 141.667 44.984  18.522  1.00 97.66  ? 610  GLY A O     1 
ATOM   4728  N  N     . GLN A  1  611  ? 142.397 47.077  19.202  1.00 92.97  ? 611  GLN A N     1 
ATOM   4729  C  CA    . GLN A  1  611  ? 142.347 46.961  20.661  1.00 92.04  ? 611  GLN A CA    1 
ATOM   4730  C  C     . GLN A  1  611  ? 141.765 48.260  21.210  1.00 93.78  ? 611  GLN A C     1 
ATOM   4731  O  O     . GLN A  1  611  ? 142.246 49.342  20.871  1.00 93.34  ? 611  GLN A O     1 
ATOM   4732  C  CB    . GLN A  1  611  ? 143.743 46.683  21.268  1.00 94.18  ? 611  GLN A CB    1 
ATOM   4733  C  CG    . GLN A  1  611  ? 144.360 45.323  20.899  1.00 103.93 ? 611  GLN A CG    1 
ATOM   4734  C  CD    . GLN A  1  611  ? 143.487 44.136  21.240  1.00 123.19 ? 611  GLN A CD    1 
ATOM   4735  O  OE1   . GLN A  1  611  ? 143.139 43.909  22.402  1.00 114.37 ? 611  GLN A OE1   1 
ATOM   4736  N  NE2   . GLN A  1  611  ? 143.118 43.347  20.227  1.00 123.69 ? 611  GLN A NE2   1 
ATOM   4737  N  N     . ILE A  1  612  ? 140.688 48.159  22.004  1.00 88.93  ? 612  ILE A N     1 
ATOM   4738  C  CA    . ILE A  1  612  ? 140.039 49.332  22.580  1.00 88.56  ? 612  ILE A CA    1 
ATOM   4739  C  C     . ILE A  1  612  ? 140.888 49.848  23.717  1.00 96.23  ? 612  ILE A C     1 
ATOM   4740  O  O     . ILE A  1  612  ? 141.207 49.095  24.647  1.00 96.98  ? 612  ILE A O     1 
ATOM   4741  C  CB    . ILE A  1  612  ? 138.581 49.044  23.016  1.00 90.37  ? 612  ILE A CB    1 
ATOM   4742  C  CG1   . ILE A  1  612  ? 137.688 48.717  21.803  1.00 88.70  ? 612  ILE A CG1   1 
ATOM   4743  C  CG2   . ILE A  1  612  ? 138.006 50.212  23.834  1.00 91.26  ? 612  ILE A CG2   1 
ATOM   4744  C  CD1   . ILE A  1  612  ? 136.581 47.778  22.089  1.00 91.09  ? 612  ILE A CD1   1 
ATOM   4745  N  N     . ILE A  1  613  ? 141.278 51.126  23.617  1.00 94.92  ? 613  ILE A N     1 
ATOM   4746  C  CA    . ILE A  1  613  ? 142.066 51.832  24.626  1.00 96.61  ? 613  ILE A CA    1 
ATOM   4747  C  C     . ILE A  1  613  ? 141.104 52.537  25.603  1.00 101.39 ? 613  ILE A C     1 
ATOM   4748  O  O     . ILE A  1  613  ? 141.222 52.328  26.811  1.00 102.04 ? 613  ILE A O     1 
ATOM   4749  C  CB    . ILE A  1  613  ? 143.170 52.733  23.984  1.00 100.06 ? 613  ILE A CB    1 
ATOM   4750  C  CG1   . ILE A  1  613  ? 144.509 51.971  23.873  1.00 100.83 ? 613  ILE A CG1   1 
ATOM   4751  C  CG2   . ILE A  1  613  ? 143.395 54.011  24.758  1.00 102.05 ? 613  ILE A CG2   1 
ATOM   4752  C  CD1   . ILE A  1  613  ? 144.660 51.037  22.699  1.00 107.25 ? 613  ILE A CD1   1 
ATOM   4753  N  N     . PHE A  1  614  ? 140.128 53.321  25.085  1.00 97.34  ? 614  PHE A N     1 
ATOM   4754  C  CA    . PHE A  1  614  ? 139.113 53.983  25.922  1.00 97.31  ? 614  PHE A CA    1 
ATOM   4755  C  C     . PHE A  1  614  ? 137.815 54.245  25.183  1.00 99.03  ? 614  PHE A C     1 
ATOM   4756  O  O     . PHE A  1  614  ? 137.810 54.299  23.952  1.00 97.33  ? 614  PHE A O     1 
ATOM   4757  C  CB    . PHE A  1  614  ? 139.636 55.274  26.597  1.00 100.25 ? 614  PHE A CB    1 
ATOM   4758  C  CG    . PHE A  1  614  ? 139.997 56.440  25.698  1.00 101.31 ? 614  PHE A CG    1 
ATOM   4759  C  CD1   . PHE A  1  614  ? 139.007 57.188  25.065  1.00 103.31 ? 614  PHE A CD1   1 
ATOM   4760  C  CD2   . PHE A  1  614  ? 141.317 56.849  25.562  1.00 103.80 ? 614  PHE A CD2   1 
ATOM   4761  C  CE1   . PHE A  1  614  ? 139.339 58.273  24.253  1.00 103.96 ? 614  PHE A CE1   1 
ATOM   4762  C  CE2   . PHE A  1  614  ? 141.647 57.945  24.764  1.00 106.44 ? 614  PHE A CE2   1 
ATOM   4763  C  CZ    . PHE A  1  614  ? 140.657 58.651  24.115  1.00 103.73 ? 614  PHE A CZ    1 
ATOM   4764  N  N     . GLY A  1  615  ? 136.743 54.457  25.943  1.00 95.76  ? 615  GLY A N     1 
ATOM   4765  C  CA    . GLY A  1  615  ? 135.430 54.775  25.395  1.00 94.80  ? 615  GLY A CA    1 
ATOM   4766  C  C     . GLY A  1  615  ? 134.421 53.649  25.431  1.00 97.38  ? 615  GLY A C     1 
ATOM   4767  O  O     . GLY A  1  615  ? 134.768 52.485  25.205  1.00 96.71  ? 615  GLY A O     1 
ATOM   4768  N  N     . VAL A  1  616  ? 133.154 53.997  25.711  1.00 92.63  ? 616  VAL A N     1 
ATOM   4769  C  CA    . VAL A  1  616  ? 132.069 53.024  25.747  1.00 90.98  ? 616  VAL A CA    1 
ATOM   4770  C  C     . VAL A  1  616  ? 131.652 52.786  24.300  1.00 94.27  ? 616  VAL A C     1 
ATOM   4771  O  O     . VAL A  1  616  ? 131.491 53.752  23.525  1.00 94.97  ? 616  VAL A O     1 
ATOM   4772  C  CB    . VAL A  1  616  ? 130.887 53.466  26.647  1.00 94.59  ? 616  VAL A CB    1 
ATOM   4773  C  CG1   . VAL A  1  616  ? 129.818 52.390  26.712  1.00 93.53  ? 616  VAL A CG1   1 
ATOM   4774  C  CG2   . VAL A  1  616  ? 131.364 53.793  28.052  1.00 96.08  ? 616  VAL A CG2   1 
ATOM   4775  N  N     . VAL A  1  617  ? 131.536 51.502  23.922  1.00 88.18  ? 617  VAL A N     1 
ATOM   4776  C  CA    . VAL A  1  617  ? 131.138 51.142  22.567  1.00 85.95  ? 617  VAL A CA    1 
ATOM   4777  C  C     . VAL A  1  617  ? 129.624 51.172  22.447  1.00 89.07  ? 617  VAL A C     1 
ATOM   4778  O  O     . VAL A  1  617  ? 128.938 50.317  23.010  1.00 89.18  ? 617  VAL A O     1 
ATOM   4779  C  CB    . VAL A  1  617  ? 131.731 49.806  22.055  1.00 88.52  ? 617  VAL A CB    1 
ATOM   4780  C  CG1   . VAL A  1  617  ? 131.361 49.582  20.588  1.00 86.84  ? 617  VAL A CG1   1 
ATOM   4781  C  CG2   . VAL A  1  617  ? 133.246 49.758  22.248  1.00 88.92  ? 617  VAL A CG2   1 
ATOM   4782  N  N     . GLU A  1  618  ? 129.112 52.167  21.717  1.00 83.96  ? 618  GLU A N     1 
ATOM   4783  C  CA    . GLU A  1  618  ? 127.690 52.318  21.424  1.00 82.30  ? 618  GLU A CA    1 
ATOM   4784  C  C     . GLU A  1  618  ? 127.480 52.698  19.929  1.00 84.20  ? 618  GLU A C     1 
ATOM   4785  O  O     . GLU A  1  618  ? 128.425 52.581  19.139  1.00 84.13  ? 618  GLU A O     1 
ATOM   4786  C  CB    . GLU A  1  618  ? 126.991 53.254  22.425  1.00 84.20  ? 618  GLU A CB    1 
ATOM   4787  C  CG    . GLU A  1  618  ? 127.702 54.567  22.678  1.00 95.72  ? 618  GLU A CG    1 
ATOM   4788  C  CD    . GLU A  1  618  ? 127.788 55.452  21.456  1.00 113.20 ? 618  GLU A CD    1 
ATOM   4789  O  OE1   . GLU A  1  618  ? 126.745 56.033  21.072  1.00 94.93  ? 618  GLU A OE1   1 
ATOM   4790  O  OE2   . GLU A  1  618  ? 128.868 55.463  20.818  1.00 108.16 ? 618  GLU A OE2   1 
ATOM   4791  N  N     . LYS A  1  619  ? 126.259 53.132  19.552  1.00 77.89  ? 619  LYS A N     1 
ATOM   4792  C  CA    . LYS A  1  619  ? 125.833 53.461  18.189  1.00 75.44  ? 619  LYS A CA    1 
ATOM   4793  C  C     . LYS A  1  619  ? 126.831 54.329  17.397  1.00 81.83  ? 619  LYS A C     1 
ATOM   4794  O  O     . LYS A  1  619  ? 127.115 54.003  16.239  1.00 81.52  ? 619  LYS A O     1 
ATOM   4795  C  CB    . LYS A  1  619  ? 124.445 54.096  18.232  1.00 75.47  ? 619  LYS A CB    1 
ATOM   4796  C  CG    . LYS A  1  619  ? 123.740 54.236  16.897  1.00 72.60  ? 619  LYS A CG    1 
ATOM   4797  C  CD    . LYS A  1  619  ? 122.363 54.846  17.120  1.00 79.72  ? 619  LYS A CD    1 
ATOM   4798  C  CE    . LYS A  1  619  ? 121.561 55.096  15.873  1.00 93.04  ? 619  LYS A CE    1 
ATOM   4799  N  NZ    . LYS A  1  619  ? 120.190 55.559  16.214  1.00 110.08 ? 619  LYS A NZ    1 
ATOM   4800  N  N     . LYS A  1  620  ? 127.398 55.395  18.022  1.00 79.39  ? 620  LYS A N     1 
ATOM   4801  C  CA    . LYS A  1  620  ? 128.358 56.296  17.359  1.00 79.07  ? 620  LYS A CA    1 
ATOM   4802  C  C     . LYS A  1  620  ? 129.604 55.556  16.843  1.00 84.14  ? 620  LYS A C     1 
ATOM   4803  O  O     . LYS A  1  620  ? 130.213 55.997  15.863  1.00 83.97  ? 620  LYS A O     1 
ATOM   4804  C  CB    . LYS A  1  620  ? 128.758 57.474  18.265  1.00 81.58  ? 620  LYS A CB    1 
ATOM   4805  C  CG    . LYS A  1  620  ? 127.634 58.471  18.566  1.00 87.22  ? 620  LYS A CG    1 
ATOM   4806  C  CD    . LYS A  1  620  ? 128.056 59.567  19.562  1.00 92.80  ? 620  LYS A CD    1 
ATOM   4807  C  CE    . LYS A  1  620  ? 127.472 59.361  20.941  1.00 105.43 ? 620  LYS A CE    1 
ATOM   4808  N  NZ    . LYS A  1  620  ? 128.523 59.068  21.961  1.00 119.47 ? 620  LYS A NZ    1 
ATOM   4809  N  N     . THR A  1  621  ? 129.951 54.413  17.483  1.00 80.48  ? 621  THR A N     1 
ATOM   4810  C  CA    . THR A  1  621  ? 131.107 53.589  17.128  1.00 79.23  ? 621  THR A CA    1 
ATOM   4811  C  C     . THR A  1  621  ? 130.763 52.476  16.160  1.00 82.42  ? 621  THR A C     1 
ATOM   4812  O  O     . THR A  1  621  ? 131.412 52.325  15.126  1.00 81.37  ? 621  THR A O     1 
ATOM   4813  C  CB    . THR A  1  621  ? 131.694 52.914  18.385  1.00 77.61  ? 621  THR A CB    1 
ATOM   4814  O  OG1   . THR A  1  621  ? 131.847 53.855  19.452  1.00 78.35  ? 621  THR A OG1   1 
ATOM   4815  C  CG2   . THR A  1  621  ? 132.991 52.167  18.102  1.00 70.06  ? 621  THR A CG2   1 
ATOM   4816  N  N     . VAL A  1  622  ? 129.765 51.668  16.541  1.00 79.51  ? 622  VAL A N     1 
ATOM   4817  C  CA    . VAL A  1  622  ? 129.401 50.385  15.951  1.00 77.62  ? 622  VAL A CA    1 
ATOM   4818  C  C     . VAL A  1  622  ? 128.065 50.375  15.146  1.00 80.81  ? 622  VAL A C     1 
ATOM   4819  O  O     . VAL A  1  622  ? 127.645 49.331  14.658  1.00 79.63  ? 622  VAL A O     1 
ATOM   4820  C  CB    . VAL A  1  622  ? 129.438 49.380  17.142  1.00 80.36  ? 622  VAL A CB    1 
ATOM   4821  C  CG1   . VAL A  1  622  ? 128.134 49.326  17.932  1.00 79.72  ? 622  VAL A CG1   1 
ATOM   4822  C  CG2   . VAL A  1  622  ? 129.914 48.014  16.713  1.00 79.53  ? 622  VAL A CG2   1 
ATOM   4823  N  N     . GLY A  1  623  ? 127.451 51.531  14.961  1.00 78.28  ? 623  GLY A N     1 
ATOM   4824  C  CA    . GLY A  1  623  ? 126.234 51.624  14.163  1.00 78.11  ? 623  GLY A CA    1 
ATOM   4825  C  C     . GLY A  1  623  ? 126.614 51.844  12.715  1.00 84.67  ? 623  GLY A C     1 
ATOM   4826  O  O     . GLY A  1  623  ? 127.801 51.737  12.375  1.00 85.19  ? 623  GLY A O     1 
ATOM   4827  N  N     . SER A  1  624  ? 125.621 52.186  11.848  1.00 81.60  ? 624  SER A N     1 
ATOM   4828  C  CA    . SER A  1  624  ? 125.859 52.466  10.420  1.00 80.61  ? 624  SER A CA    1 
ATOM   4829  C  C     . SER A  1  624  ? 126.149 53.957  10.275  1.00 84.50  ? 624  SER A C     1 
ATOM   4830  O  O     . SER A  1  624  ? 125.516 54.664  9.488   1.00 82.85  ? 624  SER A O     1 
ATOM   4831  C  CB    . SER A  1  624  ? 124.678 52.020  9.561   1.00 83.66  ? 624  SER A CB    1 
ATOM   4832  O  OG    . SER A  1  624  ? 123.537 52.835  9.771   1.00 95.23  ? 624  SER A OG    1 
ATOM   4833  N  N     . SER A  1  625  ? 127.105 54.424  11.093  1.00 83.04  ? 625  SER A N     1 
ATOM   4834  C  CA    . SER A  1  625  ? 127.565 55.801  11.194  1.00 84.41  ? 625  SER A CA    1 
ATOM   4835  C  C     . SER A  1  625  ? 128.751 56.043  10.269  1.00 89.33  ? 625  SER A C     1 
ATOM   4836  O  O     . SER A  1  625  ? 129.436 55.080  9.905   1.00 88.86  ? 625  SER A O     1 
ATOM   4837  C  CB    . SER A  1  625  ? 127.905 56.140  12.645  1.00 89.23  ? 625  SER A CB    1 
ATOM   4838  O  OG    . SER A  1  625  ? 128.729 55.179  13.285  1.00 95.94  ? 625  SER A OG    1 
ATOM   4839  N  N     . ASN A  1  626  ? 128.983 57.320  9.886   1.00 87.10  ? 626  ASN A N     1 
ATOM   4840  C  CA    . ASN A  1  626  ? 130.037 57.738  8.953   1.00 87.84  ? 626  ASN A CA    1 
ATOM   4841  C  C     . ASN A  1  626  ? 131.469 57.258  9.317   1.00 92.80  ? 626  ASN A C     1 
ATOM   4842  O  O     . ASN A  1  626  ? 131.972 56.356  8.667   1.00 92.33  ? 626  ASN A O     1 
ATOM   4843  C  CB    . ASN A  1  626  ? 130.015 59.247  8.708   1.00 91.15  ? 626  ASN A CB    1 
ATOM   4844  C  CG    . ASN A  1  626  ? 130.267 59.601  7.265   1.00 121.76 ? 626  ASN A CG    1 
ATOM   4845  O  OD1   . ASN A  1  626  ? 131.414 59.619  6.788   1.00 116.08 ? 626  ASN A OD1   1 
ATOM   4846  N  ND2   . ASN A  1  626  ? 129.189 59.856  6.529   1.00 116.16 ? 626  ASN A ND2   1 
ATOM   4847  N  N     . GLY A  1  627  ? 132.113 57.826  10.327  1.00 89.94  ? 627  GLY A N     1 
ATOM   4848  C  CA    . GLY A  1  627  ? 133.473 57.401  10.658  1.00 90.24  ? 627  GLY A CA    1 
ATOM   4849  C  C     . GLY A  1  627  ? 133.590 56.063  11.365  1.00 94.34  ? 627  GLY A C     1 
ATOM   4850  O  O     . GLY A  1  627  ? 134.701 55.631  11.676  1.00 94.99  ? 627  GLY A O     1 
ATOM   4851  N  N     . GLY A  1  628  ? 132.441 55.419  11.603  1.00 89.73  ? 628  GLY A N     1 
ATOM   4852  C  CA    . GLY A  1  628  ? 132.254 54.176  12.348  1.00 88.66  ? 628  GLY A CA    1 
ATOM   4853  C  C     . GLY A  1  628  ? 133.185 53.021  12.073  1.00 90.57  ? 628  GLY A C     1 
ATOM   4854  O  O     . GLY A  1  628  ? 133.721 52.904  10.967  1.00 91.14  ? 628  GLY A O     1 
ATOM   4855  N  N     . LEU A  1  629  ? 133.338 52.130  13.093  1.00 83.71  ? 629  LEU A N     1 
ATOM   4856  C  CA    . LEU A  1  629  ? 134.148 50.903  13.095  1.00 81.12  ? 629  LEU A CA    1 
ATOM   4857  C  C     . LEU A  1  629  ? 133.831 50.088  11.867  1.00 83.55  ? 629  LEU A C     1 
ATOM   4858  O  O     . LEU A  1  629  ? 134.734 49.466  11.314  1.00 83.60  ? 629  LEU A O     1 
ATOM   4859  C  CB    . LEU A  1  629  ? 133.802 50.056  14.336  1.00 80.62  ? 629  LEU A CB    1 
ATOM   4860  C  CG    . LEU A  1  629  ? 134.853 49.132  15.005  1.00 84.56  ? 629  LEU A CG    1 
ATOM   4861  C  CD1   . LEU A  1  629  ? 134.272 47.783  15.315  1.00 83.66  ? 629  LEU A CD1   1 
ATOM   4862  C  CD2   . LEU A  1  629  ? 136.111 48.947  14.203  1.00 86.10  ? 629  LEU A CD2   1 
ATOM   4863  N  N     . ILE A  1  630  ? 132.553 50.102  11.425  1.00 78.18  ? 630  ILE A N     1 
ATOM   4864  C  CA    . ILE A  1  630  ? 132.140 49.326  10.271  1.00 76.61  ? 630  ILE A CA    1 
ATOM   4865  C  C     . ILE A  1  630  ? 132.613 50.018  8.957   1.00 82.64  ? 630  ILE A C     1 
ATOM   4866  O  O     . ILE A  1  630  ? 133.216 49.323  8.144   1.00 82.08  ? 630  ILE A O     1 
ATOM   4867  C  CB    . ILE A  1  630  ? 130.639 48.951  10.362  1.00 77.95  ? 630  ILE A CB    1 
ATOM   4868  C  CG1   . ILE A  1  630  ? 130.522 47.733  11.287  1.00 78.53  ? 630  ILE A CG1   1 
ATOM   4869  C  CG2   . ILE A  1  630  ? 130.013 48.623  9.007   1.00 76.21  ? 630  ILE A CG2   1 
ATOM   4870  C  CD1   . ILE A  1  630  ? 129.348 47.726  12.173  1.00 89.19  ? 630  ILE A CD1   1 
ATOM   4871  N  N     . HIS A  1  631  ? 132.463 51.355  8.789   1.00 80.93  ? 631  HIS A N     1 
ATOM   4872  C  CA    . HIS A  1  631  ? 132.966 52.036  7.577   1.00 81.65  ? 631  HIS A CA    1 
ATOM   4873  C  C     . HIS A  1  631  ? 134.495 51.825  7.446   1.00 83.59  ? 631  HIS A C     1 
ATOM   4874  O  O     . HIS A  1  631  ? 135.014 51.662  6.336   1.00 83.63  ? 631  HIS A O     1 
ATOM   4875  C  CB    . HIS A  1  631  ? 132.675 53.554  7.641   1.00 84.08  ? 631  HIS A CB    1 
ATOM   4876  C  CG    . HIS A  1  631  ? 132.686 54.293  6.322   1.00 88.31  ? 631  HIS A CG    1 
ATOM   4877  N  ND1   . HIS A  1  631  ? 132.087 55.542  6.191   1.00 90.84  ? 631  HIS A ND1   1 
ATOM   4878  C  CD2   . HIS A  1  631  ? 133.195 53.940  5.116   1.00 90.69  ? 631  HIS A CD2   1 
ATOM   4879  C  CE1   . HIS A  1  631  ? 132.263 55.909  4.932   1.00 90.45  ? 631  HIS A CE1   1 
ATOM   4880  N  NE2   . HIS A  1  631  ? 132.909 54.977  4.237   1.00 90.56  ? 631  HIS A NE2   1 
ATOM   4881  N  N     . VAL A  1  632  ? 135.201 51.829  8.592   1.00 77.41  ? 632  VAL A N     1 
ATOM   4882  C  CA    . VAL A  1  632  ? 136.654 51.685  8.656   1.00 75.96  ? 632  VAL A CA    1 
ATOM   4883  C  C     . VAL A  1  632  ? 137.094 50.255  8.349   1.00 79.71  ? 632  VAL A C     1 
ATOM   4884  O  O     . VAL A  1  632  ? 137.959 50.090  7.498   1.00 79.87  ? 632  VAL A O     1 
ATOM   4885  C  CB    . VAL A  1  632  ? 137.252 52.224  9.978   1.00 78.54  ? 632  VAL A CB    1 
ATOM   4886  C  CG1   . VAL A  1  632  ? 138.763 52.024  10.027  1.00 78.63  ? 632  VAL A CG1   1 
ATOM   4887  C  CG2   . VAL A  1  632  ? 136.904 53.687  10.174  1.00 77.96  ? 632  VAL A CG2   1 
ATOM   4888  N  N     . VAL A  1  633  ? 136.516 49.234  9.020   1.00 75.56  ? 633  VAL A N     1 
ATOM   4889  C  CA    . VAL A  1  633  ? 136.900 47.844  8.769   1.00 75.22  ? 633  VAL A CA    1 
ATOM   4890  C  C     . VAL A  1  633  ? 136.615 47.474  7.294   1.00 79.52  ? 633  VAL A C     1 
ATOM   4891  O  O     . VAL A  1  633  ? 137.475 46.858  6.662   1.00 79.82  ? 633  VAL A O     1 
ATOM   4892  C  CB    . VAL A  1  633  ? 136.330 46.823  9.794   1.00 79.30  ? 633  VAL A CB    1 
ATOM   4893  C  CG1   . VAL A  1  633  ? 136.735 45.395  9.445   1.00 79.18  ? 633  VAL A CG1   1 
ATOM   4894  C  CG2   . VAL A  1  633  ? 136.807 47.138  11.197  1.00 80.10  ? 633  VAL A CG2   1 
ATOM   4895  N  N     . THR A  1  634  ? 135.470 47.930  6.719   1.00 74.88  ? 634  THR A N     1 
ATOM   4896  C  CA    . THR A  1  634  ? 135.128 47.665  5.310   1.00 72.81  ? 634  THR A CA    1 
ATOM   4897  C  C     . THR A  1  634  ? 136.184 48.240  4.393   1.00 75.67  ? 634  THR A C     1 
ATOM   4898  O  O     . THR A  1  634  ? 136.674 47.520  3.527   1.00 75.20  ? 634  THR A O     1 
ATOM   4899  C  CB    . THR A  1  634  ? 133.748 48.212  4.938   1.00 76.72  ? 634  THR A CB    1 
ATOM   4900  O  OG1   . THR A  1  634  ? 132.802 47.838  5.935   1.00 80.14  ? 634  THR A OG1   1 
ATOM   4901  C  CG2   . THR A  1  634  ? 133.276 47.721  3.577   1.00 72.07  ? 634  THR A CG2   1 
ATOM   4902  N  N     . ARG A  1  635  ? 136.553 49.519  4.597   1.00 72.23  ? 635  ARG A N     1 
ATOM   4903  C  CA    . ARG A  1  635  ? 137.554 50.175  3.763   1.00 72.78  ? 635  ARG A CA    1 
ATOM   4904  C  C     . ARG A  1  635  ? 138.956 49.607  3.953   1.00 80.08  ? 635  ARG A C     1 
ATOM   4905  O  O     . ARG A  1  635  ? 139.659 49.374  2.971   1.00 80.15  ? 635  ARG A O     1 
ATOM   4906  C  CB    . ARG A  1  635  ? 137.537 51.712  3.943   1.00 71.99  ? 635  ARG A CB    1 
ATOM   4907  C  CG    . ARG A  1  635  ? 136.504 52.448  3.063   1.00 77.91  ? 635  ARG A CG    1 
ATOM   4908  C  CD    . ARG A  1  635  ? 136.845 52.494  1.568   1.00 77.62  ? 635  ARG A CD    1 
ATOM   4909  N  NE    . ARG A  1  635  ? 135.664 52.261  0.735   1.00 88.56  ? 635  ARG A NE    1 
ATOM   4910  C  CZ    . ARG A  1  635  ? 135.250 51.062  0.315   1.00 110.91 ? 635  ARG A CZ    1 
ATOM   4911  N  NH1   . ARG A  1  635  ? 135.935 49.966  0.629   1.00 101.40 ? 635  ARG A NH1   1 
ATOM   4912  N  NH2   . ARG A  1  635  ? 134.152 50.951  -0.425  1.00 99.21  ? 635  ARG A NH2   1 
ATOM   4913  N  N     . GLU A  1  636  ? 139.350 49.348  5.199   1.00 79.14  ? 636  GLU A N     1 
ATOM   4914  C  CA    . GLU A  1  636  ? 140.694 48.891  5.500   1.00 80.51  ? 636  GLU A CA    1 
ATOM   4915  C  C     . GLU A  1  636  ? 140.929 47.404  5.265   1.00 84.46  ? 636  GLU A C     1 
ATOM   4916  O  O     . GLU A  1  636  ? 141.951 47.040  4.679   1.00 85.45  ? 636  GLU A O     1 
ATOM   4917  C  CB    . GLU A  1  636  ? 141.097 49.289  6.935   1.00 83.05  ? 636  GLU A CB    1 
ATOM   4918  C  CG    . GLU A  1  636  ? 142.595 49.502  7.136   1.00 98.70  ? 636  GLU A CG    1 
ATOM   4919  C  CD    . GLU A  1  636  ? 143.212 50.643  6.348   1.00 131.31 ? 636  GLU A CD    1 
ATOM   4920  O  OE1   . GLU A  1  636  ? 142.527 51.676  6.155   1.00 120.97 ? 636  GLU A OE1   1 
ATOM   4921  O  OE2   . GLU A  1  636  ? 144.372 50.490  5.895   1.00 141.58 ? 636  GLU A OE2   1 
ATOM   4922  N  N     . LYS A  1  637  ? 140.028 46.547  5.725   1.00 79.20  ? 637  LYS A N     1 
ATOM   4923  C  CA    . LYS A  1  637  ? 140.277 45.115  5.627   1.00 78.36  ? 637  LYS A CA    1 
ATOM   4924  C  C     . LYS A  1  637  ? 139.417 44.376  4.578   1.00 82.73  ? 637  LYS A C     1 
ATOM   4925  O  O     . LYS A  1  637  ? 139.654 43.190  4.345   1.00 82.56  ? 637  LYS A O     1 
ATOM   4926  C  CB    . LYS A  1  637  ? 140.176 44.461  7.017   1.00 79.67  ? 637  LYS A CB    1 
ATOM   4927  C  CG    . LYS A  1  637  ? 141.150 45.069  8.038   1.00 86.22  ? 637  LYS A CG    1 
ATOM   4928  C  CD    . LYS A  1  637  ? 142.459 44.300  8.217   1.00 93.92  ? 637  LYS A CD    1 
ATOM   4929  C  CE    . LYS A  1  637  ? 143.648 45.218  8.358   1.00 103.00 ? 637  LYS A CE    1 
ATOM   4930  N  NZ    . LYS A  1  637  ? 144.061 45.824  7.057   1.00 113.77 ? 637  LYS A NZ    1 
ATOM   4931  N  N     . GLY A  1  638  ? 138.498 45.072  3.911   1.00 79.44  ? 638  GLY A N     1 
ATOM   4932  C  CA    . GLY A  1  638  ? 137.686 44.456  2.863   1.00 79.24  ? 638  GLY A CA    1 
ATOM   4933  C  C     . GLY A  1  638  ? 136.260 44.115  3.251   1.00 84.80  ? 638  GLY A C     1 
ATOM   4934  O  O     . GLY A  1  638  ? 135.900 44.250  4.422   1.00 85.32  ? 638  GLY A O     1 
ATOM   4935  N  N     . PRO A  1  639  ? 135.397 43.687  2.296   1.00 81.44  ? 639  PRO A N     1 
ATOM   4936  C  CA    . PRO A  1  639  ? 134.006 43.379  2.664   1.00 80.70  ? 639  PRO A CA    1 
ATOM   4937  C  C     . PRO A  1  639  ? 133.856 42.065  3.420   1.00 83.98  ? 639  PRO A C     1 
ATOM   4938  O  O     . PRO A  1  639  ? 133.109 42.022  4.396   1.00 84.24  ? 639  PRO A O     1 
ATOM   4939  C  CB    . PRO A  1  639  ? 133.274 43.352  1.315   1.00 81.64  ? 639  PRO A CB    1 
ATOM   4940  C  CG    . PRO A  1  639  ? 134.295 42.897  0.349   1.00 86.48  ? 639  PRO A CG    1 
ATOM   4941  C  CD    . PRO A  1  639  ? 135.625 43.463  0.853   1.00 82.96  ? 639  PRO A CD    1 
ATOM   4942  N  N     . GLN A  1  640  ? 134.562 41.005  2.984   1.00 78.93  ? 640  GLN A N     1 
ATOM   4943  C  CA    . GLN A  1  640  ? 134.440 39.706  3.602   1.00 78.45  ? 640  GLN A CA    1 
ATOM   4944  C  C     . GLN A  1  640  ? 134.984 39.684  5.068   1.00 81.98  ? 640  GLN A C     1 
ATOM   4945  O  O     . GLN A  1  640  ? 134.483 38.916  5.902   1.00 81.15  ? 640  GLN A O     1 
ATOM   4946  C  CB    . GLN A  1  640  ? 135.056 38.640  2.700   1.00 80.21  ? 640  GLN A CB    1 
ATOM   4947  C  CG    . GLN A  1  640  ? 134.212 37.362  2.617   1.00 115.18 ? 640  GLN A CG    1 
ATOM   4948  C  CD    . GLN A  1  640  ? 134.418 36.430  3.804   1.00 147.84 ? 640  GLN A CD    1 
ATOM   4949  O  OE1   . GLN A  1  640  ? 135.480 35.801  3.955   1.00 144.85 ? 640  GLN A OE1   1 
ATOM   4950  N  NE2   . GLN A  1  640  ? 133.400 36.311  4.665   1.00 140.72 ? 640  GLN A NE2   1 
ATOM   4951  N  N     . VAL A  1  641  ? 135.927 40.589  5.395   1.00 78.11  ? 641  VAL A N     1 
ATOM   4952  C  CA    . VAL A  1  641  ? 136.473 40.717  6.749   1.00 77.80  ? 641  VAL A CA    1 
ATOM   4953  C  C     . VAL A  1  641  ? 135.488 41.459  7.679   1.00 82.00  ? 641  VAL A C     1 
ATOM   4954  O  O     . VAL A  1  641  ? 135.327 41.065  8.836   1.00 82.44  ? 641  VAL A O     1 
ATOM   4955  C  CB    . VAL A  1  641  ? 137.877 41.345  6.719   1.00 81.63  ? 641  VAL A CB    1 
ATOM   4956  C  CG1   . VAL A  1  641  ? 138.368 41.699  8.120   1.00 82.31  ? 641  VAL A CG1   1 
ATOM   4957  C  CG2   . VAL A  1  641  ? 138.856 40.414  6.019   1.00 81.29  ? 641  VAL A CG2   1 
ATOM   4958  N  N     . CYS A  1  642  ? 134.826 42.513  7.166   1.00 78.50  ? 642  CYS A N     1 
ATOM   4959  C  CA    . CYS A  1  642  ? 133.819 43.284  7.898   1.00 78.63  ? 642  CYS A CA    1 
ATOM   4960  C  C     . CYS A  1  642  ? 132.565 42.441  8.126   1.00 82.75  ? 642  CYS A C     1 
ATOM   4961  O  O     . CYS A  1  642  ? 131.898 42.613  9.139   1.00 83.36  ? 642  CYS A O     1 
ATOM   4962  C  CB    . CYS A  1  642  ? 133.490 44.584  7.175   1.00 78.80  ? 642  CYS A CB    1 
ATOM   4963  S  SG    . CYS A  1  642  ? 132.316 45.646  8.057   1.00 82.72  ? 642  CYS A SG    1 
ATOM   4964  N  N     . ALA A  1  643  ? 132.262 41.511  7.209   1.00 78.09  ? 643  ALA A N     1 
ATOM   4965  C  CA    . ALA A  1  643  ? 131.128 40.607  7.345   1.00 77.08  ? 643  ALA A CA    1 
ATOM   4966  C  C     . ALA A  1  643  ? 131.382 39.672  8.533   1.00 82.81  ? 643  ALA A C     1 
ATOM   4967  O  O     . ALA A  1  643  ? 130.441 39.348  9.276   1.00 84.13  ? 643  ALA A O     1 
ATOM   4968  C  CB    . ALA A  1  643  ? 130.945 39.809  6.066   1.00 76.94  ? 643  ALA A CB    1 
ATOM   4969  N  N     . LYS A  1  644  ? 132.664 39.259  8.726   1.00 78.68  ? 644  LYS A N     1 
ATOM   4970  C  CA    . LYS A  1  644  ? 133.080 38.402  9.842   1.00 78.38  ? 644  LYS A CA    1 
ATOM   4971  C  C     . LYS A  1  644  ? 132.973 39.205  11.128  1.00 82.18  ? 644  LYS A C     1 
ATOM   4972  O  O     . LYS A  1  644  ? 132.473 38.678  12.123  1.00 82.76  ? 644  LYS A O     1 
ATOM   4973  C  CB    . LYS A  1  644  ? 134.509 37.872  9.655   1.00 81.29  ? 644  LYS A CB    1 
ATOM   4974  C  CG    . LYS A  1  644  ? 134.611 36.721  8.669   1.00 105.18 ? 644  LYS A CG    1 
ATOM   4975  C  CD    . LYS A  1  644  ? 136.064 36.289  8.455   1.00 120.67 ? 644  LYS A CD    1 
ATOM   4976  C  CE    . LYS A  1  644  ? 136.221 35.234  7.375   1.00 135.24 ? 644  LYS A CE    1 
ATOM   4977  N  NZ    . LYS A  1  644  ? 135.709 33.897  7.795   1.00 144.65 ? 644  LYS A NZ    1 
ATOM   4978  N  N     . LEU A  1  645  ? 133.391 40.501  11.095  1.00 76.95  ? 645  LEU A N     1 
ATOM   4979  C  CA    . LEU A  1  645  ? 133.332 41.410  12.241  1.00 75.92  ? 645  LEU A CA    1 
ATOM   4980  C  C     . LEU A  1  645  ? 131.925 41.476  12.833  1.00 78.18  ? 645  LEU A C     1 
ATOM   4981  O  O     . LEU A  1  645  ? 131.780 41.367  14.053  1.00 78.73  ? 645  LEU A O     1 
ATOM   4982  C  CB    . LEU A  1  645  ? 133.826 42.800  11.856  1.00 75.77  ? 645  LEU A CB    1 
ATOM   4983  C  CG    . LEU A  1  645  ? 133.819 43.821  12.975  1.00 81.30  ? 645  LEU A CG    1 
ATOM   4984  C  CD1   . LEU A  1  645  ? 134.989 43.607  13.928  1.00 82.24  ? 645  LEU A CD1   1 
ATOM   4985  C  CD2   . LEU A  1  645  ? 133.755 45.243  12.432  1.00 84.73  ? 645  LEU A CD2   1 
ATOM   4986  N  N     . PHE A  1  646  ? 130.894 41.593  11.963  1.00 72.79  ? 646  PHE A N     1 
ATOM   4987  C  CA    . PHE A  1  646  ? 129.476 41.624  12.348  1.00 71.37  ? 646  PHE A CA    1 
ATOM   4988  C  C     . PHE A  1  646  ? 129.139 40.347  13.115  1.00 77.94  ? 646  PHE A C     1 
ATOM   4989  O  O     . PHE A  1  646  ? 128.615 40.425  14.221  1.00 79.71  ? 646  PHE A O     1 
ATOM   4990  C  CB    . PHE A  1  646  ? 128.566 41.737  11.114  1.00 70.89  ? 646  PHE A CB    1 
ATOM   4991  C  CG    . PHE A  1  646  ? 128.287 43.128  10.615  1.00 70.88  ? 646  PHE A CG    1 
ATOM   4992  C  CD1   . PHE A  1  646  ? 127.313 43.914  11.211  1.00 73.75  ? 646  PHE A CD1   1 
ATOM   4993  C  CD2   . PHE A  1  646  ? 128.962 43.636  9.515   1.00 71.74  ? 646  PHE A CD2   1 
ATOM   4994  C  CE1   . PHE A  1  646  ? 127.035 45.198  10.729  1.00 74.10  ? 646  PHE A CE1   1 
ATOM   4995  C  CE2   . PHE A  1  646  ? 128.695 44.922  9.040   1.00 73.89  ? 646  PHE A CE2   1 
ATOM   4996  C  CZ    . PHE A  1  646  ? 127.723 45.688  9.640   1.00 72.20  ? 646  PHE A CZ    1 
ATOM   4997  N  N     . GLY A  1  647  ? 129.493 39.196  12.552  1.00 73.74  ? 647  GLY A N     1 
ATOM   4998  C  CA    . GLY A  1  647  ? 129.245 37.910  13.188  1.00 74.16  ? 647  GLY A CA    1 
ATOM   4999  C  C     . GLY A  1  647  ? 129.927 37.753  14.529  1.00 79.19  ? 647  GLY A C     1 
ATOM   5000  O  O     . GLY A  1  647  ? 129.284 37.360  15.498  1.00 79.41  ? 647  GLY A O     1 
ATOM   5001  N  N     . ASN A  1  648  ? 131.221 38.101  14.602  1.00 76.27  ? 648  ASN A N     1 
ATOM   5002  C  CA    . ASN A  1  648  ? 132.014 37.988  15.827  1.00 76.75  ? 648  ASN A CA    1 
ATOM   5003  C  C     . ASN A  1  648  ? 131.535 38.929  16.915  1.00 80.86  ? 648  ASN A C     1 
ATOM   5004  O  O     . ASN A  1  648  ? 131.367 38.473  18.050  1.00 82.29  ? 648  ASN A O     1 
ATOM   5005  C  CB    . ASN A  1  648  ? 133.485 38.203  15.552  1.00 76.41  ? 648  ASN A CB    1 
ATOM   5006  C  CG    . ASN A  1  648  ? 134.094 37.261  14.554  1.00 94.24  ? 648  ASN A CG    1 
ATOM   5007  O  OD1   . ASN A  1  648  ? 133.576 36.167  14.252  1.00 84.33  ? 648  ASN A OD1   1 
ATOM   5008  N  ND2   . ASN A  1  648  ? 135.224 37.691  14.023  1.00 86.17  ? 648  ASN A ND2   1 
ATOM   5009  N  N     . ILE A  1  649  ? 131.283 40.225  16.585  1.00 74.42  ? 649  ILE A N     1 
ATOM   5010  C  CA    . ILE A  1  649  ? 130.763 41.161  17.583  1.00 73.52  ? 649  ILE A CA    1 
ATOM   5011  C  C     . ILE A  1  649  ? 129.455 40.579  18.145  1.00 78.38  ? 649  ILE A C     1 
ATOM   5012  O  O     . ILE A  1  649  ? 129.343 40.414  19.361  1.00 79.97  ? 649  ILE A O     1 
ATOM   5013  C  CB    . ILE A  1  649  ? 130.611 42.599  17.042  1.00 75.10  ? 649  ILE A CB    1 
ATOM   5014  C  CG1   . ILE A  1  649  ? 131.980 43.259  16.852  1.00 74.53  ? 649  ILE A CG1   1 
ATOM   5015  C  CG2   . ILE A  1  649  ? 129.726 43.438  17.960  1.00 75.91  ? 649  ILE A CG2   1 
ATOM   5016  C  CD1   . ILE A  1  649  ? 131.927 44.528  16.012  1.00 71.14  ? 649  ILE A CD1   1 
ATOM   5017  N  N     . GLN A  1  650  ? 128.533 40.167  17.249  1.00 73.24  ? 650  GLN A N     1 
ATOM   5018  C  CA    . GLN A  1  650  ? 127.248 39.538  17.582  1.00 72.79  ? 650  GLN A CA    1 
ATOM   5019  C  C     . GLN A  1  650  ? 127.426 38.315  18.518  1.00 77.83  ? 650  GLN A C     1 
ATOM   5020  O  O     . GLN A  1  650  ? 126.954 38.373  19.650  1.00 78.99  ? 650  GLN A O     1 
ATOM   5021  C  CB    . GLN A  1  650  ? 126.482 39.137  16.298  1.00 72.66  ? 650  GLN A CB    1 
ATOM   5022  C  CG    . GLN A  1  650  ? 125.523 40.182  15.764  1.00 73.51  ? 650  GLN A CG    1 
ATOM   5023  C  CD    . GLN A  1  650  ? 124.941 39.791  14.426  1.00 94.71  ? 650  GLN A CD    1 
ATOM   5024  O  OE1   . GLN A  1  650  ? 124.141 38.842  14.295  1.00 96.64  ? 650  GLN A OE1   1 
ATOM   5025  N  NE2   . GLN A  1  650  ? 125.266 40.570  13.413  1.00 80.58  ? 650  GLN A NE2   1 
ATOM   5026  N  N     . LYS A  1  651  ? 128.167 37.265  18.076  1.00 72.76  ? 651  LYS A N     1 
ATOM   5027  C  CA    . LYS A  1  651  ? 128.424 36.036  18.831  1.00 73.26  ? 651  LYS A CA    1 
ATOM   5028  C  C     . LYS A  1  651  ? 128.986 36.265  20.269  1.00 79.48  ? 651  LYS A C     1 
ATOM   5029  O  O     . LYS A  1  651  ? 128.653 35.503  21.192  1.00 79.83  ? 651  LYS A O     1 
ATOM   5030  C  CB    . LYS A  1  651  ? 129.331 35.081  18.029  1.00 74.88  ? 651  LYS A CB    1 
ATOM   5031  C  CG    . LYS A  1  651  ? 128.569 34.195  17.042  1.00 78.18  ? 651  LYS A CG    1 
ATOM   5032  C  CD    . LYS A  1  651  ? 129.483 33.385  16.109  1.00 80.26  ? 651  LYS A CD    1 
ATOM   5033  C  CE    . LYS A  1  651  ? 129.467 33.854  14.661  1.00 84.47  ? 651  LYS A CE    1 
ATOM   5034  N  NZ    . LYS A  1  651  ? 128.302 33.317  13.910  1.00 87.63  ? 651  LYS A NZ    1 
ATOM   5035  N  N     . VAL A  1  652  ? 129.810 37.314  20.452  1.00 75.51  ? 652  VAL A N     1 
ATOM   5036  C  CA    . VAL A  1  652  ? 130.412 37.633  21.749  1.00 75.98  ? 652  VAL A CA    1 
ATOM   5037  C  C     . VAL A  1  652  ? 129.444 38.408  22.640  1.00 78.21  ? 652  VAL A C     1 
ATOM   5038  O  O     . VAL A  1  652  ? 129.303 38.076  23.823  1.00 80.03  ? 652  VAL A O     1 
ATOM   5039  C  CB    . VAL A  1  652  ? 131.775 38.363  21.598  1.00 80.11  ? 652  VAL A CB    1 
ATOM   5040  C  CG1   . VAL A  1  652  ? 132.284 38.873  22.937  1.00 80.79  ? 652  VAL A CG1   1 
ATOM   5041  C  CG2   . VAL A  1  652  ? 132.800 37.436  20.990  1.00 80.16  ? 652  VAL A CG2   1 
ATOM   5042  N  N     . VAL A  1  653  ? 128.825 39.465  22.087  1.00 69.77  ? 653  VAL A N     1 
ATOM   5043  C  CA    . VAL A  1  653  ? 127.924 40.335  22.827  1.00 67.82  ? 653  VAL A CA    1 
ATOM   5044  C  C     . VAL A  1  653  ? 126.630 39.604  23.211  1.00 73.11  ? 653  VAL A C     1 
ATOM   5045  O  O     . VAL A  1  653  ? 126.220 39.688  24.376  1.00 73.89  ? 653  VAL A O     1 
ATOM   5046  C  CB    . VAL A  1  653  ? 127.681 41.666  22.092  1.00 69.04  ? 653  VAL A CB    1 
ATOM   5047  C  CG1   . VAL A  1  653  ? 126.735 42.554  22.874  1.00 68.82  ? 653  VAL A CG1   1 
ATOM   5048  C  CG2   . VAL A  1  653  ? 128.990 42.394  21.821  1.00 68.72  ? 653  VAL A CG2   1 
ATOM   5049  N  N     . ASN A  1  654  ? 126.022 38.846  22.256  1.00 68.76  ? 654  ASN A N     1 
ATOM   5050  C  CA    . ASN A  1  654  ? 124.788 38.082  22.485  1.00 68.13  ? 654  ASN A CA    1 
ATOM   5051  C  C     . ASN A  1  654  ? 124.995 37.010  23.532  1.00 74.28  ? 654  ASN A C     1 
ATOM   5052  O  O     . ASN A  1  654  ? 124.075 36.717  24.303  1.00 75.71  ? 654  ASN A O     1 
ATOM   5053  C  CB    . ASN A  1  654  ? 124.267 37.465  21.206  1.00 66.53  ? 654  ASN A CB    1 
ATOM   5054  C  CG    . ASN A  1  654  ? 123.868 38.438  20.129  1.00 84.72  ? 654  ASN A CG    1 
ATOM   5055  O  OD1   . ASN A  1  654  ? 123.520 39.609  20.395  1.00 66.05  ? 654  ASN A OD1   1 
ATOM   5056  N  ND2   . ASN A  1  654  ? 123.910 37.941  18.881  1.00 78.04  ? 654  ASN A ND2   1 
ATOM   5057  N  N     . PHE A  1  655  ? 126.213 36.438  23.578  1.00 70.69  ? 655  PHE A N     1 
ATOM   5058  C  CA    . PHE A  1  655  ? 126.589 35.461  24.595  1.00 70.80  ? 655  PHE A CA    1 
ATOM   5059  C  C     . PHE A  1  655  ? 126.627 36.145  25.954  1.00 75.19  ? 655  PHE A C     1 
ATOM   5060  O  O     . PHE A  1  655  ? 126.058 35.637  26.916  1.00 74.69  ? 655  PHE A O     1 
ATOM   5061  C  CB    . PHE A  1  655  ? 127.974 34.850  24.307  1.00 72.02  ? 655  PHE A CB    1 
ATOM   5062  C  CG    . PHE A  1  655  ? 128.398 33.877  25.377  1.00 73.44  ? 655  PHE A CG    1 
ATOM   5063  C  CD1   . PHE A  1  655  ? 127.939 32.568  25.368  1.00 73.81  ? 655  PHE A CD1   1 
ATOM   5064  C  CD2   . PHE A  1  655  ? 129.220 34.281  26.418  1.00 77.83  ? 655  PHE A CD2   1 
ATOM   5065  C  CE1   . PHE A  1  655  ? 128.299 31.677  26.373  1.00 77.81  ? 655  PHE A CE1   1 
ATOM   5066  C  CE2   . PHE A  1  655  ? 129.594 33.382  27.417  1.00 80.07  ? 655  PHE A CE2   1 
ATOM   5067  C  CZ    . PHE A  1  655  ? 129.128 32.084  27.389  1.00 77.85  ? 655  PHE A CZ    1 
ATOM   5068  N  N     . TRP A  1  656  ? 127.333 37.277  26.029  1.00 73.20  ? 656  TRP A N     1 
ATOM   5069  C  CA    . TRP A  1  656  ? 127.475 38.008  27.266  1.00 75.23  ? 656  TRP A CA    1 
ATOM   5070  C  C     . TRP A  1  656  ? 126.127 38.473  27.792  1.00 78.82  ? 656  TRP A C     1 
ATOM   5071  O  O     . TRP A  1  656  ? 125.819 38.243  28.972  1.00 79.37  ? 656  TRP A O     1 
ATOM   5072  C  CB    . TRP A  1  656  ? 128.490 39.140  27.130  1.00 74.89  ? 656  TRP A CB    1 
ATOM   5073  C  CG    . TRP A  1  656  ? 128.670 39.891  28.410  1.00 77.91  ? 656  TRP A CG    1 
ATOM   5074  C  CD1   . TRP A  1  656  ? 129.490 39.563  29.448  1.00 82.25  ? 656  TRP A CD1   1 
ATOM   5075  C  CD2   . TRP A  1  656  ? 127.934 41.045  28.826  1.00 78.27  ? 656  TRP A CD2   1 
ATOM   5076  N  NE1   . TRP A  1  656  ? 129.345 40.473  30.471  1.00 83.14  ? 656  TRP A NE1   1 
ATOM   5077  C  CE2   . TRP A  1  656  ? 128.388 41.389  30.119  1.00 83.92  ? 656  TRP A CE2   1 
ATOM   5078  C  CE3   . TRP A  1  656  ? 126.920 41.819  28.233  1.00 78.74  ? 656  TRP A CE3   1 
ATOM   5079  C  CZ2   . TRP A  1  656  ? 127.885 42.489  30.817  1.00 83.87  ? 656  TRP A CZ2   1 
ATOM   5080  C  CZ3   . TRP A  1  656  ? 126.418 42.901  28.931  1.00 80.81  ? 656  TRP A CZ3   1 
ATOM   5081  C  CH2   . TRP A  1  656  ? 126.904 43.233  30.202  1.00 82.86  ? 656  TRP A CH2   1 
ATOM   5082  N  N     . LEU A  1  657  ? 125.312 39.073  26.905  1.00 73.72  ? 657  LEU A N     1 
ATOM   5083  C  CA    . LEU A  1  657  ? 123.978 39.544  27.253  1.00 73.20  ? 657  LEU A CA    1 
ATOM   5084  C  C     . LEU A  1  657  ? 123.106 38.381  27.723  1.00 80.37  ? 657  LEU A C     1 
ATOM   5085  O  O     . LEU A  1  657  ? 122.491 38.521  28.772  1.00 82.05  ? 657  LEU A O     1 
ATOM   5086  C  CB    . LEU A  1  657  ? 123.327 40.336  26.114  1.00 71.12  ? 657  LEU A CB    1 
ATOM   5087  C  CG    . LEU A  1  657  ? 122.073 41.158  26.447  1.00 74.26  ? 657  LEU A CG    1 
ATOM   5088  C  CD1   . LEU A  1  657  ? 122.357 42.253  27.459  1.00 74.48  ? 657  LEU A CD1   1 
ATOM   5089  C  CD2   . LEU A  1  657  ? 121.500 41.790  25.189  1.00 74.92  ? 657  LEU A CD2   1 
ATOM   5090  N  N     . LEU A  1  658  ? 123.137 37.203  27.036  1.00 76.12  ? 658  LEU A N     1 
ATOM   5091  C  CA    . LEU A  1  658  ? 122.374 36.019  27.469  1.00 75.41  ? 658  LEU A CA    1 
ATOM   5092  C  C     . LEU A  1  658  ? 122.566 35.741  28.967  1.00 81.79  ? 658  LEU A C     1 
ATOM   5093  O  O     . LEU A  1  658  ? 121.585 35.503  29.667  1.00 81.55  ? 658  LEU A O     1 
ATOM   5094  C  CB    . LEU A  1  658  ? 122.739 34.769  26.633  1.00 74.22  ? 658  LEU A CB    1 
ATOM   5095  C  CG    . LEU A  1  658  ? 122.153 33.392  27.060  1.00 78.84  ? 658  LEU A CG    1 
ATOM   5096  C  CD1   . LEU A  1  658  ? 120.649 33.378  27.002  1.00 78.95  ? 658  LEU A CD1   1 
ATOM   5097  C  CD2   . LEU A  1  658  ? 122.604 32.274  26.123  1.00 79.62  ? 658  LEU A CD2   1 
ATOM   5098  N  N     . HIS A  1  659  ? 123.815 35.874  29.455  1.00 80.39  ? 659  HIS A N     1 
ATOM   5099  C  CA    . HIS A  1  659  ? 124.218 35.580  30.827  1.00 81.80  ? 659  HIS A CA    1 
ATOM   5100  C  C     . HIS A  1  659  ? 124.222 36.753  31.760  1.00 84.99  ? 659  HIS A C     1 
ATOM   5101  O  O     . HIS A  1  659  ? 124.346 36.549  32.963  1.00 85.42  ? 659  HIS A O     1 
ATOM   5102  C  CB    . HIS A  1  659  ? 125.565 34.874  30.832  1.00 83.40  ? 659  HIS A CB    1 
ATOM   5103  C  CG    . HIS A  1  659  ? 125.447 33.533  30.191  1.00 86.37  ? 659  HIS A CG    1 
ATOM   5104  N  ND1   . HIS A  1  659  ? 125.546 33.387  28.824  1.00 86.91  ? 659  HIS A ND1   1 
ATOM   5105  C  CD2   . HIS A  1  659  ? 125.083 32.351  30.734  1.00 88.80  ? 659  HIS A CD2   1 
ATOM   5106  C  CE1   . HIS A  1  659  ? 125.316 32.108  28.585  1.00 86.45  ? 659  HIS A CE1   1 
ATOM   5107  N  NE2   . HIS A  1  659  ? 125.024 31.448  29.703  1.00 87.84  ? 659  HIS A NE2   1 
ATOM   5108  N  N     . ASN A  1  660  ? 124.003 37.959  31.241  1.00 81.11  ? 660  ASN A N     1 
ATOM   5109  C  CA    . ASN A  1  660  ? 123.891 39.160  32.071  1.00 81.34  ? 660  ASN A CA    1 
ATOM   5110  C  C     . ASN A  1  660  ? 122.403 39.527  32.243  1.00 82.42  ? 660  ASN A C     1 
ATOM   5111  O  O     . ASN A  1  660  ? 121.947 39.804  33.353  1.00 82.32  ? 660  ASN A O     1 
ATOM   5112  C  CB    . ASN A  1  660  ? 124.663 40.316  31.439  1.00 82.20  ? 660  ASN A CB    1 
ATOM   5113  C  CG    . ASN A  1  660  ? 124.917 41.436  32.401  1.00 98.94  ? 660  ASN A CG    1 
ATOM   5114  O  OD1   . ASN A  1  660  ? 125.898 41.414  33.149  1.00 98.87  ? 660  ASN A OD1   1 
ATOM   5115  N  ND2   . ASN A  1  660  ? 124.035 42.435  32.406  1.00 83.74  ? 660  ASN A ND2   1 
ATOM   5116  N  N     . GLY A  1  661  ? 121.674 39.475  31.132  1.00 76.72  ? 661  GLY A N     1 
ATOM   5117  C  CA    . GLY A  1  661  ? 120.262 39.797  31.025  1.00 76.31  ? 661  GLY A CA    1 
ATOM   5118  C  C     . GLY A  1  661  ? 120.061 41.285  30.829  1.00 81.59  ? 661  GLY A C     1 
ATOM   5119  O  O     . GLY A  1  661  ? 121.011 42.076  30.944  1.00 83.30  ? 661  GLY A O     1 
ATOM   5120  N  N     . PHE A  1  662  ? 118.811 41.666  30.519  1.00 75.17  ? 662  PHE A N     1 
ATOM   5121  C  CA    . PHE A  1  662  ? 118.320 43.028  30.343  1.00 73.27  ? 662  PHE A CA    1 
ATOM   5122  C  C     . PHE A  1  662  ? 116.797 42.935  30.272  1.00 77.15  ? 662  PHE A C     1 
ATOM   5123  O  O     . PHE A  1  662  ? 116.277 41.926  29.783  1.00 76.12  ? 662  PHE A O     1 
ATOM   5124  C  CB    . PHE A  1  662  ? 118.929 43.699  29.098  1.00 73.72  ? 662  PHE A CB    1 
ATOM   5125  C  CG    . PHE A  1  662  ? 118.622 45.178  29.016  1.00 75.45  ? 662  PHE A CG    1 
ATOM   5126  C  CD1   . PHE A  1  662  ? 119.264 46.087  29.850  1.00 79.41  ? 662  PHE A CD1   1 
ATOM   5127  C  CD2   . PHE A  1  662  ? 117.665 45.657  28.131  1.00 76.19  ? 662  PHE A CD2   1 
ATOM   5128  C  CE1   . PHE A  1  662  ? 118.945 47.443  29.803  1.00 80.04  ? 662  PHE A CE1   1 
ATOM   5129  C  CE2   . PHE A  1  662  ? 117.355 47.015  28.082  1.00 78.63  ? 662  PHE A CE2   1 
ATOM   5130  C  CZ    . PHE A  1  662  ? 118.003 47.898  28.908  1.00 77.67  ? 662  PHE A CZ    1 
ATOM   5131  N  N     . SER A  1  663  ? 116.076 43.936  30.810  1.00 75.17  ? 663  SER A N     1 
ATOM   5132  C  CA    . SER A  1  663  ? 114.603 43.923  30.850  1.00 75.69  ? 663  SER A CA    1 
ATOM   5133  C  C     . SER A  1  663  ? 114.035 45.348  30.835  1.00 82.69  ? 663  SER A C     1 
ATOM   5134  O  O     . SER A  1  663  ? 114.803 46.289  30.676  1.00 82.80  ? 663  SER A O     1 
ATOM   5135  C  CB    . SER A  1  663  ? 114.143 43.180  32.108  1.00 79.93  ? 663  SER A CB    1 
ATOM   5136  O  OG    . SER A  1  663  ? 112.738 43.025  32.233  1.00 86.34  ? 663  SER A OG    1 
ATOM   5137  N  N     . THR A  1  664  ? 112.692 45.506  30.951  1.00 81.46  ? 664  THR A N     1 
ATOM   5138  C  CA    . THR A  1  664  ? 111.958 46.784  31.080  1.00 82.57  ? 664  THR A CA    1 
ATOM   5139  C  C     . THR A  1  664  ? 110.616 46.514  31.755  1.00 88.91  ? 664  THR A C     1 
ATOM   5140  O  O     . THR A  1  664  ? 109.919 45.579  31.373  1.00 88.09  ? 664  THR A O     1 
ATOM   5141  C  CB    . THR A  1  664  ? 111.791 47.566  29.749  1.00 87.51  ? 664  THR A CB    1 
ATOM   5142  O  OG1   . THR A  1  664  ? 113.060 47.714  29.144  1.00 88.91  ? 664  THR A OG1   1 
ATOM   5143  C  CG2   . THR A  1  664  ? 111.251 48.974  29.964  1.00 85.86  ? 664  THR A CG2   1 
ATOM   5144  N  N     . GLY A  1  665  ? 110.281 47.330  32.747  1.00 88.06  ? 665  GLY A N     1 
ATOM   5145  C  CA    . GLY A  1  665  ? 109.018 47.242  33.474  1.00 89.22  ? 665  GLY A CA    1 
ATOM   5146  C  C     . GLY A  1  665  ? 108.472 48.614  33.784  1.00 94.09  ? 665  GLY A C     1 
ATOM   5147  O  O     . GLY A  1  665  ? 109.157 49.603  33.486  1.00 94.30  ? 665  GLY A O     1 
ATOM   5148  N  N     . ILE A  1  666  ? 107.251 48.698  34.398  1.00 90.24  ? 666  ILE A N     1 
ATOM   5149  C  CA    . ILE A  1  666  ? 106.650 50.003  34.766  1.00 90.30  ? 666  ILE A CA    1 
ATOM   5150  C  C     . ILE A  1  666  ? 107.622 50.818  35.554  1.00 97.06  ? 666  ILE A C     1 
ATOM   5151  O  O     . ILE A  1  666  ? 107.771 51.986  35.245  1.00 97.56  ? 666  ILE A O     1 
ATOM   5152  C  CB    . ILE A  1  666  ? 105.255 50.052  35.450  1.00 93.13  ? 666  ILE A CB    1 
ATOM   5153  C  CG1   . ILE A  1  666  ? 104.725 48.671  35.801  1.00 93.91  ? 666  ILE A CG1   1 
ATOM   5154  C  CG2   . ILE A  1  666  ? 104.253 50.860  34.630  1.00 91.58  ? 666  ILE A CG2   1 
ATOM   5155  C  CD1   . ILE A  1  666  ? 105.390 48.089  36.989  1.00 105.74 ? 666  ILE A CD1   1 
ATOM   5156  N  N     . GLY A  1  667  ? 108.326 50.194  36.499  1.00 94.77  ? 667  GLY A N     1 
ATOM   5157  C  CA    . GLY A  1  667  ? 109.333 50.851  37.328  1.00 95.73  ? 667  GLY A CA    1 
ATOM   5158  C  C     . GLY A  1  667  ? 110.194 51.885  36.619  1.00 98.97  ? 667  GLY A C     1 
ATOM   5159  O  O     . GLY A  1  667  ? 110.512 52.929  37.202  1.00 100.07 ? 667  GLY A O     1 
ATOM   5160  N  N     . ASP A  1  668  ? 110.546 51.611  35.343  1.00 93.10  ? 668  ASP A N     1 
ATOM   5161  C  CA    . ASP A  1  668  ? 111.371 52.471  34.493  1.00 92.25  ? 668  ASP A CA    1 
ATOM   5162  C  C     . ASP A  1  668  ? 110.681 53.771  34.033  1.00 96.30  ? 668  ASP A C     1 
ATOM   5163  O  O     . ASP A  1  668  ? 111.362 54.659  33.528  1.00 95.49  ? 668  ASP A O     1 
ATOM   5164  C  CB    . ASP A  1  668  ? 111.909 51.681  33.294  1.00 92.61  ? 668  ASP A CB    1 
ATOM   5165  C  CG    . ASP A  1  668  ? 112.806 50.528  33.685  1.00 99.41  ? 668  ASP A CG    1 
ATOM   5166  O  OD1   . ASP A  1  668  ? 113.852 50.783  34.326  1.00 97.91  ? 668  ASP A OD1   1 
ATOM   5167  O  OD2   . ASP A  1  668  ? 112.466 49.366  33.342  1.00 105.53 ? 668  ASP A OD2   1 
ATOM   5168  N  N     . THR A  1  669  ? 109.351 53.880  34.191  1.00 93.87  ? 669  THR A N     1 
ATOM   5169  C  CA    . THR A  1  669  ? 108.560 55.080  33.865  1.00 94.36  ? 669  THR A CA    1 
ATOM   5170  C  C     . THR A  1  669  ? 108.361 55.947  35.138  1.00 102.45 ? 669  THR A C     1 
ATOM   5171  O  O     . THR A  1  669  ? 108.070 57.148  35.048  1.00 103.64 ? 669  THR A O     1 
ATOM   5172  C  CB    . THR A  1  669  ? 107.216 54.717  33.190  1.00 98.04  ? 669  THR A CB    1 
ATOM   5173  O  OG1   . THR A  1  669  ? 106.403 53.963  34.076  1.00 96.95  ? 669  THR A OG1   1 
ATOM   5174  C  CG2   . THR A  1  669  ? 107.386 53.943  31.908  1.00 94.78  ? 669  THR A CG2   1 
ATOM   5175  N  N     . ILE A  1  670  ? 108.536 55.333  36.323  1.00 99.99  ? 670  ILE A N     1 
ATOM   5176  C  CA    . ILE A  1  670  ? 108.378 56.000  37.611  1.00 101.16 ? 670  ILE A CA    1 
ATOM   5177  C  C     . ILE A  1  670  ? 109.544 56.943  37.905  1.00 106.34 ? 670  ILE A C     1 
ATOM   5178  O  O     . ILE A  1  670  ? 110.702 56.546  37.769  1.00 105.81 ? 670  ILE A O     1 
ATOM   5179  C  CB    . ILE A  1  670  ? 108.129 54.949  38.732  1.00 104.76 ? 670  ILE A CB    1 
ATOM   5180  C  CG1   . ILE A  1  670  ? 106.692 54.417  38.658  1.00 104.80 ? 670  ILE A CG1   1 
ATOM   5181  C  CG2   . ILE A  1  670  ? 108.373 55.522  40.124  1.00 107.59 ? 670  ILE A CG2   1 
ATOM   5182  C  CD1   . ILE A  1  670  ? 106.540 53.057  38.163  1.00 108.89 ? 670  ILE A CD1   1 
ATOM   5183  N  N     . ALA A  1  671  ? 109.222 58.196  38.292  1.00 104.24 ? 671  ALA A N     1 
ATOM   5184  C  CA    . ALA A  1  671  ? 110.184 59.226  38.710  1.00 104.72 ? 671  ALA A CA    1 
ATOM   5185  C  C     . ALA A  1  671  ? 109.856 59.683  40.137  1.00 110.91 ? 671  ALA A C     1 
ATOM   5186  O  O     . ALA A  1  671  ? 108.687 59.661  40.529  1.00 110.57 ? 671  ALA A O     1 
ATOM   5187  C  CB    . ALA A  1  671  ? 110.147 60.407  37.760  1.00 104.83 ? 671  ALA A CB    1 
ATOM   5188  N  N     . ASP A  1  672  ? 110.897 60.074  40.914  1.00 109.71 ? 672  ASP A N     1 
ATOM   5189  C  CA    . ASP A  1  672  ? 110.860 60.553  42.314  1.00 111.44 ? 672  ASP A CA    1 
ATOM   5190  C  C     . ASP A  1  672  ? 109.663 61.424  42.643  1.00 116.55 ? 672  ASP A C     1 
ATOM   5191  O  O     . ASP A  1  672  ? 109.276 62.264  41.833  1.00 116.01 ? 672  ASP A O     1 
ATOM   5192  C  CB    . ASP A  1  672  ? 112.110 61.407  42.609  1.00 114.05 ? 672  ASP A CB    1 
ATOM   5193  C  CG    . ASP A  1  672  ? 113.310 60.716  43.223  1.00 130.16 ? 672  ASP A CG    1 
ATOM   5194  O  OD1   . ASP A  1  672  ? 113.531 59.516  42.923  1.00 132.33 ? 672  ASP A OD1   1 
ATOM   5195  O  OD2   . ASP A  1  672  ? 114.100 61.406  43.906  1.00 136.96 ? 672  ASP A OD2   1 
ATOM   5196  N  N     . GLY A  1  673  ? 109.132 61.266  43.850  1.00 114.80 ? 673  GLY A N     1 
ATOM   5197  C  CA    . GLY A  1  673  ? 108.059 62.118  44.353  1.00 115.89 ? 673  GLY A CA    1 
ATOM   5198  C  C     . GLY A  1  673  ? 108.451 63.582  44.196  1.00 120.18 ? 673  GLY A C     1 
ATOM   5199  O  O     . GLY A  1  673  ? 107.745 64.312  43.491  1.00 118.63 ? 673  GLY A O     1 
ATOM   5200  N  N     . PRO A  1  674  ? 109.647 64.014  44.721  1.00 117.85 ? 674  PRO A N     1 
ATOM   5201  C  CA    . PRO A  1  674  ? 110.090 65.408  44.517  1.00 117.82 ? 674  PRO A CA    1 
ATOM   5202  C  C     . PRO A  1  674  ? 110.144 65.848  43.057  1.00 118.94 ? 674  PRO A C     1 
ATOM   5203  O  O     . PRO A  1  674  ? 109.712 66.962  42.750  1.00 119.15 ? 674  PRO A O     1 
ATOM   5204  C  CB    . PRO A  1  674  ? 111.483 65.444  45.166  1.00 120.40 ? 674  PRO A CB    1 
ATOM   5205  C  CG    . PRO A  1  674  ? 111.895 64.026  45.305  1.00 124.43 ? 674  PRO A CG    1 
ATOM   5206  C  CD    . PRO A  1  674  ? 110.620 63.291  45.567  1.00 120.08 ? 674  PRO A CD    1 
ATOM   5207  N  N     . THR A  1  675  ? 110.638 64.968  42.161  1.00 112.59 ? 675  THR A N     1 
ATOM   5208  C  CA    . THR A  1  675  ? 110.711 65.228  40.720  1.00 110.18 ? 675  THR A CA    1 
ATOM   5209  C  C     . THR A  1  675  ? 109.297 65.440  40.183  1.00 113.19 ? 675  THR A C     1 
ATOM   5210  O  O     . THR A  1  675  ? 109.054 66.392  39.443  1.00 112.51 ? 675  THR A O     1 
ATOM   5211  C  CB    . THR A  1  675  ? 111.440 64.083  40.025  1.00 112.29 ? 675  THR A CB    1 
ATOM   5212  O  OG1   . THR A  1  675  ? 112.715 63.933  40.637  1.00 113.36 ? 675  THR A OG1   1 
ATOM   5213  C  CG2   . THR A  1  675  ? 111.608 64.311  38.538  1.00 107.16 ? 675  THR A CG2   1 
ATOM   5214  N  N     . MET A  1  676  ? 108.361 64.595  40.626  1.00 109.50 ? 676  MET A N     1 
ATOM   5215  C  CA    . MET A  1  676  ? 106.953 64.661  40.259  1.00 108.84 ? 676  MET A CA    1 
ATOM   5216  C  C     . MET A  1  676  ? 106.261 65.937  40.754  1.00 114.36 ? 676  MET A C     1 
ATOM   5217  O  O     . MET A  1  676  ? 105.348 66.425  40.083  1.00 113.38 ? 676  MET A O     1 
ATOM   5218  C  CB    . MET A  1  676  ? 106.215 63.393  40.710  1.00 110.75 ? 676  MET A CB    1 
ATOM   5219  C  CG    . MET A  1  676  ? 106.441 62.228  39.796  1.00 111.82 ? 676  MET A CG    1 
ATOM   5220  S  SD    . MET A  1  676  ? 106.079 62.681  38.095  1.00 113.65 ? 676  MET A SD    1 
ATOM   5221  C  CE    . MET A  1  676  ? 105.047 61.238  37.575  1.00 109.53 ? 676  MET A CE    1 
ATOM   5222  N  N     . ARG A  1  677  ? 106.704 66.486  41.908  1.00 112.77 ? 677  ARG A N     1 
ATOM   5223  C  CA    . ARG A  1  677  ? 106.174 67.747  42.441  1.00 113.90 ? 677  ARG A CA    1 
ATOM   5224  C  C     . ARG A  1  677  ? 106.645 68.879  41.514  1.00 116.00 ? 677  ARG A C     1 
ATOM   5225  O  O     . ARG A  1  677  ? 105.816 69.641  41.000  1.00 114.59 ? 677  ARG A O     1 
ATOM   5226  C  CB    . ARG A  1  677  ? 106.638 67.972  43.889  1.00 116.41 ? 677  ARG A CB    1 
ATOM   5227  C  CG    . ARG A  1  677  ? 105.531 67.769  44.916  1.00 130.07 ? 677  ARG A CG    1 
ATOM   5228  C  CD    . ARG A  1  677  ? 106.069 67.714  46.336  1.00 146.41 ? 677  ARG A CD    1 
ATOM   5229  N  NE    . ARG A  1  677  ? 106.573 66.381  46.680  1.00 158.08 ? 677  ARG A NE    1 
ATOM   5230  C  CZ    . ARG A  1  677  ? 107.786 66.132  47.170  1.00 172.92 ? 677  ARG A CZ    1 
ATOM   5231  N  NH1   . ARG A  1  677  ? 108.642 67.126  47.382  1.00 162.11 ? 677  ARG A NH1   1 
ATOM   5232  N  NH2   . ARG A  1  677  ? 108.154 64.886  47.444  1.00 155.89 ? 677  ARG A NH2   1 
ATOM   5233  N  N     . GLU A  1  678  ? 107.973 68.903  41.232  1.00 112.06 ? 678  GLU A N     1 
ATOM   5234  C  CA    . GLU A  1  678  ? 108.668 69.830  40.336  1.00 111.41 ? 678  GLU A CA    1 
ATOM   5235  C  C     . GLU A  1  678  ? 107.994 69.838  38.953  1.00 112.68 ? 678  GLU A C     1 
ATOM   5236  O  O     . GLU A  1  678  ? 107.703 70.911  38.437  1.00 112.16 ? 678  GLU A O     1 
ATOM   5237  C  CB    . GLU A  1  678  ? 110.153 69.431  40.214  1.00 112.61 ? 678  GLU A CB    1 
ATOM   5238  C  CG    . GLU A  1  678  ? 111.152 70.574  40.361  1.00 125.39 ? 678  GLU A CG    1 
ATOM   5239  C  CD    . GLU A  1  678  ? 112.621 70.213  40.187  1.00 145.58 ? 678  GLU A CD    1 
ATOM   5240  O  OE1   . GLU A  1  678  ? 112.980 69.026  40.374  1.00 146.65 ? 678  GLU A OE1   1 
ATOM   5241  O  OE2   . GLU A  1  678  ? 113.409 71.115  39.816  1.00 120.02 ? 678  GLU A OE2   1 
ATOM   5242  N  N     . ILE A  1  679  ? 107.697 68.642  38.391  1.00 107.37 ? 679  ILE A N     1 
ATOM   5243  C  CA    . ILE A  1  679  ? 107.024 68.477  37.094  1.00 105.43 ? 679  ILE A CA    1 
ATOM   5244  C  C     . ILE A  1  679  ? 105.607 69.083  37.123  1.00 112.42 ? 679  ILE A C     1 
ATOM   5245  O  O     . ILE A  1  679  ? 105.260 69.835  36.210  1.00 111.22 ? 679  ILE A O     1 
ATOM   5246  C  CB    . ILE A  1  679  ? 107.063 66.995  36.617  1.00 106.18 ? 679  ILE A CB    1 
ATOM   5247  C  CG1   . ILE A  1  679  ? 108.489 66.599  36.215  1.00 104.96 ? 679  ILE A CG1   1 
ATOM   5248  C  CG2   . ILE A  1  679  ? 106.093 66.738  35.457  1.00 105.44 ? 679  ILE A CG2   1 
ATOM   5249  C  CD1   . ILE A  1  679  ? 108.774 65.159  36.262  1.00 107.87 ? 679  ILE A CD1   1 
ATOM   5250  N  N     . THR A  1  680  ? 104.816 68.786  38.187  1.00 112.38 ? 680  THR A N     1 
ATOM   5251  C  CA    . THR A  1  680  ? 103.455 69.303  38.386  1.00 113.64 ? 680  THR A CA    1 
ATOM   5252  C  C     . THR A  1  680  ? 103.467 70.834  38.480  1.00 119.60 ? 680  THR A C     1 
ATOM   5253  O  O     . THR A  1  680  ? 102.673 71.479  37.792  1.00 118.93 ? 680  THR A O     1 
ATOM   5254  C  CB    . THR A  1  680  ? 102.757 68.600  39.570  1.00 122.33 ? 680  THR A CB    1 
ATOM   5255  O  OG1   . THR A  1  680  ? 102.449 67.261  39.183  1.00 119.33 ? 680  THR A OG1   1 
ATOM   5256  C  CG2   . THR A  1  680  ? 101.461 69.290  39.999  1.00 123.02 ? 680  THR A CG2   1 
ATOM   5257  N  N     . GLU A  1  681  ? 104.386 71.411  39.282  1.00 118.28 ? 681  GLU A N     1 
ATOM   5258  C  CA    . GLU A  1  681  ? 104.470 72.872  39.411  1.00 119.99 ? 681  GLU A CA    1 
ATOM   5259  C  C     . GLU A  1  681  ? 105.061 73.543  38.137  1.00 122.13 ? 681  GLU A C     1 
ATOM   5260  O  O     . GLU A  1  681  ? 104.790 74.725  37.911  1.00 122.72 ? 681  GLU A O     1 
ATOM   5261  C  CB    . GLU A  1  681  ? 105.172 73.334  40.721  1.00 123.42 ? 681  GLU A CB    1 
ATOM   5262  C  CG    . GLU A  1  681  ? 106.625 72.911  40.927  1.00 136.77 ? 681  GLU A CG    1 
ATOM   5263  C  CD    . GLU A  1  681  ? 107.190 73.029  42.338  1.00 159.68 ? 681  GLU A CD    1 
ATOM   5264  O  OE1   . GLU A  1  681  ? 106.532 72.559  43.297  1.00 153.87 ? 681  GLU A OE1   1 
ATOM   5265  O  OE2   . GLU A  1  681  ? 108.329 73.534  42.474  1.00 151.02 ? 681  GLU A OE2   1 
ATOM   5266  N  N     . THR A  1  682  ? 105.795 72.778  37.288  1.00 115.65 ? 682  THR A N     1 
ATOM   5267  C  CA    . THR A  1  682  ? 106.364 73.260  36.021  1.00 113.53 ? 682  THR A CA    1 
ATOM   5268  C  C     . THR A  1  682  ? 105.241 73.460  34.998  1.00 116.06 ? 682  THR A C     1 
ATOM   5269  O  O     . THR A  1  682  ? 105.263 74.440  34.253  1.00 114.62 ? 682  THR A O     1 
ATOM   5270  C  CB    . THR A  1  682  ? 107.502 72.331  35.562  1.00 117.47 ? 682  THR A CB    1 
ATOM   5271  O  OG1   . THR A  1  682  ? 108.691 72.677  36.262  1.00 116.48 ? 682  THR A OG1   1 
ATOM   5272  C  CG2   . THR A  1  682  ? 107.780 72.406  34.086  1.00 114.99 ? 682  THR A CG2   1 
ATOM   5273  N  N     . ILE A  1  683  ? 104.265 72.525  34.969  1.00 113.42 ? 683  ILE A N     1 
ATOM   5274  C  CA    . ILE A  1  683  ? 103.096 72.595  34.080  1.00 113.34 ? 683  ILE A CA    1 
ATOM   5275  C  C     . ILE A  1  683  ? 102.217 73.746  34.577  1.00 119.92 ? 683  ILE A C     1 
ATOM   5276  O  O     . ILE A  1  683  ? 101.809 74.592  33.778  1.00 119.23 ? 683  ILE A O     1 
ATOM   5277  C  CB    . ILE A  1  683  ? 102.308 71.245  33.978  1.00 115.80 ? 683  ILE A CB    1 
ATOM   5278  C  CG1   . ILE A  1  683  ? 103.222 70.072  33.548  1.00 115.63 ? 683  ILE A CG1   1 
ATOM   5279  C  CG2   . ILE A  1  683  ? 101.125 71.368  33.008  1.00 115.30 ? 683  ILE A CG2   1 
ATOM   5280  C  CD1   . ILE A  1  683  ? 102.731 68.640  34.009  1.00 127.04 ? 683  ILE A CD1   1 
ATOM   5281  N  N     . ALA A  1  684  ? 101.981 73.791  35.911  1.00 119.00 ? 684  ALA A N     1 
ATOM   5282  C  CA    . ALA A  1  684  ? 101.183 74.795  36.623  1.00 120.48 ? 684  ALA A CA    1 
ATOM   5283  C  C     . ALA A  1  684  ? 101.643 76.210  36.325  1.00 125.03 ? 684  ALA A C     1 
ATOM   5284  O  O     . ALA A  1  684  ? 100.809 77.062  36.011  1.00 125.05 ? 684  ALA A O     1 
ATOM   5285  C  CB    . ALA A  1  684  ? 101.233 74.539  38.119  1.00 122.54 ? 684  ALA A CB    1 
ATOM   5286  N  N     . GLU A  1  685  ? 102.961 76.456  36.391  1.00 122.06 ? 685  GLU A N     1 
ATOM   5287  C  CA    . GLU A  1  685  ? 103.497 77.779  36.102  1.00 123.11 ? 685  GLU A CA    1 
ATOM   5288  C  C     . GLU A  1  685  ? 103.241 78.162  34.631  1.00 124.79 ? 685  GLU A C     1 
ATOM   5289  O  O     . GLU A  1  685  ? 102.783 79.276  34.380  1.00 125.88 ? 685  GLU A O     1 
ATOM   5290  C  CB    . GLU A  1  685  ? 104.976 77.935  36.544  1.00 125.32 ? 685  GLU A CB    1 
ATOM   5291  C  CG    . GLU A  1  685  ? 105.997 77.107  35.769  1.00 140.36 ? 685  GLU A CG    1 
ATOM   5292  C  CD    . GLU A  1  685  ? 107.444 77.104  36.238  1.00 169.52 ? 685  GLU A CD    1 
ATOM   5293  O  OE1   . GLU A  1  685  ? 107.758 77.767  37.255  1.00 163.27 ? 685  GLU A OE1   1 
ATOM   5294  O  OE2   . GLU A  1  685  ? 108.265 76.417  35.585  1.00 163.73 ? 685  GLU A OE2   1 
ATOM   5295  N  N     . ALA A  1  686  ? 103.436 77.217  33.684  1.00 118.09 ? 686  ALA A N     1 
ATOM   5296  C  CA    . ALA A  1  686  ? 103.197 77.455  32.255  1.00 116.25 ? 686  ALA A CA    1 
ATOM   5297  C  C     . ALA A  1  686  ? 101.721 77.740  31.947  1.00 119.63 ? 686  ALA A C     1 
ATOM   5298  O  O     . ALA A  1  686  ? 101.434 78.510  31.028  1.00 119.20 ? 686  ALA A O     1 
ATOM   5299  C  CB    . ALA A  1  686  ? 103.690 76.286  31.431  1.00 115.08 ? 686  ALA A CB    1 
ATOM   5300  N  N     . LYS A  1  687  ? 100.791 77.136  32.725  1.00 115.40 ? 687  LYS A N     1 
ATOM   5301  C  CA    . LYS A  1  687  ? 99.348  77.351  32.585  1.00 114.68 ? 687  LYS A CA    1 
ATOM   5302  C  C     . LYS A  1  687  ? 99.042  78.807  32.928  1.00 119.48 ? 687  LYS A C     1 
ATOM   5303  O  O     . LYS A  1  687  ? 98.307  79.464  32.187  1.00 119.36 ? 687  LYS A O     1 
ATOM   5304  C  CB    . LYS A  1  687  ? 98.553  76.402  33.503  1.00 116.35 ? 687  LYS A CB    1 
ATOM   5305  C  CG    . LYS A  1  687  ? 98.079  75.125  32.824  1.00 116.91 ? 687  LYS A CG    1 
ATOM   5306  C  CD    . LYS A  1  687  ? 98.299  73.893  33.704  1.00 123.35 ? 687  LYS A CD    1 
ATOM   5307  C  CE    . LYS A  1  687  ? 97.182  73.607  34.683  1.00 129.56 ? 687  LYS A CE    1 
ATOM   5308  N  NZ    . LYS A  1  687  ? 97.584  72.592  35.694  1.00 133.80 ? 687  LYS A NZ    1 
ATOM   5309  N  N     . LYS A  1  688  ? 99.651  79.315  34.028  1.00 116.51 ? 688  LYS A N     1 
ATOM   5310  C  CA    . LYS A  1  688  ? 99.507  80.695  34.501  1.00 117.65 ? 688  LYS A CA    1 
ATOM   5311  C  C     . LYS A  1  688  ? 100.076 81.662  33.454  1.00 119.39 ? 688  LYS A C     1 
ATOM   5312  O  O     . LYS A  1  688  ? 99.377  82.590  33.064  1.00 119.52 ? 688  LYS A O     1 
ATOM   5313  C  CB    . LYS A  1  688  ? 100.176 80.878  35.877  1.00 121.86 ? 688  LYS A CB    1 
ATOM   5314  C  CG    . LYS A  1  688  ? 99.519  81.944  36.748  1.00 137.76 ? 688  LYS A CG    1 
ATOM   5315  C  CD    . LYS A  1  688  ? 100.420 83.156  36.933  1.00 147.02 ? 688  LYS A CD    1 
ATOM   5316  C  CE    . LYS A  1  688  ? 99.793  84.206  37.813  1.00 155.33 ? 688  LYS A CE    1 
ATOM   5317  N  NZ    . LYS A  1  688  ? 100.680 85.388  37.968  1.00 164.41 ? 688  LYS A NZ    1 
ATOM   5318  N  N     . LYS A  1  689  ? 101.295 81.382  32.934  1.00 113.85 ? 689  LYS A N     1 
ATOM   5319  C  CA    . LYS A  1  689  ? 101.967 82.145  31.871  1.00 112.92 ? 689  LYS A CA    1 
ATOM   5320  C  C     . LYS A  1  689  ? 101.017 82.327  30.673  1.00 116.32 ? 689  LYS A C     1 
ATOM   5321  O  O     . LYS A  1  689  ? 100.926 83.431  30.131  1.00 117.10 ? 689  LYS A O     1 
ATOM   5322  C  CB    . LYS A  1  689  ? 103.246 81.412  31.424  1.00 113.80 ? 689  LYS A CB    1 
ATOM   5323  C  CG    . LYS A  1  689  ? 104.268 82.281  30.703  1.00 128.50 ? 689  LYS A CG    1 
ATOM   5324  C  CD    . LYS A  1  689  ? 105.486 81.461  30.265  1.00 140.54 ? 689  LYS A CD    1 
ATOM   5325  C  CE    . LYS A  1  689  ? 106.670 82.309  29.839  1.00 156.27 ? 689  LYS A CE    1 
ATOM   5326  N  NZ    . LYS A  1  689  ? 107.623 81.566  28.959  1.00 162.88 ? 689  LYS A NZ    1 
ATOM   5327  N  N     . VAL A  1  690  ? 100.282 81.249  30.302  1.00 110.98 ? 690  VAL A N     1 
ATOM   5328  C  CA    . VAL A  1  690  ? 99.291  81.237  29.219  1.00 109.28 ? 690  VAL A CA    1 
ATOM   5329  C  C     . VAL A  1  690  ? 98.102  82.128  29.606  1.00 113.53 ? 690  VAL A C     1 
ATOM   5330  O  O     . VAL A  1  690  ? 97.792  83.053  28.860  1.00 113.61 ? 690  VAL A O     1 
ATOM   5331  C  CB    . VAL A  1  690  ? 98.876  79.794  28.786  1.00 110.96 ? 690  VAL A CB    1 
ATOM   5332  C  CG1   . VAL A  1  690  ? 97.633  79.799  27.896  1.00 110.09 ? 690  VAL A CG1   1 
ATOM   5333  C  CG2   . VAL A  1  690  ? 100.022 79.088  28.075  1.00 109.21 ? 690  VAL A CG2   1 
ATOM   5334  N  N     . LEU A  1  691  ? 97.484  81.884  30.785  1.00 110.11 ? 691  LEU A N     1 
ATOM   5335  C  CA    . LEU A  1  691  ? 96.345  82.650  31.310  1.00 111.42 ? 691  LEU A CA    1 
ATOM   5336  C  C     . LEU A  1  691  ? 96.608  84.154  31.289  1.00 118.59 ? 691  LEU A C     1 
ATOM   5337  O  O     . LEU A  1  691  ? 95.708  84.931  30.962  1.00 118.95 ? 691  LEU A O     1 
ATOM   5338  C  CB    . LEU A  1  691  ? 96.013  82.190  32.735  1.00 112.15 ? 691  LEU A CB    1 
ATOM   5339  C  CG    . LEU A  1  691  ? 95.016  83.045  33.498  1.00 117.93 ? 691  LEU A CG    1 
ATOM   5340  C  CD1   . LEU A  1  691  ? 93.711  82.312  33.715  1.00 117.75 ? 691  LEU A CD1   1 
ATOM   5341  C  CD2   . LEU A  1  691  ? 95.622  83.555  34.785  1.00 121.97 ? 691  LEU A CD2   1 
ATOM   5342  N  N     . ASP A  1  692  ? 97.847  84.546  31.643  1.00 116.83 ? 692  ASP A N     1 
ATOM   5343  C  CA    . ASP A  1  692  ? 98.327  85.922  31.665  1.00 118.13 ? 692  ASP A CA    1 
ATOM   5344  C  C     . ASP A  1  692  ? 98.329  86.496  30.248  1.00 122.89 ? 692  ASP A C     1 
ATOM   5345  O  O     . ASP A  1  692  ? 97.822  87.595  30.044  1.00 124.83 ? 692  ASP A O     1 
ATOM   5346  C  CB    . ASP A  1  692  ? 99.721  85.997  32.319  1.00 120.11 ? 692  ASP A CB    1 
ATOM   5347  C  CG    . ASP A  1  692  ? 99.773  85.607  33.797  1.00 130.35 ? 692  ASP A CG    1 
ATOM   5348  O  OD1   . ASP A  1  692  ? 98.707  85.652  34.473  1.00 130.42 ? 692  ASP A OD1   1 
ATOM   5349  O  OD2   . ASP A  1  692  ? 100.877 85.259  34.280  1.00 137.20 ? 692  ASP A OD2   1 
ATOM   5350  N  N     . VAL A  1  693  ? 98.827  85.729  29.264  1.00 117.90 ? 693  VAL A N     1 
ATOM   5351  C  CA    . VAL A  1  693  ? 98.838  86.120  27.853  1.00 117.13 ? 693  VAL A CA    1 
ATOM   5352  C  C     . VAL A  1  693  ? 97.400  86.169  27.307  1.00 121.74 ? 693  VAL A C     1 
ATOM   5353  O  O     . VAL A  1  693  ? 97.100  87.007  26.456  1.00 121.41 ? 693  VAL A O     1 
ATOM   5354  C  CB    . VAL A  1  693  ? 99.820  85.227  27.047  1.00 119.35 ? 693  VAL A CB    1 
ATOM   5355  C  CG1   . VAL A  1  693  ? 99.356  84.980  25.612  1.00 117.91 ? 693  VAL A CG1   1 
ATOM   5356  C  CG2   . VAL A  1  693  ? 101.224 85.823  27.072  1.00 119.37 ? 693  VAL A CG2   1 
ATOM   5357  N  N     . THR A  1  694  ? 96.510  85.315  27.861  1.00 119.43 ? 694  THR A N     1 
ATOM   5358  C  CA    . THR A  1  694  ? 95.080  85.239  27.544  1.00 120.04 ? 694  THR A CA    1 
ATOM   5359  C  C     . THR A  1  694  ? 94.373  86.515  28.042  1.00 126.68 ? 694  THR A C     1 
ATOM   5360  O  O     . THR A  1  694  ? 93.618  87.123  27.285  1.00 126.27 ? 694  THR A O     1 
ATOM   5361  C  CB    . THR A  1  694  ? 94.475  83.926  28.097  1.00 128.38 ? 694  THR A CB    1 
ATOM   5362  O  OG1   . THR A  1  694  ? 95.083  82.816  27.433  1.00 128.46 ? 694  THR A OG1   1 
ATOM   5363  C  CG2   . THR A  1  694  ? 92.953  83.847  27.940  1.00 126.47 ? 694  THR A CG2   1 
ATOM   5364  N  N     . LYS A  1  695  ? 94.643  86.925  29.296  1.00 125.59 ? 695  LYS A N     1 
ATOM   5365  C  CA    . LYS A  1  695  ? 94.070  88.135  29.899  1.00 127.95 ? 695  LYS A CA    1 
ATOM   5366  C  C     . LYS A  1  695  ? 94.519  89.414  29.157  1.00 134.24 ? 695  LYS A C     1 
ATOM   5367  O  O     . LYS A  1  695  ? 93.703  90.315  28.922  1.00 134.92 ? 695  LYS A O     1 
ATOM   5368  C  CB    . LYS A  1  695  ? 94.373  88.202  31.418  1.00 131.14 ? 695  LYS A CB    1 
ATOM   5369  C  CG    . LYS A  1  695  ? 93.538  87.227  32.278  1.00 139.32 ? 695  LYS A CG    1 
ATOM   5370  C  CD    . LYS A  1  695  ? 92.080  87.691  32.473  1.00 145.66 ? 695  LYS A CD    1 
ATOM   5371  C  CE    . LYS A  1  695  ? 91.178  86.661  33.104  1.00 145.92 ? 695  LYS A CE    1 
ATOM   5372  N  NZ    . LYS A  1  695  ? 89.797  87.186  33.280  1.00 152.05 ? 695  LYS A NZ    1 
ATOM   5373  N  N     . GLU A  1  696  ? 95.805  89.448  28.746  1.00 131.08 ? 696  GLU A N     1 
ATOM   5374  C  CA    . GLU A  1  696  ? 96.457  90.526  27.996  1.00 131.52 ? 696  GLU A CA    1 
ATOM   5375  C  C     . GLU A  1  696  ? 95.810  90.684  26.601  1.00 134.41 ? 696  GLU A C     1 
ATOM   5376  O  O     . GLU A  1  696  ? 95.553  91.810  26.177  1.00 134.65 ? 696  GLU A O     1 
ATOM   5377  C  CB    . GLU A  1  696  ? 97.971  90.227  27.880  1.00 132.27 ? 696  GLU A CB    1 
ATOM   5378  C  CG    . GLU A  1  696  ? 98.788  91.247  27.098  1.00 145.20 ? 696  GLU A CG    1 
ATOM   5379  C  CD    . GLU A  1  696  ? 99.875  90.668  26.209  1.00 161.91 ? 696  GLU A CD    1 
ATOM   5380  O  OE1   . GLU A  1  696  ? 99.542  89.890  25.284  1.00 149.82 ? 696  GLU A OE1   1 
ATOM   5381  O  OE2   . GLU A  1  696  ? 101.061 91.012  26.422  1.00 155.02 ? 696  GLU A OE2   1 
ATOM   5382  N  N     . ALA A  1  697  ? 95.558  89.556  25.901  1.00 129.45 ? 697  ALA A N     1 
ATOM   5383  C  CA    . ALA A  1  697  ? 94.943  89.532  24.570  1.00 128.27 ? 697  ALA A CA    1 
ATOM   5384  C  C     . ALA A  1  697  ? 93.454  89.894  24.624  1.00 133.26 ? 697  ALA A C     1 
ATOM   5385  O  O     . ALA A  1  697  ? 92.932  90.445  23.655  1.00 132.60 ? 697  ALA A O     1 
ATOM   5386  C  CB    . ALA A  1  697  ? 95.127  88.165  23.936  1.00 126.96 ? 697  ALA A CB    1 
ATOM   5387  N  N     . GLN A  1  698  ? 92.778  89.571  25.751  1.00 131.14 ? 698  GLN A N     1 
ATOM   5388  C  CA    . GLN A  1  698  ? 91.357  89.848  25.984  1.00 132.10 ? 698  GLN A CA    1 
ATOM   5389  C  C     . GLN A  1  698  ? 91.112  91.325  26.269  1.00 139.06 ? 698  GLN A C     1 
ATOM   5390  O  O     . GLN A  1  698  ? 90.032  91.829  25.962  1.00 139.29 ? 698  GLN A O     1 
ATOM   5391  C  CB    . GLN A  1  698  ? 90.781  88.953  27.096  1.00 133.36 ? 698  GLN A CB    1 
ATOM   5392  C  CG    . GLN A  1  698  ? 90.426  87.541  26.615  1.00 139.45 ? 698  GLN A CG    1 
ATOM   5393  C  CD    . GLN A  1  698  ? 90.109  86.545  27.716  1.00 153.90 ? 698  GLN A CD    1 
ATOM   5394  O  OE1   . GLN A  1  698  ? 90.295  86.795  28.917  1.00 149.85 ? 698  GLN A OE1   1 
ATOM   5395  N  NE2   . GLN A  1  698  ? 89.604  85.380  27.324  1.00 141.53 ? 698  GLN A NE2   1 
ATOM   5396  N  N     . ALA A  1  699  ? 92.128  92.024  26.819  1.00 137.41 ? 699  ALA A N     1 
ATOM   5397  C  CA    . ALA A  1  699  ? 92.086  93.462  27.110  1.00 139.25 ? 699  ALA A CA    1 
ATOM   5398  C  C     . ALA A  1  699  ? 92.723  94.308  25.973  1.00 144.59 ? 699  ALA A C     1 
ATOM   5399  O  O     . ALA A  1  699  ? 93.149  95.437  26.215  1.00 145.38 ? 699  ALA A O     1 
ATOM   5400  C  CB    . ALA A  1  699  ? 92.761  93.745  28.446  1.00 140.87 ? 699  ALA A CB    1 
ATOM   5401  N  N     . ASN A  1  700  ? 92.775  93.744  24.733  1.00 141.27 ? 700  ASN A N     1 
ATOM   5402  C  CA    . ASN A  1  700  ? 93.300  94.317  23.472  1.00 141.21 ? 700  ASN A CA    1 
ATOM   5403  C  C     . ASN A  1  700  ? 94.756  94.889  23.557  1.00 146.85 ? 700  ASN A C     1 
ATOM   5404  O  O     . ASN A  1  700  ? 95.131  95.734  22.736  1.00 146.86 ? 700  ASN A O     1 
ATOM   5405  C  CB    . ASN A  1  700  ? 92.316  95.373  22.914  1.00 142.38 ? 700  ASN A CB    1 
ATOM   5406  C  CG    . ASN A  1  700  ? 92.314  95.541  21.405  1.00 159.16 ? 700  ASN A CG    1 
ATOM   5407  O  OD1   . ASN A  1  700  ? 92.688  94.646  20.633  1.00 149.02 ? 700  ASN A OD1   1 
ATOM   5408  N  ND2   . ASN A  1  700  ? 91.859  96.698  20.951  1.00 151.47 ? 700  ASN A ND2   1 
ATOM   5409  N  N     . LEU A  1  701  ? 95.581  94.391  24.509  1.00 144.07 ? 701  LEU A N     1 
ATOM   5410  C  CA    . LEU A  1  701  ? 96.968  94.848  24.729  1.00 144.27 ? 701  LEU A CA    1 
ATOM   5411  C  C     . LEU A  1  701  ? 97.997  94.138  23.830  1.00 147.67 ? 701  LEU A C     1 
ATOM   5412  O  O     . LEU A  1  701  ? 99.096  94.663  23.613  1.00 147.30 ? 701  LEU A O     1 
ATOM   5413  C  CB    . LEU A  1  701  ? 97.376  94.720  26.216  1.00 144.82 ? 701  LEU A CB    1 
ATOM   5414  C  CG    . LEU A  1  701  ? 96.355  95.153  27.279  1.00 150.36 ? 701  LEU A CG    1 
ATOM   5415  C  CD1   . LEU A  1  701  ? 96.621  94.467  28.594  1.00 150.71 ? 701  LEU A CD1   1 
ATOM   5416  C  CD2   . LEU A  1  701  ? 96.328  96.652  27.454  1.00 153.39 ? 701  LEU A CD2   1 
ATOM   5417  N  N     . LEU A  1  702  ? 97.633  92.949  23.317  1.00 143.47 ? 702  LEU A N     1 
ATOM   5418  C  CA    . LEU A  1  702  ? 98.471  92.127  22.445  1.00 142.18 ? 702  LEU A CA    1 
ATOM   5419  C  C     . LEU A  1  702  ? 98.632  92.785  21.073  1.00 146.30 ? 702  LEU A C     1 
ATOM   5420  O  O     . LEU A  1  702  ? 97.662  93.319  20.535  1.00 146.15 ? 702  LEU A O     1 
ATOM   5421  C  CB    . LEU A  1  702  ? 97.840  90.724  22.302  1.00 141.05 ? 702  LEU A CB    1 
ATOM   5422  C  CG    . LEU A  1  702  ? 98.699  89.621  21.670  1.00 144.01 ? 702  LEU A CG    1 
ATOM   5423  C  CD1   . LEU A  1  702  ? 98.604  88.342  22.466  1.00 143.62 ? 702  LEU A CD1   1 
ATOM   5424  C  CD2   . LEU A  1  702  ? 98.294  89.364  20.223  1.00 145.04 ? 702  LEU A CD2   1 
ATOM   5425  N  N     . THR A  1  703  ? 99.857  92.730  20.514  1.00 142.95 ? 703  THR A N     1 
ATOM   5426  C  CA    . THR A  1  703  ? 100.200 93.274  19.197  1.00 142.86 ? 703  THR A CA    1 
ATOM   5427  C  C     . THR A  1  703  ? 100.764 92.146  18.337  1.00 146.23 ? 703  THR A C     1 
ATOM   5428  O  O     . THR A  1  703  ? 101.714 91.478  18.748  1.00 144.77 ? 703  THR A O     1 
ATOM   5429  C  CB    . THR A  1  703  ? 101.139 94.484  19.332  1.00 151.98 ? 703  THR A CB    1 
ATOM   5430  O  OG1   . THR A  1  703  ? 100.593 95.396  20.292  1.00 154.82 ? 703  THR A OG1   1 
ATOM   5431  C  CG2   . THR A  1  703  ? 101.358 95.204  18.007  1.00 149.20 ? 703  THR A CG2   1 
ATOM   5432  N  N     . ALA A  1  704  ? 100.166 91.941  17.150  1.00 143.97 ? 704  ALA A N     1 
ATOM   5433  C  CA    . ALA A  1  704  ? 100.501 90.876  16.195  1.00 143.26 ? 704  ALA A CA    1 
ATOM   5434  C  C     . ALA A  1  704  ? 101.895 90.982  15.527  1.00 149.06 ? 704  ALA A C     1 
ATOM   5435  O  O     . ALA A  1  704  ? 102.285 92.073  15.120  1.00 149.68 ? 704  ALA A O     1 
ATOM   5436  C  CB    . ALA A  1  704  ? 99.420  90.784  15.136  1.00 143.66 ? 704  ALA A CB    1 
ATOM   5437  N  N     . LYS A  1  705  ? 102.612 89.832  15.373  1.00 145.69 ? 705  LYS A N     1 
ATOM   5438  C  CA    . LYS A  1  705  ? 103.960 89.752  14.779  1.00 145.48 ? 705  LYS A CA    1 
ATOM   5439  C  C     . LYS A  1  705  ? 103.947 89.608  13.234  1.00 150.11 ? 705  LYS A C     1 
ATOM   5440  O  O     . LYS A  1  705  ? 104.022 88.495  12.709  1.00 148.09 ? 705  LYS A O     1 
ATOM   5441  C  CB    . LYS A  1  705  ? 104.802 88.643  15.453  1.00 146.82 ? 705  LYS A CB    1 
ATOM   5442  C  CG    . LYS A  1  705  ? 106.310 88.741  15.180  1.00 154.88 ? 705  LYS A CG    1 
ATOM   5443  C  CD    . LYS A  1  705  ? 107.145 87.857  16.100  1.00 161.04 ? 705  LYS A CD    1 
ATOM   5444  C  CE    . LYS A  1  705  ? 107.341 86.453  15.574  1.00 166.53 ? 705  LYS A CE    1 
ATOM   5445  N  NZ    . LYS A  1  705  ? 107.964 85.563  16.591  1.00 172.72 ? 705  LYS A NZ    1 
ATOM   5446  N  N     . HIS A  1  706  ? 103.896 90.776  12.542  1.00 148.95 ? 706  HIS A N     1 
ATOM   5447  C  CA    . HIS A  1  706  ? 103.877 91.089  11.094  1.00 148.86 ? 706  HIS A CA    1 
ATOM   5448  C  C     . HIS A  1  706  ? 103.472 89.950  10.134  1.00 150.43 ? 706  HIS A C     1 
ATOM   5449  O  O     . HIS A  1  706  ? 104.151 88.919  10.033  1.00 148.58 ? 706  HIS A O     1 
ATOM   5450  C  CB    . HIS A  1  706  ? 105.211 91.684  10.635  1.00 150.10 ? 706  HIS A CB    1 
ATOM   5451  C  CG    . HIS A  1  706  ? 105.087 92.584  9.444   1.00 154.23 ? 706  HIS A CG    1 
ATOM   5452  N  ND1   . HIS A  1  706  ? 105.012 93.960  9.585   1.00 157.68 ? 706  HIS A ND1   1 
ATOM   5453  C  CD2   . HIS A  1  706  ? 105.034 92.276  8.127   1.00 155.30 ? 706  HIS A CD2   1 
ATOM   5454  C  CE1   . HIS A  1  706  ? 104.921 94.442  8.355   1.00 157.26 ? 706  HIS A CE1   1 
ATOM   5455  N  NE2   . HIS A  1  706  ? 104.927 93.467  7.445   1.00 156.20 ? 706  HIS A NE2   1 
ATOM   5456  N  N     . GLY A  1  707  ? 102.395 90.214  9.388   1.00 146.30 ? 707  GLY A N     1 
ATOM   5457  C  CA    . GLY A  1  707  ? 101.794 89.288  8.435   1.00 144.13 ? 707  GLY A CA    1 
ATOM   5458  C  C     . GLY A  1  707  ? 100.957 88.246  9.146   1.00 145.41 ? 707  GLY A C     1 
ATOM   5459  O  O     . GLY A  1  707  ? 100.413 87.337  8.513   1.00 144.22 ? 707  GLY A O     1 
ATOM   5460  N  N     . MET A  1  708  ? 100.856 88.392  10.480  1.00 140.99 ? 708  MET A N     1 
ATOM   5461  C  CA    . MET A  1  708  ? 100.142 87.527  11.408  1.00 139.72 ? 708  MET A CA    1 
ATOM   5462  C  C     . MET A  1  708  ? 98.928  88.235  11.999  1.00 141.37 ? 708  MET A C     1 
ATOM   5463  O  O     . MET A  1  708  ? 98.962  89.448  12.223  1.00 142.38 ? 708  MET A O     1 
ATOM   5464  C  CB    . MET A  1  708  ? 101.077 87.147  12.568  1.00 142.17 ? 708  MET A CB    1 
ATOM   5465  C  CG    . MET A  1  708  ? 101.622 85.749  12.490  1.00 144.60 ? 708  MET A CG    1 
ATOM   5466  S  SD    . MET A  1  708  ? 102.556 85.354  13.988  1.00 149.21 ? 708  MET A SD    1 
ATOM   5467  C  CE    . MET A  1  708  ? 102.619 83.563  13.864  1.00 143.98 ? 708  MET A CE    1 
ATOM   5468  N  N     . THR A  1  709  ? 97.878  87.453  12.306  1.00 134.26 ? 709  THR A N     1 
ATOM   5469  C  CA    . THR A  1  709  ? 96.661  87.899  12.980  1.00 133.68 ? 709  THR A CA    1 
ATOM   5470  C  C     . THR A  1  709  ? 97.037  88.093  14.464  1.00 135.56 ? 709  THR A C     1 
ATOM   5471  O  O     . THR A  1  709  ? 98.113  87.663  14.884  1.00 134.36 ? 709  THR A O     1 
ATOM   5472  C  CB    . THR A  1  709  ? 95.584  86.796  12.830  1.00 138.95 ? 709  THR A CB    1 
ATOM   5473  O  OG1   . THR A  1  709  ? 95.369  86.504  11.451  1.00 135.97 ? 709  THR A OG1   1 
ATOM   5474  C  CG2   . THR A  1  709  ? 94.272  87.150  13.482  1.00 138.86 ? 709  THR A CG2   1 
ATOM   5475  N  N     . LEU A  1  710  ? 96.161  88.718  15.261  1.00 131.93 ? 710  LEU A N     1 
ATOM   5476  C  CA    . LEU A  1  710  ? 96.397  88.843  16.698  1.00 131.88 ? 710  LEU A CA    1 
ATOM   5477  C  C     . LEU A  1  710  ? 96.230  87.441  17.277  1.00 133.55 ? 710  LEU A C     1 
ATOM   5478  O  O     . LEU A  1  710  ? 96.994  87.030  18.153  1.00 133.46 ? 710  LEU A O     1 
ATOM   5479  C  CB    . LEU A  1  710  ? 95.386  89.798  17.342  1.00 133.36 ? 710  LEU A CB    1 
ATOM   5480  C  CG    . LEU A  1  710  ? 95.469  91.241  16.899  1.00 138.83 ? 710  LEU A CG    1 
ATOM   5481  C  CD1   . LEU A  1  710  ? 94.136  91.918  17.041  1.00 139.96 ? 710  LEU A CD1   1 
ATOM   5482  C  CD2   . LEU A  1  710  ? 96.565  91.983  17.644  1.00 142.41 ? 710  LEU A CD2   1 
ATOM   5483  N  N     . ARG A  1  711  ? 95.260  86.693  16.717  1.00 127.64 ? 711  ARG A N     1 
ATOM   5484  C  CA    . ARG A  1  711  ? 94.937  85.313  17.060  1.00 125.71 ? 711  ARG A CA    1 
ATOM   5485  C  C     . ARG A  1  711  ? 96.100  84.394  16.685  1.00 127.20 ? 711  ARG A C     1 
ATOM   5486  O  O     . ARG A  1  711  ? 96.529  83.600  17.522  1.00 126.03 ? 711  ARG A O     1 
ATOM   5487  C  CB    . ARG A  1  711  ? 93.614  84.887  16.401  1.00 124.45 ? 711  ARG A CB    1 
ATOM   5488  C  CG    . ARG A  1  711  ? 92.468  85.844  16.736  1.00 132.21 ? 711  ARG A CG    1 
ATOM   5489  C  CD    . ARG A  1  711  ? 91.113  85.329  16.315  1.00 134.53 ? 711  ARG A CD    1 
ATOM   5490  N  NE    . ARG A  1  711  ? 90.154  85.423  17.415  1.00 137.36 ? 711  ARG A NE    1 
ATOM   5491  C  CZ    . ARG A  1  711  ? 88.895  85.826  17.288  1.00 149.35 ? 711  ARG A CZ    1 
ATOM   5492  N  NH1   . ARG A  1  711  ? 88.421  86.184  16.099  1.00 133.14 ? 711  ARG A NH1   1 
ATOM   5493  N  NH2   . ARG A  1  711  ? 88.096  85.866  18.345  1.00 137.06 ? 711  ARG A NH2   1 
ATOM   5494  N  N     . GLU A  1  712  ? 96.667  84.565  15.466  1.00 122.74 ? 712  GLU A N     1 
ATOM   5495  C  CA    . GLU A  1  712  ? 97.838  83.812  14.989  1.00 121.01 ? 712  GLU A CA    1 
ATOM   5496  C  C     . GLU A  1  712  ? 99.039  84.041  15.932  1.00 124.92 ? 712  GLU A C     1 
ATOM   5497  O  O     . GLU A  1  712  ? 99.791  83.107  16.216  1.00 123.77 ? 712  GLU A O     1 
ATOM   5498  C  CB    . GLU A  1  712  ? 98.209  84.224  13.546  1.00 121.85 ? 712  GLU A CB    1 
ATOM   5499  C  CG    . GLU A  1  712  ? 97.364  83.575  12.458  1.00 130.31 ? 712  GLU A CG    1 
ATOM   5500  C  CD    . GLU A  1  712  ? 97.558  84.065  11.030  1.00 147.22 ? 712  GLU A CD    1 
ATOM   5501  O  OE1   . GLU A  1  712  ? 98.698  84.425  10.653  1.00 132.32 ? 712  GLU A OE1   1 
ATOM   5502  O  OE2   . GLU A  1  712  ? 96.565  84.038  10.267  1.00 141.78 ? 712  GLU A OE2   1 
ATOM   5503  N  N     . SER A  1  713  ? 99.180  85.279  16.438  1.00 122.51 ? 713  SER A N     1 
ATOM   5504  C  CA    . SER A  1  713  ? 100.242 85.691  17.350  1.00 122.81 ? 713  SER A CA    1 
ATOM   5505  C  C     . SER A  1  713  ? 100.060 85.088  18.736  1.00 127.01 ? 713  SER A C     1 
ATOM   5506  O  O     . SER A  1  713  ? 101.023 84.555  19.289  1.00 126.84 ? 713  SER A O     1 
ATOM   5507  C  CB    . SER A  1  713  ? 100.324 87.211  17.420  1.00 127.14 ? 713  SER A CB    1 
ATOM   5508  O  OG    . SER A  1  713  ? 100.659 87.720  16.141  1.00 133.94 ? 713  SER A OG    1 
ATOM   5509  N  N     . PHE A  1  714  ? 98.833  85.152  19.287  1.00 123.34 ? 714  PHE A N     1 
ATOM   5510  C  CA    . PHE A  1  714  ? 98.499  84.593  20.597  1.00 122.99 ? 714  PHE A CA    1 
ATOM   5511  C  C     . PHE A  1  714  ? 98.726  83.084  20.607  1.00 125.96 ? 714  PHE A C     1 
ATOM   5512  O  O     . PHE A  1  714  ? 99.390  82.577  21.514  1.00 125.91 ? 714  PHE A O     1 
ATOM   5513  C  CB    . PHE A  1  714  ? 97.048  84.934  20.975  1.00 125.21 ? 714  PHE A CB    1 
ATOM   5514  C  CG    . PHE A  1  714  ? 96.404  84.057  22.024  1.00 126.09 ? 714  PHE A CG    1 
ATOM   5515  C  CD1   . PHE A  1  714  ? 96.601  84.305  23.378  1.00 129.87 ? 714  PHE A CD1   1 
ATOM   5516  C  CD2   . PHE A  1  714  ? 95.561  83.014  21.659  1.00 126.52 ? 714  PHE A CD2   1 
ATOM   5517  C  CE1   . PHE A  1  714  ? 95.981  83.513  24.348  1.00 130.61 ? 714  PHE A CE1   1 
ATOM   5518  C  CE2   . PHE A  1  714  ? 94.953  82.213  22.629  1.00 129.33 ? 714  PHE A CE2   1 
ATOM   5519  C  CZ    . PHE A  1  714  ? 95.163  82.471  23.967  1.00 128.47 ? 714  PHE A CZ    1 
ATOM   5520  N  N     . GLU A  1  715  ? 98.183  82.376  19.594  1.00 121.21 ? 715  GLU A N     1 
ATOM   5521  C  CA    . GLU A  1  715  ? 98.311  80.923  19.460  1.00 119.33 ? 715  GLU A CA    1 
ATOM   5522  C  C     . GLU A  1  715  ? 99.770  80.482  19.487  1.00 122.02 ? 715  GLU A C     1 
ATOM   5523  O  O     . GLU A  1  715  ? 100.110 79.644  20.321  1.00 121.62 ? 715  GLU A O     1 
ATOM   5524  C  CB    . GLU A  1  715  ? 97.574  80.392  18.217  1.00 119.54 ? 715  GLU A CB    1 
ATOM   5525  C  CG    . GLU A  1  715  ? 96.055  80.435  18.323  1.00 129.24 ? 715  GLU A CG    1 
ATOM   5526  C  CD    . GLU A  1  715  ? 95.401  79.553  19.371  1.00 145.51 ? 715  GLU A CD    1 
ATOM   5527  O  OE1   . GLU A  1  715  ? 95.946  78.463  19.653  1.00 124.49 ? 715  GLU A OE1   1 
ATOM   5528  O  OE2   . GLU A  1  715  ? 94.318  79.930  19.876  1.00 143.60 ? 715  GLU A OE2   1 
ATOM   5529  N  N     . ASP A  1  716  ? 100.640 81.112  18.652  1.00 117.72 ? 716  ASP A N     1 
ATOM   5530  C  CA    . ASP A  1  716  ? 102.083 80.828  18.591  1.00 116.92 ? 716  ASP A CA    1 
ATOM   5531  C  C     . ASP A  1  716  ? 102.734 80.876  19.975  1.00 119.55 ? 716  ASP A C     1 
ATOM   5532  O  O     . ASP A  1  716  ? 103.499 79.975  20.316  1.00 118.80 ? 716  ASP A O     1 
ATOM   5533  C  CB    . ASP A  1  716  ? 102.810 81.791  17.625  1.00 119.64 ? 716  ASP A CB    1 
ATOM   5534  C  CG    . ASP A  1  716  ? 104.336 81.779  17.734  1.00 134.85 ? 716  ASP A CG    1 
ATOM   5535  O  OD1   . ASP A  1  716  ? 104.971 80.922  17.078  1.00 134.62 ? 716  ASP A OD1   1 
ATOM   5536  O  OD2   . ASP A  1  716  ? 104.892 82.631  18.478  1.00 143.75 ? 716  ASP A OD2   1 
ATOM   5537  N  N     . ASN A  1  717  ? 102.432 81.921  20.761  1.00 115.32 ? 717  ASN A N     1 
ATOM   5538  C  CA    . ASN A  1  717  ? 103.005 82.092  22.089  1.00 115.07 ? 717  ASN A CA    1 
ATOM   5539  C  C     . ASN A  1  717  ? 102.407 81.127  23.108  1.00 116.33 ? 717  ASN A C     1 
ATOM   5540  O  O     . ASN A  1  717  ? 103.102 80.742  24.042  1.00 115.56 ? 717  ASN A O     1 
ATOM   5541  C  CB    . ASN A  1  717  ? 102.924 83.554  22.539  1.00 117.91 ? 717  ASN A CB    1 
ATOM   5542  C  CG    . ASN A  1  717  ? 103.664 84.522  21.626  1.00 135.40 ? 717  ASN A CG    1 
ATOM   5543  O  OD1   . ASN A  1  717  ? 104.725 84.216  21.051  1.00 128.30 ? 717  ASN A OD1   1 
ATOM   5544  N  ND2   . ASN A  1  717  ? 103.116 85.721  21.479  1.00 123.61 ? 717  ASN A ND2   1 
ATOM   5545  N  N     . VAL A  1  718  ? 101.154 80.691  22.906  1.00 111.84 ? 718  VAL A N     1 
ATOM   5546  C  CA    . VAL A  1  718  ? 100.507 79.724  23.797  1.00 111.69 ? 718  VAL A CA    1 
ATOM   5547  C  C     . VAL A  1  718  ? 101.092 78.324  23.560  1.00 113.39 ? 718  VAL A C     1 
ATOM   5548  O  O     . VAL A  1  718  ? 101.538 77.682  24.517  1.00 113.39 ? 718  VAL A O     1 
ATOM   5549  C  CB    . VAL A  1  718  ? 98.962  79.776  23.698  1.00 116.33 ? 718  VAL A CB    1 
ATOM   5550  C  CG1   . VAL A  1  718  ? 98.306  78.556  24.346  1.00 115.68 ? 718  VAL A CG1   1 
ATOM   5551  C  CG2   . VAL A  1  718  ? 98.441  81.050  24.338  1.00 118.08 ? 718  VAL A CG2   1 
ATOM   5552  N  N     . VAL A  1  719  ? 101.119 77.882  22.280  1.00 107.13 ? 719  VAL A N     1 
ATOM   5553  C  CA    . VAL A  1  719  ? 101.677 76.608  21.817  1.00 104.81 ? 719  VAL A CA    1 
ATOM   5554  C  C     . VAL A  1  719  ? 103.105 76.476  22.362  1.00 109.23 ? 719  VAL A C     1 
ATOM   5555  O  O     . VAL A  1  719  ? 103.463 75.428  22.905  1.00 109.34 ? 719  VAL A O     1 
ATOM   5556  C  CB    . VAL A  1  719  ? 101.638 76.545  20.269  1.00 107.08 ? 719  VAL A CB    1 
ATOM   5557  C  CG1   . VAL A  1  719  ? 102.529 75.435  19.720  1.00 105.48 ? 719  VAL A CG1   1 
ATOM   5558  C  CG2   . VAL A  1  719  ? 100.211 76.392  19.764  1.00 106.56 ? 719  VAL A CG2   1 
ATOM   5559  N  N     . ARG A  1  720  ? 103.882 77.575  22.260  1.00 105.42 ? 720  ARG A N     1 
ATOM   5560  C  CA    . ARG A  1  720  ? 105.259 77.723  22.716  1.00 105.07 ? 720  ARG A CA    1 
ATOM   5561  C  C     . ARG A  1  720  ? 105.396 77.455  24.215  1.00 108.19 ? 720  ARG A C     1 
ATOM   5562  O  O     . ARG A  1  720  ? 106.159 76.570  24.579  1.00 106.97 ? 720  ARG A O     1 
ATOM   5563  C  CB    . ARG A  1  720  ? 105.764 79.140  22.394  1.00 108.02 ? 720  ARG A CB    1 
ATOM   5564  C  CG    . ARG A  1  720  ? 106.970 79.219  21.461  1.00 119.19 ? 720  ARG A CG    1 
ATOM   5565  C  CD    . ARG A  1  720  ? 107.553 80.627  21.409  1.00 130.73 ? 720  ARG A CD    1 
ATOM   5566  N  NE    . ARG A  1  720  ? 108.170 81.011  22.686  1.00 144.01 ? 720  ARG A NE    1 
ATOM   5567  C  CZ    . ARG A  1  720  ? 107.650 81.883  23.547  1.00 159.10 ? 720  ARG A CZ    1 
ATOM   5568  N  NH1   . ARG A  1  720  ? 106.503 82.494  23.274  1.00 148.09 ? 720  ARG A NH1   1 
ATOM   5569  N  NH2   . ARG A  1  720  ? 108.278 82.156  24.686  1.00 143.01 ? 720  ARG A NH2   1 
ATOM   5570  N  N     . PHE A  1  721  ? 104.658 78.197  25.082  1.00 105.99 ? 721  PHE A N     1 
ATOM   5571  C  CA    . PHE A  1  721  ? 104.733 78.057  26.548  1.00 106.90 ? 721  PHE A CA    1 
ATOM   5572  C  C     . PHE A  1  721  ? 104.457 76.641  27.030  1.00 110.69 ? 721  PHE A C     1 
ATOM   5573  O  O     . PHE A  1  721  ? 105.058 76.209  28.015  1.00 111.60 ? 721  PHE A O     1 
ATOM   5574  C  CB    . PHE A  1  721  ? 103.774 79.017  27.277  1.00 110.21 ? 721  PHE A CB    1 
ATOM   5575  C  CG    . PHE A  1  721  ? 103.925 80.505  27.062  1.00 113.01 ? 721  PHE A CG    1 
ATOM   5576  C  CD1   . PHE A  1  721  ? 105.151 81.057  26.702  1.00 116.35 ? 721  PHE A CD1   1 
ATOM   5577  C  CD2   . PHE A  1  721  ? 102.854 81.363  27.268  1.00 116.19 ? 721  PHE A CD2   1 
ATOM   5578  C  CE1   . PHE A  1  721  ? 105.284 82.433  26.503  1.00 118.17 ? 721  PHE A CE1   1 
ATOM   5579  C  CE2   . PHE A  1  721  ? 102.988 82.736  27.071  1.00 119.90 ? 721  PHE A CE2   1 
ATOM   5580  C  CZ    . PHE A  1  721  ? 104.201 83.263  26.687  1.00 117.99 ? 721  PHE A CZ    1 
ATOM   5581  N  N     . LEU A  1  722  ? 103.525 75.941  26.353  1.00 105.04 ? 722  LEU A N     1 
ATOM   5582  C  CA    . LEU A  1  722  ? 103.111 74.581  26.676  1.00 103.47 ? 722  LEU A CA    1 
ATOM   5583  C  C     . LEU A  1  722  ? 104.139 73.559  26.188  1.00 106.79 ? 722  LEU A C     1 
ATOM   5584  O  O     . LEU A  1  722  ? 104.391 72.563  26.874  1.00 107.52 ? 722  LEU A O     1 
ATOM   5585  C  CB    . LEU A  1  722  ? 101.714 74.296  26.094  1.00 102.72 ? 722  LEU A CB    1 
ATOM   5586  C  CG    . LEU A  1  722  ? 100.544 75.149  26.623  1.00 107.68 ? 722  LEU A CG    1 
ATOM   5587  C  CD1   . LEU A  1  722  ? 99.302  74.954  25.782  1.00 106.95 ? 722  LEU A CD1   1 
ATOM   5588  C  CD2   . LEU A  1  722  ? 100.225 74.827  28.071  1.00 110.39 ? 722  LEU A CD2   1 
ATOM   5589  N  N     . ASN A  1  723  ? 104.747 73.805  25.020  1.00 101.07 ? 723  ASN A N     1 
ATOM   5590  C  CA    . ASN A  1  723  ? 105.776 72.909  24.513  1.00 99.25  ? 723  ASN A CA    1 
ATOM   5591  C  C     . ASN A  1  723  ? 107.090 73.071  25.278  1.00 104.90 ? 723  ASN A C     1 
ATOM   5592  O  O     . ASN A  1  723  ? 107.803 72.085  25.458  1.00 104.74 ? 723  ASN A O     1 
ATOM   5593  C  CB    . ASN A  1  723  ? 105.934 73.037  23.013  1.00 95.49  ? 723  ASN A CB    1 
ATOM   5594  C  CG    . ASN A  1  723  ? 104.776 72.423  22.263  1.00 120.01 ? 723  ASN A CG    1 
ATOM   5595  O  OD1   . ASN A  1  723  ? 104.012 71.588  22.784  1.00 115.02 ? 723  ASN A OD1   1 
ATOM   5596  N  ND2   . ASN A  1  723  ? 104.627 72.817  21.012  1.00 113.46 ? 723  ASN A ND2   1 
ATOM   5597  N  N     . GLU A  1  724  ? 107.369 74.288  25.798  1.00 102.68 ? 724  GLU A N     1 
ATOM   5598  C  CA    . GLU A  1  724  ? 108.533 74.589  26.639  1.00 103.31 ? 724  GLU A CA    1 
ATOM   5599  C  C     . GLU A  1  724  ? 108.364 73.788  27.931  1.00 107.76 ? 724  GLU A C     1 
ATOM   5600  O  O     . GLU A  1  724  ? 109.319 73.172  28.402  1.00 106.71 ? 724  GLU A O     1 
ATOM   5601  C  CB    . GLU A  1  724  ? 108.558 76.083  27.008  1.00 106.21 ? 724  GLU A CB    1 
ATOM   5602  C  CG    . GLU A  1  724  ? 109.200 77.024  26.004  1.00 116.86 ? 724  GLU A CG    1 
ATOM   5603  C  CD    . GLU A  1  724  ? 108.875 78.486  26.262  1.00 145.02 ? 724  GLU A CD    1 
ATOM   5604  O  OE1   . GLU A  1  724  ? 108.986 78.937  27.427  1.00 131.47 ? 724  GLU A OE1   1 
ATOM   5605  O  OE2   . GLU A  1  724  ? 108.498 79.183  25.292  1.00 147.48 ? 724  GLU A OE2   1 
ATOM   5606  N  N     . ALA A  1  725  ? 107.125 73.795  28.477  1.00 106.11 ? 725  ALA A N     1 
ATOM   5607  C  CA    . ALA A  1  725  ? 106.700 73.110  29.698  1.00 107.32 ? 725  ALA A CA    1 
ATOM   5608  C  C     . ALA A  1  725  ? 106.825 71.598  29.589  1.00 111.76 ? 725  ALA A C     1 
ATOM   5609  O  O     . ALA A  1  725  ? 107.344 70.981  30.519  1.00 112.49 ? 725  ALA A O     1 
ATOM   5610  C  CB    . ALA A  1  725  ? 105.266 73.479  30.034  1.00 108.78 ? 725  ALA A CB    1 
ATOM   5611  N  N     . ARG A  1  726  ? 106.353 70.998  28.467  1.00 106.60 ? 726  ARG A N     1 
ATOM   5612  C  CA    . ARG A  1  726  ? 106.431 69.552  28.246  1.00 105.10 ? 726  ARG A CA    1 
ATOM   5613  C  C     . ARG A  1  726  ? 107.892 69.097  28.227  1.00 109.56 ? 726  ARG A C     1 
ATOM   5614  O  O     . ARG A  1  726  ? 108.215 68.030  28.761  1.00 108.93 ? 726  ARG A O     1 
ATOM   5615  C  CB    . ARG A  1  726  ? 105.724 69.166  26.942  1.00 102.51 ? 726  ARG A CB    1 
ATOM   5616  C  CG    . ARG A  1  726  ? 105.676 67.659  26.727  1.00 108.02 ? 726  ARG A CG    1 
ATOM   5617  C  CD    . ARG A  1  726  ? 106.432 67.226  25.488  1.00 110.12 ? 726  ARG A CD    1 
ATOM   5618  N  NE    . ARG A  1  726  ? 105.667 67.495  24.269  1.00 111.04 ? 726  ARG A NE    1 
ATOM   5619  C  CZ    . ARG A  1  726  ? 105.993 68.410  23.362  1.00 121.54 ? 726  ARG A CZ    1 
ATOM   5620  N  NH1   . ARG A  1  726  ? 107.098 69.130  23.502  1.00 106.60 ? 726  ARG A NH1   1 
ATOM   5621  N  NH2   . ARG A  1  726  ? 105.231 68.592  22.293  1.00 108.54 ? 726  ARG A NH2   1 
ATOM   5622  N  N     . ASP A  1  727  ? 108.766 69.935  27.628  1.00 106.63 ? 727  ASP A N     1 
ATOM   5623  C  CA    . ASP A  1  727  ? 110.198 69.706  27.502  1.00 106.05 ? 727  ASP A CA    1 
ATOM   5624  C  C     . ASP A  1  727  ? 110.920 69.824  28.835  1.00 111.40 ? 727  ASP A C     1 
ATOM   5625  O  O     . ASP A  1  727  ? 111.636 68.892  29.193  1.00 110.98 ? 727  ASP A O     1 
ATOM   5626  C  CB    . ASP A  1  727  ? 110.817 70.605  26.415  1.00 107.38 ? 727  ASP A CB    1 
ATOM   5627  C  CG    . ASP A  1  727  ? 110.443 70.228  24.982  1.00 114.79 ? 727  ASP A CG    1 
ATOM   5628  O  OD1   . ASP A  1  727  ? 109.488 69.440  24.799  1.00 112.76 ? 727  ASP A OD1   1 
ATOM   5629  O  OD2   . ASP A  1  727  ? 111.105 70.727  24.044  1.00 122.62 ? 727  ASP A OD2   1 
ATOM   5630  N  N     . LYS A  1  728  ? 110.719 70.917  29.596  1.00 109.81 ? 728  LYS A N     1 
ATOM   5631  C  CA    . LYS A  1  728  ? 111.404 71.017  30.889  1.00 111.48 ? 728  LYS A CA    1 
ATOM   5632  C  C     . LYS A  1  728  ? 110.840 70.011  31.899  1.00 115.63 ? 728  LYS A C     1 
ATOM   5633  O  O     . LYS A  1  728  ? 111.612 69.482  32.698  1.00 115.90 ? 728  LYS A O     1 
ATOM   5634  C  CB    . LYS A  1  728  ? 111.499 72.452  31.457  1.00 116.21 ? 728  LYS A CB    1 
ATOM   5635  C  CG    . LYS A  1  728  ? 110.194 73.218  31.633  1.00 140.47 ? 728  LYS A CG    1 
ATOM   5636  C  CD    . LYS A  1  728  ? 110.433 74.558  32.362  1.00 157.37 ? 728  LYS A CD    1 
ATOM   5637  C  CE    . LYS A  1  728  ? 109.199 75.440  32.430  1.00 168.98 ? 728  LYS A CE    1 
ATOM   5638  N  NZ    . LYS A  1  728  ? 109.475 76.737  33.103  1.00 174.52 ? 728  LYS A NZ    1 
ATOM   5639  N  N     . ALA A  1  729  ? 109.532 69.678  31.805  1.00 111.51 ? 729  ALA A N     1 
ATOM   5640  C  CA    . ALA A  1  729  ? 108.917 68.663  32.667  1.00 111.31 ? 729  ALA A CA    1 
ATOM   5641  C  C     . ALA A  1  729  ? 109.550 67.312  32.336  1.00 114.35 ? 729  ALA A C     1 
ATOM   5642  O  O     . ALA A  1  729  ? 109.897 66.568  33.249  1.00 115.36 ? 729  ALA A O     1 
ATOM   5643  C  CB    . ALA A  1  729  ? 107.414 68.609  32.450  1.00 111.85 ? 729  ALA A CB    1 
ATOM   5644  N  N     . GLY A  1  730  ? 109.760 67.054  31.041  1.00 108.27 ? 730  GLY A N     1 
ATOM   5645  C  CA    . GLY A  1  730  ? 110.414 65.851  30.544  1.00 106.07 ? 730  GLY A CA    1 
ATOM   5646  C  C     . GLY A  1  730  ? 111.857 65.751  30.998  1.00 108.22 ? 730  GLY A C     1 
ATOM   5647  O  O     . GLY A  1  730  ? 112.258 64.726  31.558  1.00 107.32 ? 730  GLY A O     1 
ATOM   5648  N  N     . ARG A  1  731  ? 112.633 66.846  30.818  1.00 103.93 ? 731  ARG A N     1 
ATOM   5649  C  CA    . ARG A  1  731  ? 114.047 66.925  31.204  1.00 103.37 ? 731  ARG A CA    1 
ATOM   5650  C  C     . ARG A  1  731  ? 114.248 66.691  32.686  1.00 106.07 ? 731  ARG A C     1 
ATOM   5651  O  O     . ARG A  1  731  ? 115.286 66.158  33.083  1.00 104.90 ? 731  ARG A O     1 
ATOM   5652  C  CB    . ARG A  1  731  ? 114.684 68.249  30.766  1.00 104.38 ? 731  ARG A CB    1 
ATOM   5653  C  CG    . ARG A  1  731  ? 115.268 68.213  29.357  1.00 115.28 ? 731  ARG A CG    1 
ATOM   5654  C  CD    . ARG A  1  731  ? 115.963 69.515  28.998  1.00 131.29 ? 731  ARG A CD    1 
ATOM   5655  N  NE    . ARG A  1  731  ? 115.025 70.554  28.556  1.00 143.24 ? 731  ARG A NE    1 
ATOM   5656  C  CZ    . ARG A  1  731  ? 114.619 71.581  29.302  1.00 157.28 ? 731  ARG A CZ    1 
ATOM   5657  N  NH1   . ARG A  1  731  ? 115.059 71.723  30.550  1.00 142.83 ? 731  ARG A NH1   1 
ATOM   5658  N  NH2   . ARG A  1  731  ? 113.766 72.470  28.808  1.00 142.00 ? 731  ARG A NH2   1 
ATOM   5659  N  N     . LEU A  1  732  ? 113.227 67.045  33.494  1.00 103.15 ? 732  LEU A N     1 
ATOM   5660  C  CA    . LEU A  1  732  ? 113.223 66.865  34.945  1.00 104.14 ? 732  LEU A CA    1 
ATOM   5661  C  C     . LEU A  1  732  ? 113.244 65.399  35.305  1.00 108.32 ? 732  LEU A C     1 
ATOM   5662  O  O     . LEU A  1  732  ? 113.842 65.040  36.323  1.00 108.92 ? 732  LEU A O     1 
ATOM   5663  C  CB    . LEU A  1  732  ? 112.010 67.552  35.602  1.00 104.87 ? 732  LEU A CB    1 
ATOM   5664  C  CG    . LEU A  1  732  ? 112.158 69.032  35.947  1.00 109.69 ? 732  LEU A CG    1 
ATOM   5665  C  CD1   . LEU A  1  732  ? 110.859 69.598  36.469  1.00 110.22 ? 732  LEU A CD1   1 
ATOM   5666  C  CD2   . LEU A  1  732  ? 113.249 69.245  36.957  1.00 113.08 ? 732  LEU A CD2   1 
ATOM   5667  N  N     . ALA A  1  733  ? 112.607 64.554  34.453  1.00 103.70 ? 733  ALA A N     1 
ATOM   5668  C  CA    . ALA A  1  733  ? 112.525 63.105  34.616  1.00 102.37 ? 733  ALA A CA    1 
ATOM   5669  C  C     . ALA A  1  733  ? 113.824 62.469  34.154  1.00 104.94 ? 733  ALA A C     1 
ATOM   5670  O  O     . ALA A  1  733  ? 114.507 61.845  34.966  1.00 104.00 ? 733  ALA A O     1 
ATOM   5671  C  CB    . ALA A  1  733  ? 111.339 62.553  33.839  1.00 101.79 ? 733  ALA A CB    1 
ATOM   5672  N  N     . GLU A  1  734  ? 114.207 62.707  32.879  1.00 101.87 ? 734  GLU A N     1 
ATOM   5673  C  CA    . GLU A  1  734  ? 115.433 62.215  32.225  1.00 102.06 ? 734  GLU A CA    1 
ATOM   5674  C  C     . GLU A  1  734  ? 116.675 62.360  33.140  1.00 109.06 ? 734  GLU A C     1 
ATOM   5675  O  O     . GLU A  1  734  ? 117.514 61.454  33.186  1.00 108.67 ? 734  GLU A O     1 
ATOM   5676  C  CB    . GLU A  1  734  ? 115.604 62.902  30.838  1.00 102.60 ? 734  GLU A CB    1 
ATOM   5677  C  CG    . GLU A  1  734  ? 116.956 62.789  30.137  1.00 115.23 ? 734  GLU A CG    1 
ATOM   5678  C  CD    . GLU A  1  734  ? 117.390 64.061  29.419  1.00 148.75 ? 734  GLU A CD    1 
ATOM   5679  O  OE1   . GLU A  1  734  ? 117.753 65.042  30.110  1.00 150.35 ? 734  GLU A OE1   1 
ATOM   5680  O  OE2   . GLU A  1  734  ? 117.371 64.079  28.166  1.00 145.21 ? 734  GLU A OE2   1 
ATOM   5681  N  N     . VAL A  1  735  ? 116.742 63.470  33.907  1.00 107.65 ? 735  VAL A N     1 
ATOM   5682  C  CA    . VAL A  1  735  ? 117.827 63.757  34.847  1.00 108.88 ? 735  VAL A CA    1 
ATOM   5683  C  C     . VAL A  1  735  ? 117.725 62.857  36.099  1.00 115.75 ? 735  VAL A C     1 
ATOM   5684  O  O     . VAL A  1  735  ? 118.706 62.189  36.446  1.00 115.29 ? 735  VAL A O     1 
ATOM   5685  C  CB    . VAL A  1  735  ? 117.913 65.274  35.161  1.00 112.85 ? 735  VAL A CB    1 
ATOM   5686  C  CG1   . VAL A  1  735  ? 118.639 65.548  36.472  1.00 114.24 ? 735  VAL A CG1   1 
ATOM   5687  C  CG2   . VAL A  1  735  ? 118.585 66.019  34.016  1.00 111.90 ? 735  VAL A CG2   1 
ATOM   5688  N  N     . ASN A  1  736  ? 116.530 62.823  36.735  1.00 114.51 ? 736  ASN A N     1 
ATOM   5689  C  CA    . ASN A  1  736  ? 116.207 62.056  37.950  1.00 115.65 ? 736  ASN A CA    1 
ATOM   5690  C  C     . ASN A  1  736  ? 116.366 60.533  37.817  1.00 118.19 ? 736  ASN A C     1 
ATOM   5691  O  O     . ASN A  1  736  ? 116.667 59.857  38.814  1.00 118.67 ? 736  ASN A O     1 
ATOM   5692  C  CB    . ASN A  1  736  ? 114.797 62.388  38.429  1.00 118.29 ? 736  ASN A CB    1 
ATOM   5693  C  CG    . ASN A  1  736  ? 114.372 61.570  39.616  1.00 144.53 ? 736  ASN A CG    1 
ATOM   5694  O  OD1   . ASN A  1  736  ? 113.641 60.577  39.487  1.00 138.69 ? 736  ASN A OD1   1 
ATOM   5695  N  ND2   . ASN A  1  736  ? 114.919 61.909  40.776  1.00 137.42 ? 736  ASN A ND2   1 
ATOM   5696  N  N     . LEU A  1  737  ? 116.121 59.994  36.605  1.00 111.96 ? 737  LEU A N     1 
ATOM   5697  C  CA    . LEU A  1  737  ? 116.241 58.563  36.328  1.00 109.74 ? 737  LEU A CA    1 
ATOM   5698  C  C     . LEU A  1  737  ? 117.713 58.150  36.414  1.00 113.84 ? 737  LEU A C     1 
ATOM   5699  O  O     . LEU A  1  737  ? 118.551 58.729  35.714  1.00 113.78 ? 737  LEU A O     1 
ATOM   5700  C  CB    . LEU A  1  737  ? 115.653 58.219  34.945  1.00 107.45 ? 737  LEU A CB    1 
ATOM   5701  C  CG    . LEU A  1  737  ? 114.190 58.597  34.673  1.00 110.34 ? 737  LEU A CG    1 
ATOM   5702  C  CD1   . LEU A  1  737  ? 113.846 58.351  33.232  1.00 108.53 ? 737  LEU A CD1   1 
ATOM   5703  C  CD2   . LEU A  1  737  ? 113.212 57.873  35.616  1.00 110.89 ? 737  LEU A CD2   1 
ATOM   5704  N  N     . LYS A  1  738  ? 118.028 57.185  37.312  1.00 110.07 ? 738  LYS A N     1 
ATOM   5705  C  CA    . LYS A  1  738  ? 119.387 56.657  37.537  1.00 109.55 ? 738  LYS A CA    1 
ATOM   5706  C  C     . LYS A  1  738  ? 119.953 55.991  36.263  1.00 111.08 ? 738  LYS A C     1 
ATOM   5707  O  O     . LYS A  1  738  ? 119.221 55.820  35.286  1.00 109.58 ? 738  LYS A O     1 
ATOM   5708  C  CB    . LYS A  1  738  ? 119.388 55.658  38.714  1.00 112.10 ? 738  LYS A CB    1 
ATOM   5709  C  CG    . LYS A  1  738  ? 119.347 56.307  40.096  1.00 114.91 ? 738  LYS A CG    1 
ATOM   5710  C  CD    . LYS A  1  738  ? 118.554 55.492  41.114  1.00 115.55 ? 738  LYS A CD    1 
ATOM   5711  C  CE    . LYS A  1  738  ? 117.080 55.817  41.092  1.00 119.35 ? 738  LYS A CE    1 
ATOM   5712  N  NZ    . LYS A  1  738  ? 116.767 57.061  41.849  1.00 126.85 ? 738  LYS A NZ    1 
ATOM   5713  N  N     . ASP A  1  739  ? 121.248 55.625  36.263  1.00 106.55 ? 739  ASP A N     1 
ATOM   5714  C  CA    . ASP A  1  739  ? 121.850 54.968  35.100  1.00 104.38 ? 739  ASP A CA    1 
ATOM   5715  C  C     . ASP A  1  739  ? 121.381 53.503  34.960  1.00 103.87 ? 739  ASP A C     1 
ATOM   5716  O  O     . ASP A  1  739  ? 121.535 52.894  33.893  1.00 101.46 ? 739  ASP A O     1 
ATOM   5717  C  CB    . ASP A  1  739  ? 123.380 55.110  35.116  1.00 107.41 ? 739  ASP A CB    1 
ATOM   5718  C  CG    . ASP A  1  739  ? 123.912 56.434  34.577  1.00 121.88 ? 739  ASP A CG    1 
ATOM   5719  O  OD1   . ASP A  1  739  ? 123.102 57.386  34.410  1.00 122.94 ? 739  ASP A OD1   1 
ATOM   5720  O  OD2   . ASP A  1  739  ? 125.138 56.520  34.317  1.00 128.66 ? 739  ASP A OD2   1 
ATOM   5721  N  N     . LEU A  1  740  ? 120.761 52.970  36.035  1.00 98.87  ? 740  LEU A N     1 
ATOM   5722  C  CA    . LEU A  1  740  ? 120.181 51.632  36.085  1.00 97.15  ? 740  LEU A CA    1 
ATOM   5723  C  C     . LEU A  1  740  ? 118.859 51.577  35.313  1.00 98.40  ? 740  LEU A C     1 
ATOM   5724  O  O     . LEU A  1  740  ? 118.411 50.481  34.959  1.00 97.70  ? 740  LEU A O     1 
ATOM   5725  C  CB    . LEU A  1  740  ? 119.987 51.160  37.540  1.00 98.46  ? 740  LEU A CB    1 
ATOM   5726  C  CG    . LEU A  1  740  ? 119.099 52.013  38.442  1.00 104.89 ? 740  LEU A CG    1 
ATOM   5727  C  CD1   . LEU A  1  740  ? 117.677 51.511  38.461  1.00 105.10 ? 740  LEU A CD1   1 
ATOM   5728  C  CD2   . LEU A  1  740  ? 119.616 52.022  39.844  1.00 109.66 ? 740  LEU A CD2   1 
ATOM   5729  N  N     . ASN A  1  741  ? 118.215 52.752  35.096  1.00 93.38  ? 741  ASN A N     1 
ATOM   5730  C  CA    . ASN A  1  741  ? 116.947 52.868  34.381  1.00 91.73  ? 741  ASN A CA    1 
ATOM   5731  C  C     . ASN A  1  741  ? 117.121 52.264  33.021  1.00 94.75  ? 741  ASN A C     1 
ATOM   5732  O  O     . ASN A  1  741  ? 117.912 52.759  32.210  1.00 93.64  ? 741  ASN A O     1 
ATOM   5733  C  CB    . ASN A  1  741  ? 116.467 54.313  34.276  1.00 90.00  ? 741  ASN A CB    1 
ATOM   5734  C  CG    . ASN A  1  741  ? 115.044 54.440  33.786  1.00 105.50 ? 741  ASN A CG    1 
ATOM   5735  O  OD1   . ASN A  1  741  ? 114.103 54.576  34.567  1.00 93.45  ? 741  ASN A OD1   1 
ATOM   5736  N  ND2   . ASN A  1  741  ? 114.849 54.392  32.483  1.00 100.94 ? 741  ASN A ND2   1 
ATOM   5737  N  N     . ASN A  1  742  ? 116.423 51.140  32.815  1.00 91.11  ? 742  ASN A N     1 
ATOM   5738  C  CA    . ASN A  1  742  ? 116.468 50.329  31.609  1.00 89.57  ? 742  ASN A CA    1 
ATOM   5739  C  C     . ASN A  1  742  ? 116.157 51.121  30.349  1.00 92.20  ? 742  ASN A C     1 
ATOM   5740  O  O     . ASN A  1  742  ? 116.870 50.950  29.362  1.00 90.38  ? 742  ASN A O     1 
ATOM   5741  C  CB    . ASN A  1  742  ? 115.576 49.103  31.754  1.00 89.98  ? 742  ASN A CB    1 
ATOM   5742  C  CG    . ASN A  1  742  ? 116.048 48.159  32.838  1.00 108.45 ? 742  ASN A CG    1 
ATOM   5743  O  OD1   . ASN A  1  742  ? 116.873 47.257  32.616  1.00 101.82 ? 742  ASN A OD1   1 
ATOM   5744  N  ND2   . ASN A  1  742  ? 115.534 48.349  34.038  1.00 99.73  ? 742  ASN A ND2   1 
ATOM   5745  N  N     . VAL A  1  743  ? 115.148 52.027  30.396  1.00 89.46  ? 743  VAL A N     1 
ATOM   5746  C  CA    . VAL A  1  743  ? 114.781 52.877  29.245  1.00 88.51  ? 743  VAL A CA    1 
ATOM   5747  C  C     . VAL A  1  743  ? 115.945 53.820  28.903  1.00 91.60  ? 743  VAL A C     1 
ATOM   5748  O  O     . VAL A  1  743  ? 116.324 53.949  27.728  1.00 90.38  ? 743  VAL A O     1 
ATOM   5749  C  CB    . VAL A  1  743  ? 113.427 53.621  29.419  1.00 92.56  ? 743  VAL A CB    1 
ATOM   5750  C  CG1   . VAL A  1  743  ? 113.119 54.497  28.207  1.00 91.33  ? 743  VAL A CG1   1 
ATOM   5751  C  CG2   . VAL A  1  743  ? 112.286 52.635  29.654  1.00 92.48  ? 743  VAL A CG2   1 
ATOM   5752  N  N     . LYS A  1  744  ? 116.551 54.407  29.949  1.00 88.20  ? 744  LYS A N     1 
ATOM   5753  C  CA    . LYS A  1  744  ? 117.700 55.296  29.839  1.00 88.14  ? 744  LYS A CA    1 
ATOM   5754  C  C     . LYS A  1  744  ? 118.888 54.544  29.221  1.00 91.41  ? 744  LYS A C     1 
ATOM   5755  O  O     . LYS A  1  744  ? 119.620 55.127  28.437  1.00 90.54  ? 744  LYS A O     1 
ATOM   5756  C  CB    . LYS A  1  744  ? 118.056 55.889  31.213  1.00 91.80  ? 744  LYS A CB    1 
ATOM   5757  C  CG    . LYS A  1  744  ? 118.453 57.356  31.162  1.00 103.66 ? 744  LYS A CG    1 
ATOM   5758  C  CD    . LYS A  1  744  ? 118.914 57.873  32.524  1.00 111.82 ? 744  LYS A CD    1 
ATOM   5759  C  CE    . LYS A  1  744  ? 119.727 59.142  32.402  1.00 116.10 ? 744  LYS A CE    1 
ATOM   5760  N  NZ    . LYS A  1  744  ? 120.334 59.536  33.697  1.00 123.84 ? 744  LYS A NZ    1 
ATOM   5761  N  N     . GLN A  1  745  ? 119.038 53.244  29.525  1.00 87.84  ? 745  GLN A N     1 
ATOM   5762  C  CA    . GLN A  1  745  ? 120.103 52.400  28.984  1.00 87.12  ? 745  GLN A CA    1 
ATOM   5763  C  C     . GLN A  1  745  ? 119.925 52.106  27.495  1.00 91.68  ? 745  GLN A C     1 
ATOM   5764  O  O     . GLN A  1  745  ? 120.911 51.848  26.801  1.00 91.82  ? 745  GLN A O     1 
ATOM   5765  C  CB    . GLN A  1  745  ? 120.164 51.078  29.738  1.00 88.25  ? 745  GLN A CB    1 
ATOM   5766  C  CG    . GLN A  1  745  ? 120.968 51.137  31.004  1.00 95.32  ? 745  GLN A CG    1 
ATOM   5767  C  CD    . GLN A  1  745  ? 120.800 49.854  31.753  1.00 103.58 ? 745  GLN A CD    1 
ATOM   5768  O  OE1   . GLN A  1  745  ? 119.763 49.597  32.372  1.00 102.35 ? 745  GLN A OE1   1 
ATOM   5769  N  NE2   . GLN A  1  745  ? 121.801 49.006  31.678  1.00 85.83  ? 745  GLN A NE2   1 
ATOM   5770  N  N     . MET A  1  746  ? 118.675 52.064  27.017  1.00 87.74  ? 746  MET A N     1 
ATOM   5771  C  CA    . MET A  1  746  ? 118.409 51.795  25.605  1.00 86.25  ? 746  MET A CA    1 
ATOM   5772  C  C     . MET A  1  746  ? 118.585 53.084  24.828  1.00 90.50  ? 746  MET A C     1 
ATOM   5773  O  O     . MET A  1  746  ? 119.013 53.066  23.671  1.00 89.27  ? 746  MET A O     1 
ATOM   5774  C  CB    . MET A  1  746  ? 117.015 51.206  25.404  1.00 87.74  ? 746  MET A CB    1 
ATOM   5775  C  CG    . MET A  1  746  ? 116.952 49.723  25.653  1.00 90.27  ? 746  MET A CG    1 
ATOM   5776  S  SD    . MET A  1  746  ? 115.265 49.130  25.440  1.00 93.59  ? 746  MET A SD    1 
ATOM   5777  C  CE    . MET A  1  746  ? 114.598 49.516  26.991  1.00 91.83  ? 746  MET A CE    1 
ATOM   5778  N  N     . VAL A  1  747  ? 118.275 54.210  25.492  1.00 87.85  ? 747  VAL A N     1 
ATOM   5779  C  CA    . VAL A  1  747  ? 118.462 55.563  24.972  1.00 87.10  ? 747  VAL A CA    1 
ATOM   5780  C  C     . VAL A  1  747  ? 119.980 55.824  24.869  1.00 91.56  ? 747  VAL A C     1 
ATOM   5781  O  O     . VAL A  1  747  ? 120.449 56.269  23.824  1.00 89.98  ? 747  VAL A O     1 
ATOM   5782  C  CB    . VAL A  1  747  ? 117.717 56.588  25.864  1.00 90.69  ? 747  VAL A CB    1 
ATOM   5783  C  CG1   . VAL A  1  747  ? 118.351 57.961  25.793  1.00 90.91  ? 747  VAL A CG1   1 
ATOM   5784  C  CG2   . VAL A  1  747  ? 116.239 56.661  25.502  1.00 89.84  ? 747  VAL A CG2   1 
ATOM   5785  N  N     . MET A  1  748  ? 120.732 55.465  25.931  1.00 91.01  ? 748  MET A N     1 
ATOM   5786  C  CA    . MET A  1  748  ? 122.182 55.604  26.067  1.00 92.56  ? 748  MET A CA    1 
ATOM   5787  C  C     . MET A  1  748  ? 122.969 54.815  25.032  1.00 94.82  ? 748  MET A C     1 
ATOM   5788  O  O     . MET A  1  748  ? 123.953 55.340  24.507  1.00 95.10  ? 748  MET A O     1 
ATOM   5789  C  CB    . MET A  1  748  ? 122.636 55.202  27.473  1.00 96.95  ? 748  MET A CB    1 
ATOM   5790  C  CG    . MET A  1  748  ? 122.632 56.341  28.456  1.00 103.37 ? 748  MET A CG    1 
ATOM   5791  S  SD    . MET A  1  748  ? 123.383 55.839  30.029  1.00 110.79 ? 748  MET A SD    1 
ATOM   5792  C  CE    . MET A  1  748  ? 121.919 55.443  30.978  1.00 108.27 ? 748  MET A CE    1 
ATOM   5793  N  N     . ALA A  1  749  ? 122.561 53.556  24.758  1.00 89.12  ? 749  ALA A N     1 
ATOM   5794  C  CA    . ALA A  1  749  ? 123.223 52.693  23.775  1.00 87.32  ? 749  ALA A CA    1 
ATOM   5795  C  C     . ALA A  1  749  ? 122.835 53.092  22.354  1.00 89.70  ? 749  ALA A C     1 
ATOM   5796  O  O     . ALA A  1  749  ? 123.599 52.863  21.420  1.00 89.37  ? 749  ALA A O     1 
ATOM   5797  C  CB    . ALA A  1  749  ? 122.867 51.237  24.024  1.00 87.57  ? 749  ALA A CB    1 
ATOM   5798  N  N     . GLY A  1  750  ? 121.663 53.698  22.211  1.00 84.90  ? 750  GLY A N     1 
ATOM   5799  C  CA    . GLY A  1  750  ? 121.133 54.105  20.919  1.00 83.19  ? 750  GLY A CA    1 
ATOM   5800  C  C     . GLY A  1  750  ? 120.428 52.970  20.210  1.00 84.93  ? 750  GLY A C     1 
ATOM   5801  O  O     . GLY A  1  750  ? 120.284 53.010  18.987  1.00 84.33  ? 750  GLY A O     1 
ATOM   5802  N  N     . SER A  1  751  ? 119.969 51.954  20.986  1.00 79.92  ? 751  SER A N     1 
ATOM   5803  C  CA    . SER A  1  751  ? 119.255 50.767  20.515  1.00 78.02  ? 751  SER A CA    1 
ATOM   5804  C  C     . SER A  1  751  ? 117.769 51.040  20.262  1.00 82.11  ? 751  SER A C     1 
ATOM   5805  O  O     . SER A  1  751  ? 117.260 50.613  19.231  1.00 81.38  ? 751  SER A O     1 
ATOM   5806  C  CB    . SER A  1  751  ? 119.446 49.607  21.482  1.00 80.98  ? 751  SER A CB    1 
ATOM   5807  O  OG    . SER A  1  751  ? 119.038 49.964  22.791  1.00 88.18  ? 751  SER A OG    1 
ATOM   5808  N  N     . LYS A  1  752  ? 117.081 51.744  21.187  1.00 80.11  ? 752  LYS A N     1 
ATOM   5809  C  CA    . LYS A  1  752  ? 115.679 52.189  21.078  1.00 80.22  ? 752  LYS A CA    1 
ATOM   5810  C  C     . LYS A  1  752  ? 115.398 53.369  21.996  1.00 89.06  ? 752  LYS A C     1 
ATOM   5811  O  O     . LYS A  1  752  ? 115.964 53.472  23.096  1.00 89.47  ? 752  LYS A O     1 
ATOM   5812  C  CB    . LYS A  1  752  ? 114.652 51.073  21.347  1.00 80.96  ? 752  LYS A CB    1 
ATOM   5813  C  CG    . LYS A  1  752  ? 114.177 50.350  20.098  1.00 86.94  ? 752  LYS A CG    1 
ATOM   5814  C  CD    . LYS A  1  752  ? 113.209 51.152  19.237  1.00 91.04  ? 752  LYS A CD    1 
ATOM   5815  C  CE    . LYS A  1  752  ? 113.100 50.611  17.823  1.00 91.41  ? 752  LYS A CE    1 
ATOM   5816  N  NZ    . LYS A  1  752  ? 112.253 49.381  17.738  1.00 101.16 ? 752  LYS A NZ    1 
ATOM   5817  N  N     . GLY A  1  753  ? 114.508 54.243  21.540  1.00 87.86  ? 753  GLY A N     1 
ATOM   5818  C  CA    . GLY A  1  753  ? 114.063 55.389  22.324  1.00 89.17  ? 753  GLY A CA    1 
ATOM   5819  C  C     . GLY A  1  753  ? 114.893 56.644  22.210  1.00 94.21  ? 753  GLY A C     1 
ATOM   5820  O  O     . GLY A  1  753  ? 116.061 56.595  21.814  1.00 94.44  ? 753  GLY A O     1 
ATOM   5821  N  N     . SER A  1  754  ? 114.280 57.774  22.587  1.00 91.38  ? 754  SER A N     1 
ATOM   5822  C  CA    . SER A  1  754  ? 114.854 59.121  22.588  1.00 91.85  ? 754  SER A CA    1 
ATOM   5823  C  C     . SER A  1  754  ? 114.283 59.907  23.766  1.00 95.88  ? 754  SER A C     1 
ATOM   5824  O  O     . SER A  1  754  ? 113.428 59.383  24.481  1.00 94.84  ? 754  SER A O     1 
ATOM   5825  C  CB    . SER A  1  754  ? 114.538 59.831  21.276  1.00 95.08  ? 754  SER A CB    1 
ATOM   5826  O  OG    . SER A  1  754  ? 113.144 60.058  21.170  1.00 105.74 ? 754  SER A OG    1 
ATOM   5827  N  N     . PHE A  1  755  ? 114.744 61.155  23.968  1.00 94.15  ? 755  PHE A N     1 
ATOM   5828  C  CA    . PHE A  1  755  ? 114.281 61.998  25.076  1.00 95.82  ? 755  PHE A CA    1 
ATOM   5829  C  C     . PHE A  1  755  ? 112.758 62.043  25.198  1.00 99.13  ? 755  PHE A C     1 
ATOM   5830  O  O     . PHE A  1  755  ? 112.227 61.796  26.283  1.00 98.60  ? 755  PHE A O     1 
ATOM   5831  C  CB    . PHE A  1  755  ? 114.856 63.428  24.980  1.00 98.65  ? 755  PHE A CB    1 
ATOM   5832  C  CG    . PHE A  1  755  ? 114.096 64.460  25.788  1.00 102.14 ? 755  PHE A CG    1 
ATOM   5833  C  CD1   . PHE A  1  755  ? 114.247 64.537  27.169  1.00 107.36 ? 755  PHE A CD1   1 
ATOM   5834  C  CD2   . PHE A  1  755  ? 113.230 65.356  25.168  1.00 105.12 ? 755  PHE A CD2   1 
ATOM   5835  C  CE1   . PHE A  1  755  ? 113.529 65.476  27.919  1.00 109.59 ? 755  PHE A CE1   1 
ATOM   5836  C  CE2   . PHE A  1  755  ? 112.519 66.305  25.918  1.00 109.46 ? 755  PHE A CE2   1 
ATOM   5837  C  CZ    . PHE A  1  755  ? 112.677 66.359  27.290  1.00 108.78 ? 755  PHE A CZ    1 
ATOM   5838  N  N     . ILE A  1  756  ? 112.070 62.347  24.075  1.00 94.94  ? 756  ILE A N     1 
ATOM   5839  C  CA    . ILE A  1  756  ? 110.621 62.518  24.005  1.00 94.38  ? 756  ILE A CA    1 
ATOM   5840  C  C     . ILE A  1  756  ? 109.848 61.326  24.571  1.00 96.52  ? 756  ILE A C     1 
ATOM   5841  O  O     . ILE A  1  756  ? 108.817 61.537  25.213  1.00 96.70  ? 756  ILE A O     1 
ATOM   5842  C  CB    . ILE A  1  756  ? 110.143 62.921  22.584  1.00 96.80  ? 756  ILE A CB    1 
ATOM   5843  C  CG1   . ILE A  1  756  ? 108.754 63.603  22.627  1.00 98.17  ? 756  ILE A CG1   1 
ATOM   5844  C  CG2   . ILE A  1  756  ? 110.197 61.783  21.575  1.00 95.60  ? 756  ILE A CG2   1 
ATOM   5845  C  CD1   . ILE A  1  756  ? 108.690 64.945  23.523  1.00 106.15 ? 756  ILE A CD1   1 
ATOM   5846  N  N     . ASN A  1  757  ? 110.360 60.100  24.369  1.00 91.09  ? 757  ASN A N     1 
ATOM   5847  C  CA    . ASN A  1  757  ? 109.745 58.879  24.877  1.00 89.96  ? 757  ASN A CA    1 
ATOM   5848  C  C     . ASN A  1  757  ? 109.758 58.888  26.420  1.00 93.78  ? 757  ASN A C     1 
ATOM   5849  O  O     . ASN A  1  757  ? 108.736 58.596  27.045  1.00 93.66  ? 757  ASN A O     1 
ATOM   5850  C  CB    . ASN A  1  757  ? 110.417 57.637  24.269  1.00 87.03  ? 757  ASN A CB    1 
ATOM   5851  C  CG    . ASN A  1  757  ? 110.318 57.567  22.752  1.00 104.00 ? 757  ASN A CG    1 
ATOM   5852  O  OD1   . ASN A  1  757  ? 109.273 57.803  22.135  1.00 98.81  ? 757  ASN A OD1   1 
ATOM   5853  N  ND2   . ASN A  1  757  ? 111.405 57.230  22.108  1.00 93.70  ? 757  ASN A ND2   1 
ATOM   5854  N  N     . ILE A  1  758  ? 110.877 59.327  27.021  1.00 89.58  ? 758  ILE A N     1 
ATOM   5855  C  CA    . ILE A  1  758  ? 110.994 59.435  28.472  1.00 90.10  ? 758  ILE A CA    1 
ATOM   5856  C  C     . ILE A  1  758  ? 110.014 60.496  28.968  1.00 95.47  ? 758  ILE A C     1 
ATOM   5857  O  O     . ILE A  1  758  ? 109.270 60.234  29.907  1.00 96.68  ? 758  ILE A O     1 
ATOM   5858  C  CB    . ILE A  1  758  ? 112.467 59.692  28.914  1.00 93.15  ? 758  ILE A CB    1 
ATOM   5859  C  CG1   . ILE A  1  758  ? 113.286 58.399  28.838  1.00 92.41  ? 758  ILE A CG1   1 
ATOM   5860  C  CG2   . ILE A  1  758  ? 112.550 60.290  30.322  1.00 95.34  ? 758  ILE A CG2   1 
ATOM   5861  C  CD1   . ILE A  1  758  ? 114.717 58.599  28.595  1.00 98.69  ? 758  ILE A CD1   1 
ATOM   5862  N  N     . ALA A  1  759  ? 109.981 61.659  28.296  1.00 91.78  ? 759  ALA A N     1 
ATOM   5863  C  CA    . ALA A  1  759  ? 109.119 62.799  28.618  1.00 92.28  ? 759  ALA A CA    1 
ATOM   5864  C  C     . ALA A  1  759  ? 107.618 62.447  28.694  1.00 95.06  ? 759  ALA A C     1 
ATOM   5865  O  O     . ALA A  1  759  ? 106.969 62.681  29.723  1.00 95.91  ? 759  ALA A O     1 
ATOM   5866  C  CB    . ALA A  1  759  ? 109.350 63.923  27.611  1.00 92.77  ? 759  ALA A CB    1 
ATOM   5867  N  N     . GLN A  1  760  ? 107.087 61.863  27.614  1.00 89.02  ? 760  GLN A N     1 
ATOM   5868  C  CA    . GLN A  1  760  ? 105.676 61.517  27.501  1.00 88.21  ? 760  GLN A CA    1 
ATOM   5869  C  C     . GLN A  1  760  ? 105.248 60.337  28.395  1.00 93.43  ? 760  GLN A C     1 
ATOM   5870  O  O     . GLN A  1  760  ? 104.095 60.296  28.817  1.00 93.91  ? 760  GLN A O     1 
ATOM   5871  C  CB    . GLN A  1  760  ? 105.297 61.286  26.032  1.00 87.67  ? 760  GLN A CB    1 
ATOM   5872  C  CG    . GLN A  1  760  ? 105.560 62.497  25.136  1.00 85.42  ? 760  GLN A CG    1 
ATOM   5873  C  CD    . GLN A  1  760  ? 105.022 62.301  23.749  1.00 99.12  ? 760  GLN A CD    1 
ATOM   5874  O  OE1   . GLN A  1  760  ? 105.300 61.303  23.082  1.00 96.14  ? 760  GLN A OE1   1 
ATOM   5875  N  NE2   . GLN A  1  760  ? 104.253 63.262  23.270  1.00 89.38  ? 760  GLN A NE2   1 
ATOM   5876  N  N     . MET A  1  761  ? 106.161 59.398  28.695  1.00 90.03  ? 761  MET A N     1 
ATOM   5877  C  CA    . MET A  1  761  ? 105.847 58.248  29.544  1.00 89.94  ? 761  MET A CA    1 
ATOM   5878  C  C     . MET A  1  761  ? 105.929 58.577  31.029  1.00 95.08  ? 761  MET A C     1 
ATOM   5879  O  O     . MET A  1  761  ? 105.142 58.053  31.808  1.00 95.34  ? 761  MET A O     1 
ATOM   5880  C  CB    . MET A  1  761  ? 106.813 57.092  29.270  1.00 91.43  ? 761  MET A CB    1 
ATOM   5881  C  CG    . MET A  1  761  ? 106.511 56.311  28.023  1.00 93.90  ? 761  MET A CG    1 
ATOM   5882  S  SD    . MET A  1  761  ? 107.401 54.725  27.968  1.00 97.40  ? 761  MET A SD    1 
ATOM   5883  C  CE    . MET A  1  761  ? 109.073 55.265  27.540  1.00 93.19  ? 761  MET A CE    1 
ATOM   5884  N  N     . SER A  1  762  ? 106.908 59.393  31.430  1.00 92.26  ? 762  SER A N     1 
ATOM   5885  C  CA    . SER A  1  762  ? 107.180 59.666  32.835  1.00 93.85  ? 762  SER A CA    1 
ATOM   5886  C  C     . SER A  1  762  ? 106.614 60.952  33.398  1.00 99.16  ? 762  SER A C     1 
ATOM   5887  O  O     . SER A  1  762  ? 106.197 60.953  34.566  1.00 99.27  ? 762  SER A O     1 
ATOM   5888  C  CB    . SER A  1  762  ? 108.687 59.641  33.087  1.00 98.28  ? 762  SER A CB    1 
ATOM   5889  O  OG    . SER A  1  762  ? 109.315 58.513  32.494  1.00 108.09 ? 762  SER A OG    1 
ATOM   5890  N  N     . ALA A  1  763  ? 106.648 62.053  32.596  1.00 95.92  ? 763  ALA A N     1 
ATOM   5891  C  CA    . ALA A  1  763  ? 106.289 63.410  33.026  1.00 96.79  ? 763  ALA A CA    1 
ATOM   5892  C  C     . ALA A  1  763  ? 104.985 64.005  32.470  1.00 100.53 ? 763  ALA A C     1 
ATOM   5893  O  O     . ALA A  1  763  ? 104.041 64.235  33.245  1.00 100.98 ? 763  ALA A O     1 
ATOM   5894  C  CB    . ALA A  1  763  ? 107.441 64.360  32.723  1.00 97.50  ? 763  ALA A CB    1 
ATOM   5895  N  N     . CYS A  1  764  ? 104.962 64.330  31.160  1.00 95.86  ? 764  CYS A N     1 
ATOM   5896  C  CA    . CYS A  1  764  ? 103.837 65.001  30.507  1.00 95.72  ? 764  CYS A CA    1 
ATOM   5897  C  C     . CYS A  1  764  ? 103.851 64.695  29.016  1.00 92.89  ? 764  CYS A C     1 
ATOM   5898  O  O     . CYS A  1  764  ? 104.914 64.778  28.407  1.00 91.54  ? 764  CYS A O     1 
ATOM   5899  C  CB    . CYS A  1  764  ? 103.916 66.507  30.784  1.00 98.47  ? 764  CYS A CB    1 
ATOM   5900  S  SG    . CYS A  1  764  ? 103.062 67.558  29.576  1.00 102.78 ? 764  CYS A SG    1 
ATOM   5901  N  N     . VAL A  1  765  ? 102.680 64.347  28.431  1.00 85.92  ? 765  VAL A N     1 
ATOM   5902  C  CA    . VAL A  1  765  ? 102.517 64.015  27.000  1.00 82.95  ? 765  VAL A CA    1 
ATOM   5903  C  C     . VAL A  1  765  ? 102.720 65.270  26.148  1.00 88.96  ? 765  VAL A C     1 
ATOM   5904  O  O     . VAL A  1  765  ? 103.544 65.269  25.230  1.00 88.01  ? 765  VAL A O     1 
ATOM   5905  C  CB    . VAL A  1  765  ? 101.177 63.299  26.694  1.00 84.19  ? 765  VAL A CB    1 
ATOM   5906  C  CG1   . VAL A  1  765  ? 100.923 63.209  25.199  1.00 82.41  ? 765  VAL A CG1   1 
ATOM   5907  C  CG2   . VAL A  1  765  ? 101.139 61.917  27.318  1.00 83.34  ? 765  VAL A CG2   1 
ATOM   5908  N  N     . GLY A  1  766  ? 101.987 66.326  26.483  1.00 87.87  ? 766  GLY A N     1 
ATOM   5909  C  CA    . GLY A  1  766  ? 102.096 67.613  25.814  1.00 88.32  ? 766  GLY A CA    1 
ATOM   5910  C  C     . GLY A  1  766  ? 100.922 67.979  24.948  1.00 92.65  ? 766  GLY A C     1 
ATOM   5911  O  O     . GLY A  1  766  ? 99.904  67.286  24.949  1.00 91.99  ? 766  GLY A O     1 
ATOM   5912  N  N     . GLN A  1  767  ? 101.069 69.094  24.216  1.00 90.61  ? 767  GLN A N     1 
ATOM   5913  C  CA    . GLN A  1  767  ? 100.046 69.635  23.327  1.00 91.02  ? 767  GLN A CA    1 
ATOM   5914  C  C     . GLN A  1  767  ? 99.742  68.687  22.159  1.00 96.16  ? 767  GLN A C     1 
ATOM   5915  O  O     . GLN A  1  767  ? 100.653 68.113  21.549  1.00 94.90  ? 767  GLN A O     1 
ATOM   5916  C  CB    . GLN A  1  767  ? 100.443 71.048  22.836  1.00 92.42  ? 767  GLN A CB    1 
ATOM   5917  C  CG    . GLN A  1  767  ? 99.389  71.806  22.013  1.00 100.08 ? 767  GLN A CG    1 
ATOM   5918  C  CD    . GLN A  1  767  ? 98.071  72.059  22.719  1.00 128.46 ? 767  GLN A CD    1 
ATOM   5919  O  OE1   . GLN A  1  767  ? 97.964  72.802  23.709  1.00 125.81 ? 767  GLN A OE1   1 
ATOM   5920  N  NE2   . GLN A  1  767  ? 97.018  71.501  22.163  1.00 123.77 ? 767  GLN A NE2   1 
ATOM   5921  N  N     . GLN A  1  768  ? 98.449  68.496  21.895  1.00 93.66  ? 768  GLN A N     1 
ATOM   5922  C  CA    . GLN A  1  768  ? 97.975  67.701  20.777  1.00 92.59  ? 768  GLN A CA    1 
ATOM   5923  C  C     . GLN A  1  768  ? 97.662  68.671  19.613  1.00 97.89  ? 768  GLN A C     1 
ATOM   5924  O  O     . GLN A  1  768  ? 97.267  69.819  19.857  1.00 98.44  ? 768  GLN A O     1 
ATOM   5925  C  CB    . GLN A  1  768  ? 96.774  66.832  21.199  1.00 93.65  ? 768  GLN A CB    1 
ATOM   5926  C  CG    . GLN A  1  768  ? 97.060  65.330  21.136  1.00 100.72 ? 768  GLN A CG    1 
ATOM   5927  C  CD    . GLN A  1  768  ? 98.369  64.905  21.774  1.00 114.87 ? 768  GLN A CD    1 
ATOM   5928  O  OE1   . GLN A  1  768  ? 98.670  65.245  22.917  1.00 114.66 ? 768  GLN A OE1   1 
ATOM   5929  N  NE2   . GLN A  1  768  ? 99.191  64.165  21.039  1.00 97.88  ? 768  GLN A NE2   1 
ATOM   5930  N  N     . SER A  1  769  ? 97.934  68.250  18.365  1.00 93.71  ? 769  SER A N     1 
ATOM   5931  C  CA    . SER A  1  769  ? 97.716  69.106  17.203  1.00 93.31  ? 769  SER A CA    1 
ATOM   5932  C  C     . SER A  1  769  ? 97.192  68.378  15.983  1.00 95.60  ? 769  SER A C     1 
ATOM   5933  O  O     . SER A  1  769  ? 97.678  67.296  15.611  1.00 94.24  ? 769  SER A O     1 
ATOM   5934  C  CB    . SER A  1  769  ? 98.990  69.864  16.839  1.00 97.43  ? 769  SER A CB    1 
ATOM   5935  O  OG    . SER A  1  769  ? 99.398  69.616  15.500  1.00 107.70 ? 769  SER A OG    1 
ATOM   5936  N  N     . VAL A  1  770  ? 96.232  69.039  15.331  1.00 91.30  ? 770  VAL A N     1 
ATOM   5937  C  CA    . VAL A  1  770  ? 95.606  68.640  14.078  1.00 89.55  ? 770  VAL A CA    1 
ATOM   5938  C  C     . VAL A  1  770  ? 95.817  69.832  13.132  1.00 95.67  ? 770  VAL A C     1 
ATOM   5939  O  O     . VAL A  1  770  ? 95.523  70.982  13.499  1.00 96.97  ? 770  VAL A O     1 
ATOM   5940  C  CB    . VAL A  1  770  ? 94.109  68.262  14.234  1.00 92.15  ? 770  VAL A CB    1 
ATOM   5941  C  CG1   . VAL A  1  770  ? 93.495  67.874  12.894  1.00 91.06  ? 770  VAL A CG1   1 
ATOM   5942  C  CG2   . VAL A  1  770  ? 93.927  67.136  15.240  1.00 91.57  ? 770  VAL A CG2   1 
ATOM   5943  N  N     . GLU A  1  771  ? 96.358  69.545  11.929  1.00 91.38  ? 771  GLU A N     1 
ATOM   5944  C  CA    . GLU A  1  771  ? 96.673  70.496  10.858  1.00 91.29  ? 771  GLU A CA    1 
ATOM   5945  C  C     . GLU A  1  771  ? 97.652  71.612  11.338  1.00 96.80  ? 771  GLU A C     1 
ATOM   5946  O  O     . GLU A  1  771  ? 97.524  72.781  10.950  1.00 97.56  ? 771  GLU A O     1 
ATOM   5947  C  CB    . GLU A  1  771  ? 95.389  71.045  10.187  1.00 93.14  ? 771  GLU A CB    1 
ATOM   5948  C  CG    . GLU A  1  771  ? 94.656  70.010  9.343   1.00 104.53 ? 771  GLU A CG    1 
ATOM   5949  C  CD    . GLU A  1  771  ? 93.383  70.461  8.648   1.00 129.59 ? 771  GLU A CD    1 
ATOM   5950  O  OE1   . GLU A  1  771  ? 92.418  70.833  9.353   1.00 129.77 ? 771  GLU A OE1   1 
ATOM   5951  O  OE2   . GLU A  1  771  ? 93.326  70.371  7.399   1.00 121.74 ? 771  GLU A OE2   1 
ATOM   5952  N  N     . GLY A  1  772  ? 98.624  71.215  12.171  1.00 93.20  ? 772  GLY A N     1 
ATOM   5953  C  CA    . GLY A  1  772  ? 99.664  72.095  12.706  1.00 93.54  ? 772  GLY A CA    1 
ATOM   5954  C  C     . GLY A  1  772  ? 99.232  73.002  13.842  1.00 98.26  ? 772  GLY A C     1 
ATOM   5955  O  O     . GLY A  1  772  ? 100.068 73.466  14.627  1.00 98.52  ? 772  GLY A O     1 
ATOM   5956  N  N     . LYS A  1  773  ? 97.925  73.260  13.929  1.00 94.44  ? 773  LYS A N     1 
ATOM   5957  C  CA    . LYS A  1  773  ? 97.301  74.089  14.950  1.00 95.19  ? 773  LYS A CA    1 
ATOM   5958  C  C     . LYS A  1  773  ? 96.743  73.164  16.057  1.00 99.55  ? 773  LYS A C     1 
ATOM   5959  O  O     . LYS A  1  773  ? 96.539  71.966  15.815  1.00 97.16  ? 773  LYS A O     1 
ATOM   5960  C  CB    . LYS A  1  773  ? 96.150  74.900  14.321  1.00 97.65  ? 773  LYS A CB    1 
ATOM   5961  C  CG    . LYS A  1  773  ? 96.422  75.450  12.919  1.00 103.39 ? 773  LYS A CG    1 
ATOM   5962  C  CD    . LYS A  1  773  ? 95.123  75.621  12.125  1.00 110.22 ? 773  LYS A CD    1 
ATOM   5963  C  CE    . LYS A  1  773  ? 95.094  76.864  11.266  1.00 122.93 ? 773  LYS A CE    1 
ATOM   5964  N  NZ    . LYS A  1  773  ? 95.060  78.122  12.077  1.00 136.15 ? 773  LYS A NZ    1 
ATOM   5965  N  N     . ARG A  1  774  ? 96.452  73.728  17.259  1.00 97.91  ? 774  ARG A N     1 
ATOM   5966  C  CA    . ARG A  1  774  ? 95.867  72.955  18.363  1.00 97.91  ? 774  ARG A CA    1 
ATOM   5967  C  C     . ARG A  1  774  ? 94.395  72.561  18.063  1.00 103.76 ? 774  ARG A C     1 
ATOM   5968  O  O     . ARG A  1  774  ? 93.902  72.865  16.973  1.00 103.86 ? 774  ARG A O     1 
ATOM   5969  C  CB    . ARG A  1  774  ? 96.054  73.628  19.735  1.00 96.33  ? 774  ARG A CB    1 
ATOM   5970  C  CG    . ARG A  1  774  ? 95.920  75.131  19.783  1.00 103.48 ? 774  ARG A CG    1 
ATOM   5971  C  CD    . ARG A  1  774  ? 96.838  75.711  20.846  1.00 110.15 ? 774  ARG A CD    1 
ATOM   5972  N  NE    . ARG A  1  774  ? 96.314  75.594  22.211  1.00 118.36 ? 774  ARG A NE    1 
ATOM   5973  C  CZ    . ARG A  1  774  ? 95.727  76.582  22.886  1.00 130.67 ? 774  ARG A CZ    1 
ATOM   5974  N  NH1   . ARG A  1  774  ? 95.557  77.773  22.324  1.00 109.76 ? 774  ARG A NH1   1 
ATOM   5975  N  NH2   . ARG A  1  774  ? 95.296  76.381  24.123  1.00 121.42 ? 774  ARG A NH2   1 
ATOM   5976  N  N     . ILE A  1  775  ? 93.736  71.798  18.969  1.00 100.90 ? 775  ILE A N     1 
ATOM   5977  C  CA    . ILE A  1  775  ? 92.371  71.302  18.739  1.00 100.60 ? 775  ILE A CA    1 
ATOM   5978  C  C     . ILE A  1  775  ? 91.395  72.460  18.540  1.00 106.99 ? 775  ILE A C     1 
ATOM   5979  O  O     . ILE A  1  775  ? 91.211  73.290  19.428  1.00 108.07 ? 775  ILE A O     1 
ATOM   5980  C  CB    . ILE A  1  775  ? 91.878  70.271  19.796  1.00 103.25 ? 775  ILE A CB    1 
ATOM   5981  C  CG1   . ILE A  1  775  ? 92.910  69.144  20.073  1.00 102.11 ? 775  ILE A CG1   1 
ATOM   5982  C  CG2   . ILE A  1  775  ? 90.507  69.702  19.413  1.00 104.04 ? 775  ILE A CG2   1 
ATOM   5983  C  CD1   . ILE A  1  775  ? 93.374  68.278  18.866  1.00 105.92 ? 775  ILE A CD1   1 
ATOM   5984  N  N     . ALA A  1  776  ? 90.815  72.521  17.339  1.00 103.85 ? 776  ALA A N     1 
ATOM   5985  C  CA    . ALA A  1  776  ? 89.884  73.561  16.917  1.00 104.93 ? 776  ALA A CA    1 
ATOM   5986  C  C     . ALA A  1  776  ? 88.466  73.336  17.416  1.00 109.50 ? 776  ALA A C     1 
ATOM   5987  O  O     . ALA A  1  776  ? 88.128  72.239  17.858  1.00 108.24 ? 776  ALA A O     1 
ATOM   5988  C  CB    . ALA A  1  776  ? 89.886  73.658  15.402  1.00 105.15 ? 776  ALA A CB    1 
ATOM   5989  N  N     . PHE A  1  777  ? 87.634  74.386  17.330  1.00 107.94 ? 777  PHE A N     1 
ATOM   5990  C  CA    . PHE A  1  777  ? 86.235  74.336  17.727  1.00 108.68 ? 777  PHE A CA    1 
ATOM   5991  C  C     . PHE A  1  777  ? 85.412  73.655  16.622  1.00 110.78 ? 777  PHE A C     1 
ATOM   5992  O  O     . PHE A  1  777  ? 84.998  74.313  15.666  1.00 110.73 ? 777  PHE A O     1 
ATOM   5993  C  CB    . PHE A  1  777  ? 85.701  75.756  18.022  1.00 112.20 ? 777  PHE A CB    1 
ATOM   5994  C  CG    . PHE A  1  777  ? 86.372  76.548  19.125  1.00 115.10 ? 777  PHE A CG    1 
ATOM   5995  C  CD1   . PHE A  1  777  ? 86.851  75.920  20.268  1.00 118.93 ? 777  PHE A CD1   1 
ATOM   5996  C  CD2   . PHE A  1  777  ? 86.448  77.932  19.058  1.00 118.63 ? 777  PHE A CD2   1 
ATOM   5997  C  CE1   . PHE A  1  777  ? 87.407  76.663  21.319  1.00 121.09 ? 777  PHE A CE1   1 
ATOM   5998  C  CE2   . PHE A  1  777  ? 87.018  78.673  20.102  1.00 122.56 ? 777  PHE A CE2   1 
ATOM   5999  C  CZ    . PHE A  1  777  ? 87.496  78.033  21.223  1.00 120.64 ? 777  PHE A CZ    1 
ATOM   6000  N  N     . GLY A  1  778  ? 85.221  72.340  16.742  1.00 105.61 ? 778  GLY A N     1 
ATOM   6001  C  CA    . GLY A  1  778  ? 84.418  71.556  15.801  1.00 104.17 ? 778  GLY A CA    1 
ATOM   6002  C  C     . GLY A  1  778  ? 82.951  71.858  16.002  1.00 106.63 ? 778  GLY A C     1 
ATOM   6003  O  O     . GLY A  1  778  ? 82.155  71.846  15.056  1.00 104.39 ? 778  GLY A O     1 
ATOM   6004  N  N     . PHE A  1  779  ? 82.618  72.148  17.268  1.00 104.84 ? 779  PHE A N     1 
ATOM   6005  C  CA    . PHE A  1  779  ? 81.323  72.604  17.739  1.00 106.35 ? 779  PHE A CA    1 
ATOM   6006  C  C     . PHE A  1  779  ? 81.371  74.129  17.699  1.00 112.13 ? 779  PHE A C     1 
ATOM   6007  O  O     . PHE A  1  779  ? 82.437  74.722  17.485  1.00 111.26 ? 779  PHE A O     1 
ATOM   6008  C  CB    . PHE A  1  779  ? 81.072  72.140  19.189  1.00 108.72 ? 779  PHE A CB    1 
ATOM   6009  C  CG    . PHE A  1  779  ? 80.772  70.670  19.369  1.00 109.37 ? 779  PHE A CG    1 
ATOM   6010  C  CD1   . PHE A  1  779  ? 79.496  70.169  19.132  1.00 112.30 ? 779  PHE A CD1   1 
ATOM   6011  C  CD2   . PHE A  1  779  ? 81.752  69.794  19.818  1.00 110.52 ? 779  PHE A CD2   1 
ATOM   6012  C  CE1   . PHE A  1  779  ? 79.218  68.812  19.304  1.00 112.33 ? 779  PHE A CE1   1 
ATOM   6013  C  CE2   . PHE A  1  779  ? 81.473  68.437  19.986  1.00 112.46 ? 779  PHE A CE2   1 
ATOM   6014  C  CZ    . PHE A  1  779  ? 80.207  67.957  19.731  1.00 110.62 ? 779  PHE A CZ    1 
ATOM   6015  N  N     . VAL A  1  780  ? 80.228  74.762  17.925  1.00 110.93 ? 780  VAL A N     1 
ATOM   6016  C  CA    . VAL A  1  780  ? 80.130  76.209  17.954  1.00 112.44 ? 780  VAL A CA    1 
ATOM   6017  C  C     . VAL A  1  780  ? 80.884  76.742  19.192  1.00 116.98 ? 780  VAL A C     1 
ATOM   6018  O  O     . VAL A  1  780  ? 80.467  76.508  20.329  1.00 117.61 ? 780  VAL A O     1 
ATOM   6019  C  CB    . VAL A  1  780  ? 78.652  76.683  17.856  1.00 118.12 ? 780  VAL A CB    1 
ATOM   6020  C  CG1   . VAL A  1  780  ? 78.527  78.187  18.073  1.00 119.78 ? 780  VAL A CG1   1 
ATOM   6021  C  CG2   . VAL A  1  780  ? 78.044  76.295  16.513  1.00 117.25 ? 780  VAL A CG2   1 
ATOM   6022  N  N     . ASP A  1  781  ? 82.052  77.365  18.934  1.00 112.82 ? 781  ASP A N     1 
ATOM   6023  C  CA    . ASP A  1  781  ? 82.969  78.039  19.867  1.00 113.16 ? 781  ASP A CA    1 
ATOM   6024  C  C     . ASP A  1  781  ? 83.489  77.163  21.065  1.00 114.53 ? 781  ASP A C     1 
ATOM   6025  O  O     . ASP A  1  781  ? 83.960  77.696  22.077  1.00 114.83 ? 781  ASP A O     1 
ATOM   6026  C  CB    . ASP A  1  781  ? 82.347  79.368  20.363  1.00 117.41 ? 781  ASP A CB    1 
ATOM   6027  C  CG    . ASP A  1  781  ? 82.029  80.388  19.265  1.00 130.86 ? 781  ASP A CG    1 
ATOM   6028  O  OD1   . ASP A  1  781  ? 82.657  80.315  18.177  1.00 129.46 ? 781  ASP A OD1   1 
ATOM   6029  O  OD2   . ASP A  1  781  ? 81.174  81.278  19.506  1.00 141.62 ? 781  ASP A OD2   1 
ATOM   6030  N  N     . ARG A  1  782  ? 83.476  75.833  20.909  1.00 108.28 ? 782  ARG A N     1 
ATOM   6031  C  CA    . ARG A  1  782  ? 83.995  74.895  21.914  1.00 106.58 ? 782  ARG A CA    1 
ATOM   6032  C  C     . ARG A  1  782  ? 84.461  73.587  21.266  1.00 105.03 ? 782  ARG A C     1 
ATOM   6033  O  O     . ARG A  1  782  ? 83.923  73.195  20.232  1.00 102.97 ? 782  ARG A O     1 
ATOM   6034  C  CB    . ARG A  1  782  ? 83.010  74.669  23.077  1.00 107.72 ? 782  ARG A CB    1 
ATOM   6035  C  CG    . ARG A  1  782  ? 81.708  73.990  22.678  1.00 109.69 ? 782  ARG A CG    1 
ATOM   6036  C  CD    . ARG A  1  782  ? 80.522  74.712  23.248  1.00 101.01 ? 782  ARG A CD    1 
ATOM   6037  N  NE    . ARG A  1  782  ? 79.298  73.962  23.008  1.00 94.10  ? 782  ARG A NE    1 
ATOM   6038  C  CZ    . ARG A  1  782  ? 78.677  73.242  23.933  1.00 108.37 ? 782  ARG A CZ    1 
ATOM   6039  N  NH1   . ARG A  1  782  ? 79.150  73.190  25.175  1.00 90.30  ? 782  ARG A NH1   1 
ATOM   6040  N  NH2   . ARG A  1  782  ? 77.569  72.582  23.632  1.00 100.98 ? 782  ARG A NH2   1 
ATOM   6041  N  N     . THR A  1  783  ? 85.490  72.950  21.855  1.00 99.54  ? 783  THR A N     1 
ATOM   6042  C  CA    . THR A  1  783  ? 86.095  71.695  21.376  1.00 97.20  ? 783  THR A CA    1 
ATOM   6043  C  C     . THR A  1  783  ? 85.249  70.448  21.686  1.00 99.36  ? 783  THR A C     1 
ATOM   6044  O  O     . THR A  1  783  ? 85.218  69.504  20.890  1.00 97.19  ? 783  THR A O     1 
ATOM   6045  C  CB    . THR A  1  783  ? 87.522  71.556  21.903  1.00 103.59 ? 783  THR A CB    1 
ATOM   6046  O  OG1   . THR A  1  783  ? 87.529  71.821  23.305  1.00 102.85 ? 783  THR A OG1   1 
ATOM   6047  C  CG2   . THR A  1  783  ? 88.486  72.496  21.210  1.00 103.48 ? 783  THR A CG2   1 
ATOM   6048  N  N     . LEU A  1  784  ? 84.570  70.450  22.843  1.00 96.13  ? 784  LEU A N     1 
ATOM   6049  C  CA    . LEU A  1  784  ? 83.706  69.362  23.297  1.00 95.60  ? 784  LEU A CA    1 
ATOM   6050  C  C     . LEU A  1  784  ? 82.483  69.950  24.054  1.00 100.85 ? 784  LEU A C     1 
ATOM   6051  O  O     . LEU A  1  784  ? 82.595  71.083  24.531  1.00 101.40 ? 784  LEU A O     1 
ATOM   6052  C  CB    . LEU A  1  784  ? 84.507  68.403  24.214  1.00 95.04  ? 784  LEU A CB    1 
ATOM   6053  C  CG    . LEU A  1  784  ? 85.563  67.481  23.579  1.00 97.19  ? 784  LEU A CG    1 
ATOM   6054  C  CD1   . LEU A  1  784  ? 86.254  66.664  24.639  1.00 97.09  ? 784  LEU A CD1   1 
ATOM   6055  C  CD2   . LEU A  1  784  ? 84.959  66.549  22.542  1.00 97.28  ? 784  LEU A CD2   1 
ATOM   6056  N  N     . PRO A  1  785  ? 81.331  69.228  24.220  1.00 97.35  ? 785  PRO A N     1 
ATOM   6057  C  CA    . PRO A  1  785  ? 80.190  69.825  24.950  1.00 98.79  ? 785  PRO A CA    1 
ATOM   6058  C  C     . PRO A  1  785  ? 80.355  69.929  26.469  1.00 105.37 ? 785  PRO A C     1 
ATOM   6059  O  O     . PRO A  1  785  ? 79.466  70.449  27.139  1.00 106.38 ? 785  PRO A O     1 
ATOM   6060  C  CB    . PRO A  1  785  ? 78.994  68.943  24.562  1.00 100.13 ? 785  PRO A CB    1 
ATOM   6061  C  CG    . PRO A  1  785  ? 79.523  67.911  23.609  1.00 102.75 ? 785  PRO A CG    1 
ATOM   6062  C  CD    . PRO A  1  785  ? 81.001  67.869  23.746  1.00 97.48  ? 785  PRO A CD    1 
ATOM   6063  N  N     . HIS A  1  786  ? 81.502  69.480  26.996  1.00 103.20 ? 786  HIS A N     1 
ATOM   6064  C  CA    . HIS A  1  786  ? 81.864  69.505  28.416  1.00 105.07 ? 786  HIS A CA    1 
ATOM   6065  C  C     . HIS A  1  786  ? 82.483  70.837  28.812  1.00 112.97 ? 786  HIS A C     1 
ATOM   6066  O  O     . HIS A  1  786  ? 82.688  71.090  30.005  1.00 114.51 ? 786  HIS A O     1 
ATOM   6067  C  CB    . HIS A  1  786  ? 82.817  68.342  28.736  1.00 104.68 ? 786  HIS A CB    1 
ATOM   6068  C  CG    . HIS A  1  786  ? 82.354  67.066  28.118  1.00 106.75 ? 786  HIS A CG    1 
ATOM   6069  N  ND1   . HIS A  1  786  ? 82.642  66.768  26.806  1.00 106.99 ? 786  HIS A ND1   1 
ATOM   6070  C  CD2   . HIS A  1  786  ? 81.526  66.119  28.612  1.00 108.84 ? 786  HIS A CD2   1 
ATOM   6071  C  CE1   . HIS A  1  786  ? 82.019  65.632  26.553  1.00 106.05 ? 786  HIS A CE1   1 
ATOM   6072  N  NE2   . HIS A  1  786  ? 81.338  65.201  27.610  1.00 107.43 ? 786  HIS A NE2   1 
ATOM   6073  N  N     . PHE A  1  787  ? 82.762  71.693  27.804  1.00 110.28 ? 787  PHE A N     1 
ATOM   6074  C  CA    . PHE A  1  787  ? 83.356  73.021  27.954  1.00 111.19 ? 787  PHE A CA    1 
ATOM   6075  C  C     . PHE A  1  787  ? 82.359  74.144  27.647  1.00 115.19 ? 787  PHE A C     1 
ATOM   6076  O  O     . PHE A  1  787  ? 81.436  73.972  26.837  1.00 113.41 ? 787  PHE A O     1 
ATOM   6077  C  CB    . PHE A  1  787  ? 84.562  73.187  27.000  1.00 112.01 ? 787  PHE A CB    1 
ATOM   6078  C  CG    . PHE A  1  787  ? 85.717  72.226  27.149  1.00 112.71 ? 787  PHE A CG    1 
ATOM   6079  C  CD1   . PHE A  1  787  ? 86.689  72.428  28.121  1.00 115.98 ? 787  PHE A CD1   1 
ATOM   6080  C  CD2   . PHE A  1  787  ? 85.875  71.162  26.266  1.00 113.91 ? 787  PHE A CD2   1 
ATOM   6081  C  CE1   . PHE A  1  787  ? 87.769  71.551  28.243  1.00 116.10 ? 787  PHE A CE1   1 
ATOM   6082  C  CE2   . PHE A  1  787  ? 86.959  70.289  26.384  1.00 115.55 ? 787  PHE A CE2   1 
ATOM   6083  C  CZ    . PHE A  1  787  ? 87.904  70.494  27.367  1.00 113.94 ? 787  PHE A CZ    1 
ATOM   6084  N  N     . SER A  1  788  ? 82.614  75.326  28.241  1.00 113.23 ? 788  SER A N     1 
ATOM   6085  C  CA    . SER A  1  788  ? 81.846  76.537  27.977  1.00 114.40 ? 788  SER A CA    1 
ATOM   6086  C  C     . SER A  1  788  ? 82.310  77.130  26.622  1.00 118.46 ? 788  SER A C     1 
ATOM   6087  O  O     . SER A  1  788  ? 83.354  76.715  26.101  1.00 117.94 ? 788  SER A O     1 
ATOM   6088  C  CB    . SER A  1  788  ? 82.031  77.538  29.113  1.00 119.50 ? 788  SER A CB    1 
ATOM   6089  O  OG    . SER A  1  788  ? 81.037  77.369  30.114  1.00 130.78 ? 788  SER A OG    1 
ATOM   6090  N  N     . LYS A  1  789  ? 81.530  78.055  26.026  1.00 114.80 ? 789  LYS A N     1 
ATOM   6091  C  CA    . LYS A  1  789  ? 81.908  78.665  24.743  1.00 113.79 ? 789  LYS A CA    1 
ATOM   6092  C  C     . LYS A  1  789  ? 83.096  79.648  24.907  1.00 119.56 ? 789  LYS A C     1 
ATOM   6093  O  O     . LYS A  1  789  ? 83.346  80.135  26.019  1.00 120.36 ? 789  LYS A O     1 
ATOM   6094  C  CB    . LYS A  1  789  ? 80.702  79.346  24.068  1.00 116.19 ? 789  LYS A CB    1 
ATOM   6095  C  CG    . LYS A  1  789  ? 79.690  78.390  23.438  1.00 117.63 ? 789  LYS A CG    1 
ATOM   6096  C  CD    . LYS A  1  789  ? 78.620  79.141  22.639  1.00 121.83 ? 789  LYS A CD    1 
ATOM   6097  C  CE    . LYS A  1  789  ? 77.744  78.223  21.823  1.00 125.06 ? 789  LYS A CE    1 
ATOM   6098  N  NZ    . LYS A  1  789  ? 76.760  78.981  21.011  1.00 133.03 ? 789  LYS A NZ    1 
ATOM   6099  N  N     . ASP A  1  790  ? 83.835  79.909  23.800  1.00 116.09 ? 790  ASP A N     1 
ATOM   6100  C  CA    . ASP A  1  790  ? 85.008  80.798  23.729  1.00 116.53 ? 790  ASP A CA    1 
ATOM   6101  C  C     . ASP A  1  790  ? 86.062  80.481  24.836  1.00 119.79 ? 790  ASP A C     1 
ATOM   6102  O  O     . ASP A  1  790  ? 86.496  81.373  25.575  1.00 120.53 ? 790  ASP A O     1 
ATOM   6103  C  CB    . ASP A  1  790  ? 84.586  82.296  23.706  1.00 120.46 ? 790  ASP A CB    1 
ATOM   6104  C  CG    . ASP A  1  790  ? 83.802  82.734  22.469  1.00 131.17 ? 790  ASP A CG    1 
ATOM   6105  O  OD1   . ASP A  1  790  ? 84.375  82.684  21.349  1.00 131.08 ? 790  ASP A OD1   1 
ATOM   6106  O  OD2   . ASP A  1  790  ? 82.633  83.175  22.627  1.00 135.12 ? 790  ASP A OD2   1 
ATOM   6107  N  N     . ASP A  1  791  ? 86.435  79.181  24.949  1.00 114.63 ? 791  ASP A N     1 
ATOM   6108  C  CA    . ASP A  1  791  ? 87.426  78.654  25.900  1.00 113.90 ? 791  ASP A CA    1 
ATOM   6109  C  C     . ASP A  1  791  ? 88.719  78.342  25.128  1.00 116.84 ? 791  ASP A C     1 
ATOM   6110  O  O     . ASP A  1  791  ? 88.731  77.453  24.264  1.00 114.45 ? 791  ASP A O     1 
ATOM   6111  C  CB    . ASP A  1  791  ? 86.880  77.397  26.640  1.00 114.84 ? 791  ASP A CB    1 
ATOM   6112  C  CG    . ASP A  1  791  ? 87.611  76.964  27.918  1.00 115.37 ? 791  ASP A CG    1 
ATOM   6113  O  OD1   . ASP A  1  791  ? 88.843  77.154  27.996  1.00 114.37 ? 791  ASP A OD1   1 
ATOM   6114  O  OD2   . ASP A  1  791  ? 86.957  76.362  28.806  1.00 114.83 ? 791  ASP A OD2   1 
ATOM   6115  N  N     . TYR A  1  792  ? 89.789  79.113  25.415  1.00 114.45 ? 792  TYR A N     1 
ATOM   6116  C  CA    . TYR A  1  792  ? 91.086  78.981  24.743  1.00 113.48 ? 792  TYR A CA    1 
ATOM   6117  C  C     . TYR A  1  792  ? 92.172  78.427  25.665  1.00 116.39 ? 792  TYR A C     1 
ATOM   6118  O  O     . TYR A  1  792  ? 93.348  78.431  25.286  1.00 115.29 ? 792  TYR A O     1 
ATOM   6119  C  CB    . TYR A  1  792  ? 91.513  80.326  24.118  1.00 115.84 ? 792  TYR A CB    1 
ATOM   6120  C  CG    . TYR A  1  792  ? 90.644  80.780  22.960  1.00 118.94 ? 792  TYR A CG    1 
ATOM   6121  C  CD1   . TYR A  1  792  ? 89.444  81.456  23.184  1.00 122.28 ? 792  TYR A CD1   1 
ATOM   6122  C  CD2   . TYR A  1  792  ? 91.034  80.563  21.640  1.00 119.06 ? 792  TYR A CD2   1 
ATOM   6123  C  CE1   . TYR A  1  792  ? 88.636  81.872  22.123  1.00 123.46 ? 792  TYR A CE1   1 
ATOM   6124  C  CE2   . TYR A  1  792  ? 90.243  80.990  20.570  1.00 120.41 ? 792  TYR A CE2   1 
ATOM   6125  C  CZ    . TYR A  1  792  ? 89.043  81.646  20.816  1.00 130.56 ? 792  TYR A CZ    1 
ATOM   6126  O  OH    . TYR A  1  792  ? 88.249  82.063  19.769  1.00 133.15 ? 792  TYR A OH    1 
ATOM   6127  N  N     . SER A  1  793  ? 91.770  77.914  26.859  1.00 112.99 ? 793  SER A N     1 
ATOM   6128  C  CA    . SER A  1  793  ? 92.659  77.339  27.882  1.00 112.52 ? 793  SER A CA    1 
ATOM   6129  C  C     . SER A  1  793  ? 93.381  76.088  27.391  1.00 115.74 ? 793  SER A C     1 
ATOM   6130  O  O     . SER A  1  793  ? 92.821  75.389  26.535  1.00 115.70 ? 793  SER A O     1 
ATOM   6131  C  CB    . SER A  1  793  ? 91.895  77.041  29.172  1.00 116.58 ? 793  SER A CB    1 
ATOM   6132  O  OG    . SER A  1  793  ? 90.994  75.952  29.062  1.00 123.97 ? 793  SER A OG    1 
ATOM   6133  N  N     . PRO A  1  794  ? 94.603  75.768  27.913  1.00 111.36 ? 794  PRO A N     1 
ATOM   6134  C  CA    . PRO A  1  794  ? 95.331  74.566  27.424  1.00 109.51 ? 794  PRO A CA    1 
ATOM   6135  C  C     . PRO A  1  794  ? 94.490  73.281  27.351  1.00 109.88 ? 794  PRO A C     1 
ATOM   6136  O  O     . PRO A  1  794  ? 94.512  72.609  26.324  1.00 107.47 ? 794  PRO A O     1 
ATOM   6137  C  CB    . PRO A  1  794  ? 96.527  74.440  28.382  1.00 111.65 ? 794  PRO A CB    1 
ATOM   6138  C  CG    . PRO A  1  794  ? 96.318  75.469  29.454  1.00 117.58 ? 794  PRO A CG    1 
ATOM   6139  C  CD    . PRO A  1  794  ? 95.410  76.511  28.903  1.00 113.72 ? 794  PRO A CD    1 
ATOM   6140  N  N     . GLU A  1  795  ? 93.687  73.021  28.406  1.00 106.19 ? 795  GLU A N     1 
ATOM   6141  C  CA    . GLU A  1  795  ? 92.744  71.915  28.589  1.00 105.34 ? 795  GLU A CA    1 
ATOM   6142  C  C     . GLU A  1  795  ? 91.734  71.890  27.454  1.00 108.92 ? 795  GLU A C     1 
ATOM   6143  O  O     . GLU A  1  795  ? 91.493  70.822  26.880  1.00 107.85 ? 795  GLU A O     1 
ATOM   6144  C  CB    . GLU A  1  795  ? 91.972  72.060  29.921  1.00 108.19 ? 795  GLU A CB    1 
ATOM   6145  C  CG    . GLU A  1  795  ? 92.815  72.461  31.125  1.00 123.11 ? 795  GLU A CG    1 
ATOM   6146  C  CD    . GLU A  1  795  ? 92.937  73.948  31.420  1.00 145.34 ? 795  GLU A CD    1 
ATOM   6147  O  OE1   . GLU A  1  795  ? 91.891  74.636  31.502  1.00 146.67 ? 795  GLU A OE1   1 
ATOM   6148  O  OE2   . GLU A  1  795  ? 94.081  74.413  31.633  1.00 129.88 ? 795  GLU A OE2   1 
ATOM   6149  N  N     . SER A  1  796  ? 91.147  73.064  27.125  1.00 105.97 ? 796  SER A N     1 
ATOM   6150  C  CA    . SER A  1  796  ? 90.141  73.179  26.070  1.00 105.65 ? 796  SER A CA    1 
ATOM   6151  C  C     . SER A  1  796  ? 90.668  72.863  24.668  1.00 109.09 ? 796  SER A C     1 
ATOM   6152  O  O     . SER A  1  796  ? 90.114  71.990  23.999  1.00 107.17 ? 796  SER A O     1 
ATOM   6153  C  CB    . SER A  1  796  ? 89.459  74.542  26.098  1.00 109.24 ? 796  SER A CB    1 
ATOM   6154  O  OG    . SER A  1  796  ? 88.318  74.554  25.253  1.00 116.12 ? 796  SER A OG    1 
ATOM   6155  N  N     . LYS A  1  797  ? 91.759  73.531  24.246  1.00 106.12 ? 797  LYS A N     1 
ATOM   6156  C  CA    . LYS A  1  797  ? 92.307  73.361  22.899  1.00 104.49 ? 797  LYS A CA    1 
ATOM   6157  C  C     . LYS A  1  797  ? 93.325  72.181  22.753  1.00 105.86 ? 797  LYS A C     1 
ATOM   6158  O  O     . LYS A  1  797  ? 94.133  72.175  21.826  1.00 103.57 ? 797  LYS A O     1 
ATOM   6159  C  CB    . LYS A  1  797  ? 92.875  74.694  22.373  1.00 107.31 ? 797  LYS A CB    1 
ATOM   6160  C  CG    . LYS A  1  797  ? 91.801  75.720  21.981  1.00 112.56 ? 797  LYS A CG    1 
ATOM   6161  C  CD    . LYS A  1  797  ? 92.074  76.314  20.600  1.00 115.95 ? 797  LYS A CD    1 
ATOM   6162  C  CE    . LYS A  1  797  ? 90.857  76.935  19.962  1.00 117.25 ? 797  LYS A CE    1 
ATOM   6163  N  NZ    . LYS A  1  797  ? 91.008  77.060  18.487  1.00 117.53 ? 797  LYS A NZ    1 
ATOM   6164  N  N     . GLY A  1  798  ? 93.215  71.176  23.622  1.00 102.93 ? 798  GLY A N     1 
ATOM   6165  C  CA    . GLY A  1  798  ? 93.969  69.928  23.533  1.00 101.74 ? 798  GLY A CA    1 
ATOM   6166  C  C     . GLY A  1  798  ? 95.351  69.719  24.130  1.00 104.74 ? 798  GLY A C     1 
ATOM   6167  O  O     . GLY A  1  798  ? 96.144  68.971  23.544  1.00 104.15 ? 798  GLY A O     1 
ATOM   6168  N  N     . PHE A  1  799  ? 95.654  70.303  25.299  1.00 99.70  ? 799  PHE A N     1 
ATOM   6169  C  CA    . PHE A  1  799  ? 96.939  70.039  25.950  1.00 97.82  ? 799  PHE A CA    1 
ATOM   6170  C  C     . PHE A  1  799  ? 96.760  68.845  26.896  1.00 101.19 ? 799  PHE A C     1 
ATOM   6171  O  O     . PHE A  1  799  ? 95.765  68.768  27.632  1.00 101.91 ? 799  PHE A O     1 
ATOM   6172  C  CB    . PHE A  1  799  ? 97.486  71.272  26.689  1.00 99.92  ? 799  PHE A CB    1 
ATOM   6173  C  CG    . PHE A  1  799  ? 98.767  71.075  27.475  1.00 100.62 ? 799  PHE A CG    1 
ATOM   6174  C  CD1   . PHE A  1  799  ? 99.999  71.030  26.831  1.00 101.96 ? 799  PHE A CD1   1 
ATOM   6175  C  CD2   . PHE A  1  799  ? 98.747  71.003  28.864  1.00 103.05 ? 799  PHE A CD2   1 
ATOM   6176  C  CE1   . PHE A  1  799  ? 101.186 70.880  27.563  1.00 102.63 ? 799  PHE A CE1   1 
ATOM   6177  C  CE2   . PHE A  1  799  ? 99.938  70.875  29.595  1.00 105.54 ? 799  PHE A CE2   1 
ATOM   6178  C  CZ    . PHE A  1  799  ? 101.147 70.808  28.941  1.00 102.51 ? 799  PHE A CZ    1 
ATOM   6179  N  N     . VAL A  1  800  ? 97.709  67.898  26.839  1.00 95.36  ? 800  VAL A N     1 
ATOM   6180  C  CA    . VAL A  1  800  ? 97.698  66.710  27.685  1.00 94.12  ? 800  VAL A CA    1 
ATOM   6181  C  C     . VAL A  1  800  ? 98.710  66.906  28.841  1.00 99.94  ? 800  VAL A C     1 
ATOM   6182  O  O     . VAL A  1  800  ? 99.903  66.619  28.682  1.00 99.20  ? 800  VAL A O     1 
ATOM   6183  C  CB    . VAL A  1  800  ? 97.906  65.401  26.877  1.00 94.82  ? 800  VAL A CB    1 
ATOM   6184  C  CG1   . VAL A  1  800  ? 97.755  64.183  27.774  1.00 94.61  ? 800  VAL A CG1   1 
ATOM   6185  C  CG2   . VAL A  1  800  ? 96.937  65.319  25.706  1.00 93.43  ? 800  VAL A CG2   1 
ATOM   6186  N  N     . GLU A  1  801  ? 98.227  67.439  29.989  1.00 97.91  ? 801  GLU A N     1 
ATOM   6187  C  CA    . GLU A  1  801  ? 99.044  67.696  31.182  1.00 99.09  ? 801  GLU A CA    1 
ATOM   6188  C  C     . GLU A  1  801  ? 99.691  66.425  31.704  1.00 103.83 ? 801  GLU A C     1 
ATOM   6189  O  O     . GLU A  1  801  ? 100.840 66.455  32.157  1.00 105.00 ? 801  GLU A O     1 
ATOM   6190  C  CB    . GLU A  1  801  ? 98.209  68.365  32.296  1.00 102.21 ? 801  GLU A CB    1 
ATOM   6191  C  CG    . GLU A  1  801  ? 98.846  68.337  33.684  1.00 115.12 ? 801  GLU A CG    1 
ATOM   6192  C  CD    . GLU A  1  801  ? 98.500  69.476  34.622  1.00 150.35 ? 801  GLU A CD    1 
ATOM   6193  O  OE1   . GLU A  1  801  ? 97.390  70.043  34.494  1.00 148.50 ? 801  GLU A OE1   1 
ATOM   6194  O  OE2   . GLU A  1  801  ? 99.349  69.809  35.482  1.00 155.93 ? 801  GLU A OE2   1 
ATOM   6195  N  N     . ASN A  1  802  ? 98.942  65.316  31.653  1.00 98.89  ? 802  ASN A N     1 
ATOM   6196  C  CA    . ASN A  1  802  ? 99.373  64.026  32.167  1.00 97.47  ? 802  ASN A CA    1 
ATOM   6197  C  C     . ASN A  1  802  ? 100.383 63.275  31.284  1.00 98.57  ? 802  ASN A C     1 
ATOM   6198  O  O     . ASN A  1  802  ? 100.610 63.627  30.122  1.00 97.30  ? 802  ASN A O     1 
ATOM   6199  C  CB    . ASN A  1  802  ? 98.154  63.157  32.456  1.00 95.73  ? 802  ASN A CB    1 
ATOM   6200  C  CG    . ASN A  1  802  ? 97.349  63.620  33.636  1.00 114.94 ? 802  ASN A CG    1 
ATOM   6201  O  OD1   . ASN A  1  802  ? 97.875  63.839  34.733  1.00 109.54 ? 802  ASN A OD1   1 
ATOM   6202  N  ND2   . ASN A  1  802  ? 96.045  63.749  33.438  1.00 106.64 ? 802  ASN A ND2   1 
ATOM   6203  N  N     . SER A  1  803  ? 101.004 62.250  31.896  1.00 93.03  ? 803  SER A N     1 
ATOM   6204  C  CA    . SER A  1  803  ? 101.947 61.289  31.341  1.00 90.09  ? 803  SER A CA    1 
ATOM   6205  C  C     . SER A  1  803  ? 101.186 59.999  31.148  1.00 91.05  ? 803  SER A C     1 
ATOM   6206  O  O     . SER A  1  803  ? 100.221 59.741  31.875  1.00 90.72  ? 803  SER A O     1 
ATOM   6207  C  CB    . SER A  1  803  ? 103.082 61.032  32.331  1.00 94.24  ? 803  SER A CB    1 
ATOM   6208  O  OG    . SER A  1  803  ? 102.633 60.839  33.666  1.00 104.48 ? 803  SER A OG    1 
ATOM   6209  N  N     . TYR A  1  804  ? 101.651 59.157  30.206  1.00 85.67  ? 804  TYR A N     1 
ATOM   6210  C  CA    . TYR A  1  804  ? 101.084 57.842  29.913  1.00 83.57  ? 804  TYR A CA    1 
ATOM   6211  C  C     . TYR A  1  804  ? 101.047 56.949  31.155  1.00 88.85  ? 804  TYR A C     1 
ATOM   6212  O  O     . TYR A  1  804  ? 100.186 56.076  31.248  1.00 88.72  ? 804  TYR A O     1 
ATOM   6213  C  CB    . TYR A  1  804  ? 101.881 57.170  28.809  1.00 82.52  ? 804  TYR A CB    1 
ATOM   6214  C  CG    . TYR A  1  804  ? 101.647 57.767  27.441  1.00 83.31  ? 804  TYR A CG    1 
ATOM   6215  C  CD1   . TYR A  1  804  ? 100.368 57.816  26.887  1.00 84.54  ? 804  TYR A CD1   1 
ATOM   6216  C  CD2   . TYR A  1  804  ? 102.712 58.202  26.660  1.00 83.59  ? 804  TYR A CD2   1 
ATOM   6217  C  CE1   . TYR A  1  804  ? 100.152 58.332  25.611  1.00 82.76  ? 804  TYR A CE1   1 
ATOM   6218  C  CE2   . TYR A  1  804  ? 102.509 58.704  25.376  1.00 83.53  ? 804  TYR A CE2   1 
ATOM   6219  C  CZ    . TYR A  1  804  ? 101.227 58.770  24.857  1.00 88.72  ? 804  TYR A CZ    1 
ATOM   6220  O  OH    . TYR A  1  804  ? 101.037 59.299  23.606  1.00 89.23  ? 804  TYR A OH    1 
ATOM   6221  N  N     . LEU A  1  805  ? 101.956 57.196  32.121  1.00 86.26  ? 805  LEU A N     1 
ATOM   6222  C  CA    . LEU A  1  805  ? 102.014 56.475  33.385  1.00 86.89  ? 805  LEU A CA    1 
ATOM   6223  C  C     . LEU A  1  805  ? 100.848 56.875  34.261  1.00 93.40  ? 805  LEU A C     1 
ATOM   6224  O  O     . LEU A  1  805  ? 100.165 55.989  34.775  1.00 93.97  ? 805  LEU A O     1 
ATOM   6225  C  CB    . LEU A  1  805  ? 103.352 56.726  34.105  1.00 87.21  ? 805  LEU A CB    1 
ATOM   6226  C  CG    . LEU A  1  805  ? 103.522 56.251  35.562  1.00 92.56  ? 805  LEU A CG    1 
ATOM   6227  C  CD1   . LEU A  1  805  ? 103.348 54.738  35.708  1.00 92.20  ? 805  LEU A CD1   1 
ATOM   6228  C  CD2   . LEU A  1  805  ? 104.882 56.642  36.080  1.00 96.13  ? 805  LEU A CD2   1 
ATOM   6229  N  N     . ARG A  1  806  ? 100.616 58.193  34.435  1.00 91.60  ? 806  ARG A N     1 
ATOM   6230  C  CA    . ARG A  1  806  ? 99.523  58.694  35.283  1.00 93.45  ? 806  ARG A CA    1 
ATOM   6231  C  C     . ARG A  1  806  ? 98.157  58.428  34.662  1.00 96.69  ? 806  ARG A C     1 
ATOM   6232  O  O     . ARG A  1  806  ? 97.188  58.221  35.400  1.00 97.91  ? 806  ARG A O     1 
ATOM   6233  C  CB    . ARG A  1  806  ? 99.710  60.177  35.679  1.00 95.82  ? 806  ARG A CB    1 
ATOM   6234  C  CG    . ARG A  1  806  ? 100.905 60.406  36.604  1.00 108.64 ? 806  ARG A CG    1 
ATOM   6235  C  CD    . ARG A  1  806  ? 101.282 61.865  36.705  1.00 122.56 ? 806  ARG A CD    1 
ATOM   6236  N  NE    . ARG A  1  806  ? 100.556 62.541  37.785  1.00 131.72 ? 806  ARG A NE    1 
ATOM   6237  C  CZ    . ARG A  1  806  ? 100.867 63.744  38.265  1.00 141.79 ? 806  ARG A CZ    1 
ATOM   6238  N  NH1   . ARG A  1  806  ? 101.892 64.423  37.766  1.00 121.09 ? 806  ARG A NH1   1 
ATOM   6239  N  NH2   . ARG A  1  806  ? 100.153 64.276  39.248  1.00 133.46 ? 806  ARG A NH2   1 
ATOM   6240  N  N     . GLY A  1  807  ? 98.116  58.375  33.329  1.00 90.33  ? 807  GLY A N     1 
ATOM   6241  C  CA    . GLY A  1  807  ? 96.904  58.114  32.568  1.00 89.23  ? 807  GLY A CA    1 
ATOM   6242  C  C     . GLY A  1  807  ? 96.215  59.376  32.103  1.00 93.61  ? 807  GLY A C     1 
ATOM   6243  O  O     . GLY A  1  807  ? 96.230  60.389  32.806  1.00 94.73  ? 807  GLY A O     1 
ATOM   6244  N  N     . LEU A  1  808  ? 95.578  59.304  30.923  1.00 88.90  ? 808  LEU A N     1 
ATOM   6245  C  CA    . LEU A  1  808  ? 94.855  60.401  30.266  1.00 88.47  ? 808  LEU A CA    1 
ATOM   6246  C  C     . LEU A  1  808  ? 93.373  60.547  30.692  1.00 95.27  ? 808  LEU A C     1 
ATOM   6247  O  O     . LEU A  1  808  ? 92.673  59.540  30.866  1.00 94.75  ? 808  LEU A O     1 
ATOM   6248  C  CB    . LEU A  1  808  ? 94.948  60.223  28.743  1.00 86.14  ? 808  LEU A CB    1 
ATOM   6249  C  CG    . LEU A  1  808  ? 96.161  60.838  28.073  1.00 88.92  ? 808  LEU A CG    1 
ATOM   6250  C  CD1   . LEU A  1  808  ? 97.400  59.959  28.206  1.00 88.18  ? 808  LEU A CD1   1 
ATOM   6251  C  CD2   . LEU A  1  808  ? 95.876  61.106  26.626  1.00 89.17  ? 808  LEU A CD2   1 
ATOM   6252  N  N     . THR A  1  809  ? 92.891  61.809  30.822  1.00 93.30  ? 809  THR A N     1 
ATOM   6253  C  CA    . THR A  1  809  ? 91.484  62.088  31.157  1.00 93.88  ? 809  THR A CA    1 
ATOM   6254  C  C     . THR A  1  809  ? 90.612  61.872  29.885  1.00 97.48  ? 809  THR A C     1 
ATOM   6255  O  O     . THR A  1  809  ? 91.180  61.843  28.790  1.00 96.71  ? 809  THR A O     1 
ATOM   6256  C  CB    . THR A  1  809  ? 91.325  63.475  31.762  1.00 96.55  ? 809  THR A CB    1 
ATOM   6257  O  OG1   . THR A  1  809  ? 91.499  64.441  30.734  1.00 95.84  ? 809  THR A OG1   1 
ATOM   6258  C  CG2   . THR A  1  809  ? 92.265  63.718  32.932  1.00 94.03  ? 809  THR A CG2   1 
ATOM   6259  N  N     . PRO A  1  810  ? 89.266  61.699  29.974  1.00 93.29  ? 810  PRO A N     1 
ATOM   6260  C  CA    . PRO A  1  810  ? 88.472  61.438  28.751  1.00 91.94  ? 810  PRO A CA    1 
ATOM   6261  C  C     . PRO A  1  810  ? 88.652  62.453  27.628  1.00 94.79  ? 810  PRO A C     1 
ATOM   6262  O  O     . PRO A  1  810  ? 88.691  62.078  26.458  1.00 91.40  ? 810  PRO A O     1 
ATOM   6263  C  CB    . PRO A  1  810  ? 87.035  61.406  29.262  1.00 94.84  ? 810  PRO A CB    1 
ATOM   6264  C  CG    . PRO A  1  810  ? 87.157  61.051  30.690  1.00 100.23 ? 810  PRO A CG    1 
ATOM   6265  C  CD    . PRO A  1  810  ? 88.413  61.671  31.178  1.00 95.87  ? 810  PRO A CD    1 
ATOM   6266  N  N     . GLN A  1  811  ? 88.790  63.739  28.002  1.00 94.20  ? 811  GLN A N     1 
ATOM   6267  C  CA    . GLN A  1  811  ? 89.020  64.852  27.073  1.00 93.72  ? 811  GLN A CA    1 
ATOM   6268  C  C     . GLN A  1  811  ? 90.429  64.674  26.464  1.00 97.05  ? 811  GLN A C     1 
ATOM   6269  O  O     . GLN A  1  811  ? 90.540  64.498  25.242  1.00 95.87  ? 811  GLN A O     1 
ATOM   6270  C  CB    . GLN A  1  811  ? 88.840  66.218  27.773  1.00 95.69  ? 811  GLN A CB    1 
ATOM   6271  C  CG    . GLN A  1  811  ? 87.493  66.382  28.491  1.00 97.27  ? 811  GLN A CG    1 
ATOM   6272  C  CD    . GLN A  1  811  ? 87.568  66.074  29.973  1.00 110.96 ? 811  GLN A CD    1 
ATOM   6273  O  OE1   . GLN A  1  811  ? 88.181  65.093  30.412  1.00 106.09 ? 811  GLN A OE1   1 
ATOM   6274  N  NE2   . GLN A  1  811  ? 86.922  66.897  30.783  1.00 101.41 ? 811  GLN A NE2   1 
ATOM   6275  N  N     . GLU A  1  812  ? 91.480  64.596  27.332  1.00 92.98  ? 812  GLU A N     1 
ATOM   6276  C  CA    . GLU A  1  812  ? 92.872  64.346  26.950  1.00 91.49  ? 812  GLU A CA    1 
ATOM   6277  C  C     . GLU A  1  812  ? 92.933  63.158  25.963  1.00 95.24  ? 812  GLU A C     1 
ATOM   6278  O  O     . GLU A  1  812  ? 93.603  63.265  24.932  1.00 94.42  ? 812  GLU A O     1 
ATOM   6279  C  CB    . GLU A  1  812  ? 93.719  64.035  28.199  1.00 93.22  ? 812  GLU A CB    1 
ATOM   6280  C  CG    . GLU A  1  812  ? 94.256  65.256  28.925  1.00 107.01 ? 812  GLU A CG    1 
ATOM   6281  C  CD    . GLU A  1  812  ? 95.131  65.002  30.144  1.00 129.56 ? 812  GLU A CD    1 
ATOM   6282  O  OE1   . GLU A  1  812  ? 94.944  63.960  30.815  1.00 129.24 ? 812  GLU A OE1   1 
ATOM   6283  O  OE2   . GLU A  1  812  ? 95.974  65.875  30.455  1.00 116.24 ? 812  GLU A OE2   1 
ATOM   6284  N  N     . PHE A  1  813  ? 92.178  62.060  26.265  1.00 90.79  ? 813  PHE A N     1 
ATOM   6285  C  CA    . PHE A  1  813  ? 92.069  60.847  25.463  1.00 89.36  ? 813  PHE A CA    1 
ATOM   6286  C  C     . PHE A  1  813  ? 91.514  61.131  24.066  1.00 91.19  ? 813  PHE A C     1 
ATOM   6287  O  O     . PHE A  1  813  ? 92.086  60.653  23.085  1.00 89.82  ? 813  PHE A O     1 
ATOM   6288  C  CB    . PHE A  1  813  ? 91.206  59.779  26.177  1.00 92.10  ? 813  PHE A CB    1 
ATOM   6289  C  CG    . PHE A  1  813  ? 91.116  58.440  25.464  1.00 93.15  ? 813  PHE A CG    1 
ATOM   6290  C  CD1   . PHE A  1  813  ? 90.135  58.205  24.503  1.00 94.98  ? 813  PHE A CD1   1 
ATOM   6291  C  CD2   . PHE A  1  813  ? 92.018  57.417  25.750  1.00 96.26  ? 813  PHE A CD2   1 
ATOM   6292  C  CE1   . PHE A  1  813  ? 90.064  56.973  23.830  1.00 96.71  ? 813  PHE A CE1   1 
ATOM   6293  C  CE2   . PHE A  1  813  ? 91.944  56.186  25.079  1.00 96.20  ? 813  PHE A CE2   1 
ATOM   6294  C  CZ    . PHE A  1  813  ? 90.961  55.971  24.130  1.00 94.29  ? 813  PHE A CZ    1 
ATOM   6295  N  N     . PHE A  1  814  ? 90.394  61.875  23.974  1.00 87.38  ? 814  PHE A N     1 
ATOM   6296  C  CA    . PHE A  1  814  ? 89.772  62.184  22.688  1.00 86.11  ? 814  PHE A CA    1 
ATOM   6297  C  C     . PHE A  1  814  ? 90.665  63.053  21.808  1.00 90.39  ? 814  PHE A C     1 
ATOM   6298  O  O     . PHE A  1  814  ? 90.818  62.755  20.620  1.00 88.48  ? 814  PHE A O     1 
ATOM   6299  C  CB    . PHE A  1  814  ? 88.381  62.804  22.861  1.00 88.46  ? 814  PHE A CB    1 
ATOM   6300  C  CG    . PHE A  1  814  ? 87.565  62.770  21.591  1.00 89.07  ? 814  PHE A CG    1 
ATOM   6301  C  CD1   . PHE A  1  814  ? 86.837  61.640  21.244  1.00 90.14  ? 814  PHE A CD1   1 
ATOM   6302  C  CD2   . PHE A  1  814  ? 87.554  63.855  20.721  1.00 92.15  ? 814  PHE A CD2   1 
ATOM   6303  C  CE1   . PHE A  1  814  ? 86.099  61.602  20.058  1.00 92.56  ? 814  PHE A CE1   1 
ATOM   6304  C  CE2   . PHE A  1  814  ? 86.815  63.815  19.534  1.00 92.35  ? 814  PHE A CE2   1 
ATOM   6305  C  CZ    . PHE A  1  814  ? 86.090  62.690  19.214  1.00 90.81  ? 814  PHE A CZ    1 
ATOM   6306  N  N     . PHE A  1  815  ? 91.266  64.113  22.393  1.00 88.76  ? 815  PHE A N     1 
ATOM   6307  C  CA    . PHE A  1  815  ? 92.175  65.007  21.672  1.00 88.64  ? 815  PHE A CA    1 
ATOM   6308  C  C     . PHE A  1  815  ? 93.406  64.238  21.180  1.00 93.69  ? 815  PHE A C     1 
ATOM   6309  O  O     . PHE A  1  815  ? 93.768  64.350  20.002  1.00 92.09  ? 815  PHE A O     1 
ATOM   6310  C  CB    . PHE A  1  815  ? 92.568  66.221  22.534  1.00 91.15  ? 815  PHE A CB    1 
ATOM   6311  C  CG    . PHE A  1  815  ? 91.418  67.093  23.004  1.00 93.60  ? 815  PHE A CG    1 
ATOM   6312  C  CD1   . PHE A  1  815  ? 90.351  67.384  22.161  1.00 95.72  ? 815  PHE A CD1   1 
ATOM   6313  C  CD2   . PHE A  1  815  ? 91.424  67.654  24.275  1.00 96.66  ? 815  PHE A CD2   1 
ATOM   6314  C  CE1   . PHE A  1  815  ? 89.299  68.190  22.593  1.00 97.30  ? 815  PHE A CE1   1 
ATOM   6315  C  CE2   . PHE A  1  815  ? 90.379  68.474  24.697  1.00 100.12 ? 815  PHE A CE2   1 
ATOM   6316  C  CZ    . PHE A  1  815  ? 89.320  68.729  23.855  1.00 97.80  ? 815  PHE A CZ    1 
ATOM   6317  N  N     . HIS A  1  816  ? 93.994  63.389  22.065  1.00 91.34  ? 816  HIS A N     1 
ATOM   6318  C  CA    . HIS A  1  816  ? 95.141  62.549  21.726  1.00 89.96  ? 816  HIS A CA    1 
ATOM   6319  C  C     . HIS A  1  816  ? 94.806  61.627  20.573  1.00 92.45  ? 816  HIS A C     1 
ATOM   6320  O  O     . HIS A  1  816  ? 95.634  61.456  19.685  1.00 91.41  ? 816  HIS A O     1 
ATOM   6321  C  CB    . HIS A  1  816  ? 95.661  61.762  22.934  1.00 90.88  ? 816  HIS A CB    1 
ATOM   6322  C  CG    . HIS A  1  816  ? 96.908  60.979  22.655  1.00 93.00  ? 816  HIS A CG    1 
ATOM   6323  N  ND1   . HIS A  1  816  ? 97.980  61.541  21.990  1.00 94.07  ? 816  HIS A ND1   1 
ATOM   6324  C  CD2   . HIS A  1  816  ? 97.221  59.706  22.986  1.00 94.17  ? 816  HIS A CD2   1 
ATOM   6325  C  CE1   . HIS A  1  816  ? 98.895  60.592  21.914  1.00 92.63  ? 816  HIS A CE1   1 
ATOM   6326  N  NE2   . HIS A  1  816  ? 98.483  59.469  22.495  1.00 93.04  ? 816  HIS A NE2   1 
ATOM   6327  N  N     . ALA A  1  817  ? 93.580  61.084  20.557  1.00 88.90  ? 817  ALA A N     1 
ATOM   6328  C  CA    . ALA A  1  817  ? 93.118  60.235  19.469  1.00 88.29  ? 817  ALA A CA    1 
ATOM   6329  C  C     . ALA A  1  817  ? 93.020  61.045  18.154  1.00 93.19  ? 817  ALA A C     1 
ATOM   6330  O  O     . ALA A  1  817  ? 93.421  60.543  17.089  1.00 91.16  ? 817  ALA A O     1 
ATOM   6331  C  CB    . ALA A  1  817  ? 91.773  59.623  19.822  1.00 89.44  ? 817  ALA A CB    1 
ATOM   6332  N  N     . MET A  1  818  ? 92.538  62.319  18.254  1.00 91.18  ? 818  MET A N     1 
ATOM   6333  C  CA    . MET A  1  818  ? 92.386  63.242  17.123  1.00 90.48  ? 818  MET A CA    1 
ATOM   6334  C  C     . MET A  1  818  ? 93.703  63.471  16.401  1.00 92.64  ? 818  MET A C     1 
ATOM   6335  O  O     . MET A  1  818  ? 93.748  63.333  15.179  1.00 91.22  ? 818  MET A O     1 
ATOM   6336  C  CB    . MET A  1  818  ? 91.775  64.576  17.568  1.00 93.76  ? 818  MET A CB    1 
ATOM   6337  C  CG    . MET A  1  818  ? 90.306  64.506  17.773  1.00 97.65  ? 818  MET A CG    1 
ATOM   6338  S  SD    . MET A  1  818  ? 89.664  66.005  18.496  1.00 102.97 ? 818  MET A SD    1 
ATOM   6339  C  CE    . MET A  1  818  ? 89.311  66.909  17.043  1.00 99.54  ? 818  MET A CE    1 
ATOM   6340  N  N     . GLY A  1  819  ? 94.753  63.778  17.166  1.00 89.32  ? 819  GLY A N     1 
ATOM   6341  C  CA    . GLY A  1  819  ? 96.103  63.985  16.649  1.00 89.14  ? 819  GLY A CA    1 
ATOM   6342  C  C     . GLY A  1  819  ? 96.715  62.717  16.075  1.00 92.27  ? 819  GLY A C     1 
ATOM   6343  O  O     . GLY A  1  819  ? 97.408  62.757  15.050  1.00 91.25  ? 819  GLY A O     1 
ATOM   6344  N  N     . GLY A  1  820  ? 96.434  61.595  16.736  1.00 87.99  ? 820  GLY A N     1 
ATOM   6345  C  CA    . GLY A  1  820  ? 96.913  60.280  16.341  1.00 86.69  ? 820  GLY A CA    1 
ATOM   6346  C  C     . GLY A  1  820  ? 96.335  59.855  15.013  1.00 89.35  ? 820  GLY A C     1 
ATOM   6347  O  O     . GLY A  1  820  ? 97.038  59.270  14.182  1.00 87.07  ? 820  GLY A O     1 
ATOM   6348  N  N     . ARG A  1  821  ? 95.044  60.181  14.806  1.00 86.74  ? 821  ARG A N     1 
ATOM   6349  C  CA    . ARG A  1  821  ? 94.326  59.884  13.576  1.00 86.05  ? 821  ARG A CA    1 
ATOM   6350  C  C     . ARG A  1  821  ? 95.000  60.599  12.436  1.00 90.62  ? 821  ARG A C     1 
ATOM   6351  O  O     . ARG A  1  821  ? 95.120  60.007  11.372  1.00 90.08  ? 821  ARG A O     1 
ATOM   6352  C  CB    . ARG A  1  821  ? 92.845  60.284  13.691  1.00 86.89  ? 821  ARG A CB    1 
ATOM   6353  C  CG    . ARG A  1  821  ? 92.045  60.253  12.385  1.00 93.14  ? 821  ARG A CG    1 
ATOM   6354  C  CD    . ARG A  1  821  ? 91.703  58.861  11.905  1.00 96.46  ? 821  ARG A CD    1 
ATOM   6355  N  NE    . ARG A  1  821  ? 90.274  58.590  12.039  1.00 98.79  ? 821  ARG A NE    1 
ATOM   6356  C  CZ    . ARG A  1  821  ? 89.726  57.990  13.085  1.00 113.76 ? 821  ARG A CZ    1 
ATOM   6357  N  NH1   . ARG A  1  821  ? 90.481  57.595  14.103  1.00 99.38  ? 821  ARG A NH1   1 
ATOM   6358  N  NH2   . ARG A  1  821  ? 88.419  57.773  13.123  1.00 107.60 ? 821  ARG A NH2   1 
ATOM   6359  N  N     . GLU A  1  822  ? 95.496  61.843  12.672  1.00 88.29  ? 822  GLU A N     1 
ATOM   6360  C  CA    . GLU A  1  822  ? 96.205  62.656  11.680  1.00 87.95  ? 822  GLU A CA    1 
ATOM   6361  C  C     . GLU A  1  822  ? 97.481  61.935  11.180  1.00 92.51  ? 822  GLU A C     1 
ATOM   6362  O  O     . GLU A  1  822  ? 97.758  61.942  9.974   1.00 92.14  ? 822  GLU A O     1 
ATOM   6363  C  CB    . GLU A  1  822  ? 96.477  64.077  12.220  1.00 90.10  ? 822  GLU A CB    1 
ATOM   6364  C  CG    . GLU A  1  822  ? 97.607  64.820  11.525  1.00 102.74 ? 822  GLU A CG    1 
ATOM   6365  C  CD    . GLU A  1  822  ? 97.569  66.328  11.619  1.00 125.77 ? 822  GLU A CD    1 
ATOM   6366  O  OE1   . GLU A  1  822  ? 96.773  66.941  10.870  1.00 123.11 ? 822  GLU A OE1   1 
ATOM   6367  O  OE2   . GLU A  1  822  ? 98.369  66.897  12.398  1.00 116.30 ? 822  GLU A OE2   1 
ATOM   6368  N  N     . GLY A  1  823  ? 98.204  61.292  12.098  1.00 89.15  ? 823  GLY A N     1 
ATOM   6369  C  CA    . GLY A  1  823  ? 99.404  60.534  11.769  1.00 88.47  ? 823  GLY A CA    1 
ATOM   6370  C  C     . GLY A  1  823  ? 99.112  59.328  10.894  1.00 92.55  ? 823  GLY A C     1 
ATOM   6371  O  O     . GLY A  1  823  ? 99.815  59.089  9.905   1.00 91.19  ? 823  GLY A O     1 
ATOM   6372  N  N     . LEU A  1  824  ? 98.038  58.581  11.249  1.00 89.95  ? 824  LEU A N     1 
ATOM   6373  C  CA    . LEU A  1  824  ? 97.555  57.379  10.556  1.00 89.05  ? 824  LEU A CA    1 
ATOM   6374  C  C     . LEU A  1  824  ? 97.112  57.683  9.136   1.00 94.07  ? 824  LEU A C     1 
ATOM   6375  O  O     . LEU A  1  824  ? 97.300  56.838  8.254   1.00 93.59  ? 824  LEU A O     1 
ATOM   6376  C  CB    . LEU A  1  824  ? 96.424  56.693  11.341  1.00 89.18  ? 824  LEU A CB    1 
ATOM   6377  C  CG    . LEU A  1  824  ? 96.812  56.100  12.701  1.00 94.10  ? 824  LEU A CG    1 
ATOM   6378  C  CD1   . LEU A  1  824  ? 95.658  56.158  13.680  1.00 95.41  ? 824  LEU A CD1   1 
ATOM   6379  C  CD2   . LEU A  1  824  ? 97.313  54.687  12.566  1.00 95.44  ? 824  LEU A CD2   1 
ATOM   6380  N  N     . ILE A  1  825  ? 96.545  58.895  8.911   1.00 91.64  ? 825  ILE A N     1 
ATOM   6381  C  CA    . ILE A  1  825  ? 96.137  59.358  7.585   1.00 91.39  ? 825  ILE A CA    1 
ATOM   6382  C  C     . ILE A  1  825  ? 97.408  59.650  6.806   1.00 98.62  ? 825  ILE A C     1 
ATOM   6383  O  O     . ILE A  1  825  ? 97.591  59.084  5.729   1.00 97.72  ? 825  ILE A O     1 
ATOM   6384  C  CB    . ILE A  1  825  ? 95.196  60.589  7.597   1.00 94.37  ? 825  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A  1  825  ? 93.911  60.337  8.397   1.00 95.12  ? 825  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A  1  825  ? 94.852  60.985  6.169   1.00 94.37  ? 825  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A  1  825  ? 93.310  61.621  9.016   1.00 102.01 ? 825  ILE A CD1   1 
ATOM   6388  N  N     . ASP A  1  826  ? 98.300  60.498  7.369   1.00 98.83  ? 826  ASP A N     1 
ATOM   6389  C  CA    . ASP A  1  826  ? 99.562  60.885  6.743   1.00 99.96  ? 826  ASP A CA    1 
ATOM   6390  C  C     . ASP A  1  826  ? 100.335 59.688  6.240   1.00 105.51 ? 826  ASP A C     1 
ATOM   6391  O  O     . ASP A  1  826  ? 100.721 59.685  5.075   1.00 104.91 ? 826  ASP A O     1 
ATOM   6392  C  CB    . ASP A  1  826  ? 100.426 61.739  7.672   1.00 103.21 ? 826  ASP A CB    1 
ATOM   6393  C  CG    . ASP A  1  826  ? 101.636 62.323  6.966   1.00 122.16 ? 826  ASP A CG    1 
ATOM   6394  O  OD1   . ASP A  1  826  ? 101.444 63.128  6.031   1.00 123.87 ? 826  ASP A OD1   1 
ATOM   6395  O  OD2   . ASP A  1  826  ? 102.779 61.967  7.346   1.00 131.35 ? 826  ASP A OD2   1 
ATOM   6396  N  N     . THR A  1  827  ? 100.494 58.649  7.086   1.00 103.97 ? 827  THR A N     1 
ATOM   6397  C  CA    . THR A  1  827  ? 101.191 57.412  6.723   1.00 103.85 ? 827  THR A CA    1 
ATOM   6398  C  C     . THR A  1  827  ? 100.527 56.764  5.496   1.00 110.16 ? 827  THR A C     1 
ATOM   6399  O  O     . THR A  1  827  ? 101.218 56.525  4.511   1.00 109.97 ? 827  THR A O     1 
ATOM   6400  C  CB    . THR A  1  827  ? 101.348 56.473  7.939   1.00 108.78 ? 827  THR A CB    1 
ATOM   6401  O  OG1   . THR A  1  827  ? 102.035 57.163  8.985   1.00 111.30 ? 827  THR A OG1   1 
ATOM   6402  C  CG2   . THR A  1  827  ? 102.131 55.229  7.609   1.00 103.80 ? 827  THR A CG2   1 
ATOM   6403  N  N     . ALA A  1  828  ? 99.196  56.558  5.530   1.00 108.52 ? 828  ALA A N     1 
ATOM   6404  C  CA    . ALA A  1  828  ? 98.429  55.951  4.440   1.00 108.42 ? 828  ALA A CA    1 
ATOM   6405  C  C     . ALA A  1  828  ? 98.559  56.675  3.084   1.00 114.32 ? 828  ALA A C     1 
ATOM   6406  O  O     . ALA A  1  828  ? 98.803  56.011  2.077   1.00 113.92 ? 828  ALA A O     1 
ATOM   6407  C  CB    . ALA A  1  828  ? 96.973  55.816  4.840   1.00 109.51 ? 828  ALA A CB    1 
ATOM   6408  N  N     . VAL A  1  829  ? 98.455  58.016  3.066   1.00 112.83 ? 829  VAL A N     1 
ATOM   6409  C  CA    . VAL A  1  829  ? 98.543  58.828  1.842   1.00 113.86 ? 829  VAL A CA    1 
ATOM   6410  C  C     . VAL A  1  829  ? 99.961  58.853  1.254   1.00 119.70 ? 829  VAL A C     1 
ATOM   6411  O  O     . VAL A  1  829  ? 100.153 58.484  0.091   1.00 118.86 ? 829  VAL A O     1 
ATOM   6412  C  CB    . VAL A  1  829  ? 97.996  60.267  2.039   1.00 119.16 ? 829  VAL A CB    1 
ATOM   6413  C  CG1   . VAL A  1  829  ? 97.857  60.981  0.695   1.00 119.35 ? 829  VAL A CG1   1 
ATOM   6414  C  CG2   . VAL A  1  829  ? 96.661  60.263  2.778   1.00 119.65 ? 829  VAL A CG2   1 
ATOM   6415  N  N     . LYS A  1  830  ? 100.934 59.335  2.056   1.00 117.88 ? 830  LYS A N     1 
ATOM   6416  C  CA    . LYS A  1  830  ? 102.365 59.457  1.749   1.00 117.53 ? 830  LYS A CA    1 
ATOM   6417  C  C     . LYS A  1  830  ? 103.003 58.038  1.671   1.00 120.40 ? 830  LYS A C     1 
ATOM   6418  O  O     . LYS A  1  830  ? 103.864 57.659  2.473   1.00 120.18 ? 830  LYS A O     1 
ATOM   6419  C  CB    . LYS A  1  830  ? 103.022 60.379  2.812   1.00 120.83 ? 830  LYS A CB    1 
ATOM   6420  C  CG    . LYS A  1  830  ? 104.554 60.517  2.793   1.00 134.90 ? 830  LYS A CG    1 
ATOM   6421  C  CD    . LYS A  1  830  ? 105.117 60.916  4.170   1.00 140.62 ? 830  LYS A CD    1 
ATOM   6422  C  CE    . LYS A  1  830  ? 105.068 59.841  5.243   1.00 141.43 ? 830  LYS A CE    1 
ATOM   6423  N  NZ    . LYS A  1  830  ? 106.184 58.869  5.119   1.00 143.86 ? 830  LYS A NZ    1 
ATOM   6424  N  N     . THR A  1  831  ? 102.519 57.248  0.712   1.00 115.74 ? 831  THR A N     1 
ATOM   6425  C  CA    . THR A  1  831  ? 102.918 55.881  0.379   1.00 114.58 ? 831  THR A CA    1 
ATOM   6426  C  C     . THR A  1  831  ? 102.516 55.734  -1.080  1.00 117.89 ? 831  THR A C     1 
ATOM   6427  O  O     . THR A  1  831  ? 103.287 55.225  -1.895  1.00 117.92 ? 831  THR A O     1 
ATOM   6428  C  CB    . THR A  1  831  ? 102.277 54.839  1.336   1.00 120.31 ? 831  THR A CB    1 
ATOM   6429  O  OG1   . THR A  1  831  ? 102.822 55.010  2.643   1.00 116.77 ? 831  THR A OG1   1 
ATOM   6430  C  CG2   . THR A  1  831  ? 102.540 53.398  0.905   1.00 118.89 ? 831  THR A CG2   1 
ATOM   6431  N  N     . ALA A  1  832  ? 101.316 56.232  -1.411  1.00 112.96 ? 832  ALA A N     1 
ATOM   6432  C  CA    . ALA A  1  832  ? 100.802 56.236  -2.769  1.00 111.58 ? 832  ALA A CA    1 
ATOM   6433  C  C     . ALA A  1  832  ? 101.441 57.409  -3.495  1.00 112.46 ? 832  ALA A C     1 
ATOM   6434  O  O     . ALA A  1  832  ? 101.740 57.310  -4.685  1.00 111.88 ? 832  ALA A O     1 
ATOM   6435  C  CB    . ALA A  1  832  ? 99.292  56.395  -2.744  1.00 112.81 ? 832  ALA A CB    1 
ATOM   6436  N  N     . GLU A  1  833  ? 101.667 58.516  -2.755  1.00 107.05 ? 833  GLU A N     1 
ATOM   6437  C  CA    . GLU A  1  833  ? 102.262 59.748  -3.263  1.00 105.91 ? 833  GLU A CA    1 
ATOM   6438  C  C     . GLU A  1  833  ? 103.763 59.543  -3.458  1.00 104.93 ? 833  GLU A C     1 
ATOM   6439  O  O     . GLU A  1  833  ? 104.242 59.524  -4.594  1.00 103.34 ? 833  GLU A O     1 
ATOM   6440  C  CB    . GLU A  1  833  ? 101.961 60.917  -2.299  1.00 108.18 ? 833  GLU A CB    1 
ATOM   6441  C  CG    . GLU A  1  833  ? 102.106 62.292  -2.933  1.00 121.06 ? 833  GLU A CG    1 
ATOM   6442  C  CD    . GLU A  1  833  ? 100.863 63.161  -2.881  1.00 147.33 ? 833  GLU A CD    1 
ATOM   6443  O  OE1   . GLU A  1  833  ? 99.850  62.791  -3.518  1.00 144.88 ? 833  GLU A OE1   1 
ATOM   6444  O  OE2   . GLU A  1  833  ? 100.915 64.235  -2.239  1.00 139.18 ? 833  GLU A OE2   1 
ATOM   6445  N  N     . THR A  1  834  ? 104.475 59.297  -2.342  1.00 98.93  ? 834  THR A N     1 
ATOM   6446  C  CA    . THR A  1  834  ? 105.914 59.077  -2.270  1.00 96.78  ? 834  THR A CA    1 
ATOM   6447  C  C     . THR A  1  834  ? 106.342 57.900  -3.158  1.00 97.37  ? 834  THR A C     1 
ATOM   6448  O  O     . THR A  1  834  ? 107.443 57.928  -3.705  1.00 98.38  ? 834  THR A O     1 
ATOM   6449  C  CB    . THR A  1  834  ? 106.356 58.974  -0.794  1.00 102.15 ? 834  THR A CB    1 
ATOM   6450  O  OG1   . THR A  1  834  ? 107.748 59.242  -0.703  1.00 105.33 ? 834  THR A OG1   1 
ATOM   6451  C  CG2   . THR A  1  834  ? 106.045 57.636  -0.151  1.00 97.81  ? 834  THR A CG2   1 
ATOM   6452  N  N     . GLY A  1  835  ? 105.451 56.921  -3.332  1.00 89.51  ? 835  GLY A N     1 
ATOM   6453  C  CA    . GLY A  1  835  ? 105.683 55.751  -4.167  1.00 86.79  ? 835  GLY A CA    1 
ATOM   6454  C  C     . GLY A  1  835  ? 105.776 56.097  -5.635  1.00 86.33  ? 835  GLY A C     1 
ATOM   6455  O  O     . GLY A  1  835  ? 106.681 55.626  -6.334  1.00 85.49  ? 835  GLY A O     1 
ATOM   6456  N  N     . TYR A  1  836  ? 104.846 56.939  -6.101  1.00 80.53  ? 836  TYR A N     1 
ATOM   6457  C  CA    . TYR A  1  836  ? 104.803 57.412  -7.482  1.00 79.58  ? 836  TYR A CA    1 
ATOM   6458  C  C     . TYR A  1  836  ? 105.970 58.352  -7.779  1.00 83.52  ? 836  TYR A C     1 
ATOM   6459  O  O     . TYR A  1  836  ? 106.510 58.302  -8.887  1.00 84.09  ? 836  TYR A O     1 
ATOM   6460  C  CB    . TYR A  1  836  ? 103.466 58.084  -7.760  1.00 80.65  ? 836  TYR A CB    1 
ATOM   6461  C  CG    . TYR A  1  836  ? 103.265 58.651  -9.150  1.00 82.09  ? 836  TYR A CG    1 
ATOM   6462  C  CD1   . TYR A  1  836  ? 103.519 57.884  -10.285 1.00 83.57  ? 836  TYR A CD1   1 
ATOM   6463  C  CD2   . TYR A  1  836  ? 102.688 59.905  -9.332  1.00 83.55  ? 836  TYR A CD2   1 
ATOM   6464  C  CE1   . TYR A  1  836  ? 103.256 58.376  -11.567 1.00 85.05  ? 836  TYR A CE1   1 
ATOM   6465  C  CE2   . TYR A  1  836  ? 102.396 60.395  -10.604 1.00 84.64  ? 836  TYR A CE2   1 
ATOM   6466  C  CZ    . TYR A  1  836  ? 102.684 59.630  -11.719 1.00 90.36  ? 836  TYR A CZ    1 
ATOM   6467  O  OH    . TYR A  1  836  ? 102.399 60.139  -12.958 1.00 90.36  ? 836  TYR A OH    1 
ATOM   6468  N  N     . ILE A  1  837  ? 106.390 59.178  -6.793  1.00 78.27  ? 837  ILE A N     1 
ATOM   6469  C  CA    . ILE A  1  837  ? 107.545 60.052  -6.982  1.00 77.52  ? 837  ILE A CA    1 
ATOM   6470  C  C     . ILE A  1  837  ? 108.757 59.167  -7.339  1.00 78.46  ? 837  ILE A C     1 
ATOM   6471  O  O     . ILE A  1  837  ? 109.451 59.455  -8.321  1.00 77.86  ? 837  ILE A O     1 
ATOM   6472  C  CB    . ILE A  1  837  ? 107.795 60.984  -5.749  1.00 81.10  ? 837  ILE A CB    1 
ATOM   6473  C  CG1   . ILE A  1  837  ? 106.943 62.280  -5.808  1.00 82.55  ? 837  ILE A CG1   1 
ATOM   6474  C  CG2   . ILE A  1  837  ? 109.265 61.376  -5.642  1.00 80.65  ? 837  ILE A CG2   1 
ATOM   6475  C  CD1   . ILE A  1  837  ? 105.402 62.182  -5.587  1.00 91.63  ? 837  ILE A CD1   1 
ATOM   6476  N  N     . GLN A  1  838  ? 108.936 58.041  -6.600  1.00 72.73  ? 838  GLN A N     1 
ATOM   6477  C  CA    . GLN A  1  838  ? 110.044 57.102  -6.816  1.00 71.47  ? 838  GLN A CA    1 
ATOM   6478  C  C     . GLN A  1  838  ? 110.111 56.597  -8.261  1.00 71.04  ? 838  GLN A C     1 
ATOM   6479  O  O     . GLN A  1  838  ? 111.188 56.629  -8.852  1.00 70.46  ? 838  GLN A O     1 
ATOM   6480  C  CB    . GLN A  1  838  ? 110.032 55.942  -5.795  1.00 72.67  ? 838  GLN A CB    1 
ATOM   6481  C  CG    . GLN A  1  838  ? 111.381 55.185  -5.673  1.00 85.12  ? 838  GLN A CG    1 
ATOM   6482  C  CD    . GLN A  1  838  ? 111.441 53.890  -6.479  1.00 109.14 ? 838  GLN A CD    1 
ATOM   6483  O  OE1   . GLN A  1  838  ? 110.510 53.517  -7.231  1.00 104.43 ? 838  GLN A OE1   1 
ATOM   6484  N  NE2   . GLN A  1  838  ? 112.549 53.160  -6.332  1.00 98.78  ? 838  GLN A NE2   1 
ATOM   6485  N  N     . ARG A  1  839  ? 108.956 56.204  -8.834  1.00 64.09  ? 839  ARG A N     1 
ATOM   6486  C  CA    . ARG A  1  839  ? 108.816 55.703  -10.204 1.00 62.05  ? 839  ARG A CA    1 
ATOM   6487  C  C     . ARG A  1  839  ? 109.276 56.720  -11.233 1.00 67.79  ? 839  ARG A C     1 
ATOM   6488  O  O     . ARG A  1  839  ? 110.131 56.417  -12.063 1.00 67.02  ? 839  ARG A O     1 
ATOM   6489  C  CB    . ARG A  1  839  ? 107.365 55.294  -10.472 1.00 57.73  ? 839  ARG A CB    1 
ATOM   6490  C  CG    . ARG A  1  839  ? 107.105 54.937  -11.919 1.00 62.66  ? 839  ARG A CG    1 
ATOM   6491  C  CD    . ARG A  1  839  ? 105.958 53.976  -12.137 1.00 74.70  ? 839  ARG A CD    1 
ATOM   6492  N  NE    . ARG A  1  839  ? 106.247 53.214  -13.341 1.00 74.72  ? 839  ARG A NE    1 
ATOM   6493  C  CZ    . ARG A  1  839  ? 105.684 53.439  -14.512 1.00 87.16  ? 839  ARG A CZ    1 
ATOM   6494  N  NH1   . ARG A  1  839  ? 104.717 54.345  -14.630 1.00 79.42  ? 839  ARG A NH1   1 
ATOM   6495  N  NH2   . ARG A  1  839  ? 106.065 52.747  -15.575 1.00 71.85  ? 839  ARG A NH2   1 
ATOM   6496  N  N     . ARG A  1  840  ? 108.687 57.914  -11.187 1.00 66.50  ? 840  ARG A N     1 
ATOM   6497  C  CA    . ARG A  1  840  ? 109.006 59.014  -12.072 1.00 67.69  ? 840  ARG A CA    1 
ATOM   6498  C  C     . ARG A  1  840  ? 110.540 59.249  -12.092 1.00 72.82  ? 840  ARG A C     1 
ATOM   6499  O  O     . ARG A  1  840  ? 111.147 59.189  -13.164 1.00 72.67  ? 840  ARG A O     1 
ATOM   6500  C  CB    . ARG A  1  840  ? 108.249 60.243  -11.591 1.00 69.37  ? 840  ARG A CB    1 
ATOM   6501  C  CG    . ARG A  1  840  ? 106.748 60.103  -11.776 1.00 77.05  ? 840  ARG A CG    1 
ATOM   6502  C  CD    . ARG A  1  840  ? 105.988 60.958  -10.796 1.00 80.75  ? 840  ARG A CD    1 
ATOM   6503  N  NE    . ARG A  1  840  ? 106.499 62.321  -10.736 1.00 80.65  ? 840  ARG A NE    1 
ATOM   6504  C  CZ    . ARG A  1  840  ? 105.944 63.289  -10.023 1.00 98.95  ? 840  ARG A CZ    1 
ATOM   6505  N  NH1   . ARG A  1  840  ? 104.847 63.056  -9.311  1.00 85.28  ? 840  ARG A NH1   1 
ATOM   6506  N  NH2   . ARG A  1  840  ? 106.486 64.496  -10.006 1.00 89.90  ? 840  ARG A NH2   1 
ATOM   6507  N  N     . LEU A  1  841  ? 111.167 59.392  -10.903 1.00 69.04  ? 841  LEU A N     1 
ATOM   6508  C  CA    . LEU A  1  841  ? 112.614 59.538  -10.768 1.00 68.92  ? 841  LEU A CA    1 
ATOM   6509  C  C     . LEU A  1  841  ? 113.354 58.394  -11.476 1.00 71.76  ? 841  LEU A C     1 
ATOM   6510  O  O     . LEU A  1  841  ? 114.320 58.648  -12.180 1.00 72.49  ? 841  LEU A O     1 
ATOM   6511  C  CB    . LEU A  1  841  ? 113.021 59.581  -9.285  1.00 69.21  ? 841  LEU A CB    1 
ATOM   6512  C  CG    . LEU A  1  841  ? 112.591 60.806  -8.486  1.00 74.88  ? 841  LEU A CG    1 
ATOM   6513  C  CD1   . LEU A  1  841  ? 112.753 60.568  -7.010  1.00 75.11  ? 841  LEU A CD1   1 
ATOM   6514  C  CD2   . LEU A  1  841  ? 113.394 62.014  -8.871  1.00 78.03  ? 841  LEU A CD2   1 
ATOM   6515  N  N     . VAL A  1  842  ? 112.895 57.145  -11.306 1.00 66.74  ? 842  VAL A N     1 
ATOM   6516  C  CA    . VAL A  1  842  ? 113.508 55.972  -11.931 1.00 65.33  ? 842  VAL A CA    1 
ATOM   6517  C  C     . VAL A  1  842  ? 113.331 55.999  -13.444 1.00 71.62  ? 842  VAL A C     1 
ATOM   6518  O  O     . VAL A  1  842  ? 114.327 56.062  -14.160 1.00 71.93  ? 842  VAL A O     1 
ATOM   6519  C  CB    . VAL A  1  842  ? 113.032 54.645  -11.310 1.00 67.06  ? 842  VAL A CB    1 
ATOM   6520  C  CG1   . VAL A  1  842  ? 113.400 53.469  -12.189 1.00 66.20  ? 842  VAL A CG1   1 
ATOM   6521  C  CG2   . VAL A  1  842  ? 113.621 54.462  -9.928  1.00 66.81  ? 842  VAL A CG2   1 
ATOM   6522  N  N     . LYS A  1  843  ? 112.075 56.002  -13.928 1.00 67.74  ? 843  LYS A N     1 
ATOM   6523  C  CA    . LYS A  1  843  ? 111.780 55.975  -15.348 1.00 67.15  ? 843  LYS A CA    1 
ATOM   6524  C  C     . LYS A  1  843  ? 112.451 57.129  -16.155 1.00 73.16  ? 843  LYS A C     1 
ATOM   6525  O  O     . LYS A  1  843  ? 112.724 56.939  -17.348 1.00 72.48  ? 843  LYS A O     1 
ATOM   6526  C  CB    . LYS A  1  843  ? 110.271 55.882  -15.580 1.00 67.56  ? 843  LYS A CB    1 
ATOM   6527  C  CG    . LYS A  1  843  ? 109.728 54.478  -15.255 1.00 59.04  ? 843  LYS A CG    1 
ATOM   6528  C  CD    . LYS A  1  843  ? 109.852 53.408  -16.384 1.00 64.05  ? 843  LYS A CD    1 
ATOM   6529  C  CE    . LYS A  1  843  ? 109.986 52.029  -15.740 1.00 98.39  ? 843  LYS A CE    1 
ATOM   6530  N  NZ    . LYS A  1  843  ? 109.457 50.898  -16.555 1.00 111.04 ? 843  LYS A NZ    1 
ATOM   6531  N  N     . ALA A  1  844  ? 112.800 58.256  -15.495 1.00 72.16  ? 844  ALA A N     1 
ATOM   6532  C  CA    . ALA A  1  844  ? 113.464 59.401  -16.144 1.00 74.00  ? 844  ALA A CA    1 
ATOM   6533  C  C     . ALA A  1  844  ? 114.973 59.249  -16.239 1.00 79.04  ? 844  ALA A C     1 
ATOM   6534  O  O     . ALA A  1  844  ? 115.570 59.703  -17.228 1.00 80.79  ? 844  ALA A O     1 
ATOM   6535  C  CB    . ALA A  1  844  ? 113.132 60.703  -15.423 1.00 75.33  ? 844  ALA A CB    1 
ATOM   6536  N  N     . LEU A  1  845  ? 115.588 58.635  -15.203 1.00 72.77  ? 845  LEU A N     1 
ATOM   6537  C  CA    . LEU A  1  845  ? 117.042 58.461  -15.106 1.00 71.11  ? 845  LEU A CA    1 
ATOM   6538  C  C     . LEU A  1  845  ? 117.530 57.063  -15.506 1.00 73.20  ? 845  LEU A C     1 
ATOM   6539  O  O     . LEU A  1  845  ? 118.729 56.841  -15.602 1.00 73.25  ? 845  LEU A O     1 
ATOM   6540  C  CB    . LEU A  1  845  ? 117.553 58.855  -13.705 1.00 70.44  ? 845  LEU A CB    1 
ATOM   6541  C  CG    . LEU A  1  845  ? 117.054 60.187  -13.110 1.00 73.84  ? 845  LEU A CG    1 
ATOM   6542  C  CD1   . LEU A  1  845  ? 117.822 60.543  -11.865 1.00 72.96  ? 845  LEU A CD1   1 
ATOM   6543  C  CD2   . LEU A  1  845  ? 117.122 61.309  -14.104 1.00 76.53  ? 845  LEU A CD2   1 
ATOM   6544  N  N     . GLU A  1  846  ? 116.578 56.160  -15.767 1.00 68.76  ? 846  GLU A N     1 
ATOM   6545  C  CA    . GLU A  1  846  ? 116.618 54.746  -16.156 1.00 67.66  ? 846  GLU A CA    1 
ATOM   6546  C  C     . GLU A  1  846  ? 117.862 54.327  -16.935 1.00 71.04  ? 846  GLU A C     1 
ATOM   6547  O  O     . GLU A  1  846  ? 118.648 53.512  -16.438 1.00 70.72  ? 846  GLU A O     1 
ATOM   6548  C  CB    . GLU A  1  846  ? 115.365 54.496  -17.006 1.00 69.15  ? 846  GLU A CB    1 
ATOM   6549  C  CG    . GLU A  1  846  ? 114.604 53.209  -16.792 1.00 78.07  ? 846  GLU A CG    1 
ATOM   6550  C  CD    . GLU A  1  846  ? 113.714 52.927  -17.990 1.00 97.61  ? 846  GLU A CD    1 
ATOM   6551  O  OE1   . GLU A  1  846  ? 114.246 52.830  -19.122 1.00 95.10  ? 846  GLU A OE1   1 
ATOM   6552  O  OE2   . GLU A  1  846  ? 112.483 52.802  -17.801 1.00 79.02  ? 846  GLU A OE2   1 
ATOM   6553  N  N     . ASP A  1  847  ? 118.055 54.937  -18.130 1.00 67.08  ? 847  ASP A N     1 
ATOM   6554  C  CA    . ASP A  1  847  ? 119.116 54.687  -19.118 1.00 66.84  ? 847  ASP A CA    1 
ATOM   6555  C  C     . ASP A  1  847  ? 120.440 55.439  -18.917 1.00 73.16  ? 847  ASP A C     1 
ATOM   6556  O  O     . ASP A  1  847  ? 121.314 55.326  -19.783 1.00 76.08  ? 847  ASP A O     1 
ATOM   6557  C  CB    . ASP A  1  847  ? 118.586 55.006  -20.525 1.00 68.75  ? 847  ASP A CB    1 
ATOM   6558  C  CG    . ASP A  1  847  ? 118.181 56.472  -20.735 1.00 83.30  ? 847  ASP A CG    1 
ATOM   6559  O  OD1   . ASP A  1  847  ? 117.869 57.170  -19.723 1.00 85.49  ? 847  ASP A OD1   1 
ATOM   6560  O  OD2   . ASP A  1  847  ? 118.129 56.911  -21.901 1.00 87.76  ? 847  ASP A OD2   1 
ATOM   6561  N  N     . ILE A  1  848  ? 120.596 56.240  -17.848 1.00 67.96  ? 848  ILE A N     1 
ATOM   6562  C  CA    . ILE A  1  848  ? 121.845 56.988  -17.663 1.00 67.66  ? 848  ILE A CA    1 
ATOM   6563  C  C     . ILE A  1  848  ? 122.886 56.071  -17.024 1.00 72.52  ? 848  ILE A C     1 
ATOM   6564  O  O     . ILE A  1  848  ? 122.541 55.394  -16.044 1.00 74.58  ? 848  ILE A O     1 
ATOM   6565  C  CB    . ILE A  1  848  ? 121.637 58.347  -16.909 1.00 70.70  ? 848  ILE A CB    1 
ATOM   6566  C  CG1   . ILE A  1  848  ? 120.931 59.397  -17.788 1.00 70.94  ? 848  ILE A CG1   1 
ATOM   6567  C  CG2   . ILE A  1  848  ? 122.954 58.936  -16.457 1.00 71.90  ? 848  ILE A CG2   1 
ATOM   6568  C  CD1   . ILE A  1  848  ? 119.438 59.547  -17.615 1.00 76.97  ? 848  ILE A CD1   1 
ATOM   6569  N  N     . MET A  1  849  ? 124.130 56.002  -17.605 1.00 67.02  ? 849  MET A N     1 
ATOM   6570  C  CA    . MET A  1  849  ? 125.247 55.168  -17.100 1.00 66.31  ? 849  MET A CA    1 
ATOM   6571  C  C     . MET A  1  849  ? 126.663 55.711  -17.428 1.00 70.79  ? 849  MET A C     1 
ATOM   6572  O  O     . MET A  1  849  ? 126.811 56.582  -18.290 1.00 71.99  ? 849  MET A O     1 
ATOM   6573  C  CB    . MET A  1  849  ? 125.121 53.688  -17.531 1.00 67.98  ? 849  MET A CB    1 
ATOM   6574  C  CG    . MET A  1  849  ? 125.820 53.323  -18.822 1.00 71.55  ? 849  MET A CG    1 
ATOM   6575  S  SD    . MET A  1  849  ? 126.229 51.568  -18.951 1.00 74.23  ? 849  MET A SD    1 
ATOM   6576  C  CE    . MET A  1  849  ? 127.730 51.707  -19.767 1.00 71.61  ? 849  MET A CE    1 
ATOM   6577  N  N     . VAL A  1  850  ? 127.697 55.195  -16.736 1.00 66.10  ? 850  VAL A N     1 
ATOM   6578  C  CA    . VAL A  1  850  ? 129.060 55.673  -16.965 1.00 66.42  ? 850  VAL A CA    1 
ATOM   6579  C  C     . VAL A  1  850  ? 129.678 54.963  -18.171 1.00 72.19  ? 850  VAL A C     1 
ATOM   6580  O  O     . VAL A  1  850  ? 129.849 53.734  -18.164 1.00 71.16  ? 850  VAL A O     1 
ATOM   6581  C  CB    . VAL A  1  850  ? 129.970 55.644  -15.706 1.00 69.33  ? 850  VAL A CB    1 
ATOM   6582  C  CG1   . VAL A  1  850  ? 131.319 56.272  -16.007 1.00 69.74  ? 850  VAL A CG1   1 
ATOM   6583  C  CG2   . VAL A  1  850  ? 129.321 56.360  -14.531 1.00 68.93  ? 850  VAL A CG2   1 
ATOM   6584  N  N     . HIS A  1  851  ? 129.989 55.735  -19.219 1.00 69.72  ? 851  HIS A N     1 
ATOM   6585  C  CA    . HIS A  1  851  ? 130.580 55.141  -20.407 1.00 70.22  ? 851  HIS A CA    1 
ATOM   6586  C  C     . HIS A  1  851  ? 132.085 55.011  -20.240 1.00 77.47  ? 851  HIS A C     1 
ATOM   6587  O  O     . HIS A  1  851  ? 132.620 55.490  -19.228 1.00 77.84  ? 851  HIS A O     1 
ATOM   6588  C  CB    . HIS A  1  851  ? 130.145 55.870  -21.671 1.00 71.12  ? 851  HIS A CB    1 
ATOM   6589  C  CG    . HIS A  1  851  ? 128.717 55.581  -21.999 1.00 73.84  ? 851  HIS A CG    1 
ATOM   6590  N  ND1   . HIS A  1  851  ? 128.368 54.523  -22.814 1.00 74.69  ? 851  HIS A ND1   1 
ATOM   6591  C  CD2   . HIS A  1  851  ? 127.588 56.164  -21.529 1.00 75.34  ? 851  HIS A CD2   1 
ATOM   6592  C  CE1   . HIS A  1  851  ? 127.048 54.535  -22.868 1.00 73.70  ? 851  HIS A CE1   1 
ATOM   6593  N  NE2   . HIS A  1  851  ? 126.532 55.500  -22.103 1.00 74.36  ? 851  HIS A NE2   1 
ATOM   6594  N  N     . TYR A  1  852  ? 132.768 54.313  -21.185 1.00 74.31  ? 852  TYR A N     1 
ATOM   6595  C  CA    . TYR A  1  852  ? 134.207 54.047  -21.069 1.00 74.05  ? 852  TYR A CA    1 
ATOM   6596  C  C     . TYR A  1  852  ? 135.116 55.273  -21.254 1.00 80.22  ? 852  TYR A C     1 
ATOM   6597  O  O     . TYR A  1  852  ? 136.330 55.152  -21.042 1.00 81.31  ? 852  TYR A O     1 
ATOM   6598  C  CB    . TYR A  1  852  ? 134.621 52.910  -21.995 1.00 74.21  ? 852  TYR A CB    1 
ATOM   6599  C  CG    . TYR A  1  852  ? 134.354 51.550  -21.391 1.00 73.67  ? 852  TYR A CG    1 
ATOM   6600  C  CD1   . TYR A  1  852  ? 135.264 50.960  -20.518 1.00 75.14  ? 852  TYR A CD1   1 
ATOM   6601  C  CD2   . TYR A  1  852  ? 133.203 50.839  -21.711 1.00 73.05  ? 852  TYR A CD2   1 
ATOM   6602  C  CE1   . TYR A  1  852  ? 135.022 49.706  -19.961 1.00 73.63  ? 852  TYR A CE1   1 
ATOM   6603  C  CE2   . TYR A  1  852  ? 132.982 49.560  -21.206 1.00 72.81  ? 852  TYR A CE2   1 
ATOM   6604  C  CZ    . TYR A  1  852  ? 133.893 48.998  -20.331 1.00 77.50  ? 852  TYR A CZ    1 
ATOM   6605  O  OH    . TYR A  1  852  ? 133.642 47.758  -19.798 1.00 77.74  ? 852  TYR A OH    1 
ATOM   6606  N  N     . ASP A  1  853  ? 134.521 56.451  -21.590 1.00 76.32  ? 853  ASP A N     1 
ATOM   6607  C  CA    . ASP A  1  853  ? 135.189 57.747  -21.748 1.00 76.94  ? 853  ASP A CA    1 
ATOM   6608  C  C     . ASP A  1  853  ? 135.013 58.603  -20.467 1.00 82.76  ? 853  ASP A C     1 
ATOM   6609  O  O     . ASP A  1  853  ? 135.283 59.824  -20.445 1.00 83.43  ? 853  ASP A O     1 
ATOM   6610  C  CB    . ASP A  1  853  ? 134.658 58.472  -22.998 1.00 78.61  ? 853  ASP A CB    1 
ATOM   6611  C  CG    . ASP A  1  853  ? 133.168 58.713  -23.048 1.00 87.54  ? 853  ASP A CG    1 
ATOM   6612  O  OD1   . ASP A  1  853  ? 132.456 58.247  -22.131 1.00 87.46  ? 853  ASP A OD1   1 
ATOM   6613  O  OD2   . ASP A  1  853  ? 132.708 59.382  -24.001 1.00 95.05  ? 853  ASP A OD2   1 
ATOM   6614  N  N     . ASN A  1  854  ? 134.536 57.918  -19.406 1.00 78.84  ? 854  ASN A N     1 
ATOM   6615  C  CA    . ASN A  1  854  ? 134.232 58.406  -18.070 1.00 78.84  ? 854  ASN A CA    1 
ATOM   6616  C  C     . ASN A  1  854  ? 133.083 59.463  -18.075 1.00 83.57  ? 854  ASN A C     1 
ATOM   6617  O  O     . ASN A  1  854  ? 132.812 60.101  -17.056 1.00 84.03  ? 854  ASN A O     1 
ATOM   6618  C  CB    . ASN A  1  854  ? 135.505 58.876  -17.365 1.00 81.54  ? 854  ASN A CB    1 
ATOM   6619  C  CG    . ASN A  1  854  ? 135.811 58.167  -16.059 1.00 125.52 ? 854  ASN A CG    1 
ATOM   6620  O  OD1   . ASN A  1  854  ? 135.002 57.416  -15.478 1.00 122.11 ? 854  ASN A OD1   1 
ATOM   6621  N  ND2   . ASN A  1  854  ? 136.995 58.430  -15.544 1.00 123.94 ? 854  ASN A ND2   1 
ATOM   6622  N  N     . THR A  1  855  ? 132.349 59.541  -19.197 1.00 79.66  ? 855  THR A N     1 
ATOM   6623  C  CA    . THR A  1  855  ? 131.216 60.426  -19.431 1.00 79.74  ? 855  THR A CA    1 
ATOM   6624  C  C     . THR A  1  855  ? 129.946 59.768  -18.928 1.00 84.88  ? 855  THR A C     1 
ATOM   6625  O  O     . THR A  1  855  ? 129.823 58.541  -19.014 1.00 86.27  ? 855  THR A O     1 
ATOM   6626  C  CB    . THR A  1  855  ? 131.098 60.672  -20.930 1.00 89.33  ? 855  THR A CB    1 
ATOM   6627  O  OG1   . THR A  1  855  ? 132.296 61.281  -21.391 1.00 93.87  ? 855  THR A OG1   1 
ATOM   6628  C  CG2   . THR A  1  855  ? 129.977 61.560  -21.281 1.00 90.54  ? 855  THR A CG2   1 
ATOM   6629  N  N     . THR A  1  856  ? 128.991 60.587  -18.430 1.00 79.88  ? 856  THR A N     1 
ATOM   6630  C  CA    . THR A  1  856  ? 127.669 60.169  -17.961 1.00 78.57  ? 856  THR A CA    1 
ATOM   6631  C  C     . THR A  1  856  ? 126.710 60.510  -19.106 1.00 82.67  ? 856  THR A C     1 
ATOM   6632  O  O     . THR A  1  856  ? 126.619 61.682  -19.488 1.00 82.71  ? 856  THR A O     1 
ATOM   6633  C  CB    . THR A  1  856  ? 127.370 60.839  -16.615 1.00 87.05  ? 856  THR A CB    1 
ATOM   6634  O  OG1   . THR A  1  856  ? 128.273 60.326  -15.645 1.00 87.38  ? 856  THR A OG1   1 
ATOM   6635  C  CG2   . THR A  1  856  ? 125.980 60.587  -16.123 1.00 86.32  ? 856  THR A CG2   1 
ATOM   6636  N  N     . ARG A  1  857  ? 126.057 59.474  -19.700 1.00 78.68  ? 857  ARG A N     1 
ATOM   6637  C  CA    . ARG A  1  857  ? 125.188 59.598  -20.885 1.00 78.48  ? 857  ARG A CA    1 
ATOM   6638  C  C     . ARG A  1  857  ? 123.919 58.739  -20.841 1.00 83.65  ? 857  ARG A C     1 
ATOM   6639  O  O     . ARG A  1  857  ? 123.913 57.677  -20.210 1.00 85.25  ? 857  ARG A O     1 
ATOM   6640  C  CB    . ARG A  1  857  ? 125.959 59.154  -22.138 1.00 76.02  ? 857  ARG A CB    1 
ATOM   6641  C  CG    . ARG A  1  857  ? 127.002 60.099  -22.675 1.00 79.69  ? 857  ARG A CG    1 
ATOM   6642  C  CD    . ARG A  1  857  ? 127.674 59.431  -23.851 1.00 80.02  ? 857  ARG A CD    1 
ATOM   6643  N  NE    . ARG A  1  857  ? 129.033 59.911  -24.086 1.00 83.35  ? 857  ARG A NE    1 
ATOM   6644  C  CZ    . ARG A  1  857  ? 129.460 60.426  -25.237 1.00 91.54  ? 857  ARG A CZ    1 
ATOM   6645  N  NH1   . ARG A  1  857  ? 128.645 60.506  -26.282 1.00 69.83  ? 857  ARG A NH1   1 
ATOM   6646  N  NH2   . ARG A  1  857  ? 130.722 60.811  -25.369 1.00 79.48  ? 857  ARG A NH2   1 
ATOM   6647  N  N     . ASN A  1  858  ? 122.894 59.130  -21.625 1.00 78.35  ? 858  ASN A N     1 
ATOM   6648  C  CA    . ASN A  1  858  ? 121.649 58.369  -21.741 1.00 77.60  ? 858  ASN A CA    1 
ATOM   6649  C  C     . ASN A  1  858  ? 121.674 57.432  -22.971 1.00 83.24  ? 858  ASN A C     1 
ATOM   6650  O  O     . ASN A  1  858  ? 122.751 57.243  -23.548 1.00 85.08  ? 858  ASN A O     1 
ATOM   6651  C  CB    . ASN A  1  858  ? 120.443 59.307  -21.763 1.00 76.67  ? 858  ASN A CB    1 
ATOM   6652  C  CG    . ASN A  1  858  ? 120.431 60.351  -22.841 1.00 89.57  ? 858  ASN A CG    1 
ATOM   6653  O  OD1   . ASN A  1  858  ? 119.720 61.340  -22.738 1.00 88.61  ? 858  ASN A OD1   1 
ATOM   6654  N  ND2   . ASN A  1  858  ? 121.211 60.187  -23.888 1.00 80.71  ? 858  ASN A ND2   1 
ATOM   6655  N  N     . SER A  1  859  ? 120.495 56.867  -23.391 1.00 77.42  ? 859  SER A N     1 
ATOM   6656  C  CA    . SER A  1  859  ? 120.378 55.957  -24.549 1.00 75.78  ? 859  SER A CA    1 
ATOM   6657  C  C     . SER A  1  859  ? 120.577 56.671  -25.916 1.00 78.68  ? 859  SER A C     1 
ATOM   6658  O  O     . SER A  1  859  ? 120.721 56.034  -26.974 1.00 80.26  ? 859  SER A O     1 
ATOM   6659  C  CB    . SER A  1  859  ? 119.071 55.168  -24.503 1.00 78.18  ? 859  SER A CB    1 
ATOM   6660  O  OG    . SER A  1  859  ? 117.906 55.978  -24.449 1.00 86.89  ? 859  SER A OG    1 
ATOM   6661  N  N     . LEU A  1  860  ? 120.622 57.992  -25.881 1.00 72.24  ? 860  LEU A N     1 
ATOM   6662  C  CA    . LEU A  1  860  ? 120.868 58.785  -27.072 1.00 71.42  ? 860  LEU A CA    1 
ATOM   6663  C  C     . LEU A  1  860  ? 122.363 59.143  -27.159 1.00 74.25  ? 860  LEU A C     1 
ATOM   6664  O  O     . LEU A  1  860  ? 122.839 59.638  -28.188 1.00 73.52  ? 860  LEU A O     1 
ATOM   6665  C  CB    . LEU A  1  860  ? 119.997 60.048  -27.041 1.00 71.11  ? 860  LEU A CB    1 
ATOM   6666  C  CG    . LEU A  1  860  ? 118.526 59.834  -27.283 1.00 74.06  ? 860  LEU A CG    1 
ATOM   6667  C  CD1   . LEU A  1  860  ? 117.730 60.969  -26.714 1.00 74.32  ? 860  LEU A CD1   1 
ATOM   6668  C  CD2   . LEU A  1  860  ? 118.240 59.663  -28.759 1.00 75.67  ? 860  LEU A CD2   1 
ATOM   6669  N  N     . GLY A  1  861  ? 123.085 58.873  -26.076 1.00 70.68  ? 861  GLY A N     1 
ATOM   6670  C  CA    . GLY A  1  861  ? 124.502 59.181  -25.981 1.00 71.67  ? 861  GLY A CA    1 
ATOM   6671  C  C     . GLY A  1  861  ? 124.713 60.666  -25.778 1.00 78.21  ? 861  GLY A C     1 
ATOM   6672  O  O     . GLY A  1  861  ? 125.793 61.195  -26.055 1.00 80.12  ? 861  GLY A O     1 
ATOM   6673  N  N     . ASN A  1  862  ? 123.668 61.351  -25.315 1.00 73.90  ? 862  ASN A N     1 
ATOM   6674  C  CA    . ASN A  1  862  ? 123.736 62.766  -25.037 1.00 74.55  ? 862  ASN A CA    1 
ATOM   6675  C  C     . ASN A  1  862  ? 124.438 62.906  -23.696 1.00 79.26  ? 862  ASN A C     1 
ATOM   6676  O  O     . ASN A  1  862  ? 124.139 62.147  -22.779 1.00 78.26  ? 862  ASN A O     1 
ATOM   6677  C  CB    . ASN A  1  862  ? 122.332 63.371  -24.998 1.00 76.27  ? 862  ASN A CB    1 
ATOM   6678  C  CG    . ASN A  1  862  ? 121.521 63.270  -26.282 1.00 100.06 ? 862  ASN A CG    1 
ATOM   6679  O  OD1   . ASN A  1  862  ? 122.033 63.141  -27.412 1.00 89.90  ? 862  ASN A OD1   1 
ATOM   6680  N  ND2   . ASN A  1  862  ? 120.218 63.403  -26.131 1.00 96.34  ? 862  ASN A ND2   1 
ATOM   6681  N  N     . VAL A  1  863  ? 125.439 63.794  -23.608 1.00 77.32  ? 863  VAL A N     1 
ATOM   6682  C  CA    . VAL A  1  863  ? 126.196 64.014  -22.374 1.00 76.66  ? 863  VAL A CA    1 
ATOM   6683  C  C     . VAL A  1  863  ? 125.292 64.723  -21.345 1.00 82.84  ? 863  VAL A C     1 
ATOM   6684  O  O     . VAL A  1  863  ? 124.554 65.669  -21.679 1.00 84.14  ? 863  VAL A O     1 
ATOM   6685  C  CB    . VAL A  1  863  ? 127.545 64.746  -22.615 1.00 79.94  ? 863  VAL A CB    1 
ATOM   6686  C  CG1   . VAL A  1  863  ? 128.292 64.995  -21.311 1.00 79.56  ? 863  VAL A CG1   1 
ATOM   6687  C  CG2   . VAL A  1  863  ? 128.427 63.970  -23.583 1.00 79.40  ? 863  VAL A CG2   1 
ATOM   6688  N  N     . ILE A  1  864  ? 125.310 64.194  -20.109 1.00 77.52  ? 864  ILE A N     1 
ATOM   6689  C  CA    . ILE A  1  864  ? 124.563 64.722  -18.974 1.00 75.36  ? 864  ILE A CA    1 
ATOM   6690  C  C     . ILE A  1  864  ? 125.567 65.351  -18.025 1.00 78.47  ? 864  ILE A C     1 
ATOM   6691  O  O     . ILE A  1  864  ? 125.369 66.478  -17.592 1.00 79.21  ? 864  ILE A O     1 
ATOM   6692  C  CB    . ILE A  1  864  ? 123.665 63.640  -18.343 1.00 76.23  ? 864  ILE A CB    1 
ATOM   6693  C  CG1   . ILE A  1  864  ? 122.481 63.391  -19.252 1.00 76.13  ? 864  ILE A CG1   1 
ATOM   6694  C  CG2   . ILE A  1  864  ? 123.161 64.061  -16.981 1.00 76.60  ? 864  ILE A CG2   1 
ATOM   6695  C  CD1   . ILE A  1  864  ? 122.510 62.142  -19.858 1.00 88.99  ? 864  ILE A CD1   1 
ATOM   6696  N  N     . GLN A  1  865  ? 126.660 64.637  -17.754 1.00 73.46  ? 865  GLN A N     1 
ATOM   6697  C  CA    . GLN A  1  865  ? 127.793 65.060  -16.931 1.00 72.97  ? 865  GLN A CA    1 
ATOM   6698  C  C     . GLN A  1  865  ? 129.000 64.570  -17.728 1.00 75.75  ? 865  GLN A C     1 
ATOM   6699  O  O     . GLN A  1  865  ? 128.965 63.436  -18.215 1.00 76.46  ? 865  GLN A O     1 
ATOM   6700  C  CB    . GLN A  1  865  ? 127.770 64.368  -15.541 1.00 73.34  ? 865  GLN A CB    1 
ATOM   6701  C  CG    . GLN A  1  865  ? 126.708 64.845  -14.541 1.00 72.78  ? 865  GLN A CG    1 
ATOM   6702  C  CD    . GLN A  1  865  ? 126.643 63.974  -13.302 1.00 90.37  ? 865  GLN A CD    1 
ATOM   6703  O  OE1   . GLN A  1  865  ? 127.156 62.859  -13.272 1.00 91.20  ? 865  GLN A OE1   1 
ATOM   6704  N  NE2   . GLN A  1  865  ? 125.976 64.433  -12.255 1.00 79.72  ? 865  GLN A NE2   1 
ATOM   6705  N  N     . PHE A  1  866  ? 130.041 65.402  -17.898 1.00 70.10  ? 866  PHE A N     1 
ATOM   6706  C  CA    . PHE A  1  866  ? 131.225 65.023  -18.667 1.00 69.17  ? 866  PHE A CA    1 
ATOM   6707  C  C     . PHE A  1  866  ? 132.098 64.012  -17.927 1.00 78.13  ? 866  PHE A C     1 
ATOM   6708  O  O     . PHE A  1  866  ? 132.879 63.282  -18.550 1.00 79.84  ? 866  PHE A O     1 
ATOM   6709  C  CB    . PHE A  1  866  ? 132.003 66.261  -19.070 1.00 70.71  ? 866  PHE A CB    1 
ATOM   6710  C  CG    . PHE A  1  866  ? 131.333 66.996  -20.204 1.00 72.00  ? 866  PHE A CG    1 
ATOM   6711  C  CD1   . PHE A  1  866  ? 130.339 67.935  -19.955 1.00 74.00  ? 866  PHE A CD1   1 
ATOM   6712  C  CD2   . PHE A  1  866  ? 131.695 66.752  -21.522 1.00 74.92  ? 866  PHE A CD2   1 
ATOM   6713  C  CE1   . PHE A  1  866  ? 129.684 68.573  -21.004 1.00 77.05  ? 866  PHE A CE1   1 
ATOM   6714  C  CE2   . PHE A  1  866  ? 131.057 67.409  -22.570 1.00 75.98  ? 866  PHE A CE2   1 
ATOM   6715  C  CZ    . PHE A  1  866  ? 130.044 68.302  -22.304 1.00 75.49  ? 866  PHE A CZ    1 
ATOM   6716  N  N     . ILE A  1  867  ? 131.914 63.944  -16.594 1.00 75.16  ? 867  ILE A N     1 
ATOM   6717  C  CA    . ILE A  1  867  ? 132.570 63.070  -15.628 1.00 74.48  ? 867  ILE A CA    1 
ATOM   6718  C  C     . ILE A  1  867  ? 131.540 62.844  -14.528 1.00 78.16  ? 867  ILE A C     1 
ATOM   6719  O  O     . ILE A  1  867  ? 130.813 63.789  -14.207 1.00 77.67  ? 867  ILE A O     1 
ATOM   6720  C  CB    . ILE A  1  867  ? 133.942 63.696  -15.184 1.00 78.89  ? 867  ILE A CB    1 
ATOM   6721  C  CG1   . ILE A  1  867  ? 135.078 62.710  -15.282 1.00 80.96  ? 867  ILE A CG1   1 
ATOM   6722  C  CG2   . ILE A  1  867  ? 133.971 64.371  -13.849 1.00 79.12  ? 867  ILE A CG2   1 
ATOM   6723  C  CD1   . ILE A  1  867  ? 135.310 62.276  -16.637 1.00 101.21 ? 867  ILE A CD1   1 
ATOM   6724  N  N     . TYR A  1  868  ? 131.393 61.592  -14.018 1.00 74.68  ? 868  TYR A N     1 
ATOM   6725  C  CA    . TYR A  1  868  ? 130.372 61.301  -12.987 1.00 73.72  ? 868  TYR A CA    1 
ATOM   6726  C  C     . TYR A  1  868  ? 130.531 62.157  -11.739 1.00 76.12  ? 868  TYR A C     1 
ATOM   6727  O  O     . TYR A  1  868  ? 131.635 62.309  -11.215 1.00 75.99  ? 868  TYR A O     1 
ATOM   6728  C  CB    . TYR A  1  868  ? 130.330 59.800  -12.613 1.00 74.80  ? 868  TYR A CB    1 
ATOM   6729  C  CG    . TYR A  1  868  ? 129.318 59.429  -11.536 1.00 75.92  ? 868  TYR A CG    1 
ATOM   6730  C  CD1   . TYR A  1  868  ? 127.961 59.672  -11.712 1.00 77.54  ? 868  TYR A CD1   1 
ATOM   6731  C  CD2   . TYR A  1  868  ? 129.714 58.770  -10.374 1.00 76.29  ? 868  TYR A CD2   1 
ATOM   6732  C  CE1   . TYR A  1  868  ? 127.028 59.322  -10.735 1.00 77.87  ? 868  TYR A CE1   1 
ATOM   6733  C  CE2   . TYR A  1  868  ? 128.785 58.385  -9.403  1.00 76.61  ? 868  TYR A CE2   1 
ATOM   6734  C  CZ    . TYR A  1  868  ? 127.442 58.668  -9.587  1.00 84.33  ? 868  TYR A CZ    1 
ATOM   6735  O  OH    . TYR A  1  868  ? 126.494 58.280  -8.668  1.00 86.91  ? 868  TYR A OH    1 
ATOM   6736  N  N     . GLY A  1  869  ? 129.430 62.737  -11.303 1.00 72.56  ? 869  GLY A N     1 
ATOM   6737  C  CA    . GLY A  1  869  ? 129.377 63.585  -10.119 1.00 73.21  ? 869  GLY A CA    1 
ATOM   6738  C  C     . GLY A  1  869  ? 130.402 64.700  -10.036 1.00 78.58  ? 869  GLY A C     1 
ATOM   6739  O  O     . GLY A  1  869  ? 130.652 65.191  -8.935  1.00 79.02  ? 869  GLY A O     1 
ATOM   6740  N  N     . GLU A  1  870  ? 130.999 65.101  -11.206 1.00 74.65  ? 870  GLU A N     1 
ATOM   6741  C  CA    . GLU A  1  870  ? 131.986 66.177  -11.423 1.00 75.06  ? 870  GLU A CA    1 
ATOM   6742  C  C     . GLU A  1  870  ? 133.431 65.841  -10.941 1.00 81.13  ? 870  GLU A C     1 
ATOM   6743  O  O     . GLU A  1  870  ? 134.339 66.638  -11.183 1.00 82.20  ? 870  GLU A O     1 
ATOM   6744  C  CB    . GLU A  1  870  ? 131.502 67.525  -10.847 1.00 76.70  ? 870  GLU A CB    1 
ATOM   6745  C  CG    . GLU A  1  870  ? 130.216 67.998  -11.491 1.00 82.84  ? 870  GLU A CG    1 
ATOM   6746  C  CD    . GLU A  1  870  ? 129.450 69.095  -10.792 1.00 99.37  ? 870  GLU A CD    1 
ATOM   6747  O  OE1   . GLU A  1  870  ? 130.080 69.931  -10.104 1.00 94.14  ? 870  GLU A OE1   1 
ATOM   6748  O  OE2   . GLU A  1  870  ? 128.212 69.148  -10.981 1.00 94.73  ? 870  GLU A OE2   1 
ATOM   6749  N  N     . ASP A  1  871  ? 133.653 64.642  -10.345 1.00 77.99  ? 871  ASP A N     1 
ATOM   6750  C  CA    . ASP A  1  871  ? 134.959 64.149  -9.868  1.00 77.96  ? 871  ASP A CA    1 
ATOM   6751  C  C     . ASP A  1  871  ? 135.361 62.776  -10.445 1.00 80.68  ? 871  ASP A C     1 
ATOM   6752  O  O     . ASP A  1  871  ? 136.507 62.367  -10.238 1.00 81.96  ? 871  ASP A O     1 
ATOM   6753  C  CB    . ASP A  1  871  ? 134.998 64.074  -8.328  1.00 79.85  ? 871  ASP A CB    1 
ATOM   6754  C  CG    . ASP A  1  871  ? 133.943 63.163  -7.732  1.00 85.45  ? 871  ASP A CG    1 
ATOM   6755  O  OD1   . ASP A  1  871  ? 133.131 62.622  -8.506  1.00 84.77  ? 871  ASP A OD1   1 
ATOM   6756  O  OD2   . ASP A  1  871  ? 133.922 63.007  -6.482  1.00 87.97  ? 871  ASP A OD2   1 
ATOM   6757  N  N     . GLY A  1  872  ? 134.418 62.071  -11.085 1.00 74.39  ? 872  GLY A N     1 
ATOM   6758  C  CA    . GLY A  1  872  ? 134.634 60.755  -11.689 1.00 74.12  ? 872  GLY A CA    1 
ATOM   6759  C  C     . GLY A  1  872  ? 134.944 59.658  -10.680 1.00 79.69  ? 872  GLY A C     1 
ATOM   6760  O  O     . GLY A  1  872  ? 135.600 58.663  -11.002 1.00 80.57  ? 872  GLY A O     1 
ATOM   6761  N  N     . MET A  1  873  ? 134.437 59.831  -9.458  1.00 74.57  ? 873  MET A N     1 
ATOM   6762  C  CA    . MET A  1  873  ? 134.613 58.980  -8.293  1.00 72.87  ? 873  MET A CA    1 
ATOM   6763  C  C     . MET A  1  873  ? 133.286 58.210  -7.999  1.00 77.00  ? 873  MET A C     1 
ATOM   6764  O  O     . MET A  1  873  ? 132.225 58.645  -8.453  1.00 75.16  ? 873  MET A O     1 
ATOM   6765  C  CB    . MET A  1  873  ? 134.961 59.923  -7.125  1.00 74.93  ? 873  MET A CB    1 
ATOM   6766  C  CG    . MET A  1  873  ? 136.241 59.622  -6.389  1.00 78.23  ? 873  MET A CG    1 
ATOM   6767  S  SD    . MET A  1  873  ? 137.669 59.054  -7.331  1.00 82.58  ? 873  MET A SD    1 
ATOM   6768  C  CE    . MET A  1  873  ? 138.146 60.549  -8.148  1.00 80.89  ? 873  MET A CE    1 
ATOM   6769  N  N     . ASP A  1  874  ? 133.361 57.057  -7.273  1.00 74.31  ? 874  ASP A N     1 
ATOM   6770  C  CA    . ASP A  1  874  ? 132.215 56.230  -6.854  1.00 73.94  ? 874  ASP A CA    1 
ATOM   6771  C  C     . ASP A  1  874  ? 132.025 56.498  -5.371  1.00 78.19  ? 874  ASP A C     1 
ATOM   6772  O  O     . ASP A  1  874  ? 132.962 56.293  -4.596  1.00 77.95  ? 874  ASP A O     1 
ATOM   6773  C  CB    . ASP A  1  874  ? 132.473 54.730  -7.130  1.00 76.15  ? 874  ASP A CB    1 
ATOM   6774  C  CG    . ASP A  1  874  ? 131.481 53.749  -6.514  1.00 91.33  ? 874  ASP A CG    1 
ATOM   6775  O  OD1   . ASP A  1  874  ? 130.359 53.605  -7.062  1.00 98.31  ? 874  ASP A OD1   1 
ATOM   6776  O  OD2   . ASP A  1  874  ? 131.840 53.094  -5.519  1.00 93.17  ? 874  ASP A OD2   1 
ATOM   6777  N  N     . ALA A  1  875  ? 130.818 56.982  -4.987  1.00 75.08  ? 875  ALA A N     1 
ATOM   6778  C  CA    . ALA A  1  875  ? 130.438 57.413  -3.633  1.00 74.92  ? 875  ALA A CA    1 
ATOM   6779  C  C     . ALA A  1  875  ? 130.728 56.423  -2.518  1.00 79.12  ? 875  ALA A C     1 
ATOM   6780  O  O     . ALA A  1  875  ? 130.971 56.869  -1.399  1.00 80.02  ? 875  ALA A O     1 
ATOM   6781  C  CB    . ALA A  1  875  ? 128.988 57.828  -3.588  1.00 75.24  ? 875  ALA A CB    1 
ATOM   6782  N  N     . ALA A  1  876  ? 130.766 55.107  -2.795  1.00 73.99  ? 876  ALA A N     1 
ATOM   6783  C  CA    . ALA A  1  876  ? 131.084 54.153  -1.736  1.00 73.63  ? 876  ALA A CA    1 
ATOM   6784  C  C     . ALA A  1  876  ? 132.538 54.309  -1.222  1.00 79.93  ? 876  ALA A C     1 
ATOM   6785  O  O     . ALA A  1  876  ? 132.824 53.936  -0.080  1.00 80.37  ? 876  ALA A O     1 
ATOM   6786  C  CB    . ALA A  1  876  ? 130.833 52.745  -2.212  1.00 73.54  ? 876  ALA A CB    1 
ATOM   6787  N  N     . HIS A  1  877  ? 133.428 54.920  -2.054  1.00 77.05  ? 877  HIS A N     1 
ATOM   6788  C  CA    . HIS A  1  877  ? 134.856 55.168  -1.785  1.00 77.08  ? 877  HIS A CA    1 
ATOM   6789  C  C     . HIS A  1  877  ? 135.147 56.621  -1.380  1.00 79.13  ? 877  HIS A C     1 
ATOM   6790  O  O     . HIS A  1  877  ? 136.296 57.065  -1.445  1.00 80.19  ? 877  HIS A O     1 
ATOM   6791  C  CB    . HIS A  1  877  ? 135.708 54.795  -3.017  1.00 78.31  ? 877  HIS A CB    1 
ATOM   6792  C  CG    . HIS A  1  877  ? 135.588 53.366  -3.439  1.00 81.53  ? 877  HIS A CG    1 
ATOM   6793  N  ND1   . HIS A  1  877  ? 136.307 52.372  -2.816  1.00 83.66  ? 877  HIS A ND1   1 
ATOM   6794  C  CD2   . HIS A  1  877  ? 134.825 52.811  -4.410  1.00 83.07  ? 877  HIS A CD2   1 
ATOM   6795  C  CE1   . HIS A  1  877  ? 135.935 51.242  -3.394  1.00 82.70  ? 877  HIS A CE1   1 
ATOM   6796  N  NE2   . HIS A  1  877  ? 135.043 51.457  -4.356  1.00 82.65  ? 877  HIS A NE2   1 
ATOM   6797  N  N     . ILE A  1  878  ? 134.123 57.350  -0.946  1.00 73.46  ? 878  ILE A N     1 
ATOM   6798  C  CA    . ILE A  1  878  ? 134.254 58.745  -0.536  1.00 73.46  ? 878  ILE A CA    1 
ATOM   6799  C  C     . ILE A  1  878  ? 134.021 58.882  0.979   1.00 77.44  ? 878  ILE A C     1 
ATOM   6800  O  O     . ILE A  1  878  ? 133.087 58.272  1.512   1.00 77.78  ? 878  ILE A O     1 
ATOM   6801  C  CB    . ILE A  1  878  ? 133.333 59.632  -1.440  1.00 76.11  ? 878  ILE A CB    1 
ATOM   6802  C  CG1   . ILE A  1  878  ? 134.074 60.067  -2.696  1.00 76.89  ? 878  ILE A CG1   1 
ATOM   6803  C  CG2   . ILE A  1  878  ? 132.742 60.840  -0.750  1.00 76.54  ? 878  ILE A CG2   1 
ATOM   6804  C  CD1   . ILE A  1  878  ? 133.527 59.494  -3.879  1.00 86.11  ? 878  ILE A CD1   1 
ATOM   6805  N  N     . GLU A  1  879  ? 134.900 59.648  1.673   1.00 72.90  ? 879  GLU A N     1 
ATOM   6806  C  CA    . GLU A  1  879  ? 134.829 59.890  3.123   1.00 72.21  ? 879  GLU A CA    1 
ATOM   6807  C  C     . GLU A  1  879  ? 134.933 61.372  3.475   1.00 77.73  ? 879  GLU A C     1 
ATOM   6808  O  O     . GLU A  1  879  ? 135.722 62.084  2.859   1.00 77.05  ? 879  GLU A O     1 
ATOM   6809  C  CB    . GLU A  1  879  ? 135.927 59.117  3.842   1.00 73.36  ? 879  GLU A CB    1 
ATOM   6810  C  CG    . GLU A  1  879  ? 135.827 57.621  3.624   1.00 80.82  ? 879  GLU A CG    1 
ATOM   6811  C  CD    . GLU A  1  879  ? 136.917 56.818  4.287   1.00 98.81  ? 879  GLU A CD    1 
ATOM   6812  O  OE1   . GLU A  1  879  ? 137.267 57.141  5.447   1.00 93.18  ? 879  GLU A OE1   1 
ATOM   6813  O  OE2   . GLU A  1  879  ? 137.410 55.855  3.652   1.00 88.21  ? 879  GLU A OE2   1 
ATOM   6814  N  N     . LYS A  1  880  ? 134.146 61.835  4.478   1.00 76.14  ? 880  LYS A N     1 
ATOM   6815  C  CA    . LYS A  1  880  ? 134.164 63.229  4.948   1.00 76.79  ? 880  LYS A CA    1 
ATOM   6816  C  C     . LYS A  1  880  ? 135.516 63.480  5.551   1.00 81.94  ? 880  LYS A C     1 
ATOM   6817  O  O     . LYS A  1  880  ? 135.893 62.797  6.495   1.00 81.50  ? 880  LYS A O     1 
ATOM   6818  C  CB    . LYS A  1  880  ? 133.043 63.520  5.964   1.00 79.34  ? 880  LYS A CB    1 
ATOM   6819  C  CG    . LYS A  1  880  ? 132.571 64.985  5.949   1.00 95.87  ? 880  LYS A CG    1 
ATOM   6820  C  CD    . LYS A  1  880  ? 131.250 65.218  6.708   1.00 108.55 ? 880  LYS A CD    1 
ATOM   6821  C  CE    . LYS A  1  880  ? 130.011 64.950  5.864   1.00 121.91 ? 880  LYS A CE    1 
ATOM   6822  N  NZ    . LYS A  1  880  ? 128.750 64.998  6.661   1.00 128.30 ? 880  LYS A NZ    1 
ATOM   6823  N  N     . GLN A  1  881  ? 136.294 64.360  4.911   1.00 80.43  ? 881  GLN A N     1 
ATOM   6824  C  CA    . GLN A  1  881  ? 137.660 64.705  5.314   1.00 81.42  ? 881  GLN A CA    1 
ATOM   6825  C  C     . GLN A  1  881  ? 137.733 66.176  5.572   1.00 88.93  ? 881  GLN A C     1 
ATOM   6826  O  O     . GLN A  1  881  ? 136.825 66.897  5.161   1.00 89.81  ? 881  GLN A O     1 
ATOM   6827  C  CB    . GLN A  1  881  ? 138.679 64.276  4.255   1.00 81.79  ? 881  GLN A CB    1 
ATOM   6828  C  CG    . GLN A  1  881  ? 138.808 62.772  4.186   1.00 78.81  ? 881  GLN A CG    1 
ATOM   6829  C  CD    . GLN A  1  881  ? 139.953 62.361  3.329   1.00 89.81  ? 881  GLN A CD    1 
ATOM   6830  O  OE1   . GLN A  1  881  ? 141.104 62.275  3.782   1.00 82.45  ? 881  GLN A OE1   1 
ATOM   6831  N  NE2   . GLN A  1  881  ? 139.651 62.079  2.075   1.00 81.43  ? 881  GLN A NE2   1 
ATOM   6832  N  N     . SER A  1  882  ? 138.779 66.629  6.270   1.00 86.80  ? 882  SER A N     1 
ATOM   6833  C  CA    . SER A  1  882  ? 138.911 68.028  6.640   1.00 87.86  ? 882  SER A CA    1 
ATOM   6834  C  C     . SER A  1  882  ? 140.000 68.760  5.849   1.00 94.70  ? 882  SER A C     1 
ATOM   6835  O  O     . SER A  1  882  ? 141.160 68.343  5.877   1.00 95.42  ? 882  SER A O     1 
ATOM   6836  C  CB    . SER A  1  882  ? 139.109 68.140  8.150   1.00 91.38  ? 882  SER A CB    1 
ATOM   6837  O  OG    . SER A  1  882  ? 139.851 69.285  8.534   1.00 103.54 ? 882  SER A OG    1 
ATOM   6838  N  N     . LEU A  1  883  ? 139.627 69.856  5.145   1.00 92.25  ? 883  LEU A N     1 
ATOM   6839  C  CA    . LEU A  1  883  ? 140.579 70.691  4.384   1.00 93.14  ? 883  LEU A CA    1 
ATOM   6840  C  C     . LEU A  1  883  ? 141.161 71.761  5.340   1.00 99.03  ? 883  LEU A C     1 
ATOM   6841  O  O     . LEU A  1  883  ? 140.602 72.861  5.480   1.00 98.42  ? 883  LEU A O     1 
ATOM   6842  C  CB    . LEU A  1  883  ? 139.916 71.318  3.134   1.00 92.70  ? 883  LEU A CB    1 
ATOM   6843  C  CG    . LEU A  1  883  ? 139.225 70.345  2.171   1.00 96.10  ? 883  LEU A CG    1 
ATOM   6844  C  CD1   . LEU A  1  883  ? 137.967 70.953  1.598   1.00 96.47  ? 883  LEU A CD1   1 
ATOM   6845  C  CD2   . LEU A  1  883  ? 140.159 69.882  1.063   1.00 96.76  ? 883  LEU A CD2   1 
ATOM   6846  N  N     . ASP A  1  884  ? 142.255 71.384  6.050   1.00 97.22  ? 884  ASP A N     1 
ATOM   6847  C  CA    . ASP A  1  884  ? 142.936 72.184  7.091   1.00 98.82  ? 884  ASP A CA    1 
ATOM   6848  C  C     . ASP A  1  884  ? 143.196 73.631  6.742   1.00 102.85 ? 884  ASP A C     1 
ATOM   6849  O  O     . ASP A  1  884  ? 143.008 74.500  7.587   1.00 103.92 ? 884  ASP A O     1 
ATOM   6850  C  CB    . ASP A  1  884  ? 144.258 71.542  7.523   1.00 101.29 ? 884  ASP A CB    1 
ATOM   6851  C  CG    . ASP A  1  884  ? 144.116 70.093  7.870   1.00 113.46 ? 884  ASP A CG    1 
ATOM   6852  O  OD1   . ASP A  1  884  ? 143.842 69.794  9.049   1.00 119.99 ? 884  ASP A OD1   1 
ATOM   6853  O  OD2   . ASP A  1  884  ? 144.264 69.253  6.958   1.00 114.89 ? 884  ASP A OD2   1 
ATOM   6854  N  N     . THR A  1  885  ? 143.630 73.865  5.500   1.00 97.37  ? 885  THR A N     1 
ATOM   6855  C  CA    . THR A  1  885  ? 144.023 75.128  4.889   1.00 97.02  ? 885  THR A CA    1 
ATOM   6856  C  C     . THR A  1  885  ? 142.893 76.217  4.884   1.00 99.61  ? 885  THR A C     1 
ATOM   6857  O  O     . THR A  1  885  ? 143.234 77.394  4.970   1.00 98.90  ? 885  THR A O     1 
ATOM   6858  C  CB    . THR A  1  885  ? 144.581 74.777  3.496   1.00 98.26  ? 885  THR A CB    1 
ATOM   6859  O  OG1   . THR A  1  885  ? 145.620 73.852  3.712   1.00 92.84  ? 885  THR A OG1   1 
ATOM   6860  C  CG2   . THR A  1  885  ? 145.205 75.931  2.779   1.00 97.30  ? 885  THR A CG2   1 
ATOM   6861  N  N     . ILE A  1  886  ? 141.593 75.847  4.856   1.00 96.19  ? 886  ILE A N     1 
ATOM   6862  C  CA    . ILE A  1  886  ? 140.484 76.824  4.793   1.00 96.94  ? 886  ILE A CA    1 
ATOM   6863  C  C     . ILE A  1  886  ? 140.406 77.798  5.997   1.00 103.33 ? 886  ILE A C     1 
ATOM   6864  O  O     . ILE A  1  886  ? 140.502 79.013  5.801   1.00 103.33 ? 886  ILE A O     1 
ATOM   6865  C  CB    . ILE A  1  886  ? 139.100 76.179  4.539   1.00 99.06  ? 886  ILE A CB    1 
ATOM   6866  C  CG1   . ILE A  1  886  ? 139.158 75.226  3.361   1.00 99.38  ? 886  ILE A CG1   1 
ATOM   6867  C  CG2   . ILE A  1  886  ? 138.052 77.258  4.282   1.00 100.39 ? 886  ILE A CG2   1 
ATOM   6868  C  CD1   . ILE A  1  886  ? 137.856 74.520  3.030   1.00 114.95 ? 886  ILE A CD1   1 
ATOM   6869  N  N     . GLY A  1  887  ? 140.158 77.266  7.193   1.00 100.83 ? 887  GLY A N     1 
ATOM   6870  C  CA    . GLY A  1  887  ? 139.989 78.074  8.397   1.00 101.56 ? 887  GLY A CA    1 
ATOM   6871  C  C     . GLY A  1  887  ? 141.257 78.503  9.107   1.00 105.97 ? 887  GLY A C     1 
ATOM   6872  O  O     . GLY A  1  887  ? 142.365 78.389  8.566   1.00 105.13 ? 887  GLY A O     1 
ATOM   6873  N  N     . GLY A  1  888  ? 141.066 79.028  10.319  1.00 103.49 ? 888  GLY A N     1 
ATOM   6874  C  CA    . GLY A  1  888  ? 142.133 79.500  11.196  1.00 104.35 ? 888  GLY A CA    1 
ATOM   6875  C  C     . GLY A  1  888  ? 142.746 80.803  10.749  1.00 108.22 ? 888  GLY A C     1 
ATOM   6876  O  O     . GLY A  1  888  ? 142.496 81.257  9.630   1.00 107.41 ? 888  GLY A O     1 
ATOM   6877  N  N     . SER A  1  889  ? 143.554 81.417  11.614  1.00 105.79 ? 889  SER A N     1 
ATOM   6878  C  CA    . SER A  1  889  ? 144.197 82.685  11.274  1.00 106.71 ? 889  SER A CA    1 
ATOM   6879  C  C     . SER A  1  889  ? 145.337 82.490  10.297  1.00 109.07 ? 889  SER A C     1 
ATOM   6880  O  O     . SER A  1  889  ? 145.819 81.367  10.115  1.00 107.59 ? 889  SER A O     1 
ATOM   6881  C  CB    . SER A  1  889  ? 144.695 83.395  12.527  1.00 112.99 ? 889  SER A CB    1 
ATOM   6882  O  OG    . SER A  1  889  ? 145.698 82.647  13.192  1.00 125.00 ? 889  SER A OG    1 
ATOM   6883  N  N     . ASP A  1  890  ? 145.775 83.591  9.677   1.00 105.95 ? 890  ASP A N     1 
ATOM   6884  C  CA    . ASP A  1  890  ? 146.892 83.570  8.742   1.00 105.87 ? 890  ASP A CA    1 
ATOM   6885  C  C     . ASP A  1  890  ? 148.196 83.236  9.490   1.00 109.73 ? 890  ASP A C     1 
ATOM   6886  O  O     . ASP A  1  890  ? 149.029 82.499  8.958   1.00 109.39 ? 890  ASP A O     1 
ATOM   6887  C  CB    . ASP A  1  890  ? 147.004 84.901  7.981   1.00 108.74 ? 890  ASP A CB    1 
ATOM   6888  C  CG    . ASP A  1  890  ? 145.720 85.404  7.336   1.00 119.63 ? 890  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A  1  890  ? 145.075 84.626  6.601   1.00 117.80 ? 890  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A  1  890  ? 145.396 86.600  7.517   1.00 129.10 ? 890  ASP A OD2   1 
ATOM   6891  N  N     . ALA A  1  891  ? 148.338 83.732  10.745  1.00 106.22 ? 891  ALA A N     1 
ATOM   6892  C  CA    . ALA A  1  891  ? 149.497 83.476  11.612  1.00 106.42 ? 891  ALA A CA    1 
ATOM   6893  C  C     . ALA A  1  891  ? 149.574 81.998  11.970  1.00 108.49 ? 891  ALA A C     1 
ATOM   6894  O  O     . ALA A  1  891  ? 150.670 81.445  12.042  1.00 108.75 ? 891  ALA A O     1 
ATOM   6895  C  CB    . ALA A  1  891  ? 149.402 84.308  12.881  1.00 108.39 ? 891  ALA A CB    1 
ATOM   6896  N  N     . ALA A  1  892  ? 148.405 81.362  12.173  1.00 102.60 ? 892  ALA A N     1 
ATOM   6897  C  CA    . ALA A  1  892  ? 148.287 79.954  12.504  1.00 101.03 ? 892  ALA A CA    1 
ATOM   6898  C  C     . ALA A  1  892  ? 148.769 79.118  11.336  1.00 104.54 ? 892  ALA A C     1 
ATOM   6899  O  O     . ALA A  1  892  ? 149.528 78.162  11.545  1.00 104.83 ? 892  ALA A O     1 
ATOM   6900  C  CB    . ALA A  1  892  ? 146.843 79.621  12.817  1.00 100.77 ? 892  ALA A CB    1 
ATOM   6901  N  N     . PHE A  1  893  ? 148.339 79.499  10.107  1.00 99.60  ? 893  PHE A N     1 
ATOM   6902  C  CA    . PHE A  1  893  ? 148.677 78.852  8.835   1.00 98.17  ? 893  PHE A CA    1 
ATOM   6903  C  C     . PHE A  1  893  ? 150.197 78.898  8.590   1.00 103.86 ? 893  PHE A C     1 
ATOM   6904  O  O     . PHE A  1  893  ? 150.802 77.899  8.176   1.00 103.11 ? 893  PHE A O     1 
ATOM   6905  C  CB    . PHE A  1  893  ? 147.903 79.541  7.699   1.00 99.12  ? 893  PHE A CB    1 
ATOM   6906  C  CG    . PHE A  1  893  ? 148.268 79.136  6.290   1.00 99.59  ? 893  PHE A CG    1 
ATOM   6907  C  CD1   . PHE A  1  893  ? 147.680 78.029  5.695   1.00 100.39 ? 893  PHE A CD1   1 
ATOM   6908  C  CD2   . PHE A  1  893  ? 149.158 79.897  5.537   1.00 102.34 ? 893  PHE A CD2   1 
ATOM   6909  C  CE1   . PHE A  1  893  ? 148.010 77.664  4.389   1.00 100.61 ? 893  PHE A CE1   1 
ATOM   6910  C  CE2   . PHE A  1  893  ? 149.483 79.533  4.227   1.00 104.15 ? 893  PHE A CE2   1 
ATOM   6911  C  CZ    . PHE A  1  893  ? 148.902 78.422  3.661   1.00 100.63 ? 893  PHE A CZ    1 
ATOM   6912  N  N     . GLU A  1  894  ? 150.799 80.065  8.865   1.00 101.59 ? 894  GLU A N     1 
ATOM   6913  C  CA    . GLU A  1  894  ? 152.227 80.318  8.733   1.00 102.47 ? 894  GLU A CA    1 
ATOM   6914  C  C     . GLU A  1  894  ? 153.001 79.341  9.620   1.00 106.24 ? 894  GLU A C     1 
ATOM   6915  O  O     . GLU A  1  894  ? 153.917 78.676  9.137   1.00 105.65 ? 894  GLU A O     1 
ATOM   6916  C  CB    . GLU A  1  894  ? 152.524 81.764  9.155   1.00 105.47 ? 894  GLU A CB    1 
ATOM   6917  C  CG    . GLU A  1  894  ? 153.662 82.410  8.398   1.00 115.94 ? 894  GLU A CG    1 
ATOM   6918  C  CD    . GLU A  1  894  ? 153.307 83.789  7.888   1.00 136.86 ? 894  GLU A CD    1 
ATOM   6919  O  OE1   . GLU A  1  894  ? 152.482 83.883  6.948   1.00 132.53 ? 894  GLU A OE1   1 
ATOM   6920  O  OE2   . GLU A  1  894  ? 153.821 84.778  8.456   1.00 132.85 ? 894  GLU A OE2   1 
ATOM   6921  N  N     . LYS A  1  895  ? 152.593 79.227  10.908  1.00 103.03 ? 895  LYS A N     1 
ATOM   6922  C  CA    . LYS A  1  895  ? 153.212 78.346  11.911  1.00 103.20 ? 895  LYS A CA    1 
ATOM   6923  C  C     . LYS A  1  895  ? 153.146 76.895  11.434  1.00 106.39 ? 895  LYS A C     1 
ATOM   6924  O  O     . LYS A  1  895  ? 154.118 76.142  11.548  1.00 106.39 ? 895  LYS A O     1 
ATOM   6925  C  CB    . LYS A  1  895  ? 152.491 78.494  13.273  1.00 105.20 ? 895  LYS A CB    1 
ATOM   6926  C  CG    . LYS A  1  895  ? 153.329 78.096  14.492  1.00 110.59 ? 895  LYS A CG    1 
ATOM   6927  C  CD    . LYS A  1  895  ? 152.517 78.160  15.787  1.00 116.97 ? 895  LYS A CD    1 
ATOM   6928  C  CE    . LYS A  1  895  ? 153.369 78.090  17.036  1.00 124.46 ? 895  LYS A CE    1 
ATOM   6929  N  NZ    . LYS A  1  895  ? 153.902 79.424  17.431  1.00 130.57 ? 895  LYS A NZ    1 
ATOM   6930  N  N     . ARG A  1  896  ? 152.006 76.540  10.851  1.00 101.10 ? 896  ARG A N     1 
ATOM   6931  C  CA    . ARG A  1  896  ? 151.727 75.210  10.372  1.00 99.63  ? 896  ARG A CA    1 
ATOM   6932  C  C     . ARG A  1  896  ? 152.481 74.778  9.135   1.00 102.42 ? 896  ARG A C     1 
ATOM   6933  O  O     . ARG A  1  896  ? 152.899 73.617  9.079   1.00 101.61 ? 896  ARG A O     1 
ATOM   6934  C  CB    . ARG A  1  896  ? 150.223 75.069  10.123  1.00 99.30  ? 896  ARG A CB    1 
ATOM   6935  C  CG    . ARG A  1  896  ? 149.611 73.912  10.858  1.00 106.05 ? 896  ARG A CG    1 
ATOM   6936  C  CD    . ARG A  1  896  ? 149.358 72.748  9.953   1.00 107.43 ? 896  ARG A CD    1 
ATOM   6937  N  NE    . ARG A  1  896  ? 148.642 71.711  10.680  1.00 115.58 ? 896  ARG A NE    1 
ATOM   6938  C  CZ    . ARG A  1  896  ? 147.320 71.649  10.771  1.00 128.40 ? 896  ARG A CZ    1 
ATOM   6939  N  NH1   . ARG A  1  896  ? 146.562 72.560  10.168  1.00 110.93 ? 896  ARG A NH1   1 
ATOM   6940  N  NH2   . ARG A  1  896  ? 146.744 70.676  11.462  1.00 117.22 ? 896  ARG A NH2   1 
ATOM   6941  N  N     . TYR A  1  897  ? 152.606 75.668  8.126   1.00 98.42  ? 897  TYR A N     1 
ATOM   6942  C  CA    . TYR A  1  897  ? 153.147 75.280  6.829   1.00 97.89  ? 897  TYR A CA    1 
ATOM   6943  C  C     . TYR A  1  897  ? 154.450 75.937  6.372   1.00 102.81 ? 897  TYR A C     1 
ATOM   6944  O  O     . TYR A  1  897  ? 155.141 75.355  5.525   1.00 103.29 ? 897  TYR A O     1 
ATOM   6945  C  CB    . TYR A  1  897  ? 152.074 75.499  5.756   1.00 98.37  ? 897  TYR A CB    1 
ATOM   6946  C  CG    . TYR A  1  897  ? 150.824 74.686  6.014   1.00 99.89  ? 897  TYR A CG    1 
ATOM   6947  C  CD1   . TYR A  1  897  ? 150.780 73.325  5.726   1.00 100.41 ? 897  TYR A CD1   1 
ATOM   6948  C  CD2   . TYR A  1  897  ? 149.687 75.273  6.561   1.00 101.09 ? 897  TYR A CD2   1 
ATOM   6949  C  CE1   . TYR A  1  897  ? 149.643 72.566  5.990   1.00 99.40  ? 897  TYR A CE1   1 
ATOM   6950  C  CE2   . TYR A  1  897  ? 148.541 74.524  6.827   1.00 100.91 ? 897  TYR A CE2   1 
ATOM   6951  C  CZ    . TYR A  1  897  ? 148.523 73.171  6.532   1.00 107.13 ? 897  TYR A CZ    1 
ATOM   6952  O  OH    . TYR A  1  897  ? 147.402 72.426  6.796   1.00 109.21 ? 897  TYR A OH    1 
ATOM   6953  N  N     . ARG A  1  898  ? 154.785 77.125  6.885   1.00 98.55  ? 898  ARG A N     1 
ATOM   6954  C  CA    . ARG A  1  898  ? 155.982 77.823  6.436   1.00 98.42  ? 898  ARG A CA    1 
ATOM   6955  C  C     . ARG A  1  898  ? 157.281 77.181  6.886   1.00 101.87 ? 898  ARG A C     1 
ATOM   6956  O  O     . ARG A  1  898  ? 157.470 76.894  8.070   1.00 102.60 ? 898  ARG A O     1 
ATOM   6957  C  CB    . ARG A  1  898  ? 155.947 79.321  6.821   1.00 97.83  ? 898  ARG A CB    1 
ATOM   6958  C  CG    . ARG A  1  898  ? 157.086 80.183  6.254   1.00 103.65 ? 898  ARG A CG    1 
ATOM   6959  C  CD    . ARG A  1  898  ? 157.149 80.185  4.736   1.00 109.08 ? 898  ARG A CD    1 
ATOM   6960  N  NE    . ARG A  1  898  ? 157.864 81.358  4.237   1.00 117.84 ? 898  ARG A NE    1 
ATOM   6961  C  CZ    . ARG A  1  898  ? 158.652 81.365  3.167   1.00 127.05 ? 898  ARG A CZ    1 
ATOM   6962  N  NH1   . ARG A  1  898  ? 158.852 80.249  2.472   1.00 105.65 ? 898  ARG A NH1   1 
ATOM   6963  N  NH2   . ARG A  1  898  ? 159.255 82.485  2.788   1.00 114.89 ? 898  ARG A NH2   1 
ATOM   6964  N  N     . VAL A  1  899  ? 158.169 76.957  5.910   1.00 96.50  ? 899  VAL A N     1 
ATOM   6965  C  CA    . VAL A  1  899  ? 159.540 76.501  6.102   1.00 96.11  ? 899  VAL A CA    1 
ATOM   6966  C  C     . VAL A  1  899  ? 160.382 77.545  5.364   1.00 102.42 ? 899  VAL A C     1 
ATOM   6967  O  O     . VAL A  1  899  ? 160.164 77.785  4.167   1.00 102.49 ? 899  VAL A O     1 
ATOM   6968  C  CB    . VAL A  1  899  ? 159.828 75.058  5.632   1.00 97.45  ? 899  VAL A CB    1 
ATOM   6969  C  CG1   . VAL A  1  899  ? 161.322 74.770  5.659   1.00 97.94  ? 899  VAL A CG1   1 
ATOM   6970  C  CG2   . VAL A  1  899  ? 159.081 74.045  6.484   1.00 95.92  ? 899  VAL A CG2   1 
ATOM   6971  N  N     . ASP A  1  900  ? 161.268 78.227  6.117   1.00 99.43  ? 900  ASP A N     1 
ATOM   6972  C  CA    . ASP A  1  900  ? 162.174 79.272  5.649   1.00 99.70  ? 900  ASP A CA    1 
ATOM   6973  C  C     . ASP A  1  900  ? 163.543 78.886  6.149   1.00 104.18 ? 900  ASP A C     1 
ATOM   6974  O  O     . ASP A  1  900  ? 163.882 79.202  7.291   1.00 104.80 ? 900  ASP A O     1 
ATOM   6975  C  CB    . ASP A  1  900  ? 161.758 80.639  6.229   1.00 102.13 ? 900  ASP A CB    1 
ATOM   6976  C  CG    . ASP A  1  900  ? 162.473 81.864  5.673   1.00 111.01 ? 900  ASP A CG    1 
ATOM   6977  O  OD1   . ASP A  1  900  ? 163.559 81.699  5.057   1.00 111.38 ? 900  ASP A OD1   1 
ATOM   6978  O  OD2   . ASP A  1  900  ? 161.952 82.991  5.860   1.00 115.28 ? 900  ASP A OD2   1 
ATOM   6979  N  N     . LEU A  1  901  ? 164.317 78.164  5.307   1.00 100.37 ? 901  LEU A N     1 
ATOM   6980  C  CA    . LEU A  1  901  ? 165.678 77.688  5.606   1.00 100.68 ? 901  LEU A CA    1 
ATOM   6981  C  C     . LEU A  1  901  ? 166.676 78.855  5.721   1.00 105.91 ? 901  LEU A C     1 
ATOM   6982  O  O     . LEU A  1  901  ? 167.810 78.655  6.158   1.00 106.28 ? 901  LEU A O     1 
ATOM   6983  C  CB    . LEU A  1  901  ? 166.180 76.690  4.540   1.00 99.99  ? 901  LEU A CB    1 
ATOM   6984  C  CG    . LEU A  1  901  ? 165.301 75.508  4.150   1.00 102.99 ? 901  LEU A CG    1 
ATOM   6985  C  CD1   . LEU A  1  901  ? 165.928 74.751  3.006   1.00 103.16 ? 901  LEU A CD1   1 
ATOM   6986  C  CD2   . LEU A  1  901  ? 165.070 74.567  5.320   1.00 104.55 ? 901  LEU A CD2   1 
ATOM   6987  N  N     . LEU A  1  902  ? 166.250 80.064  5.330   1.00 102.15 ? 902  LEU A N     1 
ATOM   6988  C  CA    . LEU A  1  902  ? 167.098 81.236  5.381   1.00 103.46 ? 902  LEU A CA    1 
ATOM   6989  C  C     . LEU A  1  902  ? 166.864 82.106  6.634   1.00 109.93 ? 902  LEU A C     1 
ATOM   6990  O  O     . LEU A  1  902  ? 167.453 83.183  6.736   1.00 112.40 ? 902  LEU A O     1 
ATOM   6991  C  CB    . LEU A  1  902  ? 166.985 82.063  4.083   1.00 103.27 ? 902  LEU A CB    1 
ATOM   6992  C  CG    . LEU A  1  902  ? 166.967 81.343  2.730   1.00 105.90 ? 902  LEU A CG    1 
ATOM   6993  C  CD1   . LEU A  1  902  ? 166.755 82.316  1.614   1.00 106.54 ? 902  LEU A CD1   1 
ATOM   6994  C  CD2   . LEU A  1  902  ? 168.226 80.594  2.466   1.00 106.95 ? 902  LEU A CD2   1 
ATOM   6995  N  N     . ASN A  1  903  ? 166.035 81.645  7.590   1.00 105.24 ? 903  ASN A N     1 
ATOM   6996  C  CA    . ASN A  1  903  ? 165.770 82.357  8.848   1.00 106.18 ? 903  ASN A CA    1 
ATOM   6997  C  C     . ASN A  1  903  ? 166.065 81.379  9.976   1.00 111.31 ? 903  ASN A C     1 
ATOM   6998  O  O     . ASN A  1  903  ? 165.427 80.328  10.041  1.00 108.91 ? 903  ASN A O     1 
ATOM   6999  C  CB    . ASN A  1  903  ? 164.314 82.857  8.903   1.00 106.27 ? 903  ASN A CB    1 
ATOM   7000  C  CG    . ASN A  1  903  ? 163.938 83.708  10.105  1.00 136.80 ? 903  ASN A CG    1 
ATOM   7001  O  OD1   . ASN A  1  903  ? 163.456 84.834  9.969   1.00 138.70 ? 903  ASN A OD1   1 
ATOM   7002  N  ND2   . ASN A  1  903  ? 164.034 83.167  11.306  1.00 127.37 ? 903  ASN A ND2   1 
ATOM   7003  N  N     . THR A  1  904  ? 167.009 81.729  10.875  1.00 111.25 ? 904  THR A N     1 
ATOM   7004  C  CA    . THR A  1  904  ? 167.455 80.874  11.985  1.00 112.18 ? 904  THR A CA    1 
ATOM   7005  C  C     . THR A  1  904  ? 166.323 80.372  12.939  1.00 117.68 ? 904  THR A C     1 
ATOM   7006  O  O     . THR A  1  904  ? 166.525 79.354  13.602  1.00 116.89 ? 904  THR A O     1 
ATOM   7007  C  CB    . THR A  1  904  ? 168.598 81.535  12.775  1.00 122.44 ? 904  THR A CB    1 
ATOM   7008  O  OG1   . THR A  1  904  ? 169.165 80.559  13.637  1.00 126.66 ? 904  THR A OG1   1 
ATOM   7009  C  CG2   . THR A  1  904  ? 168.159 82.716  13.613  1.00 121.71 ? 904  THR A CG2   1 
ATOM   7010  N  N     . ASP A  1  905  ? 165.157 81.061  12.992  1.00 115.52 ? 905  ASP A N     1 
ATOM   7011  C  CA    . ASP A  1  905  ? 164.028 80.715  13.866  1.00 114.97 ? 905  ASP A CA    1 
ATOM   7012  C  C     . ASP A  1  905  ? 162.919 79.917  13.183  1.00 120.54 ? 905  ASP A C     1 
ATOM   7013  O  O     . ASP A  1  905  ? 162.204 79.184  13.875  1.00 120.68 ? 905  ASP A O     1 
ATOM   7014  C  CB    . ASP A  1  905  ? 163.394 81.971  14.503  1.00 117.09 ? 905  ASP A CB    1 
ATOM   7015  C  CG    . ASP A  1  905  ? 164.317 83.130  14.835  1.00 126.92 ? 905  ASP A CG    1 
ATOM   7016  O  OD1   . ASP A  1  905  ? 165.403 82.884  15.416  1.00 127.83 ? 905  ASP A OD1   1 
ATOM   7017  O  OD2   . ASP A  1  905  ? 163.922 84.288  14.579  1.00 132.89 ? 905  ASP A OD2   1 
ATOM   7018  N  N     . HIS A  1  906  ? 162.735 80.082  11.853  1.00 117.36 ? 906  HIS A N     1 
ATOM   7019  C  CA    . HIS A  1  906  ? 161.636 79.431  11.123  1.00 115.55 ? 906  HIS A CA    1 
ATOM   7020  C  C     . HIS A  1  906  ? 162.060 78.235  10.226  1.00 118.52 ? 906  HIS A C     1 
ATOM   7021  O  O     . HIS A  1  906  ? 161.235 77.724  9.460   1.00 117.05 ? 906  HIS A O     1 
ATOM   7022  C  CB    . HIS A  1  906  ? 160.843 80.480  10.332  1.00 116.30 ? 906  HIS A CB    1 
ATOM   7023  C  CG    . HIS A  1  906  ? 160.353 81.608  11.188  1.00 120.87 ? 906  HIS A CG    1 
ATOM   7024  N  ND1   . HIS A  1  906  ? 161.225 82.552  11.709  1.00 124.71 ? 906  HIS A ND1   1 
ATOM   7025  C  CD2   . HIS A  1  906  ? 159.101 81.900  11.603  1.00 122.17 ? 906  HIS A CD2   1 
ATOM   7026  C  CE1   . HIS A  1  906  ? 160.479 83.388  12.411  1.00 124.54 ? 906  HIS A CE1   1 
ATOM   7027  N  NE2   . HIS A  1  906  ? 159.195 83.037  12.378  1.00 123.42 ? 906  HIS A NE2   1 
ATOM   7028  N  N     . THR A  1  907  ? 163.310 77.746  10.382  1.00 115.20 ? 907  THR A N     1 
ATOM   7029  C  CA    . THR A  1  907  ? 163.847 76.578  9.667   1.00 113.74 ? 907  THR A CA    1 
ATOM   7030  C  C     . THR A  1  907  ? 163.338 75.308  10.357  1.00 116.36 ? 907  THR A C     1 
ATOM   7031  O  O     . THR A  1  907  ? 162.796 75.364  11.470  1.00 116.21 ? 907  THR A O     1 
ATOM   7032  C  CB    . THR A  1  907  ? 165.397 76.632  9.682   1.00 121.50 ? 907  THR A CB    1 
ATOM   7033  O  OG1   . THR A  1  907  ? 165.805 77.856  9.094   1.00 128.25 ? 907  THR A OG1   1 
ATOM   7034  C  CG2   . THR A  1  907  ? 166.074 75.479  8.923   1.00 116.68 ? 907  THR A CG2   1 
ATOM   7035  N  N     . LEU A  1  908  ? 163.507 74.161  9.677   1.00 111.05 ? 908  LEU A N     1 
ATOM   7036  C  CA    . LEU A  1  908  ? 163.222 72.835  10.198  1.00 108.64 ? 908  LEU A CA    1 
ATOM   7037  C  C     . LEU A  1  908  ? 164.406 72.506  11.107  1.00 112.21 ? 908  LEU A C     1 
ATOM   7038  O  O     . LEU A  1  908  ? 165.551 72.488  10.640  1.00 111.73 ? 908  LEU A O     1 
ATOM   7039  C  CB    . LEU A  1  908  ? 163.146 71.812  9.053   1.00 106.93 ? 908  LEU A CB    1 
ATOM   7040  C  CG    . LEU A  1  908  ? 162.006 71.968  8.072   1.00 109.41 ? 908  LEU A CG    1 
ATOM   7041  C  CD1   . LEU A  1  908  ? 162.353 71.329  6.751   1.00 108.37 ? 908  LEU A CD1   1 
ATOM   7042  C  CD2   . LEU A  1  908  ? 160.733 71.386  8.629   1.00 111.44 ? 908  LEU A CD2   1 
ATOM   7043  N  N     . ASP A  1  909  ? 164.141 72.323  12.409  1.00 109.42 ? 909  ASP A N     1 
ATOM   7044  C  CA    . ASP A  1  909  ? 165.161 72.002  13.407  1.00 111.14 ? 909  ASP A CA    1 
ATOM   7045  C  C     . ASP A  1  909  ? 165.962 70.735  13.014  1.00 114.71 ? 909  ASP A C     1 
ATOM   7046  O  O     . ASP A  1  909  ? 165.359 69.781  12.502  1.00 113.31 ? 909  ASP A O     1 
ATOM   7047  C  CB    . ASP A  1  909  ? 164.513 71.824  14.787  1.00 113.44 ? 909  ASP A CB    1 
ATOM   7048  C  CG    . ASP A  1  909  ? 165.485 72.040  15.926  1.00 128.99 ? 909  ASP A CG    1 
ATOM   7049  O  OD1   . ASP A  1  909  ? 165.670 73.209  16.332  1.00 139.23 ? 909  ASP A OD1   1 
ATOM   7050  O  OD2   . ASP A  1  909  ? 166.107 71.051  16.370  1.00 129.44 ? 909  ASP A OD2   1 
ATOM   7051  N  N     . PRO A  1  910  ? 167.306 70.697  13.222  1.00 111.43 ? 910  PRO A N     1 
ATOM   7052  C  CA    . PRO A  1  910  ? 168.083 69.497  12.845  1.00 110.96 ? 910  PRO A CA    1 
ATOM   7053  C  C     . PRO A  1  910  ? 167.691 68.212  13.586  1.00 114.18 ? 910  PRO A C     1 
ATOM   7054  O  O     . PRO A  1  910  ? 168.304 67.157  13.368  1.00 114.01 ? 910  PRO A O     1 
ATOM   7055  C  CB    . PRO A  1  910  ? 169.526 69.910  13.136  1.00 114.45 ? 910  PRO A CB    1 
ATOM   7056  C  CG    . PRO A  1  910  ? 169.404 70.954  14.180  1.00 119.93 ? 910  PRO A CG    1 
ATOM   7057  C  CD    . PRO A  1  910  ? 168.186 71.731  13.794  1.00 114.49 ? 910  PRO A CD    1 
ATOM   7058  N  N     . SER A  1  911  ? 166.665 68.318  14.460  1.00 109.57 ? 911  SER A N     1 
ATOM   7059  C  CA    . SER A  1  911  ? 166.053 67.244  15.238  1.00 108.37 ? 911  SER A CA    1 
ATOM   7060  C  C     . SER A  1  911  ? 164.907 66.581  14.445  1.00 109.82 ? 911  SER A C     1 
ATOM   7061  O  O     . SER A  1  911  ? 164.589 65.420  14.701  1.00 108.62 ? 911  SER A O     1 
ATOM   7062  C  CB    . SER A  1  911  ? 165.519 67.790  16.560  1.00 111.89 ? 911  SER A CB    1 
ATOM   7063  O  OG    . SER A  1  911  ? 164.555 68.810  16.359  1.00 117.96 ? 911  SER A OG    1 
ATOM   7064  N  N     . LEU A  1  912  ? 164.288 67.333  13.502  1.00 104.86 ? 912  LEU A N     1 
ATOM   7065  C  CA    . LEU A  1  912  ? 163.189 66.898  12.635  1.00 102.25 ? 912  LEU A CA    1 
ATOM   7066  C  C     . LEU A  1  912  ? 163.690 66.024  11.478  1.00 106.32 ? 912  LEU A C     1 
ATOM   7067  O  O     . LEU A  1  912  ? 162.975 65.115  11.050  1.00 105.27 ? 912  LEU A O     1 
ATOM   7068  C  CB    . LEU A  1  912  ? 162.418 68.111  12.071  1.00 101.56 ? 912  LEU A CB    1 
ATOM   7069  C  CG    . LEU A  1  912  ? 161.844 69.131  13.062  1.00 106.10 ? 912  LEU A CG    1 
ATOM   7070  C  CD1   . LEU A  1  912  ? 161.337 70.342  12.344  1.00 105.71 ? 912  LEU A CD1   1 
ATOM   7071  C  CD2   . LEU A  1  912  ? 160.711 68.549  13.875  1.00 107.67 ? 912  LEU A CD2   1 
ATOM   7072  N  N     . LEU A  1  913  ? 164.901 66.324  10.959  1.00 103.91 ? 913  LEU A N     1 
ATOM   7073  C  CA    . LEU A  1  913  ? 165.564 65.608  9.860   1.00 103.55 ? 913  LEU A CA    1 
ATOM   7074  C  C     . LEU A  1  913  ? 167.090 65.697  9.975   1.00 111.16 ? 913  LEU A C     1 
ATOM   7075  O  O     . LEU A  1  913  ? 167.611 66.695  10.489  1.00 113.07 ? 913  LEU A O     1 
ATOM   7076  C  CB    . LEU A  1  913  ? 165.069 66.079  8.467   1.00 102.40 ? 913  LEU A CB    1 
ATOM   7077  C  CG    . LEU A  1  913  ? 165.594 67.401  7.866   1.00 107.24 ? 913  LEU A CG    1 
ATOM   7078  C  CD1   . LEU A  1  913  ? 165.176 67.525  6.418   1.00 106.20 ? 913  LEU A CD1   1 
ATOM   7079  C  CD2   . LEU A  1  913  ? 165.093 68.618  8.632   1.00 109.08 ? 913  LEU A CD2   1 
ATOM   7080  N  N     . GLU A  1  914  ? 167.797 64.651  9.496   1.00 107.22 ? 914  GLU A N     1 
ATOM   7081  C  CA    . GLU A  1  914  ? 169.260 64.527  9.529   1.00 108.14 ? 914  GLU A CA    1 
ATOM   7082  C  C     . GLU A  1  914  ? 169.982 65.676  8.826   1.00 114.05 ? 914  GLU A C     1 
ATOM   7083  O  O     . GLU A  1  914  ? 170.952 66.216  9.366   1.00 115.91 ? 914  GLU A O     1 
ATOM   7084  C  CB    . GLU A  1  914  ? 169.689 63.180  8.938   1.00 108.83 ? 914  GLU A CB    1 
ATOM   7085  C  CG    . GLU A  1  914  ? 169.369 62.002  9.845   1.00 118.12 ? 914  GLU A CG    1 
ATOM   7086  C  CD    . GLU A  1  914  ? 169.056 60.673  9.180   1.00 130.43 ? 914  GLU A CD    1 
ATOM   7087  O  OE1   . GLU A  1  914  ? 169.527 60.436  8.042   1.00 107.69 ? 914  GLU A OE1   1 
ATOM   7088  O  OE2   . GLU A  1  914  ? 168.360 59.853  9.822   1.00 125.25 ? 914  GLU A OE2   1 
ATOM   7089  N  N     . SER A  1  915  ? 169.474 66.080  7.647   1.00 109.41 ? 915  SER A N     1 
ATOM   7090  C  CA    . SER A  1  915  ? 170.032 67.161  6.831   1.00 109.46 ? 915  SER A CA    1 
ATOM   7091  C  C     . SER A  1  915  ? 169.739 68.576  7.356   1.00 114.31 ? 915  SER A C     1 
ATOM   7092  O  O     . SER A  1  915  ? 170.245 69.542  6.788   1.00 115.59 ? 915  SER A O     1 
ATOM   7093  C  CB    . SER A  1  915  ? 169.581 67.021  5.380   1.00 110.97 ? 915  SER A CB    1 
ATOM   7094  O  OG    . SER A  1  915  ? 168.169 66.955  5.268   1.00 118.53 ? 915  SER A OG    1 
ATOM   7095  N  N     . GLY A  1  916  ? 168.971 68.680  8.443   1.00 109.94 ? 916  GLY A N     1 
ATOM   7096  C  CA    . GLY A  1  916  ? 168.581 69.940  9.079   1.00 109.80 ? 916  GLY A CA    1 
ATOM   7097  C  C     . GLY A  1  916  ? 169.669 70.979  9.273   1.00 113.60 ? 916  GLY A C     1 
ATOM   7098  O  O     . GLY A  1  916  ? 169.414 72.177  9.112   1.00 113.66 ? 916  GLY A O     1 
ATOM   7099  N  N     . SER A  1  917  ? 170.887 70.531  9.621   1.00 110.04 ? 917  SER A N     1 
ATOM   7100  C  CA    . SER A  1  917  ? 172.028 71.416  9.823   1.00 111.27 ? 917  SER A CA    1 
ATOM   7101  C  C     . SER A  1  917  ? 172.591 71.918  8.496   1.00 115.03 ? 917  SER A C     1 
ATOM   7102  O  O     . SER A  1  917  ? 172.701 73.132  8.324   1.00 116.59 ? 917  SER A O     1 
ATOM   7103  C  CB    . SER A  1  917  ? 173.107 70.744  10.668  1.00 116.30 ? 917  SER A CB    1 
ATOM   7104  O  OG    . SER A  1  917  ? 173.430 69.451  10.182  1.00 126.47 ? 917  SER A OG    1 
ATOM   7105  N  N     . GLU A  1  918  ? 172.907 71.008  7.540   1.00 109.39 ? 918  GLU A N     1 
ATOM   7106  C  CA    . GLU A  1  918  ? 173.469 71.381  6.229   1.00 108.82 ? 918  GLU A CA    1 
ATOM   7107  C  C     . GLU A  1  918  ? 172.450 72.053  5.294   1.00 109.85 ? 918  GLU A C     1 
ATOM   7108  O  O     . GLU A  1  918  ? 172.838 72.587  4.251   1.00 109.70 ? 918  GLU A O     1 
ATOM   7109  C  CB    . GLU A  1  918  ? 174.185 70.202  5.526   1.00 109.97 ? 918  GLU A CB    1 
ATOM   7110  C  CG    . GLU A  1  918  ? 173.388 68.913  5.398   1.00 120.62 ? 918  GLU A CG    1 
ATOM   7111  C  CD    . GLU A  1  918  ? 173.760 67.818  6.384   1.00 149.89 ? 918  GLU A CD    1 
ATOM   7112  O  OE1   . GLU A  1  918  ? 173.617 68.037  7.610   1.00 147.76 ? 918  GLU A OE1   1 
ATOM   7113  O  OE2   . GLU A  1  918  ? 174.181 66.731  5.927   1.00 146.31 ? 918  GLU A OE2   1 
ATOM   7114  N  N     . ILE A  1  919  ? 171.172 72.073  5.702   1.00 103.95 ? 919  ILE A N     1 
ATOM   7115  C  CA    . ILE A  1  919  ? 170.056 72.645  4.955   1.00 102.35 ? 919  ILE A CA    1 
ATOM   7116  C  C     . ILE A  1  919  ? 169.867 74.164  5.228   1.00 105.28 ? 919  ILE A C     1 
ATOM   7117  O  O     . ILE A  1  919  ? 169.255 74.857  4.408   1.00 103.61 ? 919  ILE A O     1 
ATOM   7118  C  CB    . ILE A  1  919  ? 168.783 71.784  5.225   1.00 103.91 ? 919  ILE A CB    1 
ATOM   7119  C  CG1   . ILE A  1  919  ? 168.074 71.419  3.935   1.00 103.27 ? 919  ILE A CG1   1 
ATOM   7120  C  CG2   . ILE A  1  919  ? 167.815 72.362  6.252   1.00 104.78 ? 919  ILE A CG2   1 
ATOM   7121  C  CD1   . ILE A  1  919  ? 168.246 69.984  3.584   1.00 115.70 ? 919  ILE A CD1   1 
ATOM   7122  N  N     . LEU A  1  920  ? 170.388 74.666  6.370   1.00 102.69 ? 920  LEU A N     1 
ATOM   7123  C  CA    . LEU A  1  920  ? 170.304 76.076  6.768   1.00 103.54 ? 920  LEU A CA    1 
ATOM   7124  C  C     . LEU A  1  920  ? 170.984 76.944  5.715   1.00 108.43 ? 920  LEU A C     1 
ATOM   7125  O  O     . LEU A  1  920  ? 172.128 76.692  5.340   1.00 109.16 ? 920  LEU A O     1 
ATOM   7126  C  CB    . LEU A  1  920  ? 171.028 76.292  8.118   1.00 104.98 ? 920  LEU A CB    1 
ATOM   7127  C  CG    . LEU A  1  920  ? 170.388 77.175  9.218   1.00 109.30 ? 920  LEU A CG    1 
ATOM   7128  C  CD1   . LEU A  1  920  ? 171.437 77.605  10.231  1.00 110.73 ? 920  LEU A CD1   1 
ATOM   7129  C  CD2   . LEU A  1  920  ? 169.732 78.419  8.669   1.00 111.21 ? 920  LEU A CD2   1 
ATOM   7130  N  N     . GLY A  1  921  ? 170.278 77.949  5.243   1.00 104.69 ? 921  GLY A N     1 
ATOM   7131  C  CA    . GLY A  1  921  ? 170.821 78.875  4.261   1.00 105.67 ? 921  GLY A CA    1 
ATOM   7132  C  C     . GLY A  1  921  ? 170.904 78.354  2.840   1.00 109.00 ? 921  GLY A C     1 
ATOM   7133  O  O     . GLY A  1  921  ? 171.507 79.022  1.995   1.00 109.69 ? 921  GLY A O     1 
ATOM   7134  N  N     . ASP A  1  922  ? 170.284 77.184  2.541   1.00 103.51 ? 922  ASP A N     1 
ATOM   7135  C  CA    . ASP A  1  922  ? 170.308 76.644  1.178   1.00 102.21 ? 922  ASP A CA    1 
ATOM   7136  C  C     . ASP A  1  922  ? 169.317 77.410  0.321   1.00 104.38 ? 922  ASP A C     1 
ATOM   7137  O  O     . ASP A  1  922  ? 168.117 77.361  0.590   1.00 102.57 ? 922  ASP A O     1 
ATOM   7138  C  CB    . ASP A  1  922  ? 170.022 75.133  1.138   1.00 102.46 ? 922  ASP A CB    1 
ATOM   7139  C  CG    . ASP A  1  922  ? 170.344 74.510  -0.209  1.00 112.32 ? 922  ASP A CG    1 
ATOM   7140  O  OD1   . ASP A  1  922  ? 169.614 74.790  -1.182  1.00 111.65 ? 922  ASP A OD1   1 
ATOM   7141  O  OD2   . ASP A  1  922  ? 171.329 73.740  -0.290  1.00 119.54 ? 922  ASP A OD2   1 
ATOM   7142  N  N     . LEU A  1  923  ? 169.820 78.122  -0.702  1.00 100.74 ? 923  LEU A N     1 
ATOM   7143  C  CA    . LEU A  1  923  ? 168.973 78.925  -1.586  1.00 99.65  ? 923  LEU A CA    1 
ATOM   7144  C  C     . LEU A  1  923  ? 168.178 78.077  -2.576  1.00 102.50 ? 923  LEU A C     1 
ATOM   7145  O  O     . LEU A  1  923  ? 166.971 78.278  -2.701  1.00 101.24 ? 923  LEU A O     1 
ATOM   7146  C  CB    . LEU A  1  923  ? 169.781 80.014  -2.309  1.00 100.88 ? 923  LEU A CB    1 
ATOM   7147  C  CG    . LEU A  1  923  ? 170.690 80.885  -1.436  1.00 106.37 ? 923  LEU A CG    1 
ATOM   7148  C  CD1   . LEU A  1  923  ? 171.782 81.504  -2.254  1.00 108.06 ? 923  LEU A CD1   1 
ATOM   7149  C  CD2   . LEU A  1  923  ? 169.911 81.950  -0.700  1.00 107.51 ? 923  LEU A CD2   1 
ATOM   7150  N  N     . LYS A  1  924  ? 168.848 77.115  -3.248  1.00 99.17  ? 924  LYS A N     1 
ATOM   7151  C  CA    . LYS A  1  924  ? 168.275 76.187  -4.235  1.00 97.47  ? 924  LYS A CA    1 
ATOM   7152  C  C     . LYS A  1  924  ? 167.063 75.426  -3.685  1.00 100.39 ? 924  LYS A C     1 
ATOM   7153  O  O     . LYS A  1  924  ? 166.059 75.292  -4.395  1.00 99.64  ? 924  LYS A O     1 
ATOM   7154  C  CB    . LYS A  1  924  ? 169.338 75.200  -4.736  1.00 100.00 ? 924  LYS A CB    1 
ATOM   7155  C  CG    . LYS A  1  924  ? 170.559 75.853  -5.388  1.00 114.28 ? 924  LYS A CG    1 
ATOM   7156  C  CD    . LYS A  1  924  ? 171.830 74.993  -5.255  1.00 126.86 ? 924  LYS A CD    1 
ATOM   7157  C  CE    . LYS A  1  924  ? 172.600 75.215  -3.966  1.00 139.30 ? 924  LYS A CE    1 
ATOM   7158  N  NZ    . LYS A  1  924  ? 173.751 74.277  -3.835  1.00 148.70 ? 924  LYS A NZ    1 
ATOM   7159  N  N     . LEU A  1  925  ? 167.150 74.953  -2.418  1.00 96.12  ? 925  LEU A N     1 
ATOM   7160  C  CA    . LEU A  1  925  ? 166.076 74.237  -1.712  1.00 94.03  ? 925  LEU A CA    1 
ATOM   7161  C  C     . LEU A  1  925  ? 164.998 75.186  -1.226  1.00 97.20  ? 925  LEU A C     1 
ATOM   7162  O  O     . LEU A  1  925  ? 163.830 74.822  -1.235  1.00 95.04  ? 925  LEU A O     1 
ATOM   7163  C  CB    . LEU A  1  925  ? 166.635 73.442  -0.538  1.00 94.33  ? 925  LEU A CB    1 
ATOM   7164  C  CG    . LEU A  1  925  ? 167.012 72.000  -0.832  1.00 98.56  ? 925  LEU A CG    1 
ATOM   7165  C  CD1   . LEU A  1  925  ? 168.392 71.876  -1.483  1.00 99.86  ? 925  LEU A CD1   1 
ATOM   7166  C  CD2   . LEU A  1  925  ? 167.046 71.231  0.414   1.00 101.54 ? 925  LEU A CD2   1 
ATOM   7167  N  N     . GLN A  1  926  ? 165.376 76.423  -0.839  1.00 96.05  ? 926  GLN A N     1 
ATOM   7168  C  CA    . GLN A  1  926  ? 164.420 77.449  -0.412  1.00 95.61  ? 926  GLN A CA    1 
ATOM   7169  C  C     . GLN A  1  926  ? 163.544 77.874  -1.562  1.00 99.61  ? 926  GLN A C     1 
ATOM   7170  O  O     . GLN A  1  926  ? 162.444 78.363  -1.331  1.00 98.67  ? 926  GLN A O     1 
ATOM   7171  C  CB    . GLN A  1  926  ? 165.101 78.668  0.214   1.00 98.27  ? 926  GLN A CB    1 
ATOM   7172  C  CG    . GLN A  1  926  ? 164.847 78.786  1.707   1.00 102.81 ? 926  GLN A CG    1 
ATOM   7173  C  CD    . GLN A  1  926  ? 163.388 78.782  2.058   1.00 111.67 ? 926  GLN A CD    1 
ATOM   7174  O  OE1   . GLN A  1  926  ? 162.645 79.705  1.739   1.00 105.52 ? 926  GLN A OE1   1 
ATOM   7175  N  NE2   . GLN A  1  926  ? 162.943 77.711  2.683   1.00 103.71 ? 926  GLN A NE2   1 
ATOM   7176  N  N     . VAL A  1  927  ? 164.023 77.661  -2.802  1.00 96.99  ? 927  VAL A N     1 
ATOM   7177  C  CA    . VAL A  1  927  ? 163.274 77.923  -4.022  1.00 96.53  ? 927  VAL A CA    1 
ATOM   7178  C  C     . VAL A  1  927  ? 162.124 76.903  -4.086  1.00 100.47 ? 927  VAL A C     1 
ATOM   7179  O  O     . VAL A  1  927  ? 160.990 77.305  -4.356  1.00 100.06 ? 927  VAL A O     1 
ATOM   7180  C  CB    . VAL A  1  927  ? 164.195 77.913  -5.263  1.00 100.58 ? 927  VAL A CB    1 
ATOM   7181  C  CG1   . VAL A  1  927  ? 163.405 77.750  -6.556  1.00 99.38  ? 927  VAL A CG1   1 
ATOM   7182  C  CG2   . VAL A  1  927  ? 165.036 79.179  -5.309  1.00 102.33 ? 927  VAL A CG2   1 
ATOM   7183  N  N     . LEU A  1  928  ? 162.405 75.616  -3.762  1.00 96.47  ? 928  LEU A N     1 
ATOM   7184  C  CA    . LEU A  1  928  ? 161.386 74.573  -3.734  1.00 95.59  ? 928  LEU A CA    1 
ATOM   7185  C  C     . LEU A  1  928  ? 160.366 74.846  -2.628  1.00 99.14  ? 928  LEU A C     1 
ATOM   7186  O  O     . LEU A  1  928  ? 159.159 74.737  -2.880  1.00 98.74  ? 928  LEU A O     1 
ATOM   7187  C  CB    . LEU A  1  928  ? 161.986 73.166  -3.544  1.00 96.04  ? 928  LEU A CB    1 
ATOM   7188  C  CG    . LEU A  1  928  ? 162.961 72.628  -4.605  1.00 102.55 ? 928  LEU A CG    1 
ATOM   7189  C  CD1   . LEU A  1  928  ? 163.605 71.346  -4.129  1.00 102.13 ? 928  LEU A CD1   1 
ATOM   7190  C  CD2   . LEU A  1  928  ? 162.267 72.368  -5.950  1.00 106.55 ? 928  LEU A CD2   1 
ATOM   7191  N  N     . LEU A  1  929  ? 160.838 75.216  -1.414  1.00 94.80  ? 929  LEU A N     1 
ATOM   7192  C  CA    . LEU A  1  929  ? 159.951 75.514  -0.283  1.00 93.76  ? 929  LEU A CA    1 
ATOM   7193  C  C     . LEU A  1  929  ? 159.092 76.758  -0.497  1.00 97.62  ? 929  LEU A C     1 
ATOM   7194  O  O     . LEU A  1  929  ? 157.996 76.849  0.068   1.00 96.19  ? 929  LEU A O     1 
ATOM   7195  C  CB    . LEU A  1  929  ? 160.734 75.646  1.018   1.00 94.62  ? 929  LEU A CB    1 
ATOM   7196  C  CG    . LEU A  1  929  ? 161.071 74.392  1.816   1.00 98.29  ? 929  LEU A CG    1 
ATOM   7197  C  CD1   . LEU A  1  929  ? 160.273 73.171  1.382   1.00 96.54  ? 929  LEU A CD1   1 
ATOM   7198  C  CD2   . LEU A  1  929  ? 162.544 74.156  1.835   1.00 101.42 ? 929  LEU A CD2   1 
ATOM   7199  N  N     . ASP A  1  930  ? 159.602 77.719  -1.293  1.00 95.36  ? 930  ASP A N     1 
ATOM   7200  C  CA    . ASP A  1  930  ? 158.887 78.938  -1.644  1.00 95.83  ? 930  ASP A CA    1 
ATOM   7201  C  C     . ASP A  1  930  ? 157.753 78.590  -2.607  1.00 99.55  ? 930  ASP A C     1 
ATOM   7202  O  O     . ASP A  1  930  ? 156.647 79.102  -2.440  1.00 98.33  ? 930  ASP A O     1 
ATOM   7203  C  CB    . ASP A  1  930  ? 159.829 80.003  -2.243  1.00 99.07  ? 930  ASP A CB    1 
ATOM   7204  C  CG    . ASP A  1  930  ? 160.616 80.818  -1.224  1.00 109.32 ? 930  ASP A CG    1 
ATOM   7205  O  OD1   . ASP A  1  930  ? 160.281 80.749  -0.017  1.00 109.61 ? 930  ASP A OD1   1 
ATOM   7206  O  OD2   . ASP A  1  930  ? 161.577 81.518  -1.635  1.00 115.16 ? 930  ASP A OD2   1 
ATOM   7207  N  N     . GLU A  1  931  ? 158.010 77.678  -3.575  1.00 96.46  ? 931  GLU A N     1 
ATOM   7208  C  CA    . GLU A  1  931  ? 156.998 77.219  -4.526  1.00 95.74  ? 931  GLU A CA    1 
ATOM   7209  C  C     . GLU A  1  931  ? 155.888 76.555  -3.730  1.00 97.89  ? 931  GLU A C     1 
ATOM   7210  O  O     . GLU A  1  931  ? 154.718 76.867  -3.965  1.00 96.47  ? 931  GLU A O     1 
ATOM   7211  C  CB    . GLU A  1  931  ? 157.577 76.195  -5.511  1.00 97.47  ? 931  GLU A CB    1 
ATOM   7212  C  CG    . GLU A  1  931  ? 158.472 76.748  -6.612  1.00 118.91 ? 931  GLU A CG    1 
ATOM   7213  C  CD    . GLU A  1  931  ? 159.303 75.694  -7.334  1.00 156.46 ? 931  GLU A CD    1 
ATOM   7214  O  OE1   . GLU A  1  931  ? 158.765 74.603  -7.644  1.00 150.69 ? 931  GLU A OE1   1 
ATOM   7215  O  OE2   . GLU A  1  931  ? 160.506 75.956  -7.570  1.00 160.13 ? 931  GLU A OE2   1 
ATOM   7216  N  N     . GLU A  1  932  ? 156.274 75.671  -2.758  1.00 94.20  ? 932  GLU A N     1 
ATOM   7217  C  CA    . GLU A  1  932  ? 155.389 74.906  -1.864  1.00 92.95  ? 932  GLU A CA    1 
ATOM   7218  C  C     . GLU A  1  932  ? 154.469 75.830  -1.090  1.00 96.21  ? 932  GLU A C     1 
ATOM   7219  O  O     . GLU A  1  932  ? 153.252 75.624  -1.096  1.00 94.32  ? 932  GLU A O     1 
ATOM   7220  C  CB    . GLU A  1  932  ? 156.208 74.035  -0.882  1.00 94.69  ? 932  GLU A CB    1 
ATOM   7221  C  CG    . GLU A  1  932  ? 155.349 73.231  0.086   1.00 102.71 ? 932  GLU A CG    1 
ATOM   7222  C  CD    . GLU A  1  932  ? 156.046 72.671  1.310   1.00 115.21 ? 932  GLU A CD    1 
ATOM   7223  O  OE1   . GLU A  1  932  ? 156.331 73.444  2.254   1.00 108.04 ? 932  GLU A OE1   1 
ATOM   7224  O  OE2   . GLU A  1  932  ? 156.226 71.435  1.354   1.00 96.05  ? 932  GLU A OE2   1 
ATOM   7225  N  N     . TYR A  1  933  ? 155.055 76.844  -0.426  1.00 94.27  ? 933  TYR A N     1 
ATOM   7226  C  CA    . TYR A  1  933  ? 154.293 77.814  0.341   1.00 94.46  ? 933  TYR A CA    1 
ATOM   7227  C  C     . TYR A  1  933  ? 153.305 78.553  -0.557  1.00 96.39  ? 933  TYR A C     1 
ATOM   7228  O  O     . TYR A  1  933  ? 152.105 78.477  -0.302  1.00 94.37  ? 933  TYR A O     1 
ATOM   7229  C  CB    . TYR A  1  933  ? 155.201 78.768  1.152   1.00 97.91  ? 933  TYR A CB    1 
ATOM   7230  C  CG    . TYR A  1  933  ? 154.459 79.420  2.300   1.00 101.06 ? 933  TYR A CG    1 
ATOM   7231  C  CD1   . TYR A  1  933  ? 153.995 78.664  3.375   1.00 103.48 ? 933  TYR A CD1   1 
ATOM   7232  C  CD2   . TYR A  1  933  ? 154.147 80.775  2.276   1.00 102.31 ? 933  TYR A CD2   1 
ATOM   7233  C  CE1   . TYR A  1  933  ? 153.239 79.242  4.395   1.00 105.63 ? 933  TYR A CE1   1 
ATOM   7234  C  CE2   . TYR A  1  933  ? 153.411 81.369  3.304   1.00 103.26 ? 933  TYR A CE2   1 
ATOM   7235  C  CZ    . TYR A  1  933  ? 152.966 80.599  4.366   1.00 110.43 ? 933  TYR A CZ    1 
ATOM   7236  O  OH    . TYR A  1  933  ? 152.257 81.162  5.399   1.00 110.99 ? 933  TYR A OH    1 
ATOM   7237  N  N     . LYS A  1  934  ? 153.795 79.154  -1.669  1.00 93.51  ? 934  LYS A N     1 
ATOM   7238  C  CA    . LYS A  1  934  ? 152.980 79.886  -2.650  1.00 93.15  ? 934  LYS A CA    1 
ATOM   7239  C  C     . LYS A  1  934  ? 151.783 79.057  -3.131  1.00 95.67  ? 934  LYS A C     1 
ATOM   7240  O  O     . LYS A  1  934  ? 150.662 79.573  -3.156  1.00 96.01  ? 934  LYS A O     1 
ATOM   7241  C  CB    . LYS A  1  934  ? 153.840 80.400  -3.826  1.00 96.68  ? 934  LYS A CB    1 
ATOM   7242  C  CG    . LYS A  1  934  ? 154.345 81.851  -3.688  1.00 118.26 ? 934  LYS A CG    1 
ATOM   7243  C  CD    . LYS A  1  934  ? 155.635 82.029  -2.844  1.00 132.08 ? 934  LYS A CD    1 
ATOM   7244  C  CE    . LYS A  1  934  ? 156.159 83.456  -2.841  1.00 147.59 ? 934  LYS A CE    1 
ATOM   7245  N  NZ    . LYS A  1  934  ? 157.469 83.590  -2.137  1.00 154.83 ? 934  LYS A NZ    1 
ATOM   7246  N  N     . GLN A  1  935  ? 152.012 77.753  -3.424  1.00 89.55  ? 935  GLN A N     1 
ATOM   7247  C  CA    . GLN A  1  935  ? 150.978 76.810  -3.849  1.00 86.78  ? 935  GLN A CA    1 
ATOM   7248  C  C     . GLN A  1  935  ? 149.957 76.569  -2.737  1.00 87.99  ? 935  GLN A C     1 
ATOM   7249  O  O     . GLN A  1  935  ? 148.764 76.549  -3.027  1.00 86.54  ? 935  GLN A O     1 
ATOM   7250  C  CB    . GLN A  1  935  ? 151.600 75.490  -4.344  1.00 87.33  ? 935  GLN A CB    1 
ATOM   7251  C  CG    . GLN A  1  935  ? 150.620 74.489  -4.969  1.00 98.07  ? 935  GLN A CG    1 
ATOM   7252  C  CD    . GLN A  1  935  ? 149.797 75.048  -6.103  1.00 117.98 ? 935  GLN A CD    1 
ATOM   7253  O  OE1   . GLN A  1  935  ? 150.308 75.358  -7.182  1.00 115.40 ? 935  GLN A OE1   1 
ATOM   7254  N  NE2   . GLN A  1  935  ? 148.495 75.177  -5.881  1.00 109.66 ? 935  GLN A NE2   1 
ATOM   7255  N  N     . LEU A  1  936  ? 150.410 76.410  -1.473  1.00 83.70  ? 936  LEU A N     1 
ATOM   7256  C  CA    . LEU A  1  936  ? 149.502 76.226  -0.330  1.00 82.25  ? 936  LEU A CA    1 
ATOM   7257  C  C     . LEU A  1  936  ? 148.666 77.499  -0.094  1.00 86.32  ? 936  LEU A C     1 
ATOM   7258  O  O     . LEU A  1  936  ? 147.482 77.410  0.259   1.00 85.41  ? 936  LEU A O     1 
ATOM   7259  C  CB    . LEU A  1  936  ? 150.258 75.848  0.952   1.00 82.48  ? 936  LEU A CB    1 
ATOM   7260  C  CG    . LEU A  1  936  ? 150.896 74.468  1.007   1.00 86.79  ? 936  LEU A CG    1 
ATOM   7261  C  CD1   . LEU A  1  936  ? 151.960 74.432  2.050   1.00 88.20  ? 936  LEU A CD1   1 
ATOM   7262  C  CD2   . LEU A  1  936  ? 149.881 73.390  1.315   1.00 88.80  ? 936  LEU A CD2   1 
ATOM   7263  N  N     . VAL A  1  937  ? 149.270 78.681  -0.327  1.00 83.37  ? 937  VAL A N     1 
ATOM   7264  C  CA    . VAL A  1  937  ? 148.555 79.950  -0.157  1.00 83.25  ? 937  VAL A CA    1 
ATOM   7265  C  C     . VAL A  1  937  ? 147.467 80.061  -1.232  1.00 88.94  ? 937  VAL A C     1 
ATOM   7266  O  O     . VAL A  1  937  ? 146.350 80.496  -0.931  1.00 88.54  ? 937  VAL A O     1 
ATOM   7267  C  CB    . VAL A  1  937  ? 149.464 81.206  -0.095  1.00 86.22  ? 937  VAL A CB    1 
ATOM   7268  C  CG1   . VAL A  1  937  ? 148.681 82.388  0.448   1.00 86.18  ? 937  VAL A CG1   1 
ATOM   7269  C  CG2   . VAL A  1  937  ? 150.681 80.961  0.781   1.00 86.33  ? 937  VAL A CG2   1 
ATOM   7270  N  N     . LYS A  1  938  ? 147.799 79.610  -2.469  1.00 85.62  ? 938  LYS A N     1 
ATOM   7271  C  CA    . LYS A  1  938  ? 146.927 79.606  -3.647  1.00 84.32  ? 938  LYS A CA    1 
ATOM   7272  C  C     . LYS A  1  938  ? 145.667 78.794  -3.372  1.00 85.57  ? 938  LYS A C     1 
ATOM   7273  O  O     . LYS A  1  938  ? 144.565 79.290  -3.629  1.00 83.90  ? 938  LYS A O     1 
ATOM   7274  C  CB    . LYS A  1  938  ? 147.695 79.078  -4.885  1.00 86.52  ? 938  LYS A CB    1 
ATOM   7275  C  CG    . LYS A  1  938  ? 146.940 79.181  -6.222  1.00 95.01  ? 938  LYS A CG    1 
ATOM   7276  C  CD    . LYS A  1  938  ? 147.821 78.778  -7.419  1.00 102.25 ? 938  LYS A CD    1 
ATOM   7277  C  CE    . LYS A  1  938  ? 147.073 78.798  -8.736  1.00 105.53 ? 938  LYS A CE    1 
ATOM   7278  N  NZ    . LYS A  1  938  ? 147.908 78.289  -9.857  1.00 115.93 ? 938  LYS A NZ    1 
ATOM   7279  N  N     . ASP A  1  939  ? 145.848 77.566  -2.811  1.00 81.74  ? 939  ASP A N     1 
ATOM   7280  C  CA    . ASP A  1  939  ? 144.792 76.617  -2.460  1.00 80.59  ? 939  ASP A CA    1 
ATOM   7281  C  C     . ASP A  1  939  ? 143.856 77.223  -1.447  1.00 84.29  ? 939  ASP A C     1 
ATOM   7282  O  O     . ASP A  1  939  ? 142.647 77.169  -1.646  1.00 82.74  ? 939  ASP A O     1 
ATOM   7283  C  CB    . ASP A  1  939  ? 145.378 75.326  -1.879  1.00 82.53  ? 939  ASP A CB    1 
ATOM   7284  C  CG    . ASP A  1  939  ? 146.312 74.557  -2.778  1.00 95.91  ? 939  ASP A CG    1 
ATOM   7285  O  OD1   . ASP A  1  939  ? 146.415 74.919  -3.986  1.00 95.86  ? 939  ASP A OD1   1 
ATOM   7286  O  OD2   . ASP A  1  939  ? 146.947 73.586  -2.280  1.00 103.18 ? 939  ASP A OD2   1 
ATOM   7287  N  N     . ARG A  1  940  ? 144.416 77.815  -0.369  1.00 81.90  ? 940  ARG A N     1 
ATOM   7288  C  CA    . ARG A  1  940  ? 143.663 78.492  0.681   1.00 82.20  ? 940  ARG A CA    1 
ATOM   7289  C  C     . ARG A  1  940  ? 142.734 79.537  0.076   1.00 86.91  ? 940  ARG A C     1 
ATOM   7290  O  O     . ARG A  1  940  ? 141.577 79.585  0.472   1.00 85.82  ? 940  ARG A O     1 
ATOM   7291  C  CB    . ARG A  1  940  ? 144.627 79.161  1.656   1.00 85.47  ? 940  ARG A CB    1 
ATOM   7292  C  CG    . ARG A  1  940  ? 143.982 79.747  2.900   1.00 96.98  ? 940  ARG A CG    1 
ATOM   7293  C  CD    . ARG A  1  940  ? 145.056 79.956  3.940   1.00 105.03 ? 940  ARG A CD    1 
ATOM   7294  N  NE    . ARG A  1  940  ? 144.519 80.013  5.294   1.00 104.78 ? 940  ARG A NE    1 
ATOM   7295  C  CZ    . ARG A  1  940  ? 144.263 81.143  5.934   1.00 113.71 ? 940  ARG A CZ    1 
ATOM   7296  N  NH1   . ARG A  1  940  ? 144.485 82.310  5.342   1.00 106.05 ? 940  ARG A NH1   1 
ATOM   7297  N  NH2   . ARG A  1  940  ? 143.792 81.119  7.170   1.00 95.01  ? 940  ARG A NH2   1 
ATOM   7298  N  N     . LYS A  1  941  ? 143.225 80.357  -0.893  1.00 85.33  ? 941  LYS A N     1 
ATOM   7299  C  CA    . LYS A  1  941  ? 142.405 81.381  -1.543  1.00 86.18  ? 941  LYS A CA    1 
ATOM   7300  C  C     . LYS A  1  941  ? 141.306 80.743  -2.366  1.00 90.87  ? 941  LYS A C     1 
ATOM   7301  O  O     . LYS A  1  941  ? 140.164 81.197  -2.307  1.00 92.14  ? 941  LYS A O     1 
ATOM   7302  C  CB    . LYS A  1  941  ? 143.238 82.369  -2.381  1.00 90.32  ? 941  LYS A CB    1 
ATOM   7303  C  CG    . LYS A  1  941  ? 144.366 83.099  -1.610  1.00 122.61 ? 941  LYS A CG    1 
ATOM   7304  C  CD    . LYS A  1  941  ? 143.968 83.740  -0.238  1.00 138.05 ? 941  LYS A CD    1 
ATOM   7305  C  CE    . LYS A  1  941  ? 144.681 83.116  0.956   1.00 145.76 ? 941  LYS A CE    1 
ATOM   7306  N  NZ    . LYS A  1  941  ? 144.281 83.741  2.253   1.00 151.26 ? 941  LYS A NZ    1 
ATOM   7307  N  N     . PHE A  1  942  ? 141.629 79.641  -3.060  1.00 85.14  ? 942  PHE A N     1 
ATOM   7308  C  CA    . PHE A  1  942  ? 140.695 78.910  -3.906  1.00 82.84  ? 942  PHE A CA    1 
ATOM   7309  C  C     . PHE A  1  942  ? 139.594 78.229  -3.112  1.00 86.15  ? 942  PHE A C     1 
ATOM   7310  O  O     . PHE A  1  942  ? 138.437 78.331  -3.505  1.00 86.58  ? 942  PHE A O     1 
ATOM   7311  C  CB    . PHE A  1  942  ? 141.458 77.912  -4.783  1.00 83.87  ? 942  PHE A CB    1 
ATOM   7312  C  CG    . PHE A  1  942  ? 140.611 76.931  -5.550  1.00 84.16  ? 942  PHE A CG    1 
ATOM   7313  C  CD1   . PHE A  1  942  ? 139.906 77.330  -6.681  1.00 86.89  ? 942  PHE A CD1   1 
ATOM   7314  C  CD2   . PHE A  1  942  ? 140.536 75.594  -5.157  1.00 85.12  ? 942  PHE A CD2   1 
ATOM   7315  C  CE1   . PHE A  1  942  ? 139.144 76.409  -7.410  1.00 86.73  ? 942  PHE A CE1   1 
ATOM   7316  C  CE2   . PHE A  1  942  ? 139.766 74.678  -5.878  1.00 86.33  ? 942  PHE A CE2   1 
ATOM   7317  C  CZ    . PHE A  1  942  ? 139.092 75.087  -7.011  1.00 84.47  ? 942  PHE A CZ    1 
ATOM   7318  N  N     . LEU A  1  943  ? 139.947 77.515  -2.018  1.00 81.25  ? 943  LEU A N     1 
ATOM   7319  C  CA    . LEU A  1  943  ? 138.998 76.791  -1.163  1.00 79.21  ? 943  LEU A CA    1 
ATOM   7320  C  C     . LEU A  1  943  ? 138.027 77.766  -0.510  1.00 85.40  ? 943  LEU A C     1 
ATOM   7321  O  O     . LEU A  1  943  ? 136.830 77.474  -0.391  1.00 84.64  ? 943  LEU A O     1 
ATOM   7322  C  CB    . LEU A  1  943  ? 139.727 75.953  -0.105  1.00 78.29  ? 943  LEU A CB    1 
ATOM   7323  C  CG    . LEU A  1  943  ? 140.688 74.867  -0.604  1.00 81.27  ? 943  LEU A CG    1 
ATOM   7324  C  CD1   . LEU A  1  943  ? 141.505 74.303  0.532   1.00 81.07  ? 943  LEU A CD1   1 
ATOM   7325  C  CD2   . LEU A  1  943  ? 139.964 73.764  -1.305  1.00 81.60  ? 943  LEU A CD2   1 
ATOM   7326  N  N     . ARG A  1  944  ? 138.537 78.963  -0.162  1.00 83.61  ? 944  ARG A N     1 
ATOM   7327  C  CA    . ARG A  1  944  ? 137.740 80.040  0.410   1.00 84.15  ? 944  ARG A CA    1 
ATOM   7328  C  C     . ARG A  1  944  ? 136.799 80.619  -0.635  1.00 89.54  ? 944  ARG A C     1 
ATOM   7329  O  O     . ARG A  1  944  ? 135.806 81.246  -0.260  1.00 90.49  ? 944  ARG A O     1 
ATOM   7330  C  CB    . ARG A  1  944  ? 138.627 81.122  1.033   1.00 84.16  ? 944  ARG A CB    1 
ATOM   7331  C  CG    . ARG A  1  944  ? 139.159 80.709  2.388   1.00 87.70  ? 944  ARG A CG    1 
ATOM   7332  C  CD    . ARG A  1  944  ? 139.730 81.860  3.163   1.00 88.84  ? 944  ARG A CD    1 
ATOM   7333  N  NE    . ARG A  1  944  ? 140.115 81.410  4.493   1.00 94.81  ? 944  ARG A NE    1 
ATOM   7334  C  CZ    . ARG A  1  944  ? 140.480 82.213  5.484   1.00 111.23 ? 944  ARG A CZ    1 
ATOM   7335  N  NH1   . ARG A  1  944  ? 140.510 83.530  5.305   1.00 96.99  ? 944  ARG A NH1   1 
ATOM   7336  N  NH2   . ARG A  1  944  ? 140.815 81.709  6.663   1.00 99.76  ? 944  ARG A NH2   1 
ATOM   7337  N  N     . GLU A  1  945  ? 137.103 80.396  -1.941  1.00 85.61  ? 945  GLU A N     1 
ATOM   7338  C  CA    . GLU A  1  945  ? 136.266 80.815  -3.066  1.00 85.26  ? 945  GLU A CA    1 
ATOM   7339  C  C     . GLU A  1  945  ? 135.197 79.757  -3.286  1.00 88.13  ? 945  GLU A C     1 
ATOM   7340  O  O     . GLU A  1  945  ? 134.025 80.114  -3.432  1.00 87.78  ? 945  GLU A O     1 
ATOM   7341  C  CB    . GLU A  1  945  ? 137.084 81.029  -4.355  1.00 87.07  ? 945  GLU A CB    1 
ATOM   7342  C  CG    . GLU A  1  945  ? 137.815 82.362  -4.402  1.00 101.04 ? 945  GLU A CG    1 
ATOM   7343  C  CD    . GLU A  1  945  ? 138.825 82.612  -5.512  1.00 121.97 ? 945  GLU A CD    1 
ATOM   7344  O  OE1   . GLU A  1  945  ? 139.096 81.698  -6.327  1.00 113.33 ? 945  GLU A OE1   1 
ATOM   7345  O  OE2   . GLU A  1  945  ? 139.363 83.742  -5.548  1.00 117.60 ? 945  GLU A OE2   1 
ATOM   7346  N  N     . VAL A  1  946  ? 135.586 78.455  -3.288  1.00 83.90  ? 946  VAL A N     1 
ATOM   7347  C  CA    . VAL A  1  946  ? 134.646 77.343  -3.495  1.00 83.03  ? 946  VAL A CA    1 
ATOM   7348  C  C     . VAL A  1  946  ? 133.589 77.311  -2.379  1.00 89.96  ? 946  VAL A C     1 
ATOM   7349  O  O     . VAL A  1  946  ? 132.398 77.454  -2.653  1.00 89.33  ? 946  VAL A O     1 
ATOM   7350  C  CB    . VAL A  1  946  ? 135.352 75.980  -3.695  1.00 85.22  ? 946  VAL A CB    1 
ATOM   7351  C  CG1   . VAL A  1  946  ? 134.345 74.842  -3.765  1.00 83.64  ? 946  VAL A CG1   1 
ATOM   7352  C  CG2   . VAL A  1  946  ? 136.201 75.994  -4.946  1.00 85.19  ? 946  VAL A CG2   1 
ATOM   7353  N  N     . PHE A  1  947  ? 134.044 77.192  -1.128  1.00 88.58  ? 947  PHE A N     1 
ATOM   7354  C  CA    . PHE A  1  947  ? 133.197 77.155  0.051   1.00 88.78  ? 947  PHE A CA    1 
ATOM   7355  C  C     . PHE A  1  947  ? 133.295 78.500  0.755   1.00 96.05  ? 947  PHE A C     1 
ATOM   7356  O  O     . PHE A  1  947  ? 134.106 78.679  1.669   1.00 96.14  ? 947  PHE A O     1 
ATOM   7357  C  CB    . PHE A  1  947  ? 133.637 76.002  0.960   1.00 90.15  ? 947  PHE A CB    1 
ATOM   7358  C  CG    . PHE A  1  947  ? 133.998 74.729  0.230   1.00 90.60  ? 947  PHE A CG    1 
ATOM   7359  C  CD1   . PHE A  1  947  ? 133.009 73.901  -0.288  1.00 92.57  ? 947  PHE A CD1   1 
ATOM   7360  C  CD2   . PHE A  1  947  ? 135.322 74.357  0.063   1.00 92.95  ? 947  PHE A CD2   1 
ATOM   7361  C  CE1   . PHE A  1  947  ? 133.336 72.708  -0.936  1.00 92.47  ? 947  PHE A CE1   1 
ATOM   7362  C  CE2   . PHE A  1  947  ? 135.650 73.172  -0.603  1.00 95.21  ? 947  PHE A CE2   1 
ATOM   7363  C  CZ    . PHE A  1  947  ? 134.652 72.354  -1.094  1.00 92.10  ? 947  PHE A CZ    1 
ATOM   7364  N  N     . VAL A  1  948  ? 132.487 79.463  0.275   1.00 95.23  ? 948  VAL A N     1 
ATOM   7365  C  CA    . VAL A  1  948  ? 132.387 80.864  0.727   1.00 97.01  ? 948  VAL A CA    1 
ATOM   7366  C  C     . VAL A  1  948  ? 132.246 81.037  2.249   1.00 103.76 ? 948  VAL A C     1 
ATOM   7367  O  O     . VAL A  1  948  ? 132.768 82.019  2.795   1.00 104.56 ? 948  VAL A O     1 
ATOM   7368  C  CB    . VAL A  1  948  ? 131.263 81.634  -0.014  1.00 100.91 ? 948  VAL A CB    1 
ATOM   7369  C  CG1   . VAL A  1  948  ? 131.705 82.024  -1.416  1.00 101.04 ? 948  VAL A CG1   1 
ATOM   7370  C  CG2   . VAL A  1  948  ? 129.956 80.839  -0.061  1.00 99.62  ? 948  VAL A CG2   1 
ATOM   7371  N  N     . ASP A  1  949  ? 131.540 80.086  2.915   1.00 101.19 ? 949  ASP A N     1 
ATOM   7372  C  CA    . ASP A  1  949  ? 131.271 80.070  4.359   1.00 102.16 ? 949  ASP A CA    1 
ATOM   7373  C  C     . ASP A  1  949  ? 132.445 79.545  5.205   1.00 106.89 ? 949  ASP A C     1 
ATOM   7374  O  O     . ASP A  1  949  ? 132.448 79.720  6.427   1.00 107.12 ? 949  ASP A O     1 
ATOM   7375  C  CB    . ASP A  1  949  ? 129.971 79.301  4.662   1.00 103.53 ? 949  ASP A CB    1 
ATOM   7376  C  CG    . ASP A  1  949  ? 130.123 77.800  4.742   1.00 121.89 ? 949  ASP A CG    1 
ATOM   7377  O  OD1   . ASP A  1  949  ? 130.558 77.187  3.734   1.00 123.65 ? 949  ASP A OD1   1 
ATOM   7378  O  OD2   . ASP A  1  949  ? 129.792 77.231  5.803   1.00 131.95 ? 949  ASP A OD2   1 
ATOM   7379  N  N     . GLY A  1  950  ? 133.421 78.919  4.550   1.00 103.24 ? 950  GLY A N     1 
ATOM   7380  C  CA    . GLY A  1  950  ? 134.608 78.388  5.210   1.00 103.24 ? 950  GLY A CA    1 
ATOM   7381  C  C     . GLY A  1  950  ? 134.506 76.955  5.690   1.00 105.92 ? 950  GLY A C     1 
ATOM   7382  O  O     . GLY A  1  950  ? 135.453 76.454  6.303   1.00 106.07 ? 950  GLY A O     1 
ATOM   7383  N  N     . GLU A  1  951  ? 133.358 76.282  5.416   1.00 100.47 ? 951  GLU A N     1 
ATOM   7384  C  CA    . GLU A  1  951  ? 133.090 74.882  5.769   1.00 98.79  ? 951  GLU A CA    1 
ATOM   7385  C  C     . GLU A  1  951  ? 134.248 74.024  5.245   1.00 102.34 ? 951  GLU A C     1 
ATOM   7386  O  O     . GLU A  1  951  ? 134.547 74.094  4.055   1.00 102.64 ? 951  GLU A O     1 
ATOM   7387  C  CB    . GLU A  1  951  ? 131.743 74.440  5.159   1.00 98.87  ? 951  GLU A CB    1 
ATOM   7388  C  CG    . GLU A  1  951  ? 131.368 72.996  5.427   1.00 105.96 ? 951  GLU A CG    1 
ATOM   7389  C  CD    . GLU A  1  951  ? 131.317 72.607  6.886   1.00 120.75 ? 951  GLU A CD    1 
ATOM   7390  O  OE1   . GLU A  1  951  ? 130.462 73.162  7.613   1.00 125.18 ? 951  GLU A OE1   1 
ATOM   7391  O  OE2   . GLU A  1  951  ? 132.146 71.769  7.309   1.00 104.92 ? 951  GLU A OE2   1 
ATOM   7392  N  N     . ALA A  1  952  ? 134.953 73.300  6.131   1.00 97.60  ? 952  ALA A N     1 
ATOM   7393  C  CA    . ALA A  1  952  ? 136.124 72.534  5.709   1.00 96.61  ? 952  ALA A CA    1 
ATOM   7394  C  C     . ALA A  1  952  ? 135.950 71.016  5.727   1.00 98.57  ? 952  ALA A C     1 
ATOM   7395  O  O     . ALA A  1  952  ? 136.858 70.301  5.293   1.00 98.17  ? 952  ALA A O     1 
ATOM   7396  C  CB    . ALA A  1  952  ? 137.339 72.942  6.522   1.00 98.39  ? 952  ALA A CB    1 
ATOM   7397  N  N     . ASN A  1  953  ? 134.794 70.518  6.188   1.00 93.45  ? 953  ASN A N     1 
ATOM   7398  C  CA    . ASN A  1  953  ? 134.552 69.080  6.205   1.00 92.01  ? 953  ASN A CA    1 
ATOM   7399  C  C     . ASN A  1  953  ? 133.801 68.636  4.962   1.00 95.18  ? 953  ASN A C     1 
ATOM   7400  O  O     . ASN A  1  953  ? 132.580 68.802  4.859   1.00 95.32  ? 953  ASN A O     1 
ATOM   7401  C  CB    . ASN A  1  953  ? 133.864 68.639  7.487   1.00 92.70  ? 953  ASN A CB    1 
ATOM   7402  C  CG    . ASN A  1  953  ? 134.699 68.889  8.701   1.00 114.25 ? 953  ASN A CG    1 
ATOM   7403  O  OD1   . ASN A  1  953  ? 135.786 68.315  8.862   1.00 109.07 ? 953  ASN A OD1   1 
ATOM   7404  N  ND2   . ASN A  1  953  ? 134.220 69.776  9.563   1.00 105.43 ? 953  ASN A ND2   1 
ATOM   7405  N  N     . TRP A  1  954  ? 134.542 68.089  4.002   1.00 90.85  ? 954  TRP A N     1 
ATOM   7406  C  CA    . TRP A  1  954  ? 133.962 67.649  2.743   1.00 89.74  ? 954  TRP A CA    1 
ATOM   7407  C  C     . TRP A  1  954  ? 134.261 66.208  2.419   1.00 88.46  ? 954  TRP A C     1 
ATOM   7408  O  O     . TRP A  1  954  ? 135.384 65.757  2.652   1.00 87.02  ? 954  TRP A O     1 
ATOM   7409  C  CB    . TRP A  1  954  ? 134.384 68.584  1.600   1.00 89.90  ? 954  TRP A CB    1 
ATOM   7410  C  CG    . TRP A  1  954  ? 133.812 69.943  1.796   1.00 92.11  ? 954  TRP A CG    1 
ATOM   7411  C  CD1   . TRP A  1  954  ? 134.391 70.982  2.459   1.00 96.24  ? 954  TRP A CD1   1 
ATOM   7412  C  CD2   . TRP A  1  954  ? 132.457 70.327  1.553   1.00 91.93  ? 954  TRP A CD2   1 
ATOM   7413  N  NE1   . TRP A  1  954  ? 133.504 72.027  2.562   1.00 96.32  ? 954  TRP A NE1   1 
ATOM   7414  C  CE2   . TRP A  1  954  ? 132.299 71.641  2.041   1.00 96.92  ? 954  TRP A CE2   1 
ATOM   7415  C  CE3   . TRP A  1  954  ? 131.359 69.692  0.954   1.00 92.47  ? 954  TRP A CE3   1 
ATOM   7416  C  CZ2   . TRP A  1  954  ? 131.103 72.349  1.905   1.00 96.29  ? 954  TRP A CZ2   1 
ATOM   7417  C  CZ3   . TRP A  1  954  ? 130.178 70.397  0.818   1.00 93.89  ? 954  TRP A CZ3   1 
ATOM   7418  C  CH2   . TRP A  1  954  ? 130.054 71.704  1.302   1.00 95.41  ? 954  TRP A CH2   1 
ATOM   7419  N  N     . PRO A  1  955  ? 133.270 65.474  1.868   1.00 82.59  ? 955  PRO A N     1 
ATOM   7420  C  CA    . PRO A  1  955  ? 133.505 64.074  1.498   1.00 80.99  ? 955  PRO A CA    1 
ATOM   7421  C  C     . PRO A  1  955  ? 134.378 64.020  0.250   1.00 83.84  ? 955  PRO A C     1 
ATOM   7422  O  O     . PRO A  1  955  ? 134.077 64.673  -0.756  1.00 83.51  ? 955  PRO A O     1 
ATOM   7423  C  CB    . PRO A  1  955  ? 132.092 63.511  1.286   1.00 81.64  ? 955  PRO A CB    1 
ATOM   7424  C  CG    . PRO A  1  955  ? 131.157 64.569  1.746   1.00 86.97  ? 955  PRO A CG    1 
ATOM   7425  C  CD    . PRO A  1  955  ? 131.889 65.862  1.550   1.00 83.77  ? 955  PRO A CD    1 
ATOM   7426  N  N     . LEU A  1  956  ? 135.520 63.325  0.373   1.00 78.58  ? 956  LEU A N     1 
ATOM   7427  C  CA    . LEU A  1  956  ? 136.553 63.197  -0.653  1.00 77.28  ? 956  LEU A CA    1 
ATOM   7428  C  C     . LEU A  1  956  ? 137.111 61.789  -0.659  1.00 79.54  ? 956  LEU A C     1 
ATOM   7429  O  O     . LEU A  1  956  ? 137.062 61.154  0.385   1.00 79.76  ? 956  LEU A O     1 
ATOM   7430  C  CB    . LEU A  1  956  ? 137.688 64.192  -0.359  1.00 77.84  ? 956  LEU A CB    1 
ATOM   7431  C  CG    . LEU A  1  956  ? 137.438 65.637  -0.753  1.00 82.00  ? 956  LEU A CG    1 
ATOM   7432  C  CD1   . LEU A  1  956  ? 138.583 66.494  -0.335  1.00 83.51  ? 956  LEU A CD1   1 
ATOM   7433  C  CD2   . LEU A  1  956  ? 137.260 65.776  -2.244  1.00 82.99  ? 956  LEU A CD2   1 
ATOM   7434  N  N     . PRO A  1  957  ? 137.657 61.260  -1.778  1.00 75.13  ? 957  PRO A N     1 
ATOM   7435  C  CA    . PRO A  1  957  ? 138.191 59.889  -1.745  1.00 74.98  ? 957  PRO A CA    1 
ATOM   7436  C  C     . PRO A  1  957  ? 139.510 59.822  -0.987  1.00 81.83  ? 957  PRO A C     1 
ATOM   7437  O  O     . PRO A  1  957  ? 140.128 60.861  -0.786  1.00 83.64  ? 957  PRO A O     1 
ATOM   7438  C  CB    . PRO A  1  957  ? 138.390 59.564  -3.222  1.00 76.06  ? 957  PRO A CB    1 
ATOM   7439  C  CG    . PRO A  1  957  ? 138.666 60.855  -3.848  1.00 80.76  ? 957  PRO A CG    1 
ATOM   7440  C  CD    . PRO A  1  957  ? 137.825 61.859  -3.116  1.00 76.75  ? 957  PRO A CD    1 
ATOM   7441  N  N     . VAL A  1  958  ? 139.943 58.617  -0.577  1.00 78.27  ? 958  VAL A N     1 
ATOM   7442  C  CA    . VAL A  1  958  ? 141.222 58.384  0.133   1.00 78.70  ? 958  VAL A CA    1 
ATOM   7443  C  C     . VAL A  1  958  ? 141.305 59.074  1.523   1.00 84.52  ? 958  VAL A C     1 
ATOM   7444  O  O     . VAL A  1  958  ? 141.685 60.251  1.584   1.00 85.26  ? 958  VAL A O     1 
ATOM   7445  C  CB    . VAL A  1  958  ? 142.473 58.735  -0.727  1.00 81.77  ? 958  VAL A CB    1 
ATOM   7446  C  CG1   . VAL A  1  958  ? 143.740 58.178  -0.094  1.00 82.07  ? 958  VAL A CG1   1 
ATOM   7447  C  CG2   . VAL A  1  958  ? 142.326 58.240  -2.158  1.00 80.70  ? 958  VAL A CG2   1 
ATOM   7448  N  N     . ASN A  1  959  ? 141.015 58.335  2.639   1.00 80.23  ? 959  ASN A N     1 
ATOM   7449  C  CA    . ASN A  1  959  ? 141.158 58.941  3.968   1.00 79.89  ? 959  ASN A CA    1 
ATOM   7450  C  C     . ASN A  1  959  ? 142.653 59.013  4.238   1.00 84.35  ? 959  ASN A C     1 
ATOM   7451  O  O     . ASN A  1  959  ? 143.299 57.986  4.501   1.00 85.01  ? 959  ASN A O     1 
ATOM   7452  C  CB    . ASN A  1  959  ? 140.410 58.197  5.081   1.00 76.95  ? 959  ASN A CB    1 
ATOM   7453  C  CG    . ASN A  1  959  ? 140.249 59.036  6.340   1.00 91.65  ? 959  ASN A CG    1 
ATOM   7454  O  OD1   . ASN A  1  959  ? 141.172 59.216  7.146   1.00 85.54  ? 959  ASN A OD1   1 
ATOM   7455  N  ND2   . ASN A  1  959  ? 139.074 59.599  6.529   1.00 81.34  ? 959  ASN A ND2   1 
ATOM   7456  N  N     . ILE A  1  960  ? 143.218 60.218  4.038   1.00 78.84  ? 960  ILE A N     1 
ATOM   7457  C  CA    . ILE A  1  960  ? 144.644 60.463  4.192   1.00 77.58  ? 960  ILE A CA    1 
ATOM   7458  C  C     . ILE A  1  960  ? 145.031 60.275  5.645   1.00 80.39  ? 960  ILE A C     1 
ATOM   7459  O  O     . ILE A  1  960  ? 145.999 59.555  5.887   1.00 80.24  ? 960  ILE A O     1 
ATOM   7460  C  CB    . ILE A  1  960  ? 145.079 61.811  3.556   1.00 80.24  ? 960  ILE A CB    1 
ATOM   7461  C  CG1   . ILE A  1  960  ? 144.999 61.694  2.028   1.00 79.78  ? 960  ILE A CG1   1 
ATOM   7462  C  CG2   . ILE A  1  960  ? 146.490 62.206  3.964   1.00 81.42  ? 960  ILE A CG2   1 
ATOM   7463  C  CD1   . ILE A  1  960  ? 144.899 62.984  1.290   1.00 91.55  ? 960  ILE A CD1   1 
ATOM   7464  N  N     . ARG A  1  961  ? 144.231 60.812  6.606   1.00 76.31  ? 961  ARG A N     1 
ATOM   7465  C  CA    . ARG A  1  961  ? 144.526 60.658  8.035   1.00 77.22  ? 961  ARG A CA    1 
ATOM   7466  C  C     . ARG A  1  961  ? 144.869 59.208  8.370   1.00 82.48  ? 961  ARG A C     1 
ATOM   7467  O  O     . ARG A  1  961  ? 145.983 58.924  8.824   1.00 81.88  ? 961  ARG A O     1 
ATOM   7468  C  CB    . ARG A  1  961  ? 143.396 61.197  8.928   1.00 78.78  ? 961  ARG A CB    1 
ATOM   7469  C  CG    . ARG A  1  961  ? 143.760 61.169  10.422  1.00 97.40  ? 961  ARG A CG    1 
ATOM   7470  C  CD    . ARG A  1  961  ? 142.912 62.079  11.295  1.00 119.27 ? 961  ARG A CD    1 
ATOM   7471  N  NE    . ARG A  1  961  ? 142.058 61.317  12.210  1.00 138.52 ? 961  ARG A NE    1 
ATOM   7472  C  CZ    . ARG A  1  961  ? 141.630 61.758  13.391  1.00 161.52 ? 961  ARG A CZ    1 
ATOM   7473  N  NH1   . ARG A  1  961  ? 141.986 62.962  13.828  1.00 151.99 ? 961  ARG A NH1   1 
ATOM   7474  N  NH2   . ARG A  1  961  ? 140.854 60.994  14.149  1.00 151.54 ? 961  ARG A NH2   1 
ATOM   7475  N  N     . ARG A  1  962  ? 143.948 58.289  8.040   1.00 80.41  ? 962  ARG A N     1 
ATOM   7476  C  CA    . ARG A  1  962  ? 144.114 56.855  8.249   1.00 80.34  ? 962  ARG A CA    1 
ATOM   7477  C  C     . ARG A  1  962  ? 145.414 56.310  7.643   1.00 84.68  ? 962  ARG A C     1 
ATOM   7478  O  O     . ARG A  1  962  ? 146.131 55.614  8.354   1.00 86.21  ? 962  ARG A O     1 
ATOM   7479  C  CB    . ARG A  1  962  ? 142.902 56.085  7.730   1.00 80.32  ? 962  ARG A CB    1 
ATOM   7480  C  CG    . ARG A  1  962  ? 142.381 55.078  8.738   1.00 91.62  ? 962  ARG A CG    1 
ATOM   7481  C  CD    . ARG A  1  962  ? 141.621 53.951  8.077   1.00 90.43  ? 962  ARG A CD    1 
ATOM   7482  N  NE    . ARG A  1  962  ? 140.297 54.372  7.635   1.00 92.18  ? 962  ARG A NE    1 
ATOM   7483  C  CZ    . ARG A  1  962  ? 139.951 54.569  6.369   1.00 103.44 ? 962  ARG A CZ    1 
ATOM   7484  N  NH1   . ARG A  1  962  ? 140.837 54.391  5.393   1.00 97.76  ? 962  ARG A NH1   1 
ATOM   7485  N  NH2   . ARG A  1  962  ? 138.714 54.921  6.066   1.00 77.56  ? 962  ARG A NH2   1 
ATOM   7486  N  N     . ILE A  1  963  ? 145.758 56.668  6.375   1.00 79.16  ? 963  ILE A N     1 
ATOM   7487  C  CA    . ILE A  1  963  ? 146.994 56.174  5.750   1.00 78.34  ? 963  ILE A CA    1 
ATOM   7488  C  C     . ILE A  1  963  ? 148.199 56.505  6.624   1.00 82.75  ? 963  ILE A C     1 
ATOM   7489  O  O     . ILE A  1  963  ? 149.014 55.617  6.872   1.00 82.88  ? 963  ILE A O     1 
ATOM   7490  C  CB    . ILE A  1  963  ? 147.212 56.580  4.259   1.00 80.91  ? 963  ILE A CB    1 
ATOM   7491  C  CG1   . ILE A  1  963  ? 145.986 56.245  3.370   1.00 79.75  ? 963  ILE A CG1   1 
ATOM   7492  C  CG2   . ILE A  1  963  ? 148.496 55.924  3.710   1.00 82.39  ? 963  ILE A CG2   1 
ATOM   7493  C  CD1   . ILE A  1  963  ? 146.247 56.162  1.792   1.00 82.79  ? 963  ILE A CD1   1 
ATOM   7494  N  N     . ILE A  1  964  ? 148.286 57.759  7.122   1.00 79.34  ? 964  ILE A N     1 
ATOM   7495  C  CA    . ILE A  1  964  ? 149.376 58.202  7.998   1.00 79.90  ? 964  ILE A CA    1 
ATOM   7496  C  C     . ILE A  1  964  ? 149.341 57.400  9.303   1.00 85.14  ? 964  ILE A C     1 
ATOM   7497  O  O     . ILE A  1  964  ? 150.373 56.827  9.677   1.00 85.38  ? 964  ILE A O     1 
ATOM   7498  C  CB    . ILE A  1  964  ? 149.369 59.750  8.187   1.00 82.75  ? 964  ILE A CB    1 
ATOM   7499  C  CG1   . ILE A  1  964  ? 150.126 60.436  7.046   1.00 83.74  ? 964  ILE A CG1   1 
ATOM   7500  C  CG2   . ILE A  1  964  ? 149.937 60.197  9.533   1.00 82.70  ? 964  ILE A CG2   1 
ATOM   7501  C  CD1   . ILE A  1  964  ? 149.323 60.760  5.834   1.00 91.52  ? 964  ILE A CD1   1 
ATOM   7502  N  N     . GLN A  1  965  ? 148.127 57.294  9.941   1.00 80.42  ? 965  GLN A N     1 
ATOM   7503  C  CA    . GLN A  1  965  ? 147.899 56.550  11.185  1.00 79.68  ? 965  GLN A CA    1 
ATOM   7504  C  C     . GLN A  1  965  ? 148.455 55.146  11.055  1.00 83.86  ? 965  GLN A C     1 
ATOM   7505  O  O     . GLN A  1  965  ? 149.196 54.711  11.938  1.00 85.40  ? 965  GLN A O     1 
ATOM   7506  C  CB    . GLN A  1  965  ? 146.410 56.496  11.558  1.00 79.90  ? 965  GLN A CB    1 
ATOM   7507  C  CG    . GLN A  1  965  ? 145.875 57.771  12.200  1.00 96.15  ? 965  GLN A CG    1 
ATOM   7508  C  CD    . GLN A  1  965  ? 144.368 57.800  12.411  1.00 116.01 ? 965  GLN A CD    1 
ATOM   7509  O  OE1   . GLN A  1  965  ? 143.851 58.643  13.160  1.00 109.87 ? 965  GLN A OE1   1 
ATOM   7510  N  NE2   . GLN A  1  965  ? 143.616 56.915  11.741  1.00 107.52 ? 965  GLN A NE2   1 
ATOM   7511  N  N     . ASN A  1  966  ? 148.167 54.470  9.926   1.00 78.68  ? 966  ASN A N     1 
ATOM   7512  C  CA    . ASN A  1  966  ? 148.657 53.119  9.668   1.00 78.59  ? 966  ASN A CA    1 
ATOM   7513  C  C     . ASN A  1  966  ? 150.172 53.058  9.389   1.00 84.44  ? 966  ASN A C     1 
ATOM   7514  O  O     . ASN A  1  966  ? 150.788 52.055  9.733   1.00 84.86  ? 966  ASN A O     1 
ATOM   7515  C  CB    . ASN A  1  966  ? 147.867 52.410  8.562   1.00 78.02  ? 966  ASN A CB    1 
ATOM   7516  C  CG    . ASN A  1  966  ? 146.365 52.570  8.606   1.00 97.74  ? 966  ASN A CG    1 
ATOM   7517  O  OD1   . ASN A  1  966  ? 145.723 52.591  9.675   1.00 88.11  ? 966  ASN A OD1   1 
ATOM   7518  N  ND2   . ASN A  1  966  ? 145.779 52.685  7.413   1.00 90.53  ? 966  ASN A ND2   1 
ATOM   7519  N  N     . ALA A  1  967  ? 150.777 54.108  8.789   1.00 81.32  ? 967  ALA A N     1 
ATOM   7520  C  CA    . ALA A  1  967  ? 152.220 54.105  8.531   1.00 81.53  ? 967  ALA A CA    1 
ATOM   7521  C  C     . ALA A  1  967  ? 152.943 54.131  9.870   1.00 87.63  ? 967  ALA A C     1 
ATOM   7522  O  O     . ALA A  1  967  ? 153.822 53.301  10.105  1.00 87.46  ? 967  ALA A O     1 
ATOM   7523  C  CB    . ALA A  1  967  ? 152.610 55.306  7.689   1.00 82.27  ? 967  ALA A CB    1 
ATOM   7524  N  N     . GLN A  1  968  ? 152.478 55.009  10.784  1.00 86.06  ? 968  GLN A N     1 
ATOM   7525  C  CA    . GLN A  1  968  ? 153.013 55.188  12.130  1.00 88.02  ? 968  GLN A CA    1 
ATOM   7526  C  C     . GLN A  1  968  ? 152.959 53.903  12.976  1.00 95.38  ? 968  GLN A C     1 
ATOM   7527  O  O     . GLN A  1  968  ? 153.936 53.626  13.669  1.00 96.50  ? 968  GLN A O     1 
ATOM   7528  C  CB    . GLN A  1  968  ? 152.351 56.376  12.843  1.00 89.43  ? 968  GLN A CB    1 
ATOM   7529  C  CG    . GLN A  1  968  ? 152.818 57.734  12.311  1.00 100.03 ? 968  GLN A CG    1 
ATOM   7530  C  CD    . GLN A  1  968  ? 151.933 58.892  12.727  1.00 119.99 ? 968  GLN A CD    1 
ATOM   7531  O  OE1   . GLN A  1  968  ? 150.693 58.823  12.702  1.00 114.44 ? 968  GLN A OE1   1 
ATOM   7532  N  NE2   . GLN A  1  968  ? 152.554 60.014  13.061  1.00 113.10 ? 968  GLN A NE2   1 
ATOM   7533  N  N     . GLN A  1  969  ? 151.868 53.096  12.908  1.00 92.75  ? 969  GLN A N     1 
ATOM   7534  C  CA    . GLN A  1  969  ? 151.891 51.849  13.685  1.00 93.44  ? 969  GLN A CA    1 
ATOM   7535  C  C     . GLN A  1  969  ? 152.707 50.782  12.943  1.00 95.75  ? 969  GLN A C     1 
ATOM   7536  O  O     . GLN A  1  969  ? 153.446 50.053  13.604  1.00 96.39  ? 969  GLN A O     1 
ATOM   7537  C  CB    . GLN A  1  969  ? 150.506 51.333  14.194  1.00 94.52  ? 969  GLN A CB    1 
ATOM   7538  C  CG    . GLN A  1  969  ? 149.418 51.009  13.145  1.00 123.57 ? 969  GLN A CG    1 
ATOM   7539  C  CD    . GLN A  1  969  ? 147.988 50.958  13.709  1.00 145.13 ? 969  GLN A CD    1 
ATOM   7540  O  OE1   . GLN A  1  969  ? 147.766 50.860  14.929  1.00 144.79 ? 969  GLN A OE1   1 
ATOM   7541  N  NE2   . GLN A  1  969  ? 146.975 51.026  12.827  1.00 123.55 ? 969  GLN A NE2   1 
ATOM   7542  N  N     . THR A  1  970  ? 152.651 50.752  11.586  1.00 89.97  ? 970  THR A N     1 
ATOM   7543  C  CA    . THR A  1  970  ? 153.393 49.778  10.772  1.00 89.54  ? 970  THR A CA    1 
ATOM   7544  C  C     . THR A  1  970  ? 154.888 49.884  10.975  1.00 97.58  ? 970  THR A C     1 
ATOM   7545  O  O     . THR A  1  970  ? 155.557 48.858  11.171  1.00 98.37  ? 970  THR A O     1 
ATOM   7546  C  CB    . THR A  1  970  ? 153.053 49.897  9.268   1.00 87.58  ? 970  THR A CB    1 
ATOM   7547  O  OG1   . THR A  1  970  ? 151.694 49.565  9.069   1.00 85.03  ? 970  THR A OG1   1 
ATOM   7548  C  CG2   . THR A  1  970  ? 153.877 48.975  8.395   1.00 83.26  ? 970  THR A CG2   1 
ATOM   7549  N  N     . PHE A  1  971  ? 155.408 51.121  10.917  1.00 95.46  ? 971  PHE A N     1 
ATOM   7550  C  CA    . PHE A  1  971  ? 156.837 51.379  10.961  1.00 96.70  ? 971  PHE A CA    1 
ATOM   7551  C  C     . PHE A  1  971  ? 157.371 51.795  12.330  1.00 107.94 ? 971  PHE A C     1 
ATOM   7552  O  O     . PHE A  1  971  ? 158.584 51.933  12.477  1.00 108.91 ? 971  PHE A O     1 
ATOM   7553  C  CB    . PHE A  1  971  ? 157.198 52.397  9.876   1.00 97.05  ? 971  PHE A CB    1 
ATOM   7554  C  CG    . PHE A  1  971  ? 156.830 51.951  8.478   1.00 95.85  ? 971  PHE A CG    1 
ATOM   7555  C  CD1   . PHE A  1  971  ? 157.695 51.163  7.731   1.00 97.82  ? 971  PHE A CD1   1 
ATOM   7556  C  CD2   . PHE A  1  971  ? 155.624 52.328  7.904   1.00 95.64  ? 971  PHE A CD2   1 
ATOM   7557  C  CE1   . PHE A  1  971  ? 157.368 50.776  6.428   1.00 96.99  ? 971  PHE A CE1   1 
ATOM   7558  C  CE2   . PHE A  1  971  ? 155.297 51.937  6.601   1.00 96.88  ? 971  PHE A CE2   1 
ATOM   7559  C  CZ    . PHE A  1  971  ? 156.174 51.167  5.872   1.00 94.65  ? 971  PHE A CZ    1 
ATOM   7560  N  N     . HIS A  1  972  ? 156.486 51.916  13.342  1.00 109.66 ? 972  HIS A N     1 
ATOM   7561  C  CA    . HIS A  1  972  ? 156.810 52.289  14.733  1.00 113.34 ? 972  HIS A CA    1 
ATOM   7562  C  C     . HIS A  1  972  ? 157.582 53.628  14.805  1.00 118.78 ? 972  HIS A C     1 
ATOM   7563  O  O     . HIS A  1  972  ? 158.705 53.696  15.322  1.00 119.72 ? 972  HIS A O     1 
ATOM   7564  C  CB    . HIS A  1  972  ? 157.519 51.147  15.507  1.00 116.36 ? 972  HIS A CB    1 
ATOM   7565  C  CG    . HIS A  1  972  ? 157.047 49.772  15.142  1.00 120.39 ? 972  HIS A CG    1 
ATOM   7566  N  ND1   . HIS A  1  972  ? 155.802 49.299  15.545  1.00 122.07 ? 972  HIS A ND1   1 
ATOM   7567  C  CD2   . HIS A  1  972  ? 157.665 48.810  14.410  1.00 123.14 ? 972  HIS A CD2   1 
ATOM   7568  C  CE1   . HIS A  1  972  ? 155.702 48.075  15.042  1.00 121.29 ? 972  HIS A CE1   1 
ATOM   7569  N  NE2   . HIS A  1  972  ? 156.798 47.733  14.355  1.00 122.15 ? 972  HIS A NE2   1 
ATOM   7570  N  N     . ILE A  1  973  ? 156.963 54.683  14.248  1.00 115.01 ? 973  ILE A N     1 
ATOM   7571  C  CA    . ILE A  1  973  ? 157.510 56.032  14.212  1.00 116.34 ? 973  ILE A CA    1 
ATOM   7572  C  C     . ILE A  1  973  ? 157.646 56.581  15.630  1.00 124.90 ? 973  ILE A C     1 
ATOM   7573  O  O     . ILE A  1  973  ? 156.652 56.643  16.361  1.00 124.41 ? 973  ILE A O     1 
ATOM   7574  C  CB    . ILE A  1  973  ? 156.680 56.937  13.233  1.00 117.91 ? 973  ILE A CB    1 
ATOM   7575  C  CG1   . ILE A  1  973  ? 157.267 56.898  11.820  1.00 117.56 ? 973  ILE A CG1   1 
ATOM   7576  C  CG2   . ILE A  1  973  ? 156.512 58.390  13.698  1.00 118.66 ? 973  ILE A CG2   1 
ATOM   7577  C  CD1   . ILE A  1  973  ? 156.596 55.949  10.942  1.00 122.88 ? 973  ILE A CD1   1 
ATOM   7578  N  N     . ASP A  1  974  ? 158.889 56.908  16.039  1.00 125.03 ? 974  ASP A N     1 
ATOM   7579  C  CA    . ASP A  1  974  ? 159.122 57.501  17.351  1.00 127.18 ? 974  ASP A CA    1 
ATOM   7580  C  C     . ASP A  1  974  ? 159.367 58.970  17.173  1.00 133.65 ? 974  ASP A C     1 
ATOM   7581  O  O     . ASP A  1  974  ? 160.274 59.385  16.447  1.00 133.42 ? 974  ASP A O     1 
ATOM   7582  C  CB    . ASP A  1  974  ? 160.223 56.802  18.167  1.00 130.59 ? 974  ASP A CB    1 
ATOM   7583  C  CG    . ASP A  1  974  ? 161.600 56.762  17.546  1.00 142.62 ? 974  ASP A CG    1 
ATOM   7584  O  OD1   . ASP A  1  974  ? 161.691 56.784  16.296  1.00 143.20 ? 974  ASP A OD1   1 
ATOM   7585  O  OD2   . ASP A  1  974  ? 162.585 56.646  18.307  1.00 148.71 ? 974  ASP A OD2   1 
ATOM   7586  N  N     . HIS A  1  975  ? 158.493 59.756  17.791  1.00 132.34 ? 975  HIS A N     1 
ATOM   7587  C  CA    . HIS A  1  975  ? 158.472 61.212  17.735  1.00 133.70 ? 975  HIS A CA    1 
ATOM   7588  C  C     . HIS A  1  975  ? 159.605 61.759  18.629  1.00 138.53 ? 975  HIS A C     1 
ATOM   7589  O  O     . HIS A  1  975  ? 159.361 62.543  19.551  1.00 138.94 ? 975  HIS A O     1 
ATOM   7590  C  CB    . HIS A  1  975  ? 157.065 61.722  18.152  1.00 134.57 ? 975  HIS A CB    1 
ATOM   7591  C  CG    . HIS A  1  975  ? 155.908 61.130  17.373  1.00 136.85 ? 975  HIS A CG    1 
ATOM   7592  N  ND1   . HIS A  1  975  ? 154.976 61.941  16.729  1.00 138.09 ? 975  HIS A ND1   1 
ATOM   7593  C  CD2   . HIS A  1  975  ? 155.552 59.832  17.184  1.00 137.69 ? 975  HIS A CD2   1 
ATOM   7594  C  CE1   . HIS A  1  975  ? 154.104 61.114  16.168  1.00 135.99 ? 975  HIS A CE1   1 
ATOM   7595  N  NE2   . HIS A  1  975  ? 154.414 59.836  16.403  1.00 136.05 ? 975  HIS A NE2   1 
ATOM   7596  N  N     . THR A  1  976  ? 160.850 61.298  18.356  1.00 135.15 ? 976  THR A N     1 
ATOM   7597  C  CA    . THR A  1  976  ? 162.087 61.626  19.084  1.00 136.56 ? 976  THR A CA    1 
ATOM   7598  C  C     . THR A  1  976  ? 163.314 61.715  18.152  1.00 138.60 ? 976  THR A C     1 
ATOM   7599  O  O     . THR A  1  976  ? 164.142 62.624  18.310  1.00 139.75 ? 976  THR A O     1 
ATOM   7600  C  CB    . THR A  1  976  ? 162.373 60.589  20.208  1.00 148.20 ? 976  THR A CB    1 
ATOM   7601  O  OG1   . THR A  1  976  ? 162.304 59.257  19.685  1.00 148.56 ? 976  THR A OG1   1 
ATOM   7602  C  CG2   . THR A  1  976  ? 161.459 60.745  21.427  1.00 146.93 ? 976  THR A CG2   1 
ATOM   7603  N  N     . LYS A  1  977  ? 163.433 60.758  17.198  1.00 130.96 ? 977  LYS A N     1 
ATOM   7604  C  CA    . LYS A  1  977  ? 164.569 60.653  16.272  1.00 129.21 ? 977  LYS A CA    1 
ATOM   7605  C  C     . LYS A  1  977  ? 164.404 61.480  14.969  1.00 128.35 ? 977  LYS A C     1 
ATOM   7606  O  O     . LYS A  1  977  ? 163.264 61.744  14.564  1.00 127.10 ? 977  LYS A O     1 
ATOM   7607  C  CB    . LYS A  1  977  ? 164.886 59.171  15.967  1.00 130.31 ? 977  LYS A CB    1 
ATOM   7608  C  CG    . LYS A  1  977  ? 165.112 58.290  17.212  1.00 140.85 ? 977  LYS A CG    1 
ATOM   7609  C  CD    . LYS A  1  977  ? 166.094 58.871  18.247  1.00 148.40 ? 977  LYS A CD    1 
ATOM   7610  C  CE    . LYS A  1  977  ? 165.599 58.711  19.662  1.00 150.70 ? 977  LYS A CE    1 
ATOM   7611  N  NZ    . LYS A  1  977  ? 166.339 59.592  20.601  1.00 158.18 ? 977  LYS A NZ    1 
ATOM   7612  N  N     . PRO A  1  978  ? 165.515 61.929  14.313  1.00 121.43 ? 978  PRO A N     1 
ATOM   7613  C  CA    . PRO A  1  978  ? 165.356 62.709  13.079  1.00 118.89 ? 978  PRO A CA    1 
ATOM   7614  C  C     . PRO A  1  978  ? 165.104 61.851  11.845  1.00 115.92 ? 978  PRO A C     1 
ATOM   7615  O  O     . PRO A  1  978  ? 165.758 60.819  11.656  1.00 115.69 ? 978  PRO A O     1 
ATOM   7616  C  CB    . PRO A  1  978  ? 166.663 63.500  12.981  1.00 122.34 ? 978  PRO A CB    1 
ATOM   7617  C  CG    . PRO A  1  978  ? 167.653 62.706  13.727  1.00 128.38 ? 978  PRO A CG    1 
ATOM   7618  C  CD    . PRO A  1  978  ? 166.945 61.743  14.639  1.00 123.95 ? 978  PRO A CD    1 
ATOM   7619  N  N     . SER A  1  979  ? 164.153 62.302  11.001  1.00 106.52 ? 979  SER A N     1 
ATOM   7620  C  CA    . SER A  1  979  ? 163.760 61.673  9.743   1.00 102.98 ? 979  SER A CA    1 
ATOM   7621  C  C     . SER A  1  979  ? 164.926 61.616  8.752   1.00 105.04 ? 979  SER A C     1 
ATOM   7622  O  O     . SER A  1  979  ? 165.815 62.466  8.794   1.00 106.70 ? 979  SER A O     1 
ATOM   7623  C  CB    . SER A  1  979  ? 162.599 62.440  9.123   1.00 103.78 ? 979  SER A CB    1 
ATOM   7624  O  OG    . SER A  1  979  ? 162.264 61.932  7.843   1.00 108.51 ? 979  SER A OG    1 
ATOM   7625  N  N     . ASP A  1  980  ? 164.913 60.629  7.855   1.00 98.30  ? 980  ASP A N     1 
ATOM   7626  C  CA    . ASP A  1  980  ? 165.956 60.485  6.846   1.00 98.27  ? 980  ASP A CA    1 
ATOM   7627  C  C     . ASP A  1  980  ? 165.522 61.064  5.477   1.00 100.67 ? 980  ASP A C     1 
ATOM   7628  O  O     . ASP A  1  980  ? 166.211 60.880  4.463   1.00 100.02 ? 980  ASP A O     1 
ATOM   7629  C  CB    . ASP A  1  980  ? 166.413 59.020  6.758   1.00 100.20 ? 980  ASP A CB    1 
ATOM   7630  C  CG    . ASP A  1  980  ? 165.342 58.041  6.324   1.00 110.02 ? 980  ASP A CG    1 
ATOM   7631  O  OD1   . ASP A  1  980  ? 164.255 58.035  6.942   1.00 110.85 ? 980  ASP A OD1   1 
ATOM   7632  O  OD2   . ASP A  1  980  ? 165.602 57.258  5.390   1.00 114.92 ? 980  ASP A OD2   1 
ATOM   7633  N  N     . LEU A  1  981  ? 164.383 61.789  5.472   1.00 96.09  ? 981  LEU A N     1 
ATOM   7634  C  CA    . LEU A  1  981  ? 163.827 62.459  4.296   1.00 95.19  ? 981  LEU A CA    1 
ATOM   7635  C  C     . LEU A  1  981  ? 164.647 63.722  3.948   1.00 100.97 ? 981  LEU A C     1 
ATOM   7636  O  O     . LEU A  1  981  ? 165.364 64.268  4.804   1.00 102.79 ? 981  LEU A O     1 
ATOM   7637  C  CB    . LEU A  1  981  ? 162.349 62.848  4.546   1.00 94.11  ? 981  LEU A CB    1 
ATOM   7638  C  CG    . LEU A  1  981  ? 161.283 61.731  4.488   1.00 97.01  ? 981  LEU A CG    1 
ATOM   7639  C  CD1   . LEU A  1  981  ? 160.040 62.119  5.272   1.00 96.06  ? 981  LEU A CD1   1 
ATOM   7640  C  CD2   . LEU A  1  981  ? 160.887 61.413  3.058   1.00 97.94  ? 981  LEU A CD2   1 
ATOM   7641  N  N     . THR A  1  982  ? 164.554 64.157  2.674   1.00 95.97  ? 982  THR A N     1 
ATOM   7642  C  CA    . THR A  1  982  ? 165.179 65.364  2.131   1.00 96.31  ? 982  THR A CA    1 
ATOM   7643  C  C     . THR A  1  982  ? 164.031 66.288  1.800   1.00 100.05 ? 982  THR A C     1 
ATOM   7644  O  O     . THR A  1  982  ? 162.899 65.818  1.666   1.00 97.96  ? 982  THR A O     1 
ATOM   7645  C  CB    . THR A  1  982  ? 165.866 65.074  0.790   1.00 101.89 ? 982  THR A CB    1 
ATOM   7646  O  OG1   . THR A  1  982  ? 166.370 63.756  0.779   1.00 99.54  ? 982  THR A OG1   1 
ATOM   7647  C  CG2   . THR A  1  982  ? 166.979 66.073  0.467   1.00 105.80 ? 982  THR A CG2   1 
ATOM   7648  N  N     . ILE A  1  983  ? 164.313 67.588  1.594   1.00 98.13  ? 983  ILE A N     1 
ATOM   7649  C  CA    . ILE A  1  983  ? 163.273 68.508  1.150   1.00 97.16  ? 983  ILE A CA    1 
ATOM   7650  C  C     . ILE A  1  983  ? 162.766 68.024  -0.230  1.00 99.38  ? 983  ILE A C     1 
ATOM   7651  O  O     . ILE A  1  983  ? 161.557 67.931  -0.431  1.00 97.80  ? 983  ILE A O     1 
ATOM   7652  C  CB    . ILE A  1  983  ? 163.753 69.982  1.210   1.00 101.32 ? 983  ILE A CB    1 
ATOM   7653  C  CG1   . ILE A  1  983  ? 163.452 70.583  2.590   1.00 102.57 ? 983  ILE A CG1   1 
ATOM   7654  C  CG2   . ILE A  1  983  ? 163.141 70.848  0.114   1.00 101.05 ? 983  ILE A CG2   1 
ATOM   7655  C  CD1   . ILE A  1  983  ? 164.441 70.233  3.687   1.00 115.91 ? 983  ILE A CD1   1 
ATOM   7656  N  N     . LYS A  1  984  ? 163.694 67.608  -1.113  1.00 95.56  ? 984  LYS A N     1 
ATOM   7657  C  CA    . LYS A  1  984  ? 163.393 67.060  -2.428  1.00 94.26  ? 984  LYS A CA    1 
ATOM   7658  C  C     . LYS A  1  984  ? 162.568 65.771  -2.290  1.00 97.89  ? 984  LYS A C     1 
ATOM   7659  O  O     . LYS A  1  984  ? 161.559 65.647  -2.982  1.00 97.67  ? 984  LYS A O     1 
ATOM   7660  C  CB    . LYS A  1  984  ? 164.684 66.820  -3.222  1.00 97.48  ? 984  LYS A CB    1 
ATOM   7661  C  CG    . LYS A  1  984  ? 165.324 68.104  -3.757  1.00 110.92 ? 984  LYS A CG    1 
ATOM   7662  C  CD    . LYS A  1  984  ? 166.739 67.885  -4.294  1.00 116.72 ? 984  LYS A CD    1 
ATOM   7663  C  CE    . LYS A  1  984  ? 167.076 68.782  -5.461  1.00 118.54 ? 984  LYS A CE    1 
ATOM   7664  N  NZ    . LYS A  1  984  ? 168.321 68.335  -6.141  1.00 123.92 ? 984  LYS A NZ    1 
ATOM   7665  N  N     . ASP A  1  985  ? 162.935 64.855  -1.353  1.00 93.58  ? 985  ASP A N     1 
ATOM   7666  C  CA    . ASP A  1  985  ? 162.177 63.612  -1.123  1.00 92.05  ? 985  ASP A CA    1 
ATOM   7667  C  C     . ASP A  1  985  ? 160.673 63.903  -0.927  1.00 94.06  ? 985  ASP A C     1 
ATOM   7668  O  O     . ASP A  1  985  ? 159.843 63.310  -1.618  1.00 93.10  ? 985  ASP A O     1 
ATOM   7669  C  CB    . ASP A  1  985  ? 162.736 62.801  0.077   1.00 94.72  ? 985  ASP A CB    1 
ATOM   7670  C  CG    . ASP A  1  985  ? 163.938 61.887  -0.191  1.00 110.15 ? 985  ASP A CG    1 
ATOM   7671  O  OD1   . ASP A  1  985  ? 164.162 61.522  -1.372  1.00 112.19 ? 985  ASP A OD1   1 
ATOM   7672  O  OD2   . ASP A  1  985  ? 164.635 61.506  0.792   1.00 114.67 ? 985  ASP A OD2   1 
ATOM   7673  N  N     . ILE A  1  986  ? 160.339 64.862  -0.041  1.00 89.86  ? 986  ILE A N     1 
ATOM   7674  C  CA    . ILE A  1  986  ? 158.969 65.279  0.273   1.00 88.30  ? 986  ILE A CA    1 
ATOM   7675  C  C     . ILE A  1  986  ? 158.355 66.102  -0.863  1.00 92.27  ? 986  ILE A C     1 
ATOM   7676  O  O     . ILE A  1  986  ? 157.332 65.707  -1.423  1.00 90.48  ? 986  ILE A O     1 
ATOM   7677  C  CB    . ILE A  1  986  ? 158.896 66.055  1.630   1.00 91.74  ? 986  ILE A CB    1 
ATOM   7678  C  CG1   . ILE A  1  986  ? 159.442 65.222  2.811   1.00 92.05  ? 986  ILE A CG1   1 
ATOM   7679  C  CG2   . ILE A  1  986  ? 157.469 66.560  1.914   1.00 91.64  ? 986  ILE A CG2   1 
ATOM   7680  C  CD1   . ILE A  1  986  ? 159.878 66.037  3.992   1.00 95.05  ? 986  ILE A CD1   1 
ATOM   7681  N  N     . VAL A  1  987  ? 158.951 67.280  -1.146  1.00 90.63  ? 987  VAL A N     1 
ATOM   7682  C  CA    . VAL A  1  987  ? 158.474 68.261  -2.123  1.00 90.23  ? 987  VAL A CA    1 
ATOM   7683  C  C     . VAL A  1  987  ? 158.296 67.640  -3.504  1.00 94.69  ? 987  VAL A C     1 
ATOM   7684  O  O     . VAL A  1  987  ? 157.184 67.699  -4.042  1.00 93.72  ? 987  VAL A O     1 
ATOM   7685  C  CB    . VAL A  1  987  ? 159.340 69.549  -2.129  1.00 94.63  ? 987  VAL A CB    1 
ATOM   7686  C  CG1   . VAL A  1  987  ? 159.065 70.427  -3.346  1.00 94.49  ? 987  VAL A CG1   1 
ATOM   7687  C  CG2   . VAL A  1  987  ? 159.120 70.340  -0.851  1.00 94.77  ? 987  VAL A CG2   1 
ATOM   7688  N  N     . LEU A  1  988  ? 159.346 67.002  -4.043  1.00 91.98  ? 988  LEU A N     1 
ATOM   7689  C  CA    . LEU A  1  988  ? 159.262 66.417  -5.378  1.00 91.65  ? 988  LEU A CA    1 
ATOM   7690  C  C     . LEU A  1  988  ? 158.433 65.137  -5.425  1.00 94.71  ? 988  LEU A C     1 
ATOM   7691  O  O     . LEU A  1  988  ? 157.771 64.913  -6.436  1.00 94.37  ? 988  LEU A O     1 
ATOM   7692  C  CB    . LEU A  1  988  ? 160.637 66.225  -6.033  1.00 92.74  ? 988  LEU A CB    1 
ATOM   7693  C  CG    . LEU A  1  988  ? 161.598 67.419  -5.968  1.00 99.10  ? 988  LEU A CG    1 
ATOM   7694  C  CD1   . LEU A  1  988  ? 162.940 67.055  -6.530  1.00 99.91  ? 988  LEU A CD1   1 
ATOM   7695  C  CD2   . LEU A  1  988  ? 161.031 68.649  -6.684  1.00 103.36 ? 988  LEU A CD2   1 
ATOM   7696  N  N     . GLY A  1  989  ? 158.415 64.364  -4.336  1.00 90.20  ? 989  GLY A N     1 
ATOM   7697  C  CA    . GLY A  1  989  ? 157.622 63.139  -4.227  1.00 88.53  ? 989  GLY A CA    1 
ATOM   7698  C  C     . GLY A  1  989  ? 156.113 63.345  -4.319  1.00 90.76  ? 989  GLY A C     1 
ATOM   7699  O  O     . GLY A  1  989  ? 155.420 62.561  -4.981  1.00 89.52  ? 989  GLY A O     1 
ATOM   7700  N  N     . VAL A  1  990  ? 155.594 64.408  -3.658  1.00 86.64  ? 990  VAL A N     1 
ATOM   7701  C  CA    . VAL A  1  990  ? 154.174 64.781  -3.671  1.00 85.38  ? 990  VAL A CA    1 
ATOM   7702  C  C     . VAL A  1  990  ? 153.801 65.275  -5.084  1.00 91.82  ? 990  VAL A C     1 
ATOM   7703  O  O     . VAL A  1  990  ? 152.761 64.886  -5.611  1.00 90.67  ? 990  VAL A O     1 
ATOM   7704  C  CB    . VAL A  1  990  ? 153.832 65.806  -2.550  1.00 88.72  ? 990  VAL A CB    1 
ATOM   7705  C  CG1   . VAL A  1  990  ? 152.413 66.354  -2.688  1.00 87.44  ? 990  VAL A CG1   1 
ATOM   7706  C  CG2   . VAL A  1  990  ? 154.029 65.197  -1.169  1.00 88.30  ? 990  VAL A CG2   1 
ATOM   7707  N  N     . LYS A  1  991  ? 154.678 66.091  -5.705  1.00 91.46  ? 991  LYS A N     1 
ATOM   7708  C  CA    . LYS A  1  991  ? 154.500 66.598  -7.069  1.00 91.94  ? 991  LYS A CA    1 
ATOM   7709  C  C     . LYS A  1  991  ? 154.386 65.426  -8.053  1.00 98.02  ? 991  LYS A C     1 
ATOM   7710  O  O     . LYS A  1  991  ? 153.512 65.451  -8.915  1.00 97.47  ? 991  LYS A O     1 
ATOM   7711  C  CB    . LYS A  1  991  ? 155.654 67.537  -7.466  1.00 95.01  ? 991  LYS A CB    1 
ATOM   7712  C  CG    . LYS A  1  991  ? 155.418 69.003  -7.098  1.00 104.89 ? 991  LYS A CG    1 
ATOM   7713  C  CD    . LYS A  1  991  ? 156.467 69.942  -7.716  1.00 115.21 ? 991  LYS A CD    1 
ATOM   7714  C  CE    . LYS A  1  991  ? 156.080 71.401  -7.615  1.00 127.12 ? 991  LYS A CE    1 
ATOM   7715  N  NZ    . LYS A  1  991  ? 157.139 72.304  -8.149  1.00 138.16 ? 991  LYS A NZ    1 
ATOM   7716  N  N     . ASP A  1  992  ? 155.223 64.378  -7.879  1.00 96.41  ? 992  ASP A N     1 
ATOM   7717  C  CA    . ASP A  1  992  ? 155.208 63.172  -8.712  1.00 96.53  ? 992  ASP A CA    1 
ATOM   7718  C  C     . ASP A  1  992  ? 153.905 62.392  -8.517  1.00 97.75  ? 992  ASP A C     1 
ATOM   7719  O  O     . ASP A  1  992  ? 153.304 61.979  -9.510  1.00 97.69  ? 992  ASP A O     1 
ATOM   7720  C  CB    . ASP A  1  992  ? 156.440 62.270  -8.446  1.00 100.33 ? 992  ASP A CB    1 
ATOM   7721  C  CG    . ASP A  1  992  ? 157.826 62.834  -8.825  1.00 124.66 ? 992  ASP A CG    1 
ATOM   7722  O  OD1   . ASP A  1  992  ? 157.900 64.014  -9.289  1.00 127.17 ? 992  ASP A OD1   1 
ATOM   7723  O  OD2   . ASP A  1  992  ? 158.843 62.106  -8.630  1.00 134.04 ? 992  ASP A OD2   1 
ATOM   7724  N  N     . LEU A  1  993  ? 153.438 62.243  -7.253  1.00 91.43  ? 993  LEU A N     1 
ATOM   7725  C  CA    . LEU A  1  993  ? 152.194 61.535  -6.917  1.00 88.77  ? 993  LEU A CA    1 
ATOM   7726  C  C     . LEU A  1  993  ? 150.953 62.111  -7.627  1.00 91.35  ? 993  LEU A C     1 
ATOM   7727  O  O     . LEU A  1  993  ? 150.093 61.352  -8.072  1.00 90.19  ? 993  LEU A O     1 
ATOM   7728  C  CB    . LEU A  1  993  ? 151.987 61.476  -5.384  1.00 88.17  ? 993  LEU A CB    1 
ATOM   7729  C  CG    . LEU A  1  993  ? 150.632 60.964  -4.852  1.00 90.54  ? 993  LEU A CG    1 
ATOM   7730  C  CD1   . LEU A  1  993  ? 150.422 59.501  -5.143  1.00 89.18  ? 993  LEU A CD1   1 
ATOM   7731  C  CD2   . LEU A  1  993  ? 150.516 61.192  -3.388  1.00 93.00  ? 993  LEU A CD2   1 
ATOM   7732  N  N     . GLN A  1  994  ? 150.876 63.439  -7.746  1.00 87.92  ? 994  GLN A N     1 
ATOM   7733  C  CA    . GLN A  1  994  ? 149.759 64.138  -8.388  1.00 86.96  ? 994  GLN A CA    1 
ATOM   7734  C  C     . GLN A  1  994  ? 149.601 63.787  -9.875  1.00 89.81  ? 994  GLN A C     1 
ATOM   7735  O  O     . GLN A  1  994  ? 148.488 63.803  -10.394 1.00 89.34  ? 994  GLN A O     1 
ATOM   7736  C  CB    . GLN A  1  994  ? 149.889 65.658  -8.197  1.00 88.98  ? 994  GLN A CB    1 
ATOM   7737  C  CG    . GLN A  1  994  ? 149.668 66.115  -6.764  1.00 94.16  ? 994  GLN A CG    1 
ATOM   7738  C  CD    . GLN A  1  994  ? 149.829 67.603  -6.596  1.00 112.56 ? 994  GLN A CD    1 
ATOM   7739  O  OE1   . GLN A  1  994  ? 150.733 68.078  -5.895  1.00 107.49 ? 994  GLN A OE1   1 
ATOM   7740  N  NE2   . GLN A  1  994  ? 148.938 68.374  -7.213  1.00 103.02 ? 994  GLN A NE2   1 
ATOM   7741  N  N     . GLU A  1  995  ? 150.706 63.459  -10.546 1.00 85.98  ? 995  GLU A N     1 
ATOM   7742  C  CA    . GLU A  1  995  ? 150.705 63.102  -11.961 1.00 85.46  ? 995  GLU A CA    1 
ATOM   7743  C  C     . GLU A  1  995  ? 150.133 61.708  -12.212 1.00 84.39  ? 995  GLU A C     1 
ATOM   7744  O  O     . GLU A  1  995  ? 149.773 61.387  -13.345 1.00 82.31  ? 995  GLU A O     1 
ATOM   7745  C  CB    . GLU A  1  995  ? 152.135 63.242  -12.552 1.00 88.59  ? 995  GLU A CB    1 
ATOM   7746  C  CG    . GLU A  1  995  ? 152.518 64.675  -12.914 1.00 105.80 ? 995  GLU A CG    1 
ATOM   7747  C  CD    . GLU A  1  995  ? 151.448 65.502  -13.620 1.00 138.37 ? 995  GLU A CD    1 
ATOM   7748  O  OE1   . GLU A  1  995  ? 151.043 65.119  -14.743 1.00 143.17 ? 995  GLU A OE1   1 
ATOM   7749  O  OE2   . GLU A  1  995  ? 150.995 66.516  -13.037 1.00 129.40 ? 995  GLU A OE2   1 
ATOM   7750  N  N     . ASN A  1  996  ? 150.053 60.896  -11.146 1.00 79.11  ? 996  ASN A N     1 
ATOM   7751  C  CA    . ASN A  1  996  ? 149.598 59.513  -11.150 1.00 77.52  ? 996  ASN A CA    1 
ATOM   7752  C  C     . ASN A  1  996  ? 148.148 59.298  -10.672 1.00 80.35  ? 996  ASN A C     1 
ATOM   7753  O  O     . ASN A  1  996  ? 147.609 58.192  -10.838 1.00 79.26  ? 996  ASN A O     1 
ATOM   7754  C  CB    . ASN A  1  996  ? 150.569 58.659  -10.330 1.00 76.70  ? 996  ASN A CB    1 
ATOM   7755  C  CG    . ASN A  1  996  ? 151.946 58.550  -10.918 1.00 105.68 ? 996  ASN A CG    1 
ATOM   7756  O  OD1   . ASN A  1  996  ? 152.161 58.723  -12.126 1.00 103.59 ? 996  ASN A OD1   1 
ATOM   7757  N  ND2   . ASN A  1  996  ? 152.909 58.214  -10.079 1.00 101.97 ? 996  ASN A ND2   1 
ATOM   7758  N  N     . LEU A  1  997  ? 147.526 60.330  -10.070 1.00 76.66  ? 997  LEU A N     1 
ATOM   7759  C  CA    . LEU A  1  997  ? 146.142 60.258  -9.576  1.00 75.64  ? 997  LEU A CA    1 
ATOM   7760  C  C     . LEU A  1  997  ? 145.230 60.512  -10.780 1.00 80.41  ? 997  LEU A C     1 
ATOM   7761  O  O     . LEU A  1  997  ? 144.704 61.615  -10.955 1.00 80.80  ? 997  LEU A O     1 
ATOM   7762  C  CB    . LEU A  1  997  ? 145.900 61.294  -8.442  1.00 75.72  ? 997  LEU A CB    1 
ATOM   7763  C  CG    . LEU A  1  997  ? 146.850 61.281  -7.237  1.00 79.55  ? 997  LEU A CG    1 
ATOM   7764  C  CD1   . LEU A  1  997  ? 146.537 62.400  -6.291  1.00 78.56  ? 997  LEU A CD1   1 
ATOM   7765  C  CD2   . LEU A  1  997  ? 146.817 59.944  -6.508  1.00 81.95  ? 997  LEU A CD2   1 
ATOM   7766  N  N     . LEU A  1  998  ? 145.098 59.490  -11.643 1.00 76.35  ? 998  LEU A N     1 
ATOM   7767  C  CA    . LEU A  1  998  ? 144.379 59.569  -12.917 1.00 75.24  ? 998  LEU A CA    1 
ATOM   7768  C  C     . LEU A  1  998  ? 142.916 59.210  -12.867 1.00 80.21  ? 998  LEU A C     1 
ATOM   7769  O  O     . LEU A  1  998  ? 142.534 58.207  -12.265 1.00 80.20  ? 998  LEU A O     1 
ATOM   7770  C  CB    . LEU A  1  998  ? 145.074 58.707  -13.985 1.00 74.39  ? 998  LEU A CB    1 
ATOM   7771  C  CG    . LEU A  1  998  ? 146.545 58.967  -14.271 1.00 78.02  ? 998  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A  1  998  ? 146.962 58.260  -15.514 1.00 77.65  ? 998  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A  1  998  ? 146.816 60.421  -14.456 1.00 80.74  ? 998  LEU A CD2   1 
ATOM   7774  N  N     . VAL A  1  999  ? 142.115 60.001  -13.576 1.00 77.21  ? 999  VAL A N     1 
ATOM   7775  C  CA    . VAL A  1  999  ? 140.679 59.838  -13.729 1.00 77.30  ? 999  VAL A CA    1 
ATOM   7776  C  C     . VAL A  1  999  ? 140.426 59.657  -15.231 1.00 85.27  ? 999  VAL A C     1 
ATOM   7777  O  O     . VAL A  1  999  ? 139.849 58.653  -15.616 1.00 86.78  ? 999  VAL A O     1 
ATOM   7778  C  CB    . VAL A  1  999  ? 139.887 61.018  -13.095 1.00 81.46  ? 999  VAL A CB    1 
ATOM   7779  C  CG1   . VAL A  1  999  ? 138.413 60.986  -13.480 1.00 80.67  ? 999  VAL A CG1   1 
ATOM   7780  C  CG2   . VAL A  1  999  ? 140.028 61.013  -11.581 1.00 81.51  ? 999  VAL A CG2   1 
ATOM   7781  N  N     . LEU A  1  1000 ? 140.902 60.587  -16.072 1.00 83.59  ? 1000 LEU A N     1 
ATOM   7782  C  CA    . LEU A  1  1000 ? 140.782 60.559  -17.539 1.00 83.94  ? 1000 LEU A CA    1 
ATOM   7783  C  C     . LEU A  1  1000 ? 142.166 60.281  -18.155 1.00 89.04  ? 1000 LEU A C     1 
ATOM   7784  O  O     . LEU A  1  1000 ? 143.179 60.667  -17.561 1.00 88.98  ? 1000 LEU A O     1 
ATOM   7785  C  CB    . LEU A  1  1000 ? 140.237 61.893  -18.039 1.00 84.64  ? 1000 LEU A CB    1 
ATOM   7786  C  CG    . LEU A  1  1000 ? 138.803 62.204  -17.668 1.00 88.65  ? 1000 LEU A CG    1 
ATOM   7787  C  CD1   . LEU A  1  1000 ? 138.725 63.495  -16.908 1.00 88.78  ? 1000 LEU A CD1   1 
ATOM   7788  C  CD2   . LEU A  1  1000 ? 137.949 62.294  -18.912 1.00 93.08  ? 1000 LEU A CD2   1 
ATOM   7789  N  N     . ARG A  1  1001 ? 142.232 59.621  -19.331 1.00 86.31  ? 1001 ARG A N     1 
ATOM   7790  C  CA    . ARG A  1  1001 ? 143.549 59.249  -19.834 1.00 86.94  ? 1001 ARG A CA    1 
ATOM   7791  C  C     . ARG A  1  1001 ? 143.962 59.799  -21.202 1.00 95.09  ? 1001 ARG A C     1 
ATOM   7792  O  O     . ARG A  1  1001 ? 145.178 59.840  -21.454 1.00 98.48  ? 1001 ARG A O     1 
ATOM   7793  C  CB    . ARG A  1  1001 ? 143.720 57.728  -19.814 1.00 82.87  ? 1001 ARG A CB    1 
ATOM   7794  C  CG    . ARG A  1  1001 ? 144.289 57.237  -18.493 1.00 81.76  ? 1001 ARG A CG    1 
ATOM   7795  C  CD    . ARG A  1  1001 ? 143.986 55.784  -18.248 1.00 81.84  ? 1001 ARG A CD    1 
ATOM   7796  N  NE    . ARG A  1  1001 ? 143.404 55.577  -16.926 1.00 86.49  ? 1001 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A  1  1001 ? 144.101 55.267  -15.838 1.00 97.10  ? 1001 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A  1  1001 ? 145.418 55.095  -15.911 1.00 82.25  ? 1001 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A  1  1001 ? 143.485 55.108  -14.671 1.00 79.79  ? 1001 ARG A NH2   1 
ATOM   7800  N  N     . GLY A  1  1002 ? 143.021 60.243  -22.038 1.00 90.39  ? 1002 GLY A N     1 
ATOM   7801  C  CA    . GLY A  1  1002 ? 143.346 60.797  -23.360 1.00 91.57  ? 1002 GLY A CA    1 
ATOM   7802  C  C     . GLY A  1  1002 ? 144.576 61.706  -23.474 1.00 96.87  ? 1002 GLY A C     1 
ATOM   7803  O  O     . GLY A  1  1002 ? 144.785 62.570  -22.615 1.00 96.30  ? 1002 GLY A O     1 
ATOM   7804  N  N     . LYS A  1  1003 ? 145.408 61.510  -24.539 1.00 94.73  ? 1003 LYS A N     1 
ATOM   7805  C  CA    . LYS A  1  1003 ? 146.637 62.286  -24.802 1.00 96.27  ? 1003 LYS A CA    1 
ATOM   7806  C  C     . LYS A  1  1003 ? 146.385 63.515  -25.678 1.00 102.05 ? 1003 LYS A C     1 
ATOM   7807  O  O     . LYS A  1  1003 ? 146.843 63.567  -26.824 1.00 103.08 ? 1003 LYS A O     1 
ATOM   7808  C  CB    . LYS A  1  1003 ? 147.756 61.414  -25.418 1.00 99.40  ? 1003 LYS A CB    1 
ATOM   7809  C  CG    . LYS A  1  1003 ? 148.538 60.569  -24.419 1.00 115.80 ? 1003 LYS A CG    1 
ATOM   7810  C  CD    . LYS A  1  1003 ? 149.478 59.594  -25.136 1.00 123.29 ? 1003 LYS A CD    1 
ATOM   7811  C  CE    . LYS A  1  1003 ? 150.018 58.523  -24.213 1.00 130.27 ? 1003 LYS A CE    1 
ATOM   7812  N  NZ    . LYS A  1  1003 ? 150.788 57.479  -24.948 1.00 135.96 ? 1003 LYS A NZ    1 
ATOM   7813  N  N     . ASN A  1  1004 ? 145.673 64.512  -25.123 1.00 98.17  ? 1004 ASN A N     1 
ATOM   7814  C  CA    . ASN A  1  1004 ? 145.334 65.795  -25.756 1.00 98.14  ? 1004 ASN A CA    1 
ATOM   7815  C  C     . ASN A  1  1004 ? 144.918 66.772  -24.666 1.00 101.46 ? 1004 ASN A C     1 
ATOM   7816  O  O     . ASN A  1  1004 ? 144.465 66.328  -23.604 1.00 100.12 ? 1004 ASN A O     1 
ATOM   7817  C  CB    . ASN A  1  1004 ? 144.206 65.638  -26.772 1.00 96.52  ? 1004 ASN A CB    1 
ATOM   7818  C  CG    . ASN A  1  1004 ? 142.916 65.199  -26.154 1.00 107.11 ? 1004 ASN A CG    1 
ATOM   7819  O  OD1   . ASN A  1  1004 ? 142.130 66.010  -25.653 1.00 95.60  ? 1004 ASN A OD1   1 
ATOM   7820  N  ND2   . ASN A  1  1004 ? 142.681 63.902  -26.173 1.00 99.34  ? 1004 ASN A ND2   1 
ATOM   7821  N  N     . GLU A  1  1005 ? 144.975 68.088  -24.956 1.00 98.02  ? 1005 GLU A N     1 
ATOM   7822  C  CA    . GLU A  1  1005 ? 144.684 69.112  -23.962 1.00 97.33  ? 1005 GLU A CA    1 
ATOM   7823  C  C     . GLU A  1  1005 ? 143.227 69.164  -23.469 1.00 97.20  ? 1005 GLU A C     1 
ATOM   7824  O  O     . GLU A  1  1005 ? 143.034 69.437  -22.282 1.00 96.23  ? 1005 GLU A O     1 
ATOM   7825  C  CB    . GLU A  1  1005 ? 145.177 70.491  -24.398 1.00 100.37 ? 1005 GLU A CB    1 
ATOM   7826  C  CG    . GLU A  1  1005 ? 146.669 70.666  -24.126 1.00 116.55 ? 1005 GLU A CG    1 
ATOM   7827  C  CD    . GLU A  1  1005 ? 147.182 70.143  -22.789 1.00 143.85 ? 1005 GLU A CD    1 
ATOM   7828  O  OE1   . GLU A  1  1005 ? 146.909 70.801  -21.758 1.00 146.07 ? 1005 GLU A OE1   1 
ATOM   7829  O  OE2   . GLU A  1  1005 ? 147.810 69.056  -22.764 1.00 127.17 ? 1005 GLU A OE2   1 
ATOM   7830  N  N     . ILE A  1  1006 ? 142.225 68.847  -24.306 1.00 91.31  ? 1006 ILE A N     1 
ATOM   7831  C  CA    . ILE A  1  1006 ? 140.830 68.844  -23.832 1.00 88.91  ? 1006 ILE A CA    1 
ATOM   7832  C  C     . ILE A  1  1006 ? 140.659 67.878  -22.656 1.00 91.12  ? 1006 ILE A C     1 
ATOM   7833  O  O     . ILE A  1  1006 ? 140.123 68.274  -21.618 1.00 90.81  ? 1006 ILE A O     1 
ATOM   7834  C  CB    . ILE A  1  1006 ? 139.805 68.612  -24.970 1.00 90.90  ? 1006 ILE A CB    1 
ATOM   7835  C  CG1   . ILE A  1  1006 ? 139.517 69.929  -25.683 1.00 91.76  ? 1006 ILE A CG1   1 
ATOM   7836  C  CG2   . ILE A  1  1006 ? 138.519 67.995  -24.445 1.00 90.65  ? 1006 ILE A CG2   1 
ATOM   7837  C  CD1   . ILE A  1  1006 ? 138.409 69.927  -26.667 1.00 95.71  ? 1006 ILE A CD1   1 
ATOM   7838  N  N     . ILE A  1  1007 ? 141.157 66.633  -22.813 1.00 86.27  ? 1007 ILE A N     1 
ATOM   7839  C  CA    . ILE A  1  1007 ? 141.074 65.580  -21.798 1.00 84.11  ? 1007 ILE A CA    1 
ATOM   7840  C  C     . ILE A  1  1007 ? 142.095 65.832  -20.669 1.00 88.88  ? 1007 ILE A C     1 
ATOM   7841  O  O     . ILE A  1  1007 ? 141.798 65.524  -19.511 1.00 87.80  ? 1007 ILE A O     1 
ATOM   7842  C  CB    . ILE A  1  1007 ? 141.174 64.159  -22.439 1.00 85.56  ? 1007 ILE A CB    1 
ATOM   7843  C  CG1   . ILE A  1  1007 ? 140.106 63.910  -23.532 1.00 84.78  ? 1007 ILE A CG1   1 
ATOM   7844  C  CG2   . ILE A  1  1007 ? 141.141 63.062  -21.402 1.00 85.55  ? 1007 ILE A CG2   1 
ATOM   7845  C  CD1   . ILE A  1  1007 ? 138.600 63.997  -23.089 1.00 90.15  ? 1007 ILE A CD1   1 
ATOM   7846  N  N     . GLN A  1  1008 ? 143.268 66.431  -20.991 1.00 86.39  ? 1008 GLN A N     1 
ATOM   7847  C  CA    . GLN A  1  1008 ? 144.285 66.714  -19.973 1.00 86.46  ? 1008 GLN A CA    1 
ATOM   7848  C  C     . GLN A  1  1008 ? 143.859 67.814  -19.014 1.00 90.01  ? 1008 GLN A C     1 
ATOM   7849  O  O     . GLN A  1  1008 ? 143.972 67.600  -17.807 1.00 90.09  ? 1008 GLN A O     1 
ATOM   7850  C  CB    . GLN A  1  1008 ? 145.669 66.979  -20.570 1.00 88.86  ? 1008 GLN A CB    1 
ATOM   7851  C  CG    . GLN A  1  1008 ? 146.411 65.703  -20.994 1.00 100.01 ? 1008 GLN A CG    1 
ATOM   7852  C  CD    . GLN A  1  1008 ? 146.582 64.704  -19.872 1.00 112.63 ? 1008 GLN A CD    1 
ATOM   7853  O  OE1   . GLN A  1  1008 ? 147.296 64.935  -18.893 1.00 105.72 ? 1008 GLN A OE1   1 
ATOM   7854  N  NE2   . GLN A  1  1008 ? 145.910 63.573  -19.988 1.00 106.61 ? 1008 GLN A NE2   1 
ATOM   7855  N  N     . ASN A  1  1009 ? 143.303 68.945  -19.525 1.00 85.36  ? 1009 ASN A N     1 
ATOM   7856  C  CA    . ASN A  1  1009 ? 142.784 70.023  -18.674 1.00 84.95  ? 1009 ASN A CA    1 
ATOM   7857  C  C     . ASN A  1  1009 ? 141.626 69.503  -17.834 1.00 89.31  ? 1009 ASN A C     1 
ATOM   7858  O  O     . ASN A  1  1009 ? 141.485 69.920  -16.684 1.00 90.59  ? 1009 ASN A O     1 
ATOM   7859  C  CB    . ASN A  1  1009 ? 142.301 71.207  -19.490 1.00 84.40  ? 1009 ASN A CB    1 
ATOM   7860  C  CG    . ASN A  1  1009 ? 143.380 71.946  -20.228 1.00 112.98 ? 1009 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A  1  1009 ? 144.401 72.360  -19.664 1.00 113.96 ? 1009 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A  1  1009 ? 143.137 72.190  -21.501 1.00 103.38 ? 1009 ASN A ND2   1 
ATOM   7863  N  N     . ALA A  1  1010 ? 140.817 68.572  -18.400 1.00 83.66  ? 1010 ALA A N     1 
ATOM   7864  C  CA    . ALA A  1  1010 ? 139.685 67.921  -17.737 1.00 81.55  ? 1010 ALA A CA    1 
ATOM   7865  C  C     . ALA A  1  1010 ? 140.138 67.035  -16.571 1.00 83.52  ? 1010 ALA A C     1 
ATOM   7866  O  O     . ALA A  1  1010 ? 139.402 66.888  -15.581 1.00 81.92  ? 1010 ALA A O     1 
ATOM   7867  C  CB    . ALA A  1  1010 ? 138.909 67.093  -18.740 1.00 81.63  ? 1010 ALA A CB    1 
ATOM   7868  N  N     . GLN A  1  1011 ? 141.343 66.431  -16.705 1.00 79.95  ? 1011 GLN A N     1 
ATOM   7869  C  CA    . GLN A  1  1011 ? 141.946 65.579  -15.681 1.00 79.10  ? 1011 GLN A CA    1 
ATOM   7870  C  C     . GLN A  1  1011 ? 142.414 66.445  -14.512 1.00 86.08  ? 1011 GLN A C     1 
ATOM   7871  O  O     . GLN A  1  1011 ? 142.164 66.089  -13.357 1.00 85.20  ? 1011 GLN A O     1 
ATOM   7872  C  CB    . GLN A  1  1011 ? 143.077 64.723  -16.269 1.00 79.52  ? 1011 GLN A CB    1 
ATOM   7873  C  CG    . GLN A  1  1011 ? 144.082 64.169  -15.261 1.00 81.60  ? 1011 GLN A CG    1 
ATOM   7874  C  CD    . GLN A  1  1011 ? 143.497 63.256  -14.217 1.00 96.74  ? 1011 GLN A CD    1 
ATOM   7875  O  OE1   . GLN A  1  1011 ? 142.490 62.599  -14.433 1.00 97.93  ? 1011 GLN A OE1   1 
ATOM   7876  N  NE2   . GLN A  1  1011 ? 144.117 63.198  -13.058 1.00 79.08  ? 1011 GLN A NE2   1 
ATOM   7877  N  N     . ARG A  1  1012 ? 143.046 67.601  -14.815 1.00 85.35  ? 1012 ARG A N     1 
ATOM   7878  C  CA    . ARG A  1  1012 ? 143.499 68.561  -13.802 1.00 86.72  ? 1012 ARG A CA    1 
ATOM   7879  C  C     . ARG A  1  1012 ? 142.287 69.089  -13.035 1.00 92.90  ? 1012 ARG A C     1 
ATOM   7880  O  O     . ARG A  1  1012 ? 142.338 69.153  -11.805 1.00 93.58  ? 1012 ARG A O     1 
ATOM   7881  C  CB    . ARG A  1  1012 ? 144.274 69.719  -14.433 1.00 88.49  ? 1012 ARG A CB    1 
ATOM   7882  C  CG    . ARG A  1  1012 ? 145.558 69.296  -15.116 1.00 103.21 ? 1012 ARG A CG    1 
ATOM   7883  C  CD    . ARG A  1  1012 ? 146.006 70.321  -16.135 1.00 116.95 ? 1012 ARG A CD    1 
ATOM   7884  N  NE    . ARG A  1  1012 ? 146.810 69.689  -17.179 1.00 128.57 ? 1012 ARG A NE    1 
ATOM   7885  C  CZ    . ARG A  1  1012 ? 147.162 70.279  -18.313 1.00 145.50 ? 1012 ARG A CZ    1 
ATOM   7886  N  NH1   . ARG A  1  1012 ? 146.796 71.530  -18.561 1.00 133.43 ? 1012 ARG A NH1   1 
ATOM   7887  N  NH2   . ARG A  1  1012 ? 147.888 69.624  -19.210 1.00 134.89 ? 1012 ARG A NH2   1 
ATOM   7888  N  N     . ASP A  1  1013 ? 141.183 69.413  -13.756 1.00 89.94  ? 1013 ASP A N     1 
ATOM   7889  C  CA    . ASP A  1  1013 ? 139.930 69.901  -13.174 1.00 90.47  ? 1013 ASP A CA    1 
ATOM   7890  C  C     . ASP A  1  1013 ? 139.341 68.894  -12.164 1.00 94.28  ? 1013 ASP A C     1 
ATOM   7891  O  O     . ASP A  1  1013 ? 138.954 69.285  -11.059 1.00 94.28  ? 1013 ASP A O     1 
ATOM   7892  C  CB    . ASP A  1  1013 ? 138.893 70.210  -14.276 1.00 92.80  ? 1013 ASP A CB    1 
ATOM   7893  C  CG    . ASP A  1  1013 ? 139.068 71.536  -14.992 1.00 112.28 ? 1013 ASP A CG    1 
ATOM   7894  O  OD1   . ASP A  1  1013 ? 139.525 72.511  -14.344 1.00 115.90 ? 1013 ASP A OD1   1 
ATOM   7895  O  OD2   . ASP A  1  1013 ? 138.684 71.624  -16.180 1.00 120.33 ? 1013 ASP A OD2   1 
ATOM   7896  N  N     . ALA A  1  1014 ? 139.306 67.600  -12.544 1.00 89.10  ? 1014 ALA A N     1 
ATOM   7897  C  CA    . ALA A  1  1014 ? 138.765 66.502  -11.746 1.00 87.04  ? 1014 ALA A CA    1 
ATOM   7898  C  C     . ALA A  1  1014 ? 139.455 66.299  -10.389 1.00 88.82  ? 1014 ALA A C     1 
ATOM   7899  O  O     . ALA A  1  1014 ? 138.813 65.896  -9.410  1.00 87.99  ? 1014 ALA A O     1 
ATOM   7900  C  CB    . ALA A  1  1014 ? 138.829 65.217  -12.553 1.00 87.08  ? 1014 ALA A CB    1 
ATOM   7901  N  N     . VAL A  1  1015 ? 140.763 66.561  -10.340 1.00 83.90  ? 1015 VAL A N     1 
ATOM   7902  C  CA    . VAL A  1  1015 ? 141.560 66.321  -9.145  1.00 82.71  ? 1015 VAL A CA    1 
ATOM   7903  C  C     . VAL A  1  1015 ? 141.984 67.618  -8.422  1.00 89.11  ? 1015 VAL A C     1 
ATOM   7904  O  O     . VAL A  1  1015 ? 142.829 67.557  -7.528  1.00 90.46  ? 1015 VAL A O     1 
ATOM   7905  C  CB    . VAL A  1  1015 ? 142.770 65.403  -9.480  1.00 84.85  ? 1015 VAL A CB    1 
ATOM   7906  C  CG1   . VAL A  1  1015 ? 142.315 64.074  -10.072 1.00 83.09  ? 1015 VAL A CG1   1 
ATOM   7907  C  CG2   . VAL A  1  1015 ? 143.750 66.091  -10.416 1.00 85.43  ? 1015 VAL A CG2   1 
ATOM   7908  N  N     . THR A  1  1016 ? 141.410 68.783  -8.793  1.00 84.51  ? 1016 THR A N     1 
ATOM   7909  C  CA    . THR A  1  1016 ? 141.774 70.050  -8.160  1.00 84.29  ? 1016 THR A CA    1 
ATOM   7910  C  C     . THR A  1  1016 ? 141.556 70.010  -6.643  1.00 87.43  ? 1016 THR A C     1 
ATOM   7911  O  O     . THR A  1  1016 ? 142.500 70.239  -5.896  1.00 88.33  ? 1016 THR A O     1 
ATOM   7912  C  CB    . THR A  1  1016 ? 141.075 71.222  -8.835  1.00 90.99  ? 1016 THR A CB    1 
ATOM   7913  O  OG1   . THR A  1  1016 ? 141.244 71.123  -10.244 1.00 95.05  ? 1016 THR A OG1   1 
ATOM   7914  C  CG2   . THR A  1  1016 ? 141.583 72.563  -8.351  1.00 88.12  ? 1016 THR A CG2   1 
ATOM   7915  N  N     . LEU A  1  1017 ? 140.340 69.672  -6.193  1.00 82.28  ? 1017 LEU A N     1 
ATOM   7916  C  CA    . LEU A  1  1017 ? 140.024 69.623  -4.770  1.00 81.17  ? 1017 LEU A CA    1 
ATOM   7917  C  C     . LEU A  1  1017 ? 140.769 68.500  -4.052  1.00 85.87  ? 1017 LEU A C     1 
ATOM   7918  O  O     . LEU A  1  1017 ? 141.221 68.742  -2.928  1.00 87.26  ? 1017 LEU A O     1 
ATOM   7919  C  CB    . LEU A  1  1017 ? 138.499 69.579  -4.519  1.00 79.76  ? 1017 LEU A CB    1 
ATOM   7920  C  CG    . LEU A  1  1017 ? 137.979 69.640  -3.075  1.00 82.87  ? 1017 LEU A CG    1 
ATOM   7921  C  CD1   . LEU A  1  1017 ? 138.183 71.005  -2.473  1.00 82.79  ? 1017 LEU A CD1   1 
ATOM   7922  C  CD2   . LEU A  1  1017 ? 136.489 69.254  -3.013  1.00 84.02  ? 1017 LEU A CD2   1 
ATOM   7923  N  N     . PHE A  1  1018 ? 140.947 67.300  -4.683  1.00 80.41  ? 1018 PHE A N     1 
ATOM   7924  C  CA    . PHE A  1  1018 ? 141.690 66.226  -3.984  1.00 79.47  ? 1018 PHE A CA    1 
ATOM   7925  C  C     . PHE A  1  1018 ? 143.127 66.621  -3.690  1.00 83.77  ? 1018 PHE A C     1 
ATOM   7926  O  O     . PHE A  1  1018 ? 143.593 66.438  -2.569  1.00 82.54  ? 1018 PHE A O     1 
ATOM   7927  C  CB    . PHE A  1  1018 ? 141.622 64.847  -4.682  1.00 80.03  ? 1018 PHE A CB    1 
ATOM   7928  C  CG    . PHE A  1  1018 ? 142.361 63.771  -3.913  1.00 80.33  ? 1018 PHE A CG    1 
ATOM   7929  C  CD1   . PHE A  1  1018 ? 141.890 63.323  -2.684  1.00 82.20  ? 1018 PHE A CD1   1 
ATOM   7930  C  CD2   . PHE A  1  1018 ? 143.566 63.266  -4.378  1.00 82.28  ? 1018 PHE A CD2   1 
ATOM   7931  C  CE1   . PHE A  1  1018 ? 142.613 62.396  -1.938  1.00 82.82  ? 1018 PHE A CE1   1 
ATOM   7932  C  CE2   . PHE A  1  1018 ? 144.285 62.333  -3.633  1.00 84.69  ? 1018 PHE A CE2   1 
ATOM   7933  C  CZ    . PHE A  1  1018 ? 143.795 61.893  -2.428  1.00 82.39  ? 1018 PHE A CZ    1 
ATOM   7934  N  N     . CYS A  1  1019 ? 143.796 67.220  -4.680  1.00 82.65  ? 1019 CYS A N     1 
ATOM   7935  C  CA    . CYS A  1  1019 ? 145.161 67.709  -4.563  1.00 84.19  ? 1019 CYS A CA    1 
ATOM   7936  C  C     . CYS A  1  1019 ? 145.299 68.817  -3.536  1.00 86.58  ? 1019 CYS A C     1 
ATOM   7937  O  O     . CYS A  1  1019 ? 146.291 68.837  -2.817  1.00 86.34  ? 1019 CYS A O     1 
ATOM   7938  C  CB    . CYS A  1  1019 ? 145.711 68.105  -5.923  1.00 86.06  ? 1019 CYS A CB    1 
ATOM   7939  S  SG    . CYS A  1  1019 ? 145.895 66.701  -7.059  1.00 90.05  ? 1019 CYS A SG    1 
ATOM   7940  N  N     . CYS A  1  1020 ? 144.270 69.664  -3.380  1.00 82.97  ? 1020 CYS A N     1 
ATOM   7941  C  CA    . CYS A  1  1020 ? 144.260 70.700  -2.348  1.00 84.17  ? 1020 CYS A CA    1 
ATOM   7942  C  C     . CYS A  1  1020 ? 144.341 70.053  -0.980  1.00 89.00  ? 1020 CYS A C     1 
ATOM   7943  O  O     . CYS A  1  1020 ? 145.039 70.566  -0.104  1.00 90.69  ? 1020 CYS A O     1 
ATOM   7944  C  CB    . CYS A  1  1020 ? 143.026 71.580  -2.466  1.00 84.49  ? 1020 CYS A CB    1 
ATOM   7945  S  SG    . CYS A  1  1020 ? 143.139 72.814  -3.774  1.00 89.30  ? 1020 CYS A SG    1 
ATOM   7946  N  N     . LEU A  1  1021 ? 143.642 68.914  -0.805  1.00 83.72  ? 1021 LEU A N     1 
ATOM   7947  C  CA    . LEU A  1  1021 ? 143.667 68.156  0.434   1.00 82.95  ? 1021 LEU A CA    1 
ATOM   7948  C  C     . LEU A  1  1021 ? 145.059 67.578  0.572   1.00 89.13  ? 1021 LEU A C     1 
ATOM   7949  O  O     . LEU A  1  1021 ? 145.738 67.894  1.548   1.00 90.66  ? 1021 LEU A O     1 
ATOM   7950  C  CB    . LEU A  1  1021 ? 142.594 67.053  0.423   1.00 81.16  ? 1021 LEU A CB    1 
ATOM   7951  C  CG    . LEU A  1  1021 ? 142.576 66.064  1.585   1.00 84.51  ? 1021 LEU A CG    1 
ATOM   7952  C  CD1   . LEU A  1  1021 ? 142.225 66.743  2.903   1.00 84.71  ? 1021 LEU A CD1   1 
ATOM   7953  C  CD2   . LEU A  1  1021 ? 141.610 64.932  1.303   1.00 85.85  ? 1021 LEU A CD2   1 
ATOM   7954  N  N     . LEU A  1  1022 ? 145.511 66.819  -0.458  1.00 85.03  ? 1022 LEU A N     1 
ATOM   7955  C  CA    . LEU A  1  1022 ? 146.822 66.162  -0.558  1.00 84.20  ? 1022 LEU A CA    1 
ATOM   7956  C  C     . LEU A  1  1022 ? 148.000 67.067  -0.147  1.00 86.39  ? 1022 LEU A C     1 
ATOM   7957  O  O     . LEU A  1  1022 ? 148.775 66.689  0.728   1.00 85.18  ? 1022 LEU A O     1 
ATOM   7958  C  CB    . LEU A  1  1022 ? 147.017 65.599  -1.986  1.00 83.64  ? 1022 LEU A CB    1 
ATOM   7959  C  CG    . LEU A  1  1022 ? 148.293 64.804  -2.256  1.00 89.07  ? 1022 LEU A CG    1 
ATOM   7960  C  CD1   . LEU A  1  1022 ? 148.245 63.429  -1.589  1.00 89.40  ? 1022 LEU A CD1   1 
ATOM   7961  C  CD2   . LEU A  1  1022 ? 148.526 64.642  -3.735  1.00 89.84  ? 1022 LEU A CD2   1 
ATOM   7962  N  N     . ARG A  1  1023 ? 148.090 68.263  -0.745  1.00 83.55  ? 1023 ARG A N     1 
ATOM   7963  C  CA    . ARG A  1  1023 ? 149.159 69.246  -0.520  1.00 85.14  ? 1023 ARG A CA    1 
ATOM   7964  C  C     . ARG A  1  1023 ? 149.213 69.777  0.906   1.00 90.79  ? 1023 ARG A C     1 
ATOM   7965  O  O     . ARG A  1  1023 ? 150.308 69.917  1.465   1.00 91.39  ? 1023 ARG A O     1 
ATOM   7966  C  CB    . ARG A  1  1023 ? 149.067 70.398  -1.532  1.00 84.54  ? 1023 ARG A CB    1 
ATOM   7967  C  CG    . ARG A  1  1023 ? 149.463 69.972  -2.929  1.00 88.39  ? 1023 ARG A CG    1 
ATOM   7968  C  CD    . ARG A  1  1023 ? 149.672 71.158  -3.823  1.00 94.95  ? 1023 ARG A CD    1 
ATOM   7969  N  NE    . ARG A  1  1023 ? 149.027 70.963  -5.117  1.00 94.55  ? 1023 ARG A NE    1 
ATOM   7970  C  CZ    . ARG A  1  1023 ? 147.838 71.459  -5.428  1.00 99.88  ? 1023 ARG A CZ    1 
ATOM   7971  N  NH1   . ARG A  1  1023 ? 147.165 72.180  -4.550  1.00 75.01  ? 1023 ARG A NH1   1 
ATOM   7972  N  NH2   . ARG A  1  1023 ? 147.308 71.229  -6.624  1.00 92.20  ? 1023 ARG A NH2   1 
ATOM   7973  N  N     . SER A  1  1024 ? 148.026 70.072  1.484   1.00 86.66  ? 1024 SER A N     1 
ATOM   7974  C  CA    . SER A  1  1024 ? 147.852 70.557  2.850   1.00 86.32  ? 1024 SER A CA    1 
ATOM   7975  C  C     . SER A  1  1024 ? 148.230 69.470  3.851   1.00 90.58  ? 1024 SER A C     1 
ATOM   7976  O  O     . SER A  1  1024 ? 148.708 69.784  4.932   1.00 92.42  ? 1024 SER A O     1 
ATOM   7977  C  CB    . SER A  1  1024 ? 146.414 71.028  3.081   1.00 88.18  ? 1024 SER A CB    1 
ATOM   7978  O  OG    . SER A  1  1024 ? 145.426 70.023  3.255   1.00 92.67  ? 1024 SER A OG    1 
ATOM   7979  N  N     . ARG A  1  1025 ? 148.027 68.201  3.498   1.00 84.81  ? 1025 ARG A N     1 
ATOM   7980  C  CA    . ARG A  1  1025 ? 148.326 67.098  4.400   1.00 83.87  ? 1025 ARG A CA    1 
ATOM   7981  C  C     . ARG A  1  1025 ? 149.769 66.648  4.289   1.00 88.74  ? 1025 ARG A C     1 
ATOM   7982  O  O     . ARG A  1  1025 ? 150.337 66.177  5.273   1.00 89.18  ? 1025 ARG A O     1 
ATOM   7983  C  CB    . ARG A  1  1025 ? 147.362 65.915  4.164   1.00 80.29  ? 1025 ARG A CB    1 
ATOM   7984  C  CG    . ARG A  1  1025 ? 145.908 66.214  4.501   1.00 83.50  ? 1025 ARG A CG    1 
ATOM   7985  C  CD    . ARG A  1  1025 ? 145.626 66.165  5.988   1.00 88.48  ? 1025 ARG A CD    1 
ATOM   7986  N  NE    . ARG A  1  1025 ? 144.220 66.439  6.283   1.00 95.36  ? 1025 ARG A NE    1 
ATOM   7987  C  CZ    . ARG A  1  1025 ? 143.275 65.505  6.371   1.00 115.84 ? 1025 ARG A CZ    1 
ATOM   7988  N  NH1   . ARG A  1  1025 ? 143.574 64.225  6.171   1.00 107.86 ? 1025 ARG A NH1   1 
ATOM   7989  N  NH2   . ARG A  1  1025 ? 142.025 65.842  6.654   1.00 105.10 ? 1025 ARG A NH2   1 
ATOM   7990  N  N     . LEU A  1  1026 ? 150.366 66.776  3.101   1.00 84.94  ? 1026 LEU A N     1 
ATOM   7991  C  CA    . LEU A  1  1026 ? 151.737 66.312  2.911   1.00 84.92  ? 1026 LEU A CA    1 
ATOM   7992  C  C     . LEU A  1  1026 ? 152.745 67.459  2.672   1.00 91.10  ? 1026 LEU A C     1 
ATOM   7993  O  O     . LEU A  1  1026 ? 153.720 67.302  1.925   1.00 91.44  ? 1026 LEU A O     1 
ATOM   7994  C  CB    . LEU A  1  1026 ? 151.812 65.224  1.823   1.00 83.62  ? 1026 LEU A CB    1 
ATOM   7995  C  CG    . LEU A  1  1026 ? 150.883 64.018  1.998   1.00 86.35  ? 1026 LEU A CG    1 
ATOM   7996  C  CD1   . LEU A  1  1026 ? 151.066 63.050  0.882   1.00 85.69  ? 1026 LEU A CD1   1 
ATOM   7997  C  CD2   . LEU A  1  1026 ? 151.110 63.312  3.325   1.00 88.61  ? 1026 LEU A CD2   1 
ATOM   7998  N  N     . ALA A  1  1027 ? 152.527 68.601  3.360   1.00 88.13  ? 1027 ALA A N     1 
ATOM   7999  C  CA    . ALA A  1  1027 ? 153.433 69.745  3.313   1.00 88.92  ? 1027 ALA A CA    1 
ATOM   8000  C  C     . ALA A  1  1027 ? 154.683 69.355  4.126   1.00 93.87  ? 1027 ALA A C     1 
ATOM   8001  O  O     . ALA A  1  1027 ? 154.567 68.565  5.070   1.00 93.47  ? 1027 ALA A O     1 
ATOM   8002  C  CB    . ALA A  1  1027 ? 152.759 70.960  3.918   1.00 89.85  ? 1027 ALA A CB    1 
ATOM   8003  N  N     . THR A  1  1028 ? 155.870 69.864  3.740   1.00 90.83  ? 1028 THR A N     1 
ATOM   8004  C  CA    . THR A  1  1028 ? 157.153 69.534  4.370   1.00 91.07  ? 1028 THR A CA    1 
ATOM   8005  C  C     . THR A  1  1028 ? 157.125 69.669  5.893   1.00 94.93  ? 1028 THR A C     1 
ATOM   8006  O  O     . THR A  1  1028 ? 157.497 68.708  6.561   1.00 95.01  ? 1028 THR A O     1 
ATOM   8007  C  CB    . THR A  1  1028 ? 158.287 70.317  3.722   1.00 100.14 ? 1028 THR A CB    1 
ATOM   8008  O  OG1   . THR A  1  1028 ? 158.361 69.914  2.357   1.00 98.68  ? 1028 THR A OG1   1 
ATOM   8009  C  CG2   . THR A  1  1028 ? 159.634 70.070  4.384   1.00 100.68 ? 1028 THR A CG2   1 
ATOM   8010  N  N     . ARG A  1  1029 ? 156.666 70.818  6.441   1.00 91.46  ? 1029 ARG A N     1 
ATOM   8011  C  CA    . ARG A  1  1029 ? 156.599 71.029  7.897   1.00 91.55  ? 1029 ARG A CA    1 
ATOM   8012  C  C     . ARG A  1  1029 ? 155.719 69.985  8.578   1.00 93.04  ? 1029 ARG A C     1 
ATOM   8013  O  O     . ARG A  1  1029 ? 156.154 69.336  9.527   1.00 92.23  ? 1029 ARG A O     1 
ATOM   8014  C  CB    . ARG A  1  1029 ? 156.113 72.443  8.235   1.00 92.85  ? 1029 ARG A CB    1 
ATOM   8015  C  CG    . ARG A  1  1029 ? 156.004 72.707  9.735   1.00 101.94 ? 1029 ARG A CG    1 
ATOM   8016  C  CD    . ARG A  1  1029 ? 156.656 74.015  10.130  1.00 98.22  ? 1029 ARG A CD    1 
ATOM   8017  N  NE    . ARG A  1  1029 ? 158.091 73.853  10.309  1.00 94.53  ? 1029 ARG A NE    1 
ATOM   8018  C  CZ    . ARG A  1  1029 ? 158.936 74.856  10.503  1.00 117.13 ? 1029 ARG A CZ    1 
ATOM   8019  N  NH1   . ARG A  1  1029 ? 158.494 76.108  10.545  1.00 108.39 ? 1029 ARG A NH1   1 
ATOM   8020  N  NH2   . ARG A  1  1029 ? 160.231 74.618  10.653  1.00 107.75 ? 1029 ARG A NH2   1 
ATOM   8021  N  N     . ARG A  1  1030 ? 154.498 69.812  8.058   1.00 88.12  ? 1030 ARG A N     1 
ATOM   8022  C  CA    . ARG A  1  1030 ? 153.505 68.859  8.538   1.00 86.12  ? 1030 ARG A CA    1 
ATOM   8023  C  C     . ARG A  1  1030 ? 154.056 67.424  8.550   1.00 89.45  ? 1030 ARG A C     1 
ATOM   8024  O  O     . ARG A  1  1030 ? 153.945 66.749  9.568   1.00 88.31  ? 1030 ARG A O     1 
ATOM   8025  C  CB    . ARG A  1  1030 ? 152.237 68.978  7.688   1.00 82.90  ? 1030 ARG A CB    1 
ATOM   8026  C  CG    . ARG A  1  1030 ? 151.031 68.326  8.322   1.00 94.14  ? 1030 ARG A CG    1 
ATOM   8027  C  CD    . ARG A  1  1030 ? 149.770 69.124  8.088   1.00 99.36  ? 1030 ARG A CD    1 
ATOM   8028  N  NE    . ARG A  1  1030 ? 148.704 68.733  9.007   1.00 101.92 ? 1030 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A  1  1030 ? 147.420 68.686  8.680   1.00 119.01 ? 1030 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A  1  1030 ? 147.032 68.981  7.446   1.00 108.55 ? 1030 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A  1  1030 ? 146.513 68.329  9.578   1.00 110.91 ? 1030 ARG A NH2   1 
ATOM   8032  N  N     . VAL A  1  1031 ? 154.695 66.990  7.445   1.00 86.48  ? 1031 VAL A N     1 
ATOM   8033  C  CA    . VAL A  1  1031 ? 155.256 65.648  7.291   1.00 86.05  ? 1031 VAL A CA    1 
ATOM   8034  C  C     . VAL A  1  1031 ? 156.351 65.379  8.311   1.00 93.45  ? 1031 VAL A C     1 
ATOM   8035  O  O     . VAL A  1  1031 ? 156.316 64.335  8.963   1.00 93.88  ? 1031 VAL A O     1 
ATOM   8036  C  CB    . VAL A  1  1031 ? 155.713 65.374  5.830   1.00 89.32  ? 1031 VAL A CB    1 
ATOM   8037  C  CG1   . VAL A  1  1031 ? 156.672 64.193  5.736   1.00 89.45  ? 1031 VAL A CG1   1 
ATOM   8038  C  CG2   . VAL A  1  1031 ? 154.521 65.141  4.924   1.00 87.70  ? 1031 VAL A CG2   1 
ATOM   8039  N  N     . LEU A  1  1032 ? 157.303 66.321  8.464   1.00 91.69  ? 1032 LEU A N     1 
ATOM   8040  C  CA    . LEU A  1  1032 ? 158.454 66.171  9.360   1.00 92.83  ? 1032 LEU A CA    1 
ATOM   8041  C  C     . LEU A  1  1032 ? 158.158 66.417  10.834  1.00 98.72  ? 1032 LEU A C     1 
ATOM   8042  O  O     . LEU A  1  1032 ? 158.528 65.588  11.668  1.00 99.10  ? 1032 LEU A O     1 
ATOM   8043  C  CB    . LEU A  1  1032 ? 159.637 67.054  8.915   1.00 93.91  ? 1032 LEU A CB    1 
ATOM   8044  C  CG    . LEU A  1  1032 ? 160.255 66.773  7.552   1.00 98.06  ? 1032 LEU A CG    1 
ATOM   8045  C  CD1   . LEU A  1  1032 ? 161.166 67.883  7.148   1.00 99.25  ? 1032 LEU A CD1   1 
ATOM   8046  C  CD2   . LEU A  1  1032 ? 161.029 65.470  7.541   1.00 100.84 ? 1032 LEU A CD2   1 
ATOM   8047  N  N     . GLN A  1  1033 ? 157.543 67.571  11.157  1.00 95.68  ? 1033 GLN A N     1 
ATOM   8048  C  CA    . GLN A  1  1033 ? 157.256 67.991  12.528  1.00 96.32  ? 1033 GLN A CA    1 
ATOM   8049  C  C     . GLN A  1  1033 ? 156.109 67.226  13.152  1.00 100.40 ? 1033 GLN A C     1 
ATOM   8050  O  O     . GLN A  1  1033 ? 156.262 66.697  14.255  1.00 101.07 ? 1033 GLN A O     1 
ATOM   8051  C  CB    . GLN A  1  1033 ? 156.987 69.503  12.585  1.00 98.13  ? 1033 GLN A CB    1 
ATOM   8052  C  CG    . GLN A  1  1033 ? 157.159 70.135  13.955  1.00 111.87 ? 1033 GLN A CG    1 
ATOM   8053  C  CD    . GLN A  1  1033 ? 156.988 71.624  13.847  1.00 134.20 ? 1033 GLN A CD    1 
ATOM   8054  O  OE1   . GLN A  1  1033 ? 157.933 72.363  13.554  1.00 132.37 ? 1033 GLN A OE1   1 
ATOM   8055  N  NE2   . GLN A  1  1033 ? 155.764 72.094  14.020  1.00 126.96 ? 1033 GLN A NE2   1 
ATOM   8056  N  N     . GLU A  1  1034 ? 154.955 67.190  12.460  1.00 95.55  ? 1034 GLU A N     1 
ATOM   8057  C  CA    . GLU A  1  1034 ? 153.739 66.552  12.952  1.00 93.65  ? 1034 GLU A CA    1 
ATOM   8058  C  C     . GLU A  1  1034 ? 153.831 65.033  12.897  1.00 97.34  ? 1034 GLU A C     1 
ATOM   8059  O  O     . GLU A  1  1034 ? 154.014 64.417  13.949  1.00 97.81  ? 1034 GLU A O     1 
ATOM   8060  C  CB    . GLU A  1  1034 ? 152.481 67.102  12.239  1.00 93.58  ? 1034 GLU A CB    1 
ATOM   8061  C  CG    . GLU A  1  1034 ? 152.238 68.582  12.496  1.00 102.24 ? 1034 GLU A CG    1 
ATOM   8062  C  CD    . GLU A  1  1034 ? 151.118 69.246  11.720  1.00 122.28 ? 1034 GLU A CD    1 
ATOM   8063  O  OE1   . GLU A  1  1034 ? 149.983 68.716  11.727  1.00 117.61 ? 1034 GLU A OE1   1 
ATOM   8064  O  OE2   . GLU A  1  1034 ? 151.370 70.325  11.137  1.00 120.17 ? 1034 GLU A OE2   1 
ATOM   8065  N  N     . TYR A  1  1035 ? 153.783 64.444  11.677  1.00 92.87  ? 1035 TYR A N     1 
ATOM   8066  C  CA    . TYR A  1  1035 ? 153.769 62.995  11.414  1.00 91.43  ? 1035 TYR A CA    1 
ATOM   8067  C  C     . TYR A  1  1035 ? 155.065 62.259  11.763  1.00 94.76  ? 1035 TYR A C     1 
ATOM   8068  O  O     . TYR A  1  1035 ? 155.001 61.077  12.091  1.00 93.61  ? 1035 TYR A O     1 
ATOM   8069  C  CB    . TYR A  1  1035 ? 153.366 62.675  9.955   1.00 91.58  ? 1035 TYR A CB    1 
ATOM   8070  C  CG    . TYR A  1  1035 ? 152.183 63.430  9.379   1.00 93.04  ? 1035 TYR A CG    1 
ATOM   8071  C  CD1   . TYR A  1  1035 ? 151.333 64.172  10.196  1.00 95.52  ? 1035 TYR A CD1   1 
ATOM   8072  C  CD2   . TYR A  1  1035 ? 151.900 63.385  8.019   1.00 93.25  ? 1035 TYR A CD2   1 
ATOM   8073  C  CE1   . TYR A  1  1035 ? 150.275 64.908  9.665   1.00 96.61  ? 1035 TYR A CE1   1 
ATOM   8074  C  CE2   . TYR A  1  1035 ? 150.818 64.080  7.481   1.00 93.84  ? 1035 TYR A CE2   1 
ATOM   8075  C  CZ    . TYR A  1  1035 ? 150.015 64.852  8.307   1.00 104.26 ? 1035 TYR A CZ    1 
ATOM   8076  O  OH    . TYR A  1  1035 ? 148.950 65.559  7.795   1.00 107.49 ? 1035 TYR A OH    1 
ATOM   8077  N  N     . ARG A  1  1036 ? 156.228 62.936  11.659  1.00 92.20  ? 1036 ARG A N     1 
ATOM   8078  C  CA    . ARG A  1  1036 ? 157.563 62.386  11.947  1.00 92.97  ? 1036 ARG A CA    1 
ATOM   8079  C  C     . ARG A  1  1036 ? 157.933 61.146  11.096  1.00 94.94  ? 1036 ARG A C     1 
ATOM   8080  O  O     . ARG A  1  1036 ? 158.689 60.282  11.558  1.00 95.20  ? 1036 ARG A O     1 
ATOM   8081  C  CB    . ARG A  1  1036 ? 157.730 62.096  13.457  1.00 94.79  ? 1036 ARG A CB    1 
ATOM   8082  C  CG    . ARG A  1  1036 ? 158.004 63.320  14.308  1.00 107.72 ? 1036 ARG A CG    1 
ATOM   8083  C  CD    . ARG A  1  1036 ? 159.478 63.724  14.279  1.00 117.55 ? 1036 ARG A CD    1 
ATOM   8084  N  NE    . ARG A  1  1036 ? 159.934 64.206  15.582  1.00 124.47 ? 1036 ARG A NE    1 
ATOM   8085  C  CZ    . ARG A  1  1036 ? 159.580 65.370  16.120  1.00 139.32 ? 1036 ARG A CZ    1 
ATOM   8086  N  NH1   . ARG A  1  1036 ? 158.751 66.184  15.477  1.00 120.49 ? 1036 ARG A NH1   1 
ATOM   8087  N  NH2   . ARG A  1  1036 ? 160.040 65.722  17.312  1.00 133.50 ? 1036 ARG A NH2   1 
ATOM   8088  N  N     . LEU A  1  1037 ? 157.433 61.083  9.848   1.00 89.15  ? 1037 LEU A N     1 
ATOM   8089  C  CA    . LEU A  1  1037 ? 157.670 59.957  8.937   1.00 87.90  ? 1037 LEU A CA    1 
ATOM   8090  C  C     . LEU A  1  1037 ? 159.135 59.746  8.524   1.00 94.35  ? 1037 LEU A C     1 
ATOM   8091  O  O     . LEU A  1  1037 ? 159.898 60.704  8.421   1.00 94.67  ? 1037 LEU A O     1 
ATOM   8092  C  CB    . LEU A  1  1037 ? 156.788 60.072  7.672   1.00 85.99  ? 1037 LEU A CB    1 
ATOM   8093  C  CG    . LEU A  1  1037 ? 155.279 60.101  7.881   1.00 88.17  ? 1037 LEU A CG    1 
ATOM   8094  C  CD1   . LEU A  1  1037 ? 154.580 60.564  6.637   1.00 87.31  ? 1037 LEU A CD1   1 
ATOM   8095  C  CD2   . LEU A  1  1037 ? 154.753 58.756  8.290   1.00 88.07  ? 1037 LEU A CD2   1 
ATOM   8096  N  N     . THR A  1  1038 ? 159.513 58.482  8.272   1.00 91.80  ? 1038 THR A N     1 
ATOM   8097  C  CA    . THR A  1  1038 ? 160.831 58.129  7.742   1.00 92.90  ? 1038 THR A CA    1 
ATOM   8098  C  C     . THR A  1  1038 ? 160.659 58.064  6.215   1.00 96.17  ? 1038 THR A C     1 
ATOM   8099  O  O     . THR A  1  1038 ? 159.515 57.998  5.744   1.00 94.89  ? 1038 THR A O     1 
ATOM   8100  C  CB    . THR A  1  1038 ? 161.363 56.808  8.349   1.00 105.29 ? 1038 THR A CB    1 
ATOM   8101  O  OG1   . THR A  1  1038 ? 160.608 55.688  7.881   1.00 106.03 ? 1038 THR A OG1   1 
ATOM   8102  C  CG2   . THR A  1  1038 ? 161.407 56.829  9.873   1.00 106.22 ? 1038 THR A CG2   1 
ATOM   8103  N  N     . LYS A  1  1039 ? 161.765 58.098  5.439   1.00 92.97  ? 1039 LYS A N     1 
ATOM   8104  C  CA    . LYS A  1  1039 ? 161.689 58.010  3.977   1.00 91.98  ? 1039 LYS A CA    1 
ATOM   8105  C  C     . LYS A  1  1039 ? 160.957 56.719  3.564   1.00 96.41  ? 1039 LYS A C     1 
ATOM   8106  O  O     . LYS A  1  1039 ? 160.157 56.734  2.624   1.00 96.01  ? 1039 LYS A O     1 
ATOM   8107  C  CB    . LYS A  1  1039 ? 163.085 58.178  3.336   1.00 94.37  ? 1039 LYS A CB    1 
ATOM   8108  C  CG    . LYS A  1  1039 ? 163.305 57.561  1.949   1.00 97.06  ? 1039 LYS A CG    1 
ATOM   8109  C  CD    . LYS A  1  1039 ? 162.766 58.381  0.782   1.00 101.71 ? 1039 LYS A CD    1 
ATOM   8110  C  CE    . LYS A  1  1039 ? 163.214 57.774  -0.531  1.00 109.96 ? 1039 LYS A CE    1 
ATOM   8111  N  NZ    . LYS A  1  1039 ? 162.644 58.482  -1.710  1.00 117.27 ? 1039 LYS A NZ    1 
ATOM   8112  N  N     . GLN A  1  1040 ? 161.151 55.644  4.352   1.00 92.69  ? 1040 GLN A N     1 
ATOM   8113  C  CA    . GLN A  1  1040 ? 160.519 54.334  4.183   1.00 91.05  ? 1040 GLN A CA    1 
ATOM   8114  C  C     . GLN A  1  1040 ? 159.000 54.449  4.291   1.00 91.81  ? 1040 GLN A C     1 
ATOM   8115  O  O     . GLN A  1  1040 ? 158.291 54.070  3.351   1.00 90.73  ? 1040 GLN A O     1 
ATOM   8116  C  CB    . GLN A  1  1040 ? 161.060 53.380  5.256   1.00 93.08  ? 1040 GLN A CB    1 
ATOM   8117  C  CG    . GLN A  1  1040 ? 160.556 51.950  5.176   1.00 101.36 ? 1040 GLN A CG    1 
ATOM   8118  C  CD    . GLN A  1  1040 ? 160.931 51.188  6.414   1.00 119.33 ? 1040 GLN A CD    1 
ATOM   8119  O  OE1   . GLN A  1  1040 ? 160.909 51.714  7.543   1.00 117.48 ? 1040 GLN A OE1   1 
ATOM   8120  N  NE2   . GLN A  1  1040 ? 161.274 49.927  6.230   1.00 108.84 ? 1040 GLN A NE2   1 
ATOM   8121  N  N     . ALA A  1  1041 ? 158.517 54.991  5.432   1.00 86.90  ? 1041 ALA A N     1 
ATOM   8122  C  CA    . ALA A  1  1041 ? 157.099 55.187  5.725   1.00 85.29  ? 1041 ALA A CA    1 
ATOM   8123  C  C     . ALA A  1  1041 ? 156.430 56.178  4.755   1.00 90.16  ? 1041 ALA A C     1 
ATOM   8124  O  O     . ALA A  1  1041 ? 155.304 55.919  4.320   1.00 89.49  ? 1041 ALA A O     1 
ATOM   8125  C  CB    . ALA A  1  1041 ? 156.915 55.634  7.163   1.00 86.12  ? 1041 ALA A CB    1 
ATOM   8126  N  N     . PHE A  1  1042 ? 157.130 57.284  4.394   1.00 86.80  ? 1042 PHE A N     1 
ATOM   8127  C  CA    . PHE A  1  1042 ? 156.627 58.288  3.456   1.00 86.09  ? 1042 PHE A CA    1 
ATOM   8128  C  C     . PHE A  1  1042 ? 156.372 57.682  2.072   1.00 89.88  ? 1042 PHE A C     1 
ATOM   8129  O  O     . PHE A  1  1042 ? 155.367 58.007  1.429   1.00 88.00  ? 1042 PHE A O     1 
ATOM   8130  C  CB    . PHE A  1  1042 ? 157.602 59.467  3.351   1.00 88.90  ? 1042 PHE A CB    1 
ATOM   8131  C  CG    . PHE A  1  1042 ? 157.185 60.540  2.371   1.00 89.76  ? 1042 PHE A CG    1 
ATOM   8132  C  CD1   . PHE A  1  1042 ? 156.235 61.494  2.720   1.00 92.42  ? 1042 PHE A CD1   1 
ATOM   8133  C  CD2   . PHE A  1  1042 ? 157.757 60.609  1.107   1.00 91.35  ? 1042 PHE A CD2   1 
ATOM   8134  C  CE1   . PHE A  1  1042 ? 155.861 62.495  1.818   1.00 93.19  ? 1042 PHE A CE1   1 
ATOM   8135  C  CE2   . PHE A  1  1042 ? 157.387 61.615  0.209   1.00 94.03  ? 1042 PHE A CE2   1 
ATOM   8136  C  CZ    . PHE A  1  1042 ? 156.434 62.543  0.565   1.00 92.02  ? 1042 PHE A CZ    1 
ATOM   8137  N  N     . ASP A  1  1043 ? 157.291 56.811  1.616   1.00 87.80  ? 1043 ASP A N     1 
ATOM   8138  C  CA    . ASP A  1  1043 ? 157.192 56.121  0.332   1.00 87.44  ? 1043 ASP A CA    1 
ATOM   8139  C  C     . ASP A  1  1043 ? 155.913 55.282  0.290   1.00 90.94  ? 1043 ASP A C     1 
ATOM   8140  O  O     . ASP A  1  1043 ? 155.138 55.393  -0.666  1.00 89.01  ? 1043 ASP A O     1 
ATOM   8141  C  CB    . ASP A  1  1043 ? 158.437 55.247  0.110   1.00 89.93  ? 1043 ASP A CB    1 
ATOM   8142  C  CG    . ASP A  1  1043 ? 159.684 55.996  -0.333  1.00 101.86 ? 1043 ASP A CG    1 
ATOM   8143  O  OD1   . ASP A  1  1043 ? 159.571 57.200  -0.685  1.00 104.12 ? 1043 ASP A OD1   1 
ATOM   8144  O  OD2   . ASP A  1  1043 ? 160.765 55.377  -0.358  1.00 106.54 ? 1043 ASP A OD2   1 
ATOM   8145  N  N     . TRP A  1  1044 ? 155.685 54.498  1.379   1.00 88.15  ? 1044 TRP A N     1 
ATOM   8146  C  CA    . TRP A  1  1044 ? 154.544 53.628  1.655   1.00 86.91  ? 1044 TRP A CA    1 
ATOM   8147  C  C     . TRP A  1  1044 ? 153.224 54.419  1.662   1.00 87.78  ? 1044 TRP A C     1 
ATOM   8148  O  O     . TRP A  1  1044 ? 152.227 53.922  1.146   1.00 86.37  ? 1044 TRP A O     1 
ATOM   8149  C  CB    . TRP A  1  1044 ? 154.773 52.945  3.007   1.00 86.89  ? 1044 TRP A CB    1 
ATOM   8150  C  CG    . TRP A  1  1044 ? 153.748 51.925  3.424   1.00 87.82  ? 1044 TRP A CG    1 
ATOM   8151  C  CD1   . TRP A  1  1044 ? 153.836 50.572  3.281   1.00 90.44  ? 1044 TRP A CD1   1 
ATOM   8152  C  CD2   . TRP A  1  1044 ? 152.558 52.170  4.190   1.00 87.55  ? 1044 TRP A CD2   1 
ATOM   8153  N  NE1   . TRP A  1  1044 ? 152.761 49.959  3.884   1.00 89.08  ? 1044 TRP A NE1   1 
ATOM   8154  C  CE2   . TRP A  1  1044 ? 151.962 50.915  4.450   1.00 90.45  ? 1044 TRP A CE2   1 
ATOM   8155  C  CE3   . TRP A  1  1044 ? 151.914 53.334  4.653   1.00 89.10  ? 1044 TRP A CE3   1 
ATOM   8156  C  CZ2   . TRP A  1  1044 ? 150.761 50.791  5.154   1.00 89.21  ? 1044 TRP A CZ2   1 
ATOM   8157  C  CZ3   . TRP A  1  1044 ? 150.715 53.208  5.338   1.00 89.76  ? 1044 TRP A CZ3   1 
ATOM   8158  C  CH2   . TRP A  1  1044 ? 150.160 51.950  5.596   1.00 89.66  ? 1044 TRP A CH2   1 
ATOM   8159  N  N     . VAL A  1  1045 ? 153.210 55.635  2.248   1.00 83.18  ? 1045 VAL A N     1 
ATOM   8160  C  CA    . VAL A  1  1045 ? 152.026 56.502  2.281   1.00 81.49  ? 1045 VAL A CA    1 
ATOM   8161  C  C     . VAL A  1  1045 ? 151.658 56.890  0.839   1.00 85.58  ? 1045 VAL A C     1 
ATOM   8162  O  O     . VAL A  1  1045 ? 150.523 56.662  0.425   1.00 84.51  ? 1045 VAL A O     1 
ATOM   8163  C  CB    . VAL A  1  1045 ? 152.221 57.732  3.216   1.00 85.28  ? 1045 VAL A CB    1 
ATOM   8164  C  CG1   . VAL A  1  1045 ? 151.204 58.832  2.942   1.00 84.24  ? 1045 VAL A CG1   1 
ATOM   8165  C  CG2   . VAL A  1  1045 ? 152.162 57.320  4.675   1.00 85.34  ? 1045 VAL A CG2   1 
ATOM   8166  N  N     . LEU A  1  1046 ? 152.638 57.410  0.065   1.00 82.79  ? 1046 LEU A N     1 
ATOM   8167  C  CA    . LEU A  1  1046 ? 152.452 57.823  -1.332  1.00 81.67  ? 1046 LEU A CA    1 
ATOM   8168  C  C     . LEU A  1  1046 ? 151.899 56.696  -2.221  1.00 84.88  ? 1046 LEU A C     1 
ATOM   8169  O  O     . LEU A  1  1046 ? 150.965 56.934  -2.978  1.00 83.20  ? 1046 LEU A O     1 
ATOM   8170  C  CB    . LEU A  1  1046 ? 153.760 58.380  -1.935  1.00 82.26  ? 1046 LEU A CB    1 
ATOM   8171  C  CG    . LEU A  1  1046 ? 154.397 59.667  -1.379  1.00 86.78  ? 1046 LEU A CG    1 
ATOM   8172  C  CD1   . LEU A  1  1046 ? 155.340 60.252  -2.393  1.00 87.10  ? 1046 LEU A CD1   1 
ATOM   8173  C  CD2   . LEU A  1  1046 ? 153.368 60.731  -1.049  1.00 88.01  ? 1046 LEU A CD2   1 
ATOM   8174  N  N     . SER A  1  1047 ? 152.456 55.471  -2.106  1.00 82.75  ? 1047 SER A N     1 
ATOM   8175  C  CA    . SER A  1  1047 ? 152.035 54.295  -2.888  1.00 81.89  ? 1047 SER A CA    1 
ATOM   8176  C  C     . SER A  1  1047 ? 150.588 53.928  -2.611  1.00 84.27  ? 1047 SER A C     1 
ATOM   8177  O  O     . SER A  1  1047 ? 149.869 53.543  -3.541  1.00 83.59  ? 1047 SER A O     1 
ATOM   8178  C  CB    . SER A  1  1047 ? 152.924 53.096  -2.584  1.00 85.82  ? 1047 SER A CB    1 
ATOM   8179  O  OG    . SER A  1  1047 ? 152.507 52.471  -1.382  1.00 97.06  ? 1047 SER A OG    1 
ATOM   8180  N  N     . ASN A  1  1048 ? 150.177 54.038  -1.322  1.00 79.41  ? 1048 ASN A N     1 
ATOM   8181  C  CA    . ASN A  1  1048 ? 148.822 53.755  -0.864  1.00 77.01  ? 1048 ASN A CA    1 
ATOM   8182  C  C     . ASN A  1  1048 ? 147.852 54.825  -1.299  1.00 79.02  ? 1048 ASN A C     1 
ATOM   8183  O  O     . ASN A  1  1048 ? 146.784 54.470  -1.760  1.00 78.97  ? 1048 ASN A O     1 
ATOM   8184  C  CB    . ASN A  1  1048 ? 148.765 53.475  0.624   1.00 73.93  ? 1048 ASN A CB    1 
ATOM   8185  C  CG    . ASN A  1  1048 ? 149.309 52.100  0.944   1.00 98.45  ? 1048 ASN A CG    1 
ATOM   8186  O  OD1   . ASN A  1  1048 ? 148.884 51.071  0.389   1.00 90.52  ? 1048 ASN A OD1   1 
ATOM   8187  N  ND2   . ASN A  1  1048 ? 150.288 52.049  1.828   1.00 93.17  ? 1048 ASN A ND2   1 
ATOM   8188  N  N     . ILE A  1  1049 ? 148.228 56.107  -1.259  1.00 74.41  ? 1049 ILE A N     1 
ATOM   8189  C  CA    . ILE A  1  1049 ? 147.348 57.162  -1.760  1.00 73.50  ? 1049 ILE A CA    1 
ATOM   8190  C  C     . ILE A  1  1049 ? 147.037 56.870  -3.242  1.00 78.59  ? 1049 ILE A C     1 
ATOM   8191  O  O     . ILE A  1  1049 ? 145.859 56.819  -3.614  1.00 78.09  ? 1049 ILE A O     1 
ATOM   8192  C  CB    . ILE A  1  1049 ? 147.937 58.576  -1.542  1.00 76.71  ? 1049 ILE A CB    1 
ATOM   8193  C  CG1   . ILE A  1  1049 ? 147.916 58.948  -0.056  1.00 76.96  ? 1049 ILE A CG1   1 
ATOM   8194  C  CG2   . ILE A  1  1049 ? 147.195 59.615  -2.376  1.00 76.51  ? 1049 ILE A CG2   1 
ATOM   8195  C  CD1   . ILE A  1  1049 ? 148.742 60.129  0.311   1.00 83.19  ? 1049 ILE A CD1   1 
ATOM   8196  N  N     . GLU A  1  1050 ? 148.088 56.600  -4.056  1.00 75.27  ? 1050 GLU A N     1 
ATOM   8197  C  CA    . GLU A  1  1050 ? 147.940 56.278  -5.476  1.00 74.39  ? 1050 GLU A CA    1 
ATOM   8198  C  C     . GLU A  1  1050 ? 146.950 55.132  -5.617  1.00 77.46  ? 1050 GLU A C     1 
ATOM   8199  O  O     . GLU A  1  1050 ? 145.863 55.340  -6.159  1.00 76.02  ? 1050 GLU A O     1 
ATOM   8200  C  CB    . GLU A  1  1050 ? 149.297 55.933  -6.118  1.00 76.34  ? 1050 GLU A CB    1 
ATOM   8201  C  CG    . GLU A  1  1050 ? 149.212 55.633  -7.608  1.00 86.47  ? 1050 GLU A CG    1 
ATOM   8202  C  CD    . GLU A  1  1050 ? 150.508 55.499  -8.391  1.00 108.02 ? 1050 GLU A CD    1 
ATOM   8203  O  OE1   . GLU A  1  1050 ? 151.603 55.581  -7.787  1.00 104.34 ? 1050 GLU A OE1   1 
ATOM   8204  O  OE2   . GLU A  1  1050 ? 150.419 55.315  -9.627  1.00 98.25  ? 1050 GLU A OE2   1 
ATOM   8205  N  N     . ALA A  1  1051 ? 147.285 53.965  -5.027  1.00 74.44  ? 1051 ALA A N     1 
ATOM   8206  C  CA    . ALA A  1  1051 ? 146.467 52.749  -5.045  1.00 73.11  ? 1051 ALA A CA    1 
ATOM   8207  C  C     . ALA A  1  1051 ? 145.009 53.004  -4.689  1.00 77.17  ? 1051 ALA A C     1 
ATOM   8208  O  O     . ALA A  1  1051 ? 144.129 52.655  -5.471  1.00 76.36  ? 1051 ALA A O     1 
ATOM   8209  C  CB    . ALA A  1  1051 ? 147.054 51.723  -4.108  1.00 73.78  ? 1051 ALA A CB    1 
ATOM   8210  N  N     . GLN A  1  1052 ? 144.767 53.663  -3.545  1.00 74.68  ? 1052 GLN A N     1 
ATOM   8211  C  CA    . GLN A  1  1052 ? 143.441 53.978  -3.025  1.00 74.19  ? 1052 GLN A CA    1 
ATOM   8212  C  C     . GLN A  1  1052 ? 142.664 54.926  -3.938  1.00 80.10  ? 1052 GLN A C     1 
ATOM   8213  O  O     . GLN A  1  1052 ? 141.473 54.692  -4.176  1.00 80.06  ? 1052 GLN A O     1 
ATOM   8214  C  CB    . GLN A  1  1052 ? 143.512 54.490  -1.577  1.00 75.30  ? 1052 GLN A CB    1 
ATOM   8215  C  CG    . GLN A  1  1052 ? 143.875 53.384  -0.579  1.00 72.18  ? 1052 GLN A CG    1 
ATOM   8216  C  CD    . GLN A  1  1052 ? 143.689 53.776  0.867   1.00 99.44  ? 1052 GLN A CD    1 
ATOM   8217  O  OE1   . GLN A  1  1052 ? 143.015 54.761  1.223   1.00 101.80 ? 1052 GLN A OE1   1 
ATOM   8218  N  NE2   . GLN A  1  1052 ? 144.267 52.989  1.746   1.00 92.09  ? 1052 GLN A NE2   1 
ATOM   8219  N  N     . PHE A  1  1053 ? 143.338 55.949  -4.495  1.00 76.89  ? 1053 PHE A N     1 
ATOM   8220  C  CA    . PHE A  1  1053 ? 142.689 56.873  -5.427  1.00 76.26  ? 1053 PHE A CA    1 
ATOM   8221  C  C     . PHE A  1  1053 ? 142.173 56.118  -6.649  1.00 81.71  ? 1053 PHE A C     1 
ATOM   8222  O  O     . PHE A  1  1053 ? 141.021 56.298  -7.028  1.00 81.86  ? 1053 PHE A O     1 
ATOM   8223  C  CB    . PHE A  1  1053 ? 143.646 57.979  -5.871  1.00 78.07  ? 1053 PHE A CB    1 
ATOM   8224  C  CG    . PHE A  1  1053 ? 142.987 59.043  -6.708  1.00 78.98  ? 1053 PHE A CG    1 
ATOM   8225  C  CD1   . PHE A  1  1053 ? 142.789 58.858  -8.068  1.00 80.79  ? 1053 PHE A CD1   1 
ATOM   8226  C  CD2   . PHE A  1  1053 ? 142.578 60.240  -6.140  1.00 82.52  ? 1053 PHE A CD2   1 
ATOM   8227  C  CE1   . PHE A  1  1053 ? 142.173 59.844  -8.842  1.00 83.78  ? 1053 PHE A CE1   1 
ATOM   8228  C  CE2   . PHE A  1  1053 ? 141.983 61.236  -6.920  1.00 83.51  ? 1053 PHE A CE2   1 
ATOM   8229  C  CZ    . PHE A  1  1053 ? 141.780 61.028  -8.265  1.00 82.16  ? 1053 PHE A CZ    1 
ATOM   8230  N  N     . LEU A  1  1054 ? 143.017 55.264  -7.248  1.00 78.33  ? 1054 LEU A N     1 
ATOM   8231  C  CA    . LEU A  1  1054 ? 142.665 54.490  -8.436  1.00 76.91  ? 1054 LEU A CA    1 
ATOM   8232  C  C     . LEU A  1  1054 ? 141.479 53.554  -8.221  1.00 80.48  ? 1054 LEU A C     1 
ATOM   8233  O  O     . LEU A  1  1054 ? 140.642 53.435  -9.123  1.00 79.73  ? 1054 LEU A O     1 
ATOM   8234  C  CB    . LEU A  1  1054 ? 143.880 53.750  -8.991  1.00 76.50  ? 1054 LEU A CB    1 
ATOM   8235  C  CG    . LEU A  1  1054 ? 144.957 54.658  -9.565  1.00 80.60  ? 1054 LEU A CG    1 
ATOM   8236  C  CD1   . LEU A  1  1054 ? 146.227 53.917  -9.733  1.00 81.22  ? 1054 LEU A CD1   1 
ATOM   8237  C  CD2   . LEU A  1  1054 ? 144.513 55.319  -10.876 1.00 82.02  ? 1054 LEU A CD2   1 
ATOM   8238  N  N     . ARG A  1  1055 ? 141.360 52.969  -7.014  1.00 77.34  ? 1055 ARG A N     1 
ATOM   8239  C  CA    . ARG A  1  1055 ? 140.242 52.083  -6.649  1.00 76.77  ? 1055 ARG A CA    1 
ATOM   8240  C  C     . ARG A  1  1055 ? 138.929 52.881  -6.451  1.00 81.43  ? 1055 ARG A C     1 
ATOM   8241  O  O     . ARG A  1  1055 ? 137.835 52.357  -6.707  1.00 80.91  ? 1055 ARG A O     1 
ATOM   8242  C  CB    . ARG A  1  1055 ? 140.580 51.247  -5.402  1.00 75.90  ? 1055 ARG A CB    1 
ATOM   8243  C  CG    . ARG A  1  1055 ? 141.761 50.297  -5.599  1.00 87.58  ? 1055 ARG A CG    1 
ATOM   8244  C  CD    . ARG A  1  1055 ? 141.899 49.313  -4.451  1.00 102.77 ? 1055 ARG A CD    1 
ATOM   8245  N  NE    . ARG A  1  1055 ? 143.165 49.467  -3.727  1.00 117.69 ? 1055 ARG A NE    1 
ATOM   8246  C  CZ    . ARG A  1  1055 ? 143.263 49.854  -2.456  1.00 136.24 ? 1055 ARG A CZ    1 
ATOM   8247  N  NH1   . ARG A  1  1055 ? 142.170 50.122  -1.747  1.00 124.16 ? 1055 ARG A NH1   1 
ATOM   8248  N  NH2   . ARG A  1  1055 ? 144.454 49.968  -1.881  1.00 124.31 ? 1055 ARG A NH2   1 
ATOM   8249  N  N     . SER A  1  1056 ? 139.063 54.169  -6.049  1.00 77.83  ? 1056 SER A N     1 
ATOM   8250  C  CA    . SER A  1  1056 ? 137.966 55.111  -5.781  1.00 76.09  ? 1056 SER A CA    1 
ATOM   8251  C  C     . SER A  1  1056 ? 137.154 55.535  -7.020  1.00 76.11  ? 1056 SER A C     1 
ATOM   8252  O  O     . SER A  1  1056 ? 135.965 55.843  -6.882  1.00 74.57  ? 1056 SER A O     1 
ATOM   8253  C  CB    . SER A  1  1056 ? 138.479 56.342  -5.036  1.00 79.27  ? 1056 SER A CB    1 
ATOM   8254  O  OG    . SER A  1  1056 ? 138.836 56.065  -3.689  1.00 88.40  ? 1056 SER A OG    1 
ATOM   8255  N  N     . VAL A  1  1057 ? 137.788 55.549  -8.215  1.00 70.67  ? 1057 VAL A N     1 
ATOM   8256  C  CA    . VAL A  1  1057 ? 137.171 55.959  -9.495  1.00 68.54  ? 1057 VAL A CA    1 
ATOM   8257  C  C     . VAL A  1  1057 ? 135.980 55.024  -9.872  1.00 74.38  ? 1057 VAL A C     1 
ATOM   8258  O  O     . VAL A  1  1057 ? 136.053 53.820  -9.571  1.00 74.32  ? 1057 VAL A O     1 
ATOM   8259  C  CB    . VAL A  1  1057 ? 138.255 56.086  -10.615 1.00 68.88  ? 1057 VAL A CB    1 
ATOM   8260  C  CG1   . VAL A  1  1057 ? 137.652 56.399  -11.972 1.00 67.49  ? 1057 VAL A CG1   1 
ATOM   8261  C  CG2   . VAL A  1  1057 ? 139.291 57.135  -10.255 1.00 68.95  ? 1057 VAL A CG2   1 
ATOM   8262  N  N     . VAL A  1  1058 ? 134.878 55.599  -10.470 1.00 70.92  ? 1058 VAL A N     1 
ATOM   8263  C  CA    . VAL A  1  1058 ? 133.690 54.862  -10.943 1.00 70.49  ? 1058 VAL A CA    1 
ATOM   8264  C  C     . VAL A  1  1058 ? 134.091 53.903  -12.028 1.00 77.61  ? 1058 VAL A C     1 
ATOM   8265  O  O     . VAL A  1  1058 ? 134.979 54.217  -12.829 1.00 79.81  ? 1058 VAL A O     1 
ATOM   8266  C  CB    . VAL A  1  1058 ? 132.543 55.721  -11.512 1.00 74.11  ? 1058 VAL A CB    1 
ATOM   8267  C  CG1   . VAL A  1  1058 ? 131.358 55.790  -10.572 1.00 72.75  ? 1058 VAL A CG1   1 
ATOM   8268  C  CG2   . VAL A  1  1058 ? 133.013 57.090  -11.992 1.00 75.08  ? 1058 VAL A CG2   1 
ATOM   8269  N  N     . HIS A  1  1059 ? 133.368 52.779  -12.124 1.00 73.02  ? 1059 HIS A N     1 
ATOM   8270  C  CA    . HIS A  1  1059 ? 133.619 51.759  -13.133 1.00 71.70  ? 1059 HIS A CA    1 
ATOM   8271  C  C     . HIS A  1  1059 ? 132.676 51.925  -14.314 1.00 70.97  ? 1059 HIS A C     1 
ATOM   8272  O  O     . HIS A  1  1059 ? 131.468 51.819  -14.113 1.00 70.48  ? 1059 HIS A O     1 
ATOM   8273  C  CB    . HIS A  1  1059 ? 133.412 50.360  -12.530 1.00 72.33  ? 1059 HIS A CB    1 
ATOM   8274  C  CG    . HIS A  1  1059 ? 134.398 49.986  -11.477 1.00 76.68  ? 1059 HIS A CG    1 
ATOM   8275  N  ND1   . HIS A  1  1059 ? 134.966 48.733  -11.451 1.00 78.74  ? 1059 HIS A ND1   1 
ATOM   8276  C  CD2   . HIS A  1  1059 ? 134.862 50.700  -10.423 1.00 79.95  ? 1059 HIS A CD2   1 
ATOM   8277  C  CE1   . HIS A  1  1059 ? 135.754 48.715  -10.392 1.00 79.25  ? 1059 HIS A CE1   1 
ATOM   8278  N  NE2   . HIS A  1  1059 ? 135.740 49.887  -9.751  1.00 80.13  ? 1059 HIS A NE2   1 
ATOM   8279  N  N     . PRO A  1  1060 ? 133.161 52.107  -15.554 1.00 64.84  ? 1060 PRO A N     1 
ATOM   8280  C  CA    . PRO A  1  1060 ? 132.234 52.142  -16.693 1.00 64.93  ? 1060 PRO A CA    1 
ATOM   8281  C  C     . PRO A  1  1060 ? 131.309 50.906  -16.709 1.00 72.17  ? 1060 PRO A C     1 
ATOM   8282  O  O     . PRO A  1  1060 ? 131.747 49.735  -16.681 1.00 72.09  ? 1060 PRO A O     1 
ATOM   8283  C  CB    . PRO A  1  1060 ? 133.160 52.203  -17.900 1.00 66.97  ? 1060 PRO A CB    1 
ATOM   8284  C  CG    . PRO A  1  1060 ? 134.415 52.783  -17.390 1.00 71.95  ? 1060 PRO A CG    1 
ATOM   8285  C  CD    . PRO A  1  1060 ? 134.554 52.254  -15.997 1.00 66.90  ? 1060 PRO A CD    1 
ATOM   8286  N  N     . GLY A  1  1061 ? 130.019 51.203  -16.651 1.00 70.05  ? 1061 GLY A N     1 
ATOM   8287  C  CA    . GLY A  1  1061 ? 128.948 50.223  -16.563 1.00 69.29  ? 1061 GLY A CA    1 
ATOM   8288  C  C     . GLY A  1  1061 ? 127.960 50.601  -15.478 1.00 72.93  ? 1061 GLY A C     1 
ATOM   8289  O  O     . GLY A  1  1061 ? 126.794 50.205  -15.560 1.00 71.55  ? 1061 GLY A O     1 
ATOM   8290  N  N     . GLU A  1  1062 ? 128.424 51.401  -14.464 1.00 70.72  ? 1062 GLU A N     1 
ATOM   8291  C  CA    . GLU A  1  1062 ? 127.633 51.880  -13.322 1.00 71.09  ? 1062 GLU A CA    1 
ATOM   8292  C  C     . GLU A  1  1062 ? 126.348 52.450  -13.810 1.00 77.24  ? 1062 GLU A C     1 
ATOM   8293  O  O     . GLU A  1  1062 ? 126.367 53.437  -14.539 1.00 77.64  ? 1062 GLU A O     1 
ATOM   8294  C  CB    . GLU A  1  1062 ? 128.344 52.989  -12.530 1.00 72.93  ? 1062 GLU A CB    1 
ATOM   8295  C  CG    . GLU A  1  1062 ? 129.324 52.528  -11.464 1.00 87.00  ? 1062 GLU A CG    1 
ATOM   8296  C  CD    . GLU A  1  1062 ? 128.833 51.647  -10.332 1.00 102.62 ? 1062 GLU A CD    1 
ATOM   8297  O  OE1   . GLU A  1  1062 ? 127.859 52.014  -9.632  1.00 87.85  ? 1062 GLU A OE1   1 
ATOM   8298  O  OE2   . GLU A  1  1062 ? 129.499 50.615  -10.097 1.00 104.04 ? 1062 GLU A OE2   1 
ATOM   8299  N  N     . MET A  1  1063 ? 125.228 51.821  -13.414 1.00 74.24  ? 1063 MET A N     1 
ATOM   8300  C  CA    . MET A  1  1063 ? 123.869 52.233  -13.740 1.00 73.41  ? 1063 MET A CA    1 
ATOM   8301  C  C     . MET A  1  1063 ? 123.458 53.345  -12.777 1.00 77.77  ? 1063 MET A C     1 
ATOM   8302  O  O     . MET A  1  1063 ? 122.448 53.328  -12.075 1.00 78.07  ? 1063 MET A O     1 
ATOM   8303  C  CB    . MET A  1  1063 ? 122.931 51.013  -13.765 1.00 74.97  ? 1063 MET A CB    1 
ATOM   8304  C  CG    . MET A  1  1063 ? 123.116 50.134  -15.012 1.00 77.64  ? 1063 MET A CG    1 
ATOM   8305  S  SD    . MET A  1  1063 ? 123.400 51.042  -16.559 1.00 81.74  ? 1063 MET A SD    1 
ATOM   8306  C  CE    . MET A  1  1063 ? 121.823 52.125  -16.639 1.00 78.34  ? 1063 MET A CE    1 
ATOM   8307  N  N     . VAL A  1  1064 ? 124.309 54.343  -12.809 1.00 74.07  ? 1064 VAL A N     1 
ATOM   8308  C  CA    . VAL A  1  1064 ? 124.429 55.560  -12.057 1.00 72.93  ? 1064 VAL A CA    1 
ATOM   8309  C  C     . VAL A  1  1064 ? 123.156 56.409  -12.065 1.00 77.44  ? 1064 VAL A C     1 
ATOM   8310  O  O     . VAL A  1  1064 ? 122.928 57.156  -11.110 1.00 78.99  ? 1064 VAL A O     1 
ATOM   8311  C  CB    . VAL A  1  1064 ? 125.674 56.199  -12.681 1.00 76.02  ? 1064 VAL A CB    1 
ATOM   8312  C  CG1   . VAL A  1  1064 ? 125.430 57.518  -13.381 1.00 76.14  ? 1064 VAL A CG1   1 
ATOM   8313  C  CG2   . VAL A  1  1064 ? 126.816 56.229  -11.694 1.00 75.96  ? 1064 VAL A CG2   1 
ATOM   8314  N  N     . GLY A  1  1065 ? 122.316 56.223  -13.082 1.00 72.00  ? 1065 GLY A N     1 
ATOM   8315  C  CA    . GLY A  1  1065 ? 121.040 56.912  -13.208 1.00 70.93  ? 1065 GLY A CA    1 
ATOM   8316  C  C     . GLY A  1  1065 ? 120.001 56.361  -12.252 1.00 71.97  ? 1065 GLY A C     1 
ATOM   8317  O  O     . GLY A  1  1065 ? 119.451 57.110  -11.446 1.00 71.15  ? 1065 GLY A O     1 
ATOM   8318  N  N     . VAL A  1  1066 ? 119.729 55.040  -12.327 1.00 67.13  ? 1066 VAL A N     1 
ATOM   8319  C  CA    . VAL A  1  1066 ? 118.754 54.341  -11.463 1.00 65.65  ? 1066 VAL A CA    1 
ATOM   8320  C  C     . VAL A  1  1066 ? 119.166 54.536  -10.012 1.00 68.53  ? 1066 VAL A C     1 
ATOM   8321  O  O     . VAL A  1  1066 ? 118.309 54.835  -9.172  1.00 68.79  ? 1066 VAL A O     1 
ATOM   8322  C  CB    . VAL A  1  1066 ? 118.601 52.839  -11.839 1.00 68.35  ? 1066 VAL A CB    1 
ATOM   8323  C  CG1   . VAL A  1  1066 ? 117.759 52.073  -10.823 1.00 67.13  ? 1066 VAL A CG1   1 
ATOM   8324  C  CG2   . VAL A  1  1066 ? 118.019 52.697  -13.233 1.00 68.33  ? 1066 VAL A CG2   1 
ATOM   8325  N  N     . LEU A  1  1067 ? 120.487 54.407  -9.739  1.00 62.67  ? 1067 LEU A N     1 
ATOM   8326  C  CA    . LEU A  1  1067 ? 121.072 54.615  -8.425  1.00 62.08  ? 1067 LEU A CA    1 
ATOM   8327  C  C     . LEU A  1  1067 ? 120.756 56.047  -7.922  1.00 67.25  ? 1067 LEU A C     1 
ATOM   8328  O  O     . LEU A  1  1067 ? 120.313 56.207  -6.794  1.00 66.87  ? 1067 LEU A O     1 
ATOM   8329  C  CB    . LEU A  1  1067 ? 122.597 54.347  -8.467  1.00 62.02  ? 1067 LEU A CB    1 
ATOM   8330  C  CG    . LEU A  1  1067 ? 123.399 54.684  -7.201  1.00 66.44  ? 1067 LEU A CG    1 
ATOM   8331  C  CD1   . LEU A  1  1067 ? 123.081 53.725  -6.087  1.00 66.81  ? 1067 LEU A CD1   1 
ATOM   8332  C  CD2   . LEU A  1  1067 ? 124.871 54.654  -7.470  1.00 68.76  ? 1067 LEU A CD2   1 
ATOM   8333  N  N     . ALA A  1  1068 ? 120.940 57.068  -8.769  1.00 64.45  ? 1068 ALA A N     1 
ATOM   8334  C  CA    . ALA A  1  1068 ? 120.645 58.430  -8.386  1.00 64.89  ? 1068 ALA A CA    1 
ATOM   8335  C  C     . ALA A  1  1068 ? 119.147 58.573  -8.056  1.00 70.89  ? 1068 ALA A C     1 
ATOM   8336  O  O     . ALA A  1  1068 ? 118.800 59.221  -7.078  1.00 72.16  ? 1068 ALA A O     1 
ATOM   8337  C  CB    . ALA A  1  1068 ? 121.036 59.358  -9.505  1.00 66.12  ? 1068 ALA A CB    1 
ATOM   8338  N  N     . ALA A  1  1069 ? 118.271 57.907  -8.820  1.00 67.07  ? 1069 ALA A N     1 
ATOM   8339  C  CA    . ALA A  1  1069 ? 116.822 57.951  -8.612  1.00 66.30  ? 1069 ALA A CA    1 
ATOM   8340  C  C     . ALA A  1  1069 ? 116.401 57.298  -7.305  1.00 67.45  ? 1069 ALA A C     1 
ATOM   8341  O  O     . ALA A  1  1069 ? 115.646 57.907  -6.551  1.00 66.40  ? 1069 ALA A O     1 
ATOM   8342  C  CB    . ALA A  1  1069 ? 116.111 57.306  -9.780  1.00 66.78  ? 1069 ALA A CB    1 
ATOM   8343  N  N     . GLN A  1  1070 ? 116.906 56.075  -7.028  1.00 63.22  ? 1070 GLN A N     1 
ATOM   8344  C  CA    . GLN A  1  1070 ? 116.643 55.326  -5.780  1.00 62.41  ? 1070 GLN A CA    1 
ATOM   8345  C  C     . GLN A  1  1070 ? 117.258 56.025  -4.564  1.00 69.30  ? 1070 GLN A C     1 
ATOM   8346  O  O     . GLN A  1  1070 ? 116.719 55.915  -3.470  1.00 68.53  ? 1070 GLN A O     1 
ATOM   8347  C  CB    . GLN A  1  1070 ? 117.212 53.911  -5.845  1.00 62.05  ? 1070 GLN A CB    1 
ATOM   8348  C  CG    . GLN A  1  1070 ? 116.644 53.043  -6.939  1.00 62.28  ? 1070 GLN A CG    1 
ATOM   8349  C  CD    . GLN A  1  1070 ? 117.222 51.663  -6.856  1.00 83.50  ? 1070 GLN A CD    1 
ATOM   8350  O  OE1   . GLN A  1  1070 ? 118.398 51.467  -6.481  1.00 79.64  ? 1070 GLN A OE1   1 
ATOM   8351  N  NE2   . GLN A  1  1070 ? 116.387 50.673  -7.165  1.00 76.91  ? 1070 GLN A NE2   1 
ATOM   8352  N  N     . SER A  1  1071 ? 118.393 56.734  -4.763  1.00 68.56  ? 1071 SER A N     1 
ATOM   8353  C  CA    . SER A  1  1071 ? 119.101 57.462  -3.717  1.00 69.33  ? 1071 SER A CA    1 
ATOM   8354  C  C     . SER A  1  1071 ? 118.340 58.700  -3.257  1.00 76.07  ? 1071 SER A C     1 
ATOM   8355  O  O     . SER A  1  1071 ? 118.581 59.143  -2.145  1.00 77.67  ? 1071 SER A O     1 
ATOM   8356  C  CB    . SER A  1  1071 ? 120.524 57.811  -4.150  1.00 72.02  ? 1071 SER A CB    1 
ATOM   8357  O  OG    . SER A  1  1071 ? 121.318 56.643  -4.307  1.00 80.01  ? 1071 SER A OG    1 
ATOM   8358  N  N     . ILE A  1  1072 ? 117.435 59.257  -4.096  1.00 72.41  ? 1072 ILE A N     1 
ATOM   8359  C  CA    . ILE A  1  1072 ? 116.600 60.423  -3.768  1.00 72.56  ? 1072 ILE A CA    1 
ATOM   8360  C  C     . ILE A  1  1072 ? 115.206 59.910  -3.386  1.00 78.70  ? 1072 ILE A C     1 
ATOM   8361  O  O     . ILE A  1  1072 ? 114.567 60.466  -2.499  1.00 78.79  ? 1072 ILE A O     1 
ATOM   8362  C  CB    . ILE A  1  1072 ? 116.530 61.449  -4.945  1.00 75.14  ? 1072 ILE A CB    1 
ATOM   8363  C  CG1   . ILE A  1  1072 ? 117.921 61.887  -5.410  1.00 75.09  ? 1072 ILE A CG1   1 
ATOM   8364  C  CG2   . ILE A  1  1072 ? 115.636 62.664  -4.610  1.00 75.74  ? 1072 ILE A CG2   1 
ATOM   8365  C  CD1   . ILE A  1  1072 ? 117.931 62.498  -6.791  1.00 83.14  ? 1072 ILE A CD1   1 
ATOM   8366  N  N     . GLY A  1  1073 ? 114.754 58.866  -4.073  1.00 77.32  ? 1073 GLY A N     1 
ATOM   8367  C  CA    . GLY A  1  1073 ? 113.457 58.243  -3.849  1.00 78.76  ? 1073 GLY A CA    1 
ATOM   8368  C  C     . GLY A  1  1073 ? 113.297 57.701  -2.445  1.00 87.01  ? 1073 GLY A C     1 
ATOM   8369  O  O     . GLY A  1  1073 ? 112.429 58.166  -1.708  1.00 87.21  ? 1073 GLY A O     1 
ATOM   8370  N  N     . GLU A  1  1074 ? 114.161 56.733  -2.057  1.00 85.64  ? 1074 GLU A N     1 
ATOM   8371  C  CA    . GLU A  1  1074 ? 114.180 56.101  -0.732  1.00 85.98  ? 1074 GLU A CA    1 
ATOM   8372  C  C     . GLU A  1  1074 ? 114.153 57.134  0.434   1.00 91.27  ? 1074 GLU A C     1 
ATOM   8373  O  O     . GLU A  1  1074 ? 113.218 57.048  1.218   1.00 91.46  ? 1074 GLU A O     1 
ATOM   8374  C  CB    . GLU A  1  1074 ? 115.342 55.104  -0.611  1.00 87.09  ? 1074 GLU A CB    1 
ATOM   8375  C  CG    . GLU A  1  1074 ? 115.171 54.092  0.504   1.00 97.82  ? 1074 GLU A CG    1 
ATOM   8376  C  CD    . GLU A  1  1074 ? 115.673 54.533  1.865   1.00 119.07 ? 1074 GLU A CD    1 
ATOM   8377  O  OE1   . GLU A  1  1074 ? 116.582 55.393  1.924   1.00 96.09  ? 1074 GLU A OE1   1 
ATOM   8378  O  OE2   . GLU A  1  1074 ? 115.159 54.005  2.877   1.00 124.51 ? 1074 GLU A OE2   1 
ATOM   8379  N  N     . PRO A  1  1075 ? 115.051 58.144  0.562   1.00 88.99  ? 1075 PRO A N     1 
ATOM   8380  C  CA    . PRO A  1  1075 ? 114.899 59.117  1.664   1.00 89.89  ? 1075 PRO A CA    1 
ATOM   8381  C  C     . PRO A  1  1075 ? 113.603 59.941  1.642   1.00 94.40  ? 1075 PRO A C     1 
ATOM   8382  O  O     . PRO A  1  1075 ? 113.202 60.461  2.689   1.00 95.85  ? 1075 PRO A O     1 
ATOM   8383  C  CB    . PRO A  1  1075 ? 116.128 60.027  1.516   1.00 92.18  ? 1075 PRO A CB    1 
ATOM   8384  C  CG    . PRO A  1  1075 ? 116.524 59.892  0.121   1.00 96.34  ? 1075 PRO A CG    1 
ATOM   8385  C  CD    . PRO A  1  1075 ? 116.251 58.455  -0.235  1.00 91.09  ? 1075 PRO A CD    1 
ATOM   8386  N  N     . ALA A  1  1076 ? 112.953 60.063  0.466   1.00 89.02  ? 1076 ALA A N     1 
ATOM   8387  C  CA    . ALA A  1  1076 ? 111.691 60.790  0.332   1.00 88.94  ? 1076 ALA A CA    1 
ATOM   8388  C  C     . ALA A  1  1076 ? 110.553 59.949  0.890   1.00 93.72  ? 1076 ALA A C     1 
ATOM   8389  O  O     . ALA A  1  1076 ? 109.489 60.463  1.205   1.00 93.11  ? 1076 ALA A O     1 
ATOM   8390  C  CB    . ALA A  1  1076 ? 111.427 61.109  -1.126  1.00 89.39  ? 1076 ALA A CB    1 
ATOM   8391  N  N     . THR A  1  1077 ? 110.785 58.644  0.996   1.00 92.42  ? 1077 THR A N     1 
ATOM   8392  C  CA    . THR A  1  1077 ? 109.841 57.646  1.480   1.00 92.98  ? 1077 THR A CA    1 
ATOM   8393  C  C     . THR A  1  1077 ? 109.671 57.766  2.996   1.00 103.18 ? 1077 THR A C     1 
ATOM   8394  O  O     . THR A  1  1077 ? 108.583 57.504  3.512   1.00 103.12 ? 1077 THR A O     1 
ATOM   8395  C  CB    . THR A  1  1077 ? 110.301 56.293  0.952   1.00 89.77  ? 1077 THR A CB    1 
ATOM   8396  O  OG1   . THR A  1  1077 ? 109.410 55.878  -0.073  1.00 87.44  ? 1077 THR A OG1   1 
ATOM   8397  C  CG2   . THR A  1  1077 ? 110.491 55.241  2.024   1.00 85.78  ? 1077 THR A CG2   1 
ATOM   8398  N  N     . GLN A  1  1078 ? 110.746 58.208  3.685   1.00 104.13 ? 1078 GLN A N     1 
ATOM   8399  C  CA    . GLN A  1  1078 ? 110.837 58.410  5.131   1.00 106.01 ? 1078 GLN A CA    1 
ATOM   8400  C  C     . GLN A  1  1078 ? 110.522 59.880  5.477   1.00 116.77 ? 1078 GLN A C     1 
ATOM   8401  O  O     . GLN A  1  1078 ? 110.884 60.352  6.560   1.00 117.53 ? 1078 GLN A O     1 
ATOM   8402  C  CB    . GLN A  1  1078 ? 112.256 58.033  5.634   1.00 106.84 ? 1078 GLN A CB    1 
ATOM   8403  C  CG    . GLN A  1  1078 ? 112.955 56.866  4.914   1.00 122.74 ? 1078 GLN A CG    1 
ATOM   8404  C  CD    . GLN A  1  1078 ? 112.328 55.491  5.107   1.00 149.81 ? 1078 GLN A CD    1 
ATOM   8405  O  OE1   . GLN A  1  1078 ? 111.421 55.278  5.926   1.00 149.17 ? 1078 GLN A OE1   1 
ATOM   8406  N  NE2   . GLN A  1  1078 ? 112.816 54.512  4.352   1.00 138.36 ? 1078 GLN A NE2   1 
ATOM   8407  N  N     . MET A  1  1079 ? 109.840 60.597  4.563   1.00 117.58 ? 1079 MET A N     1 
ATOM   8408  C  CA    . MET A  1  1079 ? 109.519 62.015  4.729   1.00 120.40 ? 1079 MET A CA    1 
ATOM   8409  C  C     . MET A  1  1079 ? 108.196 62.268  5.489   1.00 131.40 ? 1079 MET A C     1 
ATOM   8410  O  O     . MET A  1  1079 ? 107.773 61.423  6.287   1.00 131.34 ? 1079 MET A O     1 
ATOM   8411  C  CB    . MET A  1  1079 ? 109.540 62.714  3.361   1.00 122.43 ? 1079 MET A CB    1 
ATOM   8412  C  CG    . MET A  1  1079 ? 110.285 64.018  3.354   1.00 126.32 ? 1079 MET A CG    1 
ATOM   8413  S  SD    . MET A  1  1079 ? 111.281 64.214  1.869   1.00 129.62 ? 1079 MET A SD    1 
ATOM   8414  C  CE    . MET A  1  1079 ? 112.842 63.685  2.488   1.00 126.05 ? 1079 MET A CE    1 
ATOM   8415  N  N     . THR A  1  1080 ? 107.591 63.469  5.284   1.00 132.78 ? 1080 THR A N     1 
ATOM   8416  C  CA    . THR A  1  1080 ? 106.322 63.916  5.879   1.00 134.67 ? 1080 THR A CA    1 
ATOM   8417  C  C     . THR A  1  1080 ? 105.511 64.725  4.841   1.00 139.84 ? 1080 THR A C     1 
ATOM   8418  O  O     . THR A  1  1080 ? 106.079 65.560  4.124   1.00 139.05 ? 1080 THR A O     1 
ATOM   8419  C  CB    . THR A  1  1080 ? 106.501 64.637  7.257   1.00 145.96 ? 1080 THR A CB    1 
ATOM   8420  O  OG1   . THR A  1  1080 ? 107.886 64.766  7.609   1.00 145.77 ? 1080 THR A OG1   1 
ATOM   8421  C  CG2   . THR A  1  1080 ? 105.748 63.931  8.389   1.00 144.54 ? 1080 THR A CG2   1 
ATOM   8422  N  N     . LEU A  1  1081 ? 104.191 64.433  4.748   1.00 137.40 ? 1081 LEU A N     1 
ATOM   8423  C  CA    . LEU A  1  1081 ? 103.238 65.085  3.835   1.00 137.85 ? 1081 LEU A CA    1 
ATOM   8424  C  C     . LEU A  1  1081 ? 102.363 66.164  4.547   1.00 143.39 ? 1081 LEU A C     1 
ATOM   8425  O  O     . LEU A  1  1081 ? 101.793 67.025  3.869   1.00 143.29 ? 1081 LEU A O     1 
ATOM   8426  C  CB    . LEU A  1  1081 ? 102.376 64.011  3.125   1.00 137.20 ? 1081 LEU A CB    1 
ATOM   8427  C  CG    . LEU A  1  1081 ? 101.311 64.454  2.107   1.00 142.06 ? 1081 LEU A CG    1 
ATOM   8428  C  CD1   . LEU A  1  1081 ? 101.930 64.827  0.777   1.00 142.00 ? 1081 LEU A CD1   1 
ATOM   8429  C  CD2   . LEU A  1  1081 ? 100.288 63.373  1.902   1.00 143.85 ? 1081 LEU A CD2   1 
ATOM   8430  N  N     . ASN A  1  1082 ? 102.304 66.135  5.907   1.00 140.58 ? 1082 ASN A N     1 
ATOM   8431  C  CA    . ASN A  1  1082 ? 101.531 67.049  6.770   1.00 161.26 ? 1082 ASN A CA    1 
ATOM   8432  C  C     . ASN A  1  1082 ? 101.787 68.543  6.500   1.00 201.42 ? 1082 ASN A C     1 
ATOM   8433  O  O     . ASN A  1  1082 ? 102.865 68.928  6.045   1.00 164.96 ? 1082 ASN A O     1 
ATOM   8434  C  CB    . ASN A  1  1082 ? 101.768 66.735  8.257   1.00 160.13 ? 1082 ASN A CB    1 
ATOM   8435  C  CG    . ASN A  1  1082 ? 101.391 65.336  8.699   1.00 172.92 ? 1082 ASN A CG    1 
ATOM   8436  O  OD1   . ASN A  1  1082 ? 100.225 64.921  8.635   1.00 164.93 ? 1082 ASN A OD1   1 
ATOM   8437  N  ND2   . ASN A  1  1082 ? 102.366 64.603  9.228   1.00 160.92 ? 1082 ASN A ND2   1 
ATOM   8438  N  N     . VAL A  1  1094 ? 106.891 78.206  5.065   1.00 112.28 ? 1094 VAL A N     1 
ATOM   8439  C  CA    . VAL A  1  1094 ? 107.328 77.768  3.732   1.00 111.71 ? 1094 VAL A CA    1 
ATOM   8440  C  C     . VAL A  1  1094 ? 107.079 76.263  3.507   1.00 114.65 ? 1094 VAL A C     1 
ATOM   8441  O  O     . VAL A  1  1094 ? 107.354 75.457  4.403   1.00 114.06 ? 1094 VAL A O     1 
ATOM   8442  C  CB    . VAL A  1  1094 ? 108.797 78.197  3.426   1.00 115.75 ? 1094 VAL A CB    1 
ATOM   8443  C  CG1   . VAL A  1  1094 ? 109.644 77.066  2.825   1.00 113.99 ? 1094 VAL A CG1   1 
ATOM   8444  C  CG2   . VAL A  1  1094 ? 108.822 79.431  2.525   1.00 116.48 ? 1094 VAL A CG2   1 
ATOM   8445  N  N     . THR A  1  1095 ? 106.569 75.904  2.293   1.00 110.55 ? 1095 THR A N     1 
ATOM   8446  C  CA    . THR A  1  1095 ? 106.245 74.532  1.856   1.00 109.08 ? 1095 THR A CA    1 
ATOM   8447  C  C     . THR A  1  1095 ? 107.471 73.638  1.858   1.00 111.67 ? 1095 THR A C     1 
ATOM   8448  O  O     . THR A  1  1095 ? 108.515 74.031  1.346   1.00 111.37 ? 1095 THR A O     1 
ATOM   8449  C  CB    . THR A  1  1095 ? 105.495 74.520  0.521   1.00 117.26 ? 1095 THR A CB    1 
ATOM   8450  O  OG1   . THR A  1  1095 ? 106.056 75.491  -0.374  1.00 119.64 ? 1095 THR A OG1   1 
ATOM   8451  C  CG2   . THR A  1  1095 ? 104.015 74.785  0.706   1.00 116.33 ? 1095 THR A CG2   1 
ATOM   8452  N  N     . SER A  1  1096 ? 107.352 72.455  2.479   1.00 107.50 ? 1096 SER A N     1 
ATOM   8453  C  CA    . SER A  1  1096 ? 108.461 71.510  2.658   1.00 106.58 ? 1096 SER A CA    1 
ATOM   8454  C  C     . SER A  1  1096 ? 108.067 70.044  2.395   1.00 107.20 ? 1096 SER A C     1 
ATOM   8455  O  O     . SER A  1  1096 ? 106.895 69.755  2.151   1.00 106.65 ? 1096 SER A O     1 
ATOM   8456  C  CB    . SER A  1  1096 ? 109.005 71.643  4.078   1.00 112.54 ? 1096 SER A CB    1 
ATOM   8457  O  OG    . SER A  1  1096 ? 107.961 71.501  5.033   1.00 126.11 ? 1096 SER A OG    1 
ATOM   8458  N  N     . GLY A  1  1097 ? 109.059 69.149  2.453   1.00 100.96 ? 1097 GLY A N     1 
ATOM   8459  C  CA    . GLY A  1  1097 ? 108.894 67.705  2.305   1.00 98.83  ? 1097 GLY A CA    1 
ATOM   8460  C  C     . GLY A  1  1097 ? 108.249 67.249  1.018   1.00 100.36 ? 1097 GLY A C     1 
ATOM   8461  O  O     . GLY A  1  1097 ? 108.391 67.917  -0.007  1.00 101.00 ? 1097 GLY A O     1 
ATOM   8462  N  N     . VAL A  1  1098 ? 107.516 66.116  1.075   1.00 93.95  ? 1098 VAL A N     1 
ATOM   8463  C  CA    . VAL A  1  1098 ? 106.822 65.483  -0.059  1.00 91.60  ? 1098 VAL A CA    1 
ATOM   8464  C  C     . VAL A  1  1098 ? 106.046 66.503  -0.917  1.00 92.48  ? 1098 VAL A C     1 
ATOM   8465  O  O     . VAL A  1  1098 ? 106.347 66.563  -2.105  1.00 90.60  ? 1098 VAL A O     1 
ATOM   8466  C  CB    . VAL A  1  1098 ? 105.945 64.280  0.362   1.00 94.87  ? 1098 VAL A CB    1 
ATOM   8467  C  CG1   . VAL A  1  1098 ? 105.190 63.705  -0.829  1.00 94.43  ? 1098 VAL A CG1   1 
ATOM   8468  C  CG2   . VAL A  1  1098 ? 106.785 63.200  1.028   1.00 93.99  ? 1098 VAL A CG2   1 
ATOM   8469  N  N     . PRO A  1  1099 ? 105.136 67.366  -0.375  1.00 89.31  ? 1099 PRO A N     1 
ATOM   8470  C  CA    . PRO A  1  1099 ? 104.456 68.351  -1.246  1.00 88.74  ? 1099 PRO A CA    1 
ATOM   8471  C  C     . PRO A  1  1099 ? 105.387 69.301  -2.007  1.00 88.97  ? 1099 PRO A C     1 
ATOM   8472  O  O     . PRO A  1  1099 ? 105.056 69.694  -3.133  1.00 88.44  ? 1099 PRO A O     1 
ATOM   8473  C  CB    . PRO A  1  1099 ? 103.517 69.094  -0.293  1.00 91.34  ? 1099 PRO A CB    1 
ATOM   8474  C  CG    . PRO A  1  1099 ? 104.048 68.843  1.051   1.00 96.15  ? 1099 PRO A CG    1 
ATOM   8475  C  CD    . PRO A  1  1099 ? 104.645 67.479  1.015   1.00 91.12  ? 1099 PRO A CD    1 
ATOM   8476  N  N     . ARG A  1  1100 ? 106.556 69.634  -1.417  1.00 82.70  ? 1100 ARG A N     1 
ATOM   8477  C  CA    . ARG A  1  1100 ? 107.563 70.480  -2.061  1.00 81.45  ? 1100 ARG A CA    1 
ATOM   8478  C  C     . ARG A  1  1100 ? 108.379 69.655  -3.034  1.00 82.36  ? 1100 ARG A C     1 
ATOM   8479  O  O     . ARG A  1  1100 ? 108.768 70.166  -4.076  1.00 81.86  ? 1100 ARG A O     1 
ATOM   8480  C  CB    . ARG A  1  1100 ? 108.466 71.174  -1.030  1.00 79.95  ? 1100 ARG A CB    1 
ATOM   8481  C  CG    . ARG A  1  1100 ? 109.611 72.020  -1.598  1.00 85.18  ? 1100 ARG A CG    1 
ATOM   8482  C  CD    . ARG A  1  1100 ? 109.187 73.058  -2.618  1.00 85.89  ? 1100 ARG A CD    1 
ATOM   8483  N  NE    . ARG A  1  1100 ? 110.307 73.886  -3.051  1.00 87.25  ? 1100 ARG A NE    1 
ATOM   8484  C  CZ    . ARG A  1  1100 ? 110.289 74.656  -4.133  1.00 102.61 ? 1100 ARG A CZ    1 
ATOM   8485  N  NH1   . ARG A  1  1100 ? 109.220 74.679  -4.924  1.00 91.06  ? 1100 ARG A NH1   1 
ATOM   8486  N  NH2   . ARG A  1  1100 ? 111.341 75.396  -4.444  1.00 88.08  ? 1100 ARG A NH2   1 
ATOM   8487  N  N     . LEU A  1  1101 ? 108.628 68.380  -2.726  1.00 77.12  ? 1101 LEU A N     1 
ATOM   8488  C  CA    . LEU A  1  1101 ? 109.366 67.550  -3.667  1.00 75.56  ? 1101 LEU A CA    1 
ATOM   8489  C  C     . LEU A  1  1101 ? 108.533 67.453  -4.942  1.00 79.78  ? 1101 LEU A C     1 
ATOM   8490  O  O     . LEU A  1  1101 ? 109.082 67.662  -6.023  1.00 80.53  ? 1101 LEU A O     1 
ATOM   8491  C  CB    . LEU A  1  1101 ? 109.718 66.176  -3.082  1.00 74.14  ? 1101 LEU A CB    1 
ATOM   8492  C  CG    . LEU A  1  1101 ? 110.562 65.236  -3.957  1.00 76.88  ? 1101 LEU A CG    1 
ATOM   8493  C  CD1   . LEU A  1  1101 ? 111.984 65.766  -4.193  1.00 75.99  ? 1101 LEU A CD1   1 
ATOM   8494  C  CD2   . LEU A  1  1101 ? 110.608 63.863  -3.347  1.00 77.56  ? 1101 LEU A CD2   1 
ATOM   8495  N  N     . LYS A  1  1102 ? 107.191 67.298  -4.797  1.00 75.31  ? 1102 LYS A N     1 
ATOM   8496  C  CA    . LYS A  1  1102 ? 106.230 67.270  -5.912  1.00 74.65  ? 1102 LYS A CA    1 
ATOM   8497  C  C     . LYS A  1  1102 ? 106.353 68.568  -6.708  1.00 79.97  ? 1102 LYS A C     1 
ATOM   8498  O  O     . LYS A  1  1102 ? 106.545 68.523  -7.920  1.00 80.28  ? 1102 LYS A O     1 
ATOM   8499  C  CB    . LYS A  1  1102 ? 104.785 67.119  -5.410  1.00 76.02  ? 1102 LYS A CB    1 
ATOM   8500  C  CG    . LYS A  1  1102 ? 104.430 65.750  -4.858  1.00 89.53  ? 1102 LYS A CG    1 
ATOM   8501  C  CD    . LYS A  1  1102 ? 103.004 65.711  -4.294  1.00 104.40 ? 1102 LYS A CD    1 
ATOM   8502  C  CE    . LYS A  1  1102 ? 101.917 65.604  -5.352  1.00 116.48 ? 1102 LYS A CE    1 
ATOM   8503  N  NZ    . LYS A  1  1102 ? 100.558 65.819  -4.783  1.00 125.37 ? 1102 LYS A NZ    1 
ATOM   8504  N  N     . GLU A  1  1103 ? 106.319 69.714  -6.000  1.00 76.48  ? 1103 GLU A N     1 
ATOM   8505  C  CA    . GLU A  1  1103 ? 106.414 71.067  -6.543  1.00 76.42  ? 1103 GLU A CA    1 
ATOM   8506  C  C     . GLU A  1  1103 ? 107.651 71.202  -7.482  1.00 80.75  ? 1103 GLU A C     1 
ATOM   8507  O  O     . GLU A  1  1103 ? 107.517 71.674  -8.617  1.00 80.46  ? 1103 GLU A O     1 
ATOM   8508  C  CB    . GLU A  1  1103 ? 106.456 72.071  -5.363  1.00 77.99  ? 1103 GLU A CB    1 
ATOM   8509  C  CG    . GLU A  1  1103 ? 105.651 73.337  -5.556  1.00 87.49  ? 1103 GLU A CG    1 
ATOM   8510  C  CD    . GLU A  1  1103 ? 105.224 74.019  -4.270  1.00 111.78 ? 1103 GLU A CD    1 
ATOM   8511  O  OE1   . GLU A  1  1103 ? 105.996 74.850  -3.735  1.00 111.69 ? 1103 GLU A OE1   1 
ATOM   8512  O  OE2   . GLU A  1  1103 ? 104.088 73.753  -3.819  1.00 108.08 ? 1103 GLU A OE2   1 
ATOM   8513  N  N     . ILE A  1  1104 ? 108.825 70.704  -7.021  1.00 77.20  ? 1104 ILE A N     1 
ATOM   8514  C  CA    . ILE A  1  1104 ? 110.111 70.773  -7.725  1.00 76.76  ? 1104 ILE A CA    1 
ATOM   8515  C  C     . ILE A  1  1104 ? 110.126 69.868  -8.957  1.00 82.28  ? 1104 ILE A C     1 
ATOM   8516  O  O     . ILE A  1  1104 ? 110.318 70.357  -10.071 1.00 83.80  ? 1104 ILE A O     1 
ATOM   8517  C  CB    . ILE A  1  1104 ? 111.327 70.501  -6.787  1.00 78.51  ? 1104 ILE A CB    1 
ATOM   8518  C  CG1   . ILE A  1  1104 ? 111.367 71.471  -5.591  1.00 78.70  ? 1104 ILE A CG1   1 
ATOM   8519  C  CG2   . ILE A  1  1104 ? 112.613 70.583  -7.578  1.00 79.02  ? 1104 ILE A CG2   1 
ATOM   8520  C  CD1   . ILE A  1  1104 ? 112.467 71.216  -4.596  1.00 80.29  ? 1104 ILE A CD1   1 
ATOM   8521  N  N     . LEU A  1  1105 ? 109.926 68.562  -8.761  1.00 77.01  ? 1105 LEU A N     1 
ATOM   8522  C  CA    . LEU A  1  1105 ? 109.945 67.601  -9.853  1.00 76.14  ? 1105 LEU A CA    1 
ATOM   8523  C  C     . LEU A  1  1105 ? 108.944 67.949  -10.929 1.00 81.33  ? 1105 LEU A C     1 
ATOM   8524  O  O     . LEU A  1  1105 ? 109.112 67.532  -12.068 1.00 82.25  ? 1105 LEU A O     1 
ATOM   8525  C  CB    . LEU A  1  1105 ? 109.682 66.160  -9.353  1.00 75.10  ? 1105 LEU A CB    1 
ATOM   8526  C  CG    . LEU A  1  1105 ? 110.551 65.579  -8.230  1.00 78.20  ? 1105 LEU A CG    1 
ATOM   8527  C  CD1   . LEU A  1  1105 ? 110.081 64.218  -7.892  1.00 77.50  ? 1105 LEU A CD1   1 
ATOM   8528  C  CD2   . LEU A  1  1105 ? 112.033 65.536  -8.596  1.00 78.66  ? 1105 LEU A CD2   1 
ATOM   8529  N  N     . ASN A  1  1106 ? 107.918 68.708  -10.586 1.00 78.42  ? 1106 ASN A N     1 
ATOM   8530  C  CA    . ASN A  1  1106 ? 106.888 69.056  -11.548 1.00 79.48  ? 1106 ASN A CA    1 
ATOM   8531  C  C     . ASN A  1  1106 ? 107.098 70.329  -12.297 1.00 86.35  ? 1106 ASN A C     1 
ATOM   8532  O  O     . ASN A  1  1106 ? 106.370 70.580  -13.268 1.00 85.81  ? 1106 ASN A O     1 
ATOM   8533  C  CB    . ASN A  1  1106 ? 105.540 69.099  -10.863 1.00 79.63  ? 1106 ASN A CB    1 
ATOM   8534  C  CG    . ASN A  1  1106 ? 104.996 67.735  -10.582 1.00 88.96  ? 1106 ASN A CG    1 
ATOM   8535  O  OD1   . ASN A  1  1106 ? 105.539 66.709  -11.031 1.00 74.19  ? 1106 ASN A OD1   1 
ATOM   8536  N  ND2   . ASN A  1  1106 ? 103.895 67.711  -9.853  1.00 78.17  ? 1106 ASN A ND2   1 
ATOM   8537  N  N     . VAL A  1  1107 ? 108.062 71.157  -11.836 1.00 85.64  ? 1107 VAL A N     1 
ATOM   8538  C  CA    . VAL A  1  1107 ? 108.328 72.505  -12.360 1.00 87.03  ? 1107 VAL A CA    1 
ATOM   8539  C  C     . VAL A  1  1107 ? 106.946 73.209  -12.344 1.00 94.31  ? 1107 VAL A C     1 
ATOM   8540  O  O     . VAL A  1  1107 ? 106.411 73.616  -13.386 1.00 94.73  ? 1107 VAL A O     1 
ATOM   8541  C  CB    . VAL A  1  1107 ? 109.070 72.541  -13.729 1.00 90.40  ? 1107 VAL A CB    1 
ATOM   8542  C  CG1   . VAL A  1  1107 ? 109.580 73.942  -14.028 1.00 91.35  ? 1107 VAL A CG1   1 
ATOM   8543  C  CG2   . VAL A  1  1107 ? 110.234 71.556  -13.748 1.00 89.36  ? 1107 VAL A CG2   1 
ATOM   8544  N  N     . ALA A  1  1108 ? 106.317 73.186  -11.139 1.00 91.80  ? 1108 ALA A N     1 
ATOM   8545  C  CA    . ALA A  1  1108 ? 104.988 73.715  -10.872 1.00 92.41  ? 1108 ALA A CA    1 
ATOM   8546  C  C     . ALA A  1  1108 ? 104.987 75.202  -11.121 1.00 98.29  ? 1108 ALA A C     1 
ATOM   8547  O  O     . ALA A  1  1108 ? 105.849 75.901  -10.578 1.00 98.16  ? 1108 ALA A O     1 
ATOM   8548  C  CB    . ALA A  1  1108 ? 104.586 73.413  -9.437  1.00 92.81  ? 1108 ALA A CB    1 
ATOM   8549  N  N     . LYS A  1  1109 ? 104.077 75.679  -12.001 1.00 96.47  ? 1109 LYS A N     1 
ATOM   8550  C  CA    . LYS A  1  1109 ? 104.004 77.101  -12.301 1.00 98.25  ? 1109 LYS A CA    1 
ATOM   8551  C  C     . LYS A  1  1109 ? 103.603 77.881  -11.054 1.00 104.53 ? 1109 LYS A C     1 
ATOM   8552  O  O     . LYS A  1  1109 ? 104.399 78.696  -10.576 1.00 105.85 ? 1109 LYS A O     1 
ATOM   8553  C  CB    . LYS A  1  1109 ? 103.124 77.427  -13.528 1.00 101.85 ? 1109 LYS A CB    1 
ATOM   8554  C  CG    . LYS A  1  1109 ? 103.118 78.934  -13.924 1.00 131.77 ? 1109 LYS A CG    1 
ATOM   8555  C  CD    . LYS A  1  1109 ? 104.526 79.535  -14.296 1.00 146.10 ? 1109 LYS A CD    1 
ATOM   8556  C  CE    . LYS A  1  1109 ? 104.580 81.056  -14.347 1.00 155.97 ? 1109 LYS A CE    1 
ATOM   8557  N  NZ    . LYS A  1  1109 ? 105.972 81.576  -14.530 1.00 159.33 ? 1109 LYS A NZ    1 
ATOM   8558  N  N     . ASN A  1  1110 ? 102.433 77.582  -10.475 1.00 100.82 ? 1110 ASN A N     1 
ATOM   8559  C  CA    . ASN A  1  1110 ? 102.016 78.284  -9.271  1.00 100.99 ? 1110 ASN A CA    1 
ATOM   8560  C  C     . ASN A  1  1110 ? 102.399 77.519  -8.011  1.00 102.19 ? 1110 ASN A C     1 
ATOM   8561  O  O     . ASN A  1  1110 ? 101.663 76.645  -7.546  1.00 101.76 ? 1110 ASN A O     1 
ATOM   8562  C  CB    . ASN A  1  1110 ? 100.545 78.673  -9.327  1.00 104.99 ? 1110 ASN A CB    1 
ATOM   8563  C  CG    . ASN A  1  1110 ? 100.336 79.858  -10.239 1.00 142.28 ? 1110 ASN A CG    1 
ATOM   8564  O  OD1   . ASN A  1  1110 ? 100.546 81.021  -9.853  1.00 140.25 ? 1110 ASN A OD1   1 
ATOM   8565  N  ND2   . ASN A  1  1110 ? 100.010 79.584  -11.498 1.00 135.94 ? 1110 ASN A ND2   1 
ATOM   8566  N  N     . MET A  1  1111 ? 103.603 77.823  -7.500  1.00 97.21  ? 1111 MET A N     1 
ATOM   8567  C  CA    . MET A  1  1111 ? 104.138 77.223  -6.284  1.00 96.09  ? 1111 MET A CA    1 
ATOM   8568  C  C     . MET A  1  1111 ? 103.432 77.808  -5.058  1.00 100.56 ? 1111 MET A C     1 
ATOM   8569  O  O     . MET A  1  1111 ? 103.006 78.963  -5.113  1.00 101.43 ? 1111 MET A O     1 
ATOM   8570  C  CB    . MET A  1  1111 ? 105.676 77.332  -6.221  1.00 98.05  ? 1111 MET A CB    1 
ATOM   8571  C  CG    . MET A  1  1111 ? 106.233 78.739  -6.124  1.00 102.46 ? 1111 MET A CG    1 
ATOM   8572  S  SD    . MET A  1  1111 ? 108.002 78.774  -5.699  1.00 106.43 ? 1111 MET A SD    1 
ATOM   8573  C  CE    . MET A  1  1111 ? 107.960 78.126  -4.045  1.00 103.00 ? 1111 MET A CE    1 
ATOM   8574  N  N     . LYS A  1  1112 ? 103.274 77.019  -3.976  1.00 96.36  ? 1112 LYS A N     1 
ATOM   8575  C  CA    . LYS A  1  1112 ? 102.523 77.472  -2.799  1.00 96.76  ? 1112 LYS A CA    1 
ATOM   8576  C  C     . LYS A  1  1112 ? 103.174 78.630  -1.983  1.00 101.51 ? 1112 LYS A C     1 
ATOM   8577  O  O     . LYS A  1  1112 ? 102.459 79.573  -1.634  1.00 102.41 ? 1112 LYS A O     1 
ATOM   8578  C  CB    . LYS A  1  1112 ? 102.140 76.308  -1.874  1.00 97.81  ? 1112 LYS A CB    1 
ATOM   8579  C  CG    . LYS A  1  1112 ? 100.791 75.673  -2.242  1.00 117.37 ? 1112 LYS A CG    1 
ATOM   8580  C  CD    . LYS A  1  1112 ? 100.920 74.309  -2.988  1.00 131.20 ? 1112 LYS A CD    1 
ATOM   8581  C  CE    . LYS A  1  1112 ? 100.850 74.406  -4.505  1.00 136.51 ? 1112 LYS A CE    1 
ATOM   8582  N  NZ    . LYS A  1  1112 ? 101.409 73.197  -5.178  1.00 134.59 ? 1112 LYS A NZ    1 
ATOM   8583  N  N     . THR A  1  1113 ? 104.479 78.584  -1.678  1.00 96.70  ? 1113 THR A N     1 
ATOM   8584  C  CA    . THR A  1  1113 ? 105.071 79.656  -0.865  1.00 96.82  ? 1113 THR A CA    1 
ATOM   8585  C  C     . THR A  1  1113 ? 106.204 80.433  -1.588  1.00 100.74 ? 1113 THR A C     1 
ATOM   8586  O  O     . THR A  1  1113 ? 107.349 80.338  -1.137  1.00 100.61 ? 1113 THR A O     1 
ATOM   8587  C  CB    . THR A  1  1113 ? 105.531 79.096  0.506   1.00 103.62 ? 1113 THR A CB    1 
ATOM   8588  O  OG1   . THR A  1  1113 ? 106.497 78.062  0.309   1.00 102.18 ? 1113 THR A OG1   1 
ATOM   8589  C  CG2   . THR A  1  1113 ? 104.381 78.575  1.351   1.00 102.06 ? 1113 THR A CG2   1 
ATOM   8590  N  N     . PRO A  1  1114 ? 105.952 81.208  -2.683  1.00 97.28  ? 1114 PRO A N     1 
ATOM   8591  C  CA    . PRO A  1  1114 ? 107.066 81.924  -3.338  1.00 96.85  ? 1114 PRO A CA    1 
ATOM   8592  C  C     . PRO A  1  1114 ? 107.690 82.948  -2.407  1.00 100.57 ? 1114 PRO A C     1 
ATOM   8593  O  O     . PRO A  1  1114 ? 106.981 83.642  -1.664  1.00 101.09 ? 1114 PRO A O     1 
ATOM   8594  C  CB    . PRO A  1  1114 ? 106.428 82.576  -4.570  1.00 99.25  ? 1114 PRO A CB    1 
ATOM   8595  C  CG    . PRO A  1  1114 ? 105.109 81.931  -4.738  1.00 104.09 ? 1114 PRO A CG    1 
ATOM   8596  C  CD    . PRO A  1  1114 ? 104.675 81.472  -3.374  1.00 99.71  ? 1114 PRO A CD    1 
ATOM   8597  N  N     . SER A  1  1115 ? 109.026 82.967  -2.386  1.00 95.68  ? 1115 SER A N     1 
ATOM   8598  C  CA    . SER A  1  1115 ? 109.779 83.825  -1.496  1.00 96.23  ? 1115 SER A CA    1 
ATOM   8599  C  C     . SER A  1  1115 ? 111.052 84.347  -2.108  1.00 100.36 ? 1115 SER A C     1 
ATOM   8600  O  O     . SER A  1  1115 ? 111.715 83.658  -2.882  1.00 100.45 ? 1115 SER A O     1 
ATOM   8601  C  CB    . SER A  1  1115 ? 110.078 83.104  -0.187  1.00 100.10 ? 1115 SER A CB    1 
ATOM   8602  O  OG    . SER A  1  1115 ? 110.720 83.970  0.735   1.00 113.83 ? 1115 SER A OG    1 
ATOM   8603  N  N     . LEU A  1  1116 ? 111.402 85.564  -1.716  1.00 96.61  ? 1116 LEU A N     1 
ATOM   8604  C  CA    . LEU A  1  1116 ? 112.572 86.281  -2.169  1.00 96.45  ? 1116 LEU A CA    1 
ATOM   8605  C  C     . LEU A  1  1116 ? 113.411 86.621  -0.931  1.00 101.72 ? 1116 LEU A C     1 
ATOM   8606  O  O     . LEU A  1  1116 ? 112.888 87.168  0.040   1.00 102.92 ? 1116 LEU A O     1 
ATOM   8607  C  CB    . LEU A  1  1116 ? 112.068 87.544  -2.884  1.00 97.27  ? 1116 LEU A CB    1 
ATOM   8608  C  CG    . LEU A  1  1116 ? 112.923 88.229  -3.939  1.00 101.75 ? 1116 LEU A CG    1 
ATOM   8609  C  CD1   . LEU A  1  1116 ? 113.447 87.256  -4.983  1.00 100.84 ? 1116 LEU A CD1   1 
ATOM   8610  C  CD2   . LEU A  1  1116 ? 112.097 89.260  -4.652  1.00 104.32 ? 1116 LEU A CD2   1 
ATOM   8611  N  N     . THR A  1  1117 ? 114.683 86.214  -0.928  1.00 97.53  ? 1117 THR A N     1 
ATOM   8612  C  CA    . THR A  1  1117 ? 115.612 86.484  0.170   1.00 97.39  ? 1117 THR A CA    1 
ATOM   8613  C  C     . THR A  1  1117 ? 116.526 87.604  -0.337  1.00 102.02 ? 1117 THR A C     1 
ATOM   8614  O  O     . THR A  1  1117 ? 117.320 87.388  -1.250  1.00 101.59 ? 1117 THR A O     1 
ATOM   8615  C  CB    . THR A  1  1117 ? 116.281 85.182  0.652   1.00 100.86 ? 1117 THR A CB    1 
ATOM   8616  O  OG1   . THR A  1  1117 ? 115.257 84.255  1.022   1.00 98.95  ? 1117 THR A OG1   1 
ATOM   8617  C  CG2   . THR A  1  1117 ? 117.182 85.399  1.844   1.00 98.96  ? 1117 THR A CG2   1 
ATOM   8618  N  N     . VAL A  1  1118 ? 116.323 88.824  0.185   1.00 99.26  ? 1118 VAL A N     1 
ATOM   8619  C  CA    . VAL A  1  1118 ? 117.010 90.043  -0.236  1.00 99.92  ? 1118 VAL A CA    1 
ATOM   8620  C  C     . VAL A  1  1118 ? 118.176 90.378  0.699   1.00 105.05 ? 1118 VAL A C     1 
ATOM   8621  O  O     . VAL A  1  1118 ? 117.967 90.529  1.906   1.00 105.64 ? 1118 VAL A O     1 
ATOM   8622  C  CB    . VAL A  1  1118 ? 116.016 91.232  -0.370  1.00 104.62 ? 1118 VAL A CB    1 
ATOM   8623  C  CG1   . VAL A  1  1118 ? 116.633 92.378  -1.171  1.00 105.72 ? 1118 VAL A CG1   1 
ATOM   8624  C  CG2   . VAL A  1  1118 ? 114.693 90.795  -0.995  1.00 103.53 ? 1118 VAL A CG2   1 
ATOM   8625  N  N     . TYR A  1  1119 ? 119.401 90.495  0.132   1.00 100.91 ? 1119 TYR A N     1 
ATOM   8626  C  CA    . TYR A  1  1119 ? 120.620 90.807  0.879   1.00 100.65 ? 1119 TYR A CA    1 
ATOM   8627  C  C     . TYR A  1  1119 ? 120.981 92.235  0.673   1.00 109.68 ? 1119 TYR A C     1 
ATOM   8628  O  O     . TYR A  1  1119 ? 120.821 92.755  -0.436  1.00 109.49 ? 1119 TYR A O     1 
ATOM   8629  C  CB    . TYR A  1  1119 ? 121.774 89.887  0.474   1.00 99.19  ? 1119 TYR A CB    1 
ATOM   8630  C  CG    . TYR A  1  1119 ? 121.566 88.465  0.935   1.00 97.01  ? 1119 TYR A CG    1 
ATOM   8631  C  CD1   . TYR A  1  1119 ? 121.845 88.088  2.243   1.00 98.68  ? 1119 TYR A CD1   1 
ATOM   8632  C  CD2   . TYR A  1  1119 ? 121.043 87.505  0.077   1.00 95.87  ? 1119 TYR A CD2   1 
ATOM   8633  C  CE1   . TYR A  1  1119 ? 121.628 86.782  2.682   1.00 98.08  ? 1119 TYR A CE1   1 
ATOM   8634  C  CE2   . TYR A  1  1119 ? 120.825 86.196  0.502   1.00 95.33  ? 1119 TYR A CE2   1 
ATOM   8635  C  CZ    . TYR A  1  1119 ? 121.112 85.840  1.810   1.00 101.51 ? 1119 TYR A CZ    1 
ATOM   8636  O  OH    . TYR A  1  1119 ? 120.888 84.558  2.247   1.00 98.93  ? 1119 TYR A OH    1 
ATOM   8637  N  N     . LEU A  1  1120 ? 121.455 92.879  1.749   1.00 110.73 ? 1120 LEU A N     1 
ATOM   8638  C  CA    . LEU A  1  1120 ? 121.806 94.304  1.787   1.00 113.94 ? 1120 LEU A CA    1 
ATOM   8639  C  C     . LEU A  1  1120 ? 123.158 94.636  1.161   1.00 122.56 ? 1120 LEU A C     1 
ATOM   8640  O  O     . LEU A  1  1120 ? 124.054 93.792  1.177   1.00 121.33 ? 1120 LEU A O     1 
ATOM   8641  C  CB    . LEU A  1  1120 ? 121.746 94.802  3.246   1.00 114.66 ? 1120 LEU A CB    1 
ATOM   8642  C  CG    . LEU A  1  1120 ? 120.591 95.738  3.628   1.00 119.55 ? 1120 LEU A CG    1 
ATOM   8643  C  CD1   . LEU A  1  1120 ? 119.256 95.145  3.294   1.00 118.64 ? 1120 LEU A CD1   1 
ATOM   8644  C  CD2   . LEU A  1  1120 ? 120.600 96.023  5.105   1.00 122.41 ? 1120 LEU A CD2   1 
ATOM   8645  N  N     . GLU A  1  1121 ? 123.308 95.883  0.639   1.00 123.99 ? 1121 GLU A N     1 
ATOM   8646  C  CA    . GLU A  1  1121 ? 124.533 96.420  0.016   1.00 126.26 ? 1121 GLU A CA    1 
ATOM   8647  C  C     . GLU A  1  1121 ? 125.774 96.018  0.825   1.00 133.58 ? 1121 GLU A C     1 
ATOM   8648  O  O     . GLU A  1  1121 ? 125.736 96.130  2.053   1.00 134.34 ? 1121 GLU A O     1 
ATOM   8649  C  CB    . GLU A  1  1121 ? 124.455 97.948  -0.103  1.00 129.58 ? 1121 GLU A CB    1 
ATOM   8650  C  CG    . GLU A  1  1121 ? 125.017 98.493  -1.404  1.00 144.44 ? 1121 GLU A CG    1 
ATOM   8651  C  CD    . GLU A  1  1121 ? 124.337 99.756  -1.906  1.00 177.75 ? 1121 GLU A CD    1 
ATOM   8652  O  OE1   . GLU A  1  1121 ? 124.475 100.812 -1.245  1.00 175.58 ? 1121 GLU A OE1   1 
ATOM   8653  O  OE2   . GLU A  1  1121 ? 123.678 99.694  -2.970  1.00 175.72 ? 1121 GLU A OE2   1 
ATOM   8654  N  N     . PRO A  1  1122 ? 126.853 95.506  0.175   1.00 131.28 ? 1122 PRO A N     1 
ATOM   8655  C  CA    . PRO A  1  1122 ? 128.033 95.027  0.930   1.00 131.23 ? 1122 PRO A CA    1 
ATOM   8656  C  C     . PRO A  1  1122 ? 128.479 95.868  2.134   1.00 136.98 ? 1122 PRO A C     1 
ATOM   8657  O  O     . PRO A  1  1122 ? 128.742 95.300  3.199   1.00 135.87 ? 1122 PRO A O     1 
ATOM   8658  C  CB    . PRO A  1  1122 ? 129.115 94.946  -0.140  1.00 132.92 ? 1122 PRO A CB    1 
ATOM   8659  C  CG    . PRO A  1  1122 ? 128.360 94.572  -1.366  1.00 136.62 ? 1122 PRO A CG    1 
ATOM   8660  C  CD    . PRO A  1  1122 ? 127.023 95.266  -1.275  1.00 132.58 ? 1122 PRO A CD    1 
ATOM   8661  N  N     . GLY A  1  1123 ? 128.513 97.190  1.979   1.00 135.96 ? 1123 GLY A N     1 
ATOM   8662  C  CA    . GLY A  1  1123 ? 128.903 98.089  3.058   1.00 137.98 ? 1123 GLY A CA    1 
ATOM   8663  C  C     . GLY A  1  1123 ? 127.915 98.105  4.208   1.00 143.71 ? 1123 GLY A C     1 
ATOM   8664  O  O     . GLY A  1  1123 ? 128.249 97.742  5.340   1.00 143.53 ? 1123 GLY A O     1 
ATOM   8665  N  N     . HIS A  1  1124 ? 126.672 98.457  3.890   1.00 141.27 ? 1124 HIS A N     1 
ATOM   8666  C  CA    . HIS A  1  1124 ? 125.547 98.612  4.809   1.00 141.77 ? 1124 HIS A CA    1 
ATOM   8667  C  C     . HIS A  1  1124 ? 124.898 97.289  5.277   1.00 142.90 ? 1124 HIS A C     1 
ATOM   8668  O  O     . HIS A  1  1124 ? 123.682 97.250  5.468   1.00 142.30 ? 1124 HIS A O     1 
ATOM   8669  C  CB    . HIS A  1  1124 ? 124.499 99.519  4.148   1.00 143.94 ? 1124 HIS A CB    1 
ATOM   8670  C  CG    . HIS A  1  1124 ? 125.078 100.644 3.346   1.00 149.46 ? 1124 HIS A CG    1 
ATOM   8671  N  ND1   . HIS A  1  1124 ? 125.289 101.893 3.904   1.00 153.37 ? 1124 HIS A ND1   1 
ATOM   8672  C  CD2   . HIS A  1  1124 ? 125.467 100.672 2.049   1.00 151.64 ? 1124 HIS A CD2   1 
ATOM   8673  C  CE1   . HIS A  1  1124 ? 125.798 102.639 2.934   1.00 153.92 ? 1124 HIS A CE1   1 
ATOM   8674  N  NE2   . HIS A  1  1124 ? 125.929 101.946 1.801   1.00 153.23 ? 1124 HIS A NE2   1 
ATOM   8675  N  N     . ALA A  1  1125 ? 125.700 96.227  5.496   1.00 137.44 ? 1125 ALA A N     1 
ATOM   8676  C  CA    . ALA A  1  1125 ? 125.217 94.903  5.914   1.00 135.27 ? 1125 ALA A CA    1 
ATOM   8677  C  C     . ALA A  1  1125 ? 124.594 94.847  7.318   1.00 138.01 ? 1125 ALA A C     1 
ATOM   8678  O  O     . ALA A  1  1125 ? 123.664 94.068  7.537   1.00 136.04 ? 1125 ALA A O     1 
ATOM   8679  C  CB    . ALA A  1  1125 ? 126.331 93.882  5.793   1.00 135.19 ? 1125 ALA A CB    1 
ATOM   8680  N  N     . ALA A  1  1126 ? 125.111 95.655  8.262   1.00 135.36 ? 1126 ALA A N     1 
ATOM   8681  C  CA    . ALA A  1  1126 ? 124.610 95.709  9.637   1.00 135.33 ? 1126 ALA A CA    1 
ATOM   8682  C  C     . ALA A  1  1126 ? 123.754 96.953  9.884   1.00 140.46 ? 1126 ALA A C     1 
ATOM   8683  O  O     . ALA A  1  1126 ? 123.209 97.117  10.980  1.00 140.38 ? 1126 ALA A O     1 
ATOM   8684  C  CB    . ALA A  1  1126 ? 125.767 95.656  10.617  1.00 136.61 ? 1126 ALA A CB    1 
ATOM   8685  N  N     . ASP A  1  1127 ? 123.616 97.813  8.848   1.00 138.12 ? 1127 ASP A N     1 
ATOM   8686  C  CA    . ASP A  1  1127 ? 122.815 99.043  8.868   1.00 139.54 ? 1127 ASP A CA    1 
ATOM   8687  C  C     . ASP A  1  1127 ? 121.337 98.665  9.013   1.00 141.94 ? 1127 ASP A C     1 
ATOM   8688  O  O     . ASP A  1  1127 ? 120.668 98.338  8.026   1.00 140.70 ? 1127 ASP A O     1 
ATOM   8689  C  CB    . ASP A  1  1127 ? 123.066 99.885  7.583   1.00 142.44 ? 1127 ASP A CB    1 
ATOM   8690  C  CG    . ASP A  1  1127 ? 122.662 101.364 7.606   1.00 156.21 ? 1127 ASP A CG    1 
ATOM   8691  O  OD1   . ASP A  1  1127 ? 121.609 101.691 8.205   1.00 157.79 ? 1127 ASP A OD1   1 
ATOM   8692  O  OD2   . ASP A  1  1127 ? 123.346 102.177 6.940   1.00 162.27 ? 1127 ASP A OD2   1 
ATOM   8693  N  N     . GLN A  1  1128 ? 120.857 98.663  10.269  1.00 138.19 ? 1128 GLN A N     1 
ATOM   8694  C  CA    . GLN A  1  1128 ? 119.477 98.351  10.649  1.00 137.28 ? 1128 GLN A CA    1 
ATOM   8695  C  C     . GLN A  1  1128 ? 118.500 99.326  9.966   1.00 140.28 ? 1128 GLN A C     1 
ATOM   8696  O  O     . GLN A  1  1128 ? 117.449 98.900  9.483   1.00 138.50 ? 1128 GLN A O     1 
ATOM   8697  C  CB    . GLN A  1  1128 ? 119.358 98.347  12.196  1.00 139.46 ? 1128 GLN A CB    1 
ATOM   8698  C  CG    . GLN A  1  1128 ? 118.005 98.753  12.806  1.00 152.87 ? 1128 GLN A CG    1 
ATOM   8699  C  CD    . GLN A  1  1128 ? 117.079 97.595  13.086  1.00 163.47 ? 1128 GLN A CD    1 
ATOM   8700  O  OE1   . GLN A  1  1128 ? 116.822 96.750  12.227  1.00 160.21 ? 1128 GLN A OE1   1 
ATOM   8701  N  NE2   . GLN A  1  1128 ? 116.510 97.566  14.284  1.00 149.08 ? 1128 GLN A NE2   1 
ATOM   8702  N  N     . GLU A  1  1129 ? 118.879 100.617 9.889   1.00 137.68 ? 1129 GLU A N     1 
ATOM   8703  C  CA    . GLU A  1  1129 ? 118.070 101.656 9.259   1.00 138.27 ? 1129 GLU A CA    1 
ATOM   8704  C  C     . GLU A  1  1129 ? 117.939 101.495 7.748   1.00 140.16 ? 1129 GLU A C     1 
ATOM   8705  O  O     . GLU A  1  1129 ? 116.891 101.848 7.204   1.00 140.70 ? 1129 GLU A O     1 
ATOM   8706  C  CB    . GLU A  1  1129 ? 118.558 103.060 9.628   1.00 141.75 ? 1129 GLU A CB    1 
ATOM   8707  C  CG    . GLU A  1  1129 ? 117.918 103.601 10.900  1.00 155.33 ? 1129 GLU A CG    1 
ATOM   8708  C  CD    . GLU A  1  1129 ? 116.402 103.735 10.904  1.00 179.78 ? 1129 GLU A CD    1 
ATOM   8709  O  OE1   . GLU A  1  1129 ? 115.842 104.314 9.944   1.00 172.29 ? 1129 GLU A OE1   1 
ATOM   8710  O  OE2   . GLU A  1  1129 ? 115.777 103.284 11.891  1.00 175.69 ? 1129 GLU A OE2   1 
ATOM   8711  N  N     . GLN A  1  1130 ? 118.972 100.953 7.068   1.00 133.90 ? 1130 GLN A N     1 
ATOM   8712  C  CA    . GLN A  1  1130 ? 118.884 100.721 5.626   1.00 132.01 ? 1130 GLN A CA    1 
ATOM   8713  C  C     . GLN A  1  1130 ? 117.987 99.513  5.345   1.00 132.93 ? 1130 GLN A C     1 
ATOM   8714  O  O     . GLN A  1  1130 ? 117.362 99.453  4.285   1.00 132.24 ? 1130 GLN A O     1 
ATOM   8715  C  CB    . GLN A  1  1130 ? 120.262 100.579 4.964   1.00 132.85 ? 1130 GLN A CB    1 
ATOM   8716  C  CG    . GLN A  1  1130 ? 120.192 100.753 3.446   1.00 143.05 ? 1130 GLN A CG    1 
ATOM   8717  C  CD    . GLN A  1  1130 ? 121.528 100.911 2.781   1.00 157.95 ? 1130 GLN A CD    1 
ATOM   8718  O  OE1   . GLN A  1  1130 ? 122.161 101.972 2.859   1.00 154.98 ? 1130 GLN A OE1   1 
ATOM   8719  N  NE2   . GLN A  1  1130 ? 121.952 99.882  2.053   1.00 143.34 ? 1130 GLN A NE2   1 
ATOM   8720  N  N     . ALA A  1  1131 ? 117.886 98.579  6.310   1.00 127.66 ? 1131 ALA A N     1 
ATOM   8721  C  CA    . ALA A  1  1131 ? 117.026 97.404  6.179   1.00 125.67 ? 1131 ALA A CA    1 
ATOM   8722  C  C     . ALA A  1  1131 ? 115.561 97.848  6.158   1.00 128.76 ? 1131 ALA A C     1 
ATOM   8723  O  O     . ALA A  1  1131 ? 114.863 97.558  5.183   1.00 127.58 ? 1131 ALA A O     1 
ATOM   8724  C  CB    . ALA A  1  1131 ? 117.281 96.425  7.314   1.00 125.66 ? 1131 ALA A CB    1 
ATOM   8725  N  N     . LYS A  1  1132 ? 115.136 98.644  7.178   1.00 125.45 ? 1132 LYS A N     1 
ATOM   8726  C  CA    . LYS A  1  1132 ? 113.784 99.215  7.316   1.00 125.15 ? 1132 LYS A CA    1 
ATOM   8727  C  C     . LYS A  1  1132 ? 113.425 99.987  6.052   1.00 127.58 ? 1132 LYS A C     1 
ATOM   8728  O  O     . LYS A  1  1132 ? 112.286 99.913  5.587   1.00 126.43 ? 1132 LYS A O     1 
ATOM   8729  C  CB    . LYS A  1  1132 ? 113.711 100.183 8.515   1.00 129.28 ? 1132 LYS A CB    1 
ATOM   8730  C  CG    . LYS A  1  1132 ? 113.960 99.571  9.887   1.00 143.68 ? 1132 LYS A CG    1 
ATOM   8731  C  CD    . LYS A  1  1132 ? 113.861 100.628 10.986  1.00 154.71 ? 1132 LYS A CD    1 
ATOM   8732  C  CE    . LYS A  1  1132 ? 114.640 100.239 12.217  1.00 162.12 ? 1132 LYS A CE    1 
ATOM   8733  N  NZ    . LYS A  1  1132 ? 114.492 101.237 13.309  1.00 167.86 ? 1132 LYS A NZ    1 
ATOM   8734  N  N     . LEU A  1  1133 ? 114.420 100.723 5.504   1.00 124.20 ? 1133 LEU A N     1 
ATOM   8735  C  CA    . LEU A  1  1133 ? 114.319 101.542 4.301   1.00 124.48 ? 1133 LEU A CA    1 
ATOM   8736  C  C     . LEU A  1  1133 ? 113.978 100.710 3.071   1.00 126.61 ? 1133 LEU A C     1 
ATOM   8737  O  O     . LEU A  1  1133 ? 113.072 101.087 2.332   1.00 126.42 ? 1133 LEU A O     1 
ATOM   8738  C  CB    . LEU A  1  1133 ? 115.611 102.332 4.086   1.00 125.46 ? 1133 LEU A CB    1 
ATOM   8739  C  CG    . LEU A  1  1133 ? 115.509 103.501 3.129   1.00 131.45 ? 1133 LEU A CG    1 
ATOM   8740  C  CD1   . LEU A  1  1133 ? 115.961 104.779 3.797   1.00 132.98 ? 1133 LEU A CD1   1 
ATOM   8741  C  CD2   . LEU A  1  1133 ? 116.286 103.221 1.850   1.00 133.48 ? 1133 LEU A CD2   1 
ATOM   8742  N  N     . ILE A  1  1134 ? 114.685 99.585  2.854   1.00 121.53 ? 1134 ILE A N     1 
ATOM   8743  C  CA    . ILE A  1  1134 ? 114.409 98.722  1.707   1.00 119.87 ? 1134 ILE A CA    1 
ATOM   8744  C  C     . ILE A  1  1134 ? 113.095 97.997  1.947   1.00 123.93 ? 1134 ILE A C     1 
ATOM   8745  O  O     . ILE A  1  1134 ? 112.280 97.939  1.027   1.00 123.64 ? 1134 ILE A O     1 
ATOM   8746  C  CB    . ILE A  1  1134 ? 115.599 97.804  1.311   1.00 121.52 ? 1134 ILE A CB    1 
ATOM   8747  C  CG1   . ILE A  1  1134 ? 116.827 98.662  0.958   1.00 122.91 ? 1134 ILE A CG1   1 
ATOM   8748  C  CG2   . ILE A  1  1134 ? 115.240 96.901  0.113   1.00 120.63 ? 1134 ILE A CG2   1 
ATOM   8749  C  CD1   . ILE A  1  1134 ? 118.123 98.060  1.279   1.00 130.99 ? 1134 ILE A CD1   1 
ATOM   8750  N  N     . ARG A  1  1135 ? 112.852 97.541  3.205   1.00 120.71 ? 1135 ARG A N     1 
ATOM   8751  C  CA    . ARG A  1  1135 ? 111.621 96.862  3.652   1.00 119.90 ? 1135 ARG A CA    1 
ATOM   8752  C  C     . ARG A  1  1135 ? 110.400 97.643  3.136   1.00 125.23 ? 1135 ARG A C     1 
ATOM   8753  O  O     . ARG A  1  1135 ? 109.600 97.079  2.390   1.00 123.60 ? 1135 ARG A O     1 
ATOM   8754  C  CB    . ARG A  1  1135 ? 111.586 96.752  5.205   1.00 119.68 ? 1135 ARG A CB    1 
ATOM   8755  C  CG    . ARG A  1  1135 ? 110.705 95.652  5.822   1.00 126.95 ? 1135 ARG A CG    1 
ATOM   8756  C  CD    . ARG A  1  1135 ? 109.228 95.762  5.474   1.00 139.63 ? 1135 ARG A CD    1 
ATOM   8757  N  NE    . ARG A  1  1135 ? 108.353 95.968  6.625   1.00 153.10 ? 1135 ARG A NE    1 
ATOM   8758  C  CZ    . ARG A  1  1135 ? 108.023 97.160  7.110   1.00 175.12 ? 1135 ARG A CZ    1 
ATOM   8759  N  NH1   . ARG A  1  1135 ? 108.543 98.266  6.588   1.00 164.20 ? 1135 ARG A NH1   1 
ATOM   8760  N  NH2   . ARG A  1  1135 ? 107.201 97.256  8.147   1.00 166.63 ? 1135 ARG A NH2   1 
ATOM   8761  N  N     . SER A  1  1136 ? 110.305 98.952  3.480   1.00 124.13 ? 1136 SER A N     1 
ATOM   8762  C  CA    . SER A  1  1136 ? 109.206 99.835  3.074   1.00 124.95 ? 1136 SER A CA    1 
ATOM   8763  C  C     . SER A  1  1136 ? 109.257 100.271 1.597   1.00 127.86 ? 1136 SER A C     1 
ATOM   8764  O  O     . SER A  1  1136 ? 108.217 100.635 1.037   1.00 128.01 ? 1136 SER A O     1 
ATOM   8765  C  CB    . SER A  1  1136 ? 109.117 101.045 3.998   1.00 130.35 ? 1136 SER A CB    1 
ATOM   8766  O  OG    . SER A  1  1136 ? 110.301 101.820 3.936   1.00 142.14 ? 1136 SER A OG    1 
ATOM   8767  N  N     . ALA A  1  1137 ? 110.451 100.218 0.971   1.00 122.79 ? 1137 ALA A N     1 
ATOM   8768  C  CA    . ALA A  1  1137 ? 110.638 100.594 -0.434  1.00 122.21 ? 1137 ALA A CA    1 
ATOM   8769  C  C     . ALA A  1  1137 ? 110.158 99.519  -1.398  1.00 123.48 ? 1137 ALA A C     1 
ATOM   8770  O  O     . ALA A  1  1137 ? 109.817 99.845  -2.537  1.00 123.08 ? 1137 ALA A O     1 
ATOM   8771  C  CB    . ALA A  1  1137 ? 112.099 100.908 -0.706  1.00 123.15 ? 1137 ALA A CB    1 
ATOM   8772  N  N     . ILE A  1  1138 ? 110.156 98.242  -0.955  1.00 117.97 ? 1138 ILE A N     1 
ATOM   8773  C  CA    . ILE A  1  1138 ? 109.776 97.106  -1.794  1.00 116.20 ? 1138 ILE A CA    1 
ATOM   8774  C  C     . ILE A  1  1138 ? 108.383 96.536  -1.458  1.00 121.16 ? 1138 ILE A C     1 
ATOM   8775  O  O     . ILE A  1  1138 ? 107.715 96.067  -2.382  1.00 120.91 ? 1138 ILE A O     1 
ATOM   8776  C  CB    . ILE A  1  1138 ? 110.863 95.986  -1.845  1.00 117.46 ? 1138 ILE A CB    1 
ATOM   8777  C  CG1   . ILE A  1  1138 ? 111.133 95.334  -0.468  1.00 116.86 ? 1138 ILE A CG1   1 
ATOM   8778  C  CG2   . ILE A  1  1138 ? 112.150 96.505  -2.481  1.00 118.80 ? 1138 ILE A CG2   1 
ATOM   8779  C  CD1   . ILE A  1  1138 ? 111.716 93.935  -0.526  1.00 119.34 ? 1138 ILE A CD1   1 
ATOM   8780  N  N     . GLU A  1  1139 ? 107.943 96.560  -0.167  1.00 117.83 ? 1139 GLU A N     1 
ATOM   8781  C  CA    . GLU A  1  1139 ? 106.631 96.017  0.227   1.00 116.74 ? 1139 GLU A CA    1 
ATOM   8782  C  C     . GLU A  1  1139 ? 105.494 96.766  -0.446  1.00 122.47 ? 1139 GLU A C     1 
ATOM   8783  O  O     . GLU A  1  1139 ? 105.371 97.994  -0.300  1.00 123.48 ? 1139 GLU A O     1 
ATOM   8784  C  CB    . GLU A  1  1139 ? 106.434 95.970  1.754   1.00 117.95 ? 1139 GLU A CB    1 
ATOM   8785  C  CG    . GLU A  1  1139 ? 105.320 95.023  2.178   1.00 123.83 ? 1139 GLU A CG    1 
ATOM   8786  C  CD    . GLU A  1  1139 ? 104.999 94.909  3.657   1.00 139.54 ? 1139 GLU A CD    1 
ATOM   8787  O  OE1   . GLU A  1  1139 ? 105.911 95.099  4.495   1.00 124.69 ? 1139 GLU A OE1   1 
ATOM   8788  O  OE2   . GLU A  1  1139 ? 103.837 94.569  3.975   1.00 136.17 ? 1139 GLU A OE2   1 
ATOM   8789  N  N     . HIS A  1  1140 ? 104.681 96.009  -1.208  1.00 118.58 ? 1140 HIS A N     1 
ATOM   8790  C  CA    . HIS A  1  1140 ? 103.527 96.517  -1.945  1.00 119.21 ? 1140 HIS A CA    1 
ATOM   8791  C  C     . HIS A  1  1140 ? 102.487 97.082  -0.984  1.00 124.15 ? 1140 HIS A C     1 
ATOM   8792  O  O     . HIS A  1  1140 ? 102.169 96.459  0.039   1.00 123.52 ? 1140 HIS A O     1 
ATOM   8793  C  CB    . HIS A  1  1140 ? 102.929 95.416  -2.834  1.00 118.53 ? 1140 HIS A CB    1 
ATOM   8794  C  CG    . HIS A  1  1140 ? 101.789 95.856  -3.696  1.00 122.37 ? 1140 HIS A CG    1 
ATOM   8795  N  ND1   . HIS A  1  1140 ? 101.964 96.784  -4.709  1.00 124.78 ? 1140 HIS A ND1   1 
ATOM   8796  C  CD2   . HIS A  1  1140 ? 100.502 95.438  -3.700  1.00 123.87 ? 1140 HIS A CD2   1 
ATOM   8797  C  CE1   . HIS A  1  1140 ? 100.778 96.916  -5.277  1.00 124.67 ? 1140 HIS A CE1   1 
ATOM   8798  N  NE2   . HIS A  1  1140 ? 99.866  96.131  -4.701  1.00 124.49 ? 1140 HIS A NE2   1 
ATOM   8799  N  N     . THR A  1  1141 ? 102.002 98.292  -1.302  1.00 121.32 ? 1141 THR A N     1 
ATOM   8800  C  CA    . THR A  1  1141 ? 101.014 99.018  -0.514  1.00 122.18 ? 1141 THR A CA    1 
ATOM   8801  C  C     . THR A  1  1141 ? 99.957  99.652  -1.440  1.00 126.70 ? 1141 THR A C     1 
ATOM   8802  O  O     . THR A  1  1141 ? 100.284 100.526 -2.252  1.00 127.01 ? 1141 THR A O     1 
ATOM   8803  C  CB    . THR A  1  1141 ? 101.723 100.007 0.440   1.00 130.71 ? 1141 THR A CB    1 
ATOM   8804  O  OG1   . THR A  1  1141 ? 102.635 99.281  1.273   1.00 128.88 ? 1141 THR A OG1   1 
ATOM   8805  C  CG2   . THR A  1  1141 ? 100.749 100.799 1.306   1.00 130.25 ? 1141 THR A CG2   1 
ATOM   8806  N  N     . THR A  1  1142 ? 98.697  99.177  -1.329  1.00 122.58 ? 1142 THR A N     1 
ATOM   8807  C  CA    . THR A  1  1142 ? 97.559  99.699  -2.098  1.00 122.82 ? 1142 THR A CA    1 
ATOM   8808  C  C     . THR A  1  1142 ? 96.735  100.668 -1.251  1.00 126.06 ? 1142 THR A C     1 
ATOM   8809  O  O     . THR A  1  1142 ? 96.759  100.587 -0.018  1.00 126.12 ? 1142 THR A O     1 
ATOM   8810  C  CB    . THR A  1  1142 ? 96.680  98.578  -2.666  1.00 129.94 ? 1142 THR A CB    1 
ATOM   8811  O  OG1   . THR A  1  1142 ? 96.638  97.480  -1.749  1.00 129.53 ? 1142 THR A OG1   1 
ATOM   8812  C  CG2   . THR A  1  1142 ? 97.123  98.134  -4.054  1.00 126.93 ? 1142 THR A CG2   1 
ATOM   8813  N  N     . LEU A  1  1143 ? 95.999  101.580 -1.914  1.00 120.98 ? 1143 LEU A N     1 
ATOM   8814  C  CA    . LEU A  1  1143 ? 95.148  102.542 -1.232  1.00 120.97 ? 1143 LEU A CA    1 
ATOM   8815  C  C     . LEU A  1  1143 ? 94.106  101.801 -0.381  1.00 124.71 ? 1143 LEU A C     1 
ATOM   8816  O  O     . LEU A  1  1143 ? 93.811  102.238 0.729   1.00 125.29 ? 1143 LEU A O     1 
ATOM   8817  C  CB    . LEU A  1  1143 ? 94.503  103.490 -2.252  1.00 121.59 ? 1143 LEU A CB    1 
ATOM   8818  C  CG    . LEU A  1  1143 ? 93.554  104.570 -1.739  1.00 126.85 ? 1143 LEU A CG    1 
ATOM   8819  C  CD1   . LEU A  1  1143 ? 94.175  105.403 -0.639  1.00 127.36 ? 1143 LEU A CD1   1 
ATOM   8820  C  CD2   . LEU A  1  1143 ? 93.105  105.450 -2.866  1.00 130.12 ? 1143 LEU A CD2   1 
ATOM   8821  N  N     . LYS A  1  1144 ? 93.629  100.635 -0.869  1.00 120.28 ? 1144 LYS A N     1 
ATOM   8822  C  CA    . LYS A  1  1144 ? 92.669  99.761  -0.186  1.00 119.91 ? 1144 LYS A CA    1 
ATOM   8823  C  C     . LYS A  1  1144 ? 93.132  99.468  1.247   1.00 125.16 ? 1144 LYS A C     1 
ATOM   8824  O  O     . LYS A  1  1144 ? 92.326  99.563  2.179   1.00 125.61 ? 1144 LYS A O     1 
ATOM   8825  C  CB    . LYS A  1  1144 ? 92.489  98.447  -0.974  1.00 120.36 ? 1144 LYS A CB    1 
ATOM   8826  C  CG    . LYS A  1  1144 ? 91.243  97.650  -0.604  1.00 129.87 ? 1144 LYS A CG    1 
ATOM   8827  C  CD    . LYS A  1  1144 ? 91.038  96.439  -1.510  1.00 136.67 ? 1144 LYS A CD    1 
ATOM   8828  C  CE    . LYS A  1  1144 ? 89.908  95.568  -1.011  1.00 146.08 ? 1144 LYS A CE    1 
ATOM   8829  N  NZ    . LYS A  1  1144 ? 89.795  94.297  -1.777  1.00 154.74 ? 1144 LYS A NZ    1 
ATOM   8830  N  N     . SER A  1  1145 ? 94.444  99.166  1.415   1.00 121.57 ? 1145 SER A N     1 
ATOM   8831  C  CA    . SER A  1  1145 ? 95.067  98.873  2.707   1.00 120.97 ? 1145 SER A CA    1 
ATOM   8832  C  C     . SER A  1  1145 ? 95.006  100.064 3.687   1.00 126.60 ? 1145 SER A C     1 
ATOM   8833  O  O     . SER A  1  1145 ? 94.922  99.840  4.896   1.00 126.88 ? 1145 SER A O     1 
ATOM   8834  C  CB    . SER A  1  1145 ? 96.500  98.369  2.527   1.00 122.58 ? 1145 SER A CB    1 
ATOM   8835  O  OG    . SER A  1  1145 ? 97.439  99.413  2.320   1.00 130.64 ? 1145 SER A OG    1 
ATOM   8836  N  N     . VAL A  1  1146 ? 95.008  101.312 3.177   1.00 123.18 ? 1146 VAL A N     1 
ATOM   8837  C  CA    . VAL A  1  1146 ? 94.971  102.489 4.050   1.00 124.13 ? 1146 VAL A CA    1 
ATOM   8838  C  C     . VAL A  1  1146 ? 93.599  103.187 4.095   1.00 128.21 ? 1146 VAL A C     1 
ATOM   8839  O  O     . VAL A  1  1146 ? 93.546  104.330 4.546   1.00 129.89 ? 1146 VAL A O     1 
ATOM   8840  C  CB    . VAL A  1  1146 ? 96.104  103.510 3.763   1.00 128.98 ? 1146 VAL A CB    1 
ATOM   8841  C  CG1   . VAL A  1  1146 ? 97.465  102.966 4.182   1.00 127.94 ? 1146 VAL A CG1   1 
ATOM   8842  C  CG2   . VAL A  1  1146 ? 96.110  103.958 2.306   1.00 129.10 ? 1146 VAL A CG2   1 
ATOM   8843  N  N     . THR A  1  1147 ? 92.495  102.515 3.687   1.00 122.08 ? 1147 THR A N     1 
ATOM   8844  C  CA    . THR A  1  1147 ? 91.170  103.156 3.717   1.00 121.77 ? 1147 THR A CA    1 
ATOM   8845  C  C     . THR A  1  1147 ? 90.202  102.493 4.695   1.00 123.76 ? 1147 THR A C     1 
ATOM   8846  O  O     . THR A  1  1147 ? 90.045  101.270 4.681   1.00 121.89 ? 1147 THR A O     1 
ATOM   8847  C  CB    . THR A  1  1147 ? 90.571  103.260 2.310   1.00 124.64 ? 1147 THR A CB    1 
ATOM   8848  O  OG1   . THR A  1  1147 ? 91.580  103.650 1.382   1.00 121.75 ? 1147 THR A OG1   1 
ATOM   8849  C  CG2   . THR A  1  1147 ? 89.428  104.252 2.242   1.00 124.78 ? 1147 THR A CG2   1 
ATOM   8850  N  N     . ILE A  1  1148 ? 89.531  103.315 5.518   1.00 120.98 ? 1148 ILE A N     1 
ATOM   8851  C  CA    . ILE A  1  1148 ? 88.522  102.859 6.480   1.00 120.93 ? 1148 ILE A CA    1 
ATOM   8852  C  C     . ILE A  1  1148 ? 87.176  102.642 5.748   1.00 125.56 ? 1148 ILE A C     1 
ATOM   8853  O  O     . ILE A  1  1148 ? 86.560  101.580 5.893   1.00 123.82 ? 1148 ILE A O     1 
ATOM   8854  C  CB    . ILE A  1  1148 ? 88.353  103.812 7.706   1.00 125.43 ? 1148 ILE A CB    1 
ATOM   8855  C  CG1   . ILE A  1  1148 ? 89.656  104.535 8.090   1.00 126.14 ? 1148 ILE A CG1   1 
ATOM   8856  C  CG2   . ILE A  1  1148 ? 87.761  103.054 8.899   1.00 125.75 ? 1148 ILE A CG2   1 
ATOM   8857  C  CD1   . ILE A  1  1148 ? 89.465  105.834 8.872   1.00 133.19 ? 1148 ILE A CD1   1 
ATOM   8858  N  N     . ALA A  1  1149 ? 86.725  103.674 4.981   1.00 123.30 ? 1149 ALA A N     1 
ATOM   8859  C  CA    . ALA A  1  1149 ? 85.482  103.707 4.196   1.00 123.12 ? 1149 ALA A CA    1 
ATOM   8860  C  C     . ALA A  1  1149 ? 85.563  104.759 3.080   1.00 127.82 ? 1149 ALA A C     1 
ATOM   8861  O  O     . ALA A  1  1149 ? 86.333  105.718 3.189   1.00 128.37 ? 1149 ALA A O     1 
ATOM   8862  C  CB    . ALA A  1  1149 ? 84.304  104.031 5.103   1.00 124.94 ? 1149 ALA A CB    1 
ATOM   8863  N  N     . SER A  1  1150 ? 84.768  104.576 2.008   1.00 124.03 ? 1150 SER A N     1 
ATOM   8864  C  CA    . SER A  1  1150 ? 84.648  105.537 0.906   1.00 124.66 ? 1150 SER A CA    1 
ATOM   8865  C  C     . SER A  1  1150 ? 83.169  105.890 0.772   1.00 129.26 ? 1150 SER A C     1 
ATOM   8866  O  O     . SER A  1  1150 ? 82.313  105.026 0.970   1.00 129.08 ? 1150 SER A O     1 
ATOM   8867  C  CB    . SER A  1  1150 ? 85.205  104.983 -0.402  1.00 126.81 ? 1150 SER A CB    1 
ATOM   8868  O  OG    . SER A  1  1150 ? 84.397  103.955 -0.947  1.00 135.19 ? 1150 SER A OG    1 
ATOM   8869  N  N     . GLU A  1  1151 ? 82.858  107.158 0.499   1.00 125.85 ? 1151 GLU A N     1 
ATOM   8870  C  CA    . GLU A  1  1151 ? 81.466  107.589 0.414   1.00 126.07 ? 1151 GLU A CA    1 
ATOM   8871  C  C     . GLU A  1  1151 ? 81.186  108.442 -0.817  1.00 128.87 ? 1151 GLU A C     1 
ATOM   8872  O  O     . GLU A  1  1151 ? 82.101  109.065 -1.355  1.00 128.59 ? 1151 GLU A O     1 
ATOM   8873  C  CB    . GLU A  1  1151 ? 81.081  108.368 1.676   1.00 128.95 ? 1151 GLU A CB    1 
ATOM   8874  C  CG    . GLU A  1  1151 ? 81.021  107.569 2.968   1.00 136.52 ? 1151 GLU A CG    1 
ATOM   8875  C  CD    . GLU A  1  1151 ? 80.876  108.441 4.202   1.00 152.33 ? 1151 GLU A CD    1 
ATOM   8876  O  OE1   . GLU A  1  1151 ? 81.597  109.462 4.314   1.00 133.34 ? 1151 GLU A OE1   1 
ATOM   8877  O  OE2   . GLU A  1  1151 ? 80.042  108.088 5.068   1.00 145.49 ? 1151 GLU A OE2   1 
ATOM   8878  N  N     . ILE A  1  1152 ? 79.923  108.468 -1.267  1.00 124.93 ? 1152 ILE A N     1 
ATOM   8879  C  CA    . ILE A  1  1152 ? 79.528  109.292 -2.405  1.00 125.79 ? 1152 ILE A CA    1 
ATOM   8880  C  C     . ILE A  1  1152 ? 78.466  110.293 -1.957  1.00 131.17 ? 1152 ILE A C     1 
ATOM   8881  O  O     . ILE A  1  1152 ? 77.396  109.900 -1.493  1.00 131.33 ? 1152 ILE A O     1 
ATOM   8882  C  CB    . ILE A  1  1152 ? 79.153  108.497 -3.685  1.00 127.98 ? 1152 ILE A CB    1 
ATOM   8883  C  CG1   . ILE A  1  1152 ? 80.328  107.593 -4.130  1.00 126.23 ? 1152 ILE A CG1   1 
ATOM   8884  C  CG2   . ILE A  1  1152 ? 78.751  109.462 -4.814  1.00 130.54 ? 1152 ILE A CG2   1 
ATOM   8885  C  CD1   . ILE A  1  1152 ? 79.996  106.491 -5.151  1.00 132.87 ? 1152 ILE A CD1   1 
ATOM   8886  N  N     . TYR A  1  1153 ? 78.797  111.584 -2.058  1.00 128.35 ? 1153 TYR A N     1 
ATOM   8887  C  CA    . TYR A  1  1153 ? 77.934  112.683 -1.644  1.00 130.21 ? 1153 TYR A CA    1 
ATOM   8888  C  C     . TYR A  1  1153 ? 77.546  113.541 -2.834  1.00 134.29 ? 1153 TYR A C     1 
ATOM   8889  O  O     . TYR A  1  1153 ? 78.340  113.698 -3.763  1.00 134.28 ? 1153 TYR A O     1 
ATOM   8890  C  CB    . TYR A  1  1153 ? 78.673  113.585 -0.632  1.00 132.67 ? 1153 TYR A CB    1 
ATOM   8891  C  CG    . TYR A  1  1153 ? 78.902  112.987 0.738   1.00 134.03 ? 1153 TYR A CG    1 
ATOM   8892  C  CD1   . TYR A  1  1153 ? 79.982  112.143 0.980   1.00 134.31 ? 1153 TYR A CD1   1 
ATOM   8893  C  CD2   . TYR A  1  1153 ? 78.098  113.341 1.818   1.00 136.06 ? 1153 TYR A CD2   1 
ATOM   8894  C  CE1   . TYR A  1  1153 ? 80.220  111.617 2.248   1.00 134.77 ? 1153 TYR A CE1   1 
ATOM   8895  C  CE2   . TYR A  1  1153 ? 78.328  112.825 3.092   1.00 136.37 ? 1153 TYR A CE2   1 
ATOM   8896  C  CZ    . TYR A  1  1153 ? 79.386  111.956 3.301   1.00 143.20 ? 1153 TYR A CZ    1 
ATOM   8897  O  OH    . TYR A  1  1153 ? 79.616  111.429 4.549   1.00 144.64 ? 1153 TYR A OH    1 
ATOM   8898  N  N     . TYR A  1  1154 ? 76.350  114.133 -2.791  1.00 130.46 ? 1154 TYR A N     1 
ATOM   8899  C  CA    . TYR A  1  1154 ? 75.942  115.069 -3.822  1.00 131.44 ? 1154 TYR A CA    1 
ATOM   8900  C  C     . TYR A  1  1154 ? 76.324  116.456 -3.277  1.00 138.95 ? 1154 TYR A C     1 
ATOM   8901  O  O     . TYR A  1  1154 ? 75.590  117.043 -2.474  1.00 139.94 ? 1154 TYR A O     1 
ATOM   8902  C  CB    . TYR A  1  1154 ? 74.436  114.948 -4.181  1.00 132.59 ? 1154 TYR A CB    1 
ATOM   8903  C  CG    . TYR A  1  1154 ? 73.941  116.031 -5.124  1.00 135.01 ? 1154 TYR A CG    1 
ATOM   8904  C  CD1   . TYR A  1  1154 ? 74.205  115.971 -6.488  1.00 136.