data_4BZN
# 
_entry.id   4BZN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4BZN         
PDBE  EBI-57835    
WWPDB D_1290057835 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4BZO 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF PIM1 IN COMPLEX WITH A PYRROLO- PYRAZINONE INHIBITOR' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4BZN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Casale, E.'       1  
'Casuscelli, F.'   2  
'Ardini, E.'       3  
'Avanzi, N.'       4  
'Cervi, G.'        5  
;D'Anello, M.
;
6  
'Donati, D.'       7  
'Faiardi, D.'      8  
'Ferguson, R.D.'   9  
'Fogliatto, G.'    10 
'Galvani, A.'      11 
'Marsiglio, A.'    12 
'Mirizzi, D.G.'    13 
'Montemartini, M.' 14 
'Orrenius, C.'     15 
'Papeo, G.'        16 
'Piutti, C.'       17 
'Salom, B.'        18 
'Felder, E.R.'     19 
# 
_citation.id                        primary 
_citation.title                     
'Discovery and Optimization of Pyrrolo[1,2-A]Pyrazinones Leads to Novel and Selective Inhibitors of Pim Kinases.' 
_citation.journal_abbrev            Bioorg.Med.Chem. 
_citation.journal_volume            21 
_citation.page_first                7364 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           BMECEP 
_citation.country                   UK 
_citation.journal_id_ISSN           0968-0896 
_citation.journal_id_CSD            1200 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24139169 
_citation.pdbx_database_id_DOI      10.1016/J.BMC.2013.09.054 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Casuscelli, F.'   1  
primary 'Ardini, E.'       2  
primary 'Avanzi, N.'       3  
primary 'Casale, E.'       4  
primary 'Cervi, G.'        5  
primary 
;D'Anello, M.
;
6  
primary 'Donati, D.'       7  
primary 'Faiardi, D.'      8  
primary 'Ferguson, R.D.'   9  
primary 'Fogliatto, G.'    10 
primary 'Galvani, A.'      11 
primary 'Marsiglio, A.'    12 
primary 'Mirizzi, D.G.'    13 
primary 'Montemartini, M.' 14 
primary 'Orrenius, C.'     15 
primary 'Papeo, G.'        16 
primary 'Piutti, C.'       17 
primary 'Salom, B.'        18 
primary 'Felder, E.R.'     19 
# 
_cell.entry_id           4BZN 
_cell.length_a           96.802 
_cell.length_b           96.802 
_cell.length_c           79.995 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4BZN 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE PIM-1'                                                                    
35835.691 1   2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 2-313' ? 
2 non-polymer syn 'N-(2,2-dimethylpropyl)-2-[1-oxo-7-(thiophen-3-yl)-1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazin-4-yl]acetamide' 
345.459   1   ?        ? ?                               ? 
3 water       nat water                                                                                                      
18.015    170 ?        ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROTO-ONCOGENE SERINE THREONINE-PROTEIN KINASE PIM-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIRGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   LEU n 
1 5   SER n 
1 6   LYS n 
1 7   ILE n 
1 8   ASN n 
1 9   SER n 
1 10  LEU n 
1 11  ALA n 
1 12  HIS n 
1 13  LEU n 
1 14  ARG n 
1 15  ALA n 
1 16  ALA n 
1 17  PRO n 
1 18  CYS n 
1 19  ASN n 
1 20  ASP n 
1 21  LEU n 
1 22  HIS n 
1 23  ALA n 
1 24  THR n 
1 25  LYS n 
1 26  LEU n 
1 27  ALA n 
1 28  PRO n 
1 29  GLY n 
1 30  LYS n 
1 31  GLU n 
1 32  LYS n 
1 33  GLU n 
1 34  PRO n 
1 35  LEU n 
1 36  GLU n 
1 37  SER n 
1 38  GLN n 
1 39  TYR n 
1 40  GLN n 
1 41  VAL n 
1 42  GLY n 
1 43  PRO n 
1 44  LEU n 
1 45  LEU n 
1 46  GLY n 
1 47  SER n 
1 48  GLY n 
1 49  GLY n 
1 50  PHE n 
1 51  GLY n 
1 52  SER n 
1 53  VAL n 
1 54  TYR n 
1 55  SER n 
1 56  GLY n 
1 57  ILE n 
1 58  ARG n 
1 59  VAL n 
1 60  SER n 
1 61  ASP n 
1 62  ASN n 
1 63  LEU n 
1 64  PRO n 
1 65  VAL n 
1 66  ALA n 
1 67  ILE n 
1 68  LYS n 
1 69  HIS n 
1 70  VAL n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  ILE n 
1 76  SER n 
1 77  ASP n 
1 78  TRP n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  PRO n 
1 83  ASN n 
1 84  GLY n 
1 85  THR n 
1 86  ARG n 
1 87  VAL n 
1 88  PRO n 
1 89  MET n 
1 90  GLU n 
1 91  VAL n 
1 92  VAL n 
1 93  LEU n 
1 94  LEU n 
1 95  LYS n 
1 96  LYS n 
1 97  VAL n 
1 98  SER n 
1 99  SER n 
1 100 GLY n 
1 101 PHE n 
1 102 SER n 
1 103 GLY n 
1 104 VAL n 
1 105 ILE n 
1 106 ARG n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 TRP n 
1 111 PHE n 
1 112 GLU n 
1 113 ARG n 
1 114 PRO n 
1 115 ASP n 
1 116 SER n 
1 117 PHE n 
1 118 VAL n 
1 119 LEU n 
1 120 ILE n 
1 121 LEU n 
1 122 GLU n 
1 123 ARG n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 VAL n 
1 128 GLN n 
1 129 ASP n 
1 130 LEU n 
1 131 PHE n 
1 132 ASP n 
1 133 PHE n 
1 134 ILE n 
1 135 THR n 
1 136 GLU n 
1 137 ARG n 
1 138 GLY n 
1 139 ALA n 
1 140 LEU n 
1 141 GLN n 
1 142 GLU n 
1 143 GLU n 
1 144 LEU n 
1 145 ALA n 
1 146 ARG n 
1 147 SER n 
1 148 PHE n 
1 149 PHE n 
1 150 TRP n 
1 151 GLN n 
1 152 VAL n 
1 153 LEU n 
1 154 GLU n 
1 155 ALA n 
1 156 VAL n 
1 157 ARG n 
1 158 HIS n 
1 159 CYS n 
1 160 HIS n 
1 161 ASN n 
1 162 CYS n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 HIS n 
1 167 ARG n 
1 168 ASP n 
1 169 ILE n 
1 170 LYS n 
1 171 ASP n 
1 172 GLU n 
1 173 ASN n 
1 174 ILE n 
1 175 LEU n 
1 176 ILE n 
1 177 ASP n 
1 178 LEU n 
1 179 ASN n 
1 180 ARG n 
1 181 GLY n 
1 182 GLU n 
1 183 LEU n 
1 184 LYS n 
1 185 LEU n 
1 186 ILE n 
1 187 ASP n 
1 188 PHE n 
1 189 GLY n 
1 190 SER n 
1 191 GLY n 
1 192 ALA n 
1 193 LEU n 
1 194 LEU n 
1 195 LYS n 
1 196 ASP n 
1 197 THR n 
1 198 VAL n 
1 199 TYR n 
1 200 THR n 
1 201 ASP n 
1 202 PHE n 
1 203 ASP n 
1 204 GLY n 
1 205 THR n 
1 206 ARG n 
1 207 VAL n 
1 208 TYR n 
1 209 SER n 
1 210 PRO n 
1 211 PRO n 
1 212 GLU n 
1 213 TRP n 
1 214 ILE n 
1 215 ARG n 
1 216 TYR n 
1 217 HIS n 
1 218 ARG n 
1 219 TYR n 
1 220 HIS n 
1 221 GLY n 
1 222 ARG n 
1 223 SER n 
1 224 ALA n 
1 225 ALA n 
1 226 VAL n 
1 227 TRP n 
1 228 SER n 
1 229 LEU n 
1 230 GLY n 
1 231 ILE n 
1 232 LEU n 
1 233 LEU n 
1 234 TYR n 
1 235 ASP n 
1 236 MET n 
1 237 VAL n 
1 238 CYS n 
1 239 GLY n 
1 240 ASP n 
1 241 ILE n 
1 242 PRO n 
1 243 PHE n 
1 244 GLU n 
1 245 HIS n 
1 246 ASP n 
1 247 GLU n 
1 248 GLU n 
1 249 ILE n 
1 250 ILE n 
1 251 ARG n 
1 252 GLY n 
1 253 GLN n 
1 254 VAL n 
1 255 PHE n 
1 256 PHE n 
1 257 ARG n 
1 258 GLN n 
1 259 ARG n 
1 260 VAL n 
1 261 SER n 
1 262 SEP n 
1 263 GLU n 
1 264 CYS n 
1 265 GLN n 
1 266 HIS n 
1 267 LEU n 
1 268 ILE n 
1 269 ARG n 
1 270 TRP n 
1 271 CYS n 
1 272 LEU n 
1 273 ALA n 
1 274 LEU n 
1 275 ARG n 
1 276 PRO n 
1 277 SER n 
1 278 ASP n 
1 279 ARG n 
1 280 PRO n 
1 281 THR n 
1 282 PHE n 
1 283 GLU n 
1 284 GLU n 
1 285 ILE n 
1 286 GLN n 
1 287 ASN n 
1 288 HIS n 
1 289 PRO n 
1 290 TRP n 
1 291 MET n 
1 292 GLN n 
1 293 ASP n 
1 294 VAL n 
1 295 LEU n 
1 296 LEU n 
1 297 PRO n 
1 298 GLN n 
1 299 GLU n 
1 300 THR n 
1 301 ALA n 
1 302 GLU n 
1 303 ILE n 
1 304 HIS n 
1 305 LEU n 
1 306 HIS n 
1 307 SER n 
1 308 LEU n 
1 309 SER n 
1 310 PRO n 
1 311 GLY n 
1 312 PRO n 
1 313 SER n 
1 314 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PGEX2T 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PIM1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P11309 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4BZN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 314 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P11309 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  313 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       313 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4BZN GLY A 1 ? UNP P11309 ? ? 'expression tag' 0 1 
1 4BZN PRO A 2 ? UNP P11309 ? ? 'expression tag' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?               'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?               'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?               'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?               'C5 H9 N O2'      115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P'    185.072 
SER 'L-peptide linking' y SERINE ?               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?               'C9 H11 N O3'     181.189 
UGX non-polymer         . 
'N-(2,2-dimethylpropyl)-2-[1-oxo-7-(thiophen-3-yl)-1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazin-4-yl]acetamide' ?               
'C18 H23 N3 O2 S' 345.459 
VAL 'L-peptide linking' y VALINE ?               'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4BZN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.19 
_exptl_crystal.density_percent_sol   61.15 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '20% PEG 3350K, 0.3 M NACL, 0.1 M TRISHCL PH 7.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2008-04-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.97 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4BZN 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   33517 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.47 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.70 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4BZN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     31804 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    99.70 
_refine.ls_R_factor_obs                          0.17766 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17656 
_refine.ls_R_factor_R_free                       0.19879 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1699 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.966 
_refine.correlation_coeff_Fo_to_Fc_free          0.958 
_refine.B_iso_mean                               35.881 
_refine.aniso_B[1][1]                            0.20 
_refine.aniso_B[2][2]                            0.20 
_refine.aniso_B[3][3]                            -0.30 
_refine.aniso_B[1][2]                            0.10 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1YXT' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.113 
_refine.pdbx_overall_ESU_R_Free                  0.106 
_refine.overall_SU_ML                            0.070 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.341 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2228 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               2422 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.008  0.019  ? 2314 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.341  1.964  ? 3145 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.095  5.000  ? 272  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.432 23.136 ? 118  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.456 15.000 ? 379  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.704 15.000 ? 21   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 333  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.021  ? 1794 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.900 
_refine_ls_shell.d_res_low                        1.949 
_refine_ls_shell.number_reflns_R_work             2276 
_refine_ls_shell.R_factor_R_work                  0.253 
_refine_ls_shell.percent_reflns_obs               99.71 
_refine_ls_shell.R_factor_R_free                  0.279 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             110 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4BZN 
_struct.title                     'Crystal structure of PIM1 in complex with a Pyrrolo(1,2-a)Pyrazinone inhibitor' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE PIM-1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4BZN 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'PIM1, ATP BINDING, KINASE INHIBITOR, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 34  ? GLN A 38  ? PRO A 33  GLN A 37  1 ? 5  
HELX_P HELX_P2  2  ASP A 73  ? ILE A 75  ? ASP A 72  ILE A 74  5 ? 3  
HELX_P HELX_P3  3  MET A 89  ? VAL A 97  ? MET A 88  VAL A 96  1 ? 9  
HELX_P HELX_P4  4  LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9  
HELX_P HELX_P5  5  GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 
HELX_P HELX_P6  6  LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3  
HELX_P HELX_P7  7  THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5  
HELX_P HELX_P8  8  PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8  
HELX_P HELX_P9  9  HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 
HELX_P HELX_P10 10 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8  
HELX_P HELX_P11 11 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 
HELX_P HELX_P12 12 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5  
HELX_P HELX_P13 13 THR A 281 ? ASN A 287 ? THR A 280 ASN A 286 1 ? 7  
HELX_P HELX_P14 14 HIS A 288 ? GLN A 292 ? HIS A 287 GLN A 291 5 ? 5  
HELX_P HELX_P15 15 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale ? ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.335 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           125 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            124 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    126 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     125 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 3 ? 
AD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 39  ? GLY A 48  ? TYR A 38  GLY A 47  
AA 2 GLY A 51  ? ARG A 58  ? GLY A 50  ARG A 57  
AA 3 PRO A 64  ? GLU A 71  ? PRO A 63  GLU A 70  
AA 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 
AA 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 
AB 1 TRP A 78  ? GLU A 80  ? TRP A 77  GLU A 79  
AB 2 ARG A 86  ? PRO A 88  ? ARG A 85  PRO A 87  
AC 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 
AC 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 
AC 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 
AD 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 
AD 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 48  ? N GLY A 47  O GLY A 51  ? O GLY A 50  
AA 2 3 N GLY A 56  ? N GLY A 55  O VAL A 65  ? O VAL A 64  
AA 3 4 N VAL A 70  ? N VAL A 69  O PHE A 117 ? O PHE A 116 
AA 4 5 O ILE A 120 ? O ILE A 119 N LEU A 108 ? N LEU A 107 
AB 1 2 N GLY A 79  ? N GLY A 78  O VAL A 87  ? O VAL A 86  
AC 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 
AC 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 
AD 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE UGX A 1306' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU A 45  ? LEU A 44   . ? 1_555 ? 
2  AC1 12 GLY A 46  ? GLY A 45   . ? 1_555 ? 
3  AC1 12 PHE A 50  ? PHE A 49   . ? 1_555 ? 
4  AC1 12 ALA A 66  ? ALA A 65   . ? 1_555 ? 
5  AC1 12 LYS A 68  ? LYS A 67   . ? 1_555 ? 
6  AC1 12 LEU A 121 ? LEU A 120  . ? 1_555 ? 
7  AC1 12 GLU A 122 ? GLU A 121  . ? 1_555 ? 
8  AC1 12 ASP A 129 ? ASP A 128  . ? 1_555 ? 
9  AC1 12 LEU A 175 ? LEU A 174  . ? 1_555 ? 
10 AC1 12 ILE A 186 ? ILE A 185  . ? 1_555 ? 
11 AC1 12 ASP A 187 ? ASP A 186  . ? 1_555 ? 
12 AC1 12 HOH C .   ? HOH A 2049 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4BZN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4BZN 
_atom_sites.fract_transf_matrix[1][1]   0.010330 
_atom_sites.fract_transf_matrix[1][2]   0.005964 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011928 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012501 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 34  ? 5.588  -41.312 -12.907 1.00 86.42 ? 33   PRO A N   1 
ATOM   2    C CA  . PRO A 1 34  ? 6.866  -40.937 -13.508 1.00 85.68 ? 33   PRO A CA  1 
ATOM   3    C C   . PRO A 1 34  ? 7.994  -40.840 -12.479 1.00 84.58 ? 33   PRO A C   1 
ATOM   4    O O   . PRO A 1 34  ? 9.037  -41.477 -12.651 1.00 85.51 ? 33   PRO A O   1 
ATOM   5    C CB  . PRO A 1 34  ? 6.579  -39.566 -14.144 1.00 84.81 ? 33   PRO A CB  1 
ATOM   6    C CG  . PRO A 1 34  ? 5.255  -39.112 -13.598 1.00 86.21 ? 33   PRO A CG  1 
ATOM   7    C CD  . PRO A 1 34  ? 4.744  -40.139 -12.626 1.00 85.56 ? 33   PRO A CD  1 
ATOM   8    N N   . LEU A 1 35  ? 7.783  -40.056 -11.419 1.00 80.90 ? 34   LEU A N   1 
ATOM   9    C CA  . LEU A 1 35  ? 8.770  -39.922 -10.336 1.00 76.72 ? 34   LEU A CA  1 
ATOM   10   C C   . LEU A 1 35  ? 8.619  -41.027 -9.282  1.00 73.91 ? 34   LEU A C   1 
ATOM   11   O O   . LEU A 1 35  ? 9.596  -41.697 -8.928  1.00 67.96 ? 34   LEU A O   1 
ATOM   12   C CB  . LEU A 1 35  ? 8.683  -38.519 -9.691  1.00 75.28 ? 34   LEU A CB  1 
ATOM   13   C CG  . LEU A 1 35  ? 9.092  -38.258 -8.221  1.00 76.93 ? 34   LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 35  ? 10.485 -38.829 -7.868  1.00 74.45 ? 34   LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 35  ? 9.080  -36.747 -7.960  1.00 75.29 ? 34   LEU A CD2 1 
ATOM   16   N N   . GLU A 1 36  ? 7.397  -41.214 -8.789  1.00 74.59 ? 35   GLU A N   1 
ATOM   17   C CA  . GLU A 1 36  ? 7.127  -42.169 -7.712  1.00 72.90 ? 35   GLU A CA  1 
ATOM   18   C C   . GLU A 1 36  ? 7.369  -43.613 -8.147  1.00 70.51 ? 35   GLU A C   1 
ATOM   19   O O   . GLU A 1 36  ? 7.747  -44.456 -7.332  1.00 70.55 ? 35   GLU A O   1 
ATOM   20   C CB  . GLU A 1 36  ? 5.695  -42.007 -7.185  1.00 77.22 ? 35   GLU A CB  1 
ATOM   21   C CG  . GLU A 1 36  ? 5.371  -40.631 -6.606  1.00 80.10 ? 35   GLU A CG  1 
ATOM   22   C CD  . GLU A 1 36  ? 4.920  -39.611 -7.651  1.00 83.42 ? 35   GLU A CD  1 
ATOM   23   O OE1 . GLU A 1 36  ? 5.146  -39.817 -8.877  1.00 85.89 ? 35   GLU A OE1 1 
ATOM   24   O OE2 . GLU A 1 36  ? 4.331  -38.584 -7.240  1.00 87.34 ? 35   GLU A OE2 1 
ATOM   25   N N   . SER A 1 37  ? 7.163  -43.893 -9.430  1.00 67.45 ? 36   SER A N   1 
ATOM   26   C CA  . SER A 1 37  ? 7.392  -45.237 -9.962  1.00 68.72 ? 36   SER A CA  1 
ATOM   27   C C   . SER A 1 37  ? 8.880  -45.531 -10.202 1.00 67.46 ? 36   SER A C   1 
ATOM   28   O O   . SER A 1 37  ? 9.329  -46.661 -10.006 1.00 69.36 ? 36   SER A O   1 
ATOM   29   C CB  . SER A 1 37  ? 6.573  -45.476 -11.239 1.00 69.02 ? 36   SER A CB  1 
ATOM   30   O OG  . SER A 1 37  ? 7.199  -44.909 -12.379 1.00 67.64 ? 36   SER A OG  1 
ATOM   31   N N   . GLN A 1 38  ? 9.635  -44.512 -10.613 1.00 63.57 ? 37   GLN A N   1 
ATOM   32   C CA  . GLN A 1 38  ? 11.064 -44.663 -10.916 1.00 59.58 ? 37   GLN A CA  1 
ATOM   33   C C   . GLN A 1 38  ? 11.970 -44.846 -9.698  1.00 55.80 ? 37   GLN A C   1 
ATOM   34   O O   . GLN A 1 38  ? 13.050 -45.426 -9.814  1.00 56.78 ? 37   GLN A O   1 
ATOM   35   C CB  . GLN A 1 38  ? 11.567 -43.479 -11.730 1.00 61.26 ? 37   GLN A CB  1 
ATOM   36   C CG  . GLN A 1 38  ? 11.533 -43.692 -13.230 1.00 65.45 ? 37   GLN A CG  1 
ATOM   37   C CD  . GLN A 1 38  ? 12.282 -42.601 -13.968 1.00 65.73 ? 37   GLN A CD  1 
ATOM   38   O OE1 . GLN A 1 38  ? 13.409 -42.807 -14.417 1.00 67.70 ? 37   GLN A OE1 1 
ATOM   39   N NE2 . GLN A 1 38  ? 11.669 -41.424 -14.074 1.00 65.62 ? 37   GLN A NE2 1 
ATOM   40   N N   . TYR A 1 39  ? 11.537 -44.354 -8.540  1.00 51.27 ? 38   TYR A N   1 
ATOM   41   C CA  . TYR A 1 39  ? 12.364 -44.396 -7.337  1.00 49.76 ? 38   TYR A CA  1 
ATOM   42   C C   . TYR A 1 39  ? 11.644 -44.988 -6.142  1.00 50.90 ? 38   TYR A C   1 
ATOM   43   O O   . TYR A 1 39  ? 10.453 -44.743 -5.934  1.00 53.29 ? 38   TYR A O   1 
ATOM   44   C CB  . TYR A 1 39  ? 12.895 -42.992 -7.001  1.00 48.05 ? 38   TYR A CB  1 
ATOM   45   C CG  . TYR A 1 39  ? 13.749 -42.427 -8.109  1.00 44.67 ? 38   TYR A CG  1 
ATOM   46   C CD1 . TYR A 1 39  ? 15.085 -42.788 -8.229  1.00 44.39 ? 38   TYR A CD1 1 
ATOM   47   C CD2 . TYR A 1 39  ? 13.212 -41.552 -9.054  1.00 44.40 ? 38   TYR A CD2 1 
ATOM   48   C CE1 . TYR A 1 39  ? 15.870 -42.296 -9.259  1.00 42.30 ? 38   TYR A CE1 1 
ATOM   49   C CE2 . TYR A 1 39  ? 13.989 -41.054 -10.088 1.00 43.23 ? 38   TYR A CE2 1 
ATOM   50   C CZ  . TYR A 1 39  ? 15.317 -41.430 -10.179 1.00 42.14 ? 38   TYR A CZ  1 
ATOM   51   O OH  . TYR A 1 39  ? 16.099 -40.937 -11.195 1.00 41.98 ? 38   TYR A OH  1 
ATOM   52   N N   . GLN A 1 40  ? 12.378 -45.785 -5.374  1.00 50.49 ? 39   GLN A N   1 
ATOM   53   C CA  . GLN A 1 40  ? 11.893 -46.296 -4.101  1.00 49.02 ? 39   GLN A CA  1 
ATOM   54   C C   . GLN A 1 40  ? 12.370 -45.332 -3.013  1.00 47.90 ? 39   GLN A C   1 
ATOM   55   O O   . GLN A 1 40  ? 13.570 -45.230 -2.765  1.00 47.80 ? 39   GLN A O   1 
ATOM   56   C CB  . GLN A 1 40  ? 12.439 -47.707 -3.858  1.00 53.20 ? 39   GLN A CB  1 
ATOM   57   C CG  . GLN A 1 40  ? 11.577 -48.566 -2.946  1.00 59.13 ? 39   GLN A CG  1 
ATOM   58   C CD  . GLN A 1 40  ? 10.226 -48.877 -3.566  1.00 66.73 ? 39   GLN A CD  1 
ATOM   59   O OE1 . GLN A 1 40  ? 10.139 -49.609 -4.557  1.00 70.03 ? 39   GLN A OE1 1 
ATOM   60   N NE2 . GLN A 1 40  ? 9.162  -48.313 -2.990  1.00 66.86 ? 39   GLN A NE2 1 
ATOM   61   N N   . VAL A 1 41  ? 11.440 -44.617 -2.383  1.00 44.86 ? 40   VAL A N   1 
ATOM   62   C CA  . VAL A 1 41  ? 11.798 -43.645 -1.356  1.00 42.76 ? 40   VAL A CA  1 
ATOM   63   C C   . VAL A 1 41  ? 12.110 -44.355 -0.044  1.00 42.77 ? 40   VAL A C   1 
ATOM   64   O O   . VAL A 1 41  ? 11.300 -45.135 0.458   1.00 41.85 ? 40   VAL A O   1 
ATOM   65   C CB  . VAL A 1 41  ? 10.695 -42.594 -1.125  1.00 42.98 ? 40   VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 41  ? 11.210 -41.475 -0.230  1.00 43.64 ? 40   VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 41  ? 10.198 -42.029 -2.447  1.00 45.12 ? 40   VAL A CG2 1 
ATOM   68   N N   . GLY A 1 42  ? 13.290 -44.084 0.502   1.00 37.93 ? 41   GLY A N   1 
ATOM   69   C CA  . GLY A 1 42  ? 13.666 -44.597 1.809   1.00 35.47 ? 41   GLY A CA  1 
ATOM   70   C C   . GLY A 1 42  ? 13.492 -43.526 2.861   1.00 34.03 ? 41   GLY A C   1 
ATOM   71   O O   . GLY A 1 42  ? 12.709 -42.598 2.674   1.00 34.94 ? 41   GLY A O   1 
ATOM   72   N N   . PRO A 1 43  ? 14.226 -43.642 3.975   1.00 32.68 ? 42   PRO A N   1 
ATOM   73   C CA  . PRO A 1 43  ? 14.077 -42.709 5.097   1.00 33.83 ? 42   PRO A CA  1 
ATOM   74   C C   . PRO A 1 43  ? 14.535 -41.283 4.776   1.00 34.89 ? 42   PRO A C   1 
ATOM   75   O O   . PRO A 1 43  ? 15.359 -41.079 3.876   1.00 33.74 ? 42   PRO A O   1 
ATOM   76   C CB  . PRO A 1 43  ? 14.986 -43.279 6.186   1.00 33.25 ? 42   PRO A CB  1 
ATOM   77   C CG  . PRO A 1 43  ? 15.674 -44.466 5.619   1.00 35.48 ? 42   PRO A CG  1 
ATOM   78   C CD  . PRO A 1 43  ? 15.189 -44.726 4.231   1.00 34.57 ? 42   PRO A CD  1 
ATOM   79   N N   . LEU A 1 44  ? 13.991 -40.324 5.513   1.00 33.87 ? 43   LEU A N   1 
ATOM   80   C CA  . LEU A 1 44  ? 14.462 -38.946 5.488   1.00 34.39 ? 43   LEU A CA  1 
ATOM   81   C C   . LEU A 1 44  ? 15.913 -38.887 5.963   1.00 36.76 ? 43   LEU A C   1 
ATOM   82   O O   . LEU A 1 44  ? 16.234 -39.406 7.027   1.00 36.12 ? 43   LEU A O   1 
ATOM   83   C CB  . LEU A 1 44  ? 13.583 -38.072 6.388   1.00 34.37 ? 43   LEU A CB  1 
ATOM   84   C CG  . LEU A 1 44  ? 13.876 -36.563 6.474   1.00 35.46 ? 43   LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 44  ? 13.531 -35.822 5.187   1.00 33.50 ? 43   LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 44  ? 13.140 -35.937 7.640   1.00 34.95 ? 43   LEU A CD2 1 
ATOM   87   N N   . LEU A 1 45  ? 16.784 -38.269 5.164   1.00 34.59 ? 44   LEU A N   1 
ATOM   88   C CA  . LEU A 1 45  ? 18.188 -38.092 5.558   1.00 33.17 ? 44   LEU A CA  1 
ATOM   89   C C   . LEU A 1 45  ? 18.416 -36.787 6.305   1.00 31.78 ? 44   LEU A C   1 
ATOM   90   O O   . LEU A 1 45  ? 19.198 -36.737 7.243   1.00 33.47 ? 44   LEU A O   1 
ATOM   91   C CB  . LEU A 1 45  ? 19.114 -38.196 4.342   1.00 33.48 ? 44   LEU A CB  1 
ATOM   92   C CG  . LEU A 1 45  ? 19.211 -39.568 3.670   1.00 34.20 ? 44   LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 45  ? 19.964 -39.454 2.349   1.00 32.82 ? 44   LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 45  ? 19.883 -40.587 4.574   1.00 32.22 ? 44   LEU A CD2 1 
ATOM   95   N N   . GLY A 1 46  ? 17.729 -35.728 5.905   1.00 31.90 ? 45   GLY A N   1 
ATOM   96   C CA  . GLY A 1 46  ? 17.878 -34.435 6.569   1.00 30.47 ? 45   GLY A CA  1 
ATOM   97   C C   . GLY A 1 46  ? 16.857 -33.471 6.041   1.00 29.35 ? 45   GLY A C   1 
ATOM   98   O O   . GLY A 1 46  ? 16.316 -33.663 4.961   1.00 29.25 ? 45   GLY A O   1 
ATOM   99   N N   . SER A 1 47  ? 16.584 -32.433 6.805   1.00 30.07 ? 46   SER A N   1 
ATOM   100  C CA  . SER A 1 47  ? 15.731 -31.364 6.343   1.00 31.83 ? 46   SER A CA  1 
ATOM   101  C C   . SER A 1 47  ? 16.147 -30.099 7.040   1.00 30.75 ? 46   SER A C   1 
ATOM   102  O O   . SER A 1 47  ? 16.742 -30.144 8.110   1.00 32.31 ? 46   SER A O   1 
ATOM   103  C CB  . SER A 1 47  ? 14.246 -31.665 6.611   1.00 34.81 ? 46   SER A CB  1 
ATOM   104  O OG  . SER A 1 47  ? 13.979 -31.660 7.996   1.00 38.76 ? 46   SER A OG  1 
ATOM   105  N N   . GLY A 1 48  ? 15.841 -28.966 6.429   1.00 31.73 ? 47   GLY A N   1 
ATOM   106  C CA  . GLY A 1 48  ? 16.207 -27.675 6.982   1.00 31.97 ? 47   GLY A CA  1 
ATOM   107  C C   . GLY A 1 48  ? 15.901 -26.622 5.948   1.00 32.70 ? 47   GLY A C   1 
ATOM   108  O O   . GLY A 1 48  ? 15.029 -26.832 5.093   1.00 31.54 ? 47   GLY A O   1 
ATOM   109  N N   . GLY A 1 49  ? 16.632 -25.507 5.997   1.00 31.10 ? 48   GLY A N   1 
ATOM   110  C CA  . GLY A 1 49  ? 16.426 -24.413 5.050   1.00 32.40 ? 48   GLY A CA  1 
ATOM   111  C C   . GLY A 1 49  ? 16.552 -24.854 3.597   1.00 33.69 ? 48   GLY A C   1 
ATOM   112  O O   . GLY A 1 49  ? 15.968 -24.242 2.703   1.00 34.74 ? 48   GLY A O   1 
ATOM   113  N N   . PHE A 1 50  ? 17.297 -25.933 3.368   1.00 31.28 ? 49   PHE A N   1 
ATOM   114  C CA  . PHE A 1 50  ? 17.547 -26.448 2.025   1.00 32.08 ? 49   PHE A CA  1 
ATOM   115  C C   . PHE A 1 50  ? 16.387 -27.271 1.470   1.00 31.29 ? 49   PHE A C   1 
ATOM   116  O O   . PHE A 1 50  ? 16.371 -27.591 0.281   1.00 32.41 ? 49   PHE A O   1 
ATOM   117  C CB  . PHE A 1 50  ? 18.808 -27.323 2.022   1.00 29.94 ? 49   PHE A CB  1 
ATOM   118  C CG  . PHE A 1 50  ? 18.807 -28.411 3.073   1.00 30.40 ? 49   PHE A CG  1 
ATOM   119  C CD1 . PHE A 1 50  ? 18.199 -29.650 2.828   1.00 29.99 ? 49   PHE A CD1 1 
ATOM   120  C CD2 . PHE A 1 50  ? 19.436 -28.206 4.296   1.00 28.67 ? 49   PHE A CD2 1 
ATOM   121  C CE1 . PHE A 1 50  ? 18.209 -30.652 3.792   1.00 29.45 ? 49   PHE A CE1 1 
ATOM   122  C CE2 . PHE A 1 50  ? 19.448 -29.202 5.270   1.00 28.17 ? 49   PHE A CE2 1 
ATOM   123  C CZ  . PHE A 1 50  ? 18.841 -30.432 5.011   1.00 29.25 ? 49   PHE A CZ  1 
ATOM   124  N N   . GLY A 1 51  ? 15.440 -27.642 2.333   1.00 29.30 ? 50   GLY A N   1 
ATOM   125  C CA  . GLY A 1 51  ? 14.339 -28.528 1.945   1.00 29.44 ? 50   GLY A CA  1 
ATOM   126  C C   . GLY A 1 51  ? 14.372 -29.850 2.696   1.00 28.36 ? 50   GLY A C   1 
ATOM   127  O O   . GLY A 1 51  ? 14.838 -29.921 3.830   1.00 28.32 ? 50   GLY A O   1 
ATOM   128  N N   . SER A 1 52  ? 13.883 -30.909 2.065   1.00 27.76 ? 51   SER A N   1 
ATOM   129  C CA  . SER A 1 52  ? 13.929 -32.230 2.675   1.00 28.01 ? 51   SER A CA  1 
ATOM   130  C C   . SER A 1 52  ? 14.601 -33.200 1.750   1.00 28.12 ? 51   SER A C   1 
ATOM   131  O O   . SER A 1 52  ? 14.274 -33.249 0.570   1.00 30.90 ? 51   SER A O   1 
ATOM   132  C CB  . SER A 1 52  ? 12.510 -32.717 3.023   1.00 28.72 ? 51   SER A CB  1 
ATOM   133  O OG  . SER A 1 52  ? 11.892 -31.781 3.877   1.00 29.53 ? 51   SER A OG  1 
ATOM   134  N N   . VAL A 1 53  ? 15.552 -33.968 2.280   1.00 26.72 ? 52   VAL A N   1 
ATOM   135  C CA  . VAL A 1 53  ? 16.294 -34.920 1.482   1.00 26.76 ? 52   VAL A CA  1 
ATOM   136  C C   . VAL A 1 53  ? 16.058 -36.341 1.987   1.00 28.16 ? 52   VAL A C   1 
ATOM   137  O O   . VAL A 1 53  ? 16.303 -36.637 3.152   1.00 29.23 ? 52   VAL A O   1 
ATOM   138  C CB  . VAL A 1 53  ? 17.814 -34.593 1.490   1.00 26.33 ? 52   VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 53  ? 18.616 -35.663 0.765   1.00 27.51 ? 52   VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 53  ? 18.068 -33.222 0.861   1.00 24.27 ? 52   VAL A CG2 1 
ATOM   141  N N   . TYR A 1 54  ? 15.640 -37.220 1.084   1.00 28.68 ? 53   TYR A N   1 
ATOM   142  C CA  . TYR A 1 54  ? 15.368 -38.628 1.417   1.00 29.51 ? 53   TYR A CA  1 
ATOM   143  C C   . TYR A 1 54  ? 16.362 -39.538 0.764   1.00 31.12 ? 53   TYR A C   1 
ATOM   144  O O   . TYR A 1 54  ? 16.860 -39.239 -0.325  1.00 29.12 ? 53   TYR A O   1 
ATOM   145  C CB  . TYR A 1 54  ? 13.975 -39.034 0.919   1.00 29.83 ? 53   TYR A CB  1 
ATOM   146  C CG  . TYR A 1 54  ? 12.853 -38.339 1.618   1.00 29.97 ? 53   TYR A CG  1 
ATOM   147  C CD1 . TYR A 1 54  ? 12.471 -37.063 1.240   1.00 31.23 ? 53   TYR A CD1 1 
ATOM   148  C CD2 . TYR A 1 54  ? 12.153 -38.962 2.668   1.00 32.41 ? 53   TYR A CD2 1 
ATOM   149  C CE1 . TYR A 1 54  ? 11.442 -36.403 1.875   1.00 30.53 ? 53   TYR A CE1 1 
ATOM   150  C CE2 . TYR A 1 54  ? 11.109 -38.309 3.310   1.00 30.40 ? 53   TYR A CE2 1 
ATOM   151  C CZ  . TYR A 1 54  ? 10.764 -37.035 2.909   1.00 31.82 ? 53   TYR A CZ  1 
ATOM   152  O OH  . TYR A 1 54  ? 9.749  -36.347 3.506   1.00 30.68 ? 53   TYR A OH  1 
ATOM   153  N N   . SER A 1 55  ? 16.643 -40.663 1.425   1.00 29.15 ? 54   SER A N   1 
ATOM   154  C CA  . SER A 1 55  ? 17.371 -41.740 0.812   1.00 31.63 ? 54   SER A CA  1 
ATOM   155  C C   . SER A 1 55  ? 16.428 -42.366 -0.183  1.00 34.40 ? 54   SER A C   1 
ATOM   156  O O   . SER A 1 55  ? 15.225 -42.385 0.029   1.00 38.21 ? 54   SER A O   1 
ATOM   157  C CB  . SER A 1 55  ? 17.799 -42.784 1.842   1.00 31.44 ? 54   SER A CB  1 
ATOM   158  O OG  . SER A 1 55  ? 18.658 -43.730 1.238   1.00 32.50 ? 54   SER A OG  1 
ATOM   159  N N   . GLY A 1 56  ? 16.972 -42.845 -1.286  1.00 36.26 ? 55   GLY A N   1 
ATOM   160  C CA  . GLY A 1 56  ? 16.153 -43.495 -2.288  1.00 38.14 ? 55   GLY A CA  1 
ATOM   161  C C   . GLY A 1 56  ? 16.977 -44.482 -3.052  1.00 40.14 ? 55   GLY A C   1 
ATOM   162  O O   . GLY A 1 56  ? 18.201 -44.539 -2.905  1.00 38.57 ? 55   GLY A O   1 
ATOM   163  N N   . ILE A 1 57  ? 16.291 -45.269 -3.869  1.00 42.01 ? 56   ILE A N   1 
ATOM   164  C CA  . ILE A 1 57  ? 16.926 -46.237 -4.734  1.00 45.68 ? 56   ILE A CA  1 
ATOM   165  C C   . ILE A 1 57  ? 16.283 -46.090 -6.106  1.00 45.64 ? 56   ILE A C   1 
ATOM   166  O O   . ILE A 1 57  ? 15.061 -45.979 -6.212  1.00 47.31 ? 56   ILE A O   1 
ATOM   167  C CB  . ILE A 1 57  ? 16.740 -47.666 -4.178  1.00 48.65 ? 56   ILE A CB  1 
ATOM   168  C CG1 . ILE A 1 57  ? 17.509 -47.827 -2.860  1.00 50.23 ? 56   ILE A CG1 1 
ATOM   169  C CG2 . ILE A 1 57  ? 17.179 -48.706 -5.193  1.00 50.27 ? 56   ILE A CG2 1 
ATOM   170  C CD1 . ILE A 1 57  ? 17.033 -48.979 -1.993  1.00 54.16 ? 56   ILE A CD1 1 
ATOM   171  N N   . ARG A 1 58  ? 17.104 -46.029 -7.148  1.00 47.15 ? 57   ARG A N   1 
ATOM   172  C CA  . ARG A 1 58  ? 16.585 -46.017 -8.509  1.00 50.88 ? 57   ARG A CA  1 
ATOM   173  C C   . ARG A 1 58  ? 16.088 -47.433 -8.817  1.00 52.82 ? 57   ARG A C   1 
ATOM   174  O O   . ARG A 1 58  ? 16.867 -48.387 -8.775  1.00 51.60 ? 57   ARG A O   1 
ATOM   175  C CB  . ARG A 1 58  ? 17.663 -45.579 -9.497  1.00 51.39 ? 57   ARG A CB  1 
ATOM   176  C CG  . ARG A 1 58  ? 17.129 -45.130 -10.849 1.00 51.62 ? 57   ARG A CG  1 
ATOM   177  C CD  . ARG A 1 58  ? 18.169 -45.389 -11.923 1.00 56.65 ? 57   ARG A CD  1 
ATOM   178  N NE  . ARG A 1 58  ? 18.937 -44.210 -12.295 1.00 56.71 ? 57   ARG A NE  1 
ATOM   179  C CZ  . ARG A 1 58  ? 20.194 -44.234 -12.731 1.00 58.08 ? 57   ARG A CZ  1 
ATOM   180  N NH1 . ARG A 1 58  ? 20.864 -45.379 -12.827 1.00 58.26 ? 57   ARG A NH1 1 
ATOM   181  N NH2 . ARG A 1 58  ? 20.789 -43.099 -13.056 1.00 61.08 ? 57   ARG A NH2 1 
ATOM   182  N N   . VAL A 1 59  ? 14.790 -47.571 -9.085  1.00 55.04 ? 58   VAL A N   1 
ATOM   183  C CA  . VAL A 1 59  ? 14.181 -48.903 -9.264  1.00 58.79 ? 58   VAL A CA  1 
ATOM   184  C C   . VAL A 1 59  ? 14.826 -49.684 -10.416 1.00 60.97 ? 58   VAL A C   1 
ATOM   185  O O   . VAL A 1 59  ? 15.077 -50.886 -10.292 1.00 63.95 ? 58   VAL A O   1 
ATOM   186  C CB  . VAL A 1 59  ? 12.639 -48.834 -9.427  1.00 59.05 ? 58   VAL A CB  1 
ATOM   187  C CG1 . VAL A 1 59  ? 12.051 -50.216 -9.697  1.00 61.40 ? 58   VAL A CG1 1 
ATOM   188  C CG2 . VAL A 1 59  ? 11.999 -48.241 -8.180  1.00 60.15 ? 58   VAL A CG2 1 
ATOM   189  N N   . SER A 1 60  ? 15.124 -48.985 -11.511 1.00 61.96 ? 59   SER A N   1 
ATOM   190  C CA  . SER A 1 60  ? 15.663 -49.606 -12.719 1.00 63.11 ? 59   SER A CA  1 
ATOM   191  C C   . SER A 1 60  ? 16.924 -50.440 -12.478 1.00 66.31 ? 59   SER A C   1 
ATOM   192  O O   . SER A 1 60  ? 16.994 -51.585 -12.920 1.00 69.20 ? 59   SER A O   1 
ATOM   193  C CB  . SER A 1 60  ? 15.913 -48.554 -13.803 1.00 64.14 ? 59   SER A CB  1 
ATOM   194  O OG  . SER A 1 60  ? 16.975 -47.690 -13.439 1.00 64.22 ? 59   SER A OG  1 
ATOM   195  N N   . ASP A 1 61  ? 17.907 -49.878 -11.771 1.00 63.02 ? 60   ASP A N   1 
ATOM   196  C CA  . ASP A 1 61  ? 19.181 -50.570 -11.551 1.00 59.26 ? 60   ASP A CA  1 
ATOM   197  C C   . ASP A 1 61  ? 19.628 -50.641 -10.087 1.00 56.47 ? 60   ASP A C   1 
ATOM   198  O O   . ASP A 1 61  ? 20.737 -51.079 -9.801  1.00 55.21 ? 60   ASP A O   1 
ATOM   199  C CB  . ASP A 1 61  ? 20.287 -49.952 -12.420 1.00 61.29 ? 60   ASP A CB  1 
ATOM   200  C CG  . ASP A 1 61  ? 20.609 -48.508 -12.038 1.00 62.60 ? 60   ASP A CG  1 
ATOM   201  O OD1 . ASP A 1 61  ? 19.773 -47.841 -11.393 1.00 63.23 ? 60   ASP A OD1 1 
ATOM   202  O OD2 . ASP A 1 61  ? 21.705 -48.032 -12.400 1.00 64.35 ? 60   ASP A OD2 1 
ATOM   203  N N   . ASN A 1 62  ? 18.764 -50.208 -9.174  1.00 55.37 ? 61   ASN A N   1 
ATOM   204  C CA  . ASN A 1 62  ? 19.054 -50.207 -7.730  1.00 55.44 ? 61   ASN A CA  1 
ATOM   205  C C   . ASN A 1 62  ? 20.108 -49.202 -7.263  1.00 52.06 ? 61   ASN A C   1 
ATOM   206  O O   . ASN A 1 62  ? 20.580 -49.280 -6.124  1.00 51.75 ? 61   ASN A O   1 
ATOM   207  C CB  . ASN A 1 62  ? 19.410 -51.610 -7.226  1.00 59.19 ? 61   ASN A CB  1 
ATOM   208  C CG  . ASN A 1 62  ? 18.201 -52.516 -7.134  1.00 63.53 ? 61   ASN A CG  1 
ATOM   209  O OD1 . ASN A 1 62  ? 17.207 -52.192 -6.477  1.00 64.33 ? 61   ASN A OD1 1 
ATOM   210  N ND2 . ASN A 1 62  ? 18.281 -53.664 -7.790  1.00 64.34 ? 61   ASN A ND2 1 
ATOM   211  N N   . LEU A 1 63  ? 20.460 -48.259 -8.133  1.00 46.28 ? 62   LEU A N   1 
ATOM   212  C CA  . LEU A 1 63  ? 21.456 -47.238 -7.803  1.00 44.72 ? 62   LEU A CA  1 
ATOM   213  C C   . LEU A 1 63  ? 21.003 -46.435 -6.591  1.00 41.86 ? 62   LEU A C   1 
ATOM   214  O O   . LEU A 1 63  ? 19.857 -45.974 -6.547  1.00 42.89 ? 62   LEU A O   1 
ATOM   215  C CB  . LEU A 1 63  ? 21.690 -46.302 -8.993  1.00 42.78 ? 62   LEU A CB  1 
ATOM   216  C CG  . LEU A 1 63  ? 22.743 -45.202 -8.819  1.00 41.32 ? 62   LEU A CG  1 
ATOM   217  C CD1 . LEU A 1 63  ? 24.161 -45.739 -8.995  1.00 40.53 ? 62   LEU A CD1 1 
ATOM   218  C CD2 . LEU A 1 63  ? 22.472 -44.059 -9.785  1.00 40.71 ? 62   LEU A CD2 1 
ATOM   219  N N   . PRO A 1 64  ? 21.893 -46.279 -5.598  1.00 41.11 ? 63   PRO A N   1 
ATOM   220  C CA  . PRO A 1 64  ? 21.581 -45.429 -4.449  1.00 38.52 ? 63   PRO A CA  1 
ATOM   221  C C   . PRO A 1 64  ? 21.444 -43.968 -4.892  1.00 36.68 ? 63   PRO A C   1 
ATOM   222  O O   . PRO A 1 64  ? 22.285 -43.461 -5.645  1.00 35.44 ? 63   PRO A O   1 
ATOM   223  C CB  . PRO A 1 64  ? 22.799 -45.599 -3.529  1.00 39.70 ? 63   PRO A CB  1 
ATOM   224  C CG  . PRO A 1 64  ? 23.599 -46.725 -4.085  1.00 40.49 ? 63   PRO A CG  1 
ATOM   225  C CD  . PRO A 1 64  ? 23.261 -46.826 -5.534  1.00 41.55 ? 63   PRO A CD  1 
ATOM   226  N N   . VAL A 1 65  ? 20.367 -43.318 -4.465  1.00 33.83 ? 64   VAL A N   1 
ATOM   227  C CA  . VAL A 1 65  ? 20.140 -41.909 -4.771  1.00 32.36 ? 64   VAL A CA  1 
ATOM   228  C C   . VAL A 1 65  ? 19.698 -41.145 -3.521  1.00 31.93 ? 64   VAL A C   1 
ATOM   229  O O   . VAL A 1 65  ? 19.336 -41.745 -2.492  1.00 32.71 ? 64   VAL A O   1 
ATOM   230  C CB  . VAL A 1 65  ? 19.086 -41.715 -5.890  1.00 33.48 ? 64   VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 65  ? 19.540 -42.370 -7.194  1.00 33.67 ? 64   VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 65  ? 17.724 -42.268 -5.467  1.00 34.24 ? 64   VAL A CG2 1 
ATOM   233  N N   . ALA A 1 66  ? 19.762 -39.821 -3.606  1.00 30.26 ? 65   ALA A N   1 
ATOM   234  C CA  . ALA A 1 66  ? 19.094 -38.960 -2.649  1.00 29.73 ? 65   ALA A CA  1 
ATOM   235  C C   . ALA A 1 66  ? 18.009 -38.213 -3.388  1.00 27.93 ? 65   ALA A C   1 
ATOM   236  O O   . ALA A 1 66  ? 18.180 -37.840 -4.546  1.00 30.11 ? 65   ALA A O   1 
ATOM   237  C CB  . ALA A 1 66  ? 20.079 -37.987 -1.997  1.00 29.19 ? 65   ALA A CB  1 
ATOM   238  N N   . ILE A 1 67  ? 16.894 -37.985 -2.708  1.00 28.62 ? 66   ILE A N   1 
ATOM   239  C CA  . ILE A 1 67  ? 15.747 -37.346 -3.305  1.00 28.55 ? 66   ILE A CA  1 
ATOM   240  C C   . ILE A 1 67  ? 15.475 -36.072 -2.545  1.00 27.79 ? 66   ILE A C   1 
ATOM   241  O O   . ILE A 1 67  ? 15.036 -36.106 -1.393  1.00 28.66 ? 66   ILE A O   1 
ATOM   242  C CB  . ILE A 1 67  ? 14.511 -38.279 -3.318  1.00 29.63 ? 66   ILE A CB  1 
ATOM   243  C CG1 . ILE A 1 67  ? 14.884 -39.622 -3.956  1.00 31.92 ? 66   ILE A CG1 1 
ATOM   244  C CG2 . ILE A 1 67  ? 13.364 -37.614 -4.064  1.00 30.16 ? 66   ILE A CG2 1 
ATOM   245  C CD1 . ILE A 1 67  ? 13.782 -40.671 -3.933  1.00 33.52 ? 66   ILE A CD1 1 
ATOM   246  N N   . LYS A 1 68  ? 15.769 -34.943 -3.188  1.00 26.68 ? 67   LYS A N   1 
ATOM   247  C CA  . LYS A 1 68  ? 15.665 -33.652 -2.546  1.00 27.10 ? 67   LYS A CA  1 
ATOM   248  C C   . LYS A 1 68  ? 14.423 -32.895 -2.993  1.00 28.08 ? 67   LYS A C   1 
ATOM   249  O O   . LYS A 1 68  ? 14.222 -32.648 -4.195  1.00 29.32 ? 67   LYS A O   1 
ATOM   250  C CB  . LYS A 1 68  ? 16.929 -32.813 -2.802  1.00 24.69 ? 67   LYS A CB  1 
ATOM   251  C CG  . LYS A 1 68  ? 16.867 -31.424 -2.186  1.00 24.73 ? 67   LYS A CG  1 
ATOM   252  C CD  . LYS A 1 68  ? 18.168 -30.670 -2.453  1.00 25.46 ? 67   LYS A CD  1 
ATOM   253  C CE  . LYS A 1 68  ? 18.121 -29.253 -1.932  1.00 26.85 ? 67   LYS A CE  1 
ATOM   254  N NZ  . LYS A 1 68  ? 19.444 -28.583 -2.166  1.00 27.13 ? 67   LYS A NZ  1 
ATOM   255  N N   . HIS A 1 69  ? 13.606 -32.513 -2.013  1.00 28.63 ? 68   HIS A N   1 
ATOM   256  C CA  . HIS A 1 69  ? 12.378 -31.753 -2.257  1.00 30.70 ? 68   HIS A CA  1 
ATOM   257  C C   . HIS A 1 69  ? 12.582 -30.363 -1.805  1.00 30.97 ? 68   HIS A C   1 
ATOM   258  O O   . HIS A 1 69  ? 13.035 -30.132 -0.684  1.00 28.98 ? 68   HIS A O   1 
ATOM   259  C CB  . HIS A 1 69  ? 11.192 -32.340 -1.492  1.00 29.50 ? 68   HIS A CB  1 
ATOM   260  C CG  . HIS A 1 69  ? 10.844 -33.733 -1.898  1.00 29.87 ? 68   HIS A CG  1 
ATOM   261  N ND1 . HIS A 1 69  ? 11.532 -34.803 -1.465  1.00 31.87 ? 68   HIS A ND1 1 
ATOM   262  C CD2 . HIS A 1 69  ? 9.845  -34.215 -2.712  1.00 28.07 ? 68   HIS A CD2 1 
ATOM   263  C CE1 . HIS A 1 69  ? 11.010 -35.909 -1.995  1.00 28.60 ? 68   HIS A CE1 1 
ATOM   264  N NE2 . HIS A 1 69  ? 9.978  -35.550 -2.759  1.00 31.22 ? 68   HIS A NE2 1 
ATOM   265  N N   . VAL A 1 70  ? 12.273 -29.413 -2.680  1.00 31.98 ? 69   VAL A N   1 
ATOM   266  C CA  . VAL A 1 70  ? 12.299 -28.014 -2.309  1.00 35.65 ? 69   VAL A CA  1 
ATOM   267  C C   . VAL A 1 70  ? 10.954 -27.429 -2.699  1.00 37.67 ? 69   VAL A C   1 
ATOM   268  O O   . VAL A 1 70  ? 10.550 -27.555 -3.857  1.00 36.42 ? 69   VAL A O   1 
ATOM   269  C CB  . VAL A 1 70  ? 13.399 -27.231 -3.055  1.00 36.52 ? 69   VAL A CB  1 
ATOM   270  C CG1 . VAL A 1 70  ? 13.615 -25.881 -2.388  1.00 38.56 ? 69   VAL A CG1 1 
ATOM   271  C CG2 . VAL A 1 70  ? 14.706 -28.014 -3.092  1.00 38.84 ? 69   VAL A CG2 1 
ATOM   272  N N   . GLU A 1 71  ? 10.266 -26.809 -1.741  1.00 38.66 ? 70   GLU A N   1 
ATOM   273  C CA  . GLU A 1 71  ? 9.005  -26.111 -2.024  1.00 42.22 ? 70   GLU A CA  1 
ATOM   274  C C   . GLU A 1 71  ? 9.262  -24.884 -2.891  1.00 41.69 ? 70   GLU A C   1 
ATOM   275  O O   . GLU A 1 71  ? 10.247 -24.174 -2.690  1.00 41.45 ? 70   GLU A O   1 
ATOM   276  C CB  . GLU A 1 71  ? 8.299  -25.698 -0.724  1.00 43.55 ? 70   GLU A CB  1 
ATOM   277  C CG  . GLU A 1 71  ? 7.596  -26.858 -0.029  1.00 48.11 ? 70   GLU A CG  1 
ATOM   278  C CD  . GLU A 1 71  ? 6.921  -26.474 1.281   1.00 50.01 ? 70   GLU A CD  1 
ATOM   279  O OE1 . GLU A 1 71  ? 6.773  -25.266 1.559   1.00 48.76 ? 70   GLU A OE1 1 
ATOM   280  O OE2 . GLU A 1 71  ? 6.533  -27.393 2.037   1.00 50.30 ? 70   GLU A OE2 1 
ATOM   281  N N   . LYS A 1 72  ? 8.372  -24.646 -3.856  1.00 42.46 ? 71   LYS A N   1 
ATOM   282  C CA  . LYS A 1 72  ? 8.504  -23.525 -4.790  1.00 44.78 ? 71   LYS A CA  1 
ATOM   283  C C   . LYS A 1 72  ? 8.560  -22.164 -4.109  1.00 46.67 ? 71   LYS A C   1 
ATOM   284  O O   . LYS A 1 72  ? 9.370  -21.321 -4.485  1.00 46.80 ? 71   LYS A O   1 
ATOM   285  C CB  . LYS A 1 72  ? 7.393  -23.557 -5.842  1.00 43.16 ? 71   LYS A CB  1 
ATOM   286  C CG  . LYS A 1 72  ? 7.642  -24.578 -6.937  1.00 43.51 ? 71   LYS A CG  1 
ATOM   287  C CD  . LYS A 1 72  ? 6.565  -24.514 -8.006  1.00 44.28 ? 71   LYS A CD  1 
ATOM   288  C CE  . LYS A 1 72  ? 6.841  -25.516 -9.105  1.00 45.94 ? 71   LYS A CE  1 
ATOM   289  N NZ  . LYS A 1 72  ? 5.618  -25.821 -9.895  1.00 44.39 ? 71   LYS A NZ  1 
ATOM   290  N N   . ASP A 1 73  ? 7.722  -21.958 -3.095  1.00 50.24 ? 72   ASP A N   1 
ATOM   291  C CA  . ASP A 1 73  ? 7.694  -20.692 -2.360  1.00 54.82 ? 72   ASP A CA  1 
ATOM   292  C C   . ASP A 1 73  ? 8.995  -20.419 -1.623  1.00 57.03 ? 72   ASP A C   1 
ATOM   293  O O   . ASP A 1 73  ? 9.319  -19.272 -1.328  1.00 57.61 ? 72   ASP A O   1 
ATOM   294  C CB  . ASP A 1 73  ? 6.523  -20.669 -1.373  1.00 59.45 ? 72   ASP A CB  1 
ATOM   295  C CG  . ASP A 1 73  ? 5.172  -20.658 -2.071  1.00 65.18 ? 72   ASP A CG  1 
ATOM   296  O OD1 . ASP A 1 73  ? 5.068  -20.085 -3.180  1.00 66.80 ? 72   ASP A OD1 1 
ATOM   297  O OD2 . ASP A 1 73  ? 4.211  -21.230 -1.516  1.00 69.60 ? 72   ASP A OD2 1 
ATOM   298  N N   . ARG A 1 74  ? 9.739  -21.481 -1.340  1.00 58.78 ? 73   ARG A N   1 
ATOM   299  C CA  . ARG A 1 74  ? 10.972 -21.384 -0.572  1.00 61.94 ? 73   ARG A CA  1 
ATOM   300  C C   . ARG A 1 74  ? 12.202 -21.177 -1.450  1.00 62.72 ? 73   ARG A C   1 
ATOM   301  O O   . ARG A 1 74  ? 13.303 -20.962 -0.939  1.00 63.75 ? 73   ARG A O   1 
ATOM   302  C CB  . ARG A 1 74  ? 11.144 -22.630 0.297   1.00 62.66 ? 73   ARG A CB  1 
ATOM   303  C CG  . ARG A 1 74  ? 10.238 -22.660 1.517   1.00 65.57 ? 73   ARG A CG  1 
ATOM   304  C CD  . ARG A 1 74  ? 10.789 -23.579 2.600   1.00 70.48 ? 73   ARG A CD  1 
ATOM   305  N NE  . ARG A 1 74  ? 12.237 -23.427 2.787   1.00 75.68 ? 73   ARG A NE  1 
ATOM   306  C CZ  . ARG A 1 74  ? 12.823 -22.420 3.435   1.00 77.51 ? 73   ARG A CZ  1 
ATOM   307  N NH1 . ARG A 1 74  ? 12.097 -21.444 3.973   1.00 79.49 ? 73   ARG A NH1 1 
ATOM   308  N NH2 . ARG A 1 74  ? 14.146 -22.384 3.539   1.00 72.42 ? 73   ARG A NH2 1 
ATOM   309  N N   . ILE A 1 75  ? 12.012 -21.229 -2.766  1.00 63.55 ? 74   ILE A N   1 
ATOM   310  C CA  . ILE A 1 75  ? 13.131 -21.134 -3.704  1.00 65.04 ? 74   ILE A CA  1 
ATOM   311  C C   . ILE A 1 75  ? 13.655 -19.707 -3.812  1.00 68.79 ? 74   ILE A C   1 
ATOM   312  O O   . ILE A 1 75  ? 12.940 -18.793 -4.236  1.00 70.96 ? 74   ILE A O   1 
ATOM   313  C CB  . ILE A 1 75  ? 12.793 -21.725 -5.091  1.00 62.83 ? 74   ILE A CB  1 
ATOM   314  C CG1 . ILE A 1 75  ? 12.635 -23.241 -4.980  1.00 59.69 ? 74   ILE A CG1 1 
ATOM   315  C CG2 . ILE A 1 75  ? 13.883 -21.385 -6.103  1.00 61.68 ? 74   ILE A CG2 1 
ATOM   316  C CD1 . ILE A 1 75  ? 12.004 -23.897 -6.190  1.00 62.05 ? 74   ILE A CD1 1 
ATOM   317  N N   . SER A 1 76  ? 14.915 -19.548 -3.413  1.00 72.71 ? 75   SER A N   1 
ATOM   318  C CA  . SER A 1 76  ? 15.605 -18.266 -3.403  1.00 76.07 ? 75   SER A CA  1 
ATOM   319  C C   . SER A 1 76  ? 15.749 -17.696 -4.823  1.00 77.14 ? 75   SER A C   1 
ATOM   320  O O   . SER A 1 76  ? 15.045 -16.748 -5.192  1.00 77.61 ? 75   SER A O   1 
ATOM   321  C CB  . SER A 1 76  ? 16.971 -18.431 -2.726  1.00 76.87 ? 75   SER A CB  1 
ATOM   322  O OG  . SER A 1 76  ? 17.608 -17.181 -2.540  1.00 80.89 ? 75   SER A OG  1 
ATOM   323  N N   . ASP A 1 77  ? 16.637 -18.304 -5.613  1.00 74.15 ? 76   ASP A N   1 
ATOM   324  C CA  . ASP A 1 77  ? 16.920 -17.867 -6.981  1.00 69.18 ? 76   ASP A CA  1 
ATOM   325  C C   . ASP A 1 77  ? 16.410 -18.844 -8.031  1.00 64.03 ? 76   ASP A C   1 
ATOM   326  O O   . ASP A 1 77  ? 16.463 -20.059 -7.851  1.00 62.70 ? 76   ASP A O   1 
ATOM   327  C CB  . ASP A 1 77  ? 18.429 -17.669 -7.179  1.00 69.90 ? 76   ASP A CB  1 
ATOM   328  C CG  . ASP A 1 77  ? 18.981 -16.498 -6.385  1.00 73.68 ? 76   ASP A CG  1 
ATOM   329  O OD1 . ASP A 1 77  ? 18.305 -15.449 -6.298  1.00 73.35 ? 76   ASP A OD1 1 
ATOM   330  O OD2 . ASP A 1 77  ? 20.100 -16.628 -5.845  1.00 74.06 ? 76   ASP A OD2 1 
ATOM   331  N N   . TRP A 1 78  ? 15.942 -18.297 -9.143  1.00 62.46 ? 77   TRP A N   1 
ATOM   332  C CA  . TRP A 1 78  ? 15.502 -19.097 -10.273 1.00 62.99 ? 77   TRP A CA  1 
ATOM   333  C C   . TRP A 1 78  ? 16.389 -18.865 -11.453 1.00 63.07 ? 77   TRP A C   1 
ATOM   334  O O   . TRP A 1 78  ? 16.909 -17.767 -11.648 1.00 67.38 ? 77   TRP A O   1 
ATOM   335  C CB  . TRP A 1 78  ? 14.068 -18.745 -10.640 1.00 61.35 ? 77   TRP A CB  1 
ATOM   336  C CG  . TRP A 1 78  ? 13.074 -19.049 -9.549  1.00 60.14 ? 77   TRP A CG  1 
ATOM   337  C CD1 . TRP A 1 78  ? 12.850 -18.332 -8.376  1.00 60.49 ? 77   TRP A CD1 1 
ATOM   338  C CD2 . TRP A 1 78  ? 12.126 -20.169 -9.498  1.00 58.39 ? 77   TRP A CD2 1 
ATOM   339  N NE1 . TRP A 1 78  ? 11.863 -18.918 -7.626  1.00 60.11 ? 77   TRP A NE1 1 
ATOM   340  C CE2 . TRP A 1 78  ? 11.382 -20.019 -8.242  1.00 59.23 ? 77   TRP A CE2 1 
ATOM   341  C CE3 . TRP A 1 78  ? 11.827 -21.236 -10.336 1.00 57.90 ? 77   TRP A CE3 1 
ATOM   342  C CZ2 . TRP A 1 78  ? 10.390 -20.912 -7.865  1.00 59.03 ? 77   TRP A CZ2 1 
ATOM   343  C CZ3 . TRP A 1 78  ? 10.827 -22.129 -9.946  1.00 59.32 ? 77   TRP A CZ3 1 
ATOM   344  C CH2 . TRP A 1 78  ? 10.123 -21.968 -8.741  1.00 59.99 ? 77   TRP A CH2 1 
ATOM   345  N N   . GLY A 1 79  ? 16.578 -19.907 -12.247 1.00 59.95 ? 78   GLY A N   1 
ATOM   346  C CA  . GLY A 1 79  ? 17.301 -19.796 -13.501 1.00 60.90 ? 78   GLY A CA  1 
ATOM   347  C C   . GLY A 1 79  ? 16.456 -20.400 -14.590 1.00 63.59 ? 78   GLY A C   1 
ATOM   348  O O   . GLY A 1 79  ? 15.310 -20.790 -14.352 1.00 65.75 ? 78   GLY A O   1 
ATOM   349  N N   . GLU A 1 80  ? 17.007 -20.473 -15.792 1.00 67.54 ? 79   GLU A N   1 
ATOM   350  C CA  . GLU A 1 80  ? 16.318 -21.152 -16.879 1.00 73.44 ? 79   GLU A CA  1 
ATOM   351  C C   . GLU A 1 80  ? 17.271 -22.058 -17.635 1.00 72.68 ? 79   GLU A C   1 
ATOM   352  O O   . GLU A 1 80  ? 18.455 -21.751 -17.780 1.00 72.51 ? 79   GLU A O   1 
ATOM   353  C CB  . GLU A 1 80  ? 15.601 -20.169 -17.814 1.00 77.59 ? 79   GLU A CB  1 
ATOM   354  C CG  . GLU A 1 80  ? 16.499 -19.149 -18.498 1.00 82.59 ? 79   GLU A CG  1 
ATOM   355  C CD  . GLU A 1 80  ? 15.880 -18.589 -19.766 1.00 88.28 ? 79   GLU A CD  1 
ATOM   356  O OE1 . GLU A 1 80  ? 14.635 -18.638 -19.907 1.00 87.42 ? 79   GLU A OE1 1 
ATOM   357  O OE2 . GLU A 1 80  ? 16.645 -18.102 -20.626 1.00 88.75 ? 79   GLU A OE2 1 
ATOM   358  N N   . LEU A 1 81  ? 16.743 -23.180 -18.104 1.00 74.90 ? 80   LEU A N   1 
ATOM   359  C CA  . LEU A 1 81  ? 17.550 -24.186 -18.779 1.00 79.94 ? 80   LEU A CA  1 
ATOM   360  C C   . LEU A 1 81  ? 18.008 -23.711 -20.163 1.00 83.66 ? 80   LEU A C   1 
ATOM   361  O O   . LEU A 1 81  ? 17.461 -22.735 -20.687 1.00 80.48 ? 80   LEU A O   1 
ATOM   362  C CB  . LEU A 1 81  ? 16.771 -25.502 -18.874 1.00 79.43 ? 80   LEU A CB  1 
ATOM   363  C CG  . LEU A 1 81  ? 16.509 -26.238 -17.556 1.00 77.50 ? 80   LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 81  ? 15.765 -27.535 -17.830 1.00 76.32 ? 80   LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 81  ? 17.803 -26.507 -16.801 1.00 75.16 ? 80   LEU A CD2 1 
ATOM   366  N N   . PRO A 1 82  ? 19.034 -24.378 -20.745 1.00 87.20 ? 81   PRO A N   1 
ATOM   367  C CA  . PRO A 1 82  ? 19.417 -24.103 -22.131 1.00 88.28 ? 81   PRO A CA  1 
ATOM   368  C C   . PRO A 1 82  ? 18.204 -23.997 -23.067 1.00 88.18 ? 81   PRO A C   1 
ATOM   369  O O   . PRO A 1 82  ? 18.136 -23.072 -23.876 1.00 90.19 ? 81   PRO A O   1 
ATOM   370  C CB  . PRO A 1 82  ? 20.287 -25.309 -22.490 1.00 88.63 ? 81   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 82  ? 20.943 -25.678 -21.200 1.00 88.45 ? 81   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 82  ? 19.995 -25.293 -20.091 1.00 88.08 ? 81   PRO A CD  1 
ATOM   373  N N   . ASN A 1 83  ? 17.251 -24.920 -22.930 1.00 86.85 ? 82   ASN A N   1 
ATOM   374  C CA  . ASN A 1 83  ? 16.011 -24.898 -23.711 1.00 84.10 ? 82   ASN A CA  1 
ATOM   375  C C   . ASN A 1 83  ? 14.934 -23.958 -23.145 1.00 81.60 ? 82   ASN A C   1 
ATOM   376  O O   . ASN A 1 83  ? 13.787 -23.983 -23.589 1.00 80.97 ? 82   ASN A O   1 
ATOM   377  C CB  . ASN A 1 83  ? 15.457 -26.319 -23.867 1.00 85.61 ? 82   ASN A CB  1 
ATOM   378  C CG  . ASN A 1 83  ? 15.139 -26.970 -22.534 1.00 87.63 ? 82   ASN A CG  1 
ATOM   379  O OD1 . ASN A 1 83  ? 14.092 -26.712 -21.937 1.00 87.85 ? 82   ASN A OD1 1 
ATOM   380  N ND2 . ASN A 1 83  ? 16.043 -27.819 -22.060 1.00 86.23 ? 82   ASN A ND2 1 
ATOM   381  N N   . GLY A 1 84  ? 15.307 -23.145 -22.161 1.00 82.16 ? 83   GLY A N   1 
ATOM   382  C CA  . GLY A 1 84  ? 14.413 -22.138 -21.592 1.00 83.21 ? 83   GLY A CA  1 
ATOM   383  C C   . GLY A 1 84  ? 13.247 -22.697 -20.798 1.00 87.00 ? 83   GLY A C   1 
ATOM   384  O O   . GLY A 1 84  ? 12.093 -22.558 -21.204 1.00 90.58 ? 83   GLY A O   1 
ATOM   385  N N   . THR A 1 85  ? 13.550 -23.339 -19.672 1.00 85.42 ? 84   THR A N   1 
ATOM   386  C CA  . THR A 1 85  ? 12.524 -23.771 -18.721 1.00 82.15 ? 84   THR A CA  1 
ATOM   387  C C   . THR A 1 85  ? 12.880 -23.240 -17.334 1.00 78.94 ? 84   THR A C   1 
ATOM   388  O O   . THR A 1 85  ? 14.019 -23.379 -16.882 1.00 80.46 ? 84   THR A O   1 
ATOM   389  C CB  . THR A 1 85  ? 12.382 -25.307 -18.671 1.00 82.19 ? 84   THR A CB  1 
ATOM   390  O OG1 . THR A 1 85  ? 12.440 -25.840 -19.999 1.00 84.10 ? 84   THR A OG1 1 
ATOM   391  C CG2 . THR A 1 85  ? 11.060 -25.714 -18.016 1.00 79.40 ? 84   THR A CG2 1 
ATOM   392  N N   . ARG A 1 86  ? 11.899 -22.633 -16.670 1.00 74.19 ? 85   ARG A N   1 
ATOM   393  C CA  . ARG A 1 86  ? 12.087 -22.030 -15.351 1.00 70.14 ? 85   ARG A CA  1 
ATOM   394  C C   . ARG A 1 86  ? 12.326 -23.106 -14.275 1.00 65.48 ? 85   ARG A C   1 
ATOM   395  O O   . ARG A 1 86  ? 11.437 -23.909 -13.978 1.00 64.35 ? 85   ARG A O   1 
ATOM   396  C CB  . ARG A 1 86  ? 10.873 -21.160 -15.013 1.00 71.09 ? 85   ARG A CB  1 
ATOM   397  C CG  . ARG A 1 86  ? 11.026 -20.279 -13.789 1.00 72.93 ? 85   ARG A CG  1 
ATOM   398  C CD  . ARG A 1 86  ? 9.947  -19.207 -13.770 1.00 76.18 ? 85   ARG A CD  1 
ATOM   399  N NE  . ARG A 1 86  ? 9.598  -18.804 -12.406 1.00 78.11 ? 85   ARG A NE  1 
ATOM   400  C CZ  . ARG A 1 86  ? 10.244 -17.880 -11.698 1.00 78.67 ? 85   ARG A CZ  1 
ATOM   401  N NH1 . ARG A 1 86  ? 11.289 -17.242 -12.213 1.00 79.63 ? 85   ARG A NH1 1 
ATOM   402  N NH2 . ARG A 1 86  ? 9.843  -17.596 -10.466 1.00 77.29 ? 85   ARG A NH2 1 
ATOM   403  N N   . VAL A 1 87  ? 13.539 -23.127 -13.719 1.00 57.40 ? 86   VAL A N   1 
ATOM   404  C CA  . VAL A 1 87  ? 13.925 -24.119 -12.700 1.00 50.96 ? 86   VAL A CA  1 
ATOM   405  C C   . VAL A 1 87  ? 14.620 -23.453 -11.505 1.00 47.44 ? 86   VAL A C   1 
ATOM   406  O O   . VAL A 1 87  ? 15.086 -22.316 -11.615 1.00 48.42 ? 86   VAL A O   1 
ATOM   407  C CB  . VAL A 1 87  ? 14.857 -25.226 -13.269 1.00 49.06 ? 86   VAL A CB  1 
ATOM   408  C CG1 . VAL A 1 87  ? 14.183 -26.003 -14.388 1.00 51.08 ? 86   VAL A CG1 1 
ATOM   409  C CG2 . VAL A 1 87  ? 16.187 -24.649 -13.739 1.00 49.60 ? 86   VAL A CG2 1 
ATOM   410  N N   . PRO A 1 88  ? 14.708 -24.159 -10.357 1.00 43.75 ? 87   PRO A N   1 
ATOM   411  C CA  . PRO A 1 88  ? 15.554 -23.628 -9.284  1.00 42.54 ? 87   PRO A CA  1 
ATOM   412  C C   . PRO A 1 88  ? 16.989 -23.446 -9.779  1.00 39.83 ? 87   PRO A C   1 
ATOM   413  O O   . PRO A 1 88  ? 17.460 -24.228 -10.604 1.00 37.91 ? 87   PRO A O   1 
ATOM   414  C CB  . PRO A 1 88  ? 15.513 -24.728 -8.216  1.00 41.93 ? 87   PRO A CB  1 
ATOM   415  C CG  . PRO A 1 88  ? 14.263 -25.492 -8.499  1.00 42.58 ? 87   PRO A CG  1 
ATOM   416  C CD  . PRO A 1 88  ? 14.082 -25.442 -9.985  1.00 42.60 ? 87   PRO A CD  1 
ATOM   417  N N   . MET A 1 89  ? 17.678 -22.433 -9.266  1.00 40.51 ? 88   MET A N   1 
ATOM   418  C CA  . MET A 1 89  ? 19.066 -22.181 -9.662  1.00 39.05 ? 88   MET A CA  1 
ATOM   419  C C   . MET A 1 89  ? 19.925 -23.424 -9.442  1.00 34.53 ? 88   MET A C   1 
ATOM   420  O O   . MET A 1 89  ? 20.785 -23.746 -10.264 1.00 31.50 ? 88   MET A O   1 
ATOM   421  C CB  . MET A 1 89  ? 19.623 -20.966 -8.908  1.00 42.42 ? 88   MET A CB  1 
ATOM   422  C CG  . MET A 1 89  ? 21.036 -20.543 -9.288  1.00 45.12 ? 88   MET A CG  1 
ATOM   423  S SD  . MET A 1 89  ? 21.369 -20.271 -11.047 1.00 51.28 ? 88   MET A SD  1 
ATOM   424  C CE  . MET A 1 89  ? 20.119 -19.052 -11.463 1.00 49.94 ? 88   MET A CE  1 
ATOM   425  N N   . GLU A 1 90  ? 19.661 -24.160 -8.357  1.00 33.80 ? 89   GLU A N   1 
ATOM   426  C CA  . GLU A 1 90  ? 20.435 -25.361 -8.089  1.00 31.46 ? 89   GLU A CA  1 
ATOM   427  C C   . GLU A 1 90  ? 20.427 -26.320 -9.268  1.00 30.18 ? 89   GLU A C   1 
ATOM   428  O O   . GLU A 1 90  ? 21.429 -26.963 -9.545  1.00 29.86 ? 89   GLU A O   1 
ATOM   429  C CB  . GLU A 1 90  ? 19.985 -26.096 -6.807  1.00 32.36 ? 89   GLU A CB  1 
ATOM   430  C CG  . GLU A 1 90  ? 20.827 -27.345 -6.577  1.00 32.98 ? 89   GLU A CG  1 
ATOM   431  C CD  . GLU A 1 90  ? 20.660 -27.979 -5.203  1.00 35.13 ? 89   GLU A CD  1 
ATOM   432  O OE1 . GLU A 1 90  ? 19.553 -27.871 -4.642  1.00 32.90 ? 89   GLU A OE1 1 
ATOM   433  O OE2 . GLU A 1 90  ? 21.645 -28.598 -4.715  1.00 32.90 ? 89   GLU A OE2 1 
ATOM   434  N N   . VAL A 1 91  ? 19.295 -26.421 -9.964  1.00 30.75 ? 90   VAL A N   1 
ATOM   435  C CA  . VAL A 1 91  ? 19.210 -27.316 -11.119 1.00 30.18 ? 90   VAL A CA  1 
ATOM   436  C C   . VAL A 1 91  ? 20.138 -26.807 -12.236 1.00 29.76 ? 90   VAL A C   1 
ATOM   437  O O   . VAL A 1 91  ? 20.915 -27.578 -12.789 1.00 29.91 ? 90   VAL A O   1 
ATOM   438  C CB  . VAL A 1 91  ? 17.750 -27.461 -11.609 1.00 33.12 ? 90   VAL A CB  1 
ATOM   439  C CG1 . VAL A 1 91  ? 17.705 -28.104 -12.986 1.00 32.97 ? 90   VAL A CG1 1 
ATOM   440  C CG2 . VAL A 1 91  ? 16.944 -28.281 -10.599 1.00 32.02 ? 90   VAL A CG2 1 
ATOM   441  N N   . VAL A 1 92  ? 20.082 -25.503 -12.514 1.00 31.04 ? 91   VAL A N   1 
ATOM   442  C CA  . VAL A 1 92  ? 20.952 -24.894 -13.523 1.00 32.84 ? 91   VAL A CA  1 
ATOM   443  C C   . VAL A 1 92  ? 22.410 -25.152 -13.166 1.00 31.80 ? 91   VAL A C   1 
ATOM   444  O O   . VAL A 1 92  ? 23.193 -25.653 -13.980 1.00 30.79 ? 91   VAL A O   1 
ATOM   445  C CB  . VAL A 1 92  ? 20.708 -23.378 -13.656 1.00 33.68 ? 91   VAL A CB  1 
ATOM   446  C CG1 . VAL A 1 92  ? 21.802 -22.734 -14.506 1.00 34.53 ? 91   VAL A CG1 1 
ATOM   447  C CG2 . VAL A 1 92  ? 19.343 -23.116 -14.266 1.00 36.90 ? 91   VAL A CG2 1 
ATOM   448  N N   . LEU A 1 93  ? 22.759 -24.828 -11.926 1.00 30.40 ? 92   LEU A N   1 
ATOM   449  C CA  . LEU A 1 93  ? 24.125 -24.980 -11.454 1.00 29.11 ? 92   LEU A CA  1 
ATOM   450  C C   . LEU A 1 93  ? 24.615 -26.413 -11.482 1.00 28.48 ? 92   LEU A C   1 
ATOM   451  O O   . LEU A 1 93  ? 25.724 -26.678 -11.939 1.00 28.75 ? 92   LEU A O   1 
ATOM   452  C CB  . LEU A 1 93  ? 24.251 -24.396 -10.054 1.00 29.23 ? 92   LEU A CB  1 
ATOM   453  C CG  . LEU A 1 93  ? 23.917 -22.907 -9.984  1.00 29.86 ? 92   LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 93  ? 24.099 -22.446 -8.547  1.00 27.84 ? 92   LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 93  ? 24.780 -22.077 -10.935 1.00 28.35 ? 92   LEU A CD2 1 
ATOM   456  N N   . LEU A 1 94  ? 23.790 -27.350 -11.015 1.00 29.81 ? 93   LEU A N   1 
ATOM   457  C CA  . LEU A 1 94  ? 24.190 -28.756 -11.021 1.00 29.49 ? 93   LEU A CA  1 
ATOM   458  C C   . LEU A 1 94  ? 24.371 -29.321 -12.420 1.00 30.26 ? 93   LEU A C   1 
ATOM   459  O O   . LEU A 1 94  ? 25.259 -30.142 -12.638 1.00 30.17 ? 93   LEU A O   1 
ATOM   460  C CB  . LEU A 1 94  ? 23.233 -29.626 -10.194 1.00 32.88 ? 93   LEU A CB  1 
ATOM   461  C CG  . LEU A 1 94  ? 23.441 -29.641 -8.668  1.00 32.71 ? 93   LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 94  ? 22.353 -30.470 -8.007  1.00 34.15 ? 93   LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 94  ? 24.815 -30.178 -8.298  1.00 32.29 ? 93   LEU A CD2 1 
ATOM   464  N N   . LYS A 1 95  ? 23.548 -28.888 -13.374 1.00 33.07 ? 94   LYS A N   1 
ATOM   465  C CA  . LYS A 1 95  ? 23.753 -29.312 -14.775 1.00 33.85 ? 94   LYS A CA  1 
ATOM   466  C C   . LYS A 1 95  ? 25.070 -28.773 -15.315 1.00 33.69 ? 94   LYS A C   1 
ATOM   467  O O   . LYS A 1 95  ? 25.791 -29.471 -16.036 1.00 33.02 ? 94   LYS A O   1 
ATOM   468  C CB  . LYS A 1 95  ? 22.601 -28.865 -15.673 1.00 36.49 ? 94   LYS A CB  1 
ATOM   469  C CG  . LYS A 1 95  ? 21.299 -29.596 -15.406 1.00 41.58 ? 94   LYS A CG  1 
ATOM   470  C CD  . LYS A 1 95  ? 20.183 -29.055 -16.285 1.00 46.44 ? 94   LYS A CD  1 
ATOM   471  C CE  . LYS A 1 95  ? 20.037 -29.867 -17.567 1.00 51.09 ? 94   LYS A CE  1 
ATOM   472  N NZ  . LYS A 1 95  ? 19.232 -31.108 -17.349 1.00 52.94 ? 94   LYS A NZ  1 
ATOM   473  N N   . LYS A 1 96  ? 25.405 -27.541 -14.938 1.00 32.43 ? 95   LYS A N   1 
ATOM   474  C CA  . LYS A 1 96  ? 26.655 -26.944 -15.395 1.00 33.87 ? 95   LYS A CA  1 
ATOM   475  C C   . LYS A 1 96  ? 27.895 -27.699 -14.903 1.00 35.72 ? 95   LYS A C   1 
ATOM   476  O O   . LYS A 1 96  ? 28.900 -27.744 -15.613 1.00 36.51 ? 95   LYS A O   1 
ATOM   477  C CB  . LYS A 1 96  ? 26.726 -25.460 -15.042 1.00 33.27 ? 95   LYS A CB  1 
ATOM   478  C CG  . LYS A 1 96  ? 25.813 -24.593 -15.892 1.00 34.69 ? 95   LYS A CG  1 
ATOM   479  C CD  . LYS A 1 96  ? 25.755 -23.150 -15.411 1.00 35.20 ? 95   LYS A CD  1 
ATOM   480  C CE  . LYS A 1 96  ? 27.053 -22.404 -15.670 1.00 37.51 ? 95   LYS A CE  1 
ATOM   481  N NZ  . LYS A 1 96  ? 27.391 -22.313 -17.114 1.00 39.21 ? 95   LYS A NZ  1 
ATOM   482  N N   . VAL A 1 97  ? 27.826 -28.300 -13.711 1.00 36.68 ? 96   VAL A N   1 
ATOM   483  C CA  . VAL A 1 97  ? 28.998 -28.988 -13.162 1.00 40.63 ? 96   VAL A CA  1 
ATOM   484  C C   . VAL A 1 97  ? 29.073 -30.496 -13.436 1.00 47.21 ? 96   VAL A C   1 
ATOM   485  O O   . VAL A 1 97  ? 29.999 -31.158 -12.961 1.00 48.30 ? 96   VAL A O   1 
ATOM   486  C CB  . VAL A 1 97  ? 29.193 -28.721 -11.648 1.00 37.52 ? 96   VAL A CB  1 
ATOM   487  C CG1 . VAL A 1 97  ? 29.439 -27.238 -11.399 1.00 34.54 ? 96   VAL A CG1 1 
ATOM   488  C CG2 . VAL A 1 97  ? 27.999 -29.218 -10.844 1.00 36.89 ? 96   VAL A CG2 1 
ATOM   489  N N   . SER A 1 98  ? 28.122 -31.039 -14.197 1.00 54.39 ? 97   SER A N   1 
ATOM   490  C CA  . SER A 1 98  ? 28.095 -32.490 -14.445 1.00 58.60 ? 97   SER A CA  1 
ATOM   491  C C   . SER A 1 98  ? 29.123 -32.953 -15.486 1.00 61.06 ? 97   SER A C   1 
ATOM   492  O O   . SER A 1 98  ? 29.143 -32.479 -16.622 1.00 63.95 ? 97   SER A O   1 
ATOM   493  C CB  . SER A 1 98  ? 26.689 -32.969 -14.805 1.00 58.07 ? 97   SER A CB  1 
ATOM   494  O OG  . SER A 1 98  ? 26.315 -32.506 -16.089 1.00 61.56 ? 97   SER A OG  1 
ATOM   495  N N   . SER A 1 99  ? 29.982 -33.872 -15.054 1.00 64.91 ? 98   SER A N   1 
ATOM   496  C CA  . SER A 1 99  ? 31.005 -34.517 -15.880 1.00 66.35 ? 98   SER A CA  1 
ATOM   497  C C   . SER A 1 99  ? 31.481 -35.743 -15.090 1.00 65.91 ? 98   SER A C   1 
ATOM   498  O O   . SER A 1 99  ? 30.928 -36.046 -14.034 1.00 62.20 ? 98   SER A O   1 
ATOM   499  C CB  . SER A 1 99  ? 32.173 -33.561 -16.184 1.00 66.48 ? 98   SER A CB  1 
ATOM   500  O OG  . SER A 1 99  ? 33.109 -33.503 -15.114 1.00 67.27 ? 98   SER A OG  1 
ATOM   501  N N   . GLY A 1 100 ? 32.501 -36.439 -15.584 1.00 68.30 ? 99   GLY A N   1 
ATOM   502  C CA  . GLY A 1 100 ? 32.989 -37.662 -14.928 1.00 67.45 ? 99   GLY A CA  1 
ATOM   503  C C   . GLY A 1 100 ? 33.683 -37.442 -13.591 1.00 64.46 ? 99   GLY A C   1 
ATOM   504  O O   . GLY A 1 100 ? 34.081 -38.405 -12.922 1.00 61.82 ? 99   GLY A O   1 
ATOM   505  N N   . PHE A 1 101 ? 33.818 -36.173 -13.211 1.00 59.31 ? 100  PHE A N   1 
ATOM   506  C CA  . PHE A 1 101 ? 34.530 -35.776 -12.007 1.00 56.84 ? 100  PHE A CA  1 
ATOM   507  C C   . PHE A 1 101 ? 33.655 -35.975 -10.788 1.00 54.63 ? 100  PHE A C   1 
ATOM   508  O O   . PHE A 1 101 ? 32.559 -35.442 -10.715 1.00 57.41 ? 100  PHE A O   1 
ATOM   509  C CB  . PHE A 1 101 ? 34.975 -34.320 -12.107 1.00 57.19 ? 100  PHE A CB  1 
ATOM   510  C CG  . PHE A 1 101 ? 35.531 -33.757 -10.818 1.00 55.47 ? 100  PHE A CG  1 
ATOM   511  C CD1 . PHE A 1 101 ? 36.782 -34.166 -10.332 1.00 53.80 ? 100  PHE A CD1 1 
ATOM   512  C CD2 . PHE A 1 101 ? 34.818 -32.801 -10.098 1.00 51.71 ? 100  PHE A CD2 1 
ATOM   513  C CE1 . PHE A 1 101 ? 37.304 -33.632 -9.154  1.00 51.22 ? 100  PHE A CE1 1 
ATOM   514  C CE2 . PHE A 1 101 ? 35.342 -32.261 -8.920  1.00 49.29 ? 100  PHE A CE2 1 
ATOM   515  C CZ  . PHE A 1 101 ? 36.583 -32.672 -8.450  1.00 44.99 ? 100  PHE A CZ  1 
ATOM   516  N N   . SER A 1 102 ? 34.152 -36.741 -9.825  1.00 54.16 ? 101  SER A N   1 
ATOM   517  C CA  . SER A 1 102 ? 33.318 -37.167 -8.709  1.00 53.18 ? 101  SER A CA  1 
ATOM   518  C C   . SER A 1 102 ? 33.340 -36.239 -7.485  1.00 49.94 ? 101  SER A C   1 
ATOM   519  O O   . SER A 1 102 ? 32.791 -36.603 -6.431  1.00 49.54 ? 101  SER A O   1 
ATOM   520  C CB  . SER A 1 102 ? 33.662 -38.610 -8.306  1.00 54.75 ? 101  SER A CB  1 
ATOM   521  O OG  . SER A 1 102 ? 34.917 -38.690 -7.646  1.00 55.87 ? 101  SER A OG  1 
ATOM   522  N N   . GLY A 1 103 ? 33.954 -35.055 -7.615  1.00 43.24 ? 102  GLY A N   1 
ATOM   523  C CA  . GLY A 1 103 ? 34.063 -34.131 -6.470  1.00 33.51 ? 102  GLY A CA  1 
ATOM   524  C C   . GLY A 1 103 ? 32.807 -33.316 -6.187  1.00 29.97 ? 102  GLY A C   1 
ATOM   525  O O   . GLY A 1 103 ? 32.669 -32.697 -5.129  1.00 27.18 ? 102  GLY A O   1 
ATOM   526  N N   . VAL A 1 104 ? 31.900 -33.275 -7.150  1.00 28.20 ? 103  VAL A N   1 
ATOM   527  C CA  . VAL A 1 104 ? 30.645 -32.562 -6.966  1.00 28.49 ? 103  VAL A CA  1 
ATOM   528  C C   . VAL A 1 104 ? 29.523 -33.572 -7.106  1.00 30.04 ? 103  VAL A C   1 
ATOM   529  O O   . VAL A 1 104 ? 29.531 -34.393 -8.017  1.00 28.69 ? 103  VAL A O   1 
ATOM   530  C CB  . VAL A 1 104 ? 30.459 -31.411 -7.976  1.00 29.66 ? 103  VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 104 ? 29.127 -30.719 -7.742  1.00 30.63 ? 103  VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 104 ? 31.592 -30.397 -7.838  1.00 28.66 ? 103  VAL A CG2 1 
ATOM   533  N N   . ILE A 1 105 ? 28.567 -33.511 -6.194  1.00 30.23 ? 104  ILE A N   1 
ATOM   534  C CA  . ILE A 1 105 ? 27.423 -34.401 -6.240  1.00 32.64 ? 104  ILE A CA  1 
ATOM   535  C C   . ILE A 1 105 ? 26.743 -34.279 -7.610  1.00 32.26 ? 104  ILE A C   1 
ATOM   536  O O   . ILE A 1 105 ? 26.556 -33.173 -8.127  1.00 34.53 ? 104  ILE A O   1 
ATOM   537  C CB  . ILE A 1 105 ? 26.446 -34.078 -5.096  1.00 33.25 ? 104  ILE A CB  1 
ATOM   538  C CG1 . ILE A 1 105 ? 25.680 -35.338 -4.698  1.00 34.98 ? 104  ILE A CG1 1 
ATOM   539  C CG2 . ILE A 1 105 ? 25.580 -32.851 -5.429  1.00 35.59 ? 104  ILE A CG2 1 
ATOM   540  C CD1 . ILE A 1 105 ? 26.574 -36.338 -3.984  1.00 38.08 ? 104  ILE A CD1 1 
ATOM   541  N N   . ARG A 1 106 ? 26.412 -35.412 -8.208  1.00 31.79 ? 105  ARG A N   1 
ATOM   542  C CA  . ARG A 1 106 ? 25.838 -35.406 -9.552  1.00 34.81 ? 105  ARG A CA  1 
ATOM   543  C C   . ARG A 1 106 ? 24.307 -35.349 -9.522  1.00 31.57 ? 105  ARG A C   1 
ATOM   544  O O   . ARG A 1 106 ? 23.674 -36.129 -8.808  1.00 31.05 ? 105  ARG A O   1 
ATOM   545  C CB  . ARG A 1 106 ? 26.300 -36.646 -10.317 1.00 37.50 ? 105  ARG A CB  1 
ATOM   546  C CG  . ARG A 1 106 ? 25.750 -36.717 -11.736 1.00 46.97 ? 105  ARG A CG  1 
ATOM   547  C CD  . ARG A 1 106 ? 26.150 -38.005 -12.448 1.00 51.90 ? 105  ARG A CD  1 
ATOM   548  N NE  . ARG A 1 106 ? 27.598 -38.199 -12.448 1.00 58.98 ? 105  ARG A NE  1 
ATOM   549  C CZ  . ARG A 1 106 ? 28.440 -37.668 -13.334 1.00 63.30 ? 105  ARG A CZ  1 
ATOM   550  N NH1 . ARG A 1 106 ? 28.000 -36.885 -14.318 1.00 64.51 ? 105  ARG A NH1 1 
ATOM   551  N NH2 . ARG A 1 106 ? 29.738 -37.922 -13.228 1.00 64.61 ? 105  ARG A NH2 1 
ATOM   552  N N   . LEU A 1 107 ? 23.730 -34.439 -10.304 1.00 30.81 ? 106  LEU A N   1 
ATOM   553  C CA  . LEU A 1 107 ? 22.285 -34.388 -10.517 1.00 31.07 ? 106  LEU A CA  1 
ATOM   554  C C   . LEU A 1 107 ? 21.900 -35.432 -11.562 1.00 32.97 ? 106  LEU A C   1 
ATOM   555  O O   . LEU A 1 107 ? 22.322 -35.353 -12.714 1.00 32.60 ? 106  LEU A O   1 
ATOM   556  C CB  . LEU A 1 107 ? 21.833 -33.003 -10.977 1.00 30.90 ? 106  LEU A CB  1 
ATOM   557  C CG  . LEU A 1 107 ? 20.327 -32.827 -11.233 1.00 30.21 ? 106  LEU A CG  1 
ATOM   558  C CD1 . LEU A 1 107 ? 19.553 -32.915 -9.919  1.00 28.86 ? 106  LEU A CD1 1 
ATOM   559  C CD2 . LEU A 1 107 ? 20.023 -31.514 -11.952 1.00 29.65 ? 106  LEU A CD2 1 
ATOM   560  N N   . LEU A 1 108 ? 21.110 -36.416 -11.154 1.00 31.81 ? 107  LEU A N   1 
ATOM   561  C CA  . LEU A 1 108 ? 20.734 -37.503 -12.054 1.00 34.02 ? 107  LEU A CA  1 
ATOM   562  C C   . LEU A 1 108 ? 19.473 -37.176 -12.828 1.00 35.44 ? 107  LEU A C   1 
ATOM   563  O O   . LEU A 1 108 ? 19.337 -37.559 -13.988 1.00 35.56 ? 107  LEU A O   1 
ATOM   564  C CB  . LEU A 1 108 ? 20.552 -38.812 -11.283 1.00 33.25 ? 107  LEU A CB  1 
ATOM   565  C CG  . LEU A 1 108 ? 21.836 -39.413 -10.703 1.00 34.94 ? 107  LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 108 ? 21.514 -40.546 -9.748  1.00 35.30 ? 107  LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 108 ? 22.794 -39.880 -11.794 1.00 36.90 ? 107  LEU A CD2 1 
ATOM   568  N N   . ASP A 1 109 ? 18.558 -36.461 -12.183 1.00 34.37 ? 108  ASP A N   1 
ATOM   569  C CA  . ASP A 1 109 ? 17.281 -36.101 -12.797 1.00 36.64 ? 108  ASP A CA  1 
ATOM   570  C C   . ASP A 1 109 ? 16.602 -35.109 -11.882 1.00 34.58 ? 108  ASP A C   1 
ATOM   571  O O   . ASP A 1 109 ? 17.036 -34.903 -10.754 1.00 32.35 ? 108  ASP A O   1 
ATOM   572  C CB  . ASP A 1 109 ? 16.397 -37.354 -12.985 1.00 38.94 ? 108  ASP A CB  1 
ATOM   573  C CG  . ASP A 1 109 ? 15.416 -37.231 -14.160 1.00 41.58 ? 108  ASP A CG  1 
ATOM   574  O OD1 . ASP A 1 109 ? 15.281 -36.138 -14.756 1.00 42.57 ? 108  ASP A OD1 1 
ATOM   575  O OD2 . ASP A 1 109 ? 14.767 -38.245 -14.485 1.00 44.68 ? 108  ASP A OD2 1 
ATOM   576  N N   . TRP A 1 110 ? 15.543 -34.483 -12.372 1.00 34.78 ? 109  TRP A N   1 
ATOM   577  C CA  . TRP A 1 110 ? 14.756 -33.564 -11.570 1.00 36.12 ? 109  TRP A CA  1 
ATOM   578  C C   . TRP A 1 110 ? 13.352 -33.585 -12.083 1.00 38.05 ? 109  TRP A C   1 
ATOM   579  O O   . TRP A 1 110 ? 13.105 -33.980 -13.237 1.00 36.85 ? 109  TRP A O   1 
ATOM   580  C CB  . TRP A 1 110 ? 15.330 -32.150 -11.615 1.00 37.40 ? 109  TRP A CB  1 
ATOM   581  C CG  . TRP A 1 110 ? 15.302 -31.555 -13.002 1.00 39.39 ? 109  TRP A CG  1 
ATOM   582  C CD1 . TRP A 1 110 ? 16.249 -31.710 -14.015 1.00 40.78 ? 109  TRP A CD1 1 
ATOM   583  C CD2 . TRP A 1 110 ? 14.253 -30.709 -13.585 1.00 39.77 ? 109  TRP A CD2 1 
ATOM   584  N NE1 . TRP A 1 110 ? 15.872 -31.027 -15.146 1.00 40.02 ? 109  TRP A NE1 1 
ATOM   585  C CE2 . TRP A 1 110 ? 14.682 -30.410 -14.958 1.00 41.33 ? 109  TRP A CE2 1 
ATOM   586  C CE3 . TRP A 1 110 ? 13.046 -30.195 -13.129 1.00 42.05 ? 109  TRP A CE3 1 
ATOM   587  C CZ2 . TRP A 1 110 ? 13.917 -29.624 -15.814 1.00 43.95 ? 109  TRP A CZ2 1 
ATOM   588  C CZ3 . TRP A 1 110 ? 12.283 -29.397 -14.001 1.00 44.51 ? 109  TRP A CZ3 1 
ATOM   589  C CH2 . TRP A 1 110 ? 12.710 -29.123 -15.314 1.00 45.38 ? 109  TRP A CH2 1 
ATOM   590  N N   . PHE A 1 111 ? 12.422 -33.158 -11.238 1.00 38.08 ? 110  PHE A N   1 
ATOM   591  C CA  . PHE A 1 111 ? 11.001 -33.179 -11.564 1.00 40.67 ? 110  PHE A CA  1 
ATOM   592  C C   . PHE A 1 111 ? 10.340 -31.943 -11.017 1.00 41.08 ? 110  PHE A C   1 
ATOM   593  O O   . PHE A 1 111 ? 10.704 -31.456 -9.942  1.00 39.24 ? 110  PHE A O   1 
ATOM   594  C CB  . PHE A 1 111 ? 10.329 -34.419 -10.974 1.00 41.82 ? 110  PHE A CB  1 
ATOM   595  C CG  . PHE A 1 111 ? 10.937 -35.711 -11.430 1.00 45.40 ? 110  PHE A CG  1 
ATOM   596  C CD1 . PHE A 1 111 ? 10.607 -36.254 -12.672 1.00 47.77 ? 110  PHE A CD1 1 
ATOM   597  C CD2 . PHE A 1 111 ? 11.846 -36.392 -10.623 1.00 45.27 ? 110  PHE A CD2 1 
ATOM   598  C CE1 . PHE A 1 111 ? 11.174 -37.449 -13.097 1.00 49.58 ? 110  PHE A CE1 1 
ATOM   599  C CE2 . PHE A 1 111 ? 12.414 -37.585 -11.039 1.00 45.86 ? 110  PHE A CE2 1 
ATOM   600  C CZ  . PHE A 1 111 ? 12.073 -38.120 -12.278 1.00 49.45 ? 110  PHE A CZ  1 
ATOM   601  N N   . GLU A 1 112 ? 9.373  -31.423 -11.762 1.00 39.58 ? 111  GLU A N   1 
ATOM   602  C CA  . GLU A 1 112 ? 8.540  -30.354 -11.259 1.00 40.19 ? 111  GLU A CA  1 
ATOM   603  C C   . GLU A 1 112 ? 7.216  -30.939 -10.770 1.00 42.35 ? 111  GLU A C   1 
ATOM   604  O O   . GLU A 1 112 ? 6.594  -31.762 -11.443 1.00 42.00 ? 111  GLU A O   1 
ATOM   605  C CB  . GLU A 1 112 ? 8.290  -29.299 -12.330 1.00 41.10 ? 111  GLU A CB  1 
ATOM   606  C CG  . GLU A 1 112 ? 7.493  -28.108 -11.826 1.00 41.38 ? 111  GLU A CG  1 
ATOM   607  C CD  . GLU A 1 112 ? 7.480  -26.960 -12.805 1.00 43.86 ? 111  GLU A CD  1 
ATOM   608  O OE1 . GLU A 1 112 ? 8.037  -27.121 -13.908 1.00 45.09 ? 111  GLU A OE1 1 
ATOM   609  O OE2 . GLU A 1 112 ? 6.919  -25.894 -12.470 1.00 45.55 ? 111  GLU A OE2 1 
ATOM   610  N N   . ARG A 1 113 ? 6.820  -30.518 -9.580  1.00 42.64 ? 112  ARG A N   1 
ATOM   611  C CA  . ARG A 1 113 ? 5.520  -30.831 -9.024  1.00 43.02 ? 112  ARG A CA  1 
ATOM   612  C C   . ARG A 1 113 ? 4.745  -29.532 -8.925  1.00 44.47 ? 112  ARG A C   1 
ATOM   613  O O   . ARG A 1 113 ? 5.331  -28.456 -9.096  1.00 43.45 ? 112  ARG A O   1 
ATOM   614  C CB  . ARG A 1 113 ? 5.680  -31.473 -7.650  1.00 40.80 ? 112  ARG A CB  1 
ATOM   615  C CG  . ARG A 1 113 ? 5.950  -32.959 -7.733  1.00 38.84 ? 112  ARG A CG  1 
ATOM   616  C CD  . ARG A 1 113 ? 6.174  -33.538 -6.352  1.00 41.14 ? 112  ARG A CD  1 
ATOM   617  N NE  . ARG A 1 113 ? 6.226  -34.989 -6.436  1.00 41.59 ? 112  ARG A NE  1 
ATOM   618  C CZ  . ARG A 1 113 ? 6.375  -35.798 -5.398  1.00 40.15 ? 112  ARG A CZ  1 
ATOM   619  N NH1 . ARG A 1 113 ? 6.497  -35.305 -4.172  1.00 38.07 ? 112  ARG A NH1 1 
ATOM   620  N NH2 . ARG A 1 113 ? 6.405  -37.106 -5.596  1.00 40.71 ? 112  ARG A NH2 1 
ATOM   621  N N   . PRO A 1 114 ? 3.424  -29.616 -8.653  1.00 46.50 ? 113  PRO A N   1 
ATOM   622  C CA  . PRO A 1 114 ? 2.638  -28.386 -8.557  1.00 46.15 ? 113  PRO A CA  1 
ATOM   623  C C   . PRO A 1 114 ? 3.264  -27.341 -7.628  1.00 46.36 ? 113  PRO A C   1 
ATOM   624  O O   . PRO A 1 114 ? 3.336  -26.171 -7.992  1.00 45.65 ? 113  PRO A O   1 
ATOM   625  C CB  . PRO A 1 114 ? 1.288  -28.868 -7.998  1.00 47.07 ? 113  PRO A CB  1 
ATOM   626  C CG  . PRO A 1 114 ? 1.182  -30.298 -8.411  1.00 47.52 ? 113  PRO A CG  1 
ATOM   627  C CD  . PRO A 1 114 ? 2.587  -30.832 -8.543  1.00 46.62 ? 113  PRO A CD  1 
ATOM   628  N N   . ASP A 1 115 ? 3.727  -27.750 -6.447  1.00 44.46 ? 114  ASP A N   1 
ATOM   629  C CA  . ASP A 1 115 ? 4.235  -26.777 -5.474  1.00 46.02 ? 114  ASP A CA  1 
ATOM   630  C C   . ASP A 1 115 ? 5.696  -26.972 -5.054  1.00 42.13 ? 114  ASP A C   1 
ATOM   631  O O   . ASP A 1 115 ? 6.171  -26.343 -4.106  1.00 42.79 ? 114  ASP A O   1 
ATOM   632  C CB  . ASP A 1 115 ? 3.329  -26.753 -4.246  1.00 50.23 ? 114  ASP A CB  1 
ATOM   633  C CG  . ASP A 1 115 ? 1.950  -26.232 -4.568  1.00 53.97 ? 114  ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 115 ? 1.830  -25.025 -4.864  1.00 53.76 ? 114  ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 115 ? 0.998  -27.038 -4.559  1.00 57.85 ? 114  ASP A OD2 1 
ATOM   636  N N   . SER A 1 116 ? 6.405  -27.833 -5.767  1.00 40.04 ? 115  SER A N   1 
ATOM   637  C CA  . SER A 1 116 ? 7.778  -28.150 -5.388  1.00 39.41 ? 115  SER A CA  1 
ATOM   638  C C   . SER A 1 116 ? 8.591  -28.630 -6.581  1.00 37.66 ? 115  SER A C   1 
ATOM   639  O O   . SER A 1 116 ? 8.035  -29.023 -7.613  1.00 34.49 ? 115  SER A O   1 
ATOM   640  C CB  . SER A 1 116 ? 7.789  -29.218 -4.292  1.00 35.51 ? 115  SER A CB  1 
ATOM   641  O OG  . SER A 1 116 ? 7.309  -30.454 -4.781  1.00 33.62 ? 115  SER A OG  1 
ATOM   642  N N   . PHE A 1 117 ? 9.910  -28.583 -6.421  1.00 35.43 ? 116  PHE A N   1 
ATOM   643  C CA  . PHE A 1 117 ? 10.807 -29.332 -7.279  1.00 34.86 ? 116  PHE A CA  1 
ATOM   644  C C   . PHE A 1 117 ? 11.442 -30.480 -6.537  1.00 33.00 ? 116  PHE A C   1 
ATOM   645  O O   . PHE A 1 117 ? 11.679 -30.406 -5.325  1.00 32.60 ? 116  PHE A O   1 
ATOM   646  C CB  . PHE A 1 117 ? 11.889 -28.423 -7.833  1.00 35.57 ? 116  PHE A CB  1 
ATOM   647  C CG  . PHE A 1 117 ? 11.418 -27.576 -8.960  1.00 37.24 ? 116  PHE A CG  1 
ATOM   648  C CD1 . PHE A 1 117 ? 10.804 -26.356 -8.714  1.00 38.14 ? 116  PHE A CD1 1 
ATOM   649  C CD2 . PHE A 1 117 ? 11.559 -28.014 -10.276 1.00 38.58 ? 116  PHE A CD2 1 
ATOM   650  C CE1 . PHE A 1 117 ? 10.367 -25.568 -9.767  1.00 40.30 ? 116  PHE A CE1 1 
ATOM   651  C CE2 . PHE A 1 117 ? 11.122 -27.233 -11.326 1.00 38.06 ? 116  PHE A CE2 1 
ATOM   652  C CZ  . PHE A 1 117 ? 10.523 -26.011 -11.069 1.00 38.63 ? 116  PHE A CZ  1 
ATOM   653  N N   . VAL A 1 118 ? 11.737 -31.529 -7.281  1.00 30.85 ? 117  VAL A N   1 
ATOM   654  C CA  . VAL A 1 118 ? 12.349 -32.720 -6.737  1.00 31.12 ? 117  VAL A CA  1 
ATOM   655  C C   . VAL A 1 118 ? 13.611 -33.001 -7.533  1.00 32.82 ? 117  VAL A C   1 
ATOM   656  O O   . VAL A 1 118 ? 13.563 -33.098 -8.763  1.00 33.07 ? 117  VAL A O   1 
ATOM   657  C CB  . VAL A 1 118 ? 11.397 -33.933 -6.831  1.00 32.71 ? 117  VAL A CB  1 
ATOM   658  C CG1 . VAL A 1 118 ? 12.020 -35.133 -6.150  1.00 32.48 ? 117  VAL A CG1 1 
ATOM   659  C CG2 . VAL A 1 118 ? 10.053 -33.596 -6.188  1.00 33.31 ? 117  VAL A CG2 1 
ATOM   660  N N   . LEU A 1 119 ? 14.733 -33.121 -6.826  1.00 30.42 ? 118  LEU A N   1 
ATOM   661  C CA  . LEU A 1 119 ? 16.040 -33.352 -7.439  1.00 29.45 ? 118  LEU A CA  1 
ATOM   662  C C   . LEU A 1 119 ? 16.529 -34.731 -7.071  1.00 29.85 ? 118  LEU A C   1 
ATOM   663  O O   . LEU A 1 119 ? 16.506 -35.120 -5.896  1.00 30.12 ? 118  LEU A O   1 
ATOM   664  C CB  . LEU A 1 119 ? 17.052 -32.275 -6.976  1.00 29.66 ? 118  LEU A CB  1 
ATOM   665  C CG  . LEU A 1 119 ? 16.951 -30.898 -7.663  1.00 31.72 ? 118  LEU A CG  1 
ATOM   666  C CD1 . LEU A 1 119 ? 15.643 -30.163 -7.382  1.00 33.21 ? 118  LEU A CD1 1 
ATOM   667  C CD2 . LEU A 1 119 ? 18.121 -30.001 -7.257  1.00 31.92 ? 118  LEU A CD2 1 
ATOM   668  N N   . ILE A 1 120 ? 16.976 -35.475 -8.070  1.00 28.23 ? 119  ILE A N   1 
ATOM   669  C CA  . ILE A 1 120 ? 17.565 -36.779 -7.818  1.00 30.29 ? 119  ILE A CA  1 
ATOM   670  C C   . ILE A 1 120 ? 19.074 -36.648 -7.897  1.00 29.98 ? 119  ILE A C   1 
ATOM   671  O O   . ILE A 1 120 ? 19.630 -36.289 -8.946  1.00 29.51 ? 119  ILE A O   1 
ATOM   672  C CB  . ILE A 1 120 ? 17.106 -37.856 -8.836  1.00 29.70 ? 119  ILE A CB  1 
ATOM   673  C CG1 . ILE A 1 120 ? 15.578 -37.824 -9.035  1.00 32.31 ? 119  ILE A CG1 1 
ATOM   674  C CG2 . ILE A 1 120 ? 17.603 -39.229 -8.395  1.00 31.33 ? 119  ILE A CG2 1 
ATOM   675  C CD1 . ILE A 1 120 ? 14.775 -38.172 -7.787  1.00 32.47 ? 119  ILE A CD1 1 
ATOM   676  N N   . LEU A 1 121 ? 19.725 -36.983 -6.788  1.00 29.90 ? 120  LEU A N   1 
ATOM   677  C CA  . LEU A 1 121 ? 21.163 -36.864 -6.663  1.00 29.78 ? 120  LEU A CA  1 
ATOM   678  C C   . LEU A 1 121 ? 21.768 -38.232 -6.505  1.00 31.97 ? 120  LEU A C   1 
ATOM   679  O O   . LEU A 1 121 ? 21.159 -39.112 -5.894  1.00 30.48 ? 120  LEU A O   1 
ATOM   680  C CB  . LEU A 1 121 ? 21.505 -36.008 -5.434  1.00 29.16 ? 120  LEU A CB  1 
ATOM   681  C CG  . LEU A 1 121 ? 20.776 -34.654 -5.375  1.00 29.86 ? 120  LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 121 ? 20.947 -33.970 -4.033  1.00 31.09 ? 120  LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 121 ? 21.244 -33.745 -6.507  1.00 31.91 ? 120  LEU A CD2 1 
ATOM   684  N N   . GLU A 1 122 ? 22.981 -38.412 -7.015  1.00 32.26 ? 121  GLU A N   1 
ATOM   685  C CA  . GLU A 1 122 ? 23.729 -39.635 -6.722  1.00 35.60 ? 121  GLU A CA  1 
ATOM   686  C C   . GLU A 1 122 ? 23.970 -39.683 -5.212  1.00 35.93 ? 121  GLU A C   1 
ATOM   687  O O   . GLU A 1 122 ? 24.155 -38.639 -4.580  1.00 37.21 ? 121  GLU A O   1 
ATOM   688  C CB  . GLU A 1 122 ? 25.062 -39.655 -7.482  1.00 39.49 ? 121  GLU A CB  1 
ATOM   689  C CG  . GLU A 1 122 ? 26.222 -39.075 -6.684  1.00 46.93 ? 121  GLU A CG  1 
ATOM   690  C CD  . GLU A 1 122 ? 27.509 -38.939 -7.476  1.00 50.59 ? 121  GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 122 ? 28.114 -39.977 -7.837  1.00 52.82 ? 121  GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 122 ? 27.918 -37.781 -7.705  1.00 45.09 ? 121  GLU A OE2 1 
ATOM   693  N N   . ARG A 1 123 ? 23.950 -40.873 -4.627  1.00 32.27 ? 122  ARG A N   1 
ATOM   694  C CA  . ARG A 1 123 ? 24.243 -41.010 -3.206  1.00 33.47 ? 122  ARG A CA  1 
ATOM   695  C C   . ARG A 1 123 ? 25.330 -42.057 -2.977  1.00 34.36 ? 122  ARG A C   1 
ATOM   696  O O   . ARG A 1 123 ? 25.137 -43.229 -3.292  1.00 33.18 ? 122  ARG A O   1 
ATOM   697  C CB  . ARG A 1 123 ? 22.969 -41.322 -2.401  1.00 32.78 ? 122  ARG A CB  1 
ATOM   698  C CG  . ARG A 1 123 ? 23.208 -41.865 -1.000  1.00 33.77 ? 122  ARG A CG  1 
ATOM   699  C CD  . ARG A 1 123 ? 21.905 -42.062 -0.230  1.00 34.79 ? 122  ARG A CD  1 
ATOM   700  N NE  . ARG A 1 123 ? 21.042 -43.110 -0.794  1.00 34.77 ? 122  ARG A NE  1 
ATOM   701  C CZ  . ARG A 1 123 ? 21.144 -44.419 -0.543  1.00 38.26 ? 122  ARG A CZ  1 
ATOM   702  N NH1 . ARG A 1 123 ? 22.093 -44.908 0.262   1.00 35.59 ? 122  ARG A NH1 1 
ATOM   703  N NH2 . ARG A 1 123 ? 20.284 -45.257 -1.113  1.00 36.07 ? 122  ARG A NH2 1 
ATOM   704  N N   . PRO A 1 124 ? 26.490 -41.624 -2.449  1.00 36.36 ? 123  PRO A N   1 
ATOM   705  C CA  . PRO A 1 124 ? 27.549 -42.528 -2.010  1.00 35.40 ? 123  PRO A CA  1 
ATOM   706  C C   . PRO A 1 124 ? 27.053 -43.358 -0.837  1.00 33.76 ? 123  PRO A C   1 
ATOM   707  O O   . PRO A 1 124 ? 26.232 -42.892 -0.045  1.00 31.16 ? 123  PRO A O   1 
ATOM   708  C CB  . PRO A 1 124 ? 28.660 -41.573 -1.536  1.00 35.78 ? 123  PRO A CB  1 
ATOM   709  C CG  . PRO A 1 124 ? 28.359 -40.271 -2.202  1.00 36.78 ? 123  PRO A CG  1 
ATOM   710  C CD  . PRO A 1 124 ? 26.865 -40.205 -2.266  1.00 37.57 ? 123  PRO A CD  1 
ATOM   711  N N   . GLU A 1 125 ? 27.543 -44.580 -0.732  1.00 36.28 ? 124  GLU A N   1 
ATOM   712  C CA  . GLU A 1 125 ? 27.093 -45.488 0.320   1.00 41.27 ? 124  GLU A CA  1 
ATOM   713  C C   . GLU A 1 125 ? 28.223 -46.448 0.661   1.00 39.67 ? 124  GLU A C   1 
ATOM   714  O O   . GLU A 1 125 ? 28.683 -47.163 -0.207  1.00 43.04 ? 124  GLU A O   1 
ATOM   715  C CB  . GLU A 1 125 ? 25.817 -46.238 -0.127  1.00 44.29 ? 124  GLU A CB  1 
ATOM   716  C CG  . GLU A 1 125 ? 25.456 -47.491 0.674   1.00 50.01 ? 124  GLU A CG  1 
ATOM   717  C CD  . GLU A 1 125 ? 25.221 -47.236 2.157   1.00 55.05 ? 124  GLU A CD  1 
ATOM   718  O OE1 . GLU A 1 125 ? 24.600 -46.213 2.512   1.00 59.33 ? 124  GLU A OE1 1 
ATOM   719  O OE2 . GLU A 1 125 ? 25.656 -48.068 2.983   1.00 59.61 ? 124  GLU A OE2 1 
ATOM   720  N N   . PRO A 1 126 ? 28.690 -46.452 1.925   1.00 37.92 ? 125  PRO A N   1 
ATOM   721  C CA  . PRO A 1 126 ? 28.265 -45.618 3.034   1.00 36.00 ? 125  PRO A CA  1 
ATOM   722  C C   . PRO A 1 126 ? 28.795 -44.183 2.919   1.00 34.68 ? 125  PRO A C   1 
ATOM   723  O O   . PRO A 1 126 ? 29.819 -43.935 2.271   1.00 34.76 ? 125  PRO A O   1 
ATOM   724  C CB  . PRO A 1 126 ? 28.891 -46.308 4.252   1.00 35.82 ? 125  PRO A CB  1 
ATOM   725  C CG  . PRO A 1 126 ? 30.110 -46.960 3.718   1.00 37.31 ? 125  PRO A CG  1 
ATOM   726  C CD  . PRO A 1 126 ? 29.755 -47.392 2.324   1.00 39.85 ? 125  PRO A CD  1 
ATOM   727  N N   . VAL A 1 127 ? 28.086 -43.264 3.553   1.00 31.77 ? 126  VAL A N   1 
ATOM   728  C CA  . VAL A 1 127 ? 28.387 -41.849 3.472   1.00 30.93 ? 126  VAL A CA  1 
ATOM   729  C C   . VAL A 1 127 ? 28.263 -41.224 4.855   1.00 32.26 ? 126  VAL A C   1 
ATOM   730  O O   . VAL A 1 127 ? 27.500 -41.696 5.709   1.00 31.84 ? 126  VAL A O   1 
ATOM   731  C CB  . VAL A 1 127 ? 27.444 -41.148 2.477   1.00 30.86 ? 126  VAL A CB  1 
ATOM   732  C CG1 . VAL A 1 127 ? 26.043 -41.008 3.060   1.00 32.28 ? 126  VAL A CG1 1 
ATOM   733  C CG2 . VAL A 1 127 ? 27.991 -39.783 2.076   1.00 32.99 ? 126  VAL A CG2 1 
ATOM   734  N N   . GLN A 1 128 ? 29.029 -40.162 5.073   1.00 28.81 ? 127  GLN A N   1 
ATOM   735  C CA  . GLN A 1 128 ? 28.920 -39.377 6.275   1.00 28.20 ? 127  GLN A CA  1 
ATOM   736  C C   . GLN A 1 128 ? 29.323 -37.959 5.919   1.00 28.34 ? 127  GLN A C   1 
ATOM   737  O O   . GLN A 1 128 ? 30.314 -37.764 5.211   1.00 25.66 ? 127  GLN A O   1 
ATOM   738  C CB  . GLN A 1 128 ? 29.851 -39.924 7.352   1.00 29.22 ? 127  GLN A CB  1 
ATOM   739  C CG  . GLN A 1 128 ? 29.718 -39.171 8.667   1.00 31.33 ? 127  GLN A CG  1 
ATOM   740  C CD  . GLN A 1 128 ? 30.570 -39.759 9.777   1.00 32.58 ? 127  GLN A CD  1 
ATOM   741  O OE1 . GLN A 1 128 ? 31.731 -40.101 9.571   1.00 34.18 ? 127  GLN A OE1 1 
ATOM   742  N NE2 . GLN A 1 128 ? 29.991 -39.863 10.971  1.00 34.82 ? 127  GLN A NE2 1 
ATOM   743  N N   . ASP A 1 129 ? 28.565 -36.975 6.388   1.00 26.48 ? 128  ASP A N   1 
ATOM   744  C CA  . ASP A 1 129 ? 28.962 -35.599 6.109   1.00 28.04 ? 128  ASP A CA  1 
ATOM   745  C C   . ASP A 1 129 ? 30.168 -35.212 6.959   1.00 27.35 ? 128  ASP A C   1 
ATOM   746  O O   . ASP A 1 129 ? 30.499 -35.865 7.972   1.00 25.88 ? 128  ASP A O   1 
ATOM   747  C CB  . ASP A 1 129 ? 27.795 -34.601 6.210   1.00 27.94 ? 128  ASP A CB  1 
ATOM   748  C CG  . ASP A 1 129 ? 27.403 -34.271 7.649   1.00 30.19 ? 128  ASP A CG  1 
ATOM   749  O OD1 . ASP A 1 129 ? 28.008 -34.800 8.598   1.00 33.52 ? 128  ASP A OD1 1 
ATOM   750  O OD2 . ASP A 1 129 ? 26.483 -33.447 7.829   1.00 32.16 ? 128  ASP A OD2 1 
ATOM   751  N N   . LEU A 1 130 ? 30.851 -34.160 6.536   1.00 24.88 ? 129  LEU A N   1 
ATOM   752  C CA  . LEU A 1 130 ? 32.080 -33.793 7.195   1.00 24.66 ? 129  LEU A CA  1 
ATOM   753  C C   . LEU A 1 130 ? 31.786 -33.280 8.606   1.00 25.01 ? 129  LEU A C   1 
ATOM   754  O O   . LEU A 1 130 ? 32.595 -33.456 9.507   1.00 26.35 ? 129  LEU A O   1 
ATOM   755  C CB  . LEU A 1 130 ? 32.828 -32.743 6.366   1.00 24.35 ? 129  LEU A CB  1 
ATOM   756  C CG  . LEU A 1 130 ? 34.168 -32.269 6.909   1.00 25.16 ? 129  LEU A CG  1 
ATOM   757  C CD1 . LEU A 1 130 ? 35.139 -33.432 7.081   1.00 23.08 ? 129  LEU A CD1 1 
ATOM   758  C CD2 . LEU A 1 130 ? 34.745 -31.238 5.939   1.00 26.34 ? 129  LEU A CD2 1 
ATOM   759  N N   . PHE A 1 131 ? 30.628 -32.653 8.786   1.00 24.93 ? 130  PHE A N   1 
ATOM   760  C CA  . PHE A 1 131 ? 30.217 -32.149 10.092  1.00 27.22 ? 130  PHE A CA  1 
ATOM   761  C C   . PHE A 1 131 ? 30.168 -33.283 11.135  1.00 27.99 ? 130  PHE A C   1 
ATOM   762  O O   . PHE A 1 131 ? 30.713 -33.148 12.229  1.00 26.98 ? 130  PHE A O   1 
ATOM   763  C CB  . PHE A 1 131 ? 28.862 -31.454 9.984   1.00 29.65 ? 130  PHE A CB  1 
ATOM   764  C CG  . PHE A 1 131 ? 28.322 -30.959 11.292  1.00 33.96 ? 130  PHE A CG  1 
ATOM   765  C CD1 . PHE A 1 131 ? 27.513 -31.776 12.085  1.00 36.90 ? 130  PHE A CD1 1 
ATOM   766  C CD2 . PHE A 1 131 ? 28.608 -29.673 11.733  1.00 36.65 ? 130  PHE A CD2 1 
ATOM   767  C CE1 . PHE A 1 131 ? 27.008 -31.315 13.299  1.00 37.99 ? 130  PHE A CE1 1 
ATOM   768  C CE2 . PHE A 1 131 ? 28.109 -29.209 12.945  1.00 39.05 ? 130  PHE A CE2 1 
ATOM   769  C CZ  . PHE A 1 131 ? 27.310 -30.033 13.729  1.00 37.87 ? 130  PHE A CZ  1 
ATOM   770  N N   . ASP A 1 132 ? 29.523 -34.395 10.785  1.00 29.18 ? 131  ASP A N   1 
ATOM   771  C CA  . ASP A 1 132 ? 29.394 -35.532 11.710  1.00 29.61 ? 131  ASP A CA  1 
ATOM   772  C C   . ASP A 1 132 ? 30.732 -36.199 11.919  1.00 29.11 ? 131  ASP A C   1 
ATOM   773  O O   . ASP A 1 132 ? 31.044 -36.646 13.023  1.00 28.73 ? 131  ASP A O   1 
ATOM   774  C CB  . ASP A 1 132 ? 28.379 -36.561 11.196  1.00 30.53 ? 131  ASP A CB  1 
ATOM   775  C CG  . ASP A 1 132 ? 26.959 -36.074 11.293  1.00 31.97 ? 131  ASP A CG  1 
ATOM   776  O OD1 . ASP A 1 132 ? 26.713 -34.984 11.854  1.00 33.36 ? 131  ASP A OD1 1 
ATOM   777  O OD2 . ASP A 1 132 ? 26.070 -36.786 10.800  1.00 36.10 ? 131  ASP A OD2 1 
ATOM   778  N N   . PHE A 1 133 ? 31.527 -36.262 10.847  1.00 26.74 ? 132  PHE A N   1 
ATOM   779  C CA  . PHE A 1 133 ? 32.815 -36.888 10.887  1.00 26.69 ? 132  PHE A CA  1 
ATOM   780  C C   . PHE A 1 133 ? 33.710 -36.155 11.877  1.00 29.24 ? 132  PHE A C   1 
ATOM   781  O O   . PHE A 1 133 ? 34.376 -36.787 12.714  1.00 28.08 ? 132  PHE A O   1 
ATOM   782  C CB  . PHE A 1 133 ? 33.441 -36.883 9.493   1.00 26.45 ? 132  PHE A CB  1 
ATOM   783  C CG  . PHE A 1 133 ? 34.752 -37.600 9.412   1.00 28.43 ? 132  PHE A CG  1 
ATOM   784  C CD1 . PHE A 1 133 ? 34.794 -38.965 9.160   1.00 28.25 ? 132  PHE A CD1 1 
ATOM   785  C CD2 . PHE A 1 133 ? 35.952 -36.903 9.532   1.00 28.21 ? 132  PHE A CD2 1 
ATOM   786  C CE1 . PHE A 1 133 ? 36.006 -39.628 9.056   1.00 31.02 ? 132  PHE A CE1 1 
ATOM   787  C CE2 . PHE A 1 133 ? 37.173 -37.562 9.438   1.00 29.45 ? 132  PHE A CE2 1 
ATOM   788  C CZ  . PHE A 1 133 ? 37.199 -38.931 9.197   1.00 29.79 ? 132  PHE A CZ  1 
ATOM   789  N N   . ILE A 1 134 ? 33.718 -34.825 11.783  1.00 26.56 ? 133  ILE A N   1 
ATOM   790  C CA  . ILE A 1 134 ? 34.508 -34.016 12.691  1.00 29.73 ? 133  ILE A CA  1 
ATOM   791  C C   . ILE A 1 134 ? 33.947 -34.104 14.118  1.00 32.53 ? 133  ILE A C   1 
ATOM   792  O O   . ILE A 1 134 ? 34.712 -34.278 15.066  1.00 34.05 ? 133  ILE A O   1 
ATOM   793  C CB  . ILE A 1 134 ? 34.619 -32.557 12.204  1.00 27.99 ? 133  ILE A CB  1 
ATOM   794  C CG1 . ILE A 1 134 ? 35.497 -32.495 10.937  1.00 27.11 ? 133  ILE A CG1 1 
ATOM   795  C CG2 . ILE A 1 134 ? 35.186 -31.661 13.303  1.00 27.90 ? 133  ILE A CG2 1 
ATOM   796  C CD1 . ILE A 1 134 ? 35.495 -31.139 10.251  1.00 28.24 ? 133  ILE A CD1 1 
ATOM   797  N N   . THR A 1 135 ? 32.628 -34.006 14.256  1.00 35.75 ? 134  THR A N   1 
ATOM   798  C CA  . THR A 1 135 ? 31.970 -34.127 15.559  1.00 37.55 ? 134  THR A CA  1 
ATOM   799  C C   . THR A 1 135 ? 32.447 -35.385 16.293  1.00 41.22 ? 134  THR A C   1 
ATOM   800  O O   . THR A 1 135 ? 32.880 -35.309 17.449  1.00 39.73 ? 134  THR A O   1 
ATOM   801  C CB  . THR A 1 135 ? 30.432 -34.117 15.428  1.00 38.34 ? 134  THR A CB  1 
ATOM   802  O OG1 . THR A 1 135 ? 30.020 -32.865 14.880  1.00 36.93 ? 134  THR A OG1 1 
ATOM   803  C CG2 . THR A 1 135 ? 29.730 -34.314 16.803  1.00 37.63 ? 134  THR A CG2 1 
ATOM   804  N N   . GLU A 1 136 ? 32.423 -36.529 15.616  1.00 42.76 ? 135  GLU A N   1 
ATOM   805  C CA  . GLU A 1 136 ? 32.779 -37.780 16.281  1.00 45.76 ? 135  GLU A CA  1 
ATOM   806  C C   . GLU A 1 136 ? 34.285 -37.983 16.466  1.00 47.04 ? 135  GLU A C   1 
ATOM   807  O O   . GLU A 1 136 ? 34.712 -38.607 17.439  1.00 43.72 ? 135  GLU A O   1 
ATOM   808  C CB  . GLU A 1 136 ? 32.099 -38.994 15.627  1.00 48.73 ? 135  GLU A CB  1 
ATOM   809  C CG  . GLU A 1 136 ? 32.783 -39.565 14.401  1.00 54.77 ? 135  GLU A CG  1 
ATOM   810  C CD  . GLU A 1 136 ? 31.997 -40.705 13.764  1.00 58.42 ? 135  GLU A CD  1 
ATOM   811  O OE1 . GLU A 1 136 ? 30.763 -40.798 13.980  1.00 55.89 ? 135  GLU A OE1 1 
ATOM   812  O OE2 . GLU A 1 136 ? 32.618 -41.508 13.033  1.00 61.75 ? 135  GLU A OE2 1 
ATOM   813  N N   . ARG A 1 137 ? 35.091 -37.431 15.566  1.00 41.69 ? 136  ARG A N   1 
ATOM   814  C CA  . ARG A 1 137 ? 36.517 -37.672 15.656  1.00 42.08 ? 136  ARG A CA  1 
ATOM   815  C C   . ARG A 1 137 ? 37.326 -36.538 16.278  1.00 39.05 ? 136  ARG A C   1 
ATOM   816  O O   . ARG A 1 137 ? 38.505 -36.705 16.558  1.00 41.64 ? 136  ARG A O   1 
ATOM   817  C CB  . ARG A 1 137 ? 37.056 -38.163 14.315  1.00 46.72 ? 136  ARG A CB  1 
ATOM   818  C CG  . ARG A 1 137 ? 36.509 -39.565 14.038  1.00 53.17 ? 136  ARG A CG  1 
ATOM   819  C CD  . ARG A 1 137 ? 36.754 -40.065 12.630  1.00 54.76 ? 136  ARG A CD  1 
ATOM   820  N NE  . ARG A 1 137 ? 38.179 -40.068 12.322  1.00 54.42 ? 136  ARG A NE  1 
ATOM   821  C CZ  . ARG A 1 137 ? 38.782 -40.963 11.552  1.00 50.76 ? 136  ARG A CZ  1 
ATOM   822  N NH1 . ARG A 1 137 ? 38.092 -41.961 11.006  1.00 52.49 ? 136  ARG A NH1 1 
ATOM   823  N NH2 . ARG A 1 137 ? 40.086 -40.856 11.335  1.00 49.99 ? 136  ARG A NH2 1 
ATOM   824  N N   . GLY A 1 138 ? 36.666 -35.416 16.551  1.00 36.60 ? 137  GLY A N   1 
ATOM   825  C CA  . GLY A 1 138 ? 37.340 -34.200 17.002  1.00 36.95 ? 137  GLY A CA  1 
ATOM   826  C C   . GLY A 1 138 ? 38.138 -33.589 15.853  1.00 36.92 ? 137  GLY A C   1 
ATOM   827  O O   . GLY A 1 138 ? 37.896 -33.899 14.672  1.00 38.78 ? 137  GLY A O   1 
ATOM   828  N N   . ALA A 1 139 ? 39.100 -32.740 16.192  1.00 34.72 ? 138  ALA A N   1 
ATOM   829  C CA  . ALA A 1 139 ? 39.996 -32.142 15.201  1.00 32.51 ? 138  ALA A CA  1 
ATOM   830  C C   . ALA A 1 139 ? 40.686 -33.242 14.391  1.00 34.11 ? 138  ALA A C   1 
ATOM   831  O O   . ALA A 1 139 ? 41.112 -34.271 14.952  1.00 30.13 ? 138  ALA A O   1 
ATOM   832  C CB  . ALA A 1 139 ? 41.031 -31.275 15.888  1.00 31.97 ? 138  ALA A CB  1 
ATOM   833  N N   . LEU A 1 140 ? 40.808 -33.025 13.083  1.00 26.54 ? 139  LEU A N   1 
ATOM   834  C CA  . LEU A 1 140 ? 41.431 -34.004 12.209  1.00 26.34 ? 139  LEU A CA  1 
ATOM   835  C C   . LEU A 1 140 ? 42.944 -33.900 12.209  1.00 26.00 ? 139  LEU A C   1 
ATOM   836  O O   . LEU A 1 140 ? 43.494 -32.797 12.197  1.00 25.28 ? 139  LEU A O   1 
ATOM   837  C CB  . LEU A 1 140 ? 40.897 -33.848 10.769  1.00 26.75 ? 139  LEU A CB  1 
ATOM   838  C CG  . LEU A 1 140 ? 39.371 -33.879 10.596  1.00 28.87 ? 139  LEU A CG  1 
ATOM   839  C CD1 . LEU A 1 140 ? 39.003 -33.825 9.112   1.00 28.58 ? 139  LEU A CD1 1 
ATOM   840  C CD2 . LEU A 1 140 ? 38.764 -35.109 11.281  1.00 30.19 ? 139  LEU A CD2 1 
ATOM   841  N N   . GLN A 1 141 ? 43.622 -35.049 12.181  1.00 26.06 ? 140  GLN A N   1 
ATOM   842  C CA  . GLN A 1 141 ? 45.053 -35.073 11.909  1.00 27.56 ? 140  GLN A CA  1 
ATOM   843  C C   . GLN A 1 141 ? 45.314 -34.255 10.644  1.00 26.11 ? 140  GLN A C   1 
ATOM   844  O O   . GLN A 1 141 ? 44.495 -34.257 9.714   1.00 24.59 ? 140  GLN A O   1 
ATOM   845  C CB  . GLN A 1 141 ? 45.546 -36.499 11.697  1.00 30.16 ? 140  GLN A CB  1 
ATOM   846  C CG  . GLN A 1 141 ? 45.545 -37.327 12.977  1.00 37.36 ? 140  GLN A CG  1 
ATOM   847  C CD  . GLN A 1 141 ? 45.960 -38.764 12.727  1.00 40.77 ? 140  GLN A CD  1 
ATOM   848  O OE1 . GLN A 1 141 ? 46.699 -39.056 11.780  1.00 44.56 ? 140  GLN A OE1 1 
ATOM   849  N NE2 . GLN A 1 141 ? 45.482 -39.674 13.572  1.00 47.33 ? 140  GLN A NE2 1 
ATOM   850  N N   . GLU A 1 142 ? 46.446 -33.563 10.603  1.00 25.44 ? 141  GLU A N   1 
ATOM   851  C CA  . GLU A 1 142 ? 46.715 -32.680 9.471   1.00 24.79 ? 141  GLU A CA  1 
ATOM   852  C C   . GLU A 1 142 ? 46.808 -33.413 8.143   1.00 25.11 ? 141  GLU A C   1 
ATOM   853  O O   . GLU A 1 142 ? 46.390 -32.892 7.125   1.00 25.07 ? 141  GLU A O   1 
ATOM   854  C CB  . GLU A 1 142 ? 47.954 -31.837 9.725   1.00 26.07 ? 141  GLU A CB  1 
ATOM   855  C CG  . GLU A 1 142 ? 47.626 -30.755 10.751  1.00 26.14 ? 141  GLU A CG  1 
ATOM   856  C CD  . GLU A 1 142 ? 48.726 -29.747 10.933  1.00 27.65 ? 141  GLU A CD  1 
ATOM   857  O OE1 . GLU A 1 142 ? 49.489 -29.482 9.970   1.00 29.14 ? 141  GLU A OE1 1 
ATOM   858  O OE2 . GLU A 1 142 ? 48.794 -29.194 12.050  1.00 28.02 ? 141  GLU A OE2 1 
ATOM   859  N N   . GLU A 1 143 ? 47.348 -34.626 8.164   1.00 25.07 ? 142  GLU A N   1 
ATOM   860  C CA  . GLU A 1 143 ? 47.430 -35.416 6.944   1.00 27.52 ? 142  GLU A CA  1 
ATOM   861  C C   . GLU A 1 143 ? 46.048 -35.648 6.364   1.00 26.54 ? 142  GLU A C   1 
ATOM   862  O O   . GLU A 1 143 ? 45.858 -35.572 5.143   1.00 25.74 ? 142  GLU A O   1 
ATOM   863  C CB  . GLU A 1 143 ? 48.098 -36.757 7.236   1.00 29.83 ? 142  GLU A CB  1 
ATOM   864  C CG  . GLU A 1 143 ? 48.213 -37.659 6.034   1.00 30.68 ? 142  GLU A CG  1 
ATOM   865  C CD  . GLU A 1 143 ? 48.878 -38.974 6.390   1.00 33.24 ? 142  GLU A CD  1 
ATOM   866  O OE1 . GLU A 1 143 ? 48.194 -39.845 6.949   1.00 33.32 ? 142  GLU A OE1 1 
ATOM   867  O OE2 . GLU A 1 143 ? 50.083 -39.111 6.111   1.00 36.63 ? 142  GLU A OE2 1 
ATOM   868  N N   . LEU A 1 144 ? 45.092 -35.943 7.241   1.00 24.08 ? 143  LEU A N   1 
ATOM   869  C CA  . LEU A 1 144 ? 43.728 -36.161 6.816   1.00 24.23 ? 143  LEU A CA  1 
ATOM   870  C C   . LEU A 1 144 ? 43.078 -34.856 6.360   1.00 23.53 ? 143  LEU A C   1 
ATOM   871  O O   . LEU A 1 144 ? 42.416 -34.823 5.324   1.00 23.01 ? 143  LEU A O   1 
ATOM   872  C CB  . LEU A 1 144 ? 42.901 -36.830 7.925   1.00 23.88 ? 143  LEU A CB  1 
ATOM   873  C CG  . LEU A 1 144 ? 41.430 -37.139 7.638   1.00 26.34 ? 143  LEU A CG  1 
ATOM   874  C CD1 . LEU A 1 144 ? 41.265 -38.078 6.448   1.00 25.28 ? 143  LEU A CD1 1 
ATOM   875  C CD2 . LEU A 1 144 ? 40.830 -37.777 8.882   1.00 26.47 ? 143  LEU A CD2 1 
ATOM   876  N N   . ALA A 1 145 ? 43.224 -33.798 7.152   1.00 23.43 ? 144  ALA A N   1 
ATOM   877  C CA  . ALA A 1 145 ? 42.676 -32.481 6.761   1.00 22.90 ? 144  ALA A CA  1 
ATOM   878  C C   . ALA A 1 145 ? 43.242 -32.068 5.412   1.00 22.60 ? 144  ALA A C   1 
ATOM   879  O O   . ALA A 1 145 ? 42.539 -31.513 4.599   1.00 23.63 ? 144  ALA A O   1 
ATOM   880  C CB  . ALA A 1 145 ? 43.010 -31.422 7.795   1.00 21.09 ? 144  ALA A CB  1 
ATOM   881  N N   . ARG A 1 146 ? 44.521 -32.351 5.187   1.00 23.94 ? 145  ARG A N   1 
ATOM   882  C CA  . ARG A 1 146 ? 45.169 -31.988 3.924   1.00 23.35 ? 145  ARG A CA  1 
ATOM   883  C C   . ARG A 1 146 ? 44.481 -32.687 2.763   1.00 23.60 ? 145  ARG A C   1 
ATOM   884  O O   . ARG A 1 146 ? 44.123 -32.045 1.776   1.00 22.51 ? 145  ARG A O   1 
ATOM   885  C CB  . ARG A 1 146 ? 46.655 -32.358 3.944   1.00 24.92 ? 145  ARG A CB  1 
ATOM   886  C CG  . ARG A 1 146 ? 47.354 -32.192 2.595   1.00 25.31 ? 145  ARG A CG  1 
ATOM   887  C CD  . ARG A 1 146 ? 48.824 -32.613 2.670   1.00 26.87 ? 145  ARG A CD  1 
ATOM   888  N NE  . ARG A 1 146 ? 49.510 -31.840 3.700   1.00 27.50 ? 145  ARG A NE  1 
ATOM   889  C CZ  . ARG A 1 146 ? 50.025 -32.326 4.824   1.00 28.50 ? 145  ARG A CZ  1 
ATOM   890  N NH1 . ARG A 1 146 ? 50.017 -33.630 5.095   1.00 27.46 ? 145  ARG A NH1 1 
ATOM   891  N NH2 . ARG A 1 146 ? 50.571 -31.484 5.680   1.00 30.68 ? 145  ARG A NH2 1 
ATOM   892  N N   . SER A 1 147 ? 44.300 -34.001 2.888   1.00 22.99 ? 146  SER A N   1 
ATOM   893  C CA  . SER A 1 147 ? 43.630 -34.783 1.837   1.00 23.71 ? 146  SER A CA  1 
ATOM   894  C C   . SER A 1 147 ? 42.217 -34.264 1.597   1.00 23.49 ? 146  SER A C   1 
ATOM   895  O O   . SER A 1 147 ? 41.820 -34.065 0.452   1.00 23.61 ? 146  SER A O   1 
ATOM   896  C CB  . SER A 1 147 ? 43.570 -36.271 2.192   1.00 24.38 ? 146  SER A CB  1 
ATOM   897  O OG  . SER A 1 147 ? 42.710 -36.946 1.271   1.00 25.69 ? 146  SER A OG  1 
ATOM   898  N N   . PHE A 1 148 ? 41.462 -34.075 2.676   1.00 21.76 ? 147  PHE A N   1 
ATOM   899  C CA  . PHE A 1 148 ? 40.091 -33.588 2.569   1.00 22.65 ? 147  PHE A CA  1 
ATOM   900  C C   . PHE A 1 148 ? 40.038 -32.185 1.960   1.00 21.62 ? 147  PHE A C   1 
ATOM   901  O O   . PHE A 1 148 ? 39.262 -31.918 1.039   1.00 22.40 ? 147  PHE A O   1 
ATOM   902  C CB  . PHE A 1 148 ? 39.436 -33.580 3.948   1.00 23.14 ? 147  PHE A CB  1 
ATOM   903  C CG  . PHE A 1 148 ? 38.914 -34.933 4.390   1.00 25.09 ? 147  PHE A CG  1 
ATOM   904  C CD1 . PHE A 1 148 ? 39.221 -36.101 3.683   1.00 27.31 ? 147  PHE A CD1 1 
ATOM   905  C CD2 . PHE A 1 148 ? 38.120 -35.030 5.521   1.00 26.04 ? 147  PHE A CD2 1 
ATOM   906  C CE1 . PHE A 1 148 ? 38.726 -37.334 4.099   1.00 28.50 ? 147  PHE A CE1 1 
ATOM   907  C CE2 . PHE A 1 148 ? 37.626 -36.260 5.941   1.00 27.26 ? 147  PHE A CE2 1 
ATOM   908  C CZ  . PHE A 1 148 ? 37.935 -37.407 5.233   1.00 27.43 ? 147  PHE A CZ  1 
ATOM   909  N N   . PHE A 1 149 ? 40.876 -31.294 2.471   1.00 21.64 ? 148  PHE A N   1 
ATOM   910  C CA  . PHE A 1 149 ? 40.836 -29.889 2.024   1.00 21.51 ? 148  PHE A CA  1 
ATOM   911  C C   . PHE A 1 149 ? 41.227 -29.813 0.548   1.00 21.40 ? 148  PHE A C   1 
ATOM   912  O O   . PHE A 1 149 ? 40.618 -29.096 -0.226  1.00 22.03 ? 148  PHE A O   1 
ATOM   913  C CB  . PHE A 1 149 ? 41.780 -29.050 2.869   1.00 21.47 ? 148  PHE A CB  1 
ATOM   914  C CG  . PHE A 1 149 ? 41.637 -27.567 2.647   1.00 21.65 ? 148  PHE A CG  1 
ATOM   915  C CD1 . PHE A 1 149 ? 40.422 -26.927 2.904   1.00 21.76 ? 148  PHE A CD1 1 
ATOM   916  C CD2 . PHE A 1 149 ? 42.723 -26.815 2.213   1.00 21.95 ? 148  PHE A CD2 1 
ATOM   917  C CE1 . PHE A 1 149 ? 40.296 -25.554 2.715   1.00 22.20 ? 148  PHE A CE1 1 
ATOM   918  C CE2 . PHE A 1 149 ? 42.605 -25.443 2.037   1.00 22.40 ? 148  PHE A CE2 1 
ATOM   919  C CZ  . PHE A 1 149 ? 41.390 -24.814 2.287   1.00 21.16 ? 148  PHE A CZ  1 
ATOM   920  N N   . TRP A 1 150 ? 42.223 -30.600 0.171   1.00 22.40 ? 149  TRP A N   1 
ATOM   921  C CA  . TRP A 1 150 ? 42.659 -30.697 -1.227  1.00 22.41 ? 149  TRP A CA  1 
ATOM   922  C C   . TRP A 1 150 ? 41.522 -31.098 -2.119  1.00 22.09 ? 149  TRP A C   1 
ATOM   923  O O   . TRP A 1 150 ? 41.277 -30.479 -3.147  1.00 21.87 ? 149  TRP A O   1 
ATOM   924  C CB  . TRP A 1 150 ? 43.781 -31.709 -1.337  1.00 22.26 ? 149  TRP A CB  1 
ATOM   925  C CG  . TRP A 1 150 ? 44.324 -31.820 -2.740  1.00 22.20 ? 149  TRP A CG  1 
ATOM   926  C CD1 . TRP A 1 150 ? 43.921 -32.687 -3.755  1.00 23.04 ? 149  TRP A CD1 1 
ATOM   927  C CD2 . TRP A 1 150 ? 45.389 -31.010 -3.322  1.00 23.13 ? 149  TRP A CD2 1 
ATOM   928  N NE1 . TRP A 1 150 ? 44.661 -32.477 -4.891  1.00 24.17 ? 149  TRP A NE1 1 
ATOM   929  C CE2 . TRP A 1 150 ? 45.563 -31.489 -4.696  1.00 24.11 ? 149  TRP A CE2 1 
ATOM   930  C CE3 . TRP A 1 150 ? 46.205 -29.982 -2.853  1.00 24.40 ? 149  TRP A CE3 1 
ATOM   931  C CZ2 . TRP A 1 150 ? 46.513 -30.939 -5.551  1.00 25.03 ? 149  TRP A CZ2 1 
ATOM   932  C CZ3 . TRP A 1 150 ? 47.168 -29.444 -3.723  1.00 25.12 ? 149  TRP A CZ3 1 
ATOM   933  C CH2 . TRP A 1 150 ? 47.308 -29.915 -5.043  1.00 26.64 ? 149  TRP A CH2 1 
ATOM   934  N N   . GLN A 1 151 ? 40.789 -32.139 -1.737  1.00 21.50 ? 150  GLN A N   1 
ATOM   935  C CA  . GLN A 1 151 ? 39.642 -32.558 -2.542  1.00 21.23 ? 150  GLN A CA  1 
ATOM   936  C C   . GLN A 1 151 ? 38.565 -31.515 -2.621  1.00 20.88 ? 150  GLN A C   1 
ATOM   937  O O   . GLN A 1 151 ? 37.931 -31.365 -3.656  1.00 20.31 ? 150  GLN A O   1 
ATOM   938  C CB  . GLN A 1 151 ? 39.036 -33.845 -2.007  1.00 22.69 ? 150  GLN A CB  1 
ATOM   939  C CG  . GLN A 1 151 ? 39.973 -35.022 -2.179  1.00 24.04 ? 150  GLN A CG  1 
ATOM   940  C CD  . GLN A 1 151 ? 39.296 -36.316 -1.775  1.00 25.56 ? 150  GLN A CD  1 
ATOM   941  O OE1 . GLN A 1 151 ? 38.188 -36.601 -2.212  1.00 24.82 ? 150  GLN A OE1 1 
ATOM   942  N NE2 . GLN A 1 151 ? 39.954 -37.087 -0.925  1.00 27.02 ? 150  GLN A NE2 1 
ATOM   943  N N   . VAL A 1 152 ? 38.343 -30.792 -1.531  1.00 20.82 ? 151  VAL A N   1 
ATOM   944  C CA  . VAL A 1 152 ? 37.362 -29.717 -1.585  1.00 20.55 ? 151  VAL A CA  1 
ATOM   945  C C   . VAL A 1 152 ? 37.840 -28.658 -2.577  1.00 20.66 ? 151  VAL A C   1 
ATOM   946  O O   . VAL A 1 152 ? 37.044 -28.153 -3.390  1.00 20.65 ? 151  VAL A O   1 
ATOM   947  C CB  . VAL A 1 152 ? 37.123 -29.092 -0.191  1.00 19.40 ? 151  VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 152 ? 36.164 -27.918 -0.282  1.00 18.87 ? 151  VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 152 ? 36.511 -30.137 0.726   1.00 19.36 ? 151  VAL A CG2 1 
ATOM   950  N N   . LEU A 1 153 ? 39.120 -28.297 -2.485  1.00 20.61 ? 152  LEU A N   1 
ATOM   951  C CA  . LEU A 1 153 ? 39.683 -27.303 -3.412  1.00 22.09 ? 152  LEU A CA  1 
ATOM   952  C C   . LEU A 1 153 ? 39.494 -27.740 -4.867  1.00 22.40 ? 152  LEU A C   1 
ATOM   953  O O   . LEU A 1 153 ? 39.113 -26.932 -5.698  1.00 23.85 ? 152  LEU A O   1 
ATOM   954  C CB  . LEU A 1 153 ? 41.175 -27.100 -3.148  1.00 23.25 ? 152  LEU A CB  1 
ATOM   955  C CG  . LEU A 1 153 ? 41.438 -26.387 -1.818  1.00 24.43 ? 152  LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 153 ? 42.906 -26.484 -1.469  1.00 26.91 ? 152  LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 153 ? 40.984 -24.944 -1.844  1.00 27.34 ? 152  LEU A CD2 1 
ATOM   958  N N   . GLU A 1 154 ? 39.794 -29.003 -5.165  1.00 22.71 ? 153  GLU A N   1 
ATOM   959  C CA  . GLU A 1 154 ? 39.593 -29.528 -6.527  1.00 23.73 ? 153  GLU A CA  1 
ATOM   960  C C   . GLU A 1 154 ? 38.125 -29.413 -6.956  1.00 24.01 ? 153  GLU A C   1 
ATOM   961  O O   . GLU A 1 154 ? 37.843 -29.025 -8.093  1.00 23.66 ? 153  GLU A O   1 
ATOM   962  C CB  . GLU A 1 154 ? 40.092 -30.978 -6.645  1.00 25.80 ? 153  GLU A CB  1 
ATOM   963  C CG  . GLU A 1 154 ? 41.601 -31.116 -6.512  1.00 26.91 ? 153  GLU A CG  1 
ATOM   964  C CD  . GLU A 1 154 ? 42.342 -30.552 -7.719  1.00 28.08 ? 153  GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 154 ? 41.899 -30.787 -8.857  1.00 29.63 ? 153  GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 154 ? 43.374 -29.884 -7.543  1.00 27.96 ? 153  GLU A OE2 1 
ATOM   967  N N   . ALA A 1 155 ? 37.192 -29.736 -6.045  1.00 22.73 ? 154  ALA A N   1 
ATOM   968  C CA  . ALA A 1 155 ? 35.748 -29.663 -6.350  1.00 22.39 ? 154  ALA A CA  1 
ATOM   969  C C   . ALA A 1 155 ? 35.292 -28.227 -6.621  1.00 22.11 ? 154  ALA A C   1 
ATOM   970  O O   . ALA A 1 155 ? 34.528 -27.960 -7.558  1.00 22.16 ? 154  ALA A O   1 
ATOM   971  C CB  . ALA A 1 155 ? 34.912 -30.263 -5.212  1.00 22.43 ? 154  ALA A CB  1 
ATOM   972  N N   . VAL A 1 156 ? 35.793 -27.301 -5.807  1.00 22.16 ? 155  VAL A N   1 
ATOM   973  C CA  . VAL A 1 156 ? 35.416 -25.908 -5.919  1.00 21.30 ? 155  VAL A CA  1 
ATOM   974  C C   . VAL A 1 156 ? 36.009 -25.331 -7.209  1.00 22.06 ? 155  VAL A C   1 
ATOM   975  O O   . VAL A 1 156 ? 35.349 -24.578 -7.913  1.00 21.83 ? 155  VAL A O   1 
ATOM   976  C CB  . VAL A 1 156 ? 35.851 -25.126 -4.664  1.00 22.07 ? 155  VAL A CB  1 
ATOM   977  C CG1 . VAL A 1 156 ? 35.631 -23.639 -4.851  1.00 21.05 ? 155  VAL A CG1 1 
ATOM   978  C CG2 . VAL A 1 156 ? 35.032 -25.607 -3.456  1.00 21.63 ? 155  VAL A CG2 1 
ATOM   979  N N   . ARG A 1 157 ? 37.241 -25.714 -7.527  1.00 21.94 ? 156  ARG A N   1 
ATOM   980  C CA  . ARG A 1 157 ? 37.861 -25.239 -8.770  1.00 23.48 ? 156  ARG A CA  1 
ATOM   981  C C   . ARG A 1 157 ? 37.036 -25.746 -9.936  1.00 24.86 ? 156  ARG A C   1 
ATOM   982  O O   . ARG A 1 157 ? 36.797 -25.021 -10.895 1.00 24.16 ? 156  ARG A O   1 
ATOM   983  C CB  . ARG A 1 157 ? 39.291 -25.754 -8.876  1.00 23.82 ? 156  ARG A CB  1 
ATOM   984  C CG  . ARG A 1 157 ? 40.282 -24.999 -7.985  1.00 23.24 ? 156  ARG A CG  1 
ATOM   985  C CD  . ARG A 1 157 ? 41.686 -25.573 -8.177  1.00 23.89 ? 156  ARG A CD  1 
ATOM   986  N NE  . ARG A 1 157 ? 42.026 -25.561 -9.605  1.00 24.93 ? 156  ARG A NE  1 
ATOM   987  C CZ  . ARG A 1 157 ? 42.912 -26.361 -10.192 1.00 26.32 ? 156  ARG A CZ  1 
ATOM   988  N NH1 . ARG A 1 157 ? 43.604 -27.266 -9.484  1.00 24.52 ? 156  ARG A NH1 1 
ATOM   989  N NH2 . ARG A 1 157 ? 43.111 -26.237 -11.501 1.00 26.39 ? 156  ARG A NH2 1 
ATOM   990  N N   . HIS A 1 158 ? 36.586 -26.993 -9.850  1.00 25.71 ? 157  HIS A N   1 
ATOM   991  C CA  . HIS A 1 158 ? 35.743 -27.540 -10.908 1.00 27.44 ? 157  HIS A CA  1 
ATOM   992  C C   . HIS A 1 158 ? 34.482 -26.730 -11.074 1.00 28.00 ? 157  HIS A C   1 
ATOM   993  O O   . HIS A 1 158 ? 34.075 -26.432 -12.209 1.00 28.81 ? 157  HIS A O   1 
ATOM   994  C CB  . HIS A 1 158 ? 35.419 -29.012 -10.655 1.00 29.55 ? 157  HIS A CB  1 
ATOM   995  C CG  . HIS A 1 158 ? 34.371 -29.565 -11.587 1.00 31.91 ? 157  HIS A CG  1 
ATOM   996  N ND1 . HIS A 1 158 ? 34.651 -29.927 -12.852 1.00 34.22 ? 157  HIS A ND1 1 
ATOM   997  C CD2 . HIS A 1 158 ? 33.012 -29.793 -11.402 1.00 34.41 ? 157  HIS A CD2 1 
ATOM   998  C CE1 . HIS A 1 158 ? 33.524 -30.379 -13.449 1.00 34.54 ? 157  HIS A CE1 1 
ATOM   999  N NE2 . HIS A 1 158 ? 32.522 -30.288 -12.563 1.00 35.61 ? 157  HIS A NE2 1 
ATOM   1000 N N   . CYS A 1 159 ? 33.835 -26.370 -9.963  1.00 25.26 ? 158  CYS A N   1 
ATOM   1001 C CA  . CYS A 1 159 ? 32.647 -25.523 -10.039 1.00 26.34 ? 158  CYS A CA  1 
ATOM   1002 C C   . CYS A 1 159 ? 32.970 -24.211 -10.739 1.00 26.80 ? 158  CYS A C   1 
ATOM   1003 O O   . CYS A 1 159 ? 32.264 -23.804 -11.683 1.00 25.24 ? 158  CYS A O   1 
ATOM   1004 C CB  . CYS A 1 159 ? 32.096 -25.217 -8.639  1.00 26.05 ? 158  CYS A CB  1 
ATOM   1005 S SG  . CYS A 1 159 ? 31.448 -26.684 -7.819  1.00 27.68 ? 158  CYS A SG  1 
ATOM   1006 N N   . HIS A 1 160 ? 34.027 -23.542 -10.264 1.00 25.08 ? 159  HIS A N   1 
ATOM   1007 C CA  . HIS A 1 160 ? 34.406 -22.243 -10.826 1.00 26.31 ? 159  HIS A CA  1 
ATOM   1008 C C   . HIS A 1 160 ? 34.737 -22.346 -12.287 1.00 27.96 ? 159  HIS A C   1 
ATOM   1009 O O   . HIS A 1 160 ? 34.359 -21.475 -13.061 1.00 27.10 ? 159  HIS A O   1 
ATOM   1010 C CB  . HIS A 1 160 ? 35.568 -21.637 -10.057 1.00 27.10 ? 159  HIS A CB  1 
ATOM   1011 C CG  . HIS A 1 160 ? 35.222 -21.285 -8.634  1.00 28.13 ? 159  HIS A CG  1 
ATOM   1012 N ND1 . HIS A 1 160 ? 36.129 -20.824 -7.768  1.00 31.79 ? 159  HIS A ND1 1 
ATOM   1013 C CD2 . HIS A 1 160 ? 34.023 -21.383 -7.932  1.00 28.06 ? 159  HIS A CD2 1 
ATOM   1014 C CE1 . HIS A 1 160 ? 35.533 -20.592 -6.575  1.00 31.13 ? 159  HIS A CE1 1 
ATOM   1015 N NE2 . HIS A 1 160 ? 34.250 -20.936 -6.682  1.00 28.50 ? 159  HIS A NE2 1 
ATOM   1016 N N   . ASN A 1 161 ? 35.437 -23.415 -12.665 1.00 28.33 ? 160  ASN A N   1 
ATOM   1017 C CA  . ASN A 1 161 ? 35.772 -23.672 -14.062 1.00 31.64 ? 160  ASN A CA  1 
ATOM   1018 C C   . ASN A 1 161 ? 34.516 -23.889 -14.920 1.00 33.04 ? 160  ASN A C   1 
ATOM   1019 O O   . ASN A 1 161 ? 34.522 -23.581 -16.109 1.00 32.98 ? 160  ASN A O   1 
ATOM   1020 C CB  . ASN A 1 161 ? 36.739 -24.859 -14.176 1.00 33.53 ? 160  ASN A CB  1 
ATOM   1021 C CG  . ASN A 1 161 ? 37.306 -25.026 -15.580 1.00 36.83 ? 160  ASN A CG  1 
ATOM   1022 O OD1 . ASN A 1 161 ? 37.947 -24.123 -16.122 1.00 37.03 ? 160  ASN A OD1 1 
ATOM   1023 N ND2 . ASN A 1 161 ? 37.092 -26.199 -16.166 1.00 38.83 ? 160  ASN A ND2 1 
ATOM   1024 N N   . CYS A 1 162 ? 33.440 -24.392 -14.312 1.00 30.41 ? 161  CYS A N   1 
ATOM   1025 C CA  . CYS A 1 162 ? 32.160 -24.570 -15.001 1.00 31.11 ? 161  CYS A CA  1 
ATOM   1026 C C   . CYS A 1 162 ? 31.242 -23.361 -14.893 1.00 29.44 ? 161  CYS A C   1 
ATOM   1027 O O   . CYS A 1 162 ? 30.070 -23.436 -15.287 1.00 28.97 ? 161  CYS A O   1 
ATOM   1028 C CB  . CYS A 1 162 ? 31.430 -25.818 -14.483 1.00 33.40 ? 161  CYS A CB  1 
ATOM   1029 S SG  . CYS A 1 162 ? 32.325 -27.334 -14.848 1.00 35.80 ? 161  CYS A SG  1 
ATOM   1030 N N   . GLY A 1 163 ? 31.761 -22.269 -14.335 1.00 27.17 ? 162  GLY A N   1 
ATOM   1031 C CA  . GLY A 1 163 ? 31.018 -21.013 -14.196 1.00 26.50 ? 162  GLY A CA  1 
ATOM   1032 C C   . GLY A 1 163 ? 30.004 -21.030 -13.064 1.00 26.29 ? 162  GLY A C   1 
ATOM   1033 O O   . GLY A 1 163 ? 28.985 -20.329 -13.118 1.00 24.49 ? 162  GLY A O   1 
ATOM   1034 N N   . VAL A 1 164 ? 30.281 -21.840 -12.041 1.00 25.48 ? 163  VAL A N   1 
ATOM   1035 C CA  . VAL A 1 164 ? 29.371 -21.998 -10.905 1.00 24.87 ? 163  VAL A CA  1 
ATOM   1036 C C   . VAL A 1 164 ? 30.051 -21.590 -9.595  1.00 23.13 ? 163  VAL A C   1 
ATOM   1037 O O   . VAL A 1 164 ? 31.166 -21.993 -9.309  1.00 24.62 ? 163  VAL A O   1 
ATOM   1038 C CB  . VAL A 1 164 ? 28.866 -23.462 -10.781 1.00 26.46 ? 163  VAL A CB  1 
ATOM   1039 C CG1 . VAL A 1 164 ? 28.042 -23.646 -9.512  1.00 24.87 ? 163  VAL A CG1 1 
ATOM   1040 C CG2 . VAL A 1 164 ? 28.044 -23.849 -12.005 1.00 26.69 ? 163  VAL A CG2 1 
ATOM   1041 N N   . LEU A 1 165 ? 29.369 -20.776 -8.822  1.00 23.87 ? 164  LEU A N   1 
ATOM   1042 C CA  . LEU A 1 165 ? 29.864 -20.377 -7.508  1.00 24.43 ? 164  LEU A CA  1 
ATOM   1043 C C   . LEU A 1 165 ? 28.964 -21.036 -6.455  1.00 25.15 ? 164  LEU A C   1 
ATOM   1044 O O   . LEU A 1 165 ? 27.755 -20.823 -6.446  1.00 24.45 ? 164  LEU A O   1 
ATOM   1045 C CB  . LEU A 1 165 ? 29.795 -18.859 -7.376  1.00 25.06 ? 164  LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 165 ? 30.369 -18.225 -6.100  1.00 26.32 ? 164  LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 165 ? 31.883 -18.356 -6.053  1.00 25.87 ? 164  LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 165 ? 29.969 -16.759 -6.067  1.00 25.97 ? 164  LEU A CD2 1 
ATOM   1049 N N   . HIS A 1 166 ? 29.553 -21.803 -5.556  1.00 24.51 ? 165  HIS A N   1 
ATOM   1050 C CA  . HIS A 1 166 ? 28.737 -22.547 -4.583  1.00 24.23 ? 165  HIS A CA  1 
ATOM   1051 C C   . HIS A 1 166 ? 28.071 -21.683 -3.525  1.00 24.13 ? 165  HIS A C   1 
ATOM   1052 O O   . HIS A 1 166 ? 26.866 -21.823 -3.253  1.00 25.22 ? 165  HIS A O   1 
ATOM   1053 C CB  . HIS A 1 166 ? 29.597 -23.631 -3.952  1.00 24.99 ? 165  HIS A CB  1 
ATOM   1054 C CG  . HIS A 1 166 ? 28.823 -24.564 -3.054  1.00 25.48 ? 165  HIS A CG  1 
ATOM   1055 N ND1 . HIS A 1 166 ? 28.510 -24.244 -1.790  1.00 25.02 ? 165  HIS A ND1 1 
ATOM   1056 C CD2 . HIS A 1 166 ? 28.305 -25.834 -3.281  1.00 25.42 ? 165  HIS A CD2 1 
ATOM   1057 C CE1 . HIS A 1 166 ? 27.829 -25.263 -1.224  1.00 24.81 ? 165  HIS A CE1 1 
ATOM   1058 N NE2 . HIS A 1 166 ? 27.722 -26.242 -2.130  1.00 25.00 ? 165  HIS A NE2 1 
ATOM   1059 N N   . ARG A 1 167 ? 28.846 -20.778 -2.927  1.00 23.39 ? 166  ARG A N   1 
ATOM   1060 C CA  . ARG A 1 167 ? 28.373 -19.822 -1.912  1.00 24.24 ? 166  ARG A CA  1 
ATOM   1061 C C   . ARG A 1 167 ? 27.951 -20.402 -0.557  1.00 23.34 ? 166  ARG A C   1 
ATOM   1062 O O   . ARG A 1 167 ? 27.468 -19.682 0.290   1.00 24.29 ? 166  ARG A O   1 
ATOM   1063 C CB  . ARG A 1 167 ? 27.274 -18.876 -2.448  1.00 25.46 ? 166  ARG A CB  1 
ATOM   1064 C CG  . ARG A 1 167 ? 27.695 -18.131 -3.705  1.00 25.88 ? 166  ARG A CG  1 
ATOM   1065 C CD  . ARG A 1 167 ? 26.934 -16.832 -3.845  1.00 27.68 ? 166  ARG A CD  1 
ATOM   1066 N NE  . ARG A 1 167 ? 25.549 -17.072 -4.225  1.00 27.13 ? 166  ARG A NE  1 
ATOM   1067 C CZ  . ARG A 1 167 ? 24.647 -16.126 -4.461  1.00 28.79 ? 166  ARG A CZ  1 
ATOM   1068 N NH1 . ARG A 1 167 ? 24.967 -14.823 -4.365  1.00 27.82 ? 166  ARG A NH1 1 
ATOM   1069 N NH2 . ARG A 1 167 ? 23.419 -16.500 -4.803  1.00 27.42 ? 166  ARG A NH2 1 
ATOM   1070 N N   . ASP A 1 168 ? 28.162 -21.688 -0.339  1.00 23.68 ? 167  ASP A N   1 
ATOM   1071 C CA  . ASP A 1 168 ? 27.824 -22.246 0.974   1.00 24.05 ? 167  ASP A CA  1 
ATOM   1072 C C   . ASP A 1 168 ? 28.770 -23.385 1.329   1.00 23.02 ? 167  ASP A C   1 
ATOM   1073 O O   . ASP A 1 168 ? 28.368 -24.443 1.831   1.00 22.76 ? 167  ASP A O   1 
ATOM   1074 C CB  . ASP A 1 168 ? 26.341 -22.669 0.983   1.00 25.09 ? 167  ASP A CB  1 
ATOM   1075 C CG  . ASP A 1 168 ? 25.791 -22.902 2.392   1.00 28.35 ? 167  ASP A CG  1 
ATOM   1076 O OD1 . ASP A 1 168 ? 26.378 -22.390 3.377   1.00 29.08 ? 167  ASP A OD1 1 
ATOM   1077 O OD2 . ASP A 1 168 ? 24.772 -23.620 2.490   1.00 26.95 ? 167  ASP A OD2 1 
ATOM   1078 N N   . ILE A 1 169 ? 30.054 -23.173 1.065   1.00 22.52 ? 168  ILE A N   1 
ATOM   1079 C CA  . ILE A 1 169 ? 31.035 -24.213 1.350   1.00 22.83 ? 168  ILE A CA  1 
ATOM   1080 C C   . ILE A 1 169 ? 31.103 -24.314 2.875   1.00 22.72 ? 168  ILE A C   1 
ATOM   1081 O O   . ILE A 1 169 ? 31.345 -23.325 3.548   1.00 22.10 ? 168  ILE A O   1 
ATOM   1082 C CB  . ILE A 1 169 ? 32.424 -23.852 0.787   1.00 22.13 ? 168  ILE A CB  1 
ATOM   1083 C CG1 . ILE A 1 169 ? 32.357 -23.731 -0.747  1.00 22.34 ? 168  ILE A CG1 1 
ATOM   1084 C CG2 . ILE A 1 169 ? 33.463 -24.881 1.229   1.00 22.93 ? 168  ILE A CG2 1 
ATOM   1085 C CD1 . ILE A 1 169 ? 33.565 -23.012 -1.350  1.00 22.62 ? 168  ILE A CD1 1 
ATOM   1086 N N   . LYS A 1 170 ? 30.874 -25.511 3.396   1.00 22.68 ? 169  LYS A N   1 
ATOM   1087 C CA  . LYS A 1 170 ? 30.930 -25.759 4.828   1.00 23.33 ? 169  LYS A CA  1 
ATOM   1088 C C   . LYS A 1 170 ? 30.917 -27.264 5.080   1.00 22.79 ? 169  LYS A C   1 
ATOM   1089 O O   . LYS A 1 170 ? 30.586 -28.053 4.188   1.00 22.31 ? 169  LYS A O   1 
ATOM   1090 C CB  . LYS A 1 170 ? 29.741 -25.113 5.549   1.00 24.29 ? 169  LYS A CB  1 
ATOM   1091 C CG  . LYS A 1 170 ? 28.368 -25.593 5.097   1.00 25.92 ? 169  LYS A CG  1 
ATOM   1092 C CD  . LYS A 1 170 ? 27.297 -25.043 6.033   1.00 27.61 ? 169  LYS A CD  1 
ATOM   1093 C CE  . LYS A 1 170 ? 25.916 -25.457 5.543   1.00 28.07 ? 169  LYS A CE  1 
ATOM   1094 N NZ  . LYS A 1 170 ? 24.848 -24.882 6.415   1.00 30.87 ? 169  LYS A NZ  1 
ATOM   1095 N N   . ASP A 1 171 ? 31.231 -27.648 6.310   1.00 22.01 ? 170  ASP A N   1 
ATOM   1096 C CA  . ASP A 1 171 ? 31.334 -29.063 6.638   1.00 24.09 ? 170  ASP A CA  1 
ATOM   1097 C C   . ASP A 1 171 ? 30.023 -29.815 6.365   1.00 23.20 ? 170  ASP A C   1 
ATOM   1098 O O   . ASP A 1 171 ? 30.058 -30.958 5.936   1.00 23.69 ? 170  ASP A O   1 
ATOM   1099 C CB  . ASP A 1 171 ? 31.839 -29.260 8.081   1.00 26.47 ? 170  ASP A CB  1 
ATOM   1100 C CG  . ASP A 1 171 ? 30.967 -28.583 9.120   1.00 28.20 ? 170  ASP A CG  1 
ATOM   1101 O OD1 . ASP A 1 171 ? 29.931 -27.973 8.786   1.00 29.04 ? 170  ASP A OD1 1 
ATOM   1102 O OD2 . ASP A 1 171 ? 31.334 -28.667 10.311  1.00 33.04 ? 170  ASP A OD2 1 
ATOM   1103 N N   . GLU A 1 172 ? 28.879 -29.164 6.572   1.00 23.66 ? 171  GLU A N   1 
ATOM   1104 C CA  . GLU A 1 172 ? 27.575 -29.831 6.357   1.00 25.60 ? 171  GLU A CA  1 
ATOM   1105 C C   . GLU A 1 172 ? 27.271 -30.044 4.884   1.00 26.34 ? 171  GLU A C   1 
ATOM   1106 O O   . GLU A 1 172 ? 26.403 -30.863 4.523   1.00 25.87 ? 171  GLU A O   1 
ATOM   1107 C CB  . GLU A 1 172 ? 26.439 -29.029 6.966   1.00 28.98 ? 171  GLU A CB  1 
ATOM   1108 C CG  . GLU A 1 172 ? 26.433 -29.023 8.486   1.00 34.03 ? 171  GLU A CG  1 
ATOM   1109 C CD  . GLU A 1 172 ? 25.450 -28.008 9.038   1.00 39.19 ? 171  GLU A CD  1 
ATOM   1110 O OE1 . GLU A 1 172 ? 25.567 -26.809 8.718   1.00 42.89 ? 171  GLU A OE1 1 
ATOM   1111 O OE2 . GLU A 1 172 ? 24.544 -28.416 9.783   1.00 44.71 ? 171  GLU A OE2 1 
ATOM   1112 N N   . ASN A 1 173 ? 27.977 -29.308 4.028   1.00 23.74 ? 172  ASN A N   1 
ATOM   1113 C CA  . ASN A 1 173 ? 27.804 -29.469 2.588   1.00 23.60 ? 172  ASN A CA  1 
ATOM   1114 C C   . ASN A 1 173 ? 28.881 -30.288 1.902   1.00 23.61 ? 172  ASN A C   1 
ATOM   1115 O O   . ASN A 1 173 ? 29.055 -30.228 0.673   1.00 22.90 ? 172  ASN A O   1 
ATOM   1116 C CB  . ASN A 1 173 ? 27.640 -28.108 1.936   1.00 24.22 ? 172  ASN A CB  1 
ATOM   1117 C CG  . ASN A 1 173 ? 26.285 -27.521 2.204   1.00 23.76 ? 172  ASN A CG  1 
ATOM   1118 O OD1 . ASN A 1 173 ? 25.326 -28.264 2.416   1.00 25.50 ? 172  ASN A OD1 1 
ATOM   1119 N ND2 . ASN A 1 173 ? 26.185 -26.194 2.189   1.00 21.96 ? 172  ASN A ND2 1 
ATOM   1120 N N   . ILE A 1 174 ? 29.604 -31.067 2.696   1.00 22.13 ? 173  ILE A N   1 
ATOM   1121 C CA  . ILE A 1 174 ? 30.612 -31.960 2.152   1.00 22.24 ? 173  ILE A CA  1 
ATOM   1122 C C   . ILE A 1 174 ? 30.292 -33.371 2.614   1.00 22.93 ? 173  ILE A C   1 
ATOM   1123 O O   . ILE A 1 174 ? 30.189 -33.636 3.829   1.00 22.90 ? 173  ILE A O   1 
ATOM   1124 C CB  . ILE A 1 174 ? 32.010 -31.550 2.629   1.00 22.39 ? 173  ILE A CB  1 
ATOM   1125 C CG1 . ILE A 1 174 ? 32.329 -30.141 2.078   1.00 22.42 ? 173  ILE A CG1 1 
ATOM   1126 C CG2 . ILE A 1 174 ? 33.043 -32.575 2.203   1.00 21.32 ? 173  ILE A CG2 1 
ATOM   1127 C CD1 . ILE A 1 174 ? 33.417 -29.425 2.848   1.00 24.62 ? 173  ILE A CD1 1 
ATOM   1128 N N   . LEU A 1 175 ? 30.134 -34.270 1.655   1.00 22.78 ? 174  LEU A N   1 
ATOM   1129 C CA  . LEU A 1 175 ? 29.898 -35.673 1.977   1.00 24.65 ? 174  LEU A CA  1 
ATOM   1130 C C   . LEU A 1 175 ? 31.161 -36.451 1.790   1.00 25.21 ? 174  LEU A C   1 
ATOM   1131 O O   . LEU A 1 175 ? 31.942 -36.189 0.855   1.00 24.71 ? 174  LEU A O   1 
ATOM   1132 C CB  . LEU A 1 175 ? 28.797 -36.276 1.087   1.00 25.57 ? 174  LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 175 ? 27.419 -35.626 1.224   1.00 26.02 ? 174  LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 175 ? 26.459 -36.388 0.328   1.00 28.43 ? 174  LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 175 ? 26.958 -35.617 2.681   1.00 27.10 ? 174  LEU A CD2 1 
ATOM   1136 N N   . ILE A 1 176 ? 31.381 -37.407 2.687   1.00 25.03 ? 175  ILE A N   1 
ATOM   1137 C CA  . ILE A 1 176 ? 32.531 -38.295 2.566   1.00 25.14 ? 175  ILE A CA  1 
ATOM   1138 C C   . ILE A 1 176 ? 32.077 -39.689 2.099   1.00 27.74 ? 175  ILE A C   1 
ATOM   1139 O O   . ILE A 1 176 ? 31.285 -40.352 2.775   1.00 27.27 ? 175  ILE A O   1 
ATOM   1140 C CB  . ILE A 1 176 ? 33.323 -38.398 3.893   1.00 24.75 ? 175  ILE A CB  1 
ATOM   1141 C CG1 . ILE A 1 176 ? 33.738 -37.013 4.407   1.00 27.28 ? 175  ILE A CG1 1 
ATOM   1142 C CG2 . ILE A 1 176 ? 34.536 -39.315 3.725   1.00 25.52 ? 175  ILE A CG2 1 
ATOM   1143 C CD1 . ILE A 1 176 ? 33.956 -36.978 5.913   1.00 27.02 ? 175  ILE A CD1 1 
ATOM   1144 N N   . ASP A 1 177 ? 32.564 -40.112 0.933   1.00 28.89 ? 176  ASP A N   1 
ATOM   1145 C CA  . ASP A 1 177 ? 32.380 -41.477 0.459   1.00 31.06 ? 176  ASP A CA  1 
ATOM   1146 C C   . ASP A 1 177 ? 33.400 -42.283 1.259   1.00 32.39 ? 176  ASP A C   1 
ATOM   1147 O O   . ASP A 1 177 ? 34.599 -42.279 0.964   1.00 32.34 ? 176  ASP A O   1 
ATOM   1148 C CB  . ASP A 1 177 ? 32.611 -41.540 -1.066  1.00 33.40 ? 176  ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 177 ? 32.465 -42.953 -1.652  1.00 35.84 ? 176  ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 177 ? 32.534 -43.932 -0.901  1.00 40.52 ? 176  ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 177 ? 32.335 -43.076 -2.884  1.00 37.07 ? 176  ASP A OD2 1 
ATOM   1152 N N   . LEU A 1 178 ? 32.920 -42.905 2.330   1.00 32.80 ? 177  LEU A N   1 
ATOM   1153 C CA  . LEU A 1 178 ? 33.786 -43.547 3.322   1.00 34.90 ? 177  LEU A CA  1 
ATOM   1154 C C   . LEU A 1 178 ? 34.641 -44.696 2.767   1.00 37.03 ? 177  LEU A C   1 
ATOM   1155 O O   . LEU A 1 178 ? 35.770 -44.895 3.218   1.00 41.03 ? 177  LEU A O   1 
ATOM   1156 C CB  . LEU A 1 178 ? 32.969 -44.010 4.533   1.00 35.71 ? 177  LEU A CB  1 
ATOM   1157 C CG  . LEU A 1 178 ? 32.326 -42.927 5.406   1.00 37.00 ? 177  LEU A CG  1 
ATOM   1158 C CD1 . LEU A 1 178 ? 31.203 -43.527 6.255   1.00 38.47 ? 177  LEU A CD1 1 
ATOM   1159 C CD2 . LEU A 1 178 ? 33.355 -42.195 6.271   1.00 35.50 ? 177  LEU A CD2 1 
ATOM   1160 N N   . ASN A 1 179 ? 34.117 -45.434 1.788   1.00 36.85 ? 178  ASN A N   1 
ATOM   1161 C CA  . ASN A 1 179 ? 34.873 -46.534 1.175   1.00 37.44 ? 178  ASN A CA  1 
ATOM   1162 C C   . ASN A 1 179 ? 36.015 -46.049 0.296   1.00 35.76 ? 178  ASN A C   1 
ATOM   1163 O O   . ASN A 1 179 ? 37.099 -46.628 0.298   1.00 32.35 ? 178  ASN A O   1 
ATOM   1164 C CB  . ASN A 1 179 ? 33.959 -47.446 0.347   1.00 40.21 ? 178  ASN A CB  1 
ATOM   1165 C CG  . ASN A 1 179 ? 33.146 -48.402 1.209   1.00 46.30 ? 178  ASN A CG  1 
ATOM   1166 O OD1 . ASN A 1 179 ? 33.437 -48.602 2.387   1.00 46.59 ? 178  ASN A OD1 1 
ATOM   1167 N ND2 . ASN A 1 179 ? 32.117 -48.997 0.617   1.00 49.12 ? 178  ASN A ND2 1 
ATOM   1168 N N   . ARG A 1 180 ? 35.759 -44.977 -0.443  1.00 32.76 ? 179  ARG A N   1 
ATOM   1169 C CA  . ARG A 1 180 ? 36.695 -44.502 -1.451  1.00 33.78 ? 179  ARG A CA  1 
ATOM   1170 C C   . ARG A 1 180 ? 37.585 -43.347 -0.978  1.00 31.47 ? 179  ARG A C   1 
ATOM   1171 O O   . ARG A 1 180 ? 38.561 -42.986 -1.651  1.00 31.29 ? 179  ARG A O   1 
ATOM   1172 C CB  . ARG A 1 180 ? 35.916 -44.107 -2.696  1.00 34.75 ? 179  ARG A CB  1 
ATOM   1173 C CG  . ARG A 1 180 ? 35.235 -45.284 -3.365  1.00 38.08 ? 179  ARG A CG  1 
ATOM   1174 C CD  . ARG A 1 180 ? 34.835 -44.922 -4.773  1.00 41.55 ? 179  ARG A CD  1 
ATOM   1175 N NE  . ARG A 1 180 ? 34.332 -46.070 -5.533  1.00 47.02 ? 179  ARG A NE  1 
ATOM   1176 C CZ  . ARG A 1 180 ? 35.085 -46.981 -6.155  1.00 48.35 ? 179  ARG A CZ  1 
ATOM   1177 N NH1 . ARG A 1 180 ? 36.414 -46.935 -6.116  1.00 47.79 ? 179  ARG A NH1 1 
ATOM   1178 N NH2 . ARG A 1 180 ? 34.496 -47.961 -6.829  1.00 49.81 ? 179  ARG A NH2 1 
ATOM   1179 N N   . GLY A 1 181 ? 37.248 -42.775 0.175   1.00 30.28 ? 180  GLY A N   1 
ATOM   1180 C CA  . GLY A 1 181 ? 37.975 -41.607 0.701   1.00 30.02 ? 180  GLY A CA  1 
ATOM   1181 C C   . GLY A 1 181 ? 37.754 -40.353 -0.155  1.00 30.76 ? 180  GLY A C   1 
ATOM   1182 O O   . GLY A 1 181 ? 38.587 -39.445 -0.167  1.00 30.13 ? 180  GLY A O   1 
ATOM   1183 N N   . GLU A 1 182 ? 36.631 -40.314 -0.862  1.00 28.28 ? 181  GLU A N   1 
ATOM   1184 C CA  . GLU A 1 182 ? 36.311 -39.208 -1.780  1.00 28.62 ? 181  GLU A CA  1 
ATOM   1185 C C   . GLU A 1 182 ? 35.262 -38.293 -1.189  1.00 28.36 ? 181  GLU A C   1 
ATOM   1186 O O   . GLU A 1 182 ? 34.247 -38.759 -0.660  1.00 29.21 ? 181  GLU A O   1 
ATOM   1187 C CB  . GLU A 1 182 ? 35.849 -39.745 -3.143  1.00 28.83 ? 181  GLU A CB  1 
ATOM   1188 C CG  . GLU A 1 182 ? 36.956 -40.486 -3.872  1.00 30.22 ? 181  GLU A CG  1 
ATOM   1189 C CD  . GLU A 1 182 ? 36.512 -41.154 -5.166  1.00 32.21 ? 181  GLU A CD  1 
ATOM   1190 O OE1 . GLU A 1 182 ? 35.379 -40.929 -5.624  1.00 32.98 ? 181  GLU A OE1 1 
ATOM   1191 O OE2 . GLU A 1 182 ? 37.333 -41.888 -5.748  1.00 33.10 ? 181  GLU A OE2 1 
ATOM   1192 N N   . LEU A 1 183 ? 35.512 -36.985 -1.273  1.00 25.98 ? 182  LEU A N   1 
ATOM   1193 C CA  . LEU A 1 183 ? 34.566 -35.991 -0.798  1.00 25.10 ? 182  LEU A CA  1 
ATOM   1194 C C   . LEU A 1 183 ? 33.741 -35.471 -1.950  1.00 26.09 ? 182  LEU A C   1 
ATOM   1195 O O   . LEU A 1 183 ? 34.220 -35.395 -3.092  1.00 26.51 ? 182  LEU A O   1 
ATOM   1196 C CB  . LEU A 1 183 ? 35.304 -34.831 -0.120  1.00 25.21 ? 182  LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 183 ? 35.635 -35.016 1.360   1.00 26.12 ? 182  LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 183 ? 36.330 -36.336 1.630   1.00 28.19 ? 182  LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 183 ? 36.473 -33.836 1.841   1.00 26.59 ? 182  LEU A CD2 1 
ATOM   1200 N N   . LYS A 1 184 ? 32.492 -35.142 -1.652  1.00 24.76 ? 183  LYS A N   1 
ATOM   1201 C CA  . LYS A 1 184 ? 31.572 -34.615 -2.636  1.00 26.17 ? 183  LYS A CA  1 
ATOM   1202 C C   . LYS A 1 184 ? 30.914 -33.369 -2.102  1.00 24.07 ? 183  LYS A C   1 
ATOM   1203 O O   . LYS A 1 184 ? 30.395 -33.355 -0.979  1.00 23.98 ? 183  LYS A O   1 
ATOM   1204 C CB  . LYS A 1 184 ? 30.477 -35.626 -2.966  1.00 29.19 ? 183  LYS A CB  1 
ATOM   1205 C CG  . LYS A 1 184 ? 30.980 -36.927 -3.542  1.00 34.66 ? 183  LYS A CG  1 
ATOM   1206 C CD  . LYS A 1 184 ? 30.077 -37.375 -4.677  1.00 40.16 ? 183  LYS A CD  1 
ATOM   1207 C CE  . LYS A 1 184 ? 30.496 -38.746 -5.189  1.00 41.17 ? 183  LYS A CE  1 
ATOM   1208 N NZ  . LYS A 1 184 ? 31.870 -38.718 -5.760  1.00 42.08 ? 183  LYS A NZ  1 
ATOM   1209 N N   . LEU A 1 185 ? 30.916 -32.320 -2.911  1.00 22.38 ? 184  LEU A N   1 
ATOM   1210 C CA  . LEU A 1 185 ? 30.285 -31.075 -2.533  1.00 23.25 ? 184  LEU A CA  1 
ATOM   1211 C C   . LEU A 1 185 ? 28.811 -31.192 -2.845  1.00 24.03 ? 184  LEU A C   1 
ATOM   1212 O O   . LEU A 1 185 ? 28.441 -31.603 -3.946  1.00 25.62 ? 184  LEU A O   1 
ATOM   1213 C CB  . LEU A 1 185 ? 30.904 -29.919 -3.334  1.00 25.26 ? 184  LEU A CB  1 
ATOM   1214 C CG  . LEU A 1 185 ? 30.592 -28.463 -3.042  1.00 28.21 ? 184  LEU A CG  1 
ATOM   1215 C CD1 . LEU A 1 185 ? 30.874 -28.098 -1.586  1.00 27.02 ? 184  LEU A CD1 1 
ATOM   1216 C CD2 . LEU A 1 185 ? 31.435 -27.595 -3.986  1.00 28.29 ? 184  LEU A CD2 1 
ATOM   1217 N N   . ILE A 1 186 ? 27.966 -30.830 -1.888  1.00 22.79 ? 185  ILE A N   1 
ATOM   1218 C CA  . ILE A 1 186 ? 26.522 -30.869 -2.113  1.00 24.63 ? 185  ILE A CA  1 
ATOM   1219 C C   . ILE A 1 186 ? 25.874 -29.526 -1.862  1.00 23.84 ? 185  ILE A C   1 
ATOM   1220 O O   . ILE A 1 186 ? 26.489 -28.615 -1.318  1.00 23.74 ? 185  ILE A O   1 
ATOM   1221 C CB  . ILE A 1 186 ? 25.826 -31.900 -1.185  1.00 24.55 ? 185  ILE A CB  1 
ATOM   1222 C CG1 . ILE A 1 186 ? 26.061 -31.523 0.288   1.00 23.99 ? 185  ILE A CG1 1 
ATOM   1223 C CG2 . ILE A 1 186 ? 26.303 -33.305 -1.523  1.00 24.01 ? 185  ILE A CG2 1 
ATOM   1224 C CD1 . ILE A 1 186 ? 25.153 -32.255 1.282   1.00 24.05 ? 185  ILE A CD1 1 
ATOM   1225 N N   . ASP A 1 187 ? 24.614 -29.437 -2.278  1.00 24.38 ? 186  ASP A N   1 
ATOM   1226 C CA  . ASP A 1 187 ? 23.735 -28.297 -2.064  1.00 25.25 ? 186  ASP A CA  1 
ATOM   1227 C C   . ASP A 1 187 ? 24.152 -26.995 -2.758  1.00 25.76 ? 186  ASP A C   1 
ATOM   1228 O O   . ASP A 1 187 ? 24.793 -26.119 -2.167  1.00 24.86 ? 186  ASP A O   1 
ATOM   1229 C CB  . ASP A 1 187 ? 23.465 -28.048 -0.582  1.00 26.19 ? 186  ASP A CB  1 
ATOM   1230 C CG  . ASP A 1 187 ? 22.181 -27.258 -0.362  1.00 28.07 ? 186  ASP A CG  1 
ATOM   1231 O OD1 . ASP A 1 187 ? 21.690 -26.599 -1.309  1.00 29.79 ? 186  ASP A OD1 1 
ATOM   1232 O OD2 . ASP A 1 187 ? 21.651 -27.309 0.751   1.00 28.19 ? 186  ASP A OD2 1 
ATOM   1233 N N   . PHE A 1 188 ? 23.703 -26.847 -3.989  1.00 24.86 ? 187  PHE A N   1 
ATOM   1234 C CA  . PHE A 1 188 ? 23.920 -25.607 -4.712  1.00 26.94 ? 187  PHE A CA  1 
ATOM   1235 C C   . PHE A 1 188 ? 22.721 -24.677 -4.618  1.00 28.45 ? 187  PHE A C   1 
ATOM   1236 O O   . PHE A 1 188 ? 22.539 -23.808 -5.468  1.00 28.92 ? 187  PHE A O   1 
ATOM   1237 C CB  . PHE A 1 188 ? 24.310 -25.908 -6.157  1.00 28.54 ? 187  PHE A CB  1 
ATOM   1238 C CG  . PHE A 1 188 ? 25.674 -26.500 -6.279  1.00 28.18 ? 187  PHE A CG  1 
ATOM   1239 C CD1 . PHE A 1 188 ? 25.926 -27.820 -5.876  1.00 28.76 ? 187  PHE A CD1 1 
ATOM   1240 C CD2 . PHE A 1 188 ? 26.733 -25.739 -6.782  1.00 28.05 ? 187  PHE A CD2 1 
ATOM   1241 C CE1 . PHE A 1 188 ? 27.200 -28.363 -5.972  1.00 29.50 ? 187  PHE A CE1 1 
ATOM   1242 C CE2 . PHE A 1 188 ? 28.003 -26.285 -6.879  1.00 26.70 ? 187  PHE A CE2 1 
ATOM   1243 C CZ  . PHE A 1 188 ? 28.246 -27.591 -6.480  1.00 28.39 ? 187  PHE A CZ  1 
ATOM   1244 N N   . GLY A 1 189 ? 21.923 -24.841 -3.557  1.00 27.23 ? 188  GLY A N   1 
ATOM   1245 C CA  . GLY A 1 189 ? 20.710 -24.036 -3.369  1.00 29.04 ? 188  GLY A CA  1 
ATOM   1246 C C   . GLY A 1 189 ? 20.917 -22.576 -3.012  1.00 29.71 ? 188  GLY A C   1 
ATOM   1247 O O   . GLY A 1 189 ? 19.974 -21.795 -3.048  1.00 28.76 ? 188  GLY A O   1 
ATOM   1248 N N   . SER A 1 190 ? 22.146 -22.206 -2.654  1.00 28.12 ? 189  SER A N   1 
ATOM   1249 C CA  . SER A 1 190 ? 22.488 -20.812 -2.373  1.00 28.16 ? 189  SER A CA  1 
ATOM   1250 C C   . SER A 1 190 ? 23.504 -20.326 -3.398  1.00 27.06 ? 189  SER A C   1 
ATOM   1251 O O   . SER A 1 190 ? 24.078 -19.245 -3.257  1.00 29.18 ? 189  SER A O   1 
ATOM   1252 C CB  . SER A 1 190 ? 23.110 -20.675 -0.981  1.00 29.61 ? 189  SER A CB  1 
ATOM   1253 O OG  . SER A 1 190 ? 22.360 -21.376 -0.009  1.00 32.89 ? 189  SER A OG  1 
ATOM   1254 N N   . GLY A 1 191 ? 23.731 -21.134 -4.421  1.00 26.21 ? 190  GLY A N   1 
ATOM   1255 C CA  . GLY A 1 191 ? 24.778 -20.846 -5.403  1.00 28.03 ? 190  GLY A CA  1 
ATOM   1256 C C   . GLY A 1 191 ? 24.363 -19.795 -6.406  1.00 28.12 ? 190  GLY A C   1 
ATOM   1257 O O   . GLY A 1 191 ? 23.256 -19.263 -6.347  1.00 29.04 ? 190  GLY A O   1 
ATOM   1258 N N   . ALA A 1 192 ? 25.256 -19.495 -7.341  1.00 27.61 ? 191  ALA A N   1 
ATOM   1259 C CA  . ALA A 1 192 ? 24.957 -18.506 -8.366  1.00 27.83 ? 191  ALA A CA  1 
ATOM   1260 C C   . ALA A 1 192 ? 25.878 -18.767 -9.523  1.00 26.82 ? 191  ALA A C   1 
ATOM   1261 O O   . ALA A 1 192 ? 26.874 -19.476 -9.379  1.00 26.63 ? 191  ALA A O   1 
ATOM   1262 C CB  . ALA A 1 192 ? 25.176 -17.094 -7.825  1.00 26.71 ? 191  ALA A CB  1 
ATOM   1263 N N   . LEU A 1 193 ? 25.544 -18.219 -10.687 1.00 26.72 ? 192  LEU A N   1 
ATOM   1264 C CA  . LEU A 1 193 ? 26.506 -18.207 -11.768 1.00 27.52 ? 192  LEU A CA  1 
ATOM   1265 C C   . LEU A 1 193 ? 27.704 -17.410 -11.283 1.00 26.38 ? 192  LEU A C   1 
ATOM   1266 O O   . LEU A 1 193 ? 27.542 -16.392 -10.614 1.00 27.93 ? 192  LEU A O   1 
ATOM   1267 C CB  . LEU A 1 193 ? 25.909 -17.592 -13.045 1.00 29.19 ? 192  LEU A CB  1 
ATOM   1268 C CG  . LEU A 1 193 ? 24.681 -18.303 -13.614 1.00 30.94 ? 192  LEU A CG  1 
ATOM   1269 C CD1 . LEU A 1 193 ? 24.115 -17.547 -14.825 1.00 34.10 ? 192  LEU A CD1 1 
ATOM   1270 C CD2 . LEU A 1 193 ? 25.020 -19.734 -14.005 1.00 30.40 ? 192  LEU A CD2 1 
ATOM   1271 N N   . LEU A 1 194 ? 28.898 -17.914 -11.565 1.00 28.94 ? 193  LEU A N   1 
ATOM   1272 C CA  . LEU A 1 194 ? 30.124 -17.188 -11.241 1.00 29.17 ? 193  LEU A CA  1 
ATOM   1273 C C   . LEU A 1 194 ? 30.200 -15.953 -12.136 1.00 31.05 ? 193  LEU A C   1 
ATOM   1274 O O   . LEU A 1 194 ? 29.935 -16.042 -13.329 1.00 29.60 ? 193  LEU A O   1 
ATOM   1275 C CB  . LEU A 1 194 ? 31.347 -18.065 -11.484 1.00 30.41 ? 193  LEU A CB  1 
ATOM   1276 C CG  . LEU A 1 194 ? 32.714 -17.478 -11.074 1.00 31.18 ? 193  LEU A CG  1 
ATOM   1277 C CD1 . LEU A 1 194 ? 32.755 -17.147 -9.587  1.00 30.99 ? 193  LEU A CD1 1 
ATOM   1278 C CD2 . LEU A 1 194 ? 33.837 -18.433 -11.443 1.00 32.55 ? 193  LEU A CD2 1 
ATOM   1279 N N   . LYS A 1 195 ? 30.549 -14.816 -11.551 1.00 31.65 ? 194  LYS A N   1 
ATOM   1280 C CA  . LYS A 1 195 ? 30.752 -13.572 -12.308 1.00 32.74 ? 194  LYS A CA  1 
ATOM   1281 C C   . LYS A 1 195 ? 31.941 -12.818 -11.710 1.00 33.05 ? 194  LYS A C   1 
ATOM   1282 O O   . LYS A 1 195 ? 32.412 -13.162 -10.615 1.00 32.81 ? 194  LYS A O   1 
ATOM   1283 C CB  . LYS A 1 195 ? 29.487 -12.706 -12.280 1.00 31.98 ? 194  LYS A CB  1 
ATOM   1284 C CG  . LYS A 1 195 ? 29.114 -12.198 -10.900 1.00 30.43 ? 194  LYS A CG  1 
ATOM   1285 C CD  . LYS A 1 195 ? 27.726 -11.579 -10.896 1.00 33.25 ? 194  LYS A CD  1 
ATOM   1286 C CE  . LYS A 1 195 ? 27.515 -10.781 -9.626  1.00 32.15 ? 194  LYS A CE  1 
ATOM   1287 N NZ  . LYS A 1 195 ? 26.132 -10.232 -9.534  1.00 35.81 ? 194  LYS A NZ  1 
ATOM   1288 N N   . ASP A 1 196 ? 32.412 -11.786 -12.409 1.00 30.82 ? 195  ASP A N   1 
ATOM   1289 C CA  . ASP A 1 196 ? 33.596 -11.038 -11.974 1.00 30.93 ? 195  ASP A CA  1 
ATOM   1290 C C   . ASP A 1 196 ? 33.217 -9.738  -11.286 1.00 30.39 ? 195  ASP A C   1 
ATOM   1291 O O   . ASP A 1 196 ? 34.070 -9.022  -10.764 1.00 30.55 ? 195  ASP A O   1 
ATOM   1292 C CB  . ASP A 1 196 ? 34.506 -10.761 -13.172 1.00 32.72 ? 195  ASP A CB  1 
ATOM   1293 C CG  . ASP A 1 196 ? 35.112 -12.024 -13.742 1.00 35.25 ? 195  ASP A CG  1 
ATOM   1294 O OD1 . ASP A 1 196 ? 35.799 -12.717 -12.986 1.00 34.46 ? 195  ASP A OD1 1 
ATOM   1295 O OD2 . ASP A 1 196 ? 34.907 -12.321 -14.942 1.00 35.24 ? 195  ASP A OD2 1 
ATOM   1296 N N   . THR A 1 197 ? 31.927 -9.444  -11.290 1.00 30.87 ? 196  THR A N   1 
ATOM   1297 C CA  . THR A 1 197 ? 31.398 -8.263  -10.639 1.00 32.51 ? 196  THR A CA  1 
ATOM   1298 C C   . THR A 1 197 ? 30.920 -8.615  -9.233  1.00 34.18 ? 196  THR A C   1 
ATOM   1299 O O   . THR A 1 197 ? 30.909 -9.797  -8.838  1.00 32.10 ? 196  THR A O   1 
ATOM   1300 C CB  . THR A 1 197 ? 30.228 -7.698  -11.441 1.00 32.43 ? 196  THR A CB  1 
ATOM   1301 O OG1 . THR A 1 197 ? 29.351 -8.775  -11.788 1.00 33.73 ? 196  THR A OG1 1 
ATOM   1302 C CG2 . THR A 1 197 ? 30.756 -7.050  -12.722 1.00 34.24 ? 196  THR A CG2 1 
ATOM   1303 N N   . VAL A 1 198 ? 30.521 -7.590  -8.493  1.00 31.98 ? 197  VAL A N   1 
ATOM   1304 C CA  . VAL A 1 198 ? 30.206 -7.739  -7.074  1.00 32.63 ? 197  VAL A CA  1 
ATOM   1305 C C   . VAL A 1 198 ? 28.875 -8.470  -6.870  1.00 32.65 ? 197  VAL A C   1 
ATOM   1306 O O   . VAL A 1 198 ? 27.922 -8.283  -7.637  1.00 32.11 ? 197  VAL A O   1 
ATOM   1307 C CB  . VAL A 1 198 ? 30.194 -6.364  -6.371  1.00 33.26 ? 197  VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 198 ? 28.968 -5.536  -6.787  1.00 33.38 ? 197  VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 198 ? 30.256 -6.534  -4.864  1.00 34.40 ? 197  VAL A CG2 1 
ATOM   1310 N N   . TYR A 1 199 ? 28.825 -9.328  -5.854  1.00 30.30 ? 198  TYR A N   1 
ATOM   1311 C CA  . TYR A 1 199 ? 27.562 -9.905  -5.403  1.00 30.30 ? 198  TYR A CA  1 
ATOM   1312 C C   . TYR A 1 199 ? 27.051 -9.064  -4.255  1.00 30.33 ? 198  TYR A C   1 
ATOM   1313 O O   . TYR A 1 199 ? 27.824 -8.644  -3.382  1.00 28.72 ? 198  TYR A O   1 
ATOM   1314 C CB  . TYR A 1 199 ? 27.749 -11.336 -4.902  1.00 27.63 ? 198  TYR A CB  1 
ATOM   1315 C CG  . TYR A 1 199 ? 28.108 -12.326 -5.972  1.00 26.30 ? 198  TYR A CG  1 
ATOM   1316 C CD1 . TYR A 1 199 ? 29.437 -12.507 -6.349  1.00 25.17 ? 198  TYR A CD1 1 
ATOM   1317 C CD2 . TYR A 1 199 ? 27.120 -13.083 -6.608  1.00 25.22 ? 198  TYR A CD2 1 
ATOM   1318 C CE1 . TYR A 1 199 ? 29.780 -13.419 -7.323  1.00 25.32 ? 198  TYR A CE1 1 
ATOM   1319 C CE2 . TYR A 1 199 ? 27.452 -14.004 -7.594  1.00 25.68 ? 198  TYR A CE2 1 
ATOM   1320 C CZ  . TYR A 1 199 ? 28.778 -14.160 -7.946  1.00 25.27 ? 198  TYR A CZ  1 
ATOM   1321 O OH  . TYR A 1 199 ? 29.141 -15.056 -8.902  1.00 26.81 ? 198  TYR A OH  1 
ATOM   1322 N N   . THR A 1 200 ? 25.750 -8.813  -4.251  1.00 31.08 ? 199  THR A N   1 
ATOM   1323 C CA  . THR A 1 200 ? 25.142 -8.022  -3.188  1.00 34.60 ? 199  THR A CA  1 
ATOM   1324 C C   . THR A 1 200 ? 24.017 -8.808  -2.513  1.00 35.79 ? 199  THR A C   1 
ATOM   1325 O O   . THR A 1 200 ? 23.341 -8.300  -1.627  1.00 37.15 ? 199  THR A O   1 
ATOM   1326 C CB  . THR A 1 200 ? 24.612 -6.664  -3.708  1.00 36.25 ? 199  THR A CB  1 
ATOM   1327 O OG1 . THR A 1 200 ? 23.682 -6.895  -4.758  1.00 36.59 ? 199  THR A OG1 1 
ATOM   1328 C CG2 . THR A 1 200 ? 25.750 -5.790  -4.241  1.00 35.71 ? 199  THR A CG2 1 
ATOM   1329 N N   . ASP A 1 201 ? 23.831 -10.048 -2.947  1.00 36.73 ? 200  ASP A N   1 
ATOM   1330 C CA  . ASP A 1 201 ? 22.903 -10.968 -2.318  1.00 39.35 ? 200  ASP A CA  1 
ATOM   1331 C C   . ASP A 1 201 ? 23.714 -12.106 -1.709  1.00 37.31 ? 200  ASP A C   1 
ATOM   1332 O O   . ASP A 1 201 ? 24.775 -12.461 -2.221  1.00 33.98 ? 200  ASP A O   1 
ATOM   1333 C CB  . ASP A 1 201 ? 21.894 -11.522 -3.341  1.00 41.56 ? 200  ASP A CB  1 
ATOM   1334 C CG  . ASP A 1 201 ? 22.536 -12.469 -4.372  1.00 47.29 ? 200  ASP A CG  1 
ATOM   1335 O OD1 . ASP A 1 201 ? 23.444 -12.036 -5.134  1.00 48.55 ? 200  ASP A OD1 1 
ATOM   1336 O OD2 . ASP A 1 201 ? 22.121 -13.655 -4.423  1.00 47.45 ? 200  ASP A OD2 1 
ATOM   1337 N N   . PHE A 1 202 ? 23.218 -12.657 -0.608  1.00 35.47 ? 201  PHE A N   1 
ATOM   1338 C CA  . PHE A 1 202 ? 23.830 -13.826 -0.006  1.00 34.14 ? 201  PHE A CA  1 
ATOM   1339 C C   . PHE A 1 202 ? 22.836 -14.546 0.883   1.00 35.92 ? 201  PHE A C   1 
ATOM   1340 O O   . PHE A 1 202 ? 22.178 -13.925 1.700   1.00 35.90 ? 201  PHE A O   1 
ATOM   1341 C CB  . PHE A 1 202 ? 25.052 -13.425 0.813   1.00 33.03 ? 201  PHE A CB  1 
ATOM   1342 C CG  . PHE A 1 202 ? 25.710 -14.572 1.528   1.00 32.14 ? 201  PHE A CG  1 
ATOM   1343 C CD1 . PHE A 1 202 ? 26.493 -15.486 0.831   1.00 30.80 ? 201  PHE A CD1 1 
ATOM   1344 C CD2 . PHE A 1 202 ? 25.560 -14.725 2.904   1.00 31.87 ? 201  PHE A CD2 1 
ATOM   1345 C CE1 . PHE A 1 202 ? 27.111 -16.543 1.491   1.00 31.24 ? 201  PHE A CE1 1 
ATOM   1346 C CE2 . PHE A 1 202 ? 26.178 -15.774 3.573   1.00 32.09 ? 201  PHE A CE2 1 
ATOM   1347 C CZ  . PHE A 1 202 ? 26.962 -16.678 2.860   1.00 31.46 ? 201  PHE A CZ  1 
ATOM   1348 N N   . ASP A 1 203 ? 22.756 -15.860 0.738   1.00 36.45 ? 202  ASP A N   1 
ATOM   1349 C CA  . ASP A 1 203 ? 21.909 -16.655 1.614   1.00 36.96 ? 202  ASP A CA  1 
ATOM   1350 C C   . ASP A 1 203 ? 22.595 -17.965 1.966   1.00 34.76 ? 202  ASP A C   1 
ATOM   1351 O O   . ASP A 1 203 ? 21.937 -18.965 2.213   1.00 36.23 ? 202  ASP A O   1 
ATOM   1352 C CB  . ASP A 1 203 ? 20.526 -16.895 0.984   1.00 41.77 ? 202  ASP A CB  1 
ATOM   1353 C CG  . ASP A 1 203 ? 19.519 -17.459 1.988   1.00 47.46 ? 202  ASP A CG  1 
ATOM   1354 O OD1 . ASP A 1 203 ? 19.274 -16.811 3.039   1.00 49.05 ? 202  ASP A OD1 1 
ATOM   1355 O OD2 . ASP A 1 203 ? 18.992 -18.563 1.730   1.00 49.27 ? 202  ASP A OD2 1 
ATOM   1356 N N   . GLY A 1 204 ? 23.925 -17.960 1.995   1.00 33.72 ? 203  GLY A N   1 
ATOM   1357 C CA  . GLY A 1 204 ? 24.665 -19.121 2.495   1.00 31.46 ? 203  GLY A CA  1 
ATOM   1358 C C   . GLY A 1 204 ? 24.758 -19.023 4.006   1.00 31.91 ? 203  GLY A C   1 
ATOM   1359 O O   . GLY A 1 204 ? 23.901 -18.411 4.653   1.00 32.63 ? 203  GLY A O   1 
ATOM   1360 N N   . THR A 1 205 ? 25.806 -19.602 4.579   1.00 31.07 ? 204  THR A N   1 
ATOM   1361 C CA  . THR A 1 205 ? 25.895 -19.728 6.033   1.00 29.35 ? 204  THR A CA  1 
ATOM   1362 C C   . THR A 1 205 ? 26.709 -18.585 6.603   1.00 29.84 ? 204  THR A C   1 
ATOM   1363 O O   . THR A 1 205 ? 27.864 -18.393 6.210   1.00 26.60 ? 204  THR A O   1 
ATOM   1364 C CB  . THR A 1 205 ? 26.469 -21.104 6.437   1.00 28.83 ? 204  THR A CB  1 
ATOM   1365 O OG1 . THR A 1 205 ? 25.676 -22.131 5.831   1.00 28.25 ? 204  THR A OG1 1 
ATOM   1366 C CG2 . THR A 1 205 ? 26.438 -21.292 7.958   1.00 29.63 ? 204  THR A CG2 1 
ATOM   1367 N N   . ARG A 1 206 ? 26.112 -17.834 7.536   1.00 30.09 ? 205  ARG A N   1 
ATOM   1368 C CA  . ARG A 1 206 ? 26.711 -16.577 7.994   1.00 31.19 ? 205  ARG A CA  1 
ATOM   1369 C C   . ARG A 1 206 ? 28.101 -16.726 8.612   1.00 29.75 ? 205  ARG A C   1 
ATOM   1370 O O   . ARG A 1 206 ? 28.988 -15.902 8.347   1.00 30.41 ? 205  ARG A O   1 
ATOM   1371 C CB  . ARG A 1 206 ? 25.774 -15.776 8.926   1.00 34.05 ? 205  ARG A CB  1 
ATOM   1372 C CG  . ARG A 1 206 ? 26.384 -14.454 9.400   1.00 38.18 ? 205  ARG A CG  1 
ATOM   1373 C CD  . ARG A 1 206 ? 25.392 -13.497 10.068  1.00 42.08 ? 205  ARG A CD  1 
ATOM   1374 N NE  . ARG A 1 206 ? 24.845 -12.608 9.058   1.00 49.81 ? 205  ARG A NE  1 
ATOM   1375 C CZ  . ARG A 1 206 ? 25.056 -11.299 8.970   1.00 47.42 ? 205  ARG A CZ  1 
ATOM   1376 N NH1 . ARG A 1 206 ? 25.774 -10.651 9.870   1.00 47.44 ? 205  ARG A NH1 1 
ATOM   1377 N NH2 . ARG A 1 206 ? 24.511 -10.631 7.970   1.00 51.22 ? 205  ARG A NH2 1 
ATOM   1378 N N   . VAL A 1 207 ? 28.303 -17.766 9.419   1.00 27.38 ? 206  VAL A N   1 
ATOM   1379 C CA  . VAL A 1 207 ? 29.589 -17.942 10.102  1.00 27.59 ? 206  VAL A CA  1 
ATOM   1380 C C   . VAL A 1 207 ? 30.711 -18.366 9.144   1.00 26.72 ? 206  VAL A C   1 
ATOM   1381 O O   . VAL A 1 207 ? 31.876 -18.407 9.536   1.00 27.53 ? 206  VAL A O   1 
ATOM   1382 C CB  . VAL A 1 207 ? 29.496 -18.942 11.287  1.00 27.73 ? 206  VAL A CB  1 
ATOM   1383 C CG1 . VAL A 1 207 ? 28.707 -18.326 12.438  1.00 28.64 ? 206  VAL A CG1 1 
ATOM   1384 C CG2 . VAL A 1 207 ? 28.880 -20.271 10.837  1.00 27.76 ? 206  VAL A CG2 1 
ATOM   1385 N N   . TYR A 1 208 ? 30.358 -18.678 7.895   1.00 27.11 ? 207  TYR A N   1 
ATOM   1386 C CA  . TYR A 1 208 ? 31.368 -18.936 6.854   1.00 26.64 ? 207  TYR A CA  1 
ATOM   1387 C C   . TYR A 1 208 ? 31.486 -17.772 5.881   1.00 26.20 ? 207  TYR A C   1 
ATOM   1388 O O   . TYR A 1 208 ? 32.270 -17.836 4.928   1.00 25.41 ? 207  TYR A O   1 
ATOM   1389 C CB  . TYR A 1 208 ? 31.010 -20.184 6.055   1.00 25.40 ? 207  TYR A CB  1 
ATOM   1390 C CG  . TYR A 1 208 ? 31.291 -21.512 6.739   1.00 27.15 ? 207  TYR A CG  1 
ATOM   1391 C CD1 . TYR A 1 208 ? 30.437 -22.015 7.735   1.00 26.93 ? 207  TYR A CD1 1 
ATOM   1392 C CD2 . TYR A 1 208 ? 32.387 -22.291 6.348   1.00 25.87 ? 207  TYR A CD2 1 
ATOM   1393 C CE1 . TYR A 1 208 ? 30.691 -23.245 8.345   1.00 28.00 ? 207  TYR A CE1 1 
ATOM   1394 C CE2 . TYR A 1 208 ? 32.648 -23.516 6.954   1.00 27.09 ? 207  TYR A CE2 1 
ATOM   1395 C CZ  . TYR A 1 208 ? 31.792 -23.989 7.947   1.00 28.08 ? 207  TYR A CZ  1 
ATOM   1396 O OH  . TYR A 1 208 ? 32.062 -25.225 8.511   1.00 29.84 ? 207  TYR A OH  1 
ATOM   1397 N N   . SER A 1 209 ? 30.693 -16.729 6.095   1.00 27.15 ? 208  SER A N   1 
ATOM   1398 C CA  . SER A 1 209 ? 30.650 -15.606 5.169   1.00 26.24 ? 208  SER A CA  1 
ATOM   1399 C C   . SER A 1 209 ? 31.725 -14.581 5.534   1.00 26.96 ? 208  SER A C   1 
ATOM   1400 O O   . SER A 1 209 ? 32.096 -14.455 6.697   1.00 27.08 ? 208  SER A O   1 
ATOM   1401 C CB  . SER A 1 209 ? 29.253 -14.977 5.140   1.00 27.25 ? 208  SER A CB  1 
ATOM   1402 O OG  . SER A 1 209 ? 29.082 -14.091 6.225   1.00 29.30 ? 208  SER A OG  1 
ATOM   1403 N N   . PRO A 1 210 ? 32.255 -13.868 4.530   1.00 25.85 ? 209  PRO A N   1 
ATOM   1404 C CA  . PRO A 1 210 ? 33.420 -13.052 4.754   1.00 25.50 ? 209  PRO A CA  1 
ATOM   1405 C C   . PRO A 1 210 ? 33.080 -11.692 5.380   1.00 26.04 ? 209  PRO A C   1 
ATOM   1406 O O   . PRO A 1 210 ? 31.911 -11.280 5.374   1.00 27.01 ? 209  PRO A O   1 
ATOM   1407 C CB  . PRO A 1 210 ? 33.973 -12.874 3.334   1.00 25.61 ? 209  PRO A CB  1 
ATOM   1408 C CG  . PRO A 1 210 ? 32.738 -12.809 2.493   1.00 25.34 ? 209  PRO A CG  1 
ATOM   1409 C CD  . PRO A 1 210 ? 31.793 -13.801 3.127   1.00 26.01 ? 209  PRO A CD  1 
ATOM   1410 N N   . PRO A 1 211 ? 34.097 -10.999 5.911   1.00 25.99 ? 210  PRO A N   1 
ATOM   1411 C CA  . PRO A 1 211 ? 33.910 -9.726  6.602   1.00 26.61 ? 210  PRO A CA  1 
ATOM   1412 C C   . PRO A 1 211 ? 33.300 -8.658  5.698   1.00 27.31 ? 210  PRO A C   1 
ATOM   1413 O O   . PRO A 1 211 ? 32.509 -7.845  6.180   1.00 28.67 ? 210  PRO A O   1 
ATOM   1414 C CB  . PRO A 1 211 ? 35.333 -9.322  7.010   1.00 28.30 ? 210  PRO A CB  1 
ATOM   1415 C CG  . PRO A 1 211 ? 36.255 -10.180 6.211   1.00 28.95 ? 210  PRO A CG  1 
ATOM   1416 C CD  . PRO A 1 211 ? 35.499 -11.454 5.964   1.00 26.22 ? 210  PRO A CD  1 
ATOM   1417 N N   . GLU A 1 212 ? 33.644 -8.680  4.407   1.00 25.83 ? 211  GLU A N   1 
ATOM   1418 C CA  . GLU A 1 212 ? 33.094 -7.713  3.450   1.00 26.51 ? 211  GLU A CA  1 
ATOM   1419 C C   . GLU A 1 212 ? 31.587 -7.888  3.282   1.00 26.23 ? 211  GLU A C   1 
ATOM   1420 O O   . GLU A 1 212 ? 30.868 -6.915  3.084   1.00 29.54 ? 211  GLU A O   1 
ATOM   1421 C CB  . GLU A 1 212 ? 33.830 -7.741  2.094   1.00 26.92 ? 211  GLU A CB  1 
ATOM   1422 C CG  . GLU A 1 212 ? 33.755 -9.069  1.325   1.00 25.91 ? 211  GLU A CG  1 
ATOM   1423 C CD  . GLU A 1 212 ? 34.854 -10.074 1.706   1.00 26.82 ? 211  GLU A CD  1 
ATOM   1424 O OE1 . GLU A 1 212 ? 35.439 -9.976  2.817   1.00 28.05 ? 211  GLU A OE1 1 
ATOM   1425 O OE2 . GLU A 1 212 ? 35.152 -10.966 0.873   1.00 25.37 ? 211  GLU A OE2 1 
ATOM   1426 N N   . TRP A 1 213 ? 31.103 -9.123  3.378   1.00 26.71 ? 212  TRP A N   1 
ATOM   1427 C CA  . TRP A 1 213 ? 29.666 -9.360  3.361   1.00 28.55 ? 212  TRP A CA  1 
ATOM   1428 C C   . TRP A 1 213 ? 29.049 -8.835  4.628   1.00 30.26 ? 212  TRP A C   1 
ATOM   1429 O O   . TRP A 1 213 ? 28.039 -8.121  4.588   1.00 31.13 ? 212  TRP A O   1 
ATOM   1430 C CB  . TRP A 1 213 ? 29.321 -10.835 3.189   1.00 28.97 ? 212  TRP A CB  1 
ATOM   1431 C CG  . TRP A 1 213 ? 27.861 -11.068 3.492   1.00 28.93 ? 212  TRP A CG  1 
ATOM   1432 C CD1 . TRP A 1 213 ? 27.314 -11.688 4.614   1.00 31.44 ? 212  TRP A CD1 1 
ATOM   1433 C CD2 . TRP A 1 213 ? 26.707 -10.638 2.693   1.00 30.28 ? 212  TRP A CD2 1 
ATOM   1434 N NE1 . TRP A 1 213 ? 25.945 -11.692 4.553   1.00 31.33 ? 212  TRP A NE1 1 
ATOM   1435 C CE2 . TRP A 1 213 ? 25.514 -11.064 3.434   1.00 31.19 ? 212  TRP A CE2 1 
ATOM   1436 C CE3 . TRP A 1 213 ? 26.547 -9.967  1.481   1.00 31.43 ? 212  TRP A CE3 1 
ATOM   1437 C CZ2 . TRP A 1 213 ? 24.231 -10.822 2.965   1.00 31.81 ? 212  TRP A CZ2 1 
ATOM   1438 C CZ3 . TRP A 1 213 ? 25.242 -9.732  1.014   1.00 31.43 ? 212  TRP A CZ3 1 
ATOM   1439 C CH2 . TRP A 1 213 ? 24.118 -10.143 1.744   1.00 32.80 ? 212  TRP A CH2 1 
ATOM   1440 N N   . ILE A 1 214 ? 29.640 -9.196  5.767   1.00 29.62 ? 213  ILE A N   1 
ATOM   1441 C CA  . ILE A 1 214 ? 29.141 -8.723  7.063   1.00 32.88 ? 213  ILE A CA  1 
ATOM   1442 C C   . ILE A 1 214 ? 29.069 -7.190  7.110   1.00 32.84 ? 213  ILE A C   1 
ATOM   1443 O O   . ILE A 1 214 ? 28.031 -6.632  7.430   1.00 35.49 ? 213  ILE A O   1 
ATOM   1444 C CB  . ILE A 1 214 ? 29.973 -9.267  8.250   1.00 31.26 ? 213  ILE A CB  1 
ATOM   1445 C CG1 . ILE A 1 214 ? 30.119 -10.804 8.172   1.00 31.14 ? 213  ILE A CG1 1 
ATOM   1446 C CG2 . ILE A 1 214 ? 29.381 -8.794  9.585   1.00 32.69 ? 213  ILE A CG2 1 
ATOM   1447 C CD1 . ILE A 1 214 ? 28.869 -11.615 8.458   1.00 33.84 ? 213  ILE A CD1 1 
ATOM   1448 N N   . ARG A 1 215 ? 30.162 -6.525  6.752   1.00 35.72 ? 214  ARG A N   1 
ATOM   1449 C CA  . ARG A 1 215 ? 30.249 -5.068  6.844   1.00 37.92 ? 214  ARG A CA  1 
ATOM   1450 C C   . ARG A 1 215 ? 29.460 -4.353  5.764   1.00 39.24 ? 214  ARG A C   1 
ATOM   1451 O O   . ARG A 1 215 ? 28.736 -3.405  6.061   1.00 41.44 ? 214  ARG A O   1 
ATOM   1452 C CB  . ARG A 1 215 ? 31.699 -4.606  6.763   1.00 39.90 ? 214  ARG A CB  1 
ATOM   1453 C CG  . ARG A 1 215 ? 32.477 -4.775  8.048   1.00 45.75 ? 214  ARG A CG  1 
ATOM   1454 C CD  . ARG A 1 215 ? 33.969 -4.701  7.782   1.00 51.47 ? 214  ARG A CD  1 
ATOM   1455 N NE  . ARG A 1 215 ? 34.429 -3.323  7.645   1.00 57.39 ? 214  ARG A NE  1 
ATOM   1456 C CZ  . ARG A 1 215 ? 34.968 -2.610  8.630   1.00 63.64 ? 214  ARG A CZ  1 
ATOM   1457 N NH1 . ARG A 1 215 ? 35.120 -3.139  9.840   1.00 65.21 ? 214  ARG A NH1 1 
ATOM   1458 N NH2 . ARG A 1 215 ? 35.359 -1.362  8.405   1.00 64.07 ? 214  ARG A NH2 1 
ATOM   1459 N N   . TYR A 1 216 ? 29.599 -4.807  4.519   1.00 35.65 ? 215  TYR A N   1 
ATOM   1460 C CA  . TYR A 1 216 ? 29.183 -4.009  3.367   1.00 35.68 ? 215  TYR A CA  1 
ATOM   1461 C C   . TYR A 1 216 ? 28.108 -4.649  2.507   1.00 34.90 ? 215  TYR A C   1 
ATOM   1462 O O   . TYR A 1 216 ? 27.617 -4.015  1.580   1.00 34.26 ? 215  TYR A O   1 
ATOM   1463 C CB  . TYR A 1 216 ? 30.400 -3.667  2.491   1.00 38.62 ? 215  TYR A CB  1 
ATOM   1464 C CG  . TYR A 1 216 ? 31.543 -3.032  3.241   1.00 41.76 ? 215  TYR A CG  1 
ATOM   1465 C CD1 . TYR A 1 216 ? 31.377 -1.815  3.912   1.00 45.03 ? 215  TYR A CD1 1 
ATOM   1466 C CD2 . TYR A 1 216 ? 32.797 -3.637  3.274   1.00 44.02 ? 215  TYR A CD2 1 
ATOM   1467 C CE1 . TYR A 1 216 ? 32.422 -1.231  4.606   1.00 46.69 ? 215  TYR A CE1 1 
ATOM   1468 C CE2 . TYR A 1 216 ? 33.852 -3.058  3.961   1.00 45.99 ? 215  TYR A CE2 1 
ATOM   1469 C CZ  . TYR A 1 216 ? 33.661 -1.858  4.622   1.00 48.14 ? 215  TYR A CZ  1 
ATOM   1470 O OH  . TYR A 1 216 ? 34.711 -1.289  5.305   1.00 53.08 ? 215  TYR A OH  1 
ATOM   1471 N N   . HIS A 1 217 ? 27.740 -5.895  2.800   1.00 33.77 ? 216  HIS A N   1 
ATOM   1472 C CA  . HIS A 1 217 ? 26.796 -6.627  1.941   1.00 36.87 ? 216  HIS A CA  1 
ATOM   1473 C C   . HIS A 1 217 ? 27.292 -6.698  0.515   1.00 33.03 ? 216  HIS A C   1 
ATOM   1474 O O   . HIS A 1 217 ? 26.524 -6.634  -0.444  1.00 32.08 ? 216  HIS A O   1 
ATOM   1475 C CB  . HIS A 1 217 ? 25.390 -6.018  2.012   1.00 40.41 ? 216  HIS A CB  1 
ATOM   1476 C CG  . HIS A 1 217 ? 24.553 -6.545  3.152   1.00 48.01 ? 216  HIS A CG  1 
ATOM   1477 N ND1 . HIS A 1 217 ? 25.079 -6.871  4.354   1.00 50.89 ? 216  HIS A ND1 1 
ATOM   1478 C CD2 . HIS A 1 217 ? 23.183 -6.789  3.243   1.00 50.67 ? 216  HIS A CD2 1 
ATOM   1479 C CE1 . HIS A 1 217 ? 24.100 -7.308  5.168   1.00 53.07 ? 216  HIS A CE1 1 
ATOM   1480 N NE2 . HIS A 1 217 ? 22.940 -7.258  4.488   1.00 56.09 ? 216  HIS A NE2 1 
ATOM   1481 N N   . ARG A 1 218 ? 28.598 -6.848  0.367   1.00 30.96 ? 217  ARG A N   1 
ATOM   1482 C CA  . ARG A 1 218 ? 29.216 -6.919  -0.947  1.00 31.22 ? 217  ARG A CA  1 
ATOM   1483 C C   . ARG A 1 218 ? 30.367 -7.892  -0.880  1.00 28.94 ? 217  ARG A C   1 
ATOM   1484 O O   . ARG A 1 218 ? 31.111 -7.887  0.092   1.00 29.60 ? 217  ARG A O   1 
ATOM   1485 C CB  . ARG A 1 218 ? 29.785 -5.548  -1.322  1.00 31.16 ? 217  ARG A CB  1 
ATOM   1486 C CG  . ARG A 1 218 ? 28.758 -4.444  -1.528  1.00 33.89 ? 217  ARG A CG  1 
ATOM   1487 C CD  . ARG A 1 218 ? 29.444 -3.084  -1.710  1.00 36.35 ? 217  ARG A CD  1 
ATOM   1488 N NE  . ARG A 1 218 ? 30.393 -3.079  -2.829  1.00 36.09 ? 217  ARG A NE  1 
ATOM   1489 C CZ  . ARG A 1 218 ? 30.069 -2.805  -4.092  1.00 36.87 ? 217  ARG A CZ  1 
ATOM   1490 N NH1 . ARG A 1 218 ? 28.814 -2.518  -4.408  1.00 35.43 ? 217  ARG A NH1 1 
ATOM   1491 N NH2 . ARG A 1 218 ? 31.004 -2.827  -5.041  1.00 37.28 ? 217  ARG A NH2 1 
ATOM   1492 N N   . TYR A 1 219 ? 30.518 -8.728  -1.904  1.00 27.49 ? 218  TYR A N   1 
ATOM   1493 C CA  . TYR A 1 219 ? 31.689 -9.602  -1.997  1.00 26.50 ? 218  TYR A CA  1 
ATOM   1494 C C   . TYR A 1 219 ? 31.892 -10.020 -3.449  1.00 24.98 ? 218  TYR A C   1 
ATOM   1495 O O   . TYR A 1 219 ? 30.971 -9.909  -4.277  1.00 27.25 ? 218  TYR A O   1 
ATOM   1496 C CB  . TYR A 1 219 ? 31.499 -10.853 -1.102  1.00 25.14 ? 218  TYR A CB  1 
ATOM   1497 C CG  . TYR A 1 219 ? 30.287 -11.663 -1.468  1.00 25.53 ? 218  TYR A CG  1 
ATOM   1498 C CD1 . TYR A 1 219 ? 29.014 -11.322 -0.976  1.00 26.24 ? 218  TYR A CD1 1 
ATOM   1499 C CD2 . TYR A 1 219 ? 30.395 -12.764 -2.303  1.00 25.07 ? 218  TYR A CD2 1 
ATOM   1500 C CE1 . TYR A 1 219 ? 27.895 -12.065 -1.313  1.00 26.21 ? 218  TYR A CE1 1 
ATOM   1501 C CE2 . TYR A 1 219 ? 29.284 -13.519 -2.646  1.00 27.18 ? 218  TYR A CE2 1 
ATOM   1502 C CZ  . TYR A 1 219 ? 28.037 -13.160 -2.157  1.00 27.09 ? 218  TYR A CZ  1 
ATOM   1503 O OH  . TYR A 1 219 ? 26.943 -13.905 -2.513  1.00 26.94 ? 218  TYR A OH  1 
ATOM   1504 N N   . HIS A 1 220 ? 33.097 -10.482 -3.760  1.00 25.56 ? 219  HIS A N   1 
ATOM   1505 C CA  . HIS A 1 220 ? 33.364 -11.103 -5.046  1.00 25.94 ? 219  HIS A CA  1 
ATOM   1506 C C   . HIS A 1 220 ? 33.438 -12.580 -4.838  1.00 25.62 ? 219  HIS A C   1 
ATOM   1507 O O   . HIS A 1 220 ? 33.760 -13.037 -3.739  1.00 25.35 ? 219  HIS A O   1 
ATOM   1508 C CB  . HIS A 1 220 ? 34.625 -10.515 -5.680  1.00 27.54 ? 219  HIS A CB  1 
ATOM   1509 C CG  . HIS A 1 220 ? 34.444 -9.063  -6.071  1.00 29.62 ? 219  HIS A CG  1 
ATOM   1510 N ND1 . HIS A 1 220 ? 34.130 -8.678  -7.333  1.00 31.83 ? 219  HIS A ND1 1 
ATOM   1511 C CD2 . HIS A 1 220 ? 34.441 -7.912  -5.299  1.00 29.33 ? 219  HIS A CD2 1 
ATOM   1512 C CE1 . HIS A 1 220 ? 33.972 -7.339  -7.368  1.00 30.06 ? 219  HIS A CE1 1 
ATOM   1513 N NE2 . HIS A 1 220 ? 34.161 -6.867  -6.123  1.00 34.10 ? 219  HIS A NE2 1 
ATOM   1514 N N   . GLY A 1 221 ? 33.106 -13.330 -5.874  1.00 23.67 ? 220  GLY A N   1 
ATOM   1515 C CA  . GLY A 1 221 ? 32.869 -14.774 -5.746  1.00 25.33 ? 220  GLY A CA  1 
ATOM   1516 C C   . GLY A 1 221 ? 34.043 -15.580 -5.234  1.00 24.75 ? 220  GLY A C   1 
ATOM   1517 O O   . GLY A 1 221 ? 33.947 -16.278 -4.224  1.00 21.85 ? 220  GLY A O   1 
ATOM   1518 N N   . ARG A 1 222 ? 35.165 -15.463 -5.927  1.00 23.94 ? 221  ARG A N   1 
ATOM   1519 C CA  . ARG A 1 222 ? 36.317 -16.285 -5.632  1.00 25.11 ? 221  ARG A CA  1 
ATOM   1520 C C   . ARG A 1 222 ? 36.940 -15.964 -4.284  1.00 24.42 ? 221  ARG A C   1 
ATOM   1521 O O   . ARG A 1 222 ? 37.275 -16.875 -3.549  1.00 23.05 ? 221  ARG A O   1 
ATOM   1522 C CB  . ARG A 1 222 ? 37.344 -16.195 -6.750  1.00 28.85 ? 221  ARG A CB  1 
ATOM   1523 C CG  . ARG A 1 222 ? 36.935 -17.018 -7.970  1.00 32.94 ? 221  ARG A CG  1 
ATOM   1524 C CD  . ARG A 1 222 ? 38.171 -17.386 -8.776  1.00 38.90 ? 221  ARG A CD  1 
ATOM   1525 N NE  . ARG A 1 222 ? 37.884 -18.167 -9.980  1.00 41.02 ? 221  ARG A NE  1 
ATOM   1526 C CZ  . ARG A 1 222 ? 37.418 -17.657 -11.118 1.00 41.53 ? 221  ARG A CZ  1 
ATOM   1527 N NH1 . ARG A 1 222 ? 37.127 -16.358 -11.212 1.00 38.72 ? 221  ARG A NH1 1 
ATOM   1528 N NH2 . ARG A 1 222 ? 37.225 -18.456 -12.155 1.00 42.18 ? 221  ARG A NH2 1 
ATOM   1529 N N   . SER A 1 223 ? 37.086 -14.682 -3.961  1.00 23.06 ? 222  SER A N   1 
ATOM   1530 C CA  . SER A 1 223 ? 37.700 -14.319 -2.697  1.00 22.70 ? 222  SER A CA  1 
ATOM   1531 C C   . SER A 1 223 ? 36.790 -14.632 -1.510  1.00 22.37 ? 222  SER A C   1 
ATOM   1532 O O   . SER A 1 223 ? 37.285 -14.937 -0.426  1.00 22.66 ? 222  SER A O   1 
ATOM   1533 C CB  . SER A 1 223 ? 38.128 -12.849 -2.695  1.00 23.50 ? 222  SER A CB  1 
ATOM   1534 O OG  . SER A 1 223 ? 37.035 -11.998 -2.977  1.00 22.51 ? 222  SER A OG  1 
ATOM   1535 N N   . ALA A 1 224 ? 35.473 -14.557 -1.707  1.00 22.80 ? 223  ALA A N   1 
ATOM   1536 C CA  . ALA A 1 224 ? 34.526 -15.002 -0.672  1.00 22.47 ? 223  ALA A CA  1 
ATOM   1537 C C   . ALA A 1 224 ? 34.636 -16.520 -0.479  1.00 22.85 ? 223  ALA A C   1 
ATOM   1538 O O   . ALA A 1 224 ? 34.628 -17.026 0.664   1.00 22.74 ? 223  ALA A O   1 
ATOM   1539 C CB  . ALA A 1 224 ? 33.091 -14.606 -1.023  1.00 22.79 ? 223  ALA A CB  1 
ATOM   1540 N N   . ALA A 1 225 ? 34.736 -17.249 -1.588  1.00 21.20 ? 224  ALA A N   1 
ATOM   1541 C CA  . ALA A 1 225 ? 34.960 -18.691 -1.514  1.00 21.40 ? 224  ALA A CA  1 
ATOM   1542 C C   . ALA A 1 225 ? 36.220 -19.039 -0.729  1.00 20.32 ? 224  ALA A C   1 
ATOM   1543 O O   . ALA A 1 225 ? 36.186 -19.951 0.086   1.00 19.45 ? 224  ALA A O   1 
ATOM   1544 C CB  . ALA A 1 225 ? 35.000 -19.327 -2.898  1.00 20.42 ? 224  ALA A CB  1 
ATOM   1545 N N   . VAL A 1 226 ? 37.324 -18.331 -0.980  1.00 20.01 ? 225  VAL A N   1 
ATOM   1546 C CA  . VAL A 1 226 ? 38.577 -18.589 -0.264  1.00 19.40 ? 225  VAL A CA  1 
ATOM   1547 C C   . VAL A 1 226 ? 38.406 -18.329 1.244   1.00 20.59 ? 225  VAL A C   1 
ATOM   1548 O O   . VAL A 1 226 ? 38.921 -19.076 2.070   1.00 20.19 ? 225  VAL A O   1 
ATOM   1549 C CB  . VAL A 1 226 ? 39.765 -17.795 -0.884  1.00 20.19 ? 225  VAL A CB  1 
ATOM   1550 C CG1 . VAL A 1 226 ? 40.993 -17.820 0.025   1.00 20.00 ? 225  VAL A CG1 1 
ATOM   1551 C CG2 . VAL A 1 226 ? 40.123 -18.398 -2.244  1.00 19.44 ? 225  VAL A CG2 1 
ATOM   1552 N N   . TRP A 1 227 ? 37.681 -17.275 1.600   1.00 21.82 ? 226  TRP A N   1 
ATOM   1553 C CA  . TRP A 1 227 ? 37.371 -17.049 3.006   1.00 22.00 ? 226  TRP A CA  1 
ATOM   1554 C C   . TRP A 1 227 ? 36.675 -18.254 3.609   1.00 21.74 ? 226  TRP A C   1 
ATOM   1555 O O   . TRP A 1 227 ? 37.101 -18.764 4.645   1.00 22.18 ? 226  TRP A O   1 
ATOM   1556 C CB  . TRP A 1 227 ? 36.517 -15.807 3.184   1.00 22.72 ? 226  TRP A CB  1 
ATOM   1557 C CG  . TRP A 1 227 ? 36.119 -15.628 4.622   1.00 22.18 ? 226  TRP A CG  1 
ATOM   1558 C CD1 . TRP A 1 227 ? 35.052 -16.210 5.293   1.00 22.75 ? 226  TRP A CD1 1 
ATOM   1559 C CD2 . TRP A 1 227 ? 36.793 -14.804 5.609   1.00 21.86 ? 226  TRP A CD2 1 
ATOM   1560 N NE1 . TRP A 1 227 ? 35.029 -15.814 6.605   1.00 22.30 ? 226  TRP A NE1 1 
ATOM   1561 C CE2 . TRP A 1 227 ? 36.045 -14.974 6.863   1.00 22.63 ? 226  TRP A CE2 1 
ATOM   1562 C CE3 . TRP A 1 227 ? 37.912 -13.972 5.589   1.00 21.88 ? 226  TRP A CE3 1 
ATOM   1563 C CZ2 . TRP A 1 227 ? 36.412 -14.323 8.025   1.00 22.29 ? 226  TRP A CZ2 1 
ATOM   1564 C CZ3 . TRP A 1 227 ? 38.272 -13.320 6.771   1.00 23.23 ? 226  TRP A CZ3 1 
ATOM   1565 C CH2 . TRP A 1 227 ? 37.533 -13.495 7.962   1.00 22.74 ? 226  TRP A CH2 1 
ATOM   1566 N N   . SER A 1 228 ? 35.606 -18.722 2.977   1.00 21.59 ? 227  SER A N   1 
ATOM   1567 C CA  . SER A 1 228 ? 34.861 -19.866 3.517   1.00 21.02 ? 227  SER A CA  1 
ATOM   1568 C C   . SER A 1 228 ? 35.758 -21.108 3.609   1.00 20.42 ? 227  SER A C   1 
ATOM   1569 O O   . SER A 1 228 ? 35.628 -21.917 4.524   1.00 20.43 ? 227  SER A O   1 
ATOM   1570 C CB  . SER A 1 228 ? 33.592 -20.143 2.697   1.00 21.47 ? 227  SER A CB  1 
ATOM   1571 O OG  . SER A 1 228 ? 33.922 -20.726 1.449   1.00 22.90 ? 227  SER A OG  1 
ATOM   1572 N N   . LEU A 1 229 ? 36.699 -21.236 2.684   1.00 20.00 ? 228  LEU A N   1 
ATOM   1573 C CA  . LEU A 1 229 ? 37.662 -22.338 2.723   1.00 19.82 ? 228  LEU A CA  1 
ATOM   1574 C C   . LEU A 1 229 ? 38.627 -22.235 3.900   1.00 20.01 ? 228  LEU A C   1 
ATOM   1575 O O   . LEU A 1 229 ? 39.009 -23.247 4.476   1.00 21.06 ? 228  LEU A O   1 
ATOM   1576 C CB  . LEU A 1 229 ? 38.407 -22.494 1.377   1.00 19.41 ? 228  LEU A CB  1 
ATOM   1577 C CG  . LEU A 1 229 ? 37.488 -22.978 0.230   1.00 19.36 ? 228  LEU A CG  1 
ATOM   1578 C CD1 . LEU A 1 229 ? 38.123 -22.604 -1.119  1.00 21.04 ? 228  LEU A CD1 1 
ATOM   1579 C CD2 . LEU A 1 229 ? 37.232 -24.477 0.334   1.00 19.51 ? 228  LEU A CD2 1 
ATOM   1580 N N   . GLY A 1 230 ? 39.007 -21.028 4.279   1.00 20.29 ? 229  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 230 ? 39.830 -20.869 5.485   1.00 20.04 ? 229  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 230 ? 39.047 -21.240 6.733   1.00 19.83 ? 229  GLY A C   1 
ATOM   1583 O O   . GLY A 1 230 ? 39.604 -21.852 7.646   1.00 21.15 ? 229  GLY A O   1 
ATOM   1584 N N   . ILE A 1 231 ? 37.765 -20.867 6.781   1.00 20.12 ? 230  ILE A N   1 
ATOM   1585 C CA  . ILE A 1 231 ? 36.872 -21.270 7.883   1.00 20.23 ? 230  ILE A CA  1 
ATOM   1586 C C   . ILE A 1 231 ? 36.795 -22.810 7.933   1.00 20.46 ? 230  ILE A C   1 
ATOM   1587 O O   . ILE A 1 231 ? 36.948 -23.438 8.999   1.00 19.31 ? 230  ILE A O   1 
ATOM   1588 C CB  . ILE A 1 231 ? 35.438 -20.672 7.741   1.00 20.75 ? 230  ILE A CB  1 
ATOM   1589 C CG1 . ILE A 1 231 ? 35.455 -19.137 7.697   1.00 21.66 ? 230  ILE A CG1 1 
ATOM   1590 C CG2 . ILE A 1 231 ? 34.499 -21.156 8.861   1.00 20.75 ? 230  ILE A CG2 1 
ATOM   1591 C CD1 . ILE A 1 231 ? 35.964 -18.448 8.957   1.00 21.67 ? 230  ILE A CD1 1 
ATOM   1592 N N   . LEU A 1 232 ? 36.577 -23.406 6.768   1.00 20.59 ? 231  LEU A N   1 
ATOM   1593 C CA  . LEU A 1 232 ? 36.496 -24.854 6.654   1.00 19.99 ? 231  LEU A CA  1 
ATOM   1594 C C   . LEU A 1 232 ? 37.780 -25.542 7.109   1.00 20.60 ? 231  LEU A C   1 
ATOM   1595 O O   . LEU A 1 232 ? 37.745 -26.570 7.822   1.00 19.66 ? 231  LEU A O   1 
ATOM   1596 C CB  . LEU A 1 232 ? 36.218 -25.256 5.197   1.00 19.90 ? 231  LEU A CB  1 
ATOM   1597 C CG  . LEU A 1 232 ? 36.090 -26.785 5.029   1.00 21.82 ? 231  LEU A CG  1 
ATOM   1598 C CD1 . LEU A 1 232 ? 34.826 -27.321 5.698   1.00 22.57 ? 231  LEU A CD1 1 
ATOM   1599 C CD2 . LEU A 1 232 ? 36.093 -27.115 3.543   1.00 21.36 ? 231  LEU A CD2 1 
ATOM   1600 N N   . LEU A 1 233 ? 38.920 -25.000 6.683   1.00 19.63 ? 232  LEU A N   1 
ATOM   1601 C CA  . LEU A 1 233 ? 40.175 -25.646 7.025   1.00 20.58 ? 232  LEU A CA  1 
ATOM   1602 C C   . LEU A 1 233 ? 40.415 -25.515 8.525   1.00 20.81 ? 232  LEU A C   1 
ATOM   1603 O O   . LEU A 1 233 ? 40.845 -26.480 9.158   1.00 21.70 ? 232  LEU A O   1 
ATOM   1604 C CB  . LEU A 1 233 ? 41.349 -25.071 6.230   1.00 20.11 ? 232  LEU A CB  1 
ATOM   1605 C CG  . LEU A 1 233 ? 42.724 -25.644 6.584   1.00 21.65 ? 232  LEU A CG  1 
ATOM   1606 C CD1 . LEU A 1 233 ? 42.771 -27.174 6.503   1.00 20.51 ? 232  LEU A CD1 1 
ATOM   1607 C CD2 . LEU A 1 233 ? 43.778 -24.998 5.676   1.00 22.71 ? 232  LEU A CD2 1 
ATOM   1608 N N   . TYR A 1 234 ? 40.129 -24.340 9.087   1.00 20.10 ? 233  TYR A N   1 
ATOM   1609 C CA  . TYR A 1 234 ? 40.221 -24.167 10.531  1.00 21.33 ? 233  TYR A CA  1 
ATOM   1610 C C   . TYR A 1 234 ? 39.349 -25.207 11.231  1.00 21.42 ? 233  TYR A C   1 
ATOM   1611 O O   . TYR A 1 234 ? 39.778 -25.865 12.215  1.00 21.99 ? 233  TYR A O   1 
ATOM   1612 C CB  . TYR A 1 234 ? 39.775 -22.744 10.947  1.00 22.40 ? 233  TYR A CB  1 
ATOM   1613 C CG  . TYR A 1 234 ? 39.914 -22.517 12.429  1.00 23.59 ? 233  TYR A CG  1 
ATOM   1614 C CD1 . TYR A 1 234 ? 38.944 -22.977 13.311  1.00 24.29 ? 233  TYR A CD1 1 
ATOM   1615 C CD2 . TYR A 1 234 ? 41.028 -21.842 12.952  1.00 24.29 ? 233  TYR A CD2 1 
ATOM   1616 C CE1 . TYR A 1 234 ? 39.076 -22.797 14.676  1.00 25.25 ? 233  TYR A CE1 1 
ATOM   1617 C CE2 . TYR A 1 234 ? 41.159 -21.633 14.318  1.00 26.23 ? 233  TYR A CE2 1 
ATOM   1618 C CZ  . TYR A 1 234 ? 40.180 -22.125 15.169  1.00 26.42 ? 233  TYR A CZ  1 
ATOM   1619 O OH  . TYR A 1 234 ? 40.292 -21.928 16.528  1.00 28.52 ? 233  TYR A OH  1 
ATOM   1620 N N   . ASP A 1 235 ? 38.123 -25.353 10.734  1.00 21.41 ? 234  ASP A N   1 
ATOM   1621 C CA  . ASP A 1 235 ? 37.173 -26.308 11.277  1.00 22.46 ? 234  ASP A CA  1 
ATOM   1622 C C   . ASP A 1 235 ? 37.738 -27.726 11.290  1.00 22.82 ? 234  ASP A C   1 
ATOM   1623 O O   . ASP A 1 235 ? 37.574 -28.463 12.270  1.00 21.34 ? 234  ASP A O   1 
ATOM   1624 C CB  . ASP A 1 235 ? 35.881 -26.244 10.464  1.00 24.01 ? 234  ASP A CB  1 
ATOM   1625 C CG  . ASP A 1 235 ? 34.794 -27.139 11.003  1.00 26.49 ? 234  ASP A CG  1 
ATOM   1626 O OD1 . ASP A 1 235 ? 34.439 -27.044 12.193  1.00 26.24 ? 234  ASP A OD1 1 
ATOM   1627 O OD2 . ASP A 1 235 ? 34.244 -27.895 10.186  1.00 27.61 ? 234  ASP A OD2 1 
ATOM   1628 N N   . MET A 1 236 ? 38.397 -28.116 10.202  1.00 21.47 ? 235  MET A N   1 
ATOM   1629 C CA  . MET A 1 236 ? 38.948 -29.448 10.100  1.00 23.80 ? 235  MET A CA  1 
ATOM   1630 C C   . MET A 1 236 ? 40.041 -29.672 11.135  1.00 23.87 ? 235  MET A C   1 
ATOM   1631 O O   . MET A 1 236 ? 40.082 -30.723 11.772  1.00 24.46 ? 235  MET A O   1 
ATOM   1632 C CB  . MET A 1 236 ? 39.531 -29.698 8.706   1.00 23.64 ? 235  MET A CB  1 
ATOM   1633 C CG  . MET A 1 236 ? 38.471 -29.873 7.631   1.00 26.36 ? 235  MET A CG  1 
ATOM   1634 S SD  . MET A 1 236 ? 39.343 -30.165 6.075   1.00 29.93 ? 235  MET A SD  1 
ATOM   1635 C CE  . MET A 1 236 ? 37.996 -30.061 4.901   1.00 29.87 ? 235  MET A CE  1 
ATOM   1636 N N   . VAL A 1 237 ? 40.928 -28.700 11.300  1.00 22.56 ? 236  VAL A N   1 
ATOM   1637 C CA  . VAL A 1 237 ? 42.103 -28.954 12.132  1.00 23.79 ? 236  VAL A CA  1 
ATOM   1638 C C   . VAL A 1 237 ? 41.886 -28.546 13.582  1.00 25.56 ? 236  VAL A C   1 
ATOM   1639 O O   . VAL A 1 237 ? 42.672 -28.908 14.450  1.00 25.86 ? 236  VAL A O   1 
ATOM   1640 C CB  . VAL A 1 237 ? 43.385 -28.320 11.552  1.00 23.41 ? 236  VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 237 ? 43.701 -28.920 10.182  1.00 23.52 ? 236  VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 237 ? 43.254 -26.796 11.472  1.00 23.04 ? 236  VAL A CG2 1 
ATOM   1643 N N   . CYS A 1 238 ? 40.824 -27.792 13.843  1.00 24.89 ? 237  CYS A N   1 
ATOM   1644 C CA  . CYS A 1 238 ? 40.498 -27.394 15.215  1.00 26.33 ? 237  CYS A CA  1 
ATOM   1645 C C   . CYS A 1 238 ? 39.245 -28.040 15.788  1.00 27.61 ? 237  CYS A C   1 
ATOM   1646 O O   . CYS A 1 238 ? 39.024 -27.972 16.996  1.00 27.87 ? 237  CYS A O   1 
ATOM   1647 C CB  . CYS A 1 238 ? 40.407 -25.873 15.334  1.00 24.75 ? 237  CYS A CB  1 
ATOM   1648 S SG  . CYS A 1 238 ? 42.030 -25.101 15.164  1.00 29.39 ? 237  CYS A SG  1 
ATOM   1649 N N   . GLY A 1 239 ? 38.413 -28.636 14.932  1.00 27.11 ? 238  GLY A N   1 
ATOM   1650 C CA  . GLY A 1 239 ? 37.202 -29.297 15.407  1.00 27.51 ? 238  GLY A CA  1 
ATOM   1651 C C   . GLY A 1 239 ? 36.014 -28.374 15.588  1.00 29.64 ? 238  GLY A C   1 
ATOM   1652 O O   . GLY A 1 239 ? 34.938 -28.819 15.973  1.00 29.14 ? 238  GLY A O   1 
ATOM   1653 N N   . ASP A 1 240 ? 36.204 -27.078 15.344  1.00 28.62 ? 239  ASP A N   1 
ATOM   1654 C CA  . ASP A 1 240 ? 35.103 -26.122 15.377  1.00 30.89 ? 239  ASP A CA  1 
ATOM   1655 C C   . ASP A 1 240 ? 35.449 -24.921 14.519  1.00 28.93 ? 239  ASP A C   1 
ATOM   1656 O O   . ASP A 1 240 ? 36.598 -24.751 14.127  1.00 26.57 ? 239  ASP A O   1 
ATOM   1657 C CB  . ASP A 1 240 ? 34.790 -25.656 16.803  1.00 36.19 ? 239  ASP A CB  1 
ATOM   1658 C CG  . ASP A 1 240 ? 33.291 -25.339 17.009  1.00 42.78 ? 239  ASP A CG  1 
ATOM   1659 O OD1 . ASP A 1 240 ? 32.524 -25.131 16.010  1.00 41.93 ? 239  ASP A OD1 1 
ATOM   1660 O OD2 . ASP A 1 240 ? 32.882 -25.301 18.195  1.00 49.01 ? 239  ASP A OD2 1 
ATOM   1661 N N   . ILE A 1 241 ? 34.449 -24.106 14.211  1.00 28.04 ? 240  ILE A N   1 
ATOM   1662 C CA  . ILE A 1 241 ? 34.668 -22.923 13.389  1.00 29.29 ? 240  ILE A CA  1 
ATOM   1663 C C   . ILE A 1 241 ? 35.358 -21.837 14.220  1.00 28.35 ? 240  ILE A C   1 
ATOM   1664 O O   . ILE A 1 241 ? 35.239 -21.835 15.451  1.00 30.18 ? 240  ILE A O   1 
ATOM   1665 C CB  . ILE A 1 241 ? 33.356 -22.430 12.739  1.00 29.89 ? 240  ILE A CB  1 
ATOM   1666 C CG1 . ILE A 1 241 ? 32.276 -22.182 13.799  1.00 31.73 ? 240  ILE A CG1 1 
ATOM   1667 C CG2 . ILE A 1 241 ? 32.917 -23.408 11.658  1.00 30.99 ? 240  ILE A CG2 1 
ATOM   1668 C CD1 . ILE A 1 241 ? 31.058 -21.439 13.277  1.00 33.42 ? 240  ILE A CD1 1 
ATOM   1669 N N   . PRO A 1 242 ? 36.121 -20.936 13.577  1.00 27.29 ? 241  PRO A N   1 
ATOM   1670 C CA  . PRO A 1 242 ? 36.896 -20.007 14.410  1.00 28.39 ? 241  PRO A CA  1 
ATOM   1671 C C   . PRO A 1 242 ? 36.096 -18.802 14.926  1.00 30.60 ? 241  PRO A C   1 
ATOM   1672 O O   . PRO A 1 242 ? 36.485 -18.212 15.935  1.00 32.86 ? 241  PRO A O   1 
ATOM   1673 C CB  . PRO A 1 242 ? 38.004 -19.543 13.470  1.00 25.76 ? 241  PRO A CB  1 
ATOM   1674 C CG  . PRO A 1 242 ? 37.360 -19.586 12.109  1.00 25.74 ? 241  PRO A CG  1 
ATOM   1675 C CD  . PRO A 1 242 ? 36.441 -20.781 12.139  1.00 26.22 ? 241  PRO A CD  1 
ATOM   1676 N N   . PHE A 1 243 ? 35.014 -18.437 14.235  1.00 31.65 ? 242  PHE A N   1 
ATOM   1677 C CA  . PHE A 1 243 ? 34.230 -17.241 14.571  1.00 32.96 ? 242  PHE A CA  1 
ATOM   1678 C C   . PHE A 1 243 ? 32.784 -17.609 14.748  1.00 33.82 ? 242  PHE A C   1 
ATOM   1679 O O   . PHE A 1 243 ? 32.235 -18.359 13.949  1.00 35.44 ? 242  PHE A O   1 
ATOM   1680 C CB  . PHE A 1 243 ? 34.308 -16.165 13.468  1.00 30.60 ? 242  PHE A CB  1 
ATOM   1681 C CG  . PHE A 1 243 ? 35.698 -15.868 12.990  1.00 30.37 ? 242  PHE A CG  1 
ATOM   1682 C CD1 . PHE A 1 243 ? 36.711 -15.513 13.886  1.00 27.78 ? 242  PHE A CD1 1 
ATOM   1683 C CD2 . PHE A 1 243 ? 36.001 -15.930 11.624  1.00 28.38 ? 242  PHE A CD2 1 
ATOM   1684 C CE1 . PHE A 1 243 ? 37.998 -15.237 13.432  1.00 28.98 ? 242  PHE A CE1 1 
ATOM   1685 C CE2 . PHE A 1 243 ? 37.285 -15.652 11.170  1.00 26.71 ? 242  PHE A CE2 1 
ATOM   1686 C CZ  . PHE A 1 243 ? 38.285 -15.302 12.069  1.00 27.31 ? 242  PHE A CZ  1 
ATOM   1687 N N   . GLU A 1 244 ? 32.143 -17.054 15.771  1.00 36.74 ? 243  GLU A N   1 
ATOM   1688 C CA  . GLU A 1 244 ? 30.701 -17.250 15.930  1.00 40.79 ? 243  GLU A CA  1 
ATOM   1689 C C   . GLU A 1 244 ? 29.928 -15.952 15.667  1.00 40.91 ? 243  GLU A C   1 
ATOM   1690 O O   . GLU A 1 244 ? 28.886 -15.960 15.014  1.00 43.93 ? 243  GLU A O   1 
ATOM   1691 C CB  . GLU A 1 244 ? 30.370 -17.798 17.321  1.00 46.76 ? 243  GLU A CB  1 
ATOM   1692 C CG  . GLU A 1 244 ? 28.929 -18.286 17.435  1.00 54.41 ? 243  GLU A CG  1 
ATOM   1693 C CD  . GLU A 1 244 ? 28.433 -18.419 18.869  1.00 61.92 ? 243  GLU A CD  1 
ATOM   1694 O OE1 . GLU A 1 244 ? 29.248 -18.339 19.824  1.00 64.63 ? 243  GLU A OE1 1 
ATOM   1695 O OE2 . GLU A 1 244 ? 27.207 -18.609 19.038  1.00 65.51 ? 243  GLU A OE2 1 
ATOM   1696 N N   . HIS A 1 245 ? 30.457 -14.839 16.158  1.00 39.81 ? 244  HIS A N   1 
ATOM   1697 C CA  . HIS A 1 245 ? 29.742 -13.568 16.099  1.00 39.89 ? 244  HIS A CA  1 
ATOM   1698 C C   . HIS A 1 245 ? 30.259 -12.707 14.990  1.00 36.69 ? 244  HIS A C   1 
ATOM   1699 O O   . HIS A 1 245 ? 31.429 -12.823 14.604  1.00 32.59 ? 244  HIS A O   1 
ATOM   1700 C CB  . HIS A 1 245 ? 29.841 -12.858 17.444  1.00 42.18 ? 244  HIS A CB  1 
ATOM   1701 C CG  . HIS A 1 245 ? 29.259 -13.659 18.582  1.00 47.65 ? 244  HIS A CG  1 
ATOM   1702 N ND1 . HIS A 1 245 ? 30.020 -14.206 19.546  1.00 49.54 ? 244  HIS A ND1 1 
ATOM   1703 C CD2 . HIS A 1 245 ? 27.942 -14.024 18.865  1.00 51.69 ? 244  HIS A CD2 1 
ATOM   1704 C CE1 . HIS A 1 245 ? 29.235 -14.870 20.416  1.00 51.60 ? 244  HIS A CE1 1 
ATOM   1705 N NE2 . HIS A 1 245 ? 27.963 -14.763 19.994  1.00 52.89 ? 244  HIS A NE2 1 
ATOM   1706 N N   . ASP A 1 246 ? 29.379 -11.861 14.453  1.00 34.95 ? 245  ASP A N   1 
ATOM   1707 C CA  . ASP A 1 246 ? 29.747 -10.896 13.405  1.00 35.27 ? 245  ASP A CA  1 
ATOM   1708 C C   . ASP A 1 246 ? 31.003 -10.111 13.766  1.00 35.11 ? 245  ASP A C   1 
ATOM   1709 O O   . ASP A 1 246 ? 31.854 -9.855  12.915  1.00 32.06 ? 245  ASP A O   1 
ATOM   1710 C CB  . ASP A 1 246 ? 28.607 -9.904  13.154  1.00 36.98 ? 245  ASP A CB  1 
ATOM   1711 C CG  . ASP A 1 246 ? 27.447 -10.514 12.407  1.00 38.18 ? 245  ASP A CG  1 
ATOM   1712 O OD1 . ASP A 1 246 ? 27.524 -11.687 11.978  1.00 39.14 ? 245  ASP A OD1 1 
ATOM   1713 O OD2 . ASP A 1 246 ? 26.443 -9.797  12.224  1.00 40.45 ? 245  ASP A OD2 1 
ATOM   1714 N N   . GLU A 1 247 ? 31.101 -9.728  15.037  1.00 34.41 ? 246  GLU A N   1 
ATOM   1715 C CA  . GLU A 1 247 ? 32.235 -8.959  15.539  1.00 36.35 ? 246  GLU A CA  1 
ATOM   1716 C C   . GLU A 1 247 ? 33.550 -9.731  15.405  1.00 33.10 ? 246  GLU A C   1 
ATOM   1717 O O   . GLU A 1 247 ? 34.591 -9.147  15.138  1.00 32.85 ? 246  GLU A O   1 
ATOM   1718 C CB  . GLU A 1 247 ? 32.011 -8.560  17.009  1.00 41.30 ? 246  GLU A CB  1 
ATOM   1719 C CG  . GLU A 1 247 ? 30.813 -7.646  17.238  1.00 48.09 ? 246  GLU A CG  1 
ATOM   1720 C CD  . GLU A 1 247 ? 29.461 -8.353  17.141  1.00 52.10 ? 246  GLU A CD  1 
ATOM   1721 O OE1 . GLU A 1 247 ? 29.393 -9.606  17.200  1.00 51.31 ? 246  GLU A OE1 1 
ATOM   1722 O OE2 . GLU A 1 247 ? 28.443 -7.637  17.000  1.00 58.50 ? 246  GLU A OE2 1 
ATOM   1723 N N   . GLU A 1 248 ? 33.499 -11.043 15.585  1.00 32.94 ? 247  GLU A N   1 
ATOM   1724 C CA  . GLU A 1 248 ? 34.710 -11.844 15.460  1.00 32.69 ? 247  GLU A CA  1 
ATOM   1725 C C   . GLU A 1 248 ? 35.108 -11.967 13.997  1.00 30.42 ? 247  GLU A C   1 
ATOM   1726 O O   . GLU A 1 248 ? 36.296 -11.900 13.667  1.00 29.70 ? 247  GLU A O   1 
ATOM   1727 C CB  . GLU A 1 248 ? 34.506 -13.231 16.041  1.00 37.43 ? 247  GLU A CB  1 
ATOM   1728 C CG  . GLU A 1 248 ? 34.067 -13.262 17.497  1.00 41.14 ? 247  GLU A CG  1 
ATOM   1729 C CD  . GLU A 1 248 ? 33.831 -14.681 17.939  1.00 44.69 ? 247  GLU A CD  1 
ATOM   1730 O OE1 . GLU A 1 248 ? 34.810 -15.349 18.313  1.00 53.74 ? 247  GLU A OE1 1 
ATOM   1731 O OE2 . GLU A 1 248 ? 32.688 -15.149 17.848  1.00 48.40 ? 247  GLU A OE2 1 
ATOM   1732 N N   . ILE A 1 249 ? 34.112 -12.143 13.130  1.00 29.23 ? 248  ILE A N   1 
ATOM   1733 C CA  . ILE A 1 249 ? 34.361 -12.240 11.670  1.00 29.00 ? 248  ILE A CA  1 
ATOM   1734 C C   . ILE A 1 249 ? 35.063 -10.967 11.188  1.00 29.55 ? 248  ILE A C   1 
ATOM   1735 O O   . ILE A 1 249 ? 36.105 -11.028 10.536  1.00 29.05 ? 248  ILE A O   1 
ATOM   1736 C CB  . ILE A 1 249 ? 33.064 -12.517 10.858  1.00 28.81 ? 248  ILE A CB  1 
ATOM   1737 C CG1 . ILE A 1 249 ? 32.475 -13.889 11.216  1.00 27.27 ? 248  ILE A CG1 1 
ATOM   1738 C CG2 . ILE A 1 249 ? 33.346 -12.434 9.356   1.00 27.21 ? 248  ILE A CG2 1 
ATOM   1739 C CD1 . ILE A 1 249 ? 31.053 -14.112 10.726  1.00 28.52 ? 248  ILE A CD1 1 
ATOM   1740 N N   . ILE A 1 250 ? 34.512 -9.813  11.573  1.00 30.40 ? 249  ILE A N   1 
ATOM   1741 C CA  . ILE A 1 250 ? 35.059 -8.509  11.216  1.00 32.27 ? 249  ILE A CA  1 
ATOM   1742 C C   . ILE A 1 250 ? 36.470 -8.267  11.752  1.00 32.26 ? 249  ILE A C   1 
ATOM   1743 O O   . ILE A 1 250 ? 37.302 -7.668  11.070  1.00 29.80 ? 249  ILE A O   1 
ATOM   1744 C CB  . ILE A 1 250 ? 34.094 -7.375  11.651  1.00 36.14 ? 249  ILE A CB  1 
ATOM   1745 C CG1 . ILE A 1 250 ? 32.903 -7.315  10.695  1.00 37.22 ? 249  ILE A CG1 1 
ATOM   1746 C CG2 . ILE A 1 250 ? 34.806 -6.026  11.722  1.00 38.66 ? 249  ILE A CG2 1 
ATOM   1747 C CD1 . ILE A 1 250 ? 31.769 -6.445  11.215  1.00 42.41 ? 249  ILE A CD1 1 
ATOM   1748 N N   . ARG A 1 251 ? 36.740 -8.724  12.969  1.00 31.74 ? 250  ARG A N   1 
ATOM   1749 C CA  . ARG A 1 251 ? 38.071 -8.573  13.537  1.00 32.77 ? 250  ARG A CA  1 
ATOM   1750 C C   . ARG A 1 251 ? 39.069 -9.502  12.831  1.00 32.52 ? 250  ARG A C   1 
ATOM   1751 O O   . ARG A 1 251 ? 40.231 -9.142  12.647  1.00 33.43 ? 250  ARG A O   1 
ATOM   1752 C CB  . ARG A 1 251 ? 38.039 -8.831  15.046  1.00 32.42 ? 250  ARG A CB  1 
ATOM   1753 C CG  . ARG A 1 251 ? 39.351 -8.519  15.740  1.00 35.63 ? 250  ARG A CG  1 
ATOM   1754 C CD  . ARG A 1 251 ? 39.144 -8.208  17.215  1.00 37.50 ? 250  ARG A CD  1 
ATOM   1755 N NE  . ARG A 1 251 ? 40.436 -7.992  17.859  1.00 38.68 ? 250  ARG A NE  1 
ATOM   1756 C CZ  . ARG A 1 251 ? 41.075 -8.895  18.604  1.00 40.60 ? 250  ARG A CZ  1 
ATOM   1757 N NH1 . ARG A 1 251 ? 40.538 -10.096 18.857  1.00 35.04 ? 250  ARG A NH1 1 
ATOM   1758 N NH2 . ARG A 1 251 ? 42.250 -8.578  19.126  1.00 38.87 ? 250  ARG A NH2 1 
ATOM   1759 N N   . GLY A 1 252 ? 38.598 -10.686 12.435  1.00 33.45 ? 251  GLY A N   1 
ATOM   1760 C CA  . GLY A 1 252 ? 39.425 -11.654 11.703  1.00 33.27 ? 251  GLY A CA  1 
ATOM   1761 C C   . GLY A 1 252 ? 40.662 -12.127 12.446  1.00 34.16 ? 251  GLY A C   1 
ATOM   1762 O O   . GLY A 1 252 ? 41.630 -12.579 11.832  1.00 33.60 ? 251  GLY A O   1 
ATOM   1763 N N   . GLN A 1 253 ? 40.648 -12.022 13.771  1.00 34.50 ? 252  GLN A N   1 
ATOM   1764 C CA  . GLN A 1 253 ? 41.781 -12.493 14.567  1.00 33.98 ? 252  GLN A CA  1 
ATOM   1765 C C   . GLN A 1 253 ? 41.585 -13.984 14.839  1.00 32.13 ? 252  GLN A C   1 
ATOM   1766 O O   . GLN A 1 253 ? 40.618 -14.380 15.460  1.00 32.63 ? 252  GLN A O   1 
ATOM   1767 C CB  . GLN A 1 253 ? 41.893 -11.698 15.877  1.00 37.96 ? 252  GLN A CB  1 
ATOM   1768 C CG  . GLN A 1 253 ? 42.988 -12.178 16.826  1.00 43.53 ? 252  GLN A CG  1 
ATOM   1769 C CD  . GLN A 1 253 ? 44.389 -11.939 16.286  1.00 48.60 ? 252  GLN A CD  1 
ATOM   1770 O OE1 . GLN A 1 253 ? 45.229 -12.855 16.265  1.00 47.85 ? 252  GLN A OE1 1 
ATOM   1771 N NE2 . GLN A 1 253 ? 44.649 -10.710 15.834  1.00 48.97 ? 252  GLN A NE2 1 
ATOM   1772 N N   . VAL A 1 254 ? 42.509 -14.804 14.363  1.00 30.08 ? 253  VAL A N   1 
ATOM   1773 C CA  . VAL A 1 254 ? 42.370 -16.245 14.456  1.00 29.37 ? 253  VAL A CA  1 
ATOM   1774 C C   . VAL A 1 254 ? 43.125 -16.741 15.688  1.00 27.21 ? 253  VAL A C   1 
ATOM   1775 O O   . VAL A 1 254 ? 44.310 -16.484 15.818  1.00 29.52 ? 253  VAL A O   1 
ATOM   1776 C CB  . VAL A 1 254 ? 42.969 -16.938 13.205  1.00 28.70 ? 253  VAL A CB  1 
ATOM   1777 C CG1 . VAL A 1 254 ? 42.806 -18.454 13.311  1.00 29.75 ? 253  VAL A CG1 1 
ATOM   1778 C CG2 . VAL A 1 254 ? 42.298 -16.406 11.936  1.00 29.19 ? 253  VAL A CG2 1 
ATOM   1779 N N   . PHE A 1 255 ? 42.439 -17.480 16.545  1.00 26.13 ? 254  PHE A N   1 
ATOM   1780 C CA  . PHE A 1 255 ? 43.068 -18.129 17.680  1.00 27.86 ? 254  PHE A CA  1 
ATOM   1781 C C   . PHE A 1 255 ? 42.952 -19.635 17.482  1.00 27.26 ? 254  PHE A C   1 
ATOM   1782 O O   . PHE A 1 255 ? 41.872 -20.150 17.202  1.00 26.56 ? 254  PHE A O   1 
ATOM   1783 C CB  . PHE A 1 255 ? 42.384 -17.703 18.994  1.00 29.20 ? 254  PHE A CB  1 
ATOM   1784 C CG  . PHE A 1 255 ? 42.694 -18.610 20.158  1.00 30.96 ? 254  PHE A CG  1 
ATOM   1785 C CD1 . PHE A 1 255 ? 41.894 -19.730 20.431  1.00 31.56 ? 254  PHE A CD1 1 
ATOM   1786 C CD2 . PHE A 1 255 ? 43.800 -18.358 20.980  1.00 32.27 ? 254  PHE A CD2 1 
ATOM   1787 C CE1 . PHE A 1 255 ? 42.190 -20.571 21.502  1.00 32.94 ? 254  PHE A CE1 1 
ATOM   1788 C CE2 . PHE A 1 255 ? 44.097 -19.198 22.057  1.00 29.66 ? 254  PHE A CE2 1 
ATOM   1789 C CZ  . PHE A 1 255 ? 43.296 -20.301 22.312  1.00 32.09 ? 254  PHE A CZ  1 
ATOM   1790 N N   . PHE A 1 256 ? 44.072 -20.334 17.629  1.00 27.76 ? 255  PHE A N   1 
ATOM   1791 C CA  . PHE A 1 256 ? 44.092 -21.772 17.478  1.00 29.53 ? 255  PHE A CA  1 
ATOM   1792 C C   . PHE A 1 256 ? 43.896 -22.459 18.808  1.00 30.38 ? 255  PHE A C   1 
ATOM   1793 O O   . PHE A 1 256 ? 44.676 -22.268 19.739  1.00 34.09 ? 255  PHE A O   1 
ATOM   1794 C CB  . PHE A 1 256 ? 45.373 -22.212 16.759  1.00 28.01 ? 255  PHE A CB  1 
ATOM   1795 C CG  . PHE A 1 256 ? 45.333 -21.916 15.301  1.00 27.89 ? 255  PHE A CG  1 
ATOM   1796 C CD1 . PHE A 1 256 ? 44.772 -22.841 14.418  1.00 26.78 ? 255  PHE A CD1 1 
ATOM   1797 C CD2 . PHE A 1 256 ? 45.769 -20.698 14.812  1.00 25.92 ? 255  PHE A CD2 1 
ATOM   1798 C CE1 . PHE A 1 256 ? 44.694 -22.556 13.073  1.00 26.33 ? 255  PHE A CE1 1 
ATOM   1799 C CE2 . PHE A 1 256 ? 45.694 -20.407 13.454  1.00 26.45 ? 255  PHE A CE2 1 
ATOM   1800 C CZ  . PHE A 1 256 ? 45.155 -21.339 12.586  1.00 25.21 ? 255  PHE A CZ  1 
ATOM   1801 N N   . ARG A 1 257 ? 42.813 -23.223 18.893  1.00 33.18 ? 256  ARG A N   1 
ATOM   1802 C CA  . ARG A 1 257 ? 42.417 -23.903 20.123  1.00 35.41 ? 256  ARG A CA  1 
ATOM   1803 C C   . ARG A 1 257 ? 43.018 -25.314 20.208  1.00 34.03 ? 256  ARG A C   1 
ATOM   1804 O O   . ARG A 1 257 ? 42.957 -25.960 21.251  1.00 35.75 ? 256  ARG A O   1 
ATOM   1805 C CB  . ARG A 1 257 ? 40.881 -23.956 20.229  1.00 37.54 ? 256  ARG A CB  1 
ATOM   1806 C CG  . ARG A 1 257 ? 40.191 -24.688 19.080  1.00 37.73 ? 256  ARG A CG  1 
ATOM   1807 C CD  . ARG A 1 257 ? 38.679 -24.496 19.131  1.00 39.99 ? 256  ARG A CD  1 
ATOM   1808 N NE  . ARG A 1 257 ? 38.256 -23.264 18.459  1.00 42.65 ? 256  ARG A NE  1 
ATOM   1809 C CZ  . ARG A 1 257 ? 37.076 -22.678 18.637  1.00 44.51 ? 256  ARG A CZ  1 
ATOM   1810 N NH1 . ARG A 1 257 ? 36.189 -23.199 19.483  1.00 46.51 ? 256  ARG A NH1 1 
ATOM   1811 N NH2 . ARG A 1 257 ? 36.785 -21.562 17.984  1.00 39.62 ? 256  ARG A NH2 1 
ATOM   1812 N N   . GLN A 1 258 ? 43.609 -25.767 19.103  1.00 30.24 ? 257  GLN A N   1 
ATOM   1813 C CA  . GLN A 1 258 ? 44.273 -27.056 19.030  1.00 30.52 ? 257  GLN A CA  1 
ATOM   1814 C C   . GLN A 1 258 ? 45.687 -26.830 18.512  1.00 26.79 ? 257  GLN A C   1 
ATOM   1815 O O   . GLN A 1 258 ? 45.978 -25.790 17.927  1.00 27.30 ? 257  GLN A O   1 
ATOM   1816 C CB  . GLN A 1 258 ? 43.532 -27.970 18.042  1.00 35.15 ? 257  GLN A CB  1 
ATOM   1817 C CG  . GLN A 1 258 ? 42.139 -28.393 18.500  1.00 42.79 ? 257  GLN A CG  1 
ATOM   1818 C CD  . GLN A 1 258 ? 42.190 -29.471 19.567  1.00 46.92 ? 257  GLN A CD  1 
ATOM   1819 O OE1 . GLN A 1 258 ? 42.908 -30.464 19.433  1.00 49.38 ? 257  GLN A OE1 1 
ATOM   1820 N NE2 . GLN A 1 258 ? 41.433 -29.274 20.636  1.00 51.04 ? 257  GLN A NE2 1 
ATOM   1821 N N   . ARG A 1 259 ? 46.548 -27.820 18.690  1.00 25.12 ? 258  ARG A N   1 
ATOM   1822 C CA  . ARG A 1 259 ? 47.883 -27.747 18.162  1.00 26.02 ? 258  ARG A CA  1 
ATOM   1823 C C   . ARG A 1 259 ? 47.759 -27.881 16.657  1.00 25.64 ? 258  ARG A C   1 
ATOM   1824 O O   . ARG A 1 259 ? 47.258 -28.883 16.161  1.00 26.13 ? 258  ARG A O   1 
ATOM   1825 C CB  . ARG A 1 259 ? 48.769 -28.847 18.737  1.00 26.59 ? 258  ARG A CB  1 
ATOM   1826 C CG  . ARG A 1 259 ? 50.254 -28.638 18.496  1.00 29.92 ? 258  ARG A CG  1 
ATOM   1827 C CD  . ARG A 1 259 ? 50.685 -29.026 17.098  1.00 32.91 ? 258  ARG A CD  1 
ATOM   1828 N NE  . ARG A 1 259 ? 51.972 -28.421 16.759  1.00 35.04 ? 258  ARG A NE  1 
ATOM   1829 C CZ  . ARG A 1 259 ? 52.643 -28.657 15.636  1.00 39.76 ? 258  ARG A CZ  1 
ATOM   1830 N NH1 . ARG A 1 259 ? 52.146 -29.488 14.712  1.00 39.21 ? 258  ARG A NH1 1 
ATOM   1831 N NH2 . ARG A 1 259 ? 53.810 -28.054 15.435  1.00 39.89 ? 258  ARG A NH2 1 
ATOM   1832 N N   . VAL A 1 260 ? 48.174 -26.841 15.955  1.00 25.34 ? 259  VAL A N   1 
ATOM   1833 C CA  . VAL A 1 260 ? 48.156 -26.822 14.502  1.00 25.46 ? 259  VAL A CA  1 
ATOM   1834 C C   . VAL A 1 260 ? 49.516 -26.335 14.052  1.00 25.94 ? 259  VAL A C   1 
ATOM   1835 O O   . VAL A 1 260 ? 50.042 -25.348 14.582  1.00 26.30 ? 259  VAL A O   1 
ATOM   1836 C CB  . VAL A 1 260 ? 47.040 -25.908 13.934  1.00 24.53 ? 259  VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 260 ? 47.142 -25.826 12.413  1.00 25.39 ? 259  VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 260 ? 45.660 -26.423 14.344  1.00 24.68 ? 259  VAL A CG2 1 
ATOM   1839 N N   . SER A 1 261 ? 50.082 -27.034 13.066  1.00 25.46 ? 260  SER A N   1 
ATOM   1840 C CA  . SER A 1 261 ? 51.378 -26.677 12.512  1.00 25.70 ? 260  SER A CA  1 
ATOM   1841 C C   . SER A 1 261 ? 51.445 -25.234 12.020  1.00 26.99 ? 260  SER A C   1 
ATOM   1842 O O   . SER A 1 261 ? 50.444 -24.650 11.596  1.00 25.07 ? 260  SER A O   1 
ATOM   1843 C CB  . SER A 1 261 ? 51.778 -27.648 11.383  1.00 27.39 ? 260  SER A CB  1 
ATOM   1844 O OG  . SER A 1 261 ? 51.079 -27.341 10.172  1.00 25.86 ? 260  SER A OG  1 
HETATM 1845 N N   . SEP A 1 262 ? 52.647 -24.666 12.080  1.00 26.01 ? 261  SEP A N   1 
HETATM 1846 C CA  . SEP A 1 262 ? 52.882 -23.298 11.640  1.00 28.23 ? 261  SEP A CA  1 
HETATM 1847 C CB  . SEP A 1 262 ? 54.368 -22.973 11.773  1.00 30.67 ? 261  SEP A CB  1 
HETATM 1848 O OG  . SEP A 1 262 ? 54.731 -23.089 13.147  1.00 33.64 ? 261  SEP A OG  1 
HETATM 1849 C C   . SEP A 1 262 ? 52.463 -23.121 10.206  1.00 27.46 ? 261  SEP A C   1 
HETATM 1850 O O   . SEP A 1 262 ? 51.900 -22.094 9.864   1.00 25.36 ? 261  SEP A O   1 
HETATM 1851 P P   . SEP A 1 262 ? 55.618 -24.355 13.703  1.00 40.98 ? 261  SEP A P   1 
HETATM 1852 O O1P . SEP A 1 262 ? 55.734 -23.988 15.185  1.00 36.45 ? 261  SEP A O1P 1 
HETATM 1853 O O2P . SEP A 1 262 ? 54.849 -25.618 13.328  1.00 36.13 ? 261  SEP A O2P 1 
HETATM 1854 O O3P . SEP A 1 262 ? 56.942 -24.284 12.977  1.00 37.64 ? 261  SEP A O3P 1 
ATOM   1855 N N   . GLU A 1 263 ? 52.732 -24.116 9.357   1.00 26.03 ? 262  GLU A N   1 
ATOM   1856 C CA  . GLU A 1 263 ? 52.407 -23.974 7.932   1.00 28.11 ? 262  GLU A CA  1 
ATOM   1857 C C   . GLU A 1 263 ? 50.903 -24.004 7.719   1.00 24.79 ? 262  GLU A C   1 
ATOM   1858 O O   . GLU A 1 263 ? 50.371 -23.211 6.950   1.00 23.57 ? 262  GLU A O   1 
ATOM   1859 C CB  . GLU A 1 263 ? 53.146 -25.001 7.071   1.00 29.62 ? 262  GLU A CB  1 
ATOM   1860 C CG  . GLU A 1 263 ? 54.640 -24.693 7.026   1.00 37.48 ? 262  GLU A CG  1 
ATOM   1861 C CD  . GLU A 1 263 ? 55.442 -25.650 6.168   1.00 46.03 ? 262  GLU A CD  1 
ATOM   1862 O OE1 . GLU A 1 263 ? 54.930 -26.747 5.841   1.00 52.13 ? 262  GLU A OE1 1 
ATOM   1863 O OE2 . GLU A 1 263 ? 56.599 -25.296 5.820   1.00 51.50 ? 262  GLU A OE2 1 
ATOM   1864 N N   . CYS A 1 264 ? 50.214 -24.885 8.436   1.00 24.28 ? 263  CYS A N   1 
ATOM   1865 C CA  . CYS A 1 264 ? 48.760 -24.897 8.378   1.00 23.84 ? 263  CYS A CA  1 
ATOM   1866 C C   . CYS A 1 264 ? 48.163 -23.587 8.899   1.00 24.24 ? 263  CYS A C   1 
ATOM   1867 O O   . CYS A 1 264 ? 47.282 -23.010 8.258   1.00 24.15 ? 263  CYS A O   1 
ATOM   1868 C CB  . CYS A 1 264 ? 48.183 -26.091 9.121   1.00 24.78 ? 263  CYS A CB  1 
ATOM   1869 S SG  . CYS A 1 264 ? 46.387 -26.224 8.916   1.00 28.23 ? 263  CYS A SG  1 
ATOM   1870 N N   . GLN A 1 265 ? 48.650 -23.105 10.045  1.00 23.92 ? 264  GLN A N   1 
ATOM   1871 C CA  . GLN A 1 265 ? 48.186 -21.830 10.592  1.00 24.25 ? 264  GLN A CA  1 
ATOM   1872 C C   . GLN A 1 265 ? 48.352 -20.694 9.583   1.00 23.39 ? 264  GLN A C   1 
ATOM   1873 O O   . GLN A 1 265 ? 47.465 -19.847 9.440   1.00 25.16 ? 264  GLN A O   1 
ATOM   1874 C CB  . GLN A 1 265 ? 48.965 -21.462 11.875  1.00 24.70 ? 264  GLN A CB  1 
ATOM   1875 C CG  . GLN A 1 265 ? 48.664 -22.336 13.095  1.00 24.38 ? 264  GLN A CG  1 
ATOM   1876 C CD  . GLN A 1 265 ? 49.074 -21.649 14.395  1.00 24.57 ? 264  GLN A CD  1 
ATOM   1877 O OE1 . GLN A 1 265 ? 49.357 -20.456 14.403  1.00 27.18 ? 264  GLN A OE1 1 
ATOM   1878 N NE2 . GLN A 1 265 ? 49.091 -22.396 15.495  1.00 23.43 ? 264  GLN A NE2 1 
ATOM   1879 N N   . HIS A 1 266 ? 49.501 -20.670 8.905   1.00 24.44 ? 265  HIS A N   1 
ATOM   1880 C CA  . HIS A 1 266 ? 49.801 -19.636 7.918   1.00 26.23 ? 265  HIS A CA  1 
ATOM   1881 C C   . HIS A 1 266 ? 48.785 -19.648 6.805   1.00 24.76 ? 265  HIS A C   1 
ATOM   1882 O O   . HIS A 1 266 ? 48.252 -18.606 6.425   1.00 23.46 ? 265  HIS A O   1 
ATOM   1883 C CB  . HIS A 1 266 ? 51.213 -19.811 7.340   1.00 27.39 ? 265  HIS A CB  1 
ATOM   1884 C CG  . HIS A 1 266 ? 51.529 -18.835 6.227   1.00 29.17 ? 265  HIS A CG  1 
ATOM   1885 N ND1 . HIS A 1 266 ? 51.259 -19.101 4.939   1.00 29.11 ? 265  HIS A ND1 1 
ATOM   1886 C CD2 . HIS A 1 266 ? 52.082 -17.548 6.258   1.00 30.73 ? 265  HIS A CD2 1 
ATOM   1887 C CE1 . HIS A 1 266 ? 51.621 -18.048 4.172   1.00 31.55 ? 265  HIS A CE1 1 
ATOM   1888 N NE2 . HIS A 1 266 ? 52.124 -17.097 4.981   1.00 32.19 ? 265  HIS A NE2 1 
ATOM   1889 N N   . LEU A 1 267 ? 48.491 -20.836 6.291   1.00 23.58 ? 266  LEU A N   1 
ATOM   1890 C CA  . LEU A 1 267 ? 47.512 -20.953 5.205   1.00 23.40 ? 266  LEU A CA  1 
ATOM   1891 C C   . LEU A 1 267 ? 46.122 -20.485 5.643   1.00 22.93 ? 266  LEU A C   1 
ATOM   1892 O O   . LEU A 1 267 ? 45.434 -19.757 4.919   1.00 22.49 ? 266  LEU A O   1 
ATOM   1893 C CB  . LEU A 1 267 ? 47.472 -22.380 4.660   1.00 21.68 ? 266  LEU A CB  1 
ATOM   1894 C CG  . LEU A 1 267 ? 46.431 -22.663 3.573   1.00 22.73 ? 266  LEU A CG  1 
ATOM   1895 C CD1 . LEU A 1 267 ? 46.564 -21.732 2.354   1.00 22.36 ? 266  LEU A CD1 1 
ATOM   1896 C CD2 . LEU A 1 267 ? 46.472 -24.129 3.131   1.00 23.30 ? 266  LEU A CD2 1 
ATOM   1897 N N   . ILE A 1 268 ? 45.714 -20.907 6.834   1.00 22.92 ? 267  ILE A N   1 
ATOM   1898 C CA  . ILE A 1 268 ? 44.426 -20.481 7.372   1.00 22.81 ? 267  ILE A CA  1 
ATOM   1899 C C   . ILE A 1 268 ? 44.360 -18.965 7.472   1.00 23.30 ? 267  ILE A C   1 
ATOM   1900 O O   . ILE A 1 268 ? 43.390 -18.342 7.039   1.00 23.65 ? 267  ILE A O   1 
ATOM   1901 C CB  . ILE A 1 268 ? 44.128 -21.138 8.729   1.00 21.98 ? 267  ILE A CB  1 
ATOM   1902 C CG1 . ILE A 1 268 ? 43.954 -22.654 8.519   1.00 22.06 ? 267  ILE A CG1 1 
ATOM   1903 C CG2 . ILE A 1 268 ? 42.882 -20.523 9.352   1.00 20.76 ? 267  ILE A CG2 1 
ATOM   1904 C CD1 . ILE A 1 268 ? 43.933 -23.509 9.780   1.00 23.33 ? 267  ILE A CD1 1 
ATOM   1905 N N   . ARG A 1 269 ? 45.399 -18.370 8.038   1.00 23.71 ? 268  ARG A N   1 
ATOM   1906 C CA  . ARG A 1 269 ? 45.371 -16.942 8.287   1.00 24.44 ? 268  ARG A CA  1 
ATOM   1907 C C   . ARG A 1 269 ? 45.402 -16.194 6.976   1.00 23.78 ? 268  ARG A C   1 
ATOM   1908 O O   . ARG A 1 269 ? 44.854 -15.095 6.859   1.00 23.67 ? 268  ARG A O   1 
ATOM   1909 C CB  . ARG A 1 269 ? 46.544 -16.525 9.158   1.00 25.53 ? 268  ARG A CB  1 
ATOM   1910 C CG  . ARG A 1 269 ? 46.317 -16.900 10.609  1.00 27.80 ? 268  ARG A CG  1 
ATOM   1911 C CD  . ARG A 1 269 ? 47.233 -16.140 11.550  1.00 30.40 ? 268  ARG A CD  1 
ATOM   1912 N NE  . ARG A 1 269 ? 46.811 -16.374 12.934  1.00 32.02 ? 268  ARG A NE  1 
ATOM   1913 C CZ  . ARG A 1 269 ? 47.334 -17.299 13.734  1.00 32.32 ? 268  ARG A CZ  1 
ATOM   1914 N NH1 . ARG A 1 269 ? 48.329 -18.086 13.313  1.00 32.40 ? 268  ARG A NH1 1 
ATOM   1915 N NH2 . ARG A 1 269 ? 46.868 -17.424 14.960  1.00 34.03 ? 268  ARG A NH2 1 
ATOM   1916 N N   . TRP A 1 270 ? 46.029 -16.810 5.986   1.00 23.06 ? 269  TRP A N   1 
ATOM   1917 C CA  . TRP A 1 270 ? 46.064 -16.222 4.652   1.00 23.61 ? 269  TRP A CA  1 
ATOM   1918 C C   . TRP A 1 270 ? 44.711 -16.259 3.985   1.00 23.49 ? 269  TRP A C   1 
ATOM   1919 O O   . TRP A 1 270 ? 44.242 -15.244 3.446   1.00 21.52 ? 269  TRP A O   1 
ATOM   1920 C CB  . TRP A 1 270 ? 47.143 -16.917 3.835   1.00 24.25 ? 269  TRP A CB  1 
ATOM   1921 C CG  . TRP A 1 270 ? 47.525 -16.226 2.554   1.00 25.02 ? 269  TRP A CG  1 
ATOM   1922 C CD1 . TRP A 1 270 ? 47.207 -14.923 2.133   1.00 26.12 ? 269  TRP A CD1 1 
ATOM   1923 C CD2 . TRP A 1 270 ? 48.340 -16.786 1.488   1.00 25.95 ? 269  TRP A CD2 1 
ATOM   1924 N NE1 . TRP A 1 270 ? 47.754 -14.666 0.891   1.00 25.86 ? 269  TRP A NE1 1 
ATOM   1925 C CE2 . TRP A 1 270 ? 48.450 -15.743 0.455   1.00 25.85 ? 269  TRP A CE2 1 
ATOM   1926 C CE3 . TRP A 1 270 ? 48.989 -18.002 1.295   1.00 26.30 ? 269  TRP A CE3 1 
ATOM   1927 C CZ2 . TRP A 1 270 ? 49.162 -15.949 -0.713  1.00 27.13 ? 269  TRP A CZ2 1 
ATOM   1928 C CZ3 . TRP A 1 270 ? 49.711 -18.190 0.115   1.00 27.40 ? 269  TRP A CZ3 1 
ATOM   1929 C CH2 . TRP A 1 270 ? 49.795 -17.185 -0.861  1.00 26.25 ? 269  TRP A CH2 1 
ATOM   1930 N N   . CYS A 1 271 ? 44.040 -17.421 4.022   1.00 22.60 ? 270  CYS A N   1 
ATOM   1931 C CA  . CYS A 1 271 ? 42.668 -17.517 3.523   1.00 21.36 ? 270  CYS A CA  1 
ATOM   1932 C C   . CYS A 1 271 ? 41.711 -16.554 4.208   1.00 21.49 ? 270  CYS A C   1 
ATOM   1933 O O   . CYS A 1 271 ? 40.765 -16.056 3.588   1.00 21.29 ? 270  CYS A O   1 
ATOM   1934 C CB  . CYS A 1 271 ? 42.131 -18.951 3.703   1.00 21.28 ? 270  CYS A CB  1 
ATOM   1935 S SG  . CYS A 1 271 ? 42.950 -20.128 2.619   1.00 23.76 ? 270  CYS A SG  1 
ATOM   1936 N N   . LEU A 1 272 ? 41.963 -16.310 5.490   1.00 21.75 ? 271  LEU A N   1 
ATOM   1937 C CA  . LEU A 1 272 ? 41.137 -15.434 6.294   1.00 23.27 ? 271  LEU A CA  1 
ATOM   1938 C C   . LEU A 1 272 ? 41.657 -13.994 6.385   1.00 25.82 ? 271  LEU A C   1 
ATOM   1939 O O   . LEU A 1 272 ? 41.337 -13.278 7.335   1.00 24.02 ? 271  LEU A O   1 
ATOM   1940 C CB  . LEU A 1 272 ? 40.944 -16.026 7.691   1.00 22.86 ? 271  LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 272 ? 40.258 -17.398 7.727   1.00 22.57 ? 271  LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 272 ? 40.114 -17.877 9.171   1.00 22.43 ? 271  LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 272 ? 38.900 -17.348 7.026   1.00 21.48 ? 271  LEU A CD2 1 
ATOM   1944 N N   . ALA A 1 273 ? 42.435 -13.566 5.392   1.00 26.88 ? 272  ALA A N   1 
ATOM   1945 C CA  . ALA A 1 273 ? 42.836 -12.149 5.304   1.00 27.28 ? 272  ALA A CA  1 
ATOM   1946 C C   . ALA A 1 273 ? 41.599 -11.285 5.246   1.00 28.06 ? 272  ALA A C   1 
ATOM   1947 O O   . ALA A 1 273 ? 40.644 -11.592 4.523   1.00 26.18 ? 272  ALA A O   1 
ATOM   1948 C CB  . ALA A 1 273 ? 43.726 -11.903 4.089   1.00 27.67 ? 272  ALA A CB  1 
ATOM   1949 N N   . LEU A 1 274 ? 41.600 -10.214 6.035   1.00 29.24 ? 273  LEU A N   1 
ATOM   1950 C CA  . LEU A 1 274 ? 40.462 -9.303  6.064   1.00 29.85 ? 273  LEU A CA  1 
ATOM   1951 C C   . LEU A 1 274 ? 40.202 -8.674  4.691   1.00 29.67 ? 273  LEU A C   1 
ATOM   1952 O O   . LEU A 1 274 ? 39.066 -8.591  4.253   1.00 28.79 ? 273  LEU A O   1 
ATOM   1953 C CB  . LEU A 1 274 ? 40.660 -8.224  7.139   1.00 32.64 ? 273  LEU A CB  1 
ATOM   1954 C CG  . LEU A 1 274 ? 40.443 -8.674  8.593   1.00 33.90 ? 273  LEU A CG  1 
ATOM   1955 C CD1 . LEU A 1 274 ? 40.641 -7.510  9.560   1.00 35.36 ? 273  LEU A CD1 1 
ATOM   1956 C CD2 . LEU A 1 274 ? 39.061 -9.308  8.767   1.00 34.23 ? 273  LEU A CD2 1 
ATOM   1957 N N   . ARG A 1 275 ? 41.255 -8.238  4.015   1.00 30.80 ? 274  ARG A N   1 
ATOM   1958 C CA  . ARG A 1 275 ? 41.094 -7.627  2.701   1.00 32.32 ? 274  ARG A CA  1 
ATOM   1959 C C   . ARG A 1 275 ? 41.013 -8.741  1.661   1.00 29.27 ? 274  ARG A C   1 
ATOM   1960 O O   . ARG A 1 275 ? 41.917 -9.567  1.582   1.00 28.31 ? 274  ARG A O   1 
ATOM   1961 C CB  . ARG A 1 275 ? 42.251 -6.683  2.384   1.00 37.57 ? 274  ARG A CB  1 
ATOM   1962 C CG  . ARG A 1 275 ? 42.339 -5.471  3.309   1.00 45.61 ? 274  ARG A CG  1 
ATOM   1963 C CD  . ARG A 1 275 ? 43.646 -4.710  3.101   1.00 52.61 ? 274  ARG A CD  1 
ATOM   1964 N NE  . ARG A 1 275 ? 43.716 -4.094  1.772   1.00 59.63 ? 274  ARG A NE  1 
ATOM   1965 C CZ  . ARG A 1 275 ? 44.815 -4.034  1.019   1.00 65.75 ? 274  ARG A CZ  1 
ATOM   1966 N NH1 . ARG A 1 275 ? 45.959 -4.569  1.443   1.00 66.27 ? 274  ARG A NH1 1 
ATOM   1967 N NH2 . ARG A 1 275 ? 44.768 -3.447  -0.172  1.00 67.93 ? 274  ARG A NH2 1 
ATOM   1968 N N   . PRO A 1 276 ? 39.923 -8.776  0.877   1.00 27.85 ? 275  PRO A N   1 
ATOM   1969 C CA  . PRO A 1 276 ? 39.741 -9.876  -0.081  1.00 28.84 ? 275  PRO A CA  1 
ATOM   1970 C C   . PRO A 1 276 ? 40.944 -10.072 -1.006  1.00 29.44 ? 275  PRO A C   1 
ATOM   1971 O O   . PRO A 1 276 ? 41.322 -11.204 -1.287  1.00 28.12 ? 275  PRO A O   1 
ATOM   1972 C CB  . PRO A 1 276 ? 38.505 -9.450  -0.873  1.00 27.50 ? 275  PRO A CB  1 
ATOM   1973 C CG  . PRO A 1 276 ? 37.715 -8.650  0.122   1.00 28.29 ? 275  PRO A CG  1 
ATOM   1974 C CD  . PRO A 1 276 ? 38.744 -7.888  0.923   1.00 28.14 ? 275  PRO A CD  1 
ATOM   1975 N N   . SER A 1 277 ? 41.561 -8.973  -1.450  1.00 31.05 ? 276  SER A N   1 
ATOM   1976 C CA  . SER A 1 277 ? 42.721 -9.053  -2.345  1.00 30.79 ? 276  SER A CA  1 
ATOM   1977 C C   . SER A 1 277 ? 43.986 -9.565  -1.653  1.00 31.69 ? 276  SER A C   1 
ATOM   1978 O O   . SER A 1 277 ? 44.956 -9.905  -2.313  1.00 32.64 ? 276  SER A O   1 
ATOM   1979 C CB  . SER A 1 277 ? 42.987 -7.680  -2.992  1.00 32.53 ? 276  SER A CB  1 
ATOM   1980 O OG  . SER A 1 277 ? 43.380 -6.737  -2.002  1.00 34.96 ? 276  SER A OG  1 
ATOM   1981 N N   . ASP A 1 278 ? 43.990 -9.628  -0.325  1.00 29.11 ? 277  ASP A N   1 
ATOM   1982 C CA  . ASP A 1 278 ? 45.118 -10.210 0.365   1.00 29.09 ? 277  ASP A CA  1 
ATOM   1983 C C   . ASP A 1 278 ? 45.009 -11.736 0.462   1.00 28.69 ? 277  ASP A C   1 
ATOM   1984 O O   . ASP A 1 278 ? 45.943 -12.372 0.917   1.00 28.75 ? 277  ASP A O   1 
ATOM   1985 C CB  . ASP A 1 278 ? 45.284 -9.620  1.770   1.00 30.91 ? 277  ASP A CB  1 
ATOM   1986 C CG  . ASP A 1 278 ? 45.879 -8.212  1.750   1.00 34.65 ? 277  ASP A CG  1 
ATOM   1987 O OD1 . ASP A 1 278 ? 46.527 -7.865  0.754   1.00 33.64 ? 277  ASP A OD1 1 
ATOM   1988 O OD2 . ASP A 1 278 ? 45.684 -7.466  2.726   1.00 35.66 ? 277  ASP A OD2 1 
ATOM   1989 N N   . ARG A 1 279 ? 43.886 -12.310 0.029   1.00 26.10 ? 278  ARG A N   1 
ATOM   1990 C CA  . ARG A 1 279 ? 43.677 -13.765 0.171   1.00 25.21 ? 278  ARG A CA  1 
ATOM   1991 C C   . ARG A 1 279 ? 44.372 -14.497 -0.958  1.00 25.71 ? 278  ARG A C   1 
ATOM   1992 O O   . ARG A 1 279 ? 44.512 -13.938 -2.051  1.00 27.81 ? 278  ARG A O   1 
ATOM   1993 C CB  . ARG A 1 279 ? 42.186 -14.111 0.169   1.00 22.67 ? 278  ARG A CB  1 
ATOM   1994 C CG  . ARG A 1 279 ? 41.470 -13.596 1.414   1.00 23.01 ? 278  ARG A CG  1 
ATOM   1995 C CD  . ARG A 1 279 ? 39.964 -13.806 1.397   1.00 22.46 ? 278  ARG A CD  1 
ATOM   1996 N NE  . ARG A 1 279 ? 39.412 -12.849 2.358   1.00 22.52 ? 278  ARG A NE  1 
ATOM   1997 C CZ  . ARG A 1 279 ? 38.228 -12.257 2.260   1.00 23.15 ? 278  ARG A CZ  1 
ATOM   1998 N NH1 . ARG A 1 279 ? 37.395 -12.555 1.269   1.00 21.64 ? 278  ARG A NH1 1 
ATOM   1999 N NH2 . ARG A 1 279 ? 37.884 -11.348 3.174   1.00 23.02 ? 278  ARG A NH2 1 
ATOM   2000 N N   . PRO A 1 280 ? 44.786 -15.757 -0.719  1.00 24.77 ? 279  PRO A N   1 
ATOM   2001 C CA  . PRO A 1 280 ? 45.438 -16.508 -1.791  1.00 24.35 ? 279  PRO A CA  1 
ATOM   2002 C C   . PRO A 1 280 ? 44.459 -16.849 -2.904  1.00 25.57 ? 279  PRO A C   1 
ATOM   2003 O O   . PRO A 1 280 ? 43.256 -17.006 -2.659  1.00 25.83 ? 279  PRO A O   1 
ATOM   2004 C CB  . PRO A 1 280 ? 45.873 -17.803 -1.096  1.00 24.77 ? 279  PRO A CB  1 
ATOM   2005 C CG  . PRO A 1 280 ? 44.890 -17.959 0.035   1.00 24.56 ? 279  PRO A CG  1 
ATOM   2006 C CD  . PRO A 1 280 ? 44.690 -16.553 0.523   1.00 23.97 ? 279  PRO A CD  1 
ATOM   2007 N N   . THR A 1 281 ? 44.969 -16.979 -4.122  1.00 24.50 ? 280  THR A N   1 
ATOM   2008 C CA  . THR A 1 281 ? 44.171 -17.536 -5.205  1.00 26.13 ? 280  THR A CA  1 
ATOM   2009 C C   . THR A 1 281 ? 44.103 -19.053 -4.984  1.00 25.20 ? 280  THR A C   1 
ATOM   2010 O O   . THR A 1 281 ? 44.859 -19.600 -4.172  1.00 23.69 ? 280  THR A O   1 
ATOM   2011 C CB  . THR A 1 281 ? 44.861 -17.286 -6.549  1.00 26.48 ? 280  THR A CB  1 
ATOM   2012 O OG1 . THR A 1 281 ? 46.102 -17.993 -6.556  1.00 27.85 ? 280  THR A OG1 1 
ATOM   2013 C CG2 . THR A 1 281 ? 45.140 -15.768 -6.733  1.00 27.92 ? 280  THR A CG2 1 
ATOM   2014 N N   . PHE A 1 282 ? 43.226 -19.746 -5.703  1.00 25.85 ? 281  PHE A N   1 
ATOM   2015 C CA  . PHE A 1 282 ? 43.203 -21.197 -5.559  1.00 26.55 ? 281  PHE A CA  1 
ATOM   2016 C C   . PHE A 1 282 ? 44.551 -21.812 -5.887  1.00 26.72 ? 281  PHE A C   1 
ATOM   2017 O O   . PHE A 1 282 ? 44.986 -22.740 -5.223  1.00 24.94 ? 281  PHE A O   1 
ATOM   2018 C CB  . PHE A 1 282 ? 42.089 -21.815 -6.382  1.00 27.12 ? 281  PHE A CB  1 
ATOM   2019 C CG  . PHE A 1 282 ? 40.758 -21.666 -5.732  1.00 28.02 ? 281  PHE A CG  1 
ATOM   2020 C CD1 . PHE A 1 282 ? 40.093 -20.459 -5.767  1.00 29.67 ? 281  PHE A CD1 1 
ATOM   2021 C CD2 . PHE A 1 282 ? 40.215 -22.708 -5.004  1.00 31.19 ? 281  PHE A CD2 1 
ATOM   2022 C CE1 . PHE A 1 282 ? 38.870 -20.293 -5.129  1.00 29.78 ? 281  PHE A CE1 1 
ATOM   2023 C CE2 . PHE A 1 282 ? 38.993 -22.555 -4.367  1.00 31.37 ? 281  PHE A CE2 1 
ATOM   2024 C CZ  . PHE A 1 282 ? 38.325 -21.339 -4.431  1.00 28.86 ? 281  PHE A CZ  1 
ATOM   2025 N N   . GLU A 1 283 ? 45.228 -21.260 -6.893  1.00 26.78 ? 282  GLU A N   1 
ATOM   2026 C CA  . GLU A 1 283 ? 46.542 -21.766 -7.265  1.00 27.27 ? 282  GLU A CA  1 
ATOM   2027 C C   . GLU A 1 283 ? 47.514 -21.584 -6.106  1.00 25.19 ? 282  GLU A C   1 
ATOM   2028 O O   . GLU A 1 283 ? 48.294 -22.491 -5.793  1.00 25.08 ? 282  GLU A O   1 
ATOM   2029 C CB  . GLU A 1 283 ? 47.040 -21.090 -8.551  1.00 28.18 ? 282  GLU A CB  1 
ATOM   2030 C CG  . GLU A 1 283 ? 48.478 -21.428 -8.906  1.00 31.16 ? 282  GLU A CG  1 
ATOM   2031 C CD  . GLU A 1 283 ? 48.920 -20.750 -10.198 1.00 35.77 ? 282  GLU A CD  1 
ATOM   2032 O OE1 . GLU A 1 283 ? 48.320 -19.719 -10.563 1.00 37.25 ? 282  GLU A OE1 1 
ATOM   2033 O OE2 . GLU A 1 283 ? 49.851 -21.259 -10.842 1.00 37.94 ? 282  GLU A OE2 1 
ATOM   2034 N N   . GLU A 1 284 ? 47.441 -20.433 -5.440  1.00 25.16 ? 283  GLU A N   1 
ATOM   2035 C CA  . GLU A 1 284 ? 48.328 -20.154 -4.319  1.00 25.21 ? 283  GLU A CA  1 
ATOM   2036 C C   . GLU A 1 284 ? 48.043 -21.070 -3.134  1.00 24.14 ? 283  GLU A C   1 
ATOM   2037 O O   . GLU A 1 284 ? 48.957 -21.516 -2.446  1.00 24.81 ? 283  GLU A O   1 
ATOM   2038 C CB  . GLU A 1 284 ? 48.240 -18.701 -3.891  1.00 26.48 ? 283  GLU A CB  1 
ATOM   2039 C CG  . GLU A 1 284 ? 49.018 -17.759 -4.806  1.00 30.31 ? 283  GLU A CG  1 
ATOM   2040 C CD  . GLU A 1 284 ? 48.806 -16.314 -4.414  1.00 32.00 ? 283  GLU A CD  1 
ATOM   2041 O OE1 . GLU A 1 284 ? 47.648 -15.932 -4.123  1.00 32.16 ? 283  GLU A OE1 1 
ATOM   2042 O OE2 . GLU A 1 284 ? 49.803 -15.570 -4.374  1.00 33.77 ? 283  GLU A OE2 1 
ATOM   2043 N N   . ILE A 1 285 ? 46.775 -21.370 -2.903  1.00 23.33 ? 284  ILE A N   1 
ATOM   2044 C CA  . ILE A 1 285 ? 46.459 -22.320 -1.831  1.00 22.51 ? 284  ILE A CA  1 
ATOM   2045 C C   . ILE A 1 285 ? 47.087 -23.675 -2.139  1.00 22.36 ? 284  ILE A C   1 
ATOM   2046 O O   . ILE A 1 285 ? 47.768 -24.266 -1.296  1.00 24.10 ? 284  ILE A O   1 
ATOM   2047 C CB  . ILE A 1 285 ? 44.945 -22.481 -1.675  1.00 21.92 ? 284  ILE A CB  1 
ATOM   2048 C CG1 . ILE A 1 285 ? 44.323 -21.151 -1.230  1.00 21.08 ? 284  ILE A CG1 1 
ATOM   2049 C CG2 . ILE A 1 285 ? 44.625 -23.603 -0.690  1.00 22.04 ? 284  ILE A CG2 1 
ATOM   2050 C CD1 . ILE A 1 285 ? 42.808 -21.231 -1.163  1.00 21.12 ? 284  ILE A CD1 1 
ATOM   2051 N N   . GLN A 1 286 ? 46.865 -24.163 -3.350  1.00 22.86 ? 285  GLN A N   1 
ATOM   2052 C CA  . GLN A 1 286 ? 47.333 -25.508 -3.693  1.00 24.26 ? 285  GLN A CA  1 
ATOM   2053 C C   . GLN A 1 286 ? 48.841 -25.629 -3.835  1.00 24.98 ? 285  GLN A C   1 
ATOM   2054 O O   . GLN A 1 286 ? 49.374 -26.724 -3.770  1.00 25.40 ? 285  GLN A O   1 
ATOM   2055 C CB  . GLN A 1 286 ? 46.614 -26.006 -4.936  1.00 23.81 ? 285  GLN A CB  1 
ATOM   2056 C CG  . GLN A 1 286 ? 45.178 -26.375 -4.608  1.00 24.13 ? 285  GLN A CG  1 
ATOM   2057 C CD  . GLN A 1 286 ? 44.510 -27.089 -5.745  1.00 24.90 ? 285  GLN A CD  1 
ATOM   2058 O OE1 . GLN A 1 286 ? 44.370 -26.532 -6.834  1.00 25.42 ? 285  GLN A OE1 1 
ATOM   2059 N NE2 . GLN A 1 286 ? 44.098 -28.327 -5.507  1.00 25.26 ? 285  GLN A NE2 1 
ATOM   2060 N N   . ASN A 1 287 ? 49.514 -24.496 -4.029  1.00 25.38 ? 286  ASN A N   1 
ATOM   2061 C CA  . ASN A 1 287 ? 50.973 -24.458 -4.051  1.00 27.23 ? 286  ASN A CA  1 
ATOM   2062 C C   . ASN A 1 287 ? 51.580 -24.202 -2.683  1.00 27.67 ? 286  ASN A C   1 
ATOM   2063 O O   . ASN A 1 287 ? 52.805 -24.219 -2.534  1.00 27.09 ? 286  ASN A O   1 
ATOM   2064 C CB  . ASN A 1 287 ? 51.474 -23.402 -5.057  1.00 27.19 ? 286  ASN A CB  1 
ATOM   2065 C CG  . ASN A 1 287 ? 51.318 -23.850 -6.493  1.00 28.90 ? 286  ASN A CG  1 
ATOM   2066 O OD1 . ASN A 1 287 ? 51.333 -25.042 -6.787  1.00 30.16 ? 286  ASN A OD1 1 
ATOM   2067 N ND2 . ASN A 1 287 ? 51.184 -22.898 -7.395  1.00 31.35 ? 286  ASN A ND2 1 
ATOM   2068 N N   . HIS A 1 288 ? 50.732 -23.992 -1.671  1.00 25.55 ? 287  HIS A N   1 
ATOM   2069 C CA  . HIS A 1 288 ? 51.225 -23.673 -0.336  1.00 25.90 ? 287  HIS A CA  1 
ATOM   2070 C C   . HIS A 1 288 ? 52.004 -24.846 0.205   1.00 26.42 ? 287  HIS A C   1 
ATOM   2071 O O   . HIS A 1 288 ? 51.649 -25.983 -0.068  1.00 26.41 ? 287  HIS A O   1 
ATOM   2072 C CB  . HIS A 1 288 ? 50.054 -23.339 0.583   1.00 25.49 ? 287  HIS A CB  1 
ATOM   2073 C CG  . HIS A 1 288 ? 50.475 -22.845 1.933   1.00 24.98 ? 287  HIS A CG  1 
ATOM   2074 N ND1 . HIS A 1 288 ? 50.483 -21.535 2.260   1.00 25.71 ? 287  HIS A ND1 1 
ATOM   2075 C CD2 . HIS A 1 288 ? 50.933 -23.534 3.038   1.00 22.80 ? 287  HIS A CD2 1 
ATOM   2076 C CE1 . HIS A 1 288 ? 50.904 -21.403 3.532   1.00 23.84 ? 287  HIS A CE1 1 
ATOM   2077 N NE2 . HIS A 1 288 ? 51.189 -22.635 4.000   1.00 26.03 ? 287  HIS A NE2 1 
ATOM   2078 N N   . PRO A 1 289 ? 53.095 -24.593 0.952   1.00 27.27 ? 288  PRO A N   1 
ATOM   2079 C CA  . PRO A 1 289 ? 53.864 -25.696 1.550   1.00 28.39 ? 288  PRO A CA  1 
ATOM   2080 C C   . PRO A 1 289 ? 53.025 -26.701 2.342   1.00 26.01 ? 288  PRO A C   1 
ATOM   2081 O O   . PRO A 1 289 ? 53.309 -27.900 2.301   1.00 26.29 ? 288  PRO A O   1 
ATOM   2082 C CB  . PRO A 1 289 ? 54.824 -24.971 2.495   1.00 29.41 ? 288  PRO A CB  1 
ATOM   2083 C CG  . PRO A 1 289 ? 55.071 -23.672 1.816   1.00 31.77 ? 288  PRO A CG  1 
ATOM   2084 C CD  . PRO A 1 289 ? 53.778 -23.296 1.132   1.00 28.73 ? 288  PRO A CD  1 
ATOM   2085 N N   . TRP A 1 290 ? 51.988 -26.235 3.038   1.00 24.95 ? 289  TRP A N   1 
ATOM   2086 C CA  . TRP A 1 290 ? 51.154 -27.165 3.795   1.00 25.97 ? 289  TRP A CA  1 
ATOM   2087 C C   . TRP A 1 290 ? 50.413 -28.141 2.916   1.00 26.00 ? 289  TRP A C   1 
ATOM   2088 O O   . TRP A 1 290 ? 50.084 -29.241 3.349   1.00 26.87 ? 289  TRP A O   1 
ATOM   2089 C CB  . TRP A 1 290 ? 50.188 -26.417 4.709   1.00 26.53 ? 289  TRP A CB  1 
ATOM   2090 C CG  . TRP A 1 290 ? 49.469 -27.371 5.617   1.00 25.98 ? 289  TRP A CG  1 
ATOM   2091 C CD1 . TRP A 1 290 ? 49.983 -28.036 6.731   1.00 26.81 ? 289  TRP A CD1 1 
ATOM   2092 C CD2 . TRP A 1 290 ? 48.098 -27.846 5.475   1.00 26.01 ? 289  TRP A CD2 1 
ATOM   2093 N NE1 . TRP A 1 290 ? 49.027 -28.854 7.285   1.00 27.17 ? 289  TRP A NE1 1 
ATOM   2094 C CE2 . TRP A 1 290 ? 47.872 -28.784 6.574   1.00 25.87 ? 289  TRP A CE2 1 
ATOM   2095 C CE3 . TRP A 1 290 ? 47.060 -27.593 4.576   1.00 26.24 ? 289  TRP A CE3 1 
ATOM   2096 C CZ2 . TRP A 1 290 ? 46.658 -29.428 6.749   1.00 27.01 ? 289  TRP A CZ2 1 
ATOM   2097 C CZ3 . TRP A 1 290 ? 45.835 -28.243 4.773   1.00 26.63 ? 289  TRP A CZ3 1 
ATOM   2098 C CH2 . TRP A 1 290 ? 45.638 -29.133 5.836   1.00 26.65 ? 289  TRP A CH2 1 
ATOM   2099 N N   . MET A 1 291 ? 50.155 -27.761 1.665   1.00 25.16 ? 290  MET A N   1 
ATOM   2100 C CA  . MET A 1 291 ? 49.342 -28.581 0.764   1.00 26.11 ? 290  MET A CA  1 
ATOM   2101 C C   . MET A 1 291 ? 50.108 -29.627 -0.044  1.00 29.56 ? 290  MET A C   1 
ATOM   2102 O O   . MET A 1 291 ? 49.512 -30.344 -0.859  1.00 29.52 ? 290  MET A O   1 
ATOM   2103 C CB  . MET A 1 291 ? 48.571 -27.686 -0.201  1.00 26.32 ? 290  MET A CB  1 
ATOM   2104 C CG  . MET A 1 291 ? 47.547 -26.807 0.513   1.00 28.02 ? 290  MET A CG  1 
ATOM   2105 S SD  . MET A 1 291 ? 45.857 -27.387 0.299   1.00 29.74 ? 290  MET A SD  1 
ATOM   2106 C CE  . MET A 1 291 ? 45.869 -28.969 1.114   1.00 26.01 ? 290  MET A CE  1 
ATOM   2107 N N   . GLN A 1 292 ? 51.411 -29.723 0.179   1.00 29.99 ? 291  GLN A N   1 
ATOM   2108 C CA  . GLN A 1 292 ? 52.238 -30.600 -0.644  1.00 32.04 ? 291  GLN A CA  1 
ATOM   2109 C C   . GLN A 1 292 ? 52.091 -32.059 -0.210  1.00 32.62 ? 291  GLN A C   1 
ATOM   2110 O O   . GLN A 1 292 ? 51.713 -32.334 0.929   1.00 32.24 ? 291  GLN A O   1 
ATOM   2111 C CB  . GLN A 1 292 ? 53.694 -30.109 -0.631  1.00 35.08 ? 291  GLN A CB  1 
ATOM   2112 C CG  . GLN A 1 292 ? 53.838 -28.678 -1.160  1.00 37.21 ? 291  GLN A CG  1 
ATOM   2113 C CD  . GLN A 1 292 ? 53.049 -28.431 -2.457  1.00 44.28 ? 291  GLN A CD  1 
ATOM   2114 O OE1 . GLN A 1 292 ? 53.379 -28.990 -3.508  1.00 49.43 ? 291  GLN A OE1 1 
ATOM   2115 N NE2 . GLN A 1 292 ? 51.993 -27.590 -2.385  1.00 39.67 ? 291  GLN A NE2 1 
ATOM   2116 N N   . ASP A 1 293 ? 52.321 -32.979 -1.143  1.00 33.17 ? 292  ASP A N   1 
ATOM   2117 C CA  . ASP A 1 293 ? 52.308 -34.425 -0.855  1.00 36.25 ? 292  ASP A CA  1 
ATOM   2118 C C   . ASP A 1 293 ? 50.974 -34.943 -0.323  1.00 33.01 ? 292  ASP A C   1 
ATOM   2119 O O   . ASP A 1 293 ? 50.940 -35.767 0.587   1.00 33.32 ? 292  ASP A O   1 
ATOM   2120 C CB  . ASP A 1 293 ? 53.448 -34.791 0.108   1.00 38.89 ? 292  ASP A CB  1 
ATOM   2121 C CG  . ASP A 1 293 ? 54.808 -34.338 -0.411  1.00 46.84 ? 292  ASP A CG  1 
ATOM   2122 O OD1 . ASP A 1 293 ? 55.165 -34.689 -1.564  1.00 48.59 ? 292  ASP A OD1 1 
ATOM   2123 O OD2 . ASP A 1 293 ? 55.511 -33.611 0.323   1.00 50.99 ? 292  ASP A OD2 1 
ATOM   2124 N N   . VAL A 1 294 ? 49.872 -34.457 -0.886  1.00 32.30 ? 293  VAL A N   1 
ATOM   2125 C CA  . VAL A 1 294 ? 48.551 -34.934 -0.470  1.00 29.91 ? 293  VAL A CA  1 
ATOM   2126 C C   . VAL A 1 294 ? 48.446 -36.443 -0.699  1.00 31.73 ? 293  VAL A C   1 
ATOM   2127 O O   . VAL A 1 294 ? 49.016 -36.979 -1.646  1.00 32.33 ? 293  VAL A O   1 
ATOM   2128 C CB  . VAL A 1 294 ? 47.399 -34.169 -1.184  1.00 30.91 ? 293  VAL A CB  1 
ATOM   2129 C CG1 . VAL A 1 294 ? 47.357 -34.497 -2.673  1.00 30.92 ? 293  VAL A CG1 1 
ATOM   2130 C CG2 . VAL A 1 294 ? 46.058 -34.491 -0.535  1.00 27.98 ? 293  VAL A CG2 1 
ATOM   2131 N N   . LEU A 1 295 ? 47.744 -37.121 0.191   1.00 29.46 ? 294  LEU A N   1 
ATOM   2132 C CA  . LEU A 1 295 ? 47.379 -38.508 -0.010  1.00 30.67 ? 294  LEU A CA  1 
ATOM   2133 C C   . LEU A 1 295 ? 46.379 -38.620 -1.145  1.00 30.70 ? 294  LEU A C   1 
ATOM   2134 O O   . LEU A 1 295 ? 45.580 -37.723 -1.357  1.00 31.15 ? 294  LEU A O   1 
ATOM   2135 C CB  . LEU A 1 295 ? 46.717 -39.063 1.250   1.00 30.19 ? 294  LEU A CB  1 
ATOM   2136 C CG  . LEU A 1 295 ? 47.541 -39.195 2.532   1.00 29.97 ? 294  LEU A CG  1 
ATOM   2137 C CD1 . LEU A 1 295 ? 46.622 -39.779 3.604   1.00 30.88 ? 294  LEU A CD1 1 
ATOM   2138 C CD2 . LEU A 1 295 ? 48.758 -40.076 2.312   1.00 32.21 ? 294  LEU A CD2 1 
ATOM   2139 N N   . LEU A 1 296 ? 46.423 -39.734 -1.865  1.00 31.06 ? 295  LEU A N   1 
ATOM   2140 C CA  . LEU A 1 296 ? 45.327 -40.116 -2.748  1.00 32.21 ? 295  LEU A CA  1 
ATOM   2141 C C   . LEU A 1 296 ? 44.069 -40.408 -1.922  1.00 30.10 ? 295  LEU A C   1 
ATOM   2142 O O   . LEU A 1 296 ? 44.175 -40.760 -0.744  1.00 29.17 ? 295  LEU A O   1 
ATOM   2143 C CB  . LEU A 1 296 ? 45.720 -41.352 -3.582  1.00 33.44 ? 295  LEU A CB  1 
ATOM   2144 C CG  . LEU A 1 296 ? 47.009 -41.266 -4.414  1.00 36.81 ? 295  LEU A CG  1 
ATOM   2145 C CD1 . LEU A 1 296 ? 47.279 -42.592 -5.122  1.00 39.10 ? 295  LEU A CD1 1 
ATOM   2146 C CD2 . LEU A 1 296 ? 46.977 -40.110 -5.410  1.00 39.87 ? 295  LEU A CD2 1 
ATOM   2147 N N   . PRO A 1 297 ? 42.876 -40.260 -2.526  1.00 29.60 ? 296  PRO A N   1 
ATOM   2148 C CA  . PRO A 1 297 ? 41.668 -40.584 -1.778  1.00 30.59 ? 296  PRO A CA  1 
ATOM   2149 C C   . PRO A 1 297 ? 41.658 -42.026 -1.248  1.00 33.64 ? 296  PRO A C   1 
ATOM   2150 O O   . PRO A 1 297 ? 41.257 -42.245 -0.103  1.00 30.51 ? 296  PRO A O   1 
ATOM   2151 C CB  . PRO A 1 297 ? 40.548 -40.364 -2.805  1.00 31.14 ? 296  PRO A CB  1 
ATOM   2152 C CG  . PRO A 1 297 ? 41.098 -39.300 -3.702  1.00 29.31 ? 296  PRO A CG  1 
ATOM   2153 C CD  . PRO A 1 297 ? 42.561 -39.650 -3.832  1.00 30.31 ? 296  PRO A CD  1 
ATOM   2154 N N   . GLN A 1 298 ? 42.122 -42.991 -2.048  1.00 34.28 ? 297  GLN A N   1 
ATOM   2155 C CA  . GLN A 1 298 ? 42.106 -44.387 -1.589  1.00 38.04 ? 297  GLN A CA  1 
ATOM   2156 C C   . GLN A 1 298 ? 43.058 -44.610 -0.403  1.00 35.71 ? 297  GLN A C   1 
ATOM   2157 O O   . GLN A 1 298 ? 42.696 -45.306 0.551   1.00 36.41 ? 297  GLN A O   1 
ATOM   2158 C CB  . GLN A 1 298 ? 42.367 -45.381 -2.742  1.00 41.50 ? 297  GLN A CB  1 
ATOM   2159 C CG  . GLN A 1 298 ? 41.967 -46.840 -2.463  1.00 44.57 ? 297  GLN A CG  1 
ATOM   2160 C CD  . GLN A 1 298 ? 40.635 -47.006 -1.726  1.00 49.32 ? 297  GLN A CD  1 
ATOM   2161 O OE1 . GLN A 1 298 ? 39.558 -46.714 -2.257  1.00 49.99 ? 297  GLN A OE1 1 
ATOM   2162 N NE2 . GLN A 1 298 ? 40.707 -47.498 -0.492  1.00 52.60 ? 297  GLN A NE2 1 
ATOM   2163 N N   . GLU A 1 299 ? 44.247 -44.008 -0.463  1.00 34.13 ? 298  GLU A N   1 
ATOM   2164 C CA  . GLU A 1 299 ? 45.210 -44.052 0.645   1.00 36.72 ? 298  GLU A CA  1 
ATOM   2165 C C   . GLU A 1 299 ? 44.602 -43.412 1.882   1.00 36.63 ? 298  GLU A C   1 
ATOM   2166 O O   . GLU A 1 299 ? 44.802 -43.872 3.016   1.00 32.81 ? 298  GLU A O   1 
ATOM   2167 C CB  . GLU A 1 299 ? 46.487 -43.292 0.296   1.00 39.34 ? 298  GLU A CB  1 
ATOM   2168 C CG  . GLU A 1 299 ? 47.147 -43.724 -1.000  1.00 45.59 ? 298  GLU A CG  1 
ATOM   2169 C CD  . GLU A 1 299 ? 48.387 -42.911 -1.333  1.00 49.18 ? 298  GLU A CD  1 
ATOM   2170 O OE1 . GLU A 1 299 ? 48.389 -41.677 -1.118  1.00 45.60 ? 298  GLU A OE1 1 
ATOM   2171 O OE2 . GLU A 1 299 ? 49.361 -43.512 -1.837  1.00 51.45 ? 298  GLU A OE2 1 
ATOM   2172 N N   . THR A 1 300 ? 43.855 -42.337 1.653   1.00 33.10 ? 299  THR A N   1 
ATOM   2173 C CA  . THR A 1 300 ? 43.196 -41.632 2.730   1.00 32.74 ? 299  THR A CA  1 
ATOM   2174 C C   . THR A 1 300 ? 42.174 -42.536 3.414   1.00 33.09 ? 299  THR A C   1 
ATOM   2175 O O   . THR A 1 300 ? 42.089 -42.565 4.649   1.00 31.19 ? 299  THR A O   1 
ATOM   2176 C CB  . THR A 1 300 ? 42.513 -40.343 2.215   1.00 32.30 ? 299  THR A CB  1 
ATOM   2177 O OG1 . THR A 1 300 ? 43.492 -39.511 1.571   1.00 28.62 ? 299  THR A OG1 1 
ATOM   2178 C CG2 . THR A 1 300 ? 41.874 -39.586 3.354   1.00 31.31 ? 299  THR A CG2 1 
ATOM   2179 N N   . ALA A 1 301 ? 41.391 -43.266 2.623   1.00 31.40 ? 300  ALA A N   1 
ATOM   2180 C CA  . ALA A 1 301 ? 40.420 -44.194 3.211   1.00 36.03 ? 300  ALA A CA  1 
ATOM   2181 C C   . ALA A 1 301 ? 41.141 -45.331 3.959   1.00 37.06 ? 300  ALA A C   1 
ATOM   2182 O O   . ALA A 1 301 ? 40.744 -45.696 5.065   1.00 38.07 ? 300  ALA A O   1 
ATOM   2183 C CB  . ALA A 1 301 ? 39.471 -44.746 2.156   1.00 35.07 ? 300  ALA A CB  1 
ATOM   2184 N N   . GLU A 1 302 ? 42.204 -45.860 3.358   1.00 39.05 ? 301  GLU A N   1 
ATOM   2185 C CA  . GLU A 1 302 ? 42.961 -46.962 3.963   1.00 43.02 ? 301  GLU A CA  1 
ATOM   2186 C C   . GLU A 1 302 ? 43.541 -46.567 5.318   1.00 42.90 ? 301  GLU A C   1 
ATOM   2187 O O   . GLU A 1 302 ? 43.286 -47.236 6.320   1.00 43.74 ? 301  GLU A O   1 
ATOM   2188 C CB  . GLU A 1 302 ? 44.053 -47.464 3.018   1.00 47.08 ? 301  GLU A CB  1 
ATOM   2189 C CG  . GLU A 1 302 ? 43.581 -48.594 2.113   1.00 52.96 ? 301  GLU A CG  1 
ATOM   2190 C CD  . GLU A 1 302 ? 44.327 -48.671 0.787   1.00 56.44 ? 301  GLU A CD  1 
ATOM   2191 O OE1 . GLU A 1 302 ? 45.451 -48.118 0.668   1.00 57.55 ? 301  GLU A OE1 1 
ATOM   2192 O OE2 . GLU A 1 302 ? 43.775 -49.294 -0.151  1.00 59.06 ? 301  GLU A OE2 1 
ATOM   2193 N N   . ILE A 1 303 ? 44.283 -45.460 5.341   1.00 41.49 ? 302  ILE A N   1 
ATOM   2194 C CA  . ILE A 1 303 ? 44.923 -44.960 6.550   1.00 39.44 ? 302  ILE A CA  1 
ATOM   2195 C C   . ILE A 1 303 ? 43.916 -44.446 7.575   1.00 41.16 ? 302  ILE A C   1 
ATOM   2196 O O   . ILE A 1 303 ? 44.038 -44.746 8.763   1.00 40.82 ? 302  ILE A O   1 
ATOM   2197 C CB  . ILE A 1 303 ? 45.981 -43.880 6.222   1.00 41.19 ? 302  ILE A CB  1 
ATOM   2198 C CG1 . ILE A 1 303 ? 47.084 -44.482 5.344   1.00 42.38 ? 302  ILE A CG1 1 
ATOM   2199 C CG2 . ILE A 1 303 ? 46.576 -43.293 7.498   1.00 39.93 ? 302  ILE A CG2 1 
ATOM   2200 C CD1 . ILE A 1 303 ? 47.909 -43.480 4.559   1.00 39.75 ? 302  ILE A CD1 1 
ATOM   2201 N N   . HIS A 1 304 ? 42.902 -43.705 7.125   1.00 37.82 ? 303  HIS A N   1 
ATOM   2202 C CA  . HIS A 1 304 ? 42.108 -42.889 8.047   1.00 36.08 ? 303  HIS A CA  1 
ATOM   2203 C C   . HIS A 1 304 ? 40.677 -43.254 8.224   1.00 36.23 ? 303  HIS A C   1 
ATOM   2204 O O   . HIS A 1 304 ? 40.067 -42.868 9.223   1.00 37.68 ? 303  HIS A O   1 
ATOM   2205 C CB  . HIS A 1 304 ? 42.177 -41.418 7.646   1.00 33.52 ? 303  HIS A CB  1 
ATOM   2206 C CG  . HIS A 1 304 ? 43.523 -40.795 7.882   1.00 33.05 ? 303  HIS A CG  1 
ATOM   2207 N ND1 . HIS A 1 304 ? 43.941 -40.429 9.108   1.00 34.65 ? 303  HIS A ND1 1 
ATOM   2208 C CD2 . HIS A 1 304 ? 44.562 -40.508 7.009   1.00 32.09 ? 303  HIS A CD2 1 
ATOM   2209 C CE1 . HIS A 1 304 ? 45.185 -39.927 9.021   1.00 32.75 ? 303  HIS A CE1 1 
ATOM   2210 N NE2 . HIS A 1 304 ? 45.558 -39.961 7.733   1.00 33.39 ? 303  HIS A NE2 1 
ATOM   2211 N N   . LEU A 1 305 ? 40.102 -43.961 7.255   1.00 37.13 ? 304  LEU A N   1 
ATOM   2212 C CA  . LEU A 1 305 ? 38.674 -44.234 7.294   1.00 39.94 ? 304  LEU A CA  1 
ATOM   2213 C C   . LEU A 1 305 ? 38.328 -45.705 7.569   1.00 45.98 ? 304  LEU A C   1 
ATOM   2214 O O   . LEU A 1 305 ? 37.308 -45.986 8.192   1.00 52.15 ? 304  LEU A O   1 
ATOM   2215 C CB  . LEU A 1 305 ? 37.985 -43.724 6.011   1.00 38.86 ? 304  LEU A CB  1 
ATOM   2216 C CG  . LEU A 1 305 ? 38.305 -42.270 5.613   1.00 37.99 ? 304  LEU A CG  1 
ATOM   2217 C CD1 . LEU A 1 305 ? 37.665 -41.871 4.285   1.00 37.70 ? 304  LEU A CD1 1 
ATOM   2218 C CD2 . LEU A 1 305 ? 37.900 -41.292 6.705   1.00 36.36 ? 304  LEU A CD2 1 
ATOM   2219 N N   . HIS A 1 306 ? 39.173 -46.628 7.120   1.00 51.54 ? 305  HIS A N   1 
ATOM   2220 C CA  . HIS A 1 306 ? 38.881 -48.060 7.248   1.00 58.79 ? 305  HIS A CA  1 
ATOM   2221 C C   . HIS A 1 306 ? 39.315 -48.594 8.578   1.00 58.54 ? 305  HIS A C   1 
ATOM   2222 O O   . HIS A 1 306 ? 38.508 -48.663 9.504   1.00 60.63 ? 305  HIS A O   1 
ATOM   2223 C CB  . HIS A 1 306 ? 39.501 -48.870 6.108   1.00 59.56 ? 305  HIS A CB  1 
ATOM   2224 C CG  . HIS A 1 306 ? 38.941 -48.540 4.740   1.00 59.79 ? 305  HIS A CG  1 
ATOM   2225 N ND1 . HIS A 1 306 ? 39.672 -48.657 3.610   1.00 58.18 ? 305  HIS A ND1 1 
ATOM   2226 C CD2 . HIS A 1 306 ? 37.682 -48.078 4.347   1.00 63.03 ? 305  HIS A CD2 1 
ATOM   2227 C CE1 . HIS A 1 306 ? 38.922 -48.299 2.550   1.00 58.22 ? 305  HIS A CE1 1 
ATOM   2228 N NE2 . HIS A 1 306 ? 37.704 -47.943 3.001   1.00 62.73 ? 305  HIS A NE2 1 
HETATM 2229 O O13 . UGX B 2 .   ? 20.484 -34.091 4.333   1.00 28.35 ? 1306 UGX A O13 1 
HETATM 2230 C C12 . UGX B 2 .   ? 21.607 -33.651 4.563   1.00 27.10 ? 1306 UGX A C12 1 
HETATM 2231 N N14 . UGX B 2 .   ? 22.498 -34.327 5.283   1.00 27.29 ? 1306 UGX A N14 1 
HETATM 2232 C C21 . UGX B 2 .   ? 22.278 -35.619 5.939   1.00 28.29 ? 1306 UGX A C21 1 
HETATM 2233 C C15 . UGX B 2 .   ? 23.220 -36.728 5.505   1.00 28.85 ? 1306 UGX A C15 1 
HETATM 2234 C C24 . UGX B 2 .   ? 24.657 -36.285 5.773   1.00 27.27 ? 1306 UGX A C24 1 
HETATM 2235 C C23 . UGX B 2 .   ? 23.092 -37.034 4.021   1.00 29.22 ? 1306 UGX A C23 1 
HETATM 2236 C C22 . UGX B 2 .   ? 22.914 -37.991 6.329   1.00 27.60 ? 1306 UGX A C22 1 
HETATM 2237 C C11 . UGX B 2 .   ? 22.065 -32.323 3.998   1.00 25.47 ? 1306 UGX A C11 1 
HETATM 2238 C C6  . UGX B 2 .   ? 21.327 -31.917 2.713   1.00 24.82 ? 1306 UGX A C6  1 
HETATM 2239 N N5  . UGX B 2 .   ? 21.694 -32.761 1.521   1.00 24.96 ? 1306 UGX A N5  1 
HETATM 2240 C C1  . UGX B 2 .   ? 22.032 -34.051 1.489   1.00 25.12 ? 1306 UGX A C1  1 
HETATM 2241 C C7  . UGX B 2 .   ? 21.645 -30.428 2.440   1.00 24.53 ? 1306 UGX A C7  1 
HETATM 2242 N N8  . UGX B 2 .   ? 21.230 -30.070 1.081   1.00 24.01 ? 1306 UGX A N8  1 
HETATM 2243 C C9  . UGX B 2 .   ? 21.356 -30.841 -0.001  1.00 25.54 ? 1306 UGX A C9  1 
HETATM 2244 O O10 . UGX B 2 .   ? 21.201 -30.425 -1.143  1.00 25.72 ? 1306 UGX A O10 1 
HETATM 2245 C C4  . UGX B 2 .   ? 21.694 -32.266 0.264   1.00 24.70 ? 1306 UGX A C4  1 
HETATM 2246 C C2  . UGX B 2 .   ? 22.054 -33.245 -0.659  1.00 25.66 ? 1306 UGX A C2  1 
HETATM 2247 C C3  . UGX B 2 .   ? 22.243 -34.340 0.153   1.00 25.26 ? 1306 UGX A C3  1 
HETATM 2248 C C16 . UGX B 2 .   ? 22.692 -35.683 -0.351  1.00 26.10 ? 1306 UGX A C16 1 
HETATM 2249 C C18 . UGX B 2 .   ? 22.697 -36.791 0.481   1.00 27.98 ? 1306 UGX A C18 1 
HETATM 2250 S S20 . UGX B 2 .   ? 23.348 -38.111 -0.447  1.00 32.17 ? 1306 UGX A S20 1 
HETATM 2251 C C19 . UGX B 2 .   ? 23.576 -37.144 -1.874  1.00 27.56 ? 1306 UGX A C19 1 
HETATM 2252 C C17 . UGX B 2 .   ? 23.174 -35.838 -1.650  1.00 26.96 ? 1306 UGX A C17 1 
HETATM 2253 O O   . HOH C 3 .   ? 8.603  -45.095 -3.072  1.00 51.95 ? 2001 HOH A O   1 
HETATM 2254 O O   . HOH C 3 .   ? 10.414 -41.871 3.546   1.00 41.90 ? 2002 HOH A O   1 
HETATM 2255 O O   . HOH C 3 .   ? 12.212 -41.106 7.510   1.00 38.89 ? 2003 HOH A O   1 
HETATM 2256 O O   . HOH C 3 .   ? 16.441 -38.041 9.266   1.00 42.81 ? 2004 HOH A O   1 
HETATM 2257 O O   . HOH C 3 .   ? 20.333 -34.746 8.798   1.00 37.55 ? 2005 HOH A O   1 
HETATM 2258 O O   . HOH C 3 .   ? 20.355 -38.833 8.617   1.00 37.38 ? 2006 HOH A O   1 
HETATM 2259 O O   . HOH C 3 .   ? 15.071 -33.660 9.632   1.00 41.75 ? 2007 HOH A O   1 
HETATM 2260 O O   . HOH C 3 .   ? 12.602 -27.761 5.562   1.00 42.69 ? 2008 HOH A O   1 
HETATM 2261 O O   . HOH C 3 .   ? 19.942 -24.756 5.022   1.00 45.87 ? 2009 HOH A O   1 
HETATM 2262 O O   . HOH C 3 .   ? 18.597 -25.536 8.050   1.00 48.48 ? 2010 HOH A O   1 
HETATM 2263 O O   . HOH C 3 .   ? 17.934 -26.084 -1.503  1.00 35.00 ? 2011 HOH A O   1 
HETATM 2264 O O   . HOH C 3 .   ? 20.315 -31.978 7.697   1.00 41.55 ? 2012 HOH A O   1 
HETATM 2265 O O   . HOH C 3 .   ? 13.381 -35.188 11.155  1.00 32.85 ? 2013 HOH A O   1 
HETATM 2266 O O   . HOH C 3 .   ? 16.876 -45.940 0.728   1.00 34.59 ? 2014 HOH A O   1 
HETATM 2267 O O   . HOH C 3 .   ? 20.538 -43.946 3.253   1.00 35.99 ? 2015 HOH A O   1 
HETATM 2268 O O   . HOH C 3 .   ? 22.698 -42.139 3.278   1.00 41.94 ? 2016 HOH A O   1 
HETATM 2269 O O   . HOH C 3 .   ? 17.903 -26.212 -4.389  1.00 36.85 ? 2017 HOH A O   1 
HETATM 2270 O O   . HOH C 3 .   ? 10.718 -38.586 -1.862  1.00 46.02 ? 2018 HOH A O   1 
HETATM 2271 O O   . HOH C 3 .   ? 11.018 -27.245 1.398   1.00 33.56 ? 2019 HOH A O   1 
HETATM 2272 O O   . HOH C 3 .   ? 5.650  -23.791 -2.717  1.00 47.68 ? 2020 HOH A O   1 
HETATM 2273 O O   . HOH C 3 .   ? 20.718 -19.375 -5.258  1.00 45.95 ? 2021 HOH A O   1 
HETATM 2274 O O   . HOH C 3 .   ? 23.515 -41.684 5.757   1.00 46.36 ? 2022 HOH A O   1 
HETATM 2275 O O   . HOH C 3 .   ? 23.052 -30.907 7.110   1.00 33.56 ? 2023 HOH A O   1 
HETATM 2276 O O   . HOH C 3 .   ? 39.817 -34.679 -6.389  1.00 44.61 ? 2024 HOH A O   1 
HETATM 2277 O O   . HOH C 3 .   ? 17.810 -23.411 -6.165  1.00 41.22 ? 2025 HOH A O   1 
HETATM 2278 O O   . HOH C 3 .   ? 22.890 -31.166 -3.667  1.00 36.95 ? 2026 HOH A O   1 
HETATM 2279 O O   . HOH C 3 .   ? 22.465 -25.467 -16.748 1.00 41.96 ? 2027 HOH A O   1 
HETATM 2280 O O   . HOH C 3 .   ? 29.890 -16.543 -0.928  1.00 29.84 ? 2028 HOH A O   1 
HETATM 2281 O O   . HOH C 3 .   ? 25.584 -32.616 -11.661 1.00 36.99 ? 2029 HOH A O   1 
HETATM 2282 O O   . HOH C 3 .   ? 22.957 -28.317 5.655   1.00 43.29 ? 2030 HOH A O   1 
HETATM 2283 O O   . HOH C 3 .   ? 16.533 -31.178 -17.921 1.00 43.57 ? 2031 HOH A O   1 
HETATM 2284 O O   . HOH C 3 .   ? 35.115 -40.611 -14.725 1.00 54.52 ? 2032 HOH A O   1 
HETATM 2285 O O   . HOH C 3 .   ? 35.881 -37.087 -16.264 1.00 44.45 ? 2033 HOH A O   1 
HETATM 2286 O O   . HOH C 3 .   ? 30.311 -36.976 -8.277  1.00 41.78 ? 2034 HOH A O   1 
HETATM 2287 O O   . HOH C 3 .   ? 21.699 -16.023 -12.966 1.00 52.19 ? 2035 HOH A O   1 
HETATM 2288 O O   . HOH C 3 .   ? 36.852 -5.218  2.652   1.00 45.62 ? 2036 HOH A O   1 
HETATM 2289 O O   . HOH C 3 .   ? 8.826  -32.648 -14.193 1.00 43.48 ? 2037 HOH A O   1 
HETATM 2290 O O   . HOH C 3 .   ? 3.706  -33.309 -3.042  1.00 53.21 ? 2038 HOH A O   1 
HETATM 2291 O O   . HOH C 3 .   ? 39.938 -13.729 -6.800  1.00 42.62 ? 2039 HOH A O   1 
HETATM 2292 O O   . HOH C 3 .   ? 4.407  -30.199 -4.700  1.00 43.71 ? 2040 HOH A O   1 
HETATM 2293 O O   . HOH C 3 .   ? 24.280 -43.561 1.700   1.00 36.73 ? 2041 HOH A O   1 
HETATM 2294 O O   . HOH C 3 .   ? 37.286 -5.180  14.547  1.00 52.46 ? 2042 HOH A O   1 
HETATM 2295 O O   . HOH C 3 .   ? 31.331 -45.451 0.593   1.00 45.90 ? 2043 HOH A O   1 
HETATM 2296 O O   . HOH C 3 .   ? 25.562 -44.416 4.811   1.00 39.85 ? 2044 HOH A O   1 
HETATM 2297 O O   . HOH C 3 .   ? 25.417 -40.422 7.368   1.00 44.04 ? 2045 HOH A O   1 
HETATM 2298 O O   . HOH C 3 .   ? 27.125 -39.631 11.121  1.00 45.63 ? 2046 HOH A O   1 
HETATM 2299 O O   . HOH C 3 .   ? 26.531 -37.848 8.221   1.00 31.63 ? 2047 HOH A O   1 
HETATM 2300 O O   . HOH C 3 .   ? 25.228 -33.267 9.885   1.00 41.27 ? 2048 HOH A O   1 
HETATM 2301 O O   . HOH C 3 .   ? 24.817 -32.548 5.776   1.00 25.32 ? 2049 HOH A O   1 
HETATM 2302 O O   . HOH C 3 .   ? 50.527 -15.940 9.204   1.00 42.11 ? 2050 HOH A O   1 
HETATM 2303 O O   . HOH C 3 .   ? 45.775 -10.078 6.275   1.00 43.70 ? 2051 HOH A O   1 
HETATM 2304 O O   . HOH C 3 .   ? 23.496 -37.198 10.528  1.00 49.37 ? 2052 HOH A O   1 
HETATM 2305 O O   . HOH C 3 .   ? 44.137 -6.983  8.826   1.00 48.38 ? 2053 HOH A O   1 
HETATM 2306 O O   . HOH C 3 .   ? 34.851 -31.397 17.011  1.00 40.44 ? 2054 HOH A O   1 
HETATM 2307 O O   . HOH C 3 .   ? 52.413 -19.420 -4.546  1.00 40.34 ? 2055 HOH A O   1 
HETATM 2308 O O   . HOH C 3 .   ? 42.680 -40.191 11.351  1.00 43.04 ? 2056 HOH A O   1 
HETATM 2309 O O   . HOH C 3 .   ? 39.397 -32.302 18.876  1.00 44.51 ? 2057 HOH A O   1 
HETATM 2310 O O   . HOH C 3 .   ? 44.672 -31.052 13.807  1.00 42.58 ? 2058 HOH A O   1 
HETATM 2311 O O   . HOH C 3 .   ? 41.973 -37.643 12.280  1.00 30.50 ? 2059 HOH A O   1 
HETATM 2312 O O   . HOH C 3 .   ? 49.161 -35.625 10.256  1.00 37.18 ? 2060 HOH A O   1 
HETATM 2313 O O   . HOH C 3 .   ? 47.898 -33.417 13.128  1.00 41.34 ? 2061 HOH A O   1 
HETATM 2314 O O   . HOH C 3 .   ? 51.654 -30.826 9.376   1.00 45.11 ? 2062 HOH A O   1 
HETATM 2315 O O   . HOH C 3 .   ? 49.721 -30.670 14.456  1.00 43.47 ? 2063 HOH A O   1 
HETATM 2316 O O   . HOH C 3 .   ? 47.210 -35.790 2.742   1.00 25.38 ? 2064 HOH A O   1 
HETATM 2317 O O   . HOH C 3 .   ? 51.295 -37.757 4.475   1.00 39.48 ? 2065 HOH A O   1 
HETATM 2318 O O   . HOH C 3 .   ? 51.115 -34.655 7.558   1.00 43.30 ? 2066 HOH A O   1 
HETATM 2319 O O   . HOH C 3 .   ? 50.009 -35.903 3.178   1.00 31.81 ? 2067 HOH A O   1 
HETATM 2320 O O   . HOH C 3 .   ? 42.901 -36.700 -1.418  1.00 32.49 ? 2068 HOH A O   1 
HETATM 2321 O O   . HOH C 3 .   ? 37.661 -33.351 -5.565  1.00 25.38 ? 2069 HOH A O   1 
HETATM 2322 O O   . HOH C 3 .   ? 36.538 -35.657 -4.384  1.00 29.54 ? 2070 HOH A O   1 
HETATM 2323 O O   . HOH C 3 .   ? 39.769 -29.343 -10.263 1.00 34.52 ? 2071 HOH A O   1 
HETATM 2324 O O   . HOH C 3 .   ? 36.735 -28.405 -14.442 1.00 42.70 ? 2072 HOH A O   1 
HETATM 2325 O O   . HOH C 3 .   ? 34.828 -19.716 -15.016 1.00 45.96 ? 2073 HOH A O   1 
HETATM 2326 O O   . HOH C 3 .   ? 38.681 -20.953 -9.144  1.00 39.44 ? 2074 HOH A O   1 
HETATM 2327 O O   . HOH C 3 .   ? 32.333 -21.782 -4.886  1.00 24.34 ? 2075 HOH A O   1 
HETATM 2328 O O   . HOH C 3 .   ? 28.792 -18.661 -15.234 1.00 45.42 ? 2076 HOH A O   1 
HETATM 2329 O O   . HOH C 3 .   ? 24.785 -23.514 -2.227  1.00 26.93 ? 2077 HOH A O   1 
HETATM 2330 O O   . HOH C 3 .   ? 31.612 -20.190 -2.731  1.00 24.26 ? 2078 HOH A O   1 
HETATM 2331 O O   . HOH C 3 .   ? 30.256 -18.402 1.223   1.00 29.75 ? 2079 HOH A O   1 
HETATM 2332 O O   . HOH C 3 .   ? 28.676 -19.299 3.381   1.00 33.06 ? 2080 HOH A O   1 
HETATM 2333 O O   . HOH C 3 .   ? 23.449 -17.008 -1.608  1.00 35.68 ? 2081 HOH A O   1 
HETATM 2334 O O   . HOH C 3 .   ? 31.384 -20.616 0.070   1.00 23.47 ? 2082 HOH A O   1 
HETATM 2335 O O   . HOH C 3 .   ? 29.055 -21.842 4.109   1.00 26.57 ? 2083 HOH A O   1 
HETATM 2336 O O   . HOH C 3 .   ? 23.307 -23.823 0.381   1.00 31.10 ? 2084 HOH A O   1 
HETATM 2337 O O   . HOH C 3 .   ? 22.776 -25.352 4.789   1.00 47.56 ? 2085 HOH A O   1 
HETATM 2338 O O   . HOH C 3 .   ? 30.520 -25.760 10.625  1.00 40.16 ? 2086 HOH A O   1 
HETATM 2339 O O   . HOH C 3 .   ? 32.306 -29.608 12.527  1.00 50.92 ? 2087 HOH A O   1 
HETATM 2340 O O   . HOH C 3 .   ? 24.223 -30.941 10.750  1.00 48.22 ? 2088 HOH A O   1 
HETATM 2341 O O   . HOH C 3 .   ? 22.963 -27.354 2.984   1.00 26.51 ? 2089 HOH A O   1 
HETATM 2342 O O   . HOH C 3 .   ? 31.822 -46.285 -2.103  1.00 43.69 ? 2090 HOH A O   1 
HETATM 2343 O O   . HOH C 3 .   ? 32.970 -41.054 -4.876  1.00 42.97 ? 2091 HOH A O   1 
HETATM 2344 O O   . HOH C 3 .   ? 39.171 -43.357 -4.427  1.00 33.63 ? 2092 HOH A O   1 
HETATM 2345 O O   . HOH C 3 .   ? 38.797 -46.031 -4.856  1.00 42.24 ? 2093 HOH A O   1 
HETATM 2346 O O   . HOH C 3 .   ? 36.468 -49.261 -8.350  1.00 49.60 ? 2094 HOH A O   1 
HETATM 2347 O O   . HOH C 3 .   ? 39.339 -39.877 -6.926  1.00 44.70 ? 2095 HOH A O   1 
HETATM 2348 O O   . HOH C 3 .   ? 20.658 -24.591 0.630   1.00 41.22 ? 2096 HOH A O   1 
HETATM 2349 O O   . HOH C 3 .   ? 23.244 -16.489 -10.583 1.00 34.05 ? 2097 HOH A O   1 
HETATM 2350 O O   . HOH C 3 .   ? 25.549 -14.492 -10.830 1.00 31.15 ? 2098 HOH A O   1 
HETATM 2351 O O   . HOH C 3 .   ? 28.489 -14.900 -15.200 1.00 41.73 ? 2099 HOH A O   1 
HETATM 2352 O O   . HOH C 3 .   ? 32.776 -11.792 -8.250  1.00 25.09 ? 2100 HOH A O   1 
HETATM 2353 O O   . HOH C 3 .   ? 34.688 -14.198 -8.543  1.00 34.83 ? 2101 HOH A O   1 
HETATM 2354 O O   . HOH C 3 .   ? 24.589 -9.990  -6.740  1.00 39.75 ? 2102 HOH A O   1 
HETATM 2355 O O   . HOH C 3 .   ? 31.337 -11.347 -14.857 1.00 32.94 ? 2103 HOH A O   1 
HETATM 2356 O O   . HOH C 3 .   ? 36.441 -13.571 -16.765 1.00 48.38 ? 2104 HOH A O   1 
HETATM 2357 O O   . HOH C 3 .   ? 29.138 -9.486  -14.298 1.00 44.32 ? 2105 HOH A O   1 
HETATM 2358 O O   . HOH C 3 .   ? 30.834 -4.831  -9.729  1.00 30.92 ? 2106 HOH A O   1 
HETATM 2359 O O   . HOH C 3 .   ? 20.750 -11.363 0.104   1.00 38.16 ? 2107 HOH A O   1 
HETATM 2360 O O   . HOH C 3 .   ? 23.527 -18.476 8.625   1.00 42.54 ? 2108 HOH A O   1 
HETATM 2361 O O   . HOH C 3 .   ? 25.771 -19.017 10.375  1.00 31.77 ? 2109 HOH A O   1 
HETATM 2362 O O   . HOH C 3 .   ? 24.001 -13.717 6.158   1.00 28.67 ? 2110 HOH A O   1 
HETATM 2363 O O   . HOH C 3 .   ? 25.486 -7.796  7.898   1.00 45.59 ? 2111 HOH A O   1 
HETATM 2364 O O   . HOH C 3 .   ? 33.210 -16.140 8.631   1.00 22.50 ? 2112 HOH A O   1 
HETATM 2365 O O   . HOH C 3 .   ? 33.453 -19.080 11.705  1.00 25.11 ? 2113 HOH A O   1 
HETATM 2366 O O   . HOH C 3 .   ? 32.361 -16.903 2.350   1.00 33.04 ? 2114 HOH A O   1 
HETATM 2367 O O   . HOH C 3 .   ? 36.798 -7.393  4.167   1.00 44.12 ? 2115 HOH A O   1 
HETATM 2368 O O   . HOH C 3 .   ? 35.154 -10.691 -1.782  1.00 23.66 ? 2116 HOH A O   1 
HETATM 2369 O O   . HOH C 3 .   ? 25.269 -4.290  -1.038  1.00 38.03 ? 2117 HOH A O   1 
HETATM 2370 O O   . HOH C 3 .   ? 33.286 -6.180  -1.010  1.00 40.52 ? 2118 HOH A O   1 
HETATM 2371 O O   . HOH C 3 .   ? 35.216 -8.036  -2.664  1.00 37.51 ? 2119 HOH A O   1 
HETATM 2372 O O   . HOH C 3 .   ? 31.649 -17.417 -2.846  1.00 25.68 ? 2120 HOH A O   1 
HETATM 2373 O O   . HOH C 3 .   ? 37.239 -12.637 -6.203  1.00 31.49 ? 2121 HOH A O   1 
HETATM 2374 O O   . HOH C 3 .   ? 37.933 -10.032 -4.486  1.00 30.73 ? 2122 HOH A O   1 
HETATM 2375 O O   . HOH C 3 .   ? 29.882 -23.608 15.792  1.00 47.50 ? 2123 HOH A O   1 
HETATM 2376 O O   . HOH C 3 .   ? 39.588 -17.492 16.263  1.00 34.17 ? 2124 HOH A O   1 
HETATM 2377 O O   . HOH C 3 .   ? 27.778 -14.526 12.619  1.00 49.78 ? 2125 HOH A O   1 
HETATM 2378 O O   . HOH C 3 .   ? 26.599 -11.860 15.549  1.00 46.20 ? 2126 HOH A O   1 
HETATM 2379 O O   . HOH C 3 .   ? 35.608 -9.723  18.295  1.00 41.62 ? 2127 HOH A O   1 
HETATM 2380 O O   . HOH C 3 .   ? 35.045 -6.566  15.601  1.00 40.07 ? 2128 HOH A O   1 
HETATM 2381 O O   . HOH C 3 .   ? 38.243 -12.220 15.438  1.00 33.35 ? 2129 HOH A O   1 
HETATM 2382 O O   . HOH C 3 .   ? 36.893 -6.190  8.793   1.00 41.25 ? 2130 HOH A O   1 
HETATM 2383 O O   . HOH C 3 .   ? 41.034 -6.549  13.197  1.00 50.41 ? 2131 HOH A O   1 
HETATM 2384 O O   . HOH C 3 .   ? 37.981 -11.436 18.161  1.00 37.11 ? 2132 HOH A O   1 
HETATM 2385 O O   . HOH C 3 .   ? 42.323 -12.107 9.426   1.00 29.59 ? 2133 HOH A O   1 
HETATM 2386 O O   . HOH C 3 .   ? 45.193 -14.186 13.561  1.00 37.17 ? 2134 HOH A O   1 
HETATM 2387 O O   . HOH C 3 .   ? 46.452 -19.026 18.249  1.00 36.03 ? 2135 HOH A O   1 
HETATM 2388 O O   . HOH C 3 .   ? 48.268 -24.401 17.353  1.00 25.60 ? 2136 HOH A O   1 
HETATM 2389 O O   . HOH C 3 .   ? 53.324 -26.757 18.220  1.00 33.74 ? 2137 HOH A O   1 
HETATM 2390 O O   . HOH C 3 .   ? 55.185 -28.362 13.009  1.00 53.13 ? 2138 HOH A O   1 
HETATM 2391 O O   . HOH C 3 .   ? 55.673 -26.173 16.985  1.00 34.58 ? 2139 HOH A O   1 
HETATM 2392 O O   . HOH C 3 .   ? 54.523 -26.252 9.686   1.00 30.47 ? 2140 HOH A O   1 
HETATM 2393 O O   . HOH C 3 .   ? 57.687 -22.018 15.606  1.00 33.58 ? 2141 HOH A O   1 
HETATM 2394 O O   . HOH C 3 .   ? 59.104 -25.789 14.548  1.00 43.20 ? 2142 HOH A O   1 
HETATM 2395 O O   . HOH C 3 .   ? 52.277 -19.677 11.145  1.00 40.51 ? 2143 HOH A O   1 
HETATM 2396 O O   . HOH C 3 .   ? 53.294 -20.504 14.420  1.00 39.27 ? 2144 HOH A O   1 
HETATM 2397 O O   . HOH C 3 .   ? 49.119 -15.970 6.777   1.00 32.90 ? 2145 HOH A O   1 
HETATM 2398 O O   . HOH C 3 .   ? 44.453 -13.867 9.260   1.00 33.74 ? 2146 HOH A O   1 
HETATM 2399 O O   . HOH C 3 .   ? 46.348 -12.741 6.173   1.00 38.08 ? 2147 HOH A O   1 
HETATM 2400 O O   . HOH C 3 .   ? 50.183 -17.819 11.343  1.00 39.50 ? 2148 HOH A O   1 
HETATM 2401 O O   . HOH C 3 .   ? 48.313 -12.520 -1.156  1.00 38.75 ? 2149 HOH A O   1 
HETATM 2402 O O   . HOH C 3 .   ? 43.736 -9.863  8.087   1.00 40.70 ? 2150 HOH A O   1 
HETATM 2403 O O   . HOH C 3 .   ? 44.158 -8.328  4.751   1.00 30.04 ? 2151 HOH A O   1 
HETATM 2404 O O   . HOH C 3 .   ? 42.442 -12.717 -3.242  1.00 32.80 ? 2152 HOH A O   1 
HETATM 2405 O O   . HOH C 3 .   ? 39.995 -6.387  -2.202  1.00 39.43 ? 2153 HOH A O   1 
HETATM 2406 O O   . HOH C 3 .   ? 46.873 -13.424 -3.516  1.00 37.69 ? 2154 HOH A O   1 
HETATM 2407 O O   . HOH C 3 .   ? 41.189 -15.207 -3.236  1.00 26.72 ? 2155 HOH A O   1 
HETATM 2408 O O   . HOH C 3 .   ? 47.598 -17.363 -8.448  1.00 34.94 ? 2156 HOH A O   1 
HETATM 2409 O O   . HOH C 3 .   ? 41.695 -17.914 -7.786  1.00 29.10 ? 2157 HOH A O   1 
HETATM 2410 O O   . HOH C 3 .   ? 43.842 -19.790 -8.940  1.00 29.15 ? 2158 HOH A O   1 
HETATM 2411 O O   . HOH C 3 .   ? 45.550 -19.346 -11.049 1.00 47.17 ? 2159 HOH A O   1 
HETATM 2412 O O   . HOH C 3 .   ? 51.288 -23.672 -10.270 1.00 46.11 ? 2160 HOH A O   1 
HETATM 2413 O O   . HOH C 3 .   ? 51.409 -20.500 -2.237  1.00 32.80 ? 2161 HOH A O   1 
HETATM 2414 O O   . HOH C 3 .   ? 52.306 -16.422 -4.022  1.00 53.36 ? 2162 HOH A O   1 
HETATM 2415 O O   . HOH C 3 .   ? 51.102 -28.978 -5.955  1.00 47.96 ? 2163 HOH A O   1 
HETATM 2416 O O   . HOH C 3 .   ? 52.769 -27.168 -6.021  1.00 45.22 ? 2164 HOH A O   1 
HETATM 2417 O O   . HOH C 3 .   ? 51.417 -20.077 -6.750  1.00 40.50 ? 2165 HOH A O   1 
HETATM 2418 O O   . HOH C 3 .   ? 49.687 -31.918 -2.936  1.00 35.68 ? 2166 HOH A O   1 
HETATM 2419 O O   . HOH C 3 .   ? 53.341 -31.958 -3.580  1.00 45.57 ? 2167 HOH A O   1 
HETATM 2420 O O   . HOH C 3 .   ? 50.556 -35.948 -3.782  1.00 51.13 ? 2168 HOH A O   1 
HETATM 2421 O O   . HOH C 3 .   ? 50.426 -39.993 -1.934  1.00 45.69 ? 2169 HOH A O   1 
HETATM 2422 O O   . HOH C 3 .   ? 42.677 -42.815 -4.720  1.00 41.28 ? 2170 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   0   ?   ?   ?   A . n 
A 1 2   PRO 2   1   ?   ?   ?   A . n 
A 1 3   LEU 3   2   ?   ?   ?   A . n 
A 1 4   LEU 4   3   ?   ?   ?   A . n 
A 1 5   SER 5   4   ?   ?   ?   A . n 
A 1 6   LYS 6   5   ?   ?   ?   A . n 
A 1 7   ILE 7   6   ?   ?   ?   A . n 
A 1 8   ASN 8   7   ?   ?   ?   A . n 
A 1 9   SER 9   8   ?   ?   ?   A . n 
A 1 10  LEU 10  9   ?   ?   ?   A . n 
A 1 11  ALA 11  10  ?   ?   ?   A . n 
A 1 12  HIS 12  11  ?   ?   ?   A . n 
A 1 13  LEU 13  12  ?   ?   ?   A . n 
A 1 14  ARG 14  13  ?   ?   ?   A . n 
A 1 15  ALA 15  14  ?   ?   ?   A . n 
A 1 16  ALA 16  15  ?   ?   ?   A . n 
A 1 17  PRO 17  16  ?   ?   ?   A . n 
A 1 18  CYS 18  17  ?   ?   ?   A . n 
A 1 19  ASN 19  18  ?   ?   ?   A . n 
A 1 20  ASP 20  19  ?   ?   ?   A . n 
A 1 21  LEU 21  20  ?   ?   ?   A . n 
A 1 22  HIS 22  21  ?   ?   ?   A . n 
A 1 23  ALA 23  22  ?   ?   ?   A . n 
A 1 24  THR 24  23  ?   ?   ?   A . n 
A 1 25  LYS 25  24  ?   ?   ?   A . n 
A 1 26  LEU 26  25  ?   ?   ?   A . n 
A 1 27  ALA 27  26  ?   ?   ?   A . n 
A 1 28  PRO 28  27  ?   ?   ?   A . n 
A 1 29  GLY 29  28  ?   ?   ?   A . n 
A 1 30  LYS 30  29  ?   ?   ?   A . n 
A 1 31  GLU 31  30  ?   ?   ?   A . n 
A 1 32  LYS 32  31  ?   ?   ?   A . n 
A 1 33  GLU 33  32  ?   ?   ?   A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  GLU 36  35  35  GLU GLU A . n 
A 1 37  SER 37  36  36  SER SER A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  TYR 39  38  38  TYR TYR A . n 
A 1 40  GLN 40  39  39  GLN GLN A . n 
A 1 41  VAL 41  40  40  VAL VAL A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  PRO 43  42  42  PRO PRO A . n 
A 1 44  LEU 44  43  43  LEU LEU A . n 
A 1 45  LEU 45  44  44  LEU LEU A . n 
A 1 46  GLY 46  45  45  GLY GLY A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  GLY 48  47  47  GLY GLY A . n 
A 1 49  GLY 49  48  48  GLY GLY A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  SER 52  51  51  SER SER A . n 
A 1 53  VAL 53  52  52  VAL VAL A . n 
A 1 54  TYR 54  53  53  TYR TYR A . n 
A 1 55  SER 55  54  54  SER SER A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  ILE 57  56  56  ILE ILE A . n 
A 1 58  ARG 58  57  57  ARG ARG A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  SER 60  59  59  SER SER A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  ASN 62  61  61  ASN ASN A . n 
A 1 63  LEU 63  62  62  LEU LEU A . n 
A 1 64  PRO 64  63  63  PRO PRO A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  ALA 66  65  65  ALA ALA A . n 
A 1 67  ILE 67  66  66  ILE ILE A . n 
A 1 68  LYS 68  67  67  LYS LYS A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  LYS 72  71  71  LYS LYS A . n 
A 1 73  ASP 73  72  72  ASP ASP A . n 
A 1 74  ARG 74  73  73  ARG ARG A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  SER 76  75  75  SER SER A . n 
A 1 77  ASP 77  76  76  ASP ASP A . n 
A 1 78  TRP 78  77  77  TRP TRP A . n 
A 1 79  GLY 79  78  78  GLY GLY A . n 
A 1 80  GLU 80  79  79  GLU GLU A . n 
A 1 81  LEU 81  80  80  LEU LEU A . n 
A 1 82  PRO 82  81  81  PRO PRO A . n 
A 1 83  ASN 83  82  82  ASN ASN A . n 
A 1 84  GLY 84  83  83  GLY GLY A . n 
A 1 85  THR 85  84  84  THR THR A . n 
A 1 86  ARG 86  85  85  ARG ARG A . n 
A 1 87  VAL 87  86  86  VAL VAL A . n 
A 1 88  PRO 88  87  87  PRO PRO A . n 
A 1 89  MET 89  88  88  MET MET A . n 
A 1 90  GLU 90  89  89  GLU GLU A . n 
A 1 91  VAL 91  90  90  VAL VAL A . n 
A 1 92  VAL 92  91  91  VAL VAL A . n 
A 1 93  LEU 93  92  92  LEU LEU A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  LYS 95  94  94  LYS LYS A . n 
A 1 96  LYS 96  95  95  LYS LYS A . n 
A 1 97  VAL 97  96  96  VAL VAL A . n 
A 1 98  SER 98  97  97  SER SER A . n 
A 1 99  SER 99  98  98  SER SER A . n 
A 1 100 GLY 100 99  99  GLY GLY A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 GLY 103 102 102 GLY GLY A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 ARG 106 105 105 ARG ARG A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 LEU 108 107 107 LEU LEU A . n 
A 1 109 ASP 109 108 108 ASP ASP A . n 
A 1 110 TRP 110 109 109 TRP TRP A . n 
A 1 111 PHE 111 110 110 PHE PHE A . n 
A 1 112 GLU 112 111 111 GLU GLU A . n 
A 1 113 ARG 113 112 112 ARG ARG A . n 
A 1 114 PRO 114 113 113 PRO PRO A . n 
A 1 115 ASP 115 114 114 ASP ASP A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 PHE 117 116 116 PHE PHE A . n 
A 1 118 VAL 118 117 117 VAL VAL A . n 
A 1 119 LEU 119 118 118 LEU LEU A . n 
A 1 120 ILE 120 119 119 ILE ILE A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 PRO 124 123 123 PRO PRO A . n 
A 1 125 GLU 125 124 124 GLU GLU A . n 
A 1 126 PRO 126 125 125 PRO PRO A . n 
A 1 127 VAL 127 126 126 VAL VAL A . n 
A 1 128 GLN 128 127 127 GLN GLN A . n 
A 1 129 ASP 129 128 128 ASP ASP A . n 
A 1 130 LEU 130 129 129 LEU LEU A . n 
A 1 131 PHE 131 130 130 PHE PHE A . n 
A 1 132 ASP 132 131 131 ASP ASP A . n 
A 1 133 PHE 133 132 132 PHE PHE A . n 
A 1 134 ILE 134 133 133 ILE ILE A . n 
A 1 135 THR 135 134 134 THR THR A . n 
A 1 136 GLU 136 135 135 GLU GLU A . n 
A 1 137 ARG 137 136 136 ARG ARG A . n 
A 1 138 GLY 138 137 137 GLY GLY A . n 
A 1 139 ALA 139 138 138 ALA ALA A . n 
A 1 140 LEU 140 139 139 LEU LEU A . n 
A 1 141 GLN 141 140 140 GLN GLN A . n 
A 1 142 GLU 142 141 141 GLU GLU A . n 
A 1 143 GLU 143 142 142 GLU GLU A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ARG 146 145 145 ARG ARG A . n 
A 1 147 SER 147 146 146 SER SER A . n 
A 1 148 PHE 148 147 147 PHE PHE A . n 
A 1 149 PHE 149 148 148 PHE PHE A . n 
A 1 150 TRP 150 149 149 TRP TRP A . n 
A 1 151 GLN 151 150 150 GLN GLN A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 GLU 154 153 153 GLU GLU A . n 
A 1 155 ALA 155 154 154 ALA ALA A . n 
A 1 156 VAL 156 155 155 VAL VAL A . n 
A 1 157 ARG 157 156 156 ARG ARG A . n 
A 1 158 HIS 158 157 157 HIS HIS A . n 
A 1 159 CYS 159 158 158 CYS CYS A . n 
A 1 160 HIS 160 159 159 HIS HIS A . n 
A 1 161 ASN 161 160 160 ASN ASN A . n 
A 1 162 CYS 162 161 161 CYS CYS A . n 
A 1 163 GLY 163 162 162 GLY GLY A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 LEU 165 164 164 LEU LEU A . n 
A 1 166 HIS 166 165 165 HIS HIS A . n 
A 1 167 ARG 167 166 166 ARG ARG A . n 
A 1 168 ASP 168 167 167 ASP ASP A . n 
A 1 169 ILE 169 168 168 ILE ILE A . n 
A 1 170 LYS 170 169 169 LYS LYS A . n 
A 1 171 ASP 171 170 170 ASP ASP A . n 
A 1 172 GLU 172 171 171 GLU GLU A . n 
A 1 173 ASN 173 172 172 ASN ASN A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 ILE 176 175 175 ILE ILE A . n 
A 1 177 ASP 177 176 176 ASP ASP A . n 
A 1 178 LEU 178 177 177 LEU LEU A . n 
A 1 179 ASN 179 178 178 ASN ASN A . n 
A 1 180 ARG 180 179 179 ARG ARG A . n 
A 1 181 GLY 181 180 180 GLY GLY A . n 
A 1 182 GLU 182 181 181 GLU GLU A . n 
A 1 183 LEU 183 182 182 LEU LEU A . n 
A 1 184 LYS 184 183 183 LYS LYS A . n 
A 1 185 LEU 185 184 184 LEU LEU A . n 
A 1 186 ILE 186 185 185 ILE ILE A . n 
A 1 187 ASP 187 186 186 ASP ASP A . n 
A 1 188 PHE 188 187 187 PHE PHE A . n 
A 1 189 GLY 189 188 188 GLY GLY A . n 
A 1 190 SER 190 189 189 SER SER A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 ALA 192 191 191 ALA ALA A . n 
A 1 193 LEU 193 192 192 LEU LEU A . n 
A 1 194 LEU 194 193 193 LEU LEU A . n 
A 1 195 LYS 195 194 194 LYS LYS A . n 
A 1 196 ASP 196 195 195 ASP ASP A . n 
A 1 197 THR 197 196 196 THR THR A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 TYR 199 198 198 TYR TYR A . n 
A 1 200 THR 200 199 199 THR THR A . n 
A 1 201 ASP 201 200 200 ASP ASP A . n 
A 1 202 PHE 202 201 201 PHE PHE A . n 
A 1 203 ASP 203 202 202 ASP ASP A . n 
A 1 204 GLY 204 203 203 GLY GLY A . n 
A 1 205 THR 205 204 204 THR THR A . n 
A 1 206 ARG 206 205 205 ARG ARG A . n 
A 1 207 VAL 207 206 206 VAL VAL A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 SER 209 208 208 SER SER A . n 
A 1 210 PRO 210 209 209 PRO PRO A . n 
A 1 211 PRO 211 210 210 PRO PRO A . n 
A 1 212 GLU 212 211 211 GLU GLU A . n 
A 1 213 TRP 213 212 212 TRP TRP A . n 
A 1 214 ILE 214 213 213 ILE ILE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 TYR 216 215 215 TYR TYR A . n 
A 1 217 HIS 217 216 216 HIS HIS A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 TYR 219 218 218 TYR TYR A . n 
A 1 220 HIS 220 219 219 HIS HIS A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 ARG 222 221 221 ARG ARG A . n 
A 1 223 SER 223 222 222 SER SER A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 ALA 225 224 224 ALA ALA A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 TRP 227 226 226 TRP TRP A . n 
A 1 228 SER 228 227 227 SER SER A . n 
A 1 229 LEU 229 228 228 LEU LEU A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 ILE 231 230 230 ILE ILE A . n 
A 1 232 LEU 232 231 231 LEU LEU A . n 
A 1 233 LEU 233 232 232 LEU LEU A . n 
A 1 234 TYR 234 233 233 TYR TYR A . n 
A 1 235 ASP 235 234 234 ASP ASP A . n 
A 1 236 MET 236 235 235 MET MET A . n 
A 1 237 VAL 237 236 236 VAL VAL A . n 
A 1 238 CYS 238 237 237 CYS CYS A . n 
A 1 239 GLY 239 238 238 GLY GLY A . n 
A 1 240 ASP 240 239 239 ASP ASP A . n 
A 1 241 ILE 241 240 240 ILE ILE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 PHE 243 242 242 PHE PHE A . n 
A 1 244 GLU 244 243 243 GLU GLU A . n 
A 1 245 HIS 245 244 244 HIS HIS A . n 
A 1 246 ASP 246 245 245 ASP ASP A . n 
A 1 247 GLU 247 246 246 GLU GLU A . n 
A 1 248 GLU 248 247 247 GLU GLU A . n 
A 1 249 ILE 249 248 248 ILE ILE A . n 
A 1 250 ILE 250 249 249 ILE ILE A . n 
A 1 251 ARG 251 250 250 ARG ARG A . n 
A 1 252 GLY 252 251 251 GLY GLY A . n 
A 1 253 GLN 253 252 252 GLN GLN A . n 
A 1 254 VAL 254 253 253 VAL VAL A . n 
A 1 255 PHE 255 254 254 PHE PHE A . n 
A 1 256 PHE 256 255 255 PHE PHE A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 GLN 258 257 257 GLN GLN A . n 
A 1 259 ARG 259 258 258 ARG ARG A . n 
A 1 260 VAL 260 259 259 VAL VAL A . n 
A 1 261 SER 261 260 260 SER SER A . n 
A 1 262 SEP 262 261 261 SEP SEP A . n 
A 1 263 GLU 263 262 262 GLU GLU A . n 
A 1 264 CYS 264 263 263 CYS CYS A . n 
A 1 265 GLN 265 264 264 GLN GLN A . n 
A 1 266 HIS 266 265 265 HIS HIS A . n 
A 1 267 LEU 267 266 266 LEU LEU A . n 
A 1 268 ILE 268 267 267 ILE ILE A . n 
A 1 269 ARG 269 268 268 ARG ARG A . n 
A 1 270 TRP 270 269 269 TRP TRP A . n 
A 1 271 CYS 271 270 270 CYS CYS A . n 
A 1 272 LEU 272 271 271 LEU LEU A . n 
A 1 273 ALA 273 272 272 ALA ALA A . n 
A 1 274 LEU 274 273 273 LEU LEU A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 PRO 276 275 275 PRO PRO A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ASP 278 277 277 ASP ASP A . n 
A 1 279 ARG 279 278 278 ARG ARG A . n 
A 1 280 PRO 280 279 279 PRO PRO A . n 
A 1 281 THR 281 280 280 THR THR A . n 
A 1 282 PHE 282 281 281 PHE PHE A . n 
A 1 283 GLU 283 282 282 GLU GLU A . n 
A 1 284 GLU 284 283 283 GLU GLU A . n 
A 1 285 ILE 285 284 284 ILE ILE A . n 
A 1 286 GLN 286 285 285 GLN GLN A . n 
A 1 287 ASN 287 286 286 ASN ASN A . n 
A 1 288 HIS 288 287 287 HIS HIS A . n 
A 1 289 PRO 289 288 288 PRO PRO A . n 
A 1 290 TRP 290 289 289 TRP TRP A . n 
A 1 291 MET 291 290 290 MET MET A . n 
A 1 292 GLN 292 291 291 GLN GLN A . n 
A 1 293 ASP 293 292 292 ASP ASP A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 LEU 295 294 294 LEU LEU A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 PRO 297 296 296 PRO PRO A . n 
A 1 298 GLN 298 297 297 GLN GLN A . n 
A 1 299 GLU 299 298 298 GLU GLU A . n 
A 1 300 THR 300 299 299 THR THR A . n 
A 1 301 ALA 301 300 300 ALA ALA A . n 
A 1 302 GLU 302 301 301 GLU GLU A . n 
A 1 303 ILE 303 302 302 ILE ILE A . n 
A 1 304 HIS 304 303 303 HIS HIS A . n 
A 1 305 LEU 305 304 304 LEU LEU A . n 
A 1 306 HIS 306 305 305 HIS HIS A . n 
A 1 307 SER 307 306 ?   ?   ?   A . n 
A 1 308 LEU 308 307 ?   ?   ?   A . n 
A 1 309 SER 309 308 ?   ?   ?   A . n 
A 1 310 PRO 310 309 ?   ?   ?   A . n 
A 1 311 GLY 311 310 ?   ?   ?   A . n 
A 1 312 PRO 312 311 ?   ?   ?   A . n 
A 1 313 SER 313 312 ?   ?   ?   A . n 
A 1 314 LYS 314 313 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 UGX 1   1306 1306 UGX UGX A . 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     262 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      261 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-10-30 
2 'Structure model' 1 1 2013-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.6.0117 ? 1 
DENZO     'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
MOLREP    phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             4BZN 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE FIRST TWO RESIDUES AT THE N-TERMINAL GLY AND PRO ARE
EXPRESSION TAG
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 75  ? ? -63.40  -72.58 
2 1 ASP A 167 ? ? -148.12 43.27  
3 1 ASP A 186 ? ? 64.99   88.00  
4 1 ASP A 202 ? ? -140.83 29.38  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1   
2  1 Y 1 A PRO 1   ? A PRO 2   
3  1 Y 1 A LEU 2   ? A LEU 3   
4  1 Y 1 A LEU 3   ? A LEU 4   
5  1 Y 1 A SER 4   ? A SER 5   
6  1 Y 1 A LYS 5   ? A LYS 6   
7  1 Y 1 A ILE 6   ? A ILE 7   
8  1 Y 1 A ASN 7   ? A ASN 8   
9  1 Y 1 A SER 8   ? A SER 9   
10 1 Y 1 A LEU 9   ? A LEU 10  
11 1 Y 1 A ALA 10  ? A ALA 11  
12 1 Y 1 A HIS 11  ? A HIS 12  
13 1 Y 1 A LEU 12  ? A LEU 13  
14 1 Y 1 A ARG 13  ? A ARG 14  
15 1 Y 1 A ALA 14  ? A ALA 15  
16 1 Y 1 A ALA 15  ? A ALA 16  
17 1 Y 1 A PRO 16  ? A PRO 17  
18 1 Y 1 A CYS 17  ? A CYS 18  
19 1 Y 1 A ASN 18  ? A ASN 19  
20 1 Y 1 A ASP 19  ? A ASP 20  
21 1 Y 1 A LEU 20  ? A LEU 21  
22 1 Y 1 A HIS 21  ? A HIS 22  
23 1 Y 1 A ALA 22  ? A ALA 23  
24 1 Y 1 A THR 23  ? A THR 24  
25 1 Y 1 A LYS 24  ? A LYS 25  
26 1 Y 1 A LEU 25  ? A LEU 26  
27 1 Y 1 A ALA 26  ? A ALA 27  
28 1 Y 1 A PRO 27  ? A PRO 28  
29 1 Y 1 A GLY 28  ? A GLY 29  
30 1 Y 1 A LYS 29  ? A LYS 30  
31 1 Y 1 A GLU 30  ? A GLU 31  
32 1 Y 1 A LYS 31  ? A LYS 32  
33 1 Y 1 A GLU 32  ? A GLU 33  
34 1 Y 1 A SER 306 ? A SER 307 
35 1 Y 1 A LEU 307 ? A LEU 308 
36 1 Y 1 A SER 308 ? A SER 309 
37 1 Y 1 A PRO 309 ? A PRO 310 
38 1 Y 1 A GLY 310 ? A GLY 311 
39 1 Y 1 A PRO 311 ? A PRO 312 
40 1 Y 1 A SER 312 ? A SER 313 
41 1 Y 1 A LYS 313 ? A LYS 314 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-(2,2-dimethylpropyl)-2-[1-oxo-7-(thiophen-3-yl)-1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazin-4-yl]acetamide' UGX 
3 water                                                                                                      HOH 
#