data_4C02
# 
_entry.id   4C02 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.338 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4C02         
PDBE  EBI-57859    
WWPDB D_1290057859 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4C02 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-07-31 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Williams, E.'     1  
'Riesebos, E.'     2  
'Vollmar, M.'      3  
'Krojer, T.'       4  
'Bradley, A.'      5  
'Shrestha, L.'     6  
'Kupinska, K.'     7  
'von Delft, F.'    8  
'Arrowsmith, C.H.' 9  
'Edwards, A.M.'    10 
'Bountra, C.'      11 
'Bullock, A.'      12 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin' 
_citation.journal_abbrev            'Ph D Thesis' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            ? 
_citation.book_publisher            'Institute (Thesis)' 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Williams, E.'     1  ? 
primary 'Riesebos, E.'     2  ? 
primary 'Vollmar, M.'      3  ? 
primary 'Krojer, T.'       4  ? 
primary 'Bradley, A.'      5  ? 
primary 'Shrestha, L.'     6  ? 
primary 'Kupinska, K.'     7  ? 
primary 'von Delft, F.'    8  ? 
primary 'Arrowsmith, C.H.' 9  ? 
primary 'Edwards, A.M.'    10 ? 
primary 'Bountra, C.'      11 ? 
primary 'Bullock, A.'      12 ? 
# 
_cell.entry_id           4C02 
_cell.length_a           182.330 
_cell.length_b           182.330 
_cell.length_c           182.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4C02 
_symmetry.space_group_name_H-M             'P 41 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                213 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ACTIVIN RECEPTOR TYPE-1'                                                      37398.746 1   
'2.7.10.2, 2.7.11.30' ? 'KINASE DOMAIN, RESIDUES 172-499' ? 
2 polymer     man 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP1B'                                   11798.501 1   5.2.1.8 ? ? ? 
3 non-polymer syn 'CITRATE ANION'                                                                189.100   8   ? ? ? ? 
4 non-polymer syn '6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine' 399.488   1   ? ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                                 62.068    13  ? ? ? ? 
6 water       nat water                                                                          18.015    231 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;ACTIVIN RECEPTOR TYPE I, ACTR-I, ACTIVIN RECEPTOR-LIKE KINA SE 2, ALK-2, SERINE/THREONINE-PROTEIN KINASE RECEPTOR R1, SKR1, TG F-B SUPERFAMILY RECEPTOR TYPE I, TSR-I, ACVR1A
;
2 
;PPIASE FKBP1B, 12.6 KDA FK506-BINDING PROTEIN, 12.6 KDA FKB P, FKBP-12.6, FK506-BINDING PROTEIN 1B, FKBP-1B, IMMUNOPHILIN FKBP 12.6, ROTAMASE, H-FKBP-12, FKBP1B
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMTTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRET
ELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGK
PAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGL
VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTAL
RIKKTLTKID
;
;SMTTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRET
ELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGK
PAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGL
VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTAL
RIKKTLTKID
;
A ? 
2 'polypeptide(L)' no no 
;MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPD
VAYGATGHPGVIPPNATLIFDVELLNLE
;
;MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPD
VAYGATGHPGVIPPNATLIFDVELLNLE
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   THR n 
1 4   THR n 
1 5   ASN n 
1 6   VAL n 
1 7   GLY n 
1 8   ASP n 
1 9   SER n 
1 10  THR n 
1 11  LEU n 
1 12  ALA n 
1 13  ASP n 
1 14  LEU n 
1 15  LEU n 
1 16  ASP n 
1 17  HIS n 
1 18  SER n 
1 19  CYS n 
1 20  THR n 
1 21  SER n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  SER n 
1 26  GLY n 
1 27  LEU n 
1 28  PRO n 
1 29  PHE n 
1 30  LEU n 
1 31  VAL n 
1 32  GLN n 
1 33  ARG n 
1 34  THR n 
1 35  VAL n 
1 36  ALA n 
1 37  ARG n 
1 38  GLN n 
1 39  ILE n 
1 40  THR n 
1 41  LEU n 
1 42  LEU n 
1 43  GLU n 
1 44  CYS n 
1 45  VAL n 
1 46  GLY n 
1 47  LYS n 
1 48  GLY n 
1 49  ARG n 
1 50  TYR n 
1 51  GLY n 
1 52  GLU n 
1 53  VAL n 
1 54  TRP n 
1 55  ARG n 
1 56  GLY n 
1 57  SER n 
1 58  TRP n 
1 59  GLN n 
1 60  GLY n 
1 61  GLU n 
1 62  ASN n 
1 63  VAL n 
1 64  ALA n 
1 65  VAL n 
1 66  LYS n 
1 67  ILE n 
1 68  PHE n 
1 69  SER n 
1 70  SER n 
1 71  ARG n 
1 72  ASP n 
1 73  GLU n 
1 74  LYS n 
1 75  SER n 
1 76  TRP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  THR n 
1 81  GLU n 
1 82  LEU n 
1 83  TYR n 
1 84  ASN n 
1 85  THR n 
1 86  VAL n 
1 87  MET n 
1 88  LEU n 
1 89  ARG n 
1 90  HIS n 
1 91  GLU n 
1 92  ASN n 
1 93  ILE n 
1 94  LEU n 
1 95  GLY n 
1 96  PHE n 
1 97  ILE n 
1 98  ALA n 
1 99  SER n 
1 100 ASP n 
1 101 MET n 
1 102 THR n 
1 103 SER n 
1 104 ARG n 
1 105 HIS n 
1 106 SER n 
1 107 SER n 
1 108 THR n 
1 109 GLN n 
1 110 LEU n 
1 111 TRP n 
1 112 LEU n 
1 113 ILE n 
1 114 THR n 
1 115 HIS n 
1 116 TYR n 
1 117 HIS n 
1 118 GLU n 
1 119 MET n 
1 120 GLY n 
1 121 SER n 
1 122 LEU n 
1 123 TYR n 
1 124 ASP n 
1 125 TYR n 
1 126 LEU n 
1 127 GLN n 
1 128 LEU n 
1 129 THR n 
1 130 THR n 
1 131 LEU n 
1 132 ASP n 
1 133 THR n 
1 134 VAL n 
1 135 SER n 
1 136 CYS n 
1 137 LEU n 
1 138 ARG n 
1 139 ILE n 
1 140 VAL n 
1 141 LEU n 
1 142 SER n 
1 143 ILE n 
1 144 ALA n 
1 145 SER n 
1 146 GLY n 
1 147 LEU n 
1 148 ALA n 
1 149 HIS n 
1 150 LEU n 
1 151 HIS n 
1 152 ILE n 
1 153 GLU n 
1 154 ILE n 
1 155 PHE n 
1 156 GLY n 
1 157 THR n 
1 158 GLN n 
1 159 GLY n 
1 160 LYS n 
1 161 PRO n 
1 162 ALA n 
1 163 ILE n 
1 164 ALA n 
1 165 HIS n 
1 166 ARG n 
1 167 ASP n 
1 168 LEU n 
1 169 LYS n 
1 170 SER n 
1 171 LYS n 
1 172 ASN n 
1 173 ILE n 
1 174 LEU n 
1 175 VAL n 
1 176 LYS n 
1 177 LYS n 
1 178 ASN n 
1 179 GLY n 
1 180 GLN n 
1 181 CYS n 
1 182 CYS n 
1 183 ILE n 
1 184 ALA n 
1 185 ASP n 
1 186 LEU n 
1 187 GLY n 
1 188 LEU n 
1 189 ALA n 
1 190 VAL n 
1 191 MET n 
1 192 HIS n 
1 193 SER n 
1 194 GLN n 
1 195 SER n 
1 196 THR n 
1 197 ASN n 
1 198 GLN n 
1 199 LEU n 
1 200 ASP n 
1 201 VAL n 
1 202 GLY n 
1 203 ASN n 
1 204 ASN n 
1 205 PRO n 
1 206 ARG n 
1 207 VAL n 
1 208 GLY n 
1 209 THR n 
1 210 LYS n 
1 211 ARG n 
1 212 TYR n 
1 213 MET n 
1 214 ALA n 
1 215 PRO n 
1 216 GLU n 
1 217 VAL n 
1 218 LEU n 
1 219 ASP n 
1 220 GLU n 
1 221 THR n 
1 222 ILE n 
1 223 GLN n 
1 224 VAL n 
1 225 ASP n 
1 226 CYS n 
1 227 PHE n 
1 228 ASP n 
1 229 SER n 
1 230 TYR n 
1 231 LYS n 
1 232 ARG n 
1 233 VAL n 
1 234 ASP n 
1 235 ILE n 
1 236 TRP n 
1 237 ALA n 
1 238 PHE n 
1 239 GLY n 
1 240 LEU n 
1 241 VAL n 
1 242 LEU n 
1 243 TRP n 
1 244 GLU n 
1 245 VAL n 
1 246 ALA n 
1 247 ARG n 
1 248 ARG n 
1 249 MET n 
1 250 VAL n 
1 251 SER n 
1 252 ASN n 
1 253 GLY n 
1 254 ILE n 
1 255 VAL n 
1 256 GLU n 
1 257 ASP n 
1 258 TYR n 
1 259 LYS n 
1 260 PRO n 
1 261 PRO n 
1 262 PHE n 
1 263 TYR n 
1 264 ASP n 
1 265 VAL n 
1 266 VAL n 
1 267 PRO n 
1 268 ASN n 
1 269 ASP n 
1 270 PRO n 
1 271 SER n 
1 272 PHE n 
1 273 GLU n 
1 274 ASP n 
1 275 MET n 
1 276 ARG n 
1 277 LYS n 
1 278 VAL n 
1 279 VAL n 
1 280 CYS n 
1 281 VAL n 
1 282 ASP n 
1 283 GLN n 
1 284 GLN n 
1 285 ARG n 
1 286 PRO n 
1 287 ASN n 
1 288 ILE n 
1 289 PRO n 
1 290 ASN n 
1 291 ARG n 
1 292 TRP n 
1 293 PHE n 
1 294 SER n 
1 295 ASP n 
1 296 PRO n 
1 297 THR n 
1 298 LEU n 
1 299 THR n 
1 300 SER n 
1 301 LEU n 
1 302 ALA n 
1 303 LYS n 
1 304 LEU n 
1 305 MET n 
1 306 LYS n 
1 307 GLU n 
1 308 CYS n 
1 309 TRP n 
1 310 TYR n 
1 311 GLN n 
1 312 ASN n 
1 313 PRO n 
1 314 SER n 
1 315 ALA n 
1 316 ARG n 
1 317 LEU n 
1 318 THR n 
1 319 ALA n 
1 320 LEU n 
1 321 ARG n 
1 322 ILE n 
1 323 LYS n 
1 324 LYS n 
1 325 THR n 
1 326 LEU n 
1 327 THR n 
1 328 LYS n 
1 329 ILE n 
1 330 ASP n 
2 1   MET n 
2 2   GLY n 
2 3   VAL n 
2 4   GLU n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   ILE n 
2 9   SER n 
2 10  PRO n 
2 11  GLY n 
2 12  ASP n 
2 13  GLY n 
2 14  ARG n 
2 15  THR n 
2 16  PHE n 
2 17  PRO n 
2 18  LYS n 
2 19  LYS n 
2 20  GLY n 
2 21  GLN n 
2 22  THR n 
2 23  CYS n 
2 24  VAL n 
2 25  VAL n 
2 26  HIS n 
2 27  TYR n 
2 28  THR n 
2 29  GLY n 
2 30  MET n 
2 31  LEU n 
2 32  GLN n 
2 33  ASN n 
2 34  GLY n 
2 35  LYS n 
2 36  LYS n 
2 37  PHE n 
2 38  ASP n 
2 39  SER n 
2 40  SER n 
2 41  ARG n 
2 42  ASP n 
2 43  ARG n 
2 44  ASN n 
2 45  LYS n 
2 46  PRO n 
2 47  PHE n 
2 48  LYS n 
2 49  PHE n 
2 50  ARG n 
2 51  ILE n 
2 52  GLY n 
2 53  LYS n 
2 54  GLN n 
2 55  GLU n 
2 56  VAL n 
2 57  ILE n 
2 58  LYS n 
2 59  GLY n 
2 60  PHE n 
2 61  GLU n 
2 62  GLU n 
2 63  GLY n 
2 64  ALA n 
2 65  ALA n 
2 66  GLN n 
2 67  MET n 
2 68  SER n 
2 69  LEU n 
2 70  GLY n 
2 71  GLN n 
2 72  ARG n 
2 73  ALA n 
2 74  LYS n 
2 75  LEU n 
2 76  THR n 
2 77  CYS n 
2 78  THR n 
2 79  PRO n 
2 80  ASP n 
2 81  VAL n 
2 82  ALA n 
2 83  TYR n 
2 84  GLY n 
2 85  ALA n 
2 86  THR n 
2 87  GLY n 
2 88  HIS n 
2 89  PRO n 
2 90  GLY n 
2 91  VAL n 
2 92  ILE n 
2 93  PRO n 
2 94  PRO n 
2 95  ASN n 
2 96  ALA n 
2 97  THR n 
2 98  LEU n 
2 99  ILE n 
2 100 PHE n 
2 101 ASP n 
2 102 VAL n 
2 103 GLU n 
2 104 LEU n 
2 105 LEU n 
2 106 ASN n 
2 107 LEU n 
2 108 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 7108   ? ? ? ? ? 
? SF9         ?               ? ? ? ? ? ? BACULOVIRUS ? ? ? PFB-LIC-BSE ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ?               'ESCHERICHIA COLI'      469008 ? ? ? ? ? 
? 'BL21(DE3)' 'ROSETTA PLYSS' ? ? ? ? ? ? PLASMID     ? ? ? PNIC28-BSA4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACVR1_HUMAN 1 ? ? Q04771 ? 
2 UNP FKB1B_HUMAN 2 ? ? P68106 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4C02 A 3 ? 330 ? Q04771 172 ? 499 ? 172 499 
2 2 4C02 B 1 ? 108 ? P68106 1   ? 108 ? 1   108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4C02 SER A 1 ? UNP Q04771 ? ? 'expression tag' 170 1 
1 4C02 MET A 2 ? UNP Q04771 ? ? 'expression tag' 171 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                        ?                 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                       ?                 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                     ?                 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                ?                 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                       ?                 
'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                 'ETHYLENE GLYCOL' 
'C2 H6 O2'       62.068  
FLC non-polymer         . 'CITRATE ANION'                                                                ?                 
'C6 H5 O7 -3'    189.100 
GLN 'L-peptide linking' y GLUTAMINE                                                                      ?                 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                ?                 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                        ?                 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                      ?                 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                          ?                 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                     ?                 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                        ?                 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                         ?                 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                     ?                 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                  ?                 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                        ?                 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                         ?                 
'C3 H7 N O3'     105.093 
TAK non-polymer         . '6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine' Dorsomorphin      
'C24 H25 N5 O'   399.488 
THR 'L-peptide linking' y THREONINE                                                                      ?                 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                     ?                 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                       ?                 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                         ?                 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4C02 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.11 
_exptl_crystal.density_percent_sol   75.95 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '1.8M AMMONIUM CITRATE, pH 7.2' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-06-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.9686 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4C02 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.17 
_reflns.number_obs                   169113 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.17 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.17 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           1.07 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        9.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4C02 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     52159 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.82 
_refine.ls_d_res_high                            2.17 
_refine.ls_percent_reflns_obs                    99.75 
_refine.ls_R_factor_obs                          0.17833 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17729 
_refine.ls_R_factor_R_free                       0.19754 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2787 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.957 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               36.836 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.U VALUES WITH TLS ADDED DISORDERED REGIONS WERE NOT MODELED AND RELEVANT LOOPS DELETED FROM STRUCTURE.
;
_refine.pdbx_starting_model                      'PDB ENTRIES 1C9H AND 3H9R' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.125 
_refine.pdbx_overall_ESU_R_Free                  0.117 
_refine.overall_SU_ML                            0.084 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.385 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3271 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         179 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               3681 
_refine_hist.d_res_high                       2.17 
_refine_hist.d_res_low                        39.82 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.019  ? 3589 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 3380 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.767  1.999  ? 4865 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.777  3.000  ? 7761 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.349  5.000  ? 442  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.919 23.851 ? 148  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.796 15.000 ? 583  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.435 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.157  0.200  ? 538  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 4019 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 802  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  4.706  5.237  ? 1717 'X-RAY DIFFRACTION' ? 
r_mcbond_other               4.707  5.235  ? 1716 'X-RAY DIFFRACTION' ? 
r_mcangle_it                 6.552  9.679  ? 2149 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  6.838  6.335  ? 1872 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.170 
_refine_ls_shell.d_res_low                        2.227 
_refine_ls_shell.number_reflns_R_work             3794 
_refine_ls_shell.R_factor_R_work                  0.276 
_refine_ls_shell.percent_reflns_obs               99.97 
_refine_ls_shell.R_factor_R_free                  0.300 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             194 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4C02 
_struct.title                     'Crystal structure of human ACVR1 (ALK2) in complex with FKBP12.6 and dorsomorphin' 
_struct.pdbx_descriptor           
'ACTIVIN RECEPTOR TYPE-1 (E.C.2.7.10.2, 2.7.11.30), PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP1B (E.C.5.2.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4C02 
_struct_keywords.pdbx_keywords   TRANSFERASE/ISOMERASE 
_struct_keywords.text            'TRANSFERASE-ISOMERASE COMPLEX, TRANSFERASE, DORSOMORPHIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 3 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
Y N N 6 ? 
Z N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 10  ? ASP A 16  ? THR A 179 ASP A 185 1 ? 7  
HELX_P HELX_P2  2  PRO A 28  ? GLN A 38  ? PRO A 197 GLN A 207 1 ? 11 
HELX_P HELX_P3  3  ASP A 72  ? VAL A 86  ? ASP A 241 VAL A 255 1 ? 15 
HELX_P HELX_P4  4  SER A 121 ? THR A 129 ? SER A 290 THR A 298 1 ? 9  
HELX_P HELX_P5  5  ASP A 132 ? ILE A 152 ? ASP A 301 ILE A 321 1 ? 21 
HELX_P HELX_P6  6  LYS A 169 ? LYS A 171 ? LYS A 338 LYS A 340 5 ? 3  
HELX_P HELX_P7  7  THR A 209 ? MET A 213 ? THR A 378 MET A 382 5 ? 5  
HELX_P HELX_P8  8  ALA A 214 ? ASP A 219 ? ALA A 383 ASP A 388 1 ? 6  
HELX_P HELX_P9  9  CYS A 226 ? ARG A 247 ? CYS A 395 ARG A 416 1 ? 22 
HELX_P HELX_P10 10 SER A 271 ? CYS A 280 ? SER A 440 CYS A 449 1 ? 10 
HELX_P HELX_P11 11 PRO A 289 ? SER A 294 ? PRO A 458 SER A 463 5 ? 6  
HELX_P HELX_P12 12 ASP A 295 ? GLU A 307 ? ASP A 464 GLU A 476 1 ? 13 
HELX_P HELX_P13 13 ASN A 312 ? ARG A 316 ? ASN A 481 ARG A 485 5 ? 5  
HELX_P HELX_P14 14 THR A 318 ? ASP A 330 ? THR A 487 ASP A 499 1 ? 13 
HELX_P HELX_P15 15 ILE B 57  ? ALA B 65  ? ILE B 57  ALA B 65  1 ? 9  
HELX_P HELX_P16 16 PRO B 79  ? ALA B 82  ? PRO B 79  ALA B 82  5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
BA ? 5 ? 
BB ? 5 ? 
BC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? parallel      
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BC 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 40  ? GLY A 48  ? THR A 209 GLY A 217 
AA 2 GLY A 51  ? TRP A 58  ? GLY A 220 TRP A 227 
AA 3 GLU A 61  ? PHE A 68  ? GLU A 230 PHE A 237 
AA 4 THR A 108 ? THR A 114 ? THR A 277 THR A 283 
AA 5 PHE A 96  ? SER A 103 ? PHE A 265 SER A 272 
AB 1 ALA A 162 ? ALA A 164 ? ALA A 331 ALA A 333 
AB 2 VAL A 190 ? HIS A 192 ? VAL A 359 HIS A 361 
AC 1 ILE A 173 ? VAL A 175 ? ILE A 342 VAL A 344 
AC 2 CYS A 181 ? ILE A 183 ? CYS A 350 ILE A 352 
BA 1 VAL B 3   ? SER B 9   ? VAL B 3   SER B 9   
BA 2 ARG B 72  ? CYS B 77  ? ARG B 72  CYS B 77  
BA 3 LEU B 98  ? GLU B 108 ? LEU B 98  GLU B 108 
BA 4 THR B 22  ? LEU B 31  ? THR B 22  LEU B 31  
BA 5 LYS B 36  ? SER B 39  ? LYS B 36  SER B 39  
BB 1 VAL B 3   ? SER B 9   ? VAL B 3   SER B 9   
BB 2 ARG B 72  ? CYS B 77  ? ARG B 72  CYS B 77  
BB 3 LEU B 98  ? GLU B 108 ? LEU B 98  GLU B 108 
BB 4 THR B 22  ? LEU B 31  ? THR B 22  LEU B 31  
BB 5 PHE B 47  ? ARG B 50  ? PHE B 47  ARG B 50  
BC 1 LYS B 36  ? SER B 39  ? LYS B 36  SER B 39  
BC 2 THR B 22  ? LEU B 31  ? THR B 22  LEU B 31  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 48  ? N GLY A 217 O GLY A 51  ? O GLY A 220 
AA 2 3 N TRP A 58  ? N TRP A 227 O GLU A 61  ? O GLU A 230 
AA 3 4 N PHE A 68  ? N PHE A 237 O LEU A 110 ? O LEU A 279 
AA 4 5 O ILE A 113 ? O ILE A 282 N ILE A 97  ? N ILE A 266 
AB 1 2 N ALA A 164 ? N ALA A 333 O VAL A 190 ? O VAL A 359 
AC 1 2 N LEU A 174 ? N LEU A 343 O CYS A 182 ? O CYS A 351 
BA 1 2 N ILE B 8   ? N ILE B 8   O ARG B 72  ? O ARG B 72  
BA 2 3 N CYS B 77  ? N CYS B 77  O LEU B 98  ? O LEU B 98  
BA 3 4 N GLU B 108 ? N GLU B 108 O THR B 22  ? O THR B 22  
BA 4 5 O GLY B 29  ? O GLY B 29  N PHE B 37  ? N PHE B 37  
BB 1 2 N ILE B 8   ? N ILE B 8   O ARG B 72  ? O ARG B 72  
BB 2 3 N CYS B 77  ? N CYS B 77  O LEU B 98  ? O LEU B 98  
BB 3 4 N GLU B 108 ? N GLU B 108 O THR B 22  ? O THR B 22  
BB 4 5 N VAL B 25  ? N VAL B 25  O PHE B 47  ? O PHE B 47  
BC 1 2 N PHE B 37  ? N PHE B 37  O GLY B 29  ? O GLY B 29  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FLC 1500 ? 6  'BINDING SITE FOR RESIDUE FLC A 1500' 
AC2 Software A FLC 1501 ? 9  'BINDING SITE FOR RESIDUE FLC A 1501' 
AC3 Software A FLC 1502 ? 10 'BINDING SITE FOR RESIDUE FLC A 1502' 
AC4 Software A FLC 1503 ? 12 'BINDING SITE FOR RESIDUE FLC A 1503' 
AC5 Software A FLC 1504 ? 8  'BINDING SITE FOR RESIDUE FLC A 1504' 
AC6 Software A FLC 1505 ? 8  'BINDING SITE FOR RESIDUE FLC A 1505' 
AC7 Software A FLC 1506 ? 8  'BINDING SITE FOR RESIDUE FLC A 1506' 
AC8 Software B FLC 1108 ? 6  'BINDING SITE FOR RESIDUE FLC B 1108' 
AC9 Software A TAK 1507 ? 11 'BINDING SITE FOR RESIDUE TAK A 1507' 
BC1 Software B EDO 1109 ? 2  'BINDING SITE FOR RESIDUE EDO B 1109' 
BC2 Software A EDO 1508 ? 5  'BINDING SITE FOR RESIDUE EDO A 1508' 
BC3 Software B EDO 1110 ? 2  'BINDING SITE FOR RESIDUE EDO B 1110' 
BC4 Software A EDO 1509 ? 8  'BINDING SITE FOR RESIDUE EDO A 1509' 
BC5 Software A EDO 1510 ? 5  'BINDING SITE FOR RESIDUE EDO A 1510' 
BC6 Software A EDO 1511 ? 2  'BINDING SITE FOR RESIDUE EDO A 1511' 
BC7 Software A EDO 1512 ? 6  'BINDING SITE FOR RESIDUE EDO A 1512' 
BC8 Software A EDO 1513 ? 5  'BINDING SITE FOR RESIDUE EDO A 1513' 
BC9 Software B EDO 1111 ? 4  'BINDING SITE FOR RESIDUE EDO B 1111' 
CC1 Software A EDO 1514 ? 2  'BINDING SITE FOR RESIDUE EDO A 1514' 
CC2 Software A EDO 1515 ? 3  'BINDING SITE FOR RESIDUE EDO A 1515' 
CC3 Software A EDO 1516 ? 8  'BINDING SITE FOR RESIDUE EDO A 1516' 
CC4 Software B EDO 1112 ? 6  'BINDING SITE FOR RESIDUE EDO B 1112' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  HIS A 149 ? HIS A 318  . ? 1_555  ? 
2   AC1 6  ILE A 152 ? ILE A 321  . ? 1_555  ? 
3   AC1 6  LYS A 323 ? LYS A 492  . ? 1_555  ? 
4   AC1 6  HOH Y .   ? HOH A 2036 . ? 1_555  ? 
5   AC1 6  HOH Y .   ? HOH A 2063 . ? 1_555  ? 
6   AC1 6  HOH Y .   ? HOH A 2066 . ? 1_555  ? 
7   AC2 9  GLY A 156 ? GLY A 325  . ? 1_555  ? 
8   AC2 9  GLN A 194 ? GLN A 363  . ? 1_555  ? 
9   AC2 9  HOH Y .   ? HOH A 2074 . ? 1_555  ? 
10  AC2 9  HOH Y .   ? HOH A 2075 . ? 1_555  ? 
11  AC2 9  THR B 28  ? THR B 28   . ? 6_445  ? 
12  AC2 9  LYS B 36  ? LYS B 36   . ? 6_445  ? 
13  AC2 9  SER B 39  ? SER B 39   . ? 6_445  ? 
14  AC2 9  ARG B 41  ? ARG B 41   . ? 6_445  ? 
15  AC2 9  ASP B 42  ? ASP B 42   . ? 6_445  ? 
16  AC3 10 HIS A 115 ? HIS A 284  . ? 1_555  ? 
17  AC3 10 TYR A 116 ? TYR A 285  . ? 1_555  ? 
18  AC3 10 HIS A 117 ? HIS A 286  . ? 1_555  ? 
19  AC3 10 GLU A 118 ? GLU A 287  . ? 1_555  ? 
20  AC3 10 LYS A 176 ? LYS A 345  . ? 1_555  ? 
21  AC3 10 LYS A 177 ? LYS A 346  . ? 1_555  ? 
22  AC3 10 EDO M .   ? EDO A 1510 . ? 1_555  ? 
23  AC3 10 HOH Y .   ? HOH A 2044 . ? 1_555  ? 
24  AC3 10 HOH Y .   ? HOH A 2045 . ? 1_555  ? 
25  AC3 10 HOH Y .   ? HOH A 2091 . ? 1_555  ? 
26  AC4 12 ARG A 89  ? ARG A 258  . ? 1_555  ? 
27  AC4 12 HIS A 90  ? HIS A 259  . ? 1_555  ? 
28  AC4 12 GLU A 91  ? GLU A 260  . ? 1_555  ? 
29  AC4 12 ILE A 93  ? ILE A 262  . ? 1_555  ? 
30  AC4 12 LEU A 94  ? LEU A 263  . ? 1_555  ? 
31  AC4 12 GLY A 95  ? GLY A 264  . ? 1_555  ? 
32  AC4 12 HIS A 115 ? HIS A 284  . ? 1_555  ? 
33  AC4 12 HIS A 117 ? HIS A 286  . ? 1_555  ? 
34  AC4 12 LYS A 176 ? LYS A 345  . ? 1_555  ? 
35  AC4 12 EDO M .   ? EDO A 1510 . ? 1_555  ? 
36  AC4 12 EDO P .   ? EDO A 1513 . ? 1_555  ? 
37  AC4 12 HOH Y .   ? HOH A 2183 . ? 1_555  ? 
38  AC5 8  LYS A 169 ? LYS A 338  . ? 1_555  ? 
39  AC5 8  LYS A 171 ? LYS A 340  . ? 1_555  ? 
40  AC5 8  ARG A 211 ? ARG A 380  . ? 1_555  ? 
41  AC5 8  ASN A 268 ? ASN A 437  . ? 1_555  ? 
42  AC5 8  ASP A 269 ? ASP A 438  . ? 1_555  ? 
43  AC5 8  PRO A 270 ? PRO A 439  . ? 1_555  ? 
44  AC5 8  HOH Y .   ? HOH A 2109 . ? 1_555  ? 
45  AC5 8  HOH Y .   ? HOH A 2184 . ? 1_555  ? 
46  AC6 8  THR A 318 ? THR A 487  . ? 1_555  ? 
47  AC6 8  LEU A 320 ? LEU A 489  . ? 1_555  ? 
48  AC6 8  ARG A 321 ? ARG A 490  . ? 1_555  ? 
49  AC6 8  LYS A 324 ? LYS A 493  . ? 1_555  ? 
50  AC6 8  FLC I .   ? FLC A 1506 . ? 1_555  ? 
51  AC6 8  HOH Y .   ? HOH A 2186 . ? 1_555  ? 
52  AC6 8  LYS B 48  ? LYS B 48   . ? 6_445  ? 
53  AC6 8  GLU B 108 ? GLU B 108  . ? 6_445  ? 
54  AC7 8  ILE A 152 ? ILE A 321  . ? 1_555  ? 
55  AC7 8  LYS A 231 ? LYS A 400  . ? 1_555  ? 
56  AC7 8  THR A 318 ? THR A 487  . ? 1_555  ? 
57  AC7 8  ALA A 319 ? ALA A 488  . ? 1_555  ? 
58  AC7 8  LEU A 320 ? LEU A 489  . ? 1_555  ? 
59  AC7 8  FLC H .   ? FLC A 1505 . ? 1_555  ? 
60  AC7 8  HOH Y .   ? HOH A 2125 . ? 1_555  ? 
61  AC7 8  LEU B 105 ? LEU B 105  . ? 6_445  ? 
62  AC8 6  MET A 101 ? MET A 270  . ? 1_555  ? 
63  AC8 6  ALA B 82  ? ALA B 82   . ? 1_555  ? 
64  AC8 6  TYR B 83  ? TYR B 83   . ? 1_555  ? 
65  AC8 6  GLY B 84  ? GLY B 84   . ? 1_555  ? 
66  AC8 6  ALA B 85  ? ALA B 85   . ? 1_555  ? 
67  AC8 6  THR B 86  ? THR B 86   . ? 1_555  ? 
68  AC9 11 VAL A 53  ? VAL A 222  . ? 1_555  ? 
69  AC9 11 ALA A 64  ? ALA A 233  . ? 1_555  ? 
70  AC9 11 LEU A 94  ? LEU A 263  . ? 1_555  ? 
71  AC9 11 THR A 114 ? THR A 283  . ? 1_555  ? 
72  AC9 11 HIS A 115 ? HIS A 284  . ? 1_555  ? 
73  AC9 11 TYR A 116 ? TYR A 285  . ? 1_555  ? 
74  AC9 11 HIS A 117 ? HIS A 286  . ? 1_555  ? 
75  AC9 11 GLU A 118 ? GLU A 287  . ? 1_555  ? 
76  AC9 11 GLY A 120 ? GLY A 289  . ? 1_555  ? 
77  AC9 11 LEU A 174 ? LEU A 343  . ? 1_555  ? 
78  AC9 11 ASP A 185 ? ASP A 354  . ? 1_555  ? 
79  BC1 2  LEU B 31  ? LEU B 31   . ? 1_555  ? 
80  BC1 2  ASN B 33  ? ASN B 33   . ? 1_555  ? 
81  BC2 5  PHE A 262 ? PHE A 431  . ? 1_555  ? 
82  BC2 5  ASP A 264 ? ASP A 433  . ? 1_555  ? 
83  BC2 5  ARG A 285 ? ARG A 454  . ? 1_555  ? 
84  BC2 5  ASN A 287 ? ASN A 456  . ? 1_555  ? 
85  BC2 5  HOH Y .   ? HOH A 2138 . ? 1_555  ? 
86  BC3 2  PHE B 47  ? PHE B 47   . ? 1_555  ? 
87  BC3 2  LYS B 48  ? LYS B 48   . ? 1_555  ? 
88  BC4 8  CYS A 226 ? CYS A 395  . ? 1_555  ? 
89  BC4 8  ASP A 228 ? ASP A 397  . ? 1_555  ? 
90  BC4 8  SER A 229 ? SER A 398  . ? 1_555  ? 
91  BC4 8  ARG A 232 ? ARG A 401  . ? 1_555  ? 
92  BC4 8  PRO A 313 ? PRO A 482  . ? 1_555  ? 
93  BC4 8  SER A 314 ? SER A 483  . ? 1_555  ? 
94  BC4 8  ASP B 12  ? ASP B 12   . ? 6_445  ? 
95  BC4 8  ARG B 14  ? ARG B 14   . ? 6_445  ? 
96  BC5 5  GLU A 91  ? GLU A 260  . ? 1_555  ? 
97  BC5 5  LYS A 176 ? LYS A 345  . ? 1_555  ? 
98  BC5 5  ASN A 178 ? ASN A 347  . ? 1_555  ? 
99  BC5 5  FLC E .   ? FLC A 1502 . ? 1_555  ? 
100 BC5 5  FLC F .   ? FLC A 1503 . ? 1_555  ? 
101 BC6 2  THR A 133 ? THR A 302  . ? 1_555  ? 
102 BC6 2  HOH Y .   ? HOH A 2164 . ? 1_555  ? 
103 BC7 6  ARG A 285 ? ARG A 454  . ? 1_555  ? 
104 BC7 6  PRO A 286 ? PRO A 455  . ? 1_555  ? 
105 BC7 6  LYS A 306 ? LYS A 475  . ? 1_555  ? 
106 BC7 6  TRP A 309 ? TRP A 478  . ? 1_555  ? 
107 BC7 6  HOH Y .   ? HOH A 2160 . ? 1_555  ? 
108 BC7 6  HOH Y .   ? HOH A 2170 . ? 1_555  ? 
109 BC8 5  PHE A 96  ? PHE A 265  . ? 1_555  ? 
110 BC8 5  HIS A 115 ? HIS A 284  . ? 1_555  ? 
111 BC8 5  FLC F .   ? FLC A 1503 . ? 1_555  ? 
112 BC8 5  HOH Y .   ? HOH A 2006 . ? 1_555  ? 
113 BC8 5  HOH Y .   ? HOH A 2189 . ? 1_555  ? 
114 BC9 4  PRO B 10  ? PRO B 10   . ? 1_555  ? 
115 BC9 4  GLY B 11  ? GLY B 11   . ? 1_555  ? 
116 BC9 4  SER B 68  ? SER B 68   . ? 1_555  ? 
117 BC9 4  GLN B 71  ? GLN B 71   . ? 1_555  ? 
118 CC1 2  ARG A 37  ? ARG A 206  . ? 1_555  ? 
119 CC1 2  GLN B 54  ? GLN B 54   . ? 1_555  ? 
120 CC2 3  GLU A 43  ? GLU A 212  . ? 1_555  ? 
121 CC2 3  THR A 130 ? THR A 299  . ? 13_455 ? 
122 CC2 3  VAL A 250 ? VAL A 419  . ? 13_455 ? 
123 CC3 8  ASN A 62  ? ASN A 231  . ? 1_555  ? 
124 CC3 8  GLU A 118 ? GLU A 287  . ? 1_555  ? 
125 CC3 8  THR A 129 ? THR A 298  . ? 13_455 ? 
126 CC3 8  THR A 130 ? THR A 299  . ? 13_455 ? 
127 CC3 8  LEU A 131 ? LEU A 300  . ? 13_455 ? 
128 CC3 8  ASP A 132 ? ASP A 301  . ? 13_455 ? 
129 CC3 8  SER A 135 ? SER A 304  . ? 13_455 ? 
130 CC3 8  HOH Y .   ? HOH A 2043 . ? 1_555  ? 
131 CC4 6  LYS A 277 ? LYS A 446  . ? 17_455 ? 
132 CC4 6  VAL A 281 ? VAL A 450  . ? 17_455 ? 
133 CC4 6  ASP A 282 ? ASP A 451  . ? 17_455 ? 
134 CC4 6  ILE B 51  ? ILE B 51   . ? 1_555  ? 
135 CC4 6  GLY B 52  ? GLY B 52   . ? 1_555  ? 
136 CC4 6  GLU B 61  ? GLU B 61   . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          4C02 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4C02 
_atom_sites.fract_transf_matrix[1][1]   0.005485 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005485 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005485 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 9   ? -69.494 4.420   30.117  1.00 90.91  ? 178  SER A N   1 
ATOM   2    C CA  . SER A 1 9   ? -68.338 5.052   30.844  1.00 96.43  ? 178  SER A CA  1 
ATOM   3    C C   . SER A 1 9   ? -67.172 5.361   29.871  1.00 72.24  ? 178  SER A C   1 
ATOM   4    O O   . SER A 1 9   ? -66.906 6.520   29.594  1.00 70.22  ? 178  SER A O   1 
ATOM   5    C CB  . SER A 1 9   ? -67.883 4.189   32.054  1.00 72.16  ? 178  SER A CB  1 
ATOM   6    N N   . THR A 1 10  ? -66.515 4.325   29.349  1.00 57.62  ? 179  THR A N   1 
ATOM   7    C CA  . THR A 1 10  ? -65.335 4.461   28.479  1.00 56.08  ? 179  THR A CA  1 
ATOM   8    C C   . THR A 1 10  ? -65.709 4.920   27.043  1.00 64.12  ? 179  THR A C   1 
ATOM   9    O O   . THR A 1 10  ? -66.865 4.789   26.626  1.00 58.30  ? 179  THR A O   1 
ATOM   10   C CB  . THR A 1 10  ? -64.531 3.122   28.442  1.00 63.60  ? 179  THR A CB  1 
ATOM   11   O OG1 . THR A 1 10  ? -63.416 3.205   27.538  1.00 70.86  ? 179  THR A OG1 1 
ATOM   12   C CG2 . THR A 1 10  ? -65.393 1.946   28.003  1.00 63.39  ? 179  THR A CG2 1 
ATOM   13   N N   . LEU A 1 11  ? -64.746 5.461   26.286  1.00 47.63  ? 180  LEU A N   1 
ATOM   14   C CA  . LEU A 1 11  ? -65.033 5.883   24.909  1.00 53.03  ? 180  LEU A CA  1 
ATOM   15   C C   . LEU A 1 11  ? -65.416 4.683   24.060  1.00 51.89  ? 180  LEU A C   1 
ATOM   16   O O   . LEU A 1 11  ? -66.181 4.843   23.126  1.00 44.80  ? 180  LEU A O   1 
ATOM   17   C CB  . LEU A 1 11  ? -63.868 6.640   24.230  1.00 43.47  ? 180  LEU A CB  1 
ATOM   18   C CG  . LEU A 1 11  ? -63.851 8.147   24.431  1.00 44.70  ? 180  LEU A CG  1 
ATOM   19   C CD1 . LEU A 1 11  ? -62.624 8.774   23.804  1.00 51.84  ? 180  LEU A CD1 1 
ATOM   20   C CD2 . LEU A 1 11  ? -65.099 8.824   23.895  1.00 45.21  ? 180  LEU A CD2 1 
ATOM   21   N N   . ALA A 1 12  ? -64.875 3.502   24.369  1.00 56.58  ? 181  ALA A N   1 
ATOM   22   C CA  . ALA A 1 12  ? -65.232 2.268   23.641  1.00 65.02  ? 181  ALA A CA  1 
ATOM   23   C C   . ALA A 1 12  ? -66.722 1.891   23.786  1.00 55.06  ? 181  ALA A C   1 
ATOM   24   O O   . ALA A 1 12  ? -67.343 1.472   22.813  1.00 73.95  ? 181  ALA A O   1 
ATOM   25   C CB  . ALA A 1 12  ? -64.351 1.117   24.082  1.00 52.48  ? 181  ALA A CB  1 
ATOM   26   N N   . ASP A 1 13  ? -67.287 2.077   24.978  1.00 50.10  ? 182  ASP A N   1 
ATOM   27   C CA  . ASP A 1 13  ? -68.717 1.834   25.224  1.00 73.12  ? 182  ASP A CA  1 
ATOM   28   C C   . ASP A 1 13  ? -69.518 2.734   24.307  1.00 67.93  ? 182  ASP A C   1 
ATOM   29   O O   . ASP A 1 13  ? -70.381 2.263   23.568  1.00 88.70  ? 182  ASP A O   1 
ATOM   30   C CB  . ASP A 1 13  ? -69.161 2.160   26.675  1.00 76.76  ? 182  ASP A CB  1 
ATOM   31   C CG  . ASP A 1 13  ? -68.543 1.248   27.733  1.00 83.57  ? 182  ASP A CG  1 
ATOM   32   O OD1 . ASP A 1 13  ? -67.984 0.168   27.408  1.00 74.07  ? 182  ASP A OD1 1 
ATOM   33   O OD2 . ASP A 1 13  ? -68.622 1.644   28.916  1.00 80.09  ? 182  ASP A OD2 1 
ATOM   34   N N   . LEU A 1 14  ? -69.227 4.035   24.377  1.00 57.85  ? 183  LEU A N   1 
ATOM   35   C CA  . LEU A 1 14  ? -69.931 5.033   23.576  1.00 54.53  ? 183  LEU A CA  1 
ATOM   36   C C   . LEU A 1 14  ? -69.854 4.726   22.075  1.00 54.86  ? 183  LEU A C   1 
ATOM   37   O O   . LEU A 1 14  ? -70.764 5.091   21.317  1.00 53.59  ? 183  LEU A O   1 
ATOM   38   C CB  . LEU A 1 14  ? -69.404 6.443   23.876  1.00 54.68  ? 183  LEU A CB  1 
ATOM   39   C CG  . LEU A 1 14  ? -69.933 7.121   25.144  1.00 64.83  ? 183  LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 14  ? -69.276 8.475   25.351  1.00 67.47  ? 183  LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 14  ? -71.450 7.288   25.107  1.00 69.23  ? 183  LEU A CD2 1 
ATOM   42   N N   . LEU A 1 15  ? -68.787 4.037   21.663  1.00 51.66  ? 184  LEU A N   1 
ATOM   43   C CA  . LEU A 1 15  ? -68.566 3.705   20.259  1.00 58.61  ? 184  LEU A CA  1 
ATOM   44   C C   . LEU A 1 15  ? -69.215 2.394   19.847  1.00 58.82  ? 184  LEU A C   1 
ATOM   45   O O   . LEU A 1 15  ? -69.496 2.216   18.670  1.00 55.72  ? 184  LEU A O   1 
ATOM   46   C CB  . LEU A 1 15  ? -67.060 3.665   19.935  1.00 61.60  ? 184  LEU A CB  1 
ATOM   47   C CG  . LEU A 1 15  ? -66.391 5.044   19.750  1.00 61.27  ? 184  LEU A CG  1 
ATOM   48   C CD1 . LEU A 1 15  ? -64.885 4.980   19.985  1.00 61.08  ? 184  LEU A CD1 1 
ATOM   49   C CD2 . LEU A 1 15  ? -66.682 5.624   18.375  1.00 55.23  ? 184  LEU A CD2 1 
ATOM   50   N N   . ASP A 1 16  ? -69.454 1.493   20.799  1.00 76.67  ? 185  ASP A N   1 
ATOM   51   C CA  . ASP A 1 16  ? -69.892 0.111   20.514  1.00 82.39  ? 185  ASP A CA  1 
ATOM   52   C C   . ASP A 1 16  ? -71.034 -0.015  19.501  1.00 75.00  ? 185  ASP A C   1 
ATOM   53   O O   . ASP A 1 16  ? -72.100 0.562   19.694  1.00 62.54  ? 185  ASP A O   1 
ATOM   54   C CB  . ASP A 1 16  ? -70.314 -0.578  21.813  1.00 103.35 ? 185  ASP A CB  1 
ATOM   55   C CG  . ASP A 1 16  ? -70.421 -2.077  21.663  1.00 119.76 ? 185  ASP A CG  1 
ATOM   56   O OD1 . ASP A 1 16  ? -69.437 -2.697  21.205  1.00 128.10 ? 185  ASP A OD1 1 
ATOM   57   O OD2 . ASP A 1 16  ? -71.483 -2.635  22.001  1.00 125.97 ? 185  ASP A OD2 1 
ATOM   58   N N   . SER A 1 21  ? -75.309 3.229   16.507  1.00 92.29  ? 190  SER A N   1 
ATOM   59   C CA  . SER A 1 21  ? -75.944 2.270   15.594  1.00 123.44 ? 190  SER A CA  1 
ATOM   60   C C   . SER A 1 21  ? -76.715 3.000   14.474  1.00 115.31 ? 190  SER A C   1 
ATOM   61   O O   . SER A 1 21  ? -77.850 3.497   14.669  1.00 65.12  ? 190  SER A O   1 
ATOM   62   C CB  . SER A 1 21  ? -76.856 1.296   16.360  1.00 109.14 ? 190  SER A CB  1 
ATOM   63   N N   . GLY A 1 22  ? -76.079 3.052   13.304  1.00 106.85 ? 191  GLY A N   1 
ATOM   64   C CA  . GLY A 1 22  ? -76.598 3.793   12.161  1.00 105.84 ? 191  GLY A CA  1 
ATOM   65   C C   . GLY A 1 22  ? -75.550 3.924   11.067  1.00 108.83 ? 191  GLY A C   1 
ATOM   66   O O   . GLY A 1 22  ? -75.386 3.008   10.257  1.00 97.27  ? 191  GLY A O   1 
ATOM   67   N N   . SER A 1 23  ? -74.837 5.056   11.051  1.00 91.07  ? 192  SER A N   1 
ATOM   68   C CA  . SER A 1 23  ? -73.833 5.331   10.011  1.00 84.56  ? 192  SER A CA  1 
ATOM   69   C C   . SER A 1 23  ? -72.641 6.215   10.489  1.00 73.90  ? 192  SER A C   1 
ATOM   70   O O   . SER A 1 23  ? -72.690 6.888   11.541  1.00 56.75  ? 192  SER A O   1 
ATOM   71   C CB  . SER A 1 23  ? -74.508 5.910   8.748   1.00 72.89  ? 192  SER A CB  1 
ATOM   72   O OG  . SER A 1 23  ? -74.886 7.263   8.919   1.00 73.69  ? 192  SER A OG  1 
ATOM   73   N N   . GLY A 1 24  ? -71.564 6.171   9.706   1.00 41.45  ? 193  GLY A N   1 
ATOM   74   C CA  . GLY A 1 24  ? -70.316 6.805   10.074  1.00 42.46  ? 193  GLY A CA  1 
ATOM   75   C C   . GLY A 1 24  ? -69.404 5.909   10.905  1.00 32.47  ? 193  GLY A C   1 
ATOM   76   O O   . GLY A 1 24  ? -69.749 4.803   11.261  1.00 33.04  ? 193  GLY A O   1 
ATOM   77   N N   . SER A 1 25  ? -68.234 6.422   11.222  1.00 29.23  ? 194  SER A N   1 
ATOM   78   C CA  . SER A 1 25  ? -67.187 5.639   11.864  1.00 26.71  ? 194  SER A CA  1 
ATOM   79   C C   . SER A 1 25  ? -67.074 5.912   13.357  1.00 26.23  ? 194  SER A C   1 
ATOM   80   O O   . SER A 1 25  ? -66.552 5.064   14.100  1.00 24.32  ? 194  SER A O   1 
ATOM   81   C CB  . SER A 1 25  ? -65.843 5.987   11.237  1.00 24.24  ? 194  SER A CB  1 
ATOM   82   O OG  . SER A 1 25  ? -65.795 5.642   9.873   1.00 25.03  ? 194  SER A OG  1 
ATOM   83   N N   . GLY A 1 26  ? -67.499 7.101   13.791  1.00 26.44  ? 195  GLY A N   1 
ATOM   84   C CA  . GLY A 1 26  ? -67.190 7.543   15.159  1.00 30.30  ? 195  GLY A CA  1 
ATOM   85   C C   . GLY A 1 26  ? -68.394 7.640   16.073  1.00 26.79  ? 195  GLY A C   1 
ATOM   86   O O   . GLY A 1 26  ? -69.281 6.822   16.004  1.00 24.25  ? 195  GLY A O   1 
ATOM   87   N N   . LEU A 1 27  ? -68.412 8.646   16.948  1.00 23.57  ? 196  LEU A N   1 
ATOM   88   C CA  . LEU A 1 27  ? -69.541 8.840   17.845  1.00 20.93  ? 196  LEU A CA  1 
ATOM   89   C C   . LEU A 1 27  ? -70.784 9.307   17.087  1.00 24.65  ? 196  LEU A C   1 
ATOM   90   O O   . LEU A 1 27  ? -70.693 9.929   16.010  1.00 26.24  ? 196  LEU A O   1 
ATOM   91   C CB  . LEU A 1 27  ? -69.179 9.857   18.925  1.00 23.42  ? 196  LEU A CB  1 
ATOM   92   C CG  . LEU A 1 27  ? -68.064 9.408   19.873  1.00 23.75  ? 196  LEU A CG  1 
ATOM   93   C CD1 . LEU A 1 27  ? -67.514 10.558  20.692  1.00 27.88  ? 196  LEU A CD1 1 
ATOM   94   C CD2 . LEU A 1 27  ? -68.586 8.336   20.777  1.00 27.97  ? 196  LEU A CD2 1 
ATOM   95   N N   . PRO A 1 28  ? -71.962 9.039   17.648  1.00 24.26  ? 197  PRO A N   1 
ATOM   96   C CA  . PRO A 1 28  ? -73.160 9.616   17.075  1.00 25.40  ? 197  PRO A CA  1 
ATOM   97   C C   . PRO A 1 28  ? -72.971 11.122  16.862  1.00 25.65  ? 197  PRO A C   1 
ATOM   98   O O   . PRO A 1 28  ? -72.259 11.778  17.610  1.00 24.09  ? 197  PRO A O   1 
ATOM   99   C CB  . PRO A 1 28  ? -74.242 9.318   18.120  1.00 27.98  ? 197  PRO A CB  1 
ATOM   100  C CG  . PRO A 1 28  ? -73.719 8.163   18.916  1.00 26.57  ? 197  PRO A CG  1 
ATOM   101  C CD  . PRO A 1 28  ? -72.226 8.352   18.923  1.00 27.27  ? 197  PRO A CD  1 
ATOM   102  N N   A PHE A 1 29  ? -73.614 11.658  15.831  0.56 25.32  ? 198  PHE A N   1 
ATOM   103  N N   B PHE A 1 29  ? -73.583 11.644  15.812  0.44 24.76  ? 198  PHE A N   1 
ATOM   104  C CA  A PHE A 1 29  ? -73.255 12.980  15.327  0.56 29.19  ? 198  PHE A CA  1 
ATOM   105  C CA  B PHE A 1 29  ? -73.325 13.003  15.373  0.44 27.40  ? 198  PHE A CA  1 
ATOM   106  C C   A PHE A 1 29  ? -73.383 14.102  16.399  0.56 31.44  ? 198  PHE A C   1 
ATOM   107  C C   B PHE A 1 29  ? -73.338 14.020  16.509  0.44 29.36  ? 198  PHE A C   1 
ATOM   108  O O   A PHE A 1 29  ? -72.462 14.904  16.558  0.56 31.03  ? 198  PHE A O   1 
ATOM   109  O O   B PHE A 1 29  ? -72.329 14.656  16.815  0.44 28.88  ? 198  PHE A O   1 
ATOM   110  C CB  A PHE A 1 29  ? -73.993 13.297  13.995  0.56 29.68  ? 198  PHE A CB  1 
ATOM   111  C CB  B PHE A 1 29  ? -74.358 13.386  14.331  0.44 27.01  ? 198  PHE A CB  1 
ATOM   112  C CG  A PHE A 1 29  ? -73.768 12.253  12.869  0.56 32.11  ? 198  PHE A CG  1 
ATOM   113  C CG  B PHE A 1 29  ? -74.421 14.843  14.055  0.44 29.57  ? 198  PHE A CG  1 
ATOM   114  C CD1 A PHE A 1 29  ? -72.491 11.835  12.501  0.56 29.74  ? 198  PHE A CD1 1 
ATOM   115  C CD1 B PHE A 1 29  ? -73.309 15.527  13.654  0.44 31.67  ? 198  PHE A CD1 1 
ATOM   116  C CD2 A PHE A 1 29  ? -74.849 11.711  12.168  0.56 32.96  ? 198  PHE A CD2 1 
ATOM   117  C CD2 B PHE A 1 29  ? -75.607 15.520  14.184  0.44 31.98  ? 198  PHE A CD2 1 
ATOM   118  C CE1 A PHE A 1 29  ? -72.298 10.905  11.485  0.56 29.32  ? 198  PHE A CE1 1 
ATOM   119  C CE1 B PHE A 1 29  ? -73.378 16.872  13.403  0.44 31.42  ? 198  PHE A CE1 1 
ATOM   120  C CE2 A PHE A 1 29  ? -74.659 10.778  11.142  0.56 36.77  ? 198  PHE A CE2 1 
ATOM   121  C CE2 B PHE A 1 29  ? -75.678 16.855  13.929  0.44 32.43  ? 198  PHE A CE2 1 
ATOM   122  C CZ  A PHE A 1 29  ? -73.371 10.372  10.800  0.56 31.10  ? 198  PHE A CZ  1 
ATOM   123  C CZ  B PHE A 1 29  ? -74.560 17.528  13.533  0.44 31.71  ? 198  PHE A CZ  1 
ATOM   124  N N   . LEU A 1 30  ? -74.486 14.150  17.149  1.00 29.51  ? 199  LEU A N   1 
ATOM   125  C CA  . LEU A 1 30  ? -74.663 15.185  18.174  1.00 31.52  ? 199  LEU A CA  1 
ATOM   126  C C   . LEU A 1 30  ? -73.708 14.959  19.347  1.00 29.76  ? 199  LEU A C   1 
ATOM   127  O O   . LEU A 1 30  ? -73.259 15.896  19.977  1.00 36.23  ? 199  LEU A O   1 
ATOM   128  C CB  . LEU A 1 30  ? -76.135 15.222  18.643  1.00 34.06  ? 199  LEU A CB  1 
ATOM   129  C CG  . LEU A 1 30  ? -76.851 16.562  18.653  1.00 33.49  ? 199  LEU A CG  1 
ATOM   130  C CD1 . LEU A 1 30  ? -76.994 17.065  17.245  1.00 35.40  ? 199  LEU A CD1 1 
ATOM   131  C CD2 . LEU A 1 30  ? -78.198 16.434  19.329  1.00 33.21  ? 199  LEU A CD2 1 
ATOM   132  N N   . VAL A 1 31  ? -73.359 13.708  19.606  1.00 28.21  ? 200  VAL A N   1 
ATOM   133  C CA  . VAL A 1 31  ? -72.430 13.369  20.675  1.00 27.79  ? 200  VAL A CA  1 
ATOM   134  C C   . VAL A 1 31  ? -70.998 13.828  20.391  1.00 27.42  ? 200  VAL A C   1 
ATOM   135  O O   . VAL A 1 31  ? -70.223 14.043  21.329  1.00 23.55  ? 200  VAL A O   1 
ATOM   136  C CB  . VAL A 1 31  ? -72.509 11.857  20.944  1.00 29.45  ? 200  VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 31  ? -71.505 11.391  21.984  1.00 31.29  ? 200  VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 31  ? -73.926 11.496  21.360  1.00 34.81  ? 200  VAL A CG2 1 
ATOM   139  N N   . GLN A 1 32  ? -70.648 14.028  19.115  1.00 26.97  ? 201  GLN A N   1 
ATOM   140  C CA  . GLN A 1 32  ? -69.285 14.482  18.752  1.00 23.68  ? 201  GLN A CA  1 
ATOM   141  C C   . GLN A 1 32  ? -68.964 15.832  19.379  1.00 22.90  ? 201  GLN A C   1 
ATOM   142  O O   . GLN A 1 32  ? -67.889 16.011  19.917  1.00 24.54  ? 201  GLN A O   1 
ATOM   143  C CB  . GLN A 1 32  ? -69.056 14.520  17.219  1.00 23.41  ? 201  GLN A CB  1 
ATOM   144  C CG  . GLN A 1 32  ? -69.202 13.163  16.579  1.00 22.04  ? 201  GLN A CG  1 
ATOM   145  C CD  . GLN A 1 32  ? -68.903 13.133  15.087  1.00 23.33  ? 201  GLN A CD  1 
ATOM   146  O OE1 . GLN A 1 32  ? -68.260 14.016  14.525  1.00 22.92  ? 201  GLN A OE1 1 
ATOM   147  N NE2 . GLN A 1 32  ? -69.387 12.095  14.441  1.00 21.50  ? 201  GLN A NE2 1 
ATOM   148  N N   . ARG A 1 33  ? -69.906 16.756  19.348  1.00 26.40  ? 202  ARG A N   1 
ATOM   149  C CA  . ARG A 1 33  ? -69.756 18.052  20.024  1.00 28.02  ? 202  ARG A CA  1 
ATOM   150  C C   . ARG A 1 33  ? -69.577 17.869  21.543  1.00 26.13  ? 202  ARG A C   1 
ATOM   151  O O   . ARG A 1 33  ? -68.689 18.448  22.166  1.00 25.46  ? 202  ARG A O   1 
ATOM   152  C CB  . ARG A 1 33  ? -70.986 18.928  19.701  1.00 29.72  ? 202  ARG A CB  1 
ATOM   153  C CG  . ARG A 1 33  ? -71.185 20.203  20.528  1.00 31.05  ? 202  ARG A CG  1 
ATOM   154  C CD  . ARG A 1 33  ? -70.192 21.300  20.233  1.00 34.82  ? 202  ARG A CD  1 
ATOM   155  N NE  . ARG A 1 33  ? -70.165 21.707  18.825  1.00 40.31  ? 202  ARG A NE  1 
ATOM   156  C CZ  . ARG A 1 33  ? -70.846 22.716  18.273  1.00 39.50  ? 202  ARG A CZ  1 
ATOM   157  N NH1 . ARG A 1 33  ? -71.663 23.496  18.990  1.00 42.19  ? 202  ARG A NH1 1 
ATOM   158  N NH2 . ARG A 1 33  ? -70.704 22.943  16.972  1.00 36.94  ? 202  ARG A NH2 1 
ATOM   159  N N   . THR A 1 34  ? -70.420 17.046  22.141  1.00 26.92  ? 203  THR A N   1 
ATOM   160  C CA  . THR A 1 34  ? -70.390 16.889  23.571  1.00 26.07  ? 203  THR A CA  1 
ATOM   161  C C   . THR A 1 34  ? -69.017 16.402  24.005  1.00 24.21  ? 203  THR A C   1 
ATOM   162  O O   . THR A 1 34  ? -68.411 16.969  24.905  1.00 23.33  ? 203  THR A O   1 
ATOM   163  C CB  . THR A 1 34  ? -71.465 15.897  24.026  1.00 29.49  ? 203  THR A CB  1 
ATOM   164  O OG1 . THR A 1 34  ? -72.730 16.355  23.563  1.00 30.29  ? 203  THR A OG1 1 
ATOM   165  C CG2 . THR A 1 34  ? -71.501 15.792  25.528  1.00 33.69  ? 203  THR A CG2 1 
ATOM   166  N N   . VAL A 1 35  ? -68.509 15.352  23.361  1.00 24.01  ? 204  VAL A N   1 
ATOM   167  C CA  . VAL A 1 35  ? -67.213 14.804  23.756  1.00 22.39  ? 204  VAL A CA  1 
ATOM   168  C C   . VAL A 1 35  ? -66.115 15.793  23.457  1.00 23.22  ? 204  VAL A C   1 
ATOM   169  O O   . VAL A 1 35  ? -65.190 15.977  24.263  1.00 22.30  ? 204  VAL A O   1 
ATOM   170  C CB  . VAL A 1 35  ? -66.970 13.452  23.092  1.00 27.43  ? 204  VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 35  ? -65.509 13.024  23.200  1.00 28.09  ? 204  VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 35  ? -67.895 12.423  23.730  1.00 28.32  ? 204  VAL A CG2 1 
ATOM   173  N N   . ALA A 1 36  ? -66.231 16.499  22.334  1.00 22.79  ? 205  ALA A N   1 
ATOM   174  C CA  . ALA A 1 36  ? -65.176 17.412  21.978  1.00 22.51  ? 205  ALA A CA  1 
ATOM   175  C C   . ALA A 1 36  ? -65.037 18.510  23.016  1.00 25.72  ? 205  ALA A C   1 
ATOM   176  O O   . ALA A 1 36  ? -63.922 18.891  23.366  1.00 25.02  ? 205  ALA A O   1 
ATOM   177  C CB  . ALA A 1 36  ? -65.412 18.007  20.611  1.00 23.96  ? 205  ALA A CB  1 
ATOM   178  N N   . ARG A 1 37  ? -66.161 19.018  23.515  1.00 24.90  ? 206  ARG A N   1 
ATOM   179  C CA  . ARG A 1 37  ? -66.106 20.067  24.537  1.00 29.61  ? 206  ARG A CA  1 
ATOM   180  C C   . ARG A 1 37  ? -65.680 19.547  25.907  1.00 28.99  ? 206  ARG A C   1 
ATOM   181  O O   . ARG A 1 37  ? -65.311 20.320  26.753  1.00 28.40  ? 206  ARG A O   1 
ATOM   182  C CB  . ARG A 1 37  ? -67.459 20.772  24.672  1.00 30.07  ? 206  ARG A CB  1 
ATOM   183  C CG  . ARG A 1 37  ? -67.941 21.447  23.379  1.00 35.23  ? 206  ARG A CG  1 
ATOM   184  C CD  . ARG A 1 37  ? -66.826 22.148  22.617  1.00 38.50  ? 206  ARG A CD  1 
ATOM   185  N NE  . ARG A 1 37  ? -67.251 22.694  21.322  1.00 37.06  ? 206  ARG A NE  1 
ATOM   186  C CZ  . ARG A 1 37  ? -67.947 23.824  21.185  1.00 41.68  ? 206  ARG A CZ  1 
ATOM   187  N NH1 . ARG A 1 37  ? -68.328 24.528  22.256  1.00 43.18  ? 206  ARG A NH1 1 
ATOM   188  N NH2 . ARG A 1 37  ? -68.274 24.253  19.977  1.00 40.53  ? 206  ARG A NH2 1 
ATOM   189  N N   . GLN A 1 38  ? -65.762 18.245  26.132  1.00 26.05  ? 207  GLN A N   1 
ATOM   190  C CA  . GLN A 1 38  ? -65.304 17.671  27.400  1.00 25.87  ? 207  GLN A CA  1 
ATOM   191  C C   . GLN A 1 38  ? -63.799 17.339  27.422  1.00 27.98  ? 207  GLN A C   1 
ATOM   192  O O   . GLN A 1 38  ? -63.269 16.871  28.425  1.00 31.97  ? 207  GLN A O   1 
ATOM   193  C CB  . GLN A 1 38  ? -66.154 16.444  27.698  1.00 27.55  ? 207  GLN A CB  1 
ATOM   194  C CG  . GLN A 1 38  ? -67.599 16.813  28.019  1.00 28.03  ? 207  GLN A CG  1 
ATOM   195  C CD  . GLN A 1 38  ? -68.525 15.619  28.093  1.00 32.03  ? 207  GLN A CD  1 
ATOM   196  O OE1 . GLN A 1 38  ? -68.185 14.521  27.653  1.00 31.88  ? 207  GLN A OE1 1 
ATOM   197  N NE2 . GLN A 1 38  ? -69.720 15.833  28.644  1.00 31.53  ? 207  GLN A NE2 1 
ATOM   198  N N   . ILE A 1 39  ? -63.115 17.562  26.308  1.00 28.00  ? 208  ILE A N   1 
ATOM   199  C CA  . ILE A 1 39  ? -61.711 17.183  26.189  1.00 26.43  ? 208  ILE A CA  1 
ATOM   200  C C   . ILE A 1 39  ? -60.837 18.273  26.768  1.00 25.96  ? 208  ILE A C   1 
ATOM   201  O O   . ILE A 1 39  ? -61.091 19.444  26.540  1.00 30.84  ? 208  ILE A O   1 
ATOM   202  C CB  . ILE A 1 39  ? -61.305 16.932  24.710  1.00 23.69  ? 208  ILE A CB  1 
ATOM   203  C CG1 . ILE A 1 39  ? -61.812 15.582  24.241  1.00 26.76  ? 208  ILE A CG1 1 
ATOM   204  C CG2 . ILE A 1 39  ? -59.791 16.927  24.523  1.00 23.75  ? 208  ILE A CG2 1 
ATOM   205  C CD1 . ILE A 1 39  ? -61.729 15.410  22.721  1.00 26.66  ? 208  ILE A CD1 1 
ATOM   206  N N   . THR A 1 40  ? -59.798 17.871  27.497  1.00 27.38  ? 209  THR A N   1 
ATOM   207  C CA  . THR A 1 40  ? -58.725 18.764  27.924  1.00 28.62  ? 209  THR A CA  1 
ATOM   208  C C   . THR A 1 40  ? -57.460 18.475  27.106  1.00 27.74  ? 209  THR A C   1 
ATOM   209  O O   . THR A 1 40  ? -56.960 17.341  27.101  1.00 28.88  ? 209  THR A O   1 
ATOM   210  C CB  . THR A 1 40  ? -58.378 18.515  29.416  1.00 32.85  ? 209  THR A CB  1 
ATOM   211  O OG1 . THR A 1 40  ? -59.566 18.565  30.195  1.00 32.82  ? 209  THR A OG1 1 
ATOM   212  C CG2 . THR A 1 40  ? -57.392 19.546  29.943  1.00 31.45  ? 209  THR A CG2 1 
ATOM   213  N N   . LEU A 1 41  ? -56.922 19.503  26.467  1.00 25.49  ? 210  LEU A N   1 
ATOM   214  C CA  . LEU A 1 41  ? -55.664 19.418  25.750  1.00 27.37  ? 210  LEU A CA  1 
ATOM   215  C C   . LEU A 1 41  ? -54.484 19.439  26.709  1.00 32.40  ? 210  LEU A C   1 
ATOM   216  O O   . LEU A 1 41  ? -54.423 20.279  27.589  1.00 29.53  ? 210  LEU A O   1 
ATOM   217  C CB  . LEU A 1 41  ? -55.539 20.596  24.783  1.00 30.30  ? 210  LEU A CB  1 
ATOM   218  C CG  . LEU A 1 41  ? -56.654 20.740  23.752  1.00 31.96  ? 210  LEU A CG  1 
ATOM   219  C CD1 . LEU A 1 41  ? -56.400 21.950  22.855  1.00 33.99  ? 210  LEU A CD1 1 
ATOM   220  C CD2 . LEU A 1 41  ? -56.749 19.483  22.912  1.00 34.48  ? 210  LEU A CD2 1 
ATOM   221  N N   . LEU A 1 42  ? -53.533 18.535  26.511  1.00 32.69  ? 211  LEU A N   1 
ATOM   222  C CA  . LEU A 1 42  ? -52.403 18.379  27.416  1.00 35.06  ? 211  LEU A CA  1 
ATOM   223  C C   . LEU A 1 42  ? -51.074 18.763  26.804  1.00 39.95  ? 211  LEU A C   1 
ATOM   224  O O   . LEU A 1 42  ? -50.386 19.578  27.358  1.00 46.48  ? 211  LEU A O   1 
ATOM   225  C CB  . LEU A 1 42  ? -52.329 16.951  27.935  1.00 34.20  ? 211  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 42  ? -53.584 16.517  28.699  1.00 36.22  ? 211  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 42  ? -53.551 15.042  29.052  1.00 38.09  ? 211  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 42  ? -53.796 17.331  29.967  1.00 40.39  ? 211  LEU A CD2 1 
ATOM   229  N N   . GLU A 1 43  ? -50.692 18.177  25.682  1.00 38.74  ? 212  GLU A N   1 
ATOM   230  C CA  . GLU A 1 43  ? -49.411 18.532  25.070  1.00 39.88  ? 212  GLU A CA  1 
ATOM   231  C C   . GLU A 1 43  ? -49.449 18.333  23.574  1.00 37.65  ? 212  GLU A C   1 
ATOM   232  O O   . GLU A 1 43  ? -50.104 17.415  23.067  1.00 36.28  ? 212  GLU A O   1 
ATOM   233  C CB  . GLU A 1 43  ? -48.264 17.730  25.675  1.00 45.67  ? 212  GLU A CB  1 
ATOM   234  C CG  . GLU A 1 43  ? -48.568 16.248  25.818  1.00 54.84  ? 212  GLU A CG  1 
ATOM   235  C CD  . GLU A 1 43  ? -47.370 15.415  26.243  1.00 61.47  ? 212  GLU A CD  1 
ATOM   236  O OE1 . GLU A 1 43  ? -46.347 16.017  26.605  1.00 72.34  ? 212  GLU A OE1 1 
ATOM   237  O OE2 . GLU A 1 43  ? -47.452 14.162  26.198  1.00 54.01  ? 212  GLU A OE2 1 
ATOM   238  N N   . CYS A 1 44  ? -48.760 19.226  22.877  1.00 34.27  ? 213  CYS A N   1 
ATOM   239  C CA  . CYS A 1 44  ? -48.586 19.137  21.465  1.00 36.00  ? 213  CYS A CA  1 
ATOM   240  C C   . CYS A 1 44  ? -47.594 18.037  21.181  1.00 40.43  ? 213  CYS A C   1 
ATOM   241  O O   . CYS A 1 44  ? -46.504 18.084  21.705  1.00 33.09  ? 213  CYS A O   1 
ATOM   242  C CB  . CYS A 1 44  ? -48.041 20.441  20.939  1.00 34.93  ? 213  CYS A CB  1 
ATOM   243  S SG  . CYS A 1 44  ? -47.927 20.450  19.151  1.00 40.67  ? 213  CYS A SG  1 
ATOM   244  N N   . VAL A 1 45  ? -47.967 17.043  20.370  1.00 36.56  ? 214  VAL A N   1 
ATOM   245  C CA  . VAL A 1 45  ? -47.034 15.969  20.005  1.00 34.00  ? 214  VAL A CA  1 
ATOM   246  C C   . VAL A 1 45  ? -46.599 16.019  18.557  1.00 36.57  ? 214  VAL A C   1 
ATOM   247  O O   . VAL A 1 45  ? -45.802 15.211  18.127  1.00 41.84  ? 214  VAL A O   1 
ATOM   248  C CB  . VAL A 1 45  ? -47.620 14.571  20.295  1.00 34.79  ? 214  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 45  ? -47.717 14.371  21.786  1.00 35.21  ? 214  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 45  ? -48.983 14.365  19.621  1.00 34.70  ? 214  VAL A CG2 1 
ATOM   251  N N   . GLY A 1 46  ? -47.137 16.968  17.805  1.00 36.86  ? 215  GLY A N   1 
ATOM   252  C CA  . GLY A 1 46  ? -46.823 17.103  16.390  1.00 36.42  ? 215  GLY A CA  1 
ATOM   253  C C   . GLY A 1 46  ? -47.220 18.491  15.922  1.00 43.65  ? 215  GLY A C   1 
ATOM   254  O O   . GLY A 1 46  ? -48.235 19.052  16.369  1.00 39.88  ? 215  GLY A O   1 
ATOM   255  N N   . LYS A 1 47  ? -46.406 19.053  15.035  1.00 47.03  ? 216  LYS A N   1 
ATOM   256  C CA  . LYS A 1 47  ? -46.617 20.411  14.520  1.00 52.86  ? 216  LYS A CA  1 
ATOM   257  C C   . LYS A 1 47  ? -46.081 20.432  13.090  1.00 54.38  ? 216  LYS A C   1 
ATOM   258  O O   . LYS A 1 47  ? -45.064 19.828  12.809  1.00 53.14  ? 216  LYS A O   1 
ATOM   259  C CB  . LYS A 1 47  ? -45.915 21.448  15.402  1.00 56.68  ? 216  LYS A CB  1 
ATOM   260  C CG  . LYS A 1 47  ? -46.315 22.894  15.130  1.00 75.24  ? 216  LYS A CG  1 
ATOM   261  C CD  . LYS A 1 47  ? -45.971 23.830  16.289  1.00 65.52  ? 216  LYS A CD  1 
ATOM   262  N N   . GLY A 1 48  ? -46.803 21.078  12.186  1.00 54.60  ? 217  GLY A N   1 
ATOM   263  C CA  . GLY A 1 48  ? -46.428 21.130  10.773  1.00 55.86  ? 217  GLY A CA  1 
ATOM   264  C C   . GLY A 1 48  ? -47.261 22.183  10.075  1.00 53.79  ? 217  GLY A C   1 
ATOM   265  O O   . GLY A 1 48  ? -47.956 22.962  10.735  1.00 51.93  ? 217  GLY A O   1 
ATOM   266  N N   . ARG A 1 49  ? -47.193 22.215  8.747   1.00 64.43  ? 218  ARG A N   1 
ATOM   267  C CA  . ARG A 1 49  ? -48.036 23.119  7.957   1.00 70.20  ? 218  ARG A CA  1 
ATOM   268  C C   . ARG A 1 49  ? -49.516 22.664  8.014   1.00 57.72  ? 218  ARG A C   1 
ATOM   269  O O   . ARG A 1 49  ? -50.412 23.472  7.846   1.00 50.42  ? 218  ARG A O   1 
ATOM   270  C CB  . ARG A 1 49  ? -47.527 23.212  6.504   1.00 65.68  ? 218  ARG A CB  1 
ATOM   271  N N   . TYR A 1 50  ? -49.761 21.376  8.276   1.00 60.27  ? 219  TYR A N   1 
ATOM   272  C CA  . TYR A 1 50  ? -51.134 20.841  8.476   1.00 54.85  ? 219  TYR A CA  1 
ATOM   273  C C   . TYR A 1 50  ? -51.893 21.496  9.656   1.00 46.46  ? 219  TYR A C   1 
ATOM   274  O O   . TYR A 1 50  ? -53.119 21.511  9.672   1.00 45.14  ? 219  TYR A O   1 
ATOM   275  C CB  . TYR A 1 50  ? -51.123 19.293  8.645   1.00 49.24  ? 219  TYR A CB  1 
ATOM   276  C CG  . TYR A 1 50  ? -50.249 18.783  9.789   1.00 52.71  ? 219  TYR A CG  1 
ATOM   277  C CD1 . TYR A 1 50  ? -50.728 18.748  11.098  1.00 45.15  ? 219  TYR A CD1 1 
ATOM   278  C CD2 . TYR A 1 50  ? -48.943 18.358  9.566   1.00 57.41  ? 219  TYR A CD2 1 
ATOM   279  C CE1 . TYR A 1 50  ? -49.937 18.314  12.150  1.00 48.49  ? 219  TYR A CE1 1 
ATOM   280  C CE2 . TYR A 1 50  ? -48.149 17.913  10.619  1.00 63.48  ? 219  TYR A CE2 1 
ATOM   281  C CZ  . TYR A 1 50  ? -48.657 17.896  11.912  1.00 51.70  ? 219  TYR A CZ  1 
ATOM   282  O OH  . TYR A 1 50  ? -47.888 17.473  12.969  1.00 53.49  ? 219  TYR A OH  1 
ATOM   283  N N   . GLY A 1 51  ? -51.158 22.052  10.617  1.00 40.05  ? 220  GLY A N   1 
ATOM   284  C CA  . GLY A 1 51  ? -51.720 22.459  11.890  1.00 36.45  ? 220  GLY A CA  1 
ATOM   285  C C   . GLY A 1 51  ? -50.957 21.780  13.004  1.00 40.35  ? 220  GLY A C   1 
ATOM   286  O O   . GLY A 1 51  ? -49.731 21.723  12.965  1.00 40.65  ? 220  GLY A O   1 
ATOM   287  N N   . GLU A 1 52  ? -51.670 21.278  14.013  1.00 38.20  ? 221  GLU A N   1 
ATOM   288  C CA  . GLU A 1 52  ? -51.028 20.633  15.157  1.00 34.46  ? 221  GLU A CA  1 
ATOM   289  C C   . GLU A 1 52  ? -51.758 19.358  15.537  1.00 32.50  ? 221  GLU A C   1 
ATOM   290  O O   . GLU A 1 52  ? -52.969 19.272  15.363  1.00 34.40  ? 221  GLU A O   1 
ATOM   291  C CB  . GLU A 1 52  ? -51.044 21.589  16.348  1.00 43.11  ? 221  GLU A CB  1 
ATOM   292  C CG  . GLU A 1 52  ? -50.214 22.847  16.150  1.00 50.81  ? 221  GLU A CG  1 
ATOM   293  C CD  . GLU A 1 52  ? -50.340 23.833  17.302  1.00 56.15  ? 221  GLU A CD  1 
ATOM   294  O OE1 . GLU A 1 52  ? -51.398 23.887  17.965  1.00 52.88  ? 221  GLU A OE1 1 
ATOM   295  O OE2 . GLU A 1 52  ? -49.371 24.567  17.536  1.00 68.53  ? 221  GLU A OE2 1 
ATOM   296  N N   . VAL A 1 53  ? -51.031 18.379  16.063  1.00 30.57  ? 222  VAL A N   1 
ATOM   297  C CA  . VAL A 1 53  ? -51.643 17.237  16.743  1.00 30.44  ? 222  VAL A CA  1 
ATOM   298  C C   . VAL A 1 53  ? -51.321 17.308  18.224  1.00 33.07  ? 222  VAL A C   1 
ATOM   299  O O   . VAL A 1 53  ? -50.159 17.475  18.602  1.00 33.37  ? 222  VAL A O   1 
ATOM   300  C CB  . VAL A 1 53  ? -51.162 15.882  16.216  1.00 26.54  ? 222  VAL A CB  1 
ATOM   301  C CG1 . VAL A 1 53  ? -51.890 14.759  16.950  1.00 25.69  ? 222  VAL A CG1 1 
ATOM   302  C CG2 . VAL A 1 53  ? -51.433 15.776  14.741  1.00 26.63  ? 222  VAL A CG2 1 
ATOM   303  N N   . TRP A 1 54  ? -52.362 17.183  19.048  1.00 30.18  ? 223  TRP A N   1 
ATOM   304  C CA  . TRP A 1 54  ? -52.236 17.260  20.494  1.00 29.87  ? 223  TRP A CA  1 
ATOM   305  C C   . TRP A 1 54  ? -52.635 15.956  21.134  1.00 27.61  ? 223  TRP A C   1 
ATOM   306  O O   . TRP A 1 54  ? -53.531 15.276  20.668  1.00 30.70  ? 223  TRP A O   1 
ATOM   307  C CB  . TRP A 1 54  ? -53.140 18.369  21.082  1.00 29.37  ? 223  TRP A CB  1 
ATOM   308  C CG  . TRP A 1 54  ? -52.605 19.728  20.933  1.00 32.87  ? 223  TRP A CG  1 
ATOM   309  C CD1 . TRP A 1 54  ? -52.496 20.421  19.777  1.00 35.18  ? 223  TRP A CD1 1 
ATOM   310  C CD2 . TRP A 1 54  ? -52.095 20.582  21.967  1.00 35.24  ? 223  TRP A CD2 1 
ATOM   311  N NE1 . TRP A 1 54  ? -51.934 21.639  20.010  1.00 38.20  ? 223  TRP A NE1 1 
ATOM   312  C CE2 . TRP A 1 54  ? -51.679 21.773  21.345  1.00 38.96  ? 223  TRP A CE2 1 
ATOM   313  C CE3 . TRP A 1 54  ? -51.908 20.441  23.349  1.00 36.79  ? 223  TRP A CE3 1 
ATOM   314  C CZ2 . TRP A 1 54  ? -51.110 22.849  22.060  1.00 41.87  ? 223  TRP A CZ2 1 
ATOM   315  C CZ3 . TRP A 1 54  ? -51.343 21.516  24.064  1.00 40.37  ? 223  TRP A CZ3 1 
ATOM   316  C CH2 . TRP A 1 54  ? -50.967 22.706  23.413  1.00 36.72  ? 223  TRP A CH2 1 
ATOM   317  N N   . ARG A 1 55  ? -51.993 15.638  22.243  1.00 26.44  ? 224  ARG A N   1 
ATOM   318  C CA  . ARG A 1 55  ? -52.531 14.664  23.137  1.00 26.70  ? 224  ARG A CA  1 
ATOM   319  C C   . ARG A 1 55  ? -53.513 15.362  24.059  1.00 28.20  ? 224  ARG A C   1 
ATOM   320  O O   . ARG A 1 55  ? -53.201 16.396  24.622  1.00 27.48  ? 224  ARG A O   1 
ATOM   321  C CB  . ARG A 1 55  ? -51.417 14.040  23.960  1.00 28.55  ? 224  ARG A CB  1 
ATOM   322  C CG  . ARG A 1 55  ? -51.911 13.014  24.939  1.00 32.94  ? 224  ARG A CG  1 
ATOM   323  C CD  . ARG A 1 55  ? -50.735 12.504  25.736  1.00 41.66  ? 224  ARG A CD  1 
ATOM   324  N NE  . ARG A 1 55  ? -51.135 12.120  27.068  1.00 47.96  ? 224  ARG A NE  1 
ATOM   325  C CZ  . ARG A 1 55  ? -50.377 12.272  28.138  1.00 54.57  ? 224  ARG A CZ  1 
ATOM   326  N NH1 . ARG A 1 55  ? -49.155 12.797  28.031  1.00 56.98  ? 224  ARG A NH1 1 
ATOM   327  N NH2 . ARG A 1 55  ? -50.847 11.899  29.320  1.00 67.76  ? 224  ARG A NH2 1 
ATOM   328  N N   . GLY A 1 56  ? -54.683 14.769  24.220  1.00 25.03  ? 225  GLY A N   1 
ATOM   329  C CA  . GLY A 1 56  ? -55.724 15.315  25.065  1.00 24.12  ? 225  GLY A CA  1 
ATOM   330  C C   . GLY A 1 56  ? -56.317 14.226  25.934  1.00 25.30  ? 225  GLY A C   1 
ATOM   331  O O   . GLY A 1 56  ? -56.020 13.039  25.765  1.00 25.36  ? 225  GLY A O   1 
ATOM   332  N N   . SER A 1 57  ? -57.202 14.615  26.840  1.00 26.23  ? 226  SER A N   1 
ATOM   333  C CA  . SER A 1 57  ? -57.810 13.662  27.728  1.00 26.43  ? 226  SER A CA  1 
ATOM   334  C C   . SER A 1 57  ? -59.317 13.859  27.797  1.00 25.32  ? 226  SER A C   1 
ATOM   335  O O   . SER A 1 57  ? -59.780 14.977  27.933  1.00 28.86  ? 226  SER A O   1 
ATOM   336  C CB  . SER A 1 57  ? -57.172 13.794  29.125  1.00 27.94  ? 226  SER A CB  1 
ATOM   337  O OG  . SER A 1 57  ? -57.885 13.017  30.072  1.00 28.01  ? 226  SER A OG  1 
ATOM   338  N N   . TRP A 1 58  ? -60.067 12.759  27.698  1.00 26.25  ? 227  TRP A N   1 
ATOM   339  C CA  . TRP A 1 58  ? -61.508 12.743  27.921  1.00 28.34  ? 227  TRP A CA  1 
ATOM   340  C C   . TRP A 1 58  ? -61.801 11.795  29.081  1.00 26.69  ? 227  TRP A C   1 
ATOM   341  O O   . TRP A 1 58  ? -61.560 10.597  28.974  1.00 25.10  ? 227  TRP A O   1 
ATOM   342  C CB  . TRP A 1 58  ? -62.269 12.262  26.661  1.00 26.61  ? 227  TRP A CB  1 
ATOM   343  C CG  . TRP A 1 58  ? -63.765 12.269  26.871  1.00 27.46  ? 227  TRP A CG  1 
ATOM   344  C CD1 . TRP A 1 58  ? -64.570 13.352  26.825  1.00 27.78  ? 227  TRP A CD1 1 
ATOM   345  C CD2 . TRP A 1 58  ? -64.605 11.159  27.225  1.00 27.81  ? 227  TRP A CD2 1 
ATOM   346  N NE1 . TRP A 1 58  ? -65.865 12.996  27.094  1.00 30.37  ? 227  TRP A NE1 1 
ATOM   347  C CE2 . TRP A 1 58  ? -65.920 11.659  27.352  1.00 28.76  ? 227  TRP A CE2 1 
ATOM   348  C CE3 . TRP A 1 58  ? -64.376 9.793   27.434  1.00 29.78  ? 227  TRP A CE3 1 
ATOM   349  C CZ2 . TRP A 1 58  ? -67.016 10.849  27.669  1.00 27.85  ? 227  TRP A CZ2 1 
ATOM   350  C CZ3 . TRP A 1 58  ? -65.449 8.980   27.746  1.00 30.09  ? 227  TRP A CZ3 1 
ATOM   351  C CH2 . TRP A 1 58  ? -66.765 9.517   27.880  1.00 32.15  ? 227  TRP A CH2 1 
ATOM   352  N N   . GLN A 1 59  ? -62.331 12.328  30.181  1.00 30.67  ? 228  GLN A N   1 
ATOM   353  C CA  . GLN A 1 59  ? -62.621 11.538  31.389  1.00 28.33  ? 228  GLN A CA  1 
ATOM   354  C C   . GLN A 1 59  ? -61.507 10.555  31.749  1.00 26.76  ? 228  GLN A C   1 
ATOM   355  O O   . GLN A 1 59  ? -61.736 9.378   31.986  1.00 27.61  ? 228  GLN A O   1 
ATOM   356  C CB  . GLN A 1 59  ? -63.983 10.847  31.272  1.00 31.06  ? 228  GLN A CB  1 
ATOM   357  C CG  . GLN A 1 59  ? -65.070 11.890  31.022  1.00 40.94  ? 228  GLN A CG  1 
ATOM   358  C CD  . GLN A 1 59  ? -66.505 11.361  31.032  1.00 47.77  ? 228  GLN A CD  1 
ATOM   359  O OE1 . GLN A 1 59  ? -66.768 10.155  31.184  1.00 47.66  ? 228  GLN A OE1 1 
ATOM   360  N NE2 . GLN A 1 59  ? -67.453 12.287  30.839  1.00 54.46  ? 228  GLN A NE2 1 
ATOM   361  N N   . GLY A 1 60  ? -60.289 11.069  31.767  1.00 26.82  ? 229  GLY A N   1 
ATOM   362  C CA  . GLY A 1 60  ? -59.144 10.290  32.164  1.00 29.62  ? 229  GLY A CA  1 
ATOM   363  C C   . GLY A 1 60  ? -58.550 9.367   31.101  1.00 32.55  ? 229  GLY A C   1 
ATOM   364  O O   . GLY A 1 60  ? -57.623 8.640   31.420  1.00 28.12  ? 229  GLY A O   1 
ATOM   365  N N   . GLU A 1 61  ? -59.040 9.392   29.855  1.00 28.36  ? 230  GLU A N   1 
ATOM   366  C CA  . GLU A 1 61  ? -58.379 8.588   28.792  1.00 30.94  ? 230  GLU A CA  1 
ATOM   367  C C   . GLU A 1 61  ? -57.850 9.396   27.641  1.00 26.67  ? 230  GLU A C   1 
ATOM   368  O O   . GLU A 1 61  ? -58.513 10.302  27.171  1.00 30.11  ? 230  GLU A O   1 
ATOM   369  C CB  . GLU A 1 61  ? -59.250 7.425   28.285  1.00 32.58  ? 230  GLU A CB  1 
ATOM   370  C CG  . GLU A 1 61  ? -60.591 7.778   27.696  1.00 44.27  ? 230  GLU A CG  1 
ATOM   371  C CD  . GLU A 1 61  ? -61.419 6.543   27.319  1.00 47.04  ? 230  GLU A CD  1 
ATOM   372  O OE1 . GLU A 1 61  ? -60.994 5.783   26.402  1.00 46.34  ? 230  GLU A OE1 1 
ATOM   373  O OE2 . GLU A 1 61  ? -62.492 6.345   27.948  1.00 35.82  ? 230  GLU A OE2 1 
ATOM   374  N N   . ASN A 1 62  ? -56.626 9.064   27.208  1.00 27.29  ? 231  ASN A N   1 
ATOM   375  C CA  . ASN A 1 62  ? -55.979 9.715   26.066  1.00 26.24  ? 231  ASN A CA  1 
ATOM   376  C C   . ASN A 1 62  ? -56.805 9.680   24.769  1.00 25.58  ? 231  ASN A C   1 
ATOM   377  O O   . ASN A 1 62  ? -57.489 8.698   24.492  1.00 21.78  ? 231  ASN A O   1 
ATOM   378  C CB  . ASN A 1 62  ? -54.650 9.059   25.784  1.00 27.90  ? 231  ASN A CB  1 
ATOM   379  C CG  . ASN A 1 62  ? -53.595 9.408   26.803  1.00 34.09  ? 231  ASN A CG  1 
ATOM   380  O OD1 . ASN A 1 62  ? -53.519 10.548  27.294  1.00 33.44  ? 231  ASN A OD1 1 
ATOM   381  N ND2 . ASN A 1 62  ? -52.736 8.442   27.088  1.00 28.94  ? 231  ASN A ND2 1 
ATOM   382  N N   . VAL A 1 63  ? -56.756 10.778  24.026  1.00 21.89  ? 232  VAL A N   1 
ATOM   383  C CA  . VAL A 1 63  ? -57.268 10.875  22.651  1.00 22.97  ? 232  VAL A CA  1 
ATOM   384  C C   . VAL A 1 63  ? -56.291 11.784  21.931  1.00 22.66  ? 232  VAL A C   1 
ATOM   385  O O   . VAL A 1 63  ? -55.511 12.506  22.577  1.00 23.20  ? 232  VAL A O   1 
ATOM   386  C CB  . VAL A 1 63  ? -58.690 11.495  22.561  1.00 23.61  ? 232  VAL A CB  1 
ATOM   387  C CG1 . VAL A 1 63  ? -59.691 10.590  23.220  1.00 24.80  ? 232  VAL A CG1 1 
ATOM   388  C CG2 . VAL A 1 63  ? -58.754 12.851  23.240  1.00 25.55  ? 232  VAL A CG2 1 
ATOM   389  N N   . ALA A 1 64  ? -56.294 11.722  20.611  1.00 21.89  ? 233  ALA A N   1 
ATOM   390  C CA  . ALA A 1 64  ? -55.512 12.650  19.801  1.00 20.99  ? 233  ALA A CA  1 
ATOM   391  C C   . ALA A 1 64  ? -56.436 13.698  19.208  1.00 23.22  ? 233  ALA A C   1 
ATOM   392  O O   . ALA A 1 64  ? -57.544 13.402  18.769  1.00 22.93  ? 233  ALA A O   1 
ATOM   393  C CB  . ALA A 1 64  ? -54.787 11.914  18.691  1.00 20.39  ? 233  ALA A CB  1 
ATOM   394  N N   . VAL A 1 65  ? -55.972 14.937  19.196  1.00 24.38  ? 234  VAL A N   1 
ATOM   395  C CA  . VAL A 1 65  ? -56.749 16.009  18.644  1.00 22.69  ? 234  VAL A CA  1 
ATOM   396  C C   . VAL A 1 65  ? -55.870 16.682  17.618  1.00 24.51  ? 234  VAL A C   1 
ATOM   397  O O   . VAL A 1 65  ? -54.849 17.264  17.969  1.00 25.16  ? 234  VAL A O   1 
ATOM   398  C CB  . VAL A 1 65  ? -57.105 17.053  19.694  1.00 22.11  ? 234  VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 65  ? -57.872 18.226  19.049  1.00 24.84  ? 234  VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 65  ? -57.909 16.440  20.791  1.00 24.95  ? 234  VAL A CG2 1 
ATOM   401  N N   . LYS A 1 66  ? -56.284 16.607  16.358  1.00 26.97  ? 235  LYS A N   1 
ATOM   402  C CA  . LYS A 1 66  ? -55.638 17.336  15.297  1.00 27.23  ? 235  LYS A CA  1 
ATOM   403  C C   . LYS A 1 66  ? -56.402 18.628  15.082  1.00 26.78  ? 235  LYS A C   1 
ATOM   404  O O   . LYS A 1 66  ? -57.616 18.614  14.862  1.00 25.73  ? 235  LYS A O   1 
ATOM   405  C CB  . LYS A 1 66  ? -55.631 16.530  14.029  1.00 31.00  ? 235  LYS A CB  1 
ATOM   406  C CG  . LYS A 1 66  ? -54.937 17.258  12.898  1.00 30.67  ? 235  LYS A CG  1 
ATOM   407  C CD  . LYS A 1 66  ? -54.562 16.291  11.822  1.00 37.81  ? 235  LYS A CD  1 
ATOM   408  C CE  . LYS A 1 66  ? -54.039 17.027  10.607  1.00 43.37  ? 235  LYS A CE  1 
ATOM   409  N NZ  . LYS A 1 66  ? -53.761 16.023  9.560   1.00 53.30  ? 235  LYS A NZ  1 
ATOM   410  N N   . ILE A 1 67  ? -55.674 19.735  15.180  1.00 27.81  ? 236  ILE A N   1 
ATOM   411  C CA  . ILE A 1 67  ? -56.210 21.081  15.057  1.00 29.48  ? 236  ILE A CA  1 
ATOM   412  C C   . ILE A 1 67  ? -55.645 21.593  13.774  1.00 31.01  ? 236  ILE A C   1 
ATOM   413  O O   . ILE A 1 67  ? -54.451 21.702  13.623  1.00 31.65  ? 236  ILE A O   1 
ATOM   414  C CB  . ILE A 1 67  ? -55.765 21.983  16.218  1.00 29.93  ? 236  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 67  ? -56.123 21.329  17.554  1.00 34.04  ? 236  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 67  ? -56.434 23.343  16.139  1.00 28.82  ? 236  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 67  ? -55.730 22.158  18.766  1.00 39.45  ? 236  ILE A CD1 1 
ATOM   418  N N   . PHE A 1 68  ? -56.517 21.850  12.819  1.00 35.88  ? 237  PHE A N   1 
ATOM   419  C CA  . PHE A 1 68  ? -56.077 22.120  11.467  1.00 36.86  ? 237  PHE A CA  1 
ATOM   420  C C   . PHE A 1 68  ? -55.740 23.577  11.328  1.00 38.98  ? 237  PHE A C   1 
ATOM   421  O O   . PHE A 1 68  ? -56.448 24.423  11.879  1.00 30.81  ? 237  PHE A O   1 
ATOM   422  C CB  . PHE A 1 68  ? -57.177 21.781  10.464  1.00 32.40  ? 237  PHE A CB  1 
ATOM   423  C CG  . PHE A 1 68  ? -57.284 20.331  10.168  1.00 31.01  ? 237  PHE A CG  1 
ATOM   424  C CD1 . PHE A 1 68  ? -57.880 19.469  11.078  1.00 27.41  ? 237  PHE A CD1 1 
ATOM   425  C CD2 . PHE A 1 68  ? -56.807 19.816  8.975   1.00 28.80  ? 237  PHE A CD2 1 
ATOM   426  C CE1 . PHE A 1 68  ? -57.979 18.135  10.804  1.00 28.39  ? 237  PHE A CE1 1 
ATOM   427  C CE2 . PHE A 1 68  ? -56.928 18.468  8.692   1.00 28.83  ? 237  PHE A CE2 1 
ATOM   428  C CZ  . PHE A 1 68  ? -57.516 17.630  9.607   1.00 29.58  ? 237  PHE A CZ  1 
ATOM   429  N N   . SER A 1 69  ? -54.684 23.855  10.559  1.00 39.07  ? 238  SER A N   1 
ATOM   430  C CA  . SER A 1 69  ? -54.345 25.230  10.165  1.00 43.47  ? 238  SER A CA  1 
ATOM   431  C C   . SER A 1 69  ? -55.443 25.721  9.253   1.00 43.95  ? 238  SER A C   1 
ATOM   432  O O   . SER A 1 69  ? -56.150 24.905  8.655   1.00 38.10  ? 238  SER A O   1 
ATOM   433  C CB  . SER A 1 69  ? -52.990 25.272  9.432   1.00 47.48  ? 238  SER A CB  1 
ATOM   434  O OG  . SER A 1 69  ? -52.901 24.303  8.384   1.00 46.10  ? 238  SER A OG  1 
ATOM   435  N N   . SER A 1 70  ? -55.602 27.035  9.141   1.00 53.21  ? 239  SER A N   1 
ATOM   436  C CA  . SER A 1 70  ? -56.611 27.592  8.216   1.00 64.81  ? 239  SER A CA  1 
ATOM   437  C C   . SER A 1 70  ? -56.250 27.330  6.737   1.00 55.90  ? 239  SER A C   1 
ATOM   438  O O   . SER A 1 70  ? -57.143 27.174  5.901   1.00 56.65  ? 239  SER A O   1 
ATOM   439  C CB  . SER A 1 70  ? -56.838 29.084  8.463   1.00 66.86  ? 239  SER A CB  1 
ATOM   440  O OG  . SER A 1 70  ? -55.618 29.783  8.374   1.00 64.60  ? 239  SER A OG  1 
ATOM   441  N N   . ARG A 1 71  ? -54.955 27.232  6.427   1.00 48.94  ? 240  ARG A N   1 
ATOM   442  C CA  . ARG A 1 71  ? -54.526 26.768  5.103   1.00 50.88  ? 240  ARG A CA  1 
ATOM   443  C C   . ARG A 1 71  ? -55.114 25.392  4.737   1.00 54.34  ? 240  ARG A C   1 
ATOM   444  O O   . ARG A 1 71  ? -55.347 25.131  3.575   1.00 54.16  ? 240  ARG A O   1 
ATOM   445  C CB  . ARG A 1 71  ? -52.988 26.726  5.008   1.00 54.35  ? 240  ARG A CB  1 
ATOM   446  N N   . ASP A 1 72  ? -55.357 24.523  5.727   1.00 57.59  ? 241  ASP A N   1 
ATOM   447  C CA  . ASP A 1 72  ? -55.850 23.149  5.486   1.00 48.88  ? 241  ASP A CA  1 
ATOM   448  C C   . ASP A 1 72  ? -57.325 22.887  5.832   1.00 38.58  ? 241  ASP A C   1 
ATOM   449  O O   . ASP A 1 72  ? -57.714 21.733  6.031   1.00 40.84  ? 241  ASP A O   1 
ATOM   450  C CB  . ASP A 1 72  ? -55.012 22.155  6.297   1.00 54.64  ? 241  ASP A CB  1 
ATOM   451  C CG  . ASP A 1 72  ? -53.970 21.474  5.488   1.00 59.36  ? 241  ASP A CG  1 
ATOM   452  O OD1 . ASP A 1 72  ? -53.380 22.139  4.625   1.00 72.92  ? 241  ASP A OD1 1 
ATOM   453  O OD2 . ASP A 1 72  ? -53.724 20.280  5.742   1.00 66.90  ? 241  ASP A OD2 1 
ATOM   454  N N   . GLU A 1 73  ? -58.144 23.923  5.903   1.00 35.72  ? 242  GLU A N   1 
ATOM   455  C CA  . GLU A 1 73  ? -59.566 23.753  6.184   1.00 35.79  ? 242  GLU A CA  1 
ATOM   456  C C   . GLU A 1 73  ? -60.214 22.665  5.298   1.00 33.34  ? 242  GLU A C   1 
ATOM   457  O O   . GLU A 1 73  ? -61.053 21.902  5.756   1.00 36.21  ? 242  GLU A O   1 
ATOM   458  C CB  . GLU A 1 73  ? -60.314 25.088  6.025   1.00 37.03  ? 242  GLU A CB  1 
ATOM   459  N N   . LYS A 1 74  ? -59.811 22.581  4.042   1.00 32.12  ? 243  LYS A N   1 
ATOM   460  C CA  . LYS A 1 74  ? -60.437 21.664  3.108   1.00 33.41  ? 243  LYS A CA  1 
ATOM   461  C C   . LYS A 1 74  ? -60.111 20.215  3.432   1.00 28.80  ? 243  LYS A C   1 
ATOM   462  O O   . LYS A 1 74  ? -60.925 19.328  3.175   1.00 25.55  ? 243  LYS A O   1 
ATOM   463  C CB  . LYS A 1 74  ? -60.082 21.992  1.653   1.00 35.91  ? 243  LYS A CB  1 
ATOM   464  C CG  . LYS A 1 74  ? -60.707 23.279  1.119   1.00 38.12  ? 243  LYS A CG  1 
ATOM   465  N N   . SER A 1 75  ? -58.950 19.966  4.021   1.00 28.53  ? 244  SER A N   1 
ATOM   466  C CA  . SER A 1 75  ? -58.623 18.611  4.437   1.00 28.99  ? 244  SER A CA  1 
ATOM   467  C C   . SER A 1 75  ? -59.503 18.198  5.643   1.00 28.43  ? 244  SER A C   1 
ATOM   468  O O   . SER A 1 75  ? -60.009 17.078  5.687   1.00 28.27  ? 244  SER A O   1 
ATOM   469  C CB  . SER A 1 75  ? -57.130 18.469  4.744   1.00 30.84  ? 244  SER A CB  1 
ATOM   470  O OG  . SER A 1 75  ? -56.364 18.564  3.549   1.00 38.87  ? 244  SER A OG  1 
ATOM   471  N N   . TRP A 1 76  ? -59.705 19.114  6.586   1.00 27.99  ? 245  TRP A N   1 
ATOM   472  C CA  . TRP A 1 76  ? -60.576 18.852  7.737   1.00 29.29  ? 245  TRP A CA  1 
ATOM   473  C C   . TRP A 1 76  ? -61.935 18.465  7.211   1.00 23.76  ? 245  TRP A C   1 
ATOM   474  O O   . TRP A 1 76  ? -62.490 17.437  7.596   1.00 25.05  ? 245  TRP A O   1 
ATOM   475  C CB  . TRP A 1 76  ? -60.689 20.074  8.678   1.00 27.31  ? 245  TRP A CB  1 
ATOM   476  C CG  . TRP A 1 76  ? -61.769 19.920  9.754   1.00 28.52  ? 245  TRP A CG  1 
ATOM   477  C CD1 . TRP A 1 76  ? -61.642 19.304  10.961  1.00 28.29  ? 245  TRP A CD1 1 
ATOM   478  C CD2 . TRP A 1 76  ? -63.117 20.374  9.683   1.00 27.84  ? 245  TRP A CD2 1 
ATOM   479  N NE1 . TRP A 1 76  ? -62.822 19.365  11.652  1.00 26.82  ? 245  TRP A NE1 1 
ATOM   480  C CE2 . TRP A 1 76  ? -63.744 20.017  10.890  1.00 27.35  ? 245  TRP A CE2 1 
ATOM   481  C CE3 . TRP A 1 76  ? -63.857 21.062  8.717   1.00 31.37  ? 245  TRP A CE3 1 
ATOM   482  C CZ2 . TRP A 1 76  ? -65.072 20.307  11.155  1.00 30.73  ? 245  TRP A CZ2 1 
ATOM   483  C CZ3 . TRP A 1 76  ? -65.182 21.358  8.984   1.00 31.17  ? 245  TRP A CZ3 1 
ATOM   484  C CH2 . TRP A 1 76  ? -65.780 20.974  10.187  1.00 33.45  ? 245  TRP A CH2 1 
ATOM   485  N N   . PHE A 1 77  ? -62.445 19.284  6.301   1.00 25.95  ? 246  PHE A N   1 
ATOM   486  C CA  . PHE A 1 77  ? -63.743 19.037  5.689   1.00 27.90  ? 246  PHE A CA  1 
ATOM   487  C C   . PHE A 1 77  ? -63.812 17.660  5.044   1.00 26.15  ? 246  PHE A C   1 
ATOM   488  O O   . PHE A 1 77  ? -64.745 16.923  5.306   1.00 26.00  ? 246  PHE A O   1 
ATOM   489  C CB  . PHE A 1 77  ? -64.123 20.137  4.691   1.00 29.31  ? 246  PHE A CB  1 
ATOM   490  C CG  . PHE A 1 77  ? -65.528 20.016  4.188   1.00 33.08  ? 246  PHE A CG  1 
ATOM   491  C CD1 . PHE A 1 77  ? -65.860 19.050  3.235   1.00 32.92  ? 246  PHE A CD1 1 
ATOM   492  C CD2 . PHE A 1 77  ? -66.525 20.850  4.672   1.00 37.13  ? 246  PHE A CD2 1 
ATOM   493  C CE1 . PHE A 1 77  ? -67.168 18.905  2.794   1.00 37.88  ? 246  PHE A CE1 1 
ATOM   494  C CE2 . PHE A 1 77  ? -67.839 20.710  4.228   1.00 45.00  ? 246  PHE A CE2 1 
ATOM   495  C CZ  . PHE A 1 77  ? -68.160 19.734  3.291   1.00 38.28  ? 246  PHE A CZ  1 
ATOM   496  N N   . ARG A 1 78  ? -62.840 17.315  4.210   1.00 28.04  ? 247  ARG A N   1 
ATOM   497  C CA  . ARG A 1 78  ? -62.890 16.049  3.488   1.00 29.75  ? 247  ARG A CA  1 
ATOM   498  C C   . ARG A 1 78  ? -62.740 14.866  4.423   1.00 25.17  ? 247  ARG A C   1 
ATOM   499  O O   . ARG A 1 78  ? -63.428 13.856  4.290   1.00 21.36  ? 247  ARG A O   1 
ATOM   500  C CB  . ARG A 1 78  ? -61.821 15.973  2.369   1.00 38.19  ? 247  ARG A CB  1 
ATOM   501  C CG  . ARG A 1 78  ? -62.244 16.662  1.057   1.00 72.92  ? 247  ARG A CG  1 
ATOM   502  C CD  . ARG A 1 78  ? -61.213 16.550  -0.077  1.00 85.43  ? 247  ARG A CD  1 
ATOM   503  N NE  . ARG A 1 78  ? -59.897 17.100  0.298   1.00 89.10  ? 247  ARG A NE  1 
ATOM   504  C CZ  . ARG A 1 78  ? -59.421 18.316  -0.003  1.00 88.11  ? 247  ARG A CZ  1 
ATOM   505  N NH1 . ARG A 1 78  ? -60.129 19.185  -0.731  1.00 89.12  ? 247  ARG A NH1 1 
ATOM   506  N NH2 . ARG A 1 78  ? -58.206 18.667  0.437   1.00 66.16  ? 247  ARG A NH2 1 
ATOM   507  N N   . GLU A 1 79  ? -61.823 14.980  5.373   1.00 26.15  ? 248  GLU A N   1 
ATOM   508  C CA  . GLU A 1 79  ? -61.578 13.865  6.288   1.00 26.19  ? 248  GLU A CA  1 
ATOM   509  C C   . GLU A 1 79  ? -62.806 13.637  7.173   1.00 23.22  ? 248  GLU A C   1 
ATOM   510  O O   . GLU A 1 79  ? -63.251 12.494  7.378   1.00 22.83  ? 248  GLU A O   1 
ATOM   511  C CB  . GLU A 1 79  ? -60.316 14.128  7.116   1.00 26.50  ? 248  GLU A CB  1 
ATOM   512  C CG  . GLU A 1 79  ? -59.884 12.922  7.917   1.00 31.47  ? 248  GLU A CG  1 
ATOM   513  C CD  . GLU A 1 79  ? -58.434 12.972  8.350   1.00 30.67  ? 248  GLU A CD  1 
ATOM   514  O OE1 . GLU A 1 79  ? -57.867 14.068  8.509   1.00 32.81  ? 248  GLU A OE1 1 
ATOM   515  O OE2 . GLU A 1 79  ? -57.861 11.885  8.541   1.00 30.83  ? 248  GLU A OE2 1 
ATOM   516  N N   . THR A 1 80  ? -63.378 14.737  7.649   1.00 24.40  ? 249  THR A N   1 
ATOM   517  C CA  . THR A 1 80  ? -64.571 14.675  8.456   1.00 22.66  ? 249  THR A CA  1 
ATOM   518  C C   . THR A 1 80  ? -65.708 14.029  7.693   1.00 24.24  ? 249  THR A C   1 
ATOM   519  O O   . THR A 1 80  ? -66.396 13.125  8.208   1.00 24.55  ? 249  THR A O   1 
ATOM   520  C CB  . THR A 1 80  ? -64.995 16.052  8.946   1.00 22.25  ? 249  THR A CB  1 
ATOM   521  O OG1 . THR A 1 80  ? -63.994 16.592  9.821   1.00 22.11  ? 249  THR A OG1 1 
ATOM   522  C CG2 . THR A 1 80  ? -66.329 15.941  9.701   1.00 22.69  ? 249  THR A CG2 1 
ATOM   523  N N   . GLU A 1 81  ? -65.898 14.469  6.463   1.00 24.70  ? 250  GLU A N   1 
ATOM   524  C CA  . GLU A 1 81  ? -66.962 13.941  5.618   1.00 26.66  ? 250  GLU A CA  1 
ATOM   525  C C   . GLU A 1 81  ? -66.836 12.438  5.398   1.00 25.95  ? 250  GLU A C   1 
ATOM   526  O O   . GLU A 1 81  ? -67.810 11.695  5.510   1.00 31.37  ? 250  GLU A O   1 
ATOM   527  C CB  . GLU A 1 81  ? -66.926 14.656  4.266   1.00 28.19  ? 250  GLU A CB  1 
ATOM   528  C CG  . GLU A 1 81  ? -67.927 14.173  3.210   1.00 36.21  ? 250  GLU A CG  1 
ATOM   529  C CD  . GLU A 1 81  ? -67.820 15.021  1.937   1.00 40.32  ? 250  GLU A CD  1 
ATOM   530  O OE1 . GLU A 1 81  ? -66.715 15.137  1.368   1.00 40.90  ? 250  GLU A OE1 1 
ATOM   531  O OE2 . GLU A 1 81  ? -68.808 15.649  1.568   1.00 43.41  ? 250  GLU A OE2 1 
ATOM   532  N N   . LEU A 1 82  ? -65.631 12.004  5.078   1.00 24.45  ? 251  LEU A N   1 
ATOM   533  C CA  . LEU A 1 82  ? -65.371 10.605  4.801   1.00 25.22  ? 251  LEU A CA  1 
ATOM   534  C C   . LEU A 1 82  ? -65.703 9.732   6.001   1.00 26.80  ? 251  LEU A C   1 
ATOM   535  O O   . LEU A 1 82  ? -66.478 8.750   5.898   1.00 24.57  ? 251  LEU A O   1 
ATOM   536  C CB  . LEU A 1 82  ? -63.905 10.445  4.448   1.00 32.75  ? 251  LEU A CB  1 
ATOM   537  C CG  . LEU A 1 82  ? -63.467 9.052   4.000   1.00 37.92  ? 251  LEU A CG  1 
ATOM   538  C CD1 . LEU A 1 82  ? -64.143 8.772   2.680   1.00 48.52  ? 251  LEU A CD1 1 
ATOM   539  C CD2 . LEU A 1 82  ? -61.958 9.007   3.843   1.00 40.28  ? 251  LEU A CD2 1 
ATOM   540  N N   . TYR A 1 83  ? -65.134 10.092  7.154   1.00 22.35  ? 252  TYR A N   1 
ATOM   541  C CA  . TYR A 1 83  ? -65.341 9.297   8.347   1.00 23.82  ? 252  TYR A CA  1 
ATOM   542  C C   . TYR A 1 83  ? -66.802 9.320   8.801   1.00 23.78  ? 252  TYR A C   1 
ATOM   543  O O   . TYR A 1 83  ? -67.271 8.352   9.379   1.00 21.33  ? 252  TYR A O   1 
ATOM   544  C CB  . TYR A 1 83  ? -64.445 9.810   9.483   1.00 26.25  ? 252  TYR A CB  1 
ATOM   545  C CG  . TYR A 1 83  ? -63.020 9.281   9.543   1.00 21.97  ? 252  TYR A CG  1 
ATOM   546  C CD1 . TYR A 1 83  ? -62.756 7.934   9.705   1.00 23.17  ? 252  TYR A CD1 1 
ATOM   547  C CD2 . TYR A 1 83  ? -61.953 10.142  9.546   1.00 26.36  ? 252  TYR A CD2 1 
ATOM   548  C CE1 . TYR A 1 83  ? -61.449 7.454   9.851   1.00 22.55  ? 252  TYR A CE1 1 
ATOM   549  C CE2 . TYR A 1 83  ? -60.645 9.683   9.690   1.00 27.44  ? 252  TYR A CE2 1 
ATOM   550  C CZ  . TYR A 1 83  ? -60.397 8.340   9.846   1.00 25.98  ? 252  TYR A CZ  1 
ATOM   551  O OH  . TYR A 1 83  ? -59.088 7.895   9.991   1.00 21.95  ? 252  TYR A OH  1 
ATOM   552  N N   . ASN A 1 84  ? -67.514 10.423  8.543   1.00 23.08  ? 253  ASN A N   1 
ATOM   553  C CA  . ASN A 1 84  ? -68.908 10.498  8.949   1.00 25.24  ? 253  ASN A CA  1 
ATOM   554  C C   . ASN A 1 84  ? -69.860 9.856   7.959   1.00 28.33  ? 253  ASN A C   1 
ATOM   555  O O   . ASN A 1 84  ? -71.026 9.660   8.289   1.00 30.07  ? 253  ASN A O   1 
ATOM   556  C CB  . ASN A 1 84  ? -69.352 11.954  9.155   1.00 26.60  ? 253  ASN A CB  1 
ATOM   557  C CG  . ASN A 1 84  ? -69.001 12.492  10.515  1.00 25.67  ? 253  ASN A CG  1 
ATOM   558  O OD1 . ASN A 1 84  ? -68.830 11.751  11.483  1.00 27.30  ? 253  ASN A OD1 1 
ATOM   559  N ND2 . ASN A 1 84  ? -68.899 13.790  10.596  1.00 28.80  ? 253  ASN A ND2 1 
ATOM   560  N N   . THR A 1 85  ? -69.402 9.579   6.744   1.00 27.71  ? 254  THR A N   1 
ATOM   561  C CA  . THR A 1 85  ? -70.292 8.980   5.743   1.00 32.25  ? 254  THR A CA  1 
ATOM   562  C C   . THR A 1 85  ? -69.952 7.543   5.410   1.00 32.65  ? 254  THR A C   1 
ATOM   563  O O   . THR A 1 85  ? -70.774 6.845   4.859   1.00 35.71  ? 254  THR A O   1 
ATOM   564  C CB  . THR A 1 85  ? -70.350 9.775   4.421   1.00 31.50  ? 254  THR A CB  1 
ATOM   565  O OG1 . THR A 1 85  ? -69.052 9.870   3.863   1.00 29.79  ? 254  THR A OG1 1 
ATOM   566  C CG2 . THR A 1 85  ? -70.918 11.179  4.634   1.00 35.13  ? 254  THR A CG2 1 
ATOM   567  N N   . VAL A 1 86  ? -68.748 7.107   5.750   1.00 30.50  ? 255  VAL A N   1 
ATOM   568  C CA  . VAL A 1 86  ? -68.318 5.744   5.505   1.00 26.18  ? 255  VAL A CA  1 
ATOM   569  C C   . VAL A 1 86  ? -68.020 5.044   6.826   1.00 27.04  ? 255  VAL A C   1 
ATOM   570  O O   . VAL A 1 86  ? -67.458 5.651   7.763   1.00 27.05  ? 255  VAL A O   1 
ATOM   571  C CB  . VAL A 1 86  ? -67.053 5.759   4.630   1.00 24.19  ? 255  VAL A CB  1 
ATOM   572  C CG1 . VAL A 1 86  ? -66.556 4.357   4.366   1.00 28.19  ? 255  VAL A CG1 1 
ATOM   573  C CG2 . VAL A 1 86  ? -67.341 6.469   3.330   1.00 26.01  ? 255  VAL A CG2 1 
ATOM   574  N N   . MET A 1 87  ? -68.383 3.766   6.906   1.00 27.56  ? 256  MET A N   1 
ATOM   575  C CA  . MET A 1 87  ? -68.069 2.965   8.095   1.00 31.32  ? 256  MET A CA  1 
ATOM   576  C C   . MET A 1 87  ? -66.681 2.391   7.907   1.00 31.11  ? 256  MET A C   1 
ATOM   577  O O   . MET A 1 87  ? -66.480 1.420   7.193   1.00 32.80  ? 256  MET A O   1 
ATOM   578  C CB  . MET A 1 87  ? -69.108 1.857   8.346   1.00 35.86  ? 256  MET A CB  1 
ATOM   579  C CG  . MET A 1 87  ? -69.256 1.523   9.834   1.00 42.05  ? 256  MET A CG  1 
ATOM   580  S SD  . MET A 1 87  ? -67.745 0.922   10.641  1.00 45.49  ? 256  MET A SD  1 
ATOM   581  C CE  . MET A 1 87  ? -67.563 -0.669  9.817   1.00 43.47  ? 256  MET A CE  1 
ATOM   582  N N   . LEU A 1 88  ? -65.721 3.015   8.558   1.00 29.78  ? 257  LEU A N   1 
ATOM   583  C CA  . LEU A 1 88  ? -64.334 2.808   8.231   1.00 34.74  ? 257  LEU A CA  1 
ATOM   584  C C   . LEU A 1 88  ? -63.530 2.257   9.394   1.00 36.45  ? 257  LEU A C   1 
ATOM   585  O O   . LEU A 1 88  ? -62.301 2.360   9.417   1.00 42.53  ? 257  LEU A O   1 
ATOM   586  C CB  . LEU A 1 88  ? -63.783 4.137   7.745   1.00 34.73  ? 257  LEU A CB  1 
ATOM   587  C CG  . LEU A 1 88  ? -62.805 4.200   6.607   1.00 37.31  ? 257  LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 88  ? -63.169 3.241   5.479   1.00 35.67  ? 257  LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 88  ? -62.762 5.653   6.165   1.00 37.06  ? 257  LEU A CD2 1 
ATOM   590  N N   . ARG A 1 89  ? -64.224 1.616   10.327  1.00 31.18  ? 258  ARG A N   1 
ATOM   591  C CA  . ARG A 1 89  ? -63.570 0.918   11.423  1.00 31.07  ? 258  ARG A CA  1 
ATOM   592  C C   . ARG A 1 89  ? -62.785 -0.288  10.949  1.00 28.30  ? 258  ARG A C   1 
ATOM   593  O O   . ARG A 1 89  ? -63.302 -1.148  10.269  1.00 31.52  ? 258  ARG A O   1 
ATOM   594  C CB  . ARG A 1 89  ? -64.590 0.457   12.446  1.00 35.09  ? 258  ARG A CB  1 
ATOM   595  C CG  . ARG A 1 89  ? -65.249 1.620   13.163  1.00 46.35  ? 258  ARG A CG  1 
ATOM   596  C CD  . ARG A 1 89  ? -66.287 1.159   14.180  1.00 45.25  ? 258  ARG A CD  1 
ATOM   597  N NE  . ARG A 1 89  ? -67.137 2.278   14.557  1.00 54.23  ? 258  ARG A NE  1 
ATOM   598  C CZ  . ARG A 1 89  ? -67.844 2.359   15.682  1.00 69.50  ? 258  ARG A CZ  1 
ATOM   599  N NH1 . ARG A 1 89  ? -67.823 1.371   16.571  1.00 68.17  ? 258  ARG A NH1 1 
ATOM   600  N NH2 . ARG A 1 89  ? -68.576 3.449   15.923  1.00 67.34  ? 258  ARG A NH2 1 
ATOM   601  N N   . HIS A 1 90  ? -61.520 -0.339  11.329  1.00 27.45  ? 259  HIS A N   1 
ATOM   602  C CA  . HIS A 1 90  ? -60.595 -1.359  10.870  1.00 25.18  ? 259  HIS A CA  1 
ATOM   603  C C   . HIS A 1 90  ? -59.347 -1.159  11.690  1.00 25.53  ? 259  HIS A C   1 
ATOM   604  O O   . HIS A 1 90  ? -58.950 -0.019  11.998  1.00 23.74  ? 259  HIS A O   1 
ATOM   605  C CB  . HIS A 1 90  ? -60.264 -1.209  9.373   1.00 26.22  ? 259  HIS A CB  1 
ATOM   606  C CG  . HIS A 1 90  ? -59.523 -2.374  8.802   1.00 25.81  ? 259  HIS A CG  1 
ATOM   607  N ND1 . HIS A 1 90  ? -58.155 -2.481  8.861   1.00 29.16  ? 259  HIS A ND1 1 
ATOM   608  C CD2 . HIS A 1 90  ? -59.957 -3.499  8.185   1.00 26.59  ? 259  HIS A CD2 1 
ATOM   609  C CE1 . HIS A 1 90  ? -57.768 -3.622  8.308   1.00 28.10  ? 259  HIS A CE1 1 
ATOM   610  N NE2 . HIS A 1 90  ? -58.845 -4.256  7.884   1.00 29.66  ? 259  HIS A NE2 1 
ATOM   611  N N   . GLU A 1 91  ? -58.738 -2.271  12.058  1.00 25.16  ? 260  GLU A N   1 
ATOM   612  C CA  . GLU A 1 91  ? -57.550 -2.286  12.897  1.00 26.71  ? 260  GLU A CA  1 
ATOM   613  C C   . GLU A 1 91  ? -56.397 -1.438  12.339  1.00 28.17  ? 260  GLU A C   1 
ATOM   614  O O   . GLU A 1 91  ? -55.548 -0.945  13.092  1.00 22.12  ? 260  GLU A O   1 
ATOM   615  C CB  . GLU A 1 91  ? -57.113 -3.750  13.035  1.00 36.18  ? 260  GLU A CB  1 
ATOM   616  C CG  . GLU A 1 91  ? -55.842 -3.971  13.813  1.00 58.24  ? 260  GLU A CG  1 
ATOM   617  C CD  . GLU A 1 91  ? -55.835 -5.300  14.527  1.00 74.53  ? 260  GLU A CD  1 
ATOM   618  O OE1 . GLU A 1 91  ? -56.189 -6.345  13.902  1.00 60.11  ? 260  GLU A OE1 1 
ATOM   619  O OE2 . GLU A 1 91  ? -55.467 -5.277  15.719  1.00 96.14  ? 260  GLU A OE2 1 
ATOM   620  N N   . ASN A 1 92  ? -56.340 -1.286  11.018  1.00 22.82  ? 261  ASN A N   1 
ATOM   621  C CA  . ASN A 1 92  ? -55.208 -0.603  10.376  1.00 21.59  ? 261  ASN A CA  1 
ATOM   622  C C   . ASN A 1 92  ? -55.597 0.675   9.655   1.00 20.83  ? 261  ASN A C   1 
ATOM   623  O O   . ASN A 1 92  ? -54.881 1.127   8.732   1.00 19.09  ? 261  ASN A O   1 
ATOM   624  C CB  . ASN A 1 92  ? -54.513 -1.565  9.388   1.00 20.85  ? 261  ASN A CB  1 
ATOM   625  C CG  . ASN A 1 92  ? -54.223 -2.915  10.018  1.00 22.05  ? 261  ASN A CG  1 
ATOM   626  O OD1 . ASN A 1 92  ? -54.740 -3.940  9.585   1.00 22.36  ? 261  ASN A OD1 1 
ATOM   627  N ND2 . ASN A 1 92  ? -53.429 -2.907  11.086  1.00 21.17  ? 261  ASN A ND2 1 
ATOM   628  N N   . ILE A 1 93  ? -56.732 1.255   10.041  1.00 21.05  ? 262  ILE A N   1 
ATOM   629  C CA  . ILE A 1 93  ? -57.087 2.618   9.625   1.00 21.02  ? 262  ILE A CA  1 
ATOM   630  C C   . ILE A 1 93  ? -57.268 3.446   10.906  1.00 21.74  ? 262  ILE A C   1 
ATOM   631  O O   . ILE A 1 93  ? -57.943 3.015   11.808  1.00 20.73  ? 262  ILE A O   1 
ATOM   632  C CB  . ILE A 1 93  ? -58.360 2.606   8.785   1.00 21.77  ? 262  ILE A CB  1 
ATOM   633  C CG1 . ILE A 1 93  ? -58.130 1.821   7.503   1.00 25.01  ? 262  ILE A CG1 1 
ATOM   634  C CG2 . ILE A 1 93  ? -58.825 4.024   8.466   1.00 23.08  ? 262  ILE A CG2 1 
ATOM   635  C CD1 . ILE A 1 93  ? -59.384 1.610   6.703   1.00 24.65  ? 262  ILE A CD1 1 
ATOM   636  N N   . LEU A 1 94  ? -56.623 4.596   11.031  1.00 19.98  ? 263  LEU A N   1 
ATOM   637  C CA  . LEU A 1 94  ? -56.719 5.357   12.288  1.00 19.22  ? 263  LEU A CA  1 
ATOM   638  C C   . LEU A 1 94  ? -58.182 5.485   12.724  1.00 21.51  ? 263  LEU A C   1 
ATOM   639  O O   . LEU A 1 94  ? -59.011 5.968   11.958  1.00 20.90  ? 263  LEU A O   1 
ATOM   640  C CB  . LEU A 1 94  ? -56.117 6.747   12.137  1.00 20.77  ? 263  LEU A CB  1 
ATOM   641  C CG  . LEU A 1 94  ? -56.115 7.657   13.367  1.00 20.55  ? 263  LEU A CG  1 
ATOM   642  C CD1 . LEU A 1 94  ? -55.375 7.018   14.526  1.00 22.48  ? 263  LEU A CD1 1 
ATOM   643  C CD2 . LEU A 1 94  ? -55.503 9.011   13.075  1.00 22.38  ? 263  LEU A CD2 1 
ATOM   644  N N   . GLY A 1 95  ? -58.477 5.114   13.968  1.00 22.40  ? 264  GLY A N   1 
ATOM   645  C CA  . GLY A 1 95  ? -59.840 5.186   14.508  1.00 21.26  ? 264  GLY A CA  1 
ATOM   646  C C   . GLY A 1 95  ? -60.350 6.587   14.794  1.00 20.50  ? 264  GLY A C   1 
ATOM   647  O O   . GLY A 1 95  ? -59.795 7.318   15.607  1.00 22.70  ? 264  GLY A O   1 
ATOM   648  N N   . PHE A 1 96  ? -61.401 6.974   14.091  1.00 20.78  ? 265  PHE A N   1 
ATOM   649  C CA  . PHE A 1 96  ? -62.028 8.293   14.245  1.00 22.18  ? 265  PHE A CA  1 
ATOM   650  C C   . PHE A 1 96  ? -62.991 8.279   15.411  1.00 22.33  ? 265  PHE A C   1 
ATOM   651  O O   . PHE A 1 96  ? -63.740 7.311   15.589  1.00 23.25  ? 265  PHE A O   1 
ATOM   652  C CB  . PHE A 1 96  ? -62.773 8.654   12.948  1.00 20.62  ? 265  PHE A CB  1 
ATOM   653  C CG  . PHE A 1 96  ? -63.664 9.846   13.043  1.00 19.92  ? 265  PHE A CG  1 
ATOM   654  C CD1 . PHE A 1 96  ? -63.160 11.108  12.857  1.00 21.22  ? 265  PHE A CD1 1 
ATOM   655  C CD2 . PHE A 1 96  ? -65.028 9.702   13.218  1.00 21.18  ? 265  PHE A CD2 1 
ATOM   656  C CE1 . PHE A 1 96  ? -63.980 12.223  12.889  1.00 22.13  ? 265  PHE A CE1 1 
ATOM   657  C CE2 . PHE A 1 96  ? -65.865 10.801  13.216  1.00 20.51  ? 265  PHE A CE2 1 
ATOM   658  C CZ  . PHE A 1 96  ? -65.337 12.073  13.059  1.00 21.07  ? 265  PHE A CZ  1 
ATOM   659  N N   . ILE A 1 97  ? -62.974 9.358   16.189  1.00 22.15  ? 266  ILE A N   1 
ATOM   660  C CA  . ILE A 1 97  ? -63.915 9.541   17.287  1.00 23.71  ? 266  ILE A CA  1 
ATOM   661  C C   . ILE A 1 97  ? -64.965 10.636  17.019  1.00 21.09  ? 266  ILE A C   1 
ATOM   662  O O   . ILE A 1 97  ? -66.169 10.408  17.168  1.00 23.17  ? 266  ILE A O   1 
ATOM   663  C CB  . ILE A 1 97  ? -63.125 9.823   18.590  1.00 21.73  ? 266  ILE A CB  1 
ATOM   664  C CG1 . ILE A 1 97  ? -62.269 8.596   18.917  1.00 21.60  ? 266  ILE A CG1 1 
ATOM   665  C CG2 . ILE A 1 97  ? -64.050 10.085  19.758  1.00 22.65  ? 266  ILE A CG2 1 
ATOM   666  C CD1 . ILE A 1 97  ? -61.328 8.803   20.114  1.00 22.57  ? 266  ILE A CD1 1 
ATOM   667  N N   . ALA A 1 98  ? -64.494 11.811  16.639  1.00 21.21  ? 267  ALA A N   1 
ATOM   668  C CA  . ALA A 1 98  ? -65.341 12.986  16.414  1.00 22.63  ? 267  ALA A CA  1 
ATOM   669  C C   . ALA A 1 98  ? -64.621 14.097  15.662  1.00 23.19  ? 267  ALA A C   1 
ATOM   670  O O   . ALA A 1 98  ? -63.387 14.168  15.664  1.00 21.77  ? 267  ALA A O   1 
ATOM   671  C CB  . ALA A 1 98  ? -65.784 13.548  17.766  1.00 24.75  ? 267  ALA A CB  1 
ATOM   672  N N   A SER A 1 99  ? -65.414 14.973  15.051  0.50 23.52  ? 268  SER A N   1 
ATOM   673  N N   B SER A 1 99  ? -65.410 14.948  14.998  0.50 25.28  ? 268  SER A N   1 
ATOM   674  C CA  A SER A 1 99  ? -64.937 16.215  14.486  0.50 23.02  ? 268  SER A CA  1 
ATOM   675  C CA  B SER A 1 99  ? -64.952 16.234  14.481  0.50 26.13  ? 268  SER A CA  1 
ATOM   676  C C   A SER A 1 99  ? -65.784 17.336  15.063  0.50 24.44  ? 268  SER A C   1 
ATOM   677  C C   B SER A 1 99  ? -65.775 17.324  15.123  0.50 26.02  ? 268  SER A C   1 
ATOM   678  O O   A SER A 1 99  ? -66.978 17.147  15.301  0.50 23.77  ? 268  SER A O   1 
ATOM   679  O O   B SER A 1 99  ? -66.944 17.113  15.443  0.50 25.20  ? 268  SER A O   1 
ATOM   680  C CB  A SER A 1 99  ? -65.053 16.181  12.967  0.50 22.16  ? 268  SER A CB  1 
ATOM   681  C CB  B SER A 1 99  ? -65.126 16.338  12.968  0.50 27.73  ? 268  SER A CB  1 
ATOM   682  O OG  A SER A 1 99  ? -64.818 17.449  12.403  0.50 19.87  ? 268  SER A OG  1 
ATOM   683  O OG  B SER A 1 99  ? -64.226 15.489  12.293  0.50 29.68  ? 268  SER A OG  1 
ATOM   684  N N   . ASP A 1 100 ? -65.178 18.495  15.295  1.00 25.45  ? 269  ASP A N   1 
ATOM   685  C CA  . ASP A 1 100 ? -65.901 19.627  15.899  1.00 27.08  ? 269  ASP A CA  1 
ATOM   686  C C   . ASP A 1 100 ? -65.346 20.973  15.449  1.00 29.49  ? 269  ASP A C   1 
ATOM   687  O O   . ASP A 1 100 ? -64.152 21.093  15.159  1.00 27.18  ? 269  ASP A O   1 
ATOM   688  C CB  . ASP A 1 100 ? -65.852 19.525  17.433  1.00 27.63  ? 269  ASP A CB  1 
ATOM   689  C CG  . ASP A 1 100 ? -66.863 20.421  18.120  1.00 29.11  ? 269  ASP A CG  1 
ATOM   690  O OD1 . ASP A 1 100 ? -68.064 20.350  17.772  1.00 32.26  ? 269  ASP A OD1 1 
ATOM   691  O OD2 . ASP A 1 100 ? -66.452 21.205  19.003  1.00 29.01  ? 269  ASP A OD2 1 
ATOM   692  N N   . MET A 1 101 ? -66.243 21.953  15.360  1.00 30.80  ? 270  MET A N   1 
ATOM   693  C CA  . MET A 1 101 ? -65.899 23.376  15.190  1.00 42.89  ? 270  MET A CA  1 
ATOM   694  C C   . MET A 1 101 ? -66.125 24.120  16.489  1.00 45.25  ? 270  MET A C   1 
ATOM   695  O O   . MET A 1 101 ? -67.162 23.951  17.116  1.00 53.62  ? 270  MET A O   1 
ATOM   696  C CB  . MET A 1 101 ? -66.810 24.030  14.190  1.00 44.23  ? 270  MET A CB  1 
ATOM   697  C CG  . MET A 1 101 ? -66.695 23.516  12.779  1.00 50.10  ? 270  MET A CG  1 
ATOM   698  S SD  . MET A 1 101 ? -67.651 24.610  11.676  1.00 65.78  ? 270  MET A SD  1 
ATOM   699  C CE  . MET A 1 101 ? -69.295 24.368  12.395  1.00 54.21  ? 270  MET A CE  1 
ATOM   700  N N   . THR A 1 102 ? -65.173 24.954  16.882  1.00 60.17  ? 271  THR A N   1 
ATOM   701  C CA  . THR A 1 102 ? -65.196 25.598  18.206  1.00 66.20  ? 271  THR A CA  1 
ATOM   702  C C   . THR A 1 102 ? -64.530 26.964  18.090  1.00 67.35  ? 271  THR A C   1 
ATOM   703  O O   . THR A 1 102 ? -63.364 27.021  17.714  1.00 68.47  ? 271  THR A O   1 
ATOM   704  C CB  . THR A 1 102 ? -64.484 24.698  19.282  1.00 70.70  ? 271  THR A CB  1 
ATOM   705  O OG1 . THR A 1 102 ? -64.535 25.314  20.573  1.00 69.12  ? 271  THR A OG1 1 
ATOM   706  C CG2 . THR A 1 102 ? -62.992 24.363  18.951  1.00 54.75  ? 271  THR A CG2 1 
ATOM   707  N N   . SER A 1 103 ? -65.259 28.056  18.369  1.00 109.02 ? 272  SER A N   1 
ATOM   708  C CA  . SER A 1 103 ? -64.671 29.429  18.359  1.00 120.38 ? 272  SER A CA  1 
ATOM   709  C C   . SER A 1 103 ? -63.687 29.634  19.536  1.00 118.09 ? 272  SER A C   1 
ATOM   710  O O   . SER A 1 103 ? -64.110 29.800  20.681  1.00 82.53  ? 272  SER A O   1 
ATOM   711  C CB  . SER A 1 103 ? -65.763 30.519  18.365  1.00 79.33  ? 272  SER A CB  1 
ATOM   712  N N   . ARG A 1 104 ? -62.382 29.595  19.238  1.00 137.59 ? 273  ARG A N   1 
ATOM   713  C CA  . ARG A 1 104 ? -61.313 29.721  20.249  1.00 123.69 ? 273  ARG A CA  1 
ATOM   714  C C   . ARG A 1 104 ? -60.087 30.441  19.673  1.00 112.58 ? 273  ARG A C   1 
ATOM   715  O O   . ARG A 1 104 ? -59.676 31.494  20.166  1.00 98.41  ? 273  ARG A O   1 
ATOM   716  C CB  . ARG A 1 104 ? -60.902 28.341  20.789  1.00 90.98  ? 273  ARG A CB  1 
ATOM   717  N N   . SER A 1 107 ? -61.382 33.308  16.291  1.00 101.58 ? 276  SER A N   1 
ATOM   718  C CA  . SER A 1 107 ? -61.545 32.538  15.053  1.00 112.72 ? 276  SER A CA  1 
ATOM   719  C C   . SER A 1 107 ? -61.870 31.060  15.342  1.00 113.34 ? 276  SER A C   1 
ATOM   720  O O   . SER A 1 107 ? -61.355 30.474  16.312  1.00 92.23  ? 276  SER A O   1 
ATOM   721  C CB  . SER A 1 107 ? -60.287 32.650  14.182  1.00 92.09  ? 276  SER A CB  1 
ATOM   722  N N   . THR A 1 108 ? -62.722 30.466  14.498  1.00 92.87  ? 277  THR A N   1 
ATOM   723  C CA  . THR A 1 108 ? -63.181 29.077  14.694  1.00 93.41  ? 277  THR A CA  1 
ATOM   724  C C   . THR A 1 108 ? -62.036 28.079  14.449  1.00 70.41  ? 277  THR A C   1 
ATOM   725  O O   . THR A 1 108 ? -61.330 28.189  13.455  1.00 60.53  ? 277  THR A O   1 
ATOM   726  C CB  . THR A 1 108 ? -64.397 28.728  13.801  1.00 71.93  ? 277  THR A CB  1 
ATOM   727  N N   . GLN A 1 109 ? -61.840 27.154  15.394  1.00 49.90  ? 278  GLN A N   1 
ATOM   728  C CA  . GLN A 1 109 ? -60.855 26.094  15.293  1.00 39.79  ? 278  GLN A CA  1 
ATOM   729  C C   . GLN A 1 109 ? -61.534 24.836  14.770  1.00 35.64  ? 278  GLN A C   1 
ATOM   730  O O   . GLN A 1 109 ? -62.712 24.582  15.062  1.00 31.83  ? 278  GLN A O   1 
ATOM   731  C CB  . GLN A 1 109 ? -60.240 25.772  16.646  1.00 52.95  ? 278  GLN A CB  1 
ATOM   732  C CG  . GLN A 1 109 ? -59.214 26.767  17.169  1.00 60.26  ? 278  GLN A CG  1 
ATOM   733  C CD  . GLN A 1 109 ? -58.206 26.144  18.146  1.00 62.15  ? 278  GLN A CD  1 
ATOM   734  O OE1 . GLN A 1 109 ? -58.480 25.139  18.833  1.00 42.28  ? 278  GLN A OE1 1 
ATOM   735  N NE2 . GLN A 1 109 ? -57.030 26.753  18.218  1.00 62.04  ? 278  GLN A NE2 1 
ATOM   736  N N   . LEU A 1 110 ? -60.790 24.061  13.989  1.00 29.45  ? 279  LEU A N   1 
ATOM   737  C CA  . LEU A 1 110 ? -61.284 22.818  13.399  1.00 31.79  ? 279  LEU A CA  1 
ATOM   738  C C   . LEU A 1 110 ? -60.542 21.609  14.003  1.00 27.35  ? 279  LEU A C   1 
ATOM   739  O O   . LEU A 1 110 ? -59.338 21.494  13.860  1.00 30.28  ? 279  LEU A O   1 
ATOM   740  C CB  . LEU A 1 110 ? -61.086 22.858  11.881  1.00 33.01  ? 279  LEU A CB  1 
ATOM   741  C CG  . LEU A 1 110 ? -61.688 24.085  11.189  1.00 36.18  ? 279  LEU A CG  1 
ATOM   742  C CD1 . LEU A 1 110 ? -61.239 24.168  9.745   1.00 35.97  ? 279  LEU A CD1 1 
ATOM   743  C CD2 . LEU A 1 110 ? -63.207 24.037  11.277  1.00 35.53  ? 279  LEU A CD2 1 
ATOM   744  N N   . TRP A 1 111 ? -61.284 20.716  14.653  1.00 26.58  ? 280  TRP A N   1 
ATOM   745  C CA  . TRP A 1 111 ? -60.723 19.614  15.429  1.00 24.73  ? 280  TRP A CA  1 
ATOM   746  C C   . TRP A 1 111 ? -61.117 18.326  14.782  1.00 24.94  ? 280  TRP A C   1 
ATOM   747  O O   . TRP A 1 111 ? -62.278 18.153  14.398  1.00 23.23  ? 280  TRP A O   1 
ATOM   748  C CB  . TRP A 1 111 ? -61.300 19.603  16.848  1.00 22.96  ? 280  TRP A CB  1 
ATOM   749  C CG  . TRP A 1 111 ? -60.685 20.598  17.783  1.00 27.78  ? 280  TRP A CG  1 
ATOM   750  C CD1 . TRP A 1 111 ? -60.061 21.762  17.450  1.00 30.98  ? 280  TRP A CD1 1 
ATOM   751  C CD2 . TRP A 1 111 ? -60.686 20.546  19.216  1.00 28.75  ? 280  TRP A CD2 1 
ATOM   752  N NE1 . TRP A 1 111 ? -59.642 22.416  18.570  1.00 30.86  ? 280  TRP A NE1 1 
ATOM   753  C CE2 . TRP A 1 111 ? -60.007 21.698  19.674  1.00 34.53  ? 280  TRP A CE2 1 
ATOM   754  C CE3 . TRP A 1 111 ? -61.165 19.623  20.156  1.00 28.92  ? 280  TRP A CE3 1 
ATOM   755  C CZ2 . TRP A 1 111 ? -59.812 21.972  21.046  1.00 34.02  ? 280  TRP A CZ2 1 
ATOM   756  C CZ3 . TRP A 1 111 ? -60.963 19.886  21.527  1.00 33.09  ? 280  TRP A CZ3 1 
ATOM   757  C CH2 . TRP A 1 111 ? -60.288 21.050  21.950  1.00 32.53  ? 280  TRP A CH2 1 
ATOM   758  N N   . LEU A 1 112 ? -60.151 17.427  14.632  1.00 24.93  ? 281  LEU A N   1 
ATOM   759  C CA  . LEU A 1 112 ? -60.441 16.045  14.316  1.00 25.03  ? 281  LEU A CA  1 
ATOM   760  C C   . LEU A 1 112 ? -59.893 15.205  15.469  1.00 22.95  ? 281  LEU A C   1 
ATOM   761  O O   . LEU A 1 112 ? -58.712 15.290  15.783  1.00 25.83  ? 281  LEU A O   1 
ATOM   762  C CB  . LEU A 1 112 ? -59.774 15.635  13.017  1.00 25.97  ? 281  LEU A CB  1 
ATOM   763  C CG  . LEU A 1 112 ? -60.156 14.220  12.588  1.00 28.21  ? 281  LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 112 ? -61.245 14.328  11.544  1.00 31.78  ? 281  LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 112 ? -58.932 13.514  12.053  1.00 33.38  ? 281  LEU A CD2 1 
ATOM   766  N N   . ILE A 1 113 ? -60.743 14.383  16.079  1.00 19.40  ? 282  ILE A N   1 
ATOM   767  C CA  . ILE A 1 113 ? -60.389 13.672  17.294  1.00 19.90  ? 282  ILE A CA  1 
ATOM   768  C C   . ILE A 1 113 ? -60.343 12.200  16.983  1.00 20.58  ? 282  ILE A C   1 
ATOM   769  O O   . ILE A 1 113 ? -61.305 11.655  16.437  1.00 18.90  ? 282  ILE A O   1 
ATOM   770  C CB  . ILE A 1 113 ? -61.448 13.948  18.393  1.00 22.55  ? 282  ILE A CB  1 
ATOM   771  C CG1 . ILE A 1 113 ? -61.514 15.442  18.695  1.00 22.78  ? 282  ILE A CG1 1 
ATOM   772  C CG2 . ILE A 1 113 ? -61.113 13.224  19.689  1.00 24.47  ? 282  ILE A CG2 1 
ATOM   773  C CD1 . ILE A 1 113 ? -62.859 15.925  19.112  1.00 23.93  ? 282  ILE A CD1 1 
ATOM   774  N N   . THR A 1 114 ? -59.234 11.556  17.338  1.00 20.20  ? 283  THR A N   1 
ATOM   775  C CA  . THR A 1 114 ? -59.010 10.170  16.974  1.00 22.07  ? 283  THR A CA  1 
ATOM   776  C C   . THR A 1 114 ? -58.403 9.381   18.104  1.00 21.73  ? 283  THR A C   1 
ATOM   777  O O   . THR A 1 114 ? -58.006 9.949   19.118  1.00 23.40  ? 283  THR A O   1 
ATOM   778  C CB  . THR A 1 114 ? -58.010 10.070  15.802  1.00 22.91  ? 283  THR A CB  1 
ATOM   779  O OG1 . THR A 1 114 ? -56.704 10.335  16.261  1.00 21.86  ? 283  THR A OG1 1 
ATOM   780  C CG2 . THR A 1 114 ? -58.337 11.056  14.742  1.00 25.73  ? 283  THR A CG2 1 
ATOM   781  N N   . HIS A 1 115 ? -58.340 8.072   17.918  1.00 23.62  ? 284  HIS A N   1 
ATOM   782  C CA  . HIS A 1 115 ? -57.562 7.165   18.779  1.00 23.81  ? 284  HIS A CA  1 
ATOM   783  C C   . HIS A 1 115 ? -56.136 7.719   18.883  1.00 23.82  ? 284  HIS A C   1 
ATOM   784  O O   . HIS A 1 115 ? -55.596 8.180   17.890  1.00 22.37  ? 284  HIS A O   1 
ATOM   785  C CB  . HIS A 1 115 ? -57.555 5.802   18.105  1.00 26.83  ? 284  HIS A CB  1 
ATOM   786  C CG  . HIS A 1 115 ? -57.164 4.672   18.983  1.00 29.32  ? 284  HIS A CG  1 
ATOM   787  N ND1 . HIS A 1 115 ? -57.651 3.399   18.795  1.00 41.81  ? 284  HIS A ND1 1 
ATOM   788  C CD2 . HIS A 1 115 ? -56.286 4.591   20.011  1.00 32.30  ? 284  HIS A CD2 1 
ATOM   789  C CE1 . HIS A 1 115 ? -57.112 2.589   19.689  1.00 36.79  ? 284  HIS A CE1 1 
ATOM   790  N NE2 . HIS A 1 115 ? -56.285 3.290   20.439  1.00 31.39  ? 284  HIS A NE2 1 
ATOM   791  N N   . TYR A 1 116 ? -55.575 7.724   20.099  1.00 20.79  ? 285  TYR A N   1 
ATOM   792  C CA  . TYR A 1 116 ? -54.234 8.205   20.367  1.00 20.84  ? 285  TYR A CA  1 
ATOM   793  C C   . TYR A 1 116 ? -53.256 7.048   20.324  1.00 22.07  ? 285  TYR A C   1 
ATOM   794  O O   . TYR A 1 116 ? -53.479 6.020   20.961  1.00 23.61  ? 285  TYR A O   1 
ATOM   795  C CB  . TYR A 1 116 ? -54.170 8.815   21.791  1.00 23.28  ? 285  TYR A CB  1 
ATOM   796  C CG  . TYR A 1 116 ? -52.808 9.350   22.167  1.00 23.79  ? 285  TYR A CG  1 
ATOM   797  C CD1 . TYR A 1 116 ? -52.328 10.514  21.592  1.00 26.31  ? 285  TYR A CD1 1 
ATOM   798  C CD2 . TYR A 1 116 ? -52.023 8.713   23.096  1.00 23.91  ? 285  TYR A CD2 1 
ATOM   799  C CE1 . TYR A 1 116 ? -51.113 11.028  21.939  1.00 27.43  ? 285  TYR A CE1 1 
ATOM   800  C CE2 . TYR A 1 116 ? -50.780 9.208   23.439  1.00 25.80  ? 285  TYR A CE2 1 
ATOM   801  C CZ  . TYR A 1 116 ? -50.329 10.366  22.856  1.00 29.56  ? 285  TYR A CZ  1 
ATOM   802  O OH  . TYR A 1 116 ? -49.094 10.899  23.181  1.00 33.15  ? 285  TYR A OH  1 
ATOM   803  N N   . HIS A 1 117 ? -52.146 7.234   19.624  1.00 22.44  ? 286  HIS A N   1 
ATOM   804  C CA  . HIS A 1 117 ? -51.124 6.205   19.507  1.00 20.86  ? 286  HIS A CA  1 
ATOM   805  C C   . HIS A 1 117 ? -49.779 6.772   19.943  1.00 21.88  ? 286  HIS A C   1 
ATOM   806  O O   . HIS A 1 117 ? -49.150 7.568   19.233  1.00 19.63  ? 286  HIS A O   1 
ATOM   807  C CB  . HIS A 1 117 ? -51.074 5.699   18.083  1.00 20.96  ? 286  HIS A CB  1 
ATOM   808  C CG  . HIS A 1 117 ? -52.308 4.990   17.671  1.00 19.88  ? 286  HIS A CG  1 
ATOM   809  N ND1 . HIS A 1 117 ? -52.650 3.759   18.178  1.00 20.66  ? 286  HIS A ND1 1 
ATOM   810  C CD2 . HIS A 1 117 ? -53.287 5.318   16.797  1.00 22.76  ? 286  HIS A CD2 1 
ATOM   811  C CE1 . HIS A 1 117 ? -53.804 3.370   17.659  1.00 18.82  ? 286  HIS A CE1 1 
ATOM   812  N NE2 . HIS A 1 117 ? -54.211 4.291   16.814  1.00 19.89  ? 286  HIS A NE2 1 
ATOM   813  N N   . GLU A 1 118 ? -49.341 6.376   21.132  1.00 22.61  ? 287  GLU A N   1 
ATOM   814  C CA  . GLU A 1 118 ? -48.212 7.043   21.776  1.00 26.44  ? 287  GLU A CA  1 
ATOM   815  C C   . GLU A 1 118 ? -46.890 6.741   21.069  1.00 27.28  ? 287  GLU A C   1 
ATOM   816  O O   . GLU A 1 118 ? -45.926 7.466   21.262  1.00 24.27  ? 287  GLU A O   1 
ATOM   817  C CB  . GLU A 1 118 ? -48.131 6.687   23.299  1.00 28.31  ? 287  GLU A CB  1 
ATOM   818  C CG  . GLU A 1 118 ? -47.453 5.372   23.584  1.00 35.16  ? 287  GLU A CG  1 
ATOM   819  C CD  . GLU A 1 118 ? -47.309 5.036   25.078  1.00 39.25  ? 287  GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 118 ? -46.352 5.452   25.743  1.00 38.17  ? 287  GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 118 ? -48.153 4.299   25.582  1.00 40.94  ? 287  GLU A OE2 1 
ATOM   822  N N   . MET A 1 119 ? -46.817 5.681   20.250  1.00 26.46  ? 288  MET A N   1 
ATOM   823  C CA  . MET A 1 119 ? -45.541 5.421   19.552  1.00 26.14  ? 288  MET A CA  1 
ATOM   824  C C   . MET A 1 119 ? -45.320 6.394   18.417  1.00 23.36  ? 288  MET A C   1 
ATOM   825  O O   . MET A 1 119 ? -44.254 6.429   17.874  1.00 32.83  ? 288  MET A O   1 
ATOM   826  C CB  . MET A 1 119 ? -45.467 4.021   18.966  1.00 31.37  ? 288  MET A CB  1 
ATOM   827  C CG  . MET A 1 119 ? -45.903 2.859   19.848  1.00 41.99  ? 288  MET A CG  1 
ATOM   828  S SD  . MET A 1 119 ? -44.530 1.936   20.464  1.00 62.95  ? 288  MET A SD  1 
ATOM   829  C CE  . MET A 1 119 ? -43.883 3.290   21.420  1.00 40.01  ? 288  MET A CE  1 
ATOM   830  N N   . GLY A 1 120 ? -46.338 7.158   18.025  1.00 24.17  ? 289  GLY A N   1 
ATOM   831  C CA  . GLY A 1 120 ? -46.190 8.152   16.950  1.00 25.86  ? 289  GLY A CA  1 
ATOM   832  C C   . GLY A 1 120 ? -46.125 7.534   15.547  1.00 24.11  ? 289  GLY A C   1 
ATOM   833  O O   . GLY A 1 120 ? -46.623 6.427   15.310  1.00 23.65  ? 289  GLY A O   1 
ATOM   834  N N   . SER A 1 121 ? -45.515 8.245   14.620  1.00 21.31  ? 290  SER A N   1 
ATOM   835  C CA  . SER A 1 121 ? -45.523 7.829   13.227  1.00 20.68  ? 290  SER A CA  1 
ATOM   836  C C   . SER A 1 121 ? -44.470 6.780   12.933  1.00 21.62  ? 290  SER A C   1 
ATOM   837  O O   . SER A 1 121 ? -43.470 6.685   13.620  1.00 21.45  ? 290  SER A O   1 
ATOM   838  C CB  . SER A 1 121 ? -45.290 9.011   12.317  1.00 22.57  ? 290  SER A CB  1 
ATOM   839  O OG  . SER A 1 121 ? -43.938 9.439   12.399  1.00 25.55  ? 290  SER A OG  1 
ATOM   840  N N   . LEU A 1 122 ? -44.706 5.993   11.886  1.00 21.77  ? 291  LEU A N   1 
ATOM   841  C CA  . LEU A 1 122 ? -43.718 5.028   11.397  1.00 21.08  ? 291  LEU A CA  1 
ATOM   842  C C   . LEU A 1 122 ? -42.403 5.750   11.066  1.00 23.55  ? 291  LEU A C   1 
ATOM   843  O O   . LEU A 1 122 ? -41.311 5.268   11.356  1.00 22.12  ? 291  LEU A O   1 
ATOM   844  C CB  . LEU A 1 122 ? -44.279 4.351   10.141  1.00 19.98  ? 291  LEU A CB  1 
ATOM   845  C CG  . LEU A 1 122 ? -43.426 3.280   9.515   1.00 22.30  ? 291  LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 122 ? -43.111 2.183   10.536  1.00 23.86  ? 291  LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 122 ? -44.137 2.714   8.287   1.00 22.16  ? 291  LEU A CD2 1 
ATOM   848  N N   . TYR A 1 123 ? -42.521 6.913   10.445  1.00 21.77  ? 292  TYR A N   1 
ATOM   849  C CA  . TYR A 1 123 ? -41.339 7.740   10.167  1.00 24.50  ? 292  TYR A CA  1 
ATOM   850  C C   . TYR A 1 123 ? -40.474 7.954   11.403  1.00 26.76  ? 292  TYR A C   1 
ATOM   851  O O   . TYR A 1 123 ? -39.288 7.669   11.380  1.00 25.24  ? 292  TYR A O   1 
ATOM   852  C CB  . TYR A 1 123 ? -41.750 9.069   9.574   1.00 26.72  ? 292  TYR A CB  1 
ATOM   853  C CG  . TYR A 1 123 ? -40.610 10.014  9.319   1.00 27.71  ? 292  TYR A CG  1 
ATOM   854  C CD1 . TYR A 1 123 ? -39.870 9.912   8.161   1.00 29.22  ? 292  TYR A CD1 1 
ATOM   855  C CD2 . TYR A 1 123 ? -40.294 11.037  10.224  1.00 30.61  ? 292  TYR A CD2 1 
ATOM   856  C CE1 . TYR A 1 123 ? -38.824 10.769  7.898   1.00 29.21  ? 292  TYR A CE1 1 
ATOM   857  C CE2 . TYR A 1 123 ? -39.235 11.908  9.976   1.00 34.40  ? 292  TYR A CE2 1 
ATOM   858  C CZ  . TYR A 1 123 ? -38.509 11.761  8.792   1.00 32.62  ? 292  TYR A CZ  1 
ATOM   859  O OH  . TYR A 1 123 ? -37.462 12.582  8.489   1.00 32.39  ? 292  TYR A OH  1 
ATOM   860  N N   . ASP A 1 124 ? -41.066 8.407   12.494  1.00 28.17  ? 293  ASP A N   1 
ATOM   861  C CA  . ASP A 1 124 ? -40.289 8.633   13.707  1.00 29.64  ? 293  ASP A CA  1 
ATOM   862  C C   . ASP A 1 124 ? -39.784 7.360   14.314  1.00 28.73  ? 293  ASP A C   1 
ATOM   863  O O   . ASP A 1 124 ? -38.631 7.297   14.719  1.00 27.31  ? 293  ASP A O   1 
ATOM   864  C CB  . ASP A 1 124 ? -41.081 9.429   14.723  1.00 32.37  ? 293  ASP A CB  1 
ATOM   865  C CG  . ASP A 1 124 ? -41.260 10.885  14.286  1.00 36.47  ? 293  ASP A CG  1 
ATOM   866  O OD1 . ASP A 1 124 ? -40.316 11.535  13.753  1.00 39.72  ? 293  ASP A OD1 1 
ATOM   867  O OD2 . ASP A 1 124 ? -42.362 11.378  14.451  1.00 38.85  ? 293  ASP A OD2 1 
ATOM   868  N N   . TYR A 1 125 ? -40.614 6.325   14.324  1.00 24.15  ? 294  TYR A N   1 
ATOM   869  C CA  . TYR A 1 125 ? -40.230 5.046   14.932  1.00 24.19  ? 294  TYR A CA  1 
ATOM   870  C C   . TYR A 1 125 ? -39.033 4.396   14.248  1.00 27.78  ? 294  TYR A C   1 
ATOM   871  O O   . TYR A 1 125 ? -38.153 3.859   14.917  1.00 27.78  ? 294  TYR A O   1 
ATOM   872  C CB  . TYR A 1 125 ? -41.410 4.103   14.863  1.00 23.42  ? 294  TYR A CB  1 
ATOM   873  C CG  . TYR A 1 125 ? -41.225 2.769   15.498  1.00 27.91  ? 294  TYR A CG  1 
ATOM   874  C CD1 . TYR A 1 125 ? -41.139 2.634   16.892  1.00 27.62  ? 294  TYR A CD1 1 
ATOM   875  C CD2 . TYR A 1 125 ? -41.186 1.624   14.728  1.00 27.41  ? 294  TYR A CD2 1 
ATOM   876  C CE1 . TYR A 1 125 ? -40.979 1.390   17.465  1.00 25.63  ? 294  TYR A CE1 1 
ATOM   877  C CE2 . TYR A 1 125 ? -41.036 0.387   15.299  1.00 28.55  ? 294  TYR A CE2 1 
ATOM   878  C CZ  . TYR A 1 125 ? -40.950 0.277   16.672  1.00 27.65  ? 294  TYR A CZ  1 
ATOM   879  O OH  . TYR A 1 125 ? -40.831 -0.973  17.221  1.00 25.75  ? 294  TYR A OH  1 
ATOM   880  N N   . LEU A 1 126 ? -39.016 4.429   12.918  1.00 24.64  ? 295  LEU A N   1 
ATOM   881  C CA  . LEU A 1 126 ? -37.926 3.811   12.157  1.00 29.18  ? 295  LEU A CA  1 
ATOM   882  C C   . LEU A 1 126 ? -36.609 4.531   12.382  1.00 28.58  ? 295  LEU A C   1 
ATOM   883  O O   . LEU A 1 126 ? -35.529 3.988   12.133  1.00 25.11  ? 295  LEU A O   1 
ATOM   884  C CB  . LEU A 1 126 ? -38.215 3.817   10.647  1.00 27.62  ? 295  LEU A CB  1 
ATOM   885  C CG  . LEU A 1 126 ? -39.374 2.972   10.163  1.00 28.42  ? 295  LEU A CG  1 
ATOM   886  C CD1 . LEU A 1 126 ? -39.553 3.182   8.676   1.00 27.51  ? 295  LEU A CD1 1 
ATOM   887  C CD2 . LEU A 1 126 ? -39.131 1.504   10.481  1.00 29.21  ? 295  LEU A CD2 1 
ATOM   888  N N   . GLN A 1 127 ? -36.677 5.766   12.833  1.00 33.75  ? 296  GLN A N   1 
ATOM   889  C CA  . GLN A 1 127 ? -35.447 6.500   13.016  1.00 40.43  ? 296  GLN A CA  1 
ATOM   890  C C   . GLN A 1 127 ? -34.455 6.042   14.075  1.00 44.15  ? 296  GLN A C   1 
ATOM   891  O O   . GLN A 1 127 ? -33.253 5.961   13.776  1.00 52.92  ? 296  GLN A O   1 
ATOM   892  C CB  . GLN A 1 127 ? -35.698 7.981   13.086  1.00 39.16  ? 296  GLN A CB  1 
ATOM   893  C CG  . GLN A 1 127 ? -35.224 8.516   11.752  1.00 51.54  ? 296  GLN A CG  1 
ATOM   894  C CD  . GLN A 1 127 ? -35.975 9.689   11.346  1.00 45.51  ? 296  GLN A CD  1 
ATOM   895  O OE1 . GLN A 1 127 ? -35.461 10.796  11.382  1.00 62.49  ? 296  GLN A OE1 1 
ATOM   896  N NE2 . GLN A 1 127 ? -37.217 9.476   10.975  1.00 53.76  ? 296  GLN A NE2 1 
ATOM   897  N N   . LEU A 1 128 ? -34.919 5.721   15.268  1.00 42.58  ? 297  LEU A N   1 
ATOM   898  C CA  . LEU A 1 128 ? -34.005 5.125   16.243  1.00 66.19  ? 297  LEU A CA  1 
ATOM   899  C C   . LEU A 1 128 ? -34.418 3.709   16.707  1.00 56.75  ? 297  LEU A C   1 
ATOM   900  O O   . LEU A 1 128 ? -34.052 3.295   17.783  1.00 61.23  ? 297  LEU A O   1 
ATOM   901  C CB  . LEU A 1 128 ? -33.748 6.080   17.439  1.00 82.72  ? 297  LEU A CB  1 
ATOM   902  C CG  . LEU A 1 128 ? -32.958 7.397   17.239  1.00 85.24  ? 297  LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 128 ? -32.847 8.100   18.588  1.00 90.82  ? 297  LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 128 ? -31.564 7.220   16.623  1.00 67.55  ? 297  LEU A CD2 1 
ATOM   905  N N   . THR A 1 129 ? -35.148 2.960   15.888  1.00 39.81  ? 298  THR A N   1 
ATOM   906  C CA  . THR A 1 129 ? -35.304 1.538   16.117  1.00 37.85  ? 298  THR A CA  1 
ATOM   907  C C   . THR A 1 129 ? -35.022 0.732   14.860  1.00 30.14  ? 298  THR A C   1 
ATOM   908  O O   . THR A 1 129 ? -35.480 1.095   13.773  1.00 33.30  ? 298  THR A O   1 
ATOM   909  C CB  . THR A 1 129 ? -36.759 1.212   16.487  1.00 40.92  ? 298  THR A CB  1 
ATOM   910  O OG1 . THR A 1 129 ? -37.194 2.105   17.503  1.00 52.98  ? 298  THR A OG1 1 
ATOM   911  C CG2 . THR A 1 129 ? -36.881 -0.191  16.943  1.00 37.27  ? 298  THR A CG2 1 
ATOM   912  N N   . THR A 1 130 ? -34.306 -0.371  15.030  1.00 27.97  ? 299  THR A N   1 
ATOM   913  C CA  . THR A 1 130 ? -34.168 -1.401  14.025  1.00 30.20  ? 299  THR A CA  1 
ATOM   914  C C   . THR A 1 130 ? -35.132 -2.517  14.409  1.00 32.09  ? 299  THR A C   1 
ATOM   915  O O   . THR A 1 130 ? -35.593 -2.550  15.537  1.00 32.07  ? 299  THR A O   1 
ATOM   916  C CB  . THR A 1 130 ? -32.724 -1.908  13.901  1.00 31.97  ? 299  THR A CB  1 
ATOM   917  O OG1 . THR A 1 130 ? -32.277 -2.428  15.138  1.00 33.65  ? 299  THR A OG1 1 
ATOM   918  C CG2 . THR A 1 130 ? -31.778 -0.776  13.513  1.00 34.68  ? 299  THR A CG2 1 
ATOM   919  N N   . LEU A 1 131 ? -35.448 -3.394  13.452  1.00 26.95  ? 300  LEU A N   1 
ATOM   920  C CA  . LEU A 1 131 ? -36.579 -4.310  13.516  1.00 26.18  ? 300  LEU A CA  1 
ATOM   921  C C   . LEU A 1 131 ? -36.092 -5.748  13.429  1.00 25.32  ? 300  LEU A C   1 
ATOM   922  O O   . LEU A 1 131 ? -35.173 -6.027  12.685  1.00 28.25  ? 300  LEU A O   1 
ATOM   923  C CB  . LEU A 1 131 ? -37.524 -4.041  12.332  1.00 25.90  ? 300  LEU A CB  1 
ATOM   924  C CG  . LEU A 1 131 ? -38.045 -2.599  12.100  1.00 25.78  ? 300  LEU A CG  1 
ATOM   925  C CD1 . LEU A 1 131 ? -38.926 -2.509  10.847  1.00 26.62  ? 300  LEU A CD1 1 
ATOM   926  C CD2 . LEU A 1 131 ? -38.821 -2.068  13.300  1.00 26.39  ? 300  LEU A CD2 1 
ATOM   927  N N   . ASP A 1 132 ? -36.706 -6.663  14.185  1.00 24.64  ? 301  ASP A N   1 
ATOM   928  C CA  . ASP A 1 132 ? -36.503 -8.092  13.933  1.00 24.28  ? 301  ASP A CA  1 
ATOM   929  C C   . ASP A 1 132 ? -37.386 -8.487  12.736  1.00 28.64  ? 301  ASP A C   1 
ATOM   930  O O   . ASP A 1 132 ? -38.049 -7.629  12.127  1.00 25.63  ? 301  ASP A O   1 
ATOM   931  C CB  . ASP A 1 132 ? -36.691 -8.979  15.177  1.00 24.33  ? 301  ASP A CB  1 
ATOM   932  C CG  . ASP A 1 132 ? -38.086 -8.947  15.747  1.00 29.32  ? 301  ASP A CG  1 
ATOM   933  O OD1 . ASP A 1 132 ? -38.939 -8.183  15.232  1.00 29.69  ? 301  ASP A OD1 1 
ATOM   934  O OD2 . ASP A 1 132 ? -38.311 -9.695  16.733  1.00 29.23  ? 301  ASP A OD2 1 
ATOM   935  N N   . THR A 1 133 ? -37.339 -9.750  12.347  1.00 28.23  ? 302  THR A N   1 
ATOM   936  C CA  . THR A 1 133 ? -38.058 -10.201 11.167  1.00 28.77  ? 302  THR A CA  1 
ATOM   937  C C   . THR A 1 133 ? -39.581 -10.164 11.396  1.00 29.51  ? 302  THR A C   1 
ATOM   938  O O   . THR A 1 133 ? -40.368 -9.636  10.586  1.00 28.88  ? 302  THR A O   1 
ATOM   939  C CB  . THR A 1 133 ? -37.566 -11.585 10.790  1.00 28.29  ? 302  THR A CB  1 
ATOM   940  O OG1 . THR A 1 133 ? -36.161 -11.480 10.570  1.00 31.12  ? 302  THR A OG1 1 
ATOM   941  C CG2 . THR A 1 133 ? -38.254 -12.084 9.529   1.00 29.80  ? 302  THR A CG2 1 
ATOM   942  N N   . VAL A 1 134 ? -39.976 -10.676 12.537  1.00 27.08  ? 303  VAL A N   1 
ATOM   943  C CA  . VAL A 1 134 ? -41.378 -10.650 12.959  1.00 30.82  ? 303  VAL A CA  1 
ATOM   944  C C   . VAL A 1 134 ? -41.974 -9.229  12.844  1.00 27.26  ? 303  VAL A C   1 
ATOM   945  O O   . VAL A 1 134 ? -43.074 -9.066  12.318  1.00 25.06  ? 303  VAL A O   1 
ATOM   946  C CB  . VAL A 1 134 ? -41.501 -11.158 14.439  1.00 34.93  ? 303  VAL A CB  1 
ATOM   947  C CG1 . VAL A 1 134 ? -42.947 -11.125 14.935  1.00 34.57  ? 303  VAL A CG1 1 
ATOM   948  C CG2 . VAL A 1 134 ? -40.908 -12.572 14.577  1.00 35.24  ? 303  VAL A CG2 1 
ATOM   949  N N   . SER A 1 135 ? -41.252 -8.220  13.350  1.00 24.19  ? 304  SER A N   1 
ATOM   950  C CA  . SER A 1 135 ? -41.772 -6.859  13.419  1.00 25.02  ? 304  SER A CA  1 
ATOM   951  C C   . SER A 1 135 ? -41.799 -6.208  12.068  1.00 22.52  ? 304  SER A C   1 
ATOM   952  O O   . SER A 1 135 ? -42.748 -5.515  11.732  1.00 24.49  ? 304  SER A O   1 
ATOM   953  C CB  . SER A 1 135 ? -40.957 -5.971  14.365  1.00 26.18  ? 304  SER A CB  1 
ATOM   954  O OG  . SER A 1 135 ? -40.942 -6.537  15.668  1.00 35.03  ? 304  SER A OG  1 
ATOM   955  N N   . CYS A 1 136 ? -40.730 -6.359  11.299  1.00 25.30  ? 305  CYS A N   1 
ATOM   956  C CA  . CYS A 1 136 ? -40.769 -5.922  9.916   1.00 23.34  ? 305  CYS A CA  1 
ATOM   957  C C   . CYS A 1 136 ? -42.025 -6.435  9.196   1.00 22.82  ? 305  CYS A C   1 
ATOM   958  O O   . CYS A 1 136 ? -42.777 -5.653  8.632   1.00 23.41  ? 305  CYS A O   1 
ATOM   959  C CB  . CYS A 1 136 ? -39.546 -6.422  9.181   1.00 25.82  ? 305  CYS A CB  1 
ATOM   960  S SG  . CYS A 1 136 ? -39.567 -5.914  7.464   1.00 26.80  ? 305  CYS A SG  1 
ATOM   961  N N   . LEU A 1 137 ? -42.252 -7.744  9.231   1.00 23.34  ? 306  LEU A N   1 
ATOM   962  C CA  . LEU A 1 137 ? -43.392 -8.330  8.521   1.00 25.71  ? 306  LEU A CA  1 
ATOM   963  C C   . LEU A 1 137 ? -44.736 -7.860  9.076   1.00 27.40  ? 306  LEU A C   1 
ATOM   964  O O   . LEU A 1 137 ? -45.690 -7.603  8.319   1.00 25.30  ? 306  LEU A O   1 
ATOM   965  C CB  . LEU A 1 137 ? -43.299 -9.856  8.489   1.00 25.10  ? 306  LEU A CB  1 
ATOM   966  C CG  . LEU A 1 137 ? -42.159 -10.354 7.590   1.00 30.54  ? 306  LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 137 ? -41.877 -11.855 7.730   1.00 31.51  ? 306  LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 137 ? -42.444 -10.012 6.129   1.00 34.33  ? 306  LEU A CD2 1 
ATOM   969  N N   . ARG A 1 138 ? -44.812 -7.712  10.391  1.00 24.94  ? 307  ARG A N   1 
ATOM   970  C CA  . ARG A 1 138 ? -46.035 -7.278  10.994  1.00 26.76  ? 307  ARG A CA  1 
ATOM   971  C C   . ARG A 1 138 ? -46.364 -5.871  10.534  1.00 24.71  ? 307  ARG A C   1 
ATOM   972  O O   . ARG A 1 138 ? -47.515 -5.552  10.233  1.00 22.72  ? 307  ARG A O   1 
ATOM   973  C CB  . ARG A 1 138 ? -45.922 -7.340  12.513  1.00 32.05  ? 307  ARG A CB  1 
ATOM   974  C CG  . ARG A 1 138 ? -47.208 -7.083  13.252  1.00 33.95  ? 307  ARG A CG  1 
ATOM   975  C CD  . ARG A 1 138 ? -46.964 -7.173  14.763  1.00 40.51  ? 307  ARG A CD  1 
ATOM   976  N NE  . ARG A 1 138 ? -46.928 -8.562  15.204  1.00 42.54  ? 307  ARG A NE  1 
ATOM   977  C CZ  . ARG A 1 138 ? -46.216 -9.053  16.225  1.00 56.39  ? 307  ARG A CZ  1 
ATOM   978  N NH1 . ARG A 1 138 ? -45.440 -8.278  16.972  1.00 66.19  ? 307  ARG A NH1 1 
ATOM   979  N NH2 . ARG A 1 138 ? -46.290 -10.347 16.510  1.00 49.43  ? 307  ARG A NH2 1 
ATOM   980  N N   . ILE A 1 139 ? -45.353 -5.029  10.489  1.00 21.78  ? 308  ILE A N   1 
ATOM   981  C CA  . ILE A 1 139 ? -45.548 -3.675  10.050  1.00 22.88  ? 308  ILE A CA  1 
ATOM   982  C C   . ILE A 1 139 ? -46.077 -3.644  8.611   1.00 22.87  ? 308  ILE A C   1 
ATOM   983  O O   . ILE A 1 139 ? -47.157 -3.113  8.353   1.00 23.19  ? 308  ILE A O   1 
ATOM   984  C CB  . ILE A 1 139 ? -44.272 -2.843  10.219  1.00 25.10  ? 308  ILE A CB  1 
ATOM   985  C CG1 . ILE A 1 139 ? -44.034 -2.579  11.715  1.00 22.30  ? 308  ILE A CG1 1 
ATOM   986  C CG2 . ILE A 1 139 ? -44.363 -1.508  9.456   1.00 25.34  ? 308  ILE A CG2 1 
ATOM   987  C CD1 . ILE A 1 139 ? -42.709 -1.924  12.010  1.00 23.62  ? 308  ILE A CD1 1 
ATOM   988  N N   . VAL A 1 140 ? -45.379 -4.288  7.691   1.00 22.64  ? 309  VAL A N   1 
ATOM   989  C CA  . VAL A 1 140 ? -45.741 -4.115  6.294   1.00 23.09  ? 309  VAL A CA  1 
ATOM   990  C C   . VAL A 1 140 ? -47.048 -4.842  5.955   1.00 22.35  ? 309  VAL A C   1 
ATOM   991  O O   . VAL A 1 140 ? -47.852 -4.323  5.190   1.00 22.73  ? 309  VAL A O   1 
ATOM   992  C CB  . VAL A 1 140 ? -44.571 -4.478  5.336   1.00 24.15  ? 309  VAL A CB  1 
ATOM   993  C CG1 . VAL A 1 140 ? -43.388 -3.593  5.613   1.00 21.73  ? 309  VAL A CG1 1 
ATOM   994  C CG2 . VAL A 1 140 ? -44.170 -5.911  5.484   1.00 25.59  ? 309  VAL A CG2 1 
ATOM   995  N N   . LEU A 1 141 ? -47.279 -6.025  6.532   1.00 21.33  ? 310  LEU A N   1 
ATOM   996  C CA  . LEU A 1 141 ? -48.588 -6.687  6.383   1.00 21.72  ? 310  LEU A CA  1 
ATOM   997  C C   . LEU A 1 141 ? -49.729 -5.813  6.863   1.00 22.48  ? 310  LEU A C   1 
ATOM   998  O O   . LEU A 1 141 ? -50.788 -5.723  6.202   1.00 21.16  ? 310  LEU A O   1 
ATOM   999  C CB  . LEU A 1 141 ? -48.626 -8.013  7.150   1.00 23.62  ? 310  LEU A CB  1 
ATOM   1000 C CG  . LEU A 1 141 ? -49.921 -8.832  7.103   1.00 24.66  ? 310  LEU A CG  1 
ATOM   1001 C CD1 . LEU A 1 141 ? -50.417 -9.106  5.697   1.00 26.71  ? 310  LEU A CD1 1 
ATOM   1002 C CD2 . LEU A 1 141 ? -49.720 -10.156 7.820   1.00 23.97  ? 310  LEU A CD2 1 
ATOM   1003 N N   . SER A 1 142 ? -49.539 -5.164  8.018   1.00 20.10  ? 311  SER A N   1 
ATOM   1004 C CA  . SER A 1 142 ? -50.622 -4.332  8.569   1.00 20.44  ? 311  SER A CA  1 
ATOM   1005 C C   . SER A 1 142 ? -50.913 -3.144  7.657   1.00 19.60  ? 311  SER A C   1 
ATOM   1006 O O   . SER A 1 142 ? -52.064 -2.788  7.448   1.00 22.78  ? 311  SER A O   1 
ATOM   1007 C CB  . SER A 1 142 ? -50.342 -3.902  10.033  1.00 20.81  ? 311  SER A CB  1 
ATOM   1008 O OG  . SER A 1 142 ? -49.316 -2.953  10.136  1.00 19.98  ? 311  SER A OG  1 
ATOM   1009 N N   . ILE A 1 143 ? -49.880 -2.540  7.073   1.00 19.53  ? 312  ILE A N   1 
ATOM   1010 C CA  . ILE A 1 143 ? -50.128 -1.403  6.171   1.00 20.53  ? 312  ILE A CA  1 
ATOM   1011 C C   . ILE A 1 143 ? -50.907 -1.867  4.940   1.00 20.86  ? 312  ILE A C   1 
ATOM   1012 O O   . ILE A 1 143 ? -51.865 -1.232  4.531   1.00 23.62  ? 312  ILE A O   1 
ATOM   1013 C CB  . ILE A 1 143 ? -48.818 -0.722  5.786   1.00 21.78  ? 312  ILE A CB  1 
ATOM   1014 C CG1 . ILE A 1 143 ? -48.176 -0.128  7.029   1.00 22.06  ? 312  ILE A CG1 1 
ATOM   1015 C CG2 . ILE A 1 143 ? -49.070 0.407   4.812   1.00 22.13  ? 312  ILE A CG2 1 
ATOM   1016 C CD1 . ILE A 1 143 ? -46.691 0.133   6.890   1.00 26.17  ? 312  ILE A CD1 1 
ATOM   1017 N N   . ALA A 1 144 ? -50.508 -3.008  4.389   1.00 20.27  ? 313  ALA A N   1 
ATOM   1018 C CA  . ALA A 1 144 ? -51.179 -3.603  3.234   1.00 23.24  ? 313  ALA A CA  1 
ATOM   1019 C C   . ALA A 1 144 ? -52.637 -3.941  3.519   1.00 23.84  ? 313  ALA A C   1 
ATOM   1020 O O   . ALA A 1 144 ? -53.508 -3.754  2.640   1.00 21.33  ? 313  ALA A O   1 
ATOM   1021 C CB  . ALA A 1 144 ? -50.448 -4.870  2.788   1.00 26.04  ? 313  ALA A CB  1 
ATOM   1022 N N   A SER A 1 145 ? -52.903 -4.454  4.727   0.50 21.69  ? 314  SER A N   1 
ATOM   1023 N N   B SER A 1 145 ? -52.914 -4.452  4.721   0.50 22.59  ? 314  SER A N   1 
ATOM   1024 C CA  A SER A 1 145 ? -54.258 -4.806  5.134   0.50 21.55  ? 314  SER A CA  1 
ATOM   1025 C CA  B SER A 1 145 ? -54.278 -4.807  5.087   0.50 23.18  ? 314  SER A CA  1 
ATOM   1026 C C   A SER A 1 145 ? -55.146 -3.565  5.170   0.50 22.26  ? 314  SER A C   1 
ATOM   1027 C C   B SER A 1 145 ? -55.158 -3.560  5.169   0.50 23.21  ? 314  SER A C   1 
ATOM   1028 O O   A SER A 1 145 ? -56.284 -3.587  4.699   0.50 21.45  ? 314  SER A O   1 
ATOM   1029 O O   B SER A 1 145 ? -56.302 -3.569  4.715   0.50 22.38  ? 314  SER A O   1 
ATOM   1030 C CB  A SER A 1 145 ? -54.253 -5.471  6.513   0.50 22.13  ? 314  SER A CB  1 
ATOM   1031 C CB  B SER A 1 145 ? -54.294 -5.570  6.410   0.50 25.23  ? 314  SER A CB  1 
ATOM   1032 O OG  A SER A 1 145 ? -55.526 -6.007  6.821   0.50 20.70  ? 314  SER A OG  1 
ATOM   1033 O OG  B SER A 1 145 ? -53.489 -6.729  6.300   0.50 25.71  ? 314  SER A OG  1 
ATOM   1034 N N   . GLY A 1 146 ? -54.594 -2.480  5.709   1.00 23.19  ? 315  GLY A N   1 
ATOM   1035 C CA  . GLY A 1 146 ? -55.297 -1.214  5.808   1.00 22.19  ? 315  GLY A CA  1 
ATOM   1036 C C   . GLY A 1 146 ? -55.562 -0.628  4.447   1.00 24.37  ? 315  GLY A C   1 
ATOM   1037 O O   . GLY A 1 146 ? -56.647 -0.107  4.200   1.00 20.39  ? 315  GLY A O   1 
ATOM   1038 N N   . LEU A 1 147 ? -54.554 -0.694  3.573   1.00 20.92  ? 316  LEU A N   1 
ATOM   1039 C CA  . LEU A 1 147 ? -54.679 -0.092  2.261   1.00 20.68  ? 316  LEU A CA  1 
ATOM   1040 C C   . LEU A 1 147 ? -55.655 -0.935  1.406   1.00 19.67  ? 316  LEU A C   1 
ATOM   1041 O O   . LEU A 1 147 ? -56.455 -0.395  0.668   1.00 21.39  ? 316  LEU A O   1 
ATOM   1042 C CB  . LEU A 1 147 ? -53.306 0.004   1.592   1.00 20.68  ? 316  LEU A CB  1 
ATOM   1043 C CG  . LEU A 1 147 ? -53.229 0.720   0.253   1.00 23.59  ? 316  LEU A CG  1 
ATOM   1044 C CD1 . LEU A 1 147 ? -53.645 2.168   0.380   1.00 23.21  ? 316  LEU A CD1 1 
ATOM   1045 C CD2 . LEU A 1 147 ? -51.799 0.605   -0.274  1.00 25.39  ? 316  LEU A CD2 1 
ATOM   1046 N N   . ALA A 1 148 ? -55.588 -2.247  1.503   1.00 18.46  ? 317  ALA A N   1 
ATOM   1047 C CA  . ALA A 1 148 ? -56.560 -3.077  0.790   1.00 20.72  ? 317  ALA A CA  1 
ATOM   1048 C C   . ALA A 1 148 ? -57.969 -2.789  1.280   1.00 23.82  ? 317  ALA A C   1 
ATOM   1049 O O   . ALA A 1 148 ? -58.876 -2.695  0.476   1.00 22.19  ? 317  ALA A O   1 
ATOM   1050 C CB  . ALA A 1 148 ? -56.247 -4.533  0.953   1.00 20.51  ? 317  ALA A CB  1 
ATOM   1051 N N   . HIS A 1 149 ? -58.144 -2.618  2.598   1.00 23.62  ? 318  HIS A N   1 
ATOM   1052 C CA  . HIS A 1 149 ? -59.464 -2.290  3.118   1.00 24.09  ? 318  HIS A CA  1 
ATOM   1053 C C   . HIS A 1 149 ? -59.959 -0.938  2.601   1.00 22.17  ? 318  HIS A C   1 
ATOM   1054 O O   . HIS A 1 149 ? -61.117 -0.805  2.263   1.00 23.74  ? 318  HIS A O   1 
ATOM   1055 C CB  . HIS A 1 149 ? -59.506 -2.294  4.643   1.00 24.93  ? 318  HIS A CB  1 
ATOM   1056 C CG  . HIS A 1 149 ? -60.887 -2.303  5.170   1.00 23.63  ? 318  HIS A CG  1 
ATOM   1057 N ND1 . HIS A 1 149 ? -61.692 -3.415  5.084   1.00 25.34  ? 318  HIS A ND1 1 
ATOM   1058 C CD2 . HIS A 1 149 ? -61.630 -1.337  5.758   1.00 22.86  ? 318  HIS A CD2 1 
ATOM   1059 C CE1 . HIS A 1 149 ? -62.866 -3.144  5.622   1.00 25.31  ? 318  HIS A CE1 1 
ATOM   1060 N NE2 . HIS A 1 149 ? -62.860 -1.885  6.020   1.00 26.05  ? 318  HIS A NE2 1 
ATOM   1061 N N   . LEU A 1 150 ? -59.091 0.060   2.546   1.00 23.78  ? 319  LEU A N   1 
ATOM   1062 C CA  . LEU A 1 150 ? -59.451 1.338   1.922   1.00 23.00  ? 319  LEU A CA  1 
ATOM   1063 C C   . LEU A 1 150 ? -59.881 1.109   0.463   1.00 25.43  ? 319  LEU A C   1 
ATOM   1064 O O   . LEU A 1 150 ? -60.954 1.551   0.032   1.00 22.68  ? 319  LEU A O   1 
ATOM   1065 C CB  . LEU A 1 150 ? -58.264 2.308   1.961   1.00 21.90  ? 319  LEU A CB  1 
ATOM   1066 C CG  . LEU A 1 150 ? -57.993 2.957   3.310   1.00 23.07  ? 319  LEU A CG  1 
ATOM   1067 C CD1 . LEU A 1 150 ? -56.687 3.715   3.276   1.00 24.43  ? 319  LEU A CD1 1 
ATOM   1068 C CD2 . LEU A 1 150 ? -59.147 3.887   3.704   1.00 22.32  ? 319  LEU A CD2 1 
ATOM   1069 N N   . HIS A 1 151 ? -59.032 0.412   -0.286  1.00 24.05  ? 320  HIS A N   1 
ATOM   1070 C CA  . HIS A 1 151 ? -59.201 0.269   -1.744  1.00 24.93  ? 320  HIS A CA  1 
ATOM   1071 C C   . HIS A 1 151 ? -60.406 -0.529  -2.209  1.00 24.78  ? 320  HIS A C   1 
ATOM   1072 O O   . HIS A 1 151 ? -60.906 -0.295  -3.309  1.00 26.79  ? 320  HIS A O   1 
ATOM   1073 C CB  . HIS A 1 151 ? -57.949 -0.359  -2.350  1.00 23.59  ? 320  HIS A CB  1 
ATOM   1074 C CG  . HIS A 1 151 ? -56.830 0.604   -2.515  1.00 21.14  ? 320  HIS A CG  1 
ATOM   1075 N ND1 . HIS A 1 151 ? -55.680 0.284   -3.191  1.00 22.03  ? 320  HIS A ND1 1 
ATOM   1076 C CD2 . HIS A 1 151 ? -56.681 1.881   -2.089  1.00 21.43  ? 320  HIS A CD2 1 
ATOM   1077 C CE1 . HIS A 1 151 ? -54.872 1.332   -3.198  1.00 25.12  ? 320  HIS A CE1 1 
ATOM   1078 N NE2 . HIS A 1 151 ? -55.462 2.318   -2.545  1.00 24.91  ? 320  HIS A NE2 1 
ATOM   1079 N N   . ILE A 1 152 ? -60.875 -1.448  -1.379  1.00 25.97  ? 321  ILE A N   1 
ATOM   1080 C CA  A ILE A 1 152 ? -61.931 -2.387  -1.784  0.50 23.97  ? 321  ILE A CA  1 
ATOM   1081 C CA  B ILE A 1 152 ? -61.922 -2.393  -1.771  0.50 24.75  ? 321  ILE A CA  1 
ATOM   1082 C C   . ILE A 1 152 ? -63.322 -1.803  -1.596  1.00 26.52  ? 321  ILE A C   1 
ATOM   1083 O O   . ILE A 1 152 ? -63.629 -1.187  -0.563  1.00 24.67  ? 321  ILE A O   1 
ATOM   1084 C CB  A ILE A 1 152 ? -61.828 -3.706  -1.005  0.50 26.73  ? 321  ILE A CB  1 
ATOM   1085 C CB  B ILE A 1 152 ? -61.776 -3.698  -0.964  0.50 29.27  ? 321  ILE A CB  1 
ATOM   1086 C CG1 A ILE A 1 152 ? -60.587 -4.480  -1.447  0.50 27.18  ? 321  ILE A CG1 1 
ATOM   1087 C CG1 B ILE A 1 152 ? -62.479 -4.859  -1.673  0.50 33.83  ? 321  ILE A CG1 1 
ATOM   1088 C CG2 A ILE A 1 152 ? -63.043 -4.584  -1.251  0.50 29.44  ? 321  ILE A CG2 1 
ATOM   1089 C CG2 B ILE A 1 152 ? -62.264 -3.530  0.474   0.50 29.94  ? 321  ILE A CG2 1 
ATOM   1090 C CD1 A ILE A 1 152 ? -60.270 -5.692  -0.604  0.50 24.74  ? 321  ILE A CD1 1 
ATOM   1091 C CD1 B ILE A 1 152 ? -62.565 -6.117  -0.832  0.50 36.37  ? 321  ILE A CD1 1 
ATOM   1092 N N   . GLU A 1 153 ? -64.175 -1.973  -2.600  1.00 27.50  ? 322  GLU A N   1 
ATOM   1093 C CA  . GLU A 1 153 ? -65.561 -1.554  -2.484  1.00 25.59  ? 322  GLU A CA  1 
ATOM   1094 C C   . GLU A 1 153 ? -66.364 -2.742  -1.963  1.00 24.61  ? 322  GLU A C   1 
ATOM   1095 O O   . GLU A 1 153 ? -66.269 -3.820  -2.494  1.00 26.01  ? 322  GLU A O   1 
ATOM   1096 C CB  . GLU A 1 153 ? -66.122 -1.116  -3.826  1.00 28.98  ? 322  GLU A CB  1 
ATOM   1097 C CG  . GLU A 1 153 ? -67.581 -0.698  -3.707  1.00 32.36  ? 322  GLU A CG  1 
ATOM   1098 C CD  . GLU A 1 153 ? -68.124 0.016   -4.937  1.00 36.61  ? 322  GLU A CD  1 
ATOM   1099 O OE1 . GLU A 1 153 ? -67.438 0.008   -5.996  1.00 33.83  ? 322  GLU A OE1 1 
ATOM   1100 O OE2 . GLU A 1 153 ? -69.257 0.566   -4.824  1.00 39.36  ? 322  GLU A OE2 1 
ATOM   1101 N N   . ILE A 1 154 ? -67.160 -2.530  -0.926  1.00 24.69  ? 323  ILE A N   1 
ATOM   1102 C CA  . ILE A 1 154 ? -67.984 -3.572  -0.336  1.00 27.23  ? 323  ILE A CA  1 
ATOM   1103 C C   . ILE A 1 154 ? -69.404 -3.091  -0.527  1.00 29.89  ? 323  ILE A C   1 
ATOM   1104 O O   . ILE A 1 154 ? -69.733 -1.948  -0.177  1.00 27.99  ? 323  ILE A O   1 
ATOM   1105 C CB  . ILE A 1 154 ? -67.648 -3.805  1.153   1.00 29.28  ? 323  ILE A CB  1 
ATOM   1106 C CG1 . ILE A 1 154 ? -66.134 -4.067  1.321   1.00 29.80  ? 323  ILE A CG1 1 
ATOM   1107 C CG2 . ILE A 1 154 ? -68.444 -4.982  1.717   1.00 31.29  ? 323  ILE A CG2 1 
ATOM   1108 C CD1 . ILE A 1 154 ? -65.694 -4.428  2.729   1.00 33.00  ? 323  ILE A CD1 1 
ATOM   1109 N N   . PHE A 1 155 ? -70.218 -3.946  -1.145  1.00 28.45  ? 324  PHE A N   1 
ATOM   1110 C CA  . PHE A 1 155 ? -71.614 -3.639  -1.427  1.00 33.07  ? 324  PHE A CA  1 
ATOM   1111 C C   . PHE A 1 155 ? -72.509 -4.163  -0.310  1.00 31.77  ? 324  PHE A C   1 
ATOM   1112 O O   . PHE A 1 155 ? -72.132 -5.081  0.427   1.00 35.03  ? 324  PHE A O   1 
ATOM   1113 C CB  . PHE A 1 155 ? -72.027 -4.271  -2.765  1.00 31.55  ? 324  PHE A CB  1 
ATOM   1114 C CG  . PHE A 1 155 ? -71.182 -3.817  -3.903  1.00 31.79  ? 324  PHE A CG  1 
ATOM   1115 C CD1 . PHE A 1 155 ? -71.481 -2.656  -4.567  1.00 31.71  ? 324  PHE A CD1 1 
ATOM   1116 C CD2 . PHE A 1 155 ? -70.059 -4.525  -4.272  1.00 29.14  ? 324  PHE A CD2 1 
ATOM   1117 C CE1 . PHE A 1 155 ? -70.677 -2.201  -5.585  1.00 28.37  ? 324  PHE A CE1 1 
ATOM   1118 C CE2 . PHE A 1 155 ? -69.257 -4.083  -5.295  1.00 30.95  ? 324  PHE A CE2 1 
ATOM   1119 C CZ  . PHE A 1 155 ? -69.567 -2.916  -5.957  1.00 28.69  ? 324  PHE A CZ  1 
ATOM   1120 N N   . GLY A 1 156 ? -73.717 -3.611  -0.224  1.00 42.08  ? 325  GLY A N   1 
ATOM   1121 C CA  . GLY A 1 156 ? -74.683 -4.068  0.763   1.00 47.05  ? 325  GLY A CA  1 
ATOM   1122 C C   . GLY A 1 156 ? -74.709 -3.124  1.945   1.00 62.79  ? 325  GLY A C   1 
ATOM   1123 O O   . GLY A 1 156 ? -74.042 -2.075  1.944   1.00 53.30  ? 325  GLY A O   1 
ATOM   1124 N N   . THR A 1 157 ? -75.465 -3.504  2.967   1.00 64.63  ? 326  THR A N   1 
ATOM   1125 C CA  . THR A 1 157 ? -75.827 -2.563  4.024   1.00 71.30  ? 326  THR A CA  1 
ATOM   1126 C C   . THR A 1 157 ? -74.649 -2.318  4.961   1.00 65.70  ? 326  THR A C   1 
ATOM   1127 O O   . THR A 1 157 ? -74.547 -1.238  5.550   1.00 62.53  ? 326  THR A O   1 
ATOM   1128 C CB  . THR A 1 157 ? -77.080 -3.038  4.798   1.00 81.63  ? 326  THR A CB  1 
ATOM   1129 O OG1 . THR A 1 157 ? -76.862 -4.362  5.318   1.00 67.52  ? 326  THR A OG1 1 
ATOM   1130 C CG2 . THR A 1 157 ? -78.317 -3.033  3.862   1.00 73.42  ? 326  THR A CG2 1 
ATOM   1131 N N   . GLN A 1 158 ? -73.754 -3.307  5.055   1.00 47.69  ? 327  GLN A N   1 
ATOM   1132 C CA  . GLN A 1 158 ? -72.543 -3.189  5.857   1.00 56.53  ? 327  GLN A CA  1 
ATOM   1133 C C   . GLN A 1 158 ? -71.332 -2.807  4.972   1.00 52.81  ? 327  GLN A C   1 
ATOM   1134 O O   . GLN A 1 158 ? -70.186 -3.099  5.298   1.00 48.85  ? 327  GLN A O   1 
ATOM   1135 C CB  . GLN A 1 158 ? -72.286 -4.514  6.593   1.00 67.94  ? 327  GLN A CB  1 
ATOM   1136 N N   . GLY A 1 159 ? -71.588 -2.141  3.854   1.00 39.52  ? 328  GLY A N   1 
ATOM   1137 C CA  . GLY A 1 159 ? -70.554 -1.910  2.876   1.00 37.98  ? 328  GLY A CA  1 
ATOM   1138 C C   . GLY A 1 159 ? -69.810 -0.615  3.015   1.00 30.22  ? 328  GLY A C   1 
ATOM   1139 O O   . GLY A 1 159 ? -69.982 0.103   3.984   1.00 30.47  ? 328  GLY A O   1 
ATOM   1140 N N   . LYS A 1 160 ? -68.995 -0.319  2.006   1.00 26.58  ? 329  LYS A N   1 
ATOM   1141 C CA  . LYS A 1 160 ? -68.258 0.933   1.921   1.00 26.79  ? 329  LYS A CA  1 
ATOM   1142 C C   . LYS A 1 160 ? -67.861 1.218   0.475   1.00 29.13  ? 329  LYS A C   1 
ATOM   1143 O O   . LYS A 1 160 ? -67.555 0.309   -0.296  1.00 29.16  ? 329  LYS A O   1 
ATOM   1144 C CB  . LYS A 1 160 ? -66.983 0.860   2.801   1.00 28.03  ? 329  LYS A CB  1 
ATOM   1145 C CG  . LYS A 1 160 ? -66.042 -0.295  2.443   1.00 30.05  ? 329  LYS A CG  1 
ATOM   1146 C CD  . LYS A 1 160 ? -64.729 -0.292  3.220   1.00 27.69  ? 329  LYS A CD  1 
ATOM   1147 C CE  . LYS A 1 160 ? -63.749 0.792   2.762   1.00 32.35  ? 329  LYS A CE  1 
ATOM   1148 N NZ  . LYS A 1 160 ? -63.260 0.705   1.358   1.00 30.42  ? 329  LYS A NZ  1 
ATOM   1149 N N   . PRO A 1 161 ? -67.820 2.488   0.095   1.00 30.76  ? 330  PRO A N   1 
ATOM   1150 C CA  . PRO A 1 161 ? -67.170 2.742   -1.185  1.00 28.69  ? 330  PRO A CA  1 
ATOM   1151 C C   . PRO A 1 161 ? -65.667 2.484   -1.149  1.00 26.34  ? 330  PRO A C   1 
ATOM   1152 O O   . PRO A 1 161 ? -65.055 2.372   -0.071  1.00 26.39  ? 330  PRO A O   1 
ATOM   1153 C CB  . PRO A 1 161 ? -67.439 4.219   -1.419  1.00 30.45  ? 330  PRO A CB  1 
ATOM   1154 C CG  . PRO A 1 161 ? -67.559 4.766   -0.042  1.00 34.56  ? 330  PRO A CG  1 
ATOM   1155 C CD  . PRO A 1 161 ? -68.324 3.719   0.704   1.00 30.70  ? 330  PRO A CD  1 
ATOM   1156 N N   . ALA A 1 162 ? -65.096 2.352   -2.335  1.00 24.52  ? 331  ALA A N   1 
ATOM   1157 C CA  . ALA A 1 162 ? -63.675 2.221   -2.489  1.00 25.55  ? 331  ALA A CA  1 
ATOM   1158 C C   . ALA A 1 162 ? -63.066 3.582   -2.237  1.00 27.44  ? 331  ALA A C   1 
ATOM   1159 O O   . ALA A 1 162 ? -63.649 4.611   -2.597  1.00 25.68  ? 331  ALA A O   1 
ATOM   1160 C CB  . ALA A 1 162 ? -63.342 1.759   -3.879  1.00 28.53  ? 331  ALA A CB  1 
ATOM   1161 N N   . ILE A 1 163 ? -61.887 3.590   -1.631  1.00 23.40  ? 332  ILE A N   1 
ATOM   1162 C CA  . ILE A 1 163 ? -61.211 4.828   -1.290  1.00 22.28  ? 332  ILE A CA  1 
ATOM   1163 C C   . ILE A 1 163 ? -59.744 4.723   -1.660  1.00 22.06  ? 332  ILE A C   1 
ATOM   1164 O O   . ILE A 1 163 ? -59.086 3.722   -1.352  1.00 20.99  ? 332  ILE A O   1 
ATOM   1165 C CB  . ILE A 1 163 ? -61.317 5.097   0.231   1.00 23.07  ? 332  ILE A CB  1 
ATOM   1166 C CG1 . ILE A 1 163 ? -62.782 5.240   0.646   1.00 28.26  ? 332  ILE A CG1 1 
ATOM   1167 C CG2 . ILE A 1 163 ? -60.574 6.357   0.624   1.00 25.38  ? 332  ILE A CG2 1 
ATOM   1168 C CD1 . ILE A 1 163 ? -62.997 5.016   2.117   1.00 32.11  ? 332  ILE A CD1 1 
ATOM   1169 N N   . ALA A 1 164 ? -59.225 5.771   -2.271  1.00 21.47  ? 333  ALA A N   1 
ATOM   1170 C CA  . ALA A 1 164 ? -57.812 5.889   -2.543  1.00 23.36  ? 333  ALA A CA  1 
ATOM   1171 C C   . ALA A 1 164 ? -57.337 7.044   -1.695  1.00 25.23  ? 333  ALA A C   1 
ATOM   1172 O O   . ALA A 1 164 ? -57.999 8.083   -1.619  1.00 23.48  ? 333  ALA A O   1 
ATOM   1173 C CB  . ALA A 1 164 ? -57.573 6.205   -4.011  1.00 26.33  ? 333  ALA A CB  1 
ATOM   1174 N N   . HIS A 1 165 ? -56.175 6.871   -1.087  1.00 23.84  ? 334  HIS A N   1 
ATOM   1175 C CA  . HIS A 1 165 ? -55.674 7.781   -0.073  1.00 22.83  ? 334  HIS A CA  1 
ATOM   1176 C C   . HIS A 1 165 ? -55.057 9.073   -0.593  1.00 23.94  ? 334  HIS A C   1 
ATOM   1177 O O   . HIS A 1 165 ? -55.339 10.137  -0.059  1.00 24.71  ? 334  HIS A O   1 
ATOM   1178 C CB  . HIS A 1 165 ? -54.628 7.000   0.733   1.00 22.41  ? 334  HIS A CB  1 
ATOM   1179 C CG  . HIS A 1 165 ? -54.143 7.701   1.964   1.00 22.10  ? 334  HIS A CG  1 
ATOM   1180 N ND1 . HIS A 1 165 ? -53.345 8.816   1.922   1.00 22.78  ? 334  HIS A ND1 1 
ATOM   1181 C CD2 . HIS A 1 165 ? -54.337 7.436   3.269   1.00 21.26  ? 334  HIS A CD2 1 
ATOM   1182 C CE1 . HIS A 1 165 ? -53.036 9.194   3.143   1.00 24.22  ? 334  HIS A CE1 1 
ATOM   1183 N NE2 . HIS A 1 165 ? -53.648 8.385   3.980   1.00 25.36  ? 334  HIS A NE2 1 
ATOM   1184 N N   . ARG A 1 166 ? -54.128 8.950   -1.549  1.00 24.72  ? 335  ARG A N   1 
ATOM   1185 C CA  . ARG A 1 166 ? -53.488 10.061  -2.287  1.00 20.97  ? 335  ARG A CA  1 
ATOM   1186 C C   . ARG A 1 166 ? -52.366 10.792  -1.566  1.00 23.73  ? 335  ARG A C   1 
ATOM   1187 O O   . ARG A 1 166 ? -51.755 11.726  -2.110  1.00 20.14  ? 335  ARG A O   1 
ATOM   1188 C CB  . ARG A 1 166 ? -54.513 11.059  -2.762  1.00 23.86  ? 335  ARG A CB  1 
ATOM   1189 C CG  . ARG A 1 166 ? -55.546 10.416  -3.664  1.00 25.76  ? 335  ARG A CG  1 
ATOM   1190 C CD  . ARG A 1 166 ? -56.477 11.485  -4.145  1.00 28.14  ? 335  ARG A CD  1 
ATOM   1191 N NE  . ARG A 1 166 ? -55.901 12.253  -5.192  1.00 40.37  ? 335  ARG A NE  1 
ATOM   1192 C CZ  . ARG A 1 166 ? -56.246 13.506  -5.472  1.00 45.71  ? 335  ARG A CZ  1 
ATOM   1193 N NH1 . ARG A 1 166 ? -57.114 14.173  -4.727  1.00 41.33  ? 335  ARG A NH1 1 
ATOM   1194 N NH2 . ARG A 1 166 ? -55.673 14.096  -6.495  1.00 45.07  ? 335  ARG A NH2 1 
ATOM   1195 N N   . ASP A 1 167 ? -52.032 10.331  -0.372  1.00 22.63  ? 336  ASP A N   1 
ATOM   1196 C CA  . ASP A 1 167 ? -50.873 10.858  0.328   1.00 21.94  ? 336  ASP A CA  1 
ATOM   1197 C C   . ASP A 1 167 ? -50.290 9.843   1.270   1.00 22.37  ? 336  ASP A C   1 
ATOM   1198 O O   . ASP A 1 167 ? -49.908 10.157  2.394   1.00 21.40  ? 336  ASP A O   1 
ATOM   1199 C CB  . ASP A 1 167 ? -51.217 12.153  1.057   1.00 22.17  ? 336  ASP A CB  1 
ATOM   1200 C CG  . ASP A 1 167 ? -49.978 12.979  1.404   1.00 28.46  ? 336  ASP A CG  1 
ATOM   1201 O OD1 . ASP A 1 167 ? -48.869 12.783  0.830   1.00 29.04  ? 336  ASP A OD1 1 
ATOM   1202 O OD2 . ASP A 1 167 ? -50.117 13.819  2.295   1.00 32.17  ? 336  ASP A OD2 1 
ATOM   1203 N N   . LEU A 1 168 ? -50.157 8.617   0.785   1.00 22.86  ? 337  LEU A N   1 
ATOM   1204 C CA  . LEU A 1 168 ? -49.563 7.568   1.581   1.00 22.36  ? 337  LEU A CA  1 
ATOM   1205 C C   . LEU A 1 168 ? -48.060 7.788   1.744   1.00 24.78  ? 337  LEU A C   1 
ATOM   1206 O O   . LEU A 1 168 ? -47.339 7.985   0.762   1.00 28.46  ? 337  LEU A O   1 
ATOM   1207 C CB  . LEU A 1 168 ? -49.874 6.217   0.977   1.00 25.17  ? 337  LEU A CB  1 
ATOM   1208 C CG  . LEU A 1 168 ? -49.537 5.020   1.825   1.00 28.29  ? 337  LEU A CG  1 
ATOM   1209 C CD1 . LEU A 1 168 ? -50.405 4.977   3.075   1.00 29.60  ? 337  LEU A CD1 1 
ATOM   1210 C CD2 . LEU A 1 168 ? -49.736 3.764   0.995   1.00 29.15  ? 337  LEU A CD2 1 
ATOM   1211 N N   . LYS A 1 169 ? -47.598 7.809   2.999   1.00 23.05  ? 338  LYS A N   1 
ATOM   1212 C CA  . LYS A 1 169 ? -46.174 7.914   3.328   1.00 21.72  ? 338  LYS A CA  1 
ATOM   1213 C C   . LYS A 1 169 ? -45.948 7.554   4.806   1.00 22.20  ? 338  LYS A C   1 
ATOM   1214 O O   . LYS A 1 169 ? -46.902 7.403   5.559   1.00 22.11  ? 338  LYS A O   1 
ATOM   1215 C CB  . LYS A 1 169 ? -45.674 9.299   3.054   1.00 21.65  ? 338  LYS A CB  1 
ATOM   1216 C CG  . LYS A 1 169 ? -46.469 10.351  3.793   1.00 21.97  ? 338  LYS A CG  1 
ATOM   1217 C CD  . LYS A 1 169 ? -45.829 11.704  3.597   1.00 25.71  ? 338  LYS A CD  1 
ATOM   1218 C CE  . LYS A 1 169 ? -46.710 12.790  4.146   1.00 29.73  ? 338  LYS A CE  1 
ATOM   1219 N NZ  . LYS A 1 169 ? -46.035 14.090  3.952   1.00 31.25  ? 338  LYS A NZ  1 
ATOM   1220 N N   . SER A 1 170 ? -44.693 7.459   5.215   1.00 21.40  ? 339  SER A N   1 
ATOM   1221 C CA  . SER A 1 170 ? -44.359 6.938   6.537   1.00 23.51  ? 339  SER A CA  1 
ATOM   1222 C C   . SER A 1 170 ? -44.776 7.880   7.664   1.00 23.90  ? 339  SER A C   1 
ATOM   1223 O O   . SER A 1 170 ? -45.025 7.431   8.775   1.00 24.50  ? 339  SER A O   1 
ATOM   1224 C CB  . SER A 1 170 ? -42.863 6.599   6.620   1.00 19.45  ? 339  SER A CB  1 
ATOM   1225 O OG  . SER A 1 170 ? -42.038 7.675   6.225   1.00 21.36  ? 339  SER A OG  1 
ATOM   1226 N N   . LYS A 1 171 ? -44.843 9.177   7.371   1.00 23.61  ? 340  LYS A N   1 
ATOM   1227 C CA  . LYS A 1 171 ? -45.413 10.149  8.305   1.00 24.43  ? 340  LYS A CA  1 
ATOM   1228 C C   . LYS A 1 171 ? -46.916 10.071  8.469   1.00 26.13  ? 340  LYS A C   1 
ATOM   1229 O O   . LYS A 1 171 ? -47.444 10.612  9.431   1.00 23.10  ? 340  LYS A O   1 
ATOM   1230 C CB  . LYS A 1 171 ? -45.069 11.565  7.902   1.00 26.39  ? 340  LYS A CB  1 
ATOM   1231 C CG  . LYS A 1 171 ? -43.649 11.922  8.259   1.00 29.99  ? 340  LYS A CG  1 
ATOM   1232 C CD  . LYS A 1 171 ? -43.311 13.342  7.875   1.00 35.02  ? 340  LYS A CD  1 
ATOM   1233 C CE  . LYS A 1 171 ? -41.873 13.626  8.286   1.00 41.25  ? 340  LYS A CE  1 
ATOM   1234 N NZ  . LYS A 1 171 ? -41.521 15.035  8.081   1.00 42.32  ? 340  LYS A NZ  1 
ATOM   1235 N N   . ASN A 1 172 ? -47.609 9.434   7.535   1.00 24.32  ? 341  ASN A N   1 
ATOM   1236 C CA  . ASN A 1 172 ? -49.061 9.364   7.592   1.00 23.65  ? 341  ASN A CA  1 
ATOM   1237 C C   . ASN A 1 172 ? -49.491 7.980   8.032   1.00 20.89  ? 341  ASN A C   1 
ATOM   1238 O O   . ASN A 1 172 ? -50.620 7.595   7.846   1.00 21.21  ? 341  ASN A O   1 
ATOM   1239 C CB  . ASN A 1 172 ? -49.679 9.739   6.226   1.00 23.80  ? 341  ASN A CB  1 
ATOM   1240 C CG  . ASN A 1 172 ? -49.672 11.239  5.977   1.00 27.32  ? 341  ASN A CG  1 
ATOM   1241 O OD1 . ASN A 1 172 ? -49.319 12.022  6.861   1.00 26.47  ? 341  ASN A OD1 1 
ATOM   1242 N ND2 . ASN A 1 172 ? -50.044 11.649  4.752   1.00 25.10  ? 341  ASN A ND2 1 
ATOM   1243 N N   . ILE A 1 173 ? -48.562 7.246   8.620   1.00 23.58  ? 342  ILE A N   1 
ATOM   1244 C CA  . ILE A 1 173 ? -48.822 5.943   9.195   1.00 22.26  ? 342  ILE A CA  1 
ATOM   1245 C C   . ILE A 1 173 ? -48.371 5.979   10.642  1.00 22.59  ? 342  ILE A C   1 
ATOM   1246 O O   . ILE A 1 173 ? -47.272 6.471   10.958  1.00 22.11  ? 342  ILE A O   1 
ATOM   1247 C CB  . ILE A 1 173 ? -48.064 4.870   8.430   1.00 22.71  ? 342  ILE A CB  1 
ATOM   1248 C CG1 . ILE A 1 173 ? -48.620 4.787   7.003   1.00 23.71  ? 342  ILE A CG1 1 
ATOM   1249 C CG2 . ILE A 1 173 ? -48.181 3.518   9.105   1.00 22.92  ? 342  ILE A CG2 1 
ATOM   1250 C CD1 . ILE A 1 173 ? -47.718 4.003   6.075   1.00 22.84  ? 342  ILE A CD1 1 
ATOM   1251 N N   . LEU A 1 174 ? -49.224 5.449   11.522  1.00 21.56  ? 343  LEU A N   1 
ATOM   1252 C CA  . LEU A 1 174 ? -48.948 5.432   12.947  1.00 22.25  ? 343  LEU A CA  1 
ATOM   1253 C C   . LEU A 1 174 ? -48.655 4.024   13.426  1.00 21.26  ? 343  LEU A C   1 
ATOM   1254 O O   . LEU A 1 174 ? -49.239 3.058   12.934  1.00 22.20  ? 343  LEU A O   1 
ATOM   1255 C CB  . LEU A 1 174 ? -50.146 6.008   13.719  1.00 23.73  ? 343  LEU A CB  1 
ATOM   1256 C CG  . LEU A 1 174 ? -50.423 7.475   13.401  1.00 23.68  ? 343  LEU A CG  1 
ATOM   1257 C CD1 . LEU A 1 174 ? -51.777 7.817   13.946  1.00 24.22  ? 343  LEU A CD1 1 
ATOM   1258 C CD2 . LEU A 1 174 ? -49.368 8.354   14.044  1.00 26.98  ? 343  LEU A CD2 1 
ATOM   1259 N N   . VAL A 1 175 ? -47.753 3.912   14.401  1.00 20.41  ? 344  VAL A N   1 
ATOM   1260 C CA  . VAL A 1 175 ? -47.392 2.628   14.966  1.00 21.41  ? 344  VAL A CA  1 
ATOM   1261 C C   . VAL A 1 175 ? -48.220 2.380   16.208  1.00 22.84  ? 344  VAL A C   1 
ATOM   1262 O O   . VAL A 1 175 ? -48.297 3.220   17.098  1.00 24.65  ? 344  VAL A O   1 
ATOM   1263 C CB  . VAL A 1 175 ? -45.913 2.595   15.331  1.00 23.04  ? 344  VAL A CB  1 
ATOM   1264 C CG1 . VAL A 1 175 ? -45.540 1.282   16.007  1.00 23.38  ? 344  VAL A CG1 1 
ATOM   1265 C CG2 . VAL A 1 175 ? -45.101 2.801   14.070  1.00 26.19  ? 344  VAL A CG2 1 
ATOM   1266 N N   . LYS A 1 176 ? -48.856 1.228   16.239  1.00 24.64  ? 345  LYS A N   1 
ATOM   1267 C CA  . LYS A 1 176 ? -49.653 0.796   17.371  1.00 27.02  ? 345  LYS A CA  1 
ATOM   1268 C C   . LYS A 1 176 ? -48.806 -0.064  18.294  1.00 27.60  ? 345  LYS A C   1 
ATOM   1269 O O   . LYS A 1 176 ? -47.803 -0.674  17.890  1.00 28.11  ? 345  LYS A O   1 
ATOM   1270 C CB  . LYS A 1 176 ? -50.889 0.012   16.905  1.00 25.42  ? 345  LYS A CB  1 
ATOM   1271 C CG  . LYS A 1 176 ? -51.750 0.794   15.940  1.00 28.65  ? 345  LYS A CG  1 
ATOM   1272 C CD  . LYS A 1 176 ? -52.806 -0.076  15.252  1.00 31.09  ? 345  LYS A CD  1 
ATOM   1273 C CE  . LYS A 1 176 ? -53.742 -0.640  16.287  1.00 29.12  ? 345  LYS A CE  1 
ATOM   1274 N NZ  . LYS A 1 176 ? -55.103 -0.886  15.819  1.00 29.79  ? 345  LYS A NZ  1 
ATOM   1275 N N   . LYS A 1 177 ? -49.226 -0.103  19.543  1.00 27.98  ? 346  LYS A N   1 
ATOM   1276 C CA  . LYS A 1 177 ? -48.567 -0.905  20.573  1.00 29.92  ? 346  LYS A CA  1 
ATOM   1277 C C   . LYS A 1 177 ? -48.574 -2.397  20.305  1.00 26.61  ? 346  LYS A C   1 
ATOM   1278 O O   . LYS A 1 177 ? -47.661 -3.094  20.699  1.00 28.16  ? 346  LYS A O   1 
ATOM   1279 C CB  . LYS A 1 177 ? -49.231 -0.635  21.932  1.00 36.36  ? 346  LYS A CB  1 
ATOM   1280 C CG  . LYS A 1 177 ? -48.900 0.723   22.529  1.00 35.85  ? 346  LYS A CG  1 
ATOM   1281 C CD  . LYS A 1 177 ? -47.471 0.753   23.014  1.00 46.52  ? 346  LYS A CD  1 
ATOM   1282 C CE  . LYS A 1 177 ? -47.251 1.880   23.988  1.00 49.36  ? 346  LYS A CE  1 
ATOM   1283 N NZ  . LYS A 1 177 ? -48.143 1.756   25.180  1.00 69.57  ? 346  LYS A NZ  1 
ATOM   1284 N N   . ASN A 1 178 ? -49.583 -2.915  19.619  1.00 29.74  ? 347  ASN A N   1 
ATOM   1285 C CA  . ASN A 1 178 ? -49.566 -4.336  19.301  1.00 26.02  ? 347  ASN A CA  1 
ATOM   1286 C C   . ASN A 1 178 ? -48.597 -4.675  18.146  1.00 27.73  ? 347  ASN A C   1 
ATOM   1287 O O   . ASN A 1 178 ? -48.519 -5.826  17.725  1.00 30.30  ? 347  ASN A O   1 
ATOM   1288 C CB  . ASN A 1 178 ? -50.971 -4.822  19.003  1.00 29.91  ? 347  ASN A CB  1 
ATOM   1289 C CG  . ASN A 1 178 ? -51.518 -4.291  17.665  1.00 35.23  ? 347  ASN A CG  1 
ATOM   1290 O OD1 . ASN A 1 178 ? -50.817 -3.628  16.889  1.00 28.03  ? 347  ASN A OD1 1 
ATOM   1291 N ND2 . ASN A 1 178 ? -52.772 -4.598  17.391  1.00 33.69  ? 347  ASN A ND2 1 
ATOM   1292 N N   . GLY A 1 179 ? -47.865 -3.683  17.639  1.00 26.12  ? 348  GLY A N   1 
ATOM   1293 C CA  . GLY A 1 179 ? -46.840 -3.924  16.600  1.00 29.38  ? 348  GLY A CA  1 
ATOM   1294 C C   . GLY A 1 179 ? -47.357 -3.743  15.170  1.00 26.97  ? 348  GLY A C   1 
ATOM   1295 O O   . GLY A 1 179 ? -46.603 -3.751  14.212  1.00 31.04  ? 348  GLY A O   1 
ATOM   1296 N N   . GLN A 1 180 ? -48.654 -3.567  15.030  1.00 26.25  ? 349  GLN A N   1 
ATOM   1297 C CA  . GLN A 1 180 ? -49.239 -3.210  13.757  1.00 25.92  ? 349  GLN A CA  1 
ATOM   1298 C C   . GLN A 1 180 ? -49.222 -1.709  13.570  1.00 26.46  ? 349  GLN A C   1 
ATOM   1299 O O   . GLN A 1 180 ? -48.955 -0.955  14.513  1.00 25.66  ? 349  GLN A O   1 
ATOM   1300 C CB  . GLN A 1 180 ? -50.664 -3.738  13.684  1.00 26.92  ? 349  GLN A CB  1 
ATOM   1301 C CG  . GLN A 1 180 ? -50.659 -5.257  13.605  1.00 29.56  ? 349  GLN A CG  1 
ATOM   1302 C CD  . GLN A 1 180 ? -52.030 -5.830  13.418  1.00 32.25  ? 349  GLN A CD  1 
ATOM   1303 O OE1 . GLN A 1 180 ? -52.866 -5.261  12.740  1.00 34.66  ? 349  GLN A OE1 1 
ATOM   1304 N NE2 . GLN A 1 180 ? -52.261 -6.969  14.010  1.00 38.36  ? 349  GLN A NE2 1 
ATOM   1305 N N   . CYS A 1 181 ? -49.522 -1.287  12.350  1.00 22.24  ? 350  CYS A N   1 
ATOM   1306 C CA  . CYS A 1 181 ? -49.669 0.122   12.050  1.00 20.82  ? 350  CYS A CA  1 
ATOM   1307 C C   . CYS A 1 181 ? -51.071 0.414   11.640  1.00 22.29  ? 350  CYS A C   1 
ATOM   1308 O O   . CYS A 1 181 ? -51.854 -0.486  11.345  1.00 22.77  ? 350  CYS A O   1 
ATOM   1309 C CB  . CYS A 1 181 ? -48.717 0.526   10.926  1.00 23.34  ? 350  CYS A CB  1 
ATOM   1310 S SG  . CYS A 1 181 ? -46.974 0.449   11.387  1.00 25.02  ? 350  CYS A SG  1 
ATOM   1311 N N   . CYS A 1 182 ? -51.406 1.693   11.634  1.00 24.92  ? 351  CYS A N   1 
ATOM   1312 C CA  . CYS A 1 182 ? -52.626 2.131   11.007  1.00 21.38  ? 351  CYS A CA  1 
ATOM   1313 C C   . CYS A 1 182 ? -52.375 3.346   10.146  1.00 21.30  ? 351  CYS A C   1 
ATOM   1314 O O   . CYS A 1 182 ? -51.517 4.182   10.432  1.00 21.06  ? 351  CYS A O   1 
ATOM   1315 C CB  . CYS A 1 182 ? -53.706 2.428   12.057  1.00 20.85  ? 351  CYS A CB  1 
ATOM   1316 S SG  . CYS A 1 182 ? -53.254 3.690   13.256  1.00 23.12  ? 351  CYS A SG  1 
ATOM   1317 N N   . ILE A 1 183 ? -53.168 3.440   9.088   1.00 21.26  ? 352  ILE A N   1 
ATOM   1318 C CA  . ILE A 1 183 ? -53.061 4.506   8.138   1.00 20.97  ? 352  ILE A CA  1 
ATOM   1319 C C   . ILE A 1 183 ? -53.909 5.670   8.574   1.00 20.80  ? 352  ILE A C   1 
ATOM   1320 O O   . ILE A 1 183 ? -55.077 5.490   8.874   1.00 19.86  ? 352  ILE A O   1 
ATOM   1321 C CB  . ILE A 1 183 ? -53.525 4.025   6.756   1.00 22.13  ? 352  ILE A CB  1 
ATOM   1322 C CG1 . ILE A 1 183 ? -52.550 2.942   6.250   1.00 22.54  ? 352  ILE A CG1 1 
ATOM   1323 C CG2 . ILE A 1 183 ? -53.595 5.202   5.796   1.00 23.95  ? 352  ILE A CG2 1 
ATOM   1324 C CD1 . ILE A 1 183 ? -53.065 2.147   5.071   1.00 23.45  ? 352  ILE A CD1 1 
ATOM   1325 N N   . ALA A 1 184 ? -53.328 6.862   8.524   1.00 20.76  ? 353  ALA A N   1 
ATOM   1326 C CA  . ALA A 1 184 ? -53.989 8.111   8.927   1.00 22.00  ? 353  ALA A CA  1 
ATOM   1327 C C   . ALA A 1 184 ? -53.987 9.120   7.785   1.00 24.57  ? 353  ALA A C   1 
ATOM   1328 O O   . ALA A 1 184 ? -53.383 8.890   6.735   1.00 23.39  ? 353  ALA A O   1 
ATOM   1329 C CB  . ALA A 1 184 ? -53.254 8.729   10.111  1.00 22.39  ? 353  ALA A CB  1 
ATOM   1330 N N   . ASP A 1 185 ? -54.635 10.250  8.039   1.00 26.31  ? 354  ASP A N   1 
ATOM   1331 C CA  . ASP A 1 185 ? -54.576 11.463  7.207   1.00 28.59  ? 354  ASP A CA  1 
ATOM   1332 C C   . ASP A 1 185 ? -55.287 11.227  5.893   1.00 28.52  ? 354  ASP A C   1 
ATOM   1333 O O   . ASP A 1 185 ? -54.673 11.094  4.825   1.00 21.55  ? 354  ASP A O   1 
ATOM   1334 C CB  . ASP A 1 185 ? -53.142 11.951  7.004   1.00 34.90  ? 354  ASP A CB  1 
ATOM   1335 C CG  . ASP A 1 185 ? -52.441 12.298  8.323   1.00 53.40  ? 354  ASP A CG  1 
ATOM   1336 O OD1 . ASP A 1 185 ? -52.715 13.372  8.888   1.00 69.55  ? 354  ASP A OD1 1 
ATOM   1337 O OD2 . ASP A 1 185 ? -51.602 11.503  8.798   1.00 59.49  ? 354  ASP A OD2 1 
ATOM   1338 N N   . LEU A 1 186 ? -56.599 11.136  6.011   1.00 24.29  ? 355  LEU A N   1 
ATOM   1339 C CA  . LEU A 1 186 ? -57.479 10.886  4.900   1.00 25.53  ? 355  LEU A CA  1 
ATOM   1340 C C   . LEU A 1 186 ? -58.037 12.160  4.252   1.00 25.57  ? 355  LEU A C   1 
ATOM   1341 O O   . LEU A 1 186 ? -58.971 12.095  3.449   1.00 25.06  ? 355  LEU A O   1 
ATOM   1342 C CB  . LEU A 1 186 ? -58.632 10.013  5.353   1.00 28.31  ? 355  LEU A CB  1 
ATOM   1343 C CG  . LEU A 1 186 ? -58.213 8.708   5.999   1.00 31.84  ? 355  LEU A CG  1 
ATOM   1344 C CD1 . LEU A 1 186 ? -59.454 7.946   6.400   1.00 34.03  ? 355  LEU A CD1 1 
ATOM   1345 C CD2 . LEU A 1 186 ? -57.364 7.920   5.036   1.00 33.08  ? 355  LEU A CD2 1 
ATOM   1346 N N   . GLY A 1 187 ? -57.437 13.300  4.557   1.00 25.92  ? 356  GLY A N   1 
ATOM   1347 C CA  . GLY A 1 187 ? -57.929 14.585  4.044   1.00 30.35  ? 356  GLY A CA  1 
ATOM   1348 C C   . GLY A 1 187 ? -57.818 14.801  2.531   1.00 29.88  ? 356  GLY A C   1 
ATOM   1349 O O   . GLY A 1 187 ? -58.454 15.689  2.028   1.00 27.30  ? 356  GLY A O   1 
ATOM   1350 N N   . LEU A 1 188 ? -57.019 14.001  1.818   1.00 28.32  ? 357  LEU A N   1 
ATOM   1351 C CA  . LEU A 1 188 ? -56.900 14.090  0.362   1.00 27.65  ? 357  LEU A CA  1 
ATOM   1352 C C   . LEU A 1 188 ? -57.610 12.922  -0.316  1.00 29.44  ? 357  LEU A C   1 
ATOM   1353 O O   . LEU A 1 188 ? -57.592 12.803  -1.521  1.00 26.89  ? 357  LEU A O   1 
ATOM   1354 C CB  . LEU A 1 188 ? -55.411 14.123  -0.048  1.00 30.05  ? 357  LEU A CB  1 
ATOM   1355 C CG  . LEU A 1 188 ? -54.631 15.416  0.254   1.00 33.32  ? 357  LEU A CG  1 
ATOM   1356 C CD1 . LEU A 1 188 ? -53.217 15.309  -0.268  1.00 42.09  ? 357  LEU A CD1 1 
ATOM   1357 C CD2 . LEU A 1 188 ? -55.307 16.617  -0.399  1.00 42.05  ? 357  LEU A CD2 1 
ATOM   1358 N N   . ALA A 1 189 ? -58.249 12.050  0.450   1.00 29.02  ? 358  ALA A N   1 
ATOM   1359 C CA  . ALA A 1 189 ? -58.763 10.805  -0.123  1.00 25.78  ? 358  ALA A CA  1 
ATOM   1360 C C   . ALA A 1 189 ? -59.896 11.031  -1.091  1.00 27.12  ? 358  ALA A C   1 
ATOM   1361 O O   . ALA A 1 189 ? -60.586 12.024  -1.000  1.00 31.64  ? 358  ALA A O   1 
ATOM   1362 C CB  . ALA A 1 189 ? -59.230 9.880   0.965   1.00 26.03  ? 358  ALA A CB  1 
ATOM   1363 N N   . VAL A 1 190 ? -60.092 10.081  -1.992  1.00 25.83  ? 359  VAL A N   1 
ATOM   1364 C CA  . VAL A 1 190 ? -61.213 10.099  -2.907  1.00 27.89  ? 359  VAL A CA  1 
ATOM   1365 C C   . VAL A 1 190 ? -61.972 8.789   -2.882  1.00 29.69  ? 359  VAL A C   1 
ATOM   1366 O O   . VAL A 1 190 ? -61.380 7.720   -2.701  1.00 26.59  ? 359  VAL A O   1 
ATOM   1367 C CB  . VAL A 1 190 ? -60.765 10.378  -4.342  1.00 32.67  ? 359  VAL A CB  1 
ATOM   1368 C CG1 . VAL A 1 190 ? -60.166 11.773  -4.403  1.00 45.06  ? 359  VAL A CG1 1 
ATOM   1369 C CG2 . VAL A 1 190 ? -59.741 9.352   -4.836  1.00 35.44  ? 359  VAL A CG2 1 
ATOM   1370 N N   . MET A 1 191 ? -63.260 8.885   -3.165  1.00 34.22  ? 360  MET A N   1 
ATOM   1371 C CA  . MET A 1 191 ? -64.225 7.808   -2.958  1.00 35.83  ? 360  MET A CA  1 
ATOM   1372 C C   . MET A 1 191 ? -64.819 7.388   -4.287  1.00 38.23  ? 360  MET A C   1 
ATOM   1373 O O   . MET A 1 191 ? -65.091 8.224   -5.137  1.00 33.99  ? 360  MET A O   1 
ATOM   1374 C CB  . MET A 1 191 ? -65.381 8.316   -2.096  1.00 36.06  ? 360  MET A CB  1 
ATOM   1375 C CG  . MET A 1 191 ? -65.262 8.093   -0.603  1.00 44.78  ? 360  MET A CG  1 
ATOM   1376 S SD  . MET A 1 191 ? -66.712 8.758   0.281   1.00 61.18  ? 360  MET A SD  1 
ATOM   1377 C CE  . MET A 1 191 ? -68.097 8.366   -0.813  1.00 62.58  ? 360  MET A CE  1 
ATOM   1378 N N   . HIS A 1 192 ? -65.108 6.098   -4.414  1.00 41.41  ? 361  HIS A N   1 
ATOM   1379 C CA  . HIS A 1 192 ? -65.726 5.546   -5.591  1.00 40.25  ? 361  HIS A CA  1 
ATOM   1380 C C   . HIS A 1 192 ? -66.811 4.562   -5.185  1.00 48.04  ? 361  HIS A C   1 
ATOM   1381 O O   . HIS A 1 192 ? -66.533 3.509   -4.572  1.00 47.18  ? 361  HIS A O   1 
ATOM   1382 C CB  . HIS A 1 192 ? -64.657 4.845   -6.423  1.00 39.07  ? 361  HIS A CB  1 
ATOM   1383 C CG  . HIS A 1 192 ? -65.195 4.023   -7.561  1.00 48.01  ? 361  HIS A CG  1 
ATOM   1384 N ND1 . HIS A 1 192 ? -65.756 4.586   -8.688  1.00 47.31  ? 361  HIS A ND1 1 
ATOM   1385 C CD2 . HIS A 1 192 ? -65.213 2.680   -7.763  1.00 49.41  ? 361  HIS A CD2 1 
ATOM   1386 C CE1 . HIS A 1 192 ? -66.121 3.627   -9.522  1.00 55.37  ? 361  HIS A CE1 1 
ATOM   1387 N NE2 . HIS A 1 192 ? -65.802 2.463   -8.985  1.00 52.07  ? 361  HIS A NE2 1 
ATOM   1388 N N   . SER A 1 193 ? -68.051 4.893   -5.536  1.00 56.80  ? 362  SER A N   1 
ATOM   1389 C CA  . SER A 1 193 ? -69.191 4.001   -5.274  1.00 58.97  ? 362  SER A CA  1 
ATOM   1390 C C   . SER A 1 193 ? -69.975 3.719   -6.544  1.00 70.90  ? 362  SER A C   1 
ATOM   1391 O O   . SER A 1 193 ? -69.584 4.113   -7.656  1.00 66.29  ? 362  SER A O   1 
ATOM   1392 C CB  . SER A 1 193 ? -70.126 4.579   -4.201  1.00 56.19  ? 362  SER A CB  1 
ATOM   1393 O OG  . SER A 1 193 ? -70.956 5.598   -4.726  1.00 69.73  ? 362  SER A OG  1 
ATOM   1394 N N   . GLN A 1 194 ? -71.071 2.996   -6.356  1.00 80.89  ? 363  GLN A N   1 
ATOM   1395 C CA  . GLN A 1 194 ? -72.059 2.800   -7.390  1.00 79.05  ? 363  GLN A CA  1 
ATOM   1396 C C   . GLN A 1 194 ? -72.814 4.087   -7.728  1.00 84.09  ? 363  GLN A C   1 
ATOM   1397 O O   . GLN A 1 194 ? -73.153 4.293   -8.891  1.00 75.24  ? 363  GLN A O   1 
ATOM   1398 C CB  . GLN A 1 194 ? -73.048 1.730   -6.969  1.00 85.56  ? 363  GLN A CB  1 
ATOM   1399 C CG  . GLN A 1 194 ? -72.842 0.405   -7.659  1.00 82.64  ? 363  GLN A CG  1 
ATOM   1400 C CD  . GLN A 1 194 ? -74.016 -0.501  -7.401  1.00 90.95  ? 363  GLN A CD  1 
ATOM   1401 O OE1 . GLN A 1 194 ? -74.453 -0.622  -6.255  1.00 77.35  ? 363  GLN A OE1 1 
ATOM   1402 N NE2 . GLN A 1 194 ? -74.556 -1.123  -8.463  1.00 81.94  ? 363  GLN A NE2 1 
ATOM   1403 N N   . SER A 1 195 ? -73.085 4.937   -6.731  1.00 98.48  ? 364  SER A N   1 
ATOM   1404 C CA  . SER A 1 195 ? -73.662 6.274   -6.974  1.00 102.32 ? 364  SER A CA  1 
ATOM   1405 C C   . SER A 1 195 ? -72.636 7.145   -7.737  1.00 99.39  ? 364  SER A C   1 
ATOM   1406 O O   . SER A 1 195 ? -72.303 8.278   -7.349  1.00 77.13  ? 364  SER A O   1 
ATOM   1407 C CB  . SER A 1 195 ? -74.094 6.926   -5.651  1.00 99.79  ? 364  SER A CB  1 
ATOM   1408 N N   . THR A 1 196 ? -72.177 6.598   -8.860  1.00 102.24 ? 365  THR A N   1 
ATOM   1409 C CA  . THR A 1 196 ? -70.975 7.057   -9.525  1.00 100.21 ? 365  THR A CA  1 
ATOM   1410 C C   . THR A 1 196 ? -71.266 8.214   -10.464 1.00 123.60 ? 365  THR A C   1 
ATOM   1411 O O   . THR A 1 196 ? -71.656 8.023   -11.621 1.00 106.75 ? 365  THR A O   1 
ATOM   1412 C CB  . THR A 1 196 ? -70.317 5.923   -10.325 1.00 87.06  ? 365  THR A CB  1 
ATOM   1413 N N   . ASN A 1 197 ? -71.079 9.420   -9.945  1.00 123.56 ? 366  ASN A N   1 
ATOM   1414 C CA  . ASN A 1 197 ? -70.991 10.604  -10.778 1.00 119.22 ? 366  ASN A CA  1 
ATOM   1415 C C   . ASN A 1 197 ? -69.533 10.693  -11.246 1.00 110.49 ? 366  ASN A C   1 
ATOM   1416 O O   . ASN A 1 197 ? -68.910 9.658   -11.513 1.00 89.22  ? 366  ASN A O   1 
ATOM   1417 C CB  . ASN A 1 197 ? -71.430 11.839  -9.979  1.00 110.30 ? 366  ASN A CB  1 
ATOM   1418 C CG  . ASN A 1 197 ? -72.833 11.703  -9.419  1.00 93.28  ? 366  ASN A CG  1 
ATOM   1419 O OD1 . ASN A 1 197 ? -73.065 11.928  -8.237  1.00 76.77  ? 366  ASN A OD1 1 
ATOM   1420 N ND2 . ASN A 1 197 ? -73.775 11.318  -10.271 1.00 100.29 ? 366  ASN A ND2 1 
ATOM   1421 N N   . GLN A 1 198 ? -68.991 11.904  -11.361 1.00 110.49 ? 367  GLN A N   1 
ATOM   1422 C CA  . GLN A 1 198 ? -67.549 12.076  -11.506 1.00 102.71 ? 367  GLN A CA  1 
ATOM   1423 C C   . GLN A 1 198 ? -66.874 11.898  -10.131 1.00 90.49  ? 367  GLN A C   1 
ATOM   1424 O O   . GLN A 1 198 ? -67.509 12.054  -9.079  1.00 66.87  ? 367  GLN A O   1 
ATOM   1425 C CB  . GLN A 1 198 ? -67.218 13.457  -12.105 1.00 85.70  ? 367  GLN A CB  1 
ATOM   1426 N N   . LEU A 1 199 ? -65.599 11.523  -10.148 1.00 75.55  ? 368  LEU A N   1 
ATOM   1427 C CA  A LEU A 1 199 ? -64.792 11.530  -8.929  0.50 65.57  ? 368  LEU A CA  1 
ATOM   1428 C CA  B LEU A 1 199 ? -64.764 11.536  -8.944  0.50 74.88  ? 368  LEU A CA  1 
ATOM   1429 C C   . LEU A 1 199 ? -64.672 12.952  -8.389  1.00 72.93  ? 368  LEU A C   1 
ATOM   1430 O O   . LEU A 1 199 ? -64.442 13.893  -9.148  1.00 87.56  ? 368  LEU A O   1 
ATOM   1431 C CB  A LEU A 1 199 ? -63.388 11.013  -9.205  0.50 50.67  ? 368  LEU A CB  1 
ATOM   1432 C CB  B LEU A 1 199 ? -63.344 11.071  -9.272  0.50 70.07  ? 368  LEU A CB  1 
ATOM   1433 C CG  A LEU A 1 199 ? -63.170 9.520   -9.232  0.50 40.09  ? 368  LEU A CG  1 
ATOM   1434 C CG  B LEU A 1 199 ? -62.950 9.667   -8.861  0.50 65.28  ? 368  LEU A CG  1 
ATOM   1435 C CD1 A LEU A 1 199 ? -61.705 9.272   -9.554  0.50 38.99  ? 368  LEU A CD1 1 
ATOM   1436 C CD1 B LEU A 1 199 ? -64.181 8.797   -8.705  0.50 67.39  ? 368  LEU A CD1 1 
ATOM   1437 C CD2 A LEU A 1 199 ? -63.545 8.909   -7.885  0.50 37.71  ? 368  LEU A CD2 1 
ATOM   1438 C CD2 B LEU A 1 199 ? -61.981 9.098   -9.883  0.50 67.36  ? 368  LEU A CD2 1 
ATOM   1439 N N   . ASP A 1 200 ? -64.808 13.101  -7.075  1.00 72.60  ? 369  ASP A N   1 
ATOM   1440 C CA  . ASP A 1 200 ? -64.683 14.410  -6.453  1.00 80.14  ? 369  ASP A CA  1 
ATOM   1441 C C   . ASP A 1 200 ? -63.224 14.679  -6.074  1.00 81.25  ? 369  ASP A C   1 
ATOM   1442 O O   . ASP A 1 200 ? -62.750 14.207  -5.047  1.00 82.90  ? 369  ASP A O   1 
ATOM   1443 C CB  . ASP A 1 200 ? -65.603 14.513  -5.227  1.00 91.29  ? 369  ASP A CB  1 
ATOM   1444 C CG  . ASP A 1 200 ? -65.994 15.950  -4.905  1.00 95.79  ? 369  ASP A CG  1 
ATOM   1445 O OD1 . ASP A 1 200 ? -65.154 16.858  -5.075  1.00 86.46  ? 369  ASP A OD1 1 
ATOM   1446 O OD2 . ASP A 1 200 ? -67.148 16.171  -4.483  1.00 109.18 ? 369  ASP A OD2 1 
ATOM   1447 N N   . VAL A 1 201 ? -62.518 15.439  -6.907  1.00 83.29  ? 370  VAL A N   1 
ATOM   1448 C CA  . VAL A 1 201 ? -61.173 15.900  -6.553  1.00 89.90  ? 370  VAL A CA  1 
ATOM   1449 C C   . VAL A 1 201 ? -60.928 17.368  -6.958  1.00 96.67  ? 370  VAL A C   1 
ATOM   1450 O O   . VAL A 1 201 ? -60.796 17.702  -8.134  1.00 92.51  ? 370  VAL A O   1 
ATOM   1451 C CB  . VAL A 1 201 ? -60.075 14.925  -7.078  1.00 85.28  ? 370  VAL A CB  1 
ATOM   1452 C CG1 . VAL A 1 201 ? -60.548 14.126  -8.294  1.00 73.02  ? 370  VAL A CG1 1 
ATOM   1453 C CG2 . VAL A 1 201 ? -58.745 15.651  -7.333  1.00 91.69  ? 370  VAL A CG2 1 
ATOM   1454 N N   . PRO A 1 205 ? -54.777 17.619  -9.006  1.00 79.87  ? 374  PRO A N   1 
ATOM   1455 C CA  . PRO A 1 205 ? -53.982 16.599  -9.725  1.00 89.10  ? 374  PRO A CA  1 
ATOM   1456 C C   . PRO A 1 205 ? -52.729 16.110  -8.934  1.00 85.49  ? 374  PRO A C   1 
ATOM   1457 O O   . PRO A 1 205 ? -52.665 14.948  -8.455  1.00 52.80  ? 374  PRO A O   1 
ATOM   1458 C CB  . PRO A 1 205 ? -53.597 17.321  -11.030 1.00 85.02  ? 374  PRO A CB  1 
ATOM   1459 C CG  . PRO A 1 205 ? -53.710 18.807  -10.734 1.00 81.63  ? 374  PRO A CG  1 
ATOM   1460 C CD  . PRO A 1 205 ? -54.442 18.996  -9.429  1.00 83.74  ? 374  PRO A CD  1 
ATOM   1461 N N   . ARG A 1 206 ? -51.757 17.009  -8.783  1.00 65.73  ? 375  ARG A N   1 
ATOM   1462 C CA  . ARG A 1 206 ? -50.592 16.776  -7.942  1.00 61.76  ? 375  ARG A CA  1 
ATOM   1463 C C   . ARG A 1 206 ? -50.815 17.275  -6.487  1.00 56.52  ? 375  ARG A C   1 
ATOM   1464 O O   . ARG A 1 206 ? -50.326 18.346  -6.107  1.00 44.91  ? 375  ARG A O   1 
ATOM   1465 C CB  . ARG A 1 206 ? -49.397 17.511  -8.539  1.00 56.81  ? 375  ARG A CB  1 
ATOM   1466 C CG  . ARG A 1 206 ? -49.207 17.374  -10.043 1.00 68.91  ? 375  ARG A CG  1 
ATOM   1467 C CD  . ARG A 1 206 ? -47.727 17.533  -10.342 1.00 70.97  ? 375  ARG A CD  1 
ATOM   1468 N NE  . ARG A 1 206 ? -47.420 17.856  -11.720 1.00 77.08  ? 375  ARG A NE  1 
ATOM   1469 C CZ  . ARG A 1 206 ? -46.979 19.035  -12.154 1.00 86.09  ? 375  ARG A CZ  1 
ATOM   1470 N NH1 . ARG A 1 206 ? -46.789 20.061  -11.324 1.00 69.92  ? 375  ARG A NH1 1 
ATOM   1471 N NH2 . ARG A 1 206 ? -46.737 19.190  -13.449 1.00 89.85  ? 375  ARG A NH2 1 
ATOM   1472 N N   . VAL A 1 207 ? -51.520 16.502  -5.662  1.00 50.44  ? 376  VAL A N   1 
ATOM   1473 C CA  . VAL A 1 207 ? -51.918 17.022  -4.334  1.00 57.26  ? 376  VAL A CA  1 
ATOM   1474 C C   . VAL A 1 207 ? -51.030 16.533  -3.180  1.00 48.45  ? 376  VAL A C   1 
ATOM   1475 O O   . VAL A 1 207 ? -50.890 17.204  -2.149  1.00 41.36  ? 376  VAL A O   1 
ATOM   1476 C CB  . VAL A 1 207 ? -53.404 16.720  -4.015  1.00 58.05  ? 376  VAL A CB  1 
ATOM   1477 C CG1 . VAL A 1 207 ? -54.332 17.588  -4.864  1.00 61.51  ? 376  VAL A CG1 1 
ATOM   1478 C CG2 . VAL A 1 207 ? -53.706 15.244  -4.212  1.00 54.81  ? 376  VAL A CG2 1 
ATOM   1479 N N   . GLY A 1 208 ? -50.434 15.363  -3.353  1.00 35.74  ? 377  GLY A N   1 
ATOM   1480 C CA  . GLY A 1 208 ? -49.758 14.715  -2.244  1.00 33.67  ? 377  GLY A CA  1 
ATOM   1481 C C   . GLY A 1 208 ? -48.385 15.269  -1.933  1.00 32.08  ? 377  GLY A C   1 
ATOM   1482 O O   . GLY A 1 208 ? -48.065 16.419  -2.252  1.00 36.83  ? 377  GLY A O   1 
ATOM   1483 N N   . THR A 1 209 ? -47.573 14.421  -1.307  1.00 27.41  ? 378  THR A N   1 
ATOM   1484 C CA  . THR A 1 209 ? -46.172 14.695  -1.028  1.00 25.02  ? 378  THR A CA  1 
ATOM   1485 C C   . THR A 1 209 ? -45.322 14.300  -2.237  1.00 26.14  ? 378  THR A C   1 
ATOM   1486 O O   . THR A 1 209 ? -45.415 13.159  -2.771  1.00 27.35  ? 378  THR A O   1 
ATOM   1487 C CB  . THR A 1 209 ? -45.745 13.894  0.188   1.00 26.24  ? 378  THR A CB  1 
ATOM   1488 O OG1 . THR A 1 209 ? -46.626 14.233  1.262   1.00 27.04  ? 378  THR A OG1 1 
ATOM   1489 C CG2 . THR A 1 209 ? -44.306 14.210  0.578   1.00 24.36  ? 378  THR A CG2 1 
ATOM   1490 N N   . LYS A 1 210 ? -44.485 15.236  -2.670  1.00 28.00  ? 379  LYS A N   1 
ATOM   1491 C CA  . LYS A 1 210 ? -43.803 15.130  -3.979  1.00 28.50  ? 379  LYS A CA  1 
ATOM   1492 C C   . LYS A 1 210 ? -42.890 13.945  -4.060  1.00 27.43  ? 379  LYS A C   1 
ATOM   1493 O O   . LYS A 1 210 ? -42.901 13.218  -5.057  1.00 26.79  ? 379  LYS A O   1 
ATOM   1494 C CB  . LYS A 1 210 ? -43.055 16.422  -4.324  1.00 30.97  ? 379  LYS A CB  1 
ATOM   1495 C CG  . LYS A 1 210 ? -44.000 17.599  -4.556  1.00 32.83  ? 379  LYS A CG  1 
ATOM   1496 C CD  . LYS A 1 210 ? -43.263 18.810  -5.112  1.00 43.22  ? 379  LYS A CD  1 
ATOM   1497 C CE  . LYS A 1 210 ? -43.465 20.062  -4.289  1.00 52.49  ? 379  LYS A CE  1 
ATOM   1498 N NZ  . LYS A 1 210 ? -44.853 20.566  -4.407  1.00 62.21  ? 379  LYS A NZ  1 
ATOM   1499 N N   . ARG A 1 211 ? -42.141 13.725  -2.986  1.00 25.06  ? 380  ARG A N   1 
ATOM   1500 C CA  . ARG A 1 211 ? -41.164 12.641  -2.906  1.00 25.24  ? 380  ARG A CA  1 
ATOM   1501 C C   . ARG A 1 211 ? -41.795 11.282  -3.149  1.00 24.61  ? 380  ARG A C   1 
ATOM   1502 O O   . ARG A 1 211 ? -41.102 10.359  -3.593  1.00 25.35  ? 380  ARG A O   1 
ATOM   1503 C CB  . ARG A 1 211 ? -40.536 12.646  -1.491  1.00 28.09  ? 380  ARG A CB  1 
ATOM   1504 C CG  . ARG A 1 211 ? -39.414 11.654  -1.222  1.00 26.02  ? 380  ARG A CG  1 
ATOM   1505 C CD  . ARG A 1 211 ? -38.959 11.747  0.242   1.00 25.59  ? 380  ARG A CD  1 
ATOM   1506 N NE  . ARG A 1 211 ? -38.314 13.032  0.520   1.00 26.58  ? 380  ARG A NE  1 
ATOM   1507 C CZ  . ARG A 1 211 ? -37.029 13.296  0.262   1.00 30.93  ? 380  ARG A CZ  1 
ATOM   1508 N NH1 . ARG A 1 211 ? -36.218 12.373  -0.290  1.00 30.06  ? 380  ARG A NH1 1 
ATOM   1509 N NH2 . ARG A 1 211 ? -36.548 14.497  0.529   1.00 30.89  ? 380  ARG A NH2 1 
ATOM   1510 N N   . TYR A 1 212 ? -43.094 11.147  -2.844  1.00 23.03  ? 381  TYR A N   1 
ATOM   1511 C CA  . TYR A 1 212 ? -43.800 9.851   -2.972  1.00 26.28  ? 381  TYR A CA  1 
ATOM   1512 C C   . TYR A 1 212 ? -44.694 9.785   -4.224  1.00 26.64  ? 381  TYR A C   1 
ATOM   1513 O O   . TYR A 1 212 ? -45.420 8.808   -4.424  1.00 24.88  ? 381  TYR A O   1 
ATOM   1514 C CB  . TYR A 1 212 ? -44.654 9.569   -1.707  1.00 23.48  ? 381  TYR A CB  1 
ATOM   1515 C CG  . TYR A 1 212 ? -43.864 9.212   -0.443  1.00 22.25  ? 381  TYR A CG  1 
ATOM   1516 C CD1 . TYR A 1 212 ? -43.278 10.188  0.351   1.00 23.11  ? 381  TYR A CD1 1 
ATOM   1517 C CD2 . TYR A 1 212 ? -43.753 7.896   -0.025  1.00 23.62  ? 381  TYR A CD2 1 
ATOM   1518 C CE1 . TYR A 1 212 ? -42.584 9.852   1.525   1.00 23.42  ? 381  TYR A CE1 1 
ATOM   1519 C CE2 . TYR A 1 212 ? -43.058 7.544   1.122   1.00 21.70  ? 381  TYR A CE2 1 
ATOM   1520 C CZ  . TYR A 1 212 ? -42.479 8.526   1.910   1.00 25.18  ? 381  TYR A CZ  1 
ATOM   1521 O OH  . TYR A 1 212 ? -41.785 8.152   3.069   1.00 21.27  ? 381  TYR A OH  1 
ATOM   1522 N N   . MET A 1 213 ? -44.666 10.824  -5.057  1.00 21.85  ? 382  MET A N   1 
ATOM   1523 C CA  . MET A 1 213 ? -45.548 10.870  -6.254  1.00 24.41  ? 382  MET A CA  1 
ATOM   1524 C C   . MET A 1 213 ? -45.102 9.911   -7.345  1.00 20.13  ? 382  MET A C   1 
ATOM   1525 O O   . MET A 1 213 ? -43.937 9.887   -7.716  1.00 27.36  ? 382  MET A O   1 
ATOM   1526 C CB  . MET A 1 213 ? -45.614 12.265  -6.832  1.00 27.43  ? 382  MET A CB  1 
ATOM   1527 C CG  . MET A 1 213 ? -46.512 13.206  -6.069  1.00 29.15  ? 382  MET A CG  1 
ATOM   1528 S SD  . MET A 1 213 ? -46.458 14.871  -6.782  1.00 29.80  ? 382  MET A SD  1 
ATOM   1529 C CE  . MET A 1 213 ? -47.658 15.696  -5.745  1.00 34.27  ? 382  MET A CE  1 
ATOM   1530 N N   . ALA A 1 214 ? -46.041 9.103   -7.824  1.00 22.94  ? 383  ALA A N   1 
ATOM   1531 C CA  . ALA A 1 214 ? -45.818 8.204   -8.954  1.00 24.56  ? 383  ALA A CA  1 
ATOM   1532 C C   . ALA A 1 214 ? -45.510 8.999   -10.253 1.00 24.18  ? 383  ALA A C   1 
ATOM   1533 O O   . ALA A 1 214 ? -45.903 10.180  -10.369 1.00 22.45  ? 383  ALA A O   1 
ATOM   1534 C CB  . ALA A 1 214 ? -47.064 7.362   -9.167  1.00 23.25  ? 383  ALA A CB  1 
ATOM   1535 N N   . PRO A 1 215 ? -44.852 8.356   -11.227 1.00 28.87  ? 384  PRO A N   1 
ATOM   1536 C CA  . PRO A 1 215 ? -44.481 9.013   -12.485 1.00 30.10  ? 384  PRO A CA  1 
ATOM   1537 C C   . PRO A 1 215 ? -45.683 9.656   -13.169 1.00 26.50  ? 384  PRO A C   1 
ATOM   1538 O O   . PRO A 1 215 ? -45.587 10.783  -13.646 1.00 26.11  ? 384  PRO A O   1 
ATOM   1539 C CB  . PRO A 1 215 ? -43.957 7.864   -13.343 1.00 30.48  ? 384  PRO A CB  1 
ATOM   1540 C CG  . PRO A 1 215 ? -43.508 6.831   -12.373 1.00 36.50  ? 384  PRO A CG  1 
ATOM   1541 C CD  . PRO A 1 215 ? -44.336 6.979   -11.146 1.00 32.90  ? 384  PRO A CD  1 
ATOM   1542 N N   . GLU A 1 216 ? -46.806 8.944   -13.185 1.00 23.22  ? 385  GLU A N   1 
ATOM   1543 C CA  . GLU A 1 216 ? -47.998 9.427   -13.856 1.00 24.56  ? 385  GLU A CA  1 
ATOM   1544 C C   . GLU A 1 216 ? -48.641 10.628  -13.152 1.00 27.49  ? 385  GLU A C   1 
ATOM   1545 O O   . GLU A 1 216 ? -49.472 11.343  -13.740 1.00 27.41  ? 385  GLU A O   1 
ATOM   1546 C CB  . GLU A 1 216 ? -49.003 8.295   -14.022 1.00 28.02  ? 385  GLU A CB  1 
ATOM   1547 C CG  . GLU A 1 216 ? -49.648 7.734   -12.740 1.00 23.92  ? 385  GLU A CG  1 
ATOM   1548 C CD  . GLU A 1 216 ? -48.946 6.557   -12.097 1.00 25.70  ? 385  GLU A CD  1 
ATOM   1549 O OE1 . GLU A 1 216 ? -47.738 6.391   -12.308 1.00 24.87  ? 385  GLU A OE1 1 
ATOM   1550 O OE2 . GLU A 1 216 ? -49.624 5.775   -11.353 1.00 25.11  ? 385  GLU A OE2 1 
ATOM   1551 N N   . VAL A 1 217 ? -48.295 10.846  -11.883 1.00 26.45  ? 386  VAL A N   1 
ATOM   1552 C CA  . VAL A 1 217 ? -48.737 12.067  -11.215 1.00 24.13  ? 386  VAL A CA  1 
ATOM   1553 C C   . VAL A 1 217 ? -47.797 13.178  -11.638 1.00 25.34  ? 386  VAL A C   1 
ATOM   1554 O O   . VAL A 1 217 ? -48.216 14.269  -12.026 1.00 24.71  ? 386  VAL A O   1 
ATOM   1555 C CB  . VAL A 1 217 ? -48.763 11.933  -9.681  1.00 29.09  ? 386  VAL A CB  1 
ATOM   1556 C CG1 . VAL A 1 217 ? -49.115 13.264  -9.037  1.00 27.99  ? 386  VAL A CG1 1 
ATOM   1557 C CG2 . VAL A 1 217 ? -49.759 10.851  -9.246  1.00 31.90  ? 386  VAL A CG2 1 
ATOM   1558 N N   . LEU A 1 218 ? -46.509 12.881  -11.618 1.00 27.99  ? 387  LEU A N   1 
ATOM   1559 C CA  . LEU A 1 218 ? -45.501 13.866  -11.969 1.00 26.39  ? 387  LEU A CA  1 
ATOM   1560 C C   . LEU A 1 218 ? -45.595 14.348  -13.453 1.00 30.04  ? 387  LEU A C   1 
ATOM   1561 O O   . LEU A 1 218 ? -45.401 15.527  -13.718 1.00 27.31  ? 387  LEU A O   1 
ATOM   1562 C CB  . LEU A 1 218 ? -44.133 13.309  -11.639 1.00 28.53  ? 387  LEU A CB  1 
ATOM   1563 C CG  . LEU A 1 218 ? -43.824 13.108  -10.146 1.00 29.36  ? 387  LEU A CG  1 
ATOM   1564 C CD1 . LEU A 1 218 ? -42.539 12.319  -10.000 1.00 31.60  ? 387  LEU A CD1 1 
ATOM   1565 C CD2 . LEU A 1 218 ? -43.679 14.429  -9.431  1.00 30.38  ? 387  LEU A CD2 1 
ATOM   1566 N N   . ASP A 1 219 ? -45.910 13.451  -14.390 1.00 29.22  ? 388  ASP A N   1 
ATOM   1567 C CA  A ASP A 1 219 ? -46.050 13.863  -15.790 0.50 29.01  ? 388  ASP A CA  1 
ATOM   1568 C CA  B ASP A 1 219 ? -46.071 13.803  -15.809 0.50 30.30  ? 388  ASP A CA  1 
ATOM   1569 C C   . ASP A 1 219 ? -47.528 14.136  -16.161 1.00 28.95  ? 388  ASP A C   1 
ATOM   1570 O O   . ASP A 1 219 ? -47.838 14.481  -17.271 1.00 29.79  ? 388  ASP A O   1 
ATOM   1571 C CB  A ASP A 1 219 ? -45.384 12.846  -16.707 0.50 28.01  ? 388  ASP A CB  1 
ATOM   1572 C CB  B ASP A 1 219 ? -45.478 12.722  -16.737 0.50 31.73  ? 388  ASP A CB  1 
ATOM   1573 C CG  A ASP A 1 219 ? -43.887 13.140  -16.945 0.50 32.19  ? 388  ASP A CG  1 
ATOM   1574 C CG  B ASP A 1 219 ? -46.250 11.376  -16.729 0.50 39.87  ? 388  ASP A CG  1 
ATOM   1575 O OD1 A ASP A 1 219 ? -43.436 14.299  -16.741 0.50 33.44  ? 388  ASP A OD1 1 
ATOM   1576 O OD1 B ASP A 1 219 ? -47.452 11.327  -16.384 0.50 40.61  ? 388  ASP A OD1 1 
ATOM   1577 O OD2 A ASP A 1 219 ? -43.174 12.211  -17.398 0.50 33.97  ? 388  ASP A OD2 1 
ATOM   1578 O OD2 B ASP A 1 219 ? -45.628 10.345  -17.097 0.50 42.11  ? 388  ASP A OD2 1 
ATOM   1579 N N   . GLU A 1 220 ? -48.421 14.025  -15.185 1.00 32.78  ? 389  GLU A N   1 
ATOM   1580 C CA  . GLU A 1 220 ? -49.840 14.319  -15.347 1.00 31.01  ? 389  GLU A CA  1 
ATOM   1581 C C   . GLU A 1 220 ? -50.494 13.545  -16.475 1.00 32.53  ? 389  GLU A C   1 
ATOM   1582 O O   . GLU A 1 220 ? -51.306 14.073  -17.192 1.00 30.83  ? 389  GLU A O   1 
ATOM   1583 C CB  . GLU A 1 220 ? -50.095 15.824  -15.486 1.00 35.85  ? 389  GLU A CB  1 
ATOM   1584 C CG  . GLU A 1 220 ? -49.540 16.635  -14.320 1.00 45.59  ? 389  GLU A CG  1 
ATOM   1585 C CD  . GLU A 1 220 ? -49.904 18.112  -14.384 1.00 49.48  ? 389  GLU A CD  1 
ATOM   1586 O OE1 . GLU A 1 220 ? -49.746 18.711  -15.442 1.00 56.70  ? 389  GLU A OE1 1 
ATOM   1587 O OE2 . GLU A 1 220 ? -50.364 18.678  -13.383 1.00 59.70  ? 389  GLU A OE2 1 
ATOM   1588 N N   . THR A 1 221 ? -50.183 12.264  -16.593 1.00 27.85  ? 390  THR A N   1 
ATOM   1589 C CA  . THR A 1 221 ? -50.872 11.443  -17.558 1.00 31.20  ? 390  THR A CA  1 
ATOM   1590 C C   . THR A 1 221 ? -52.047 10.673  -16.930 1.00 34.34  ? 390  THR A C   1 
ATOM   1591 O O   . THR A 1 221 ? -52.734 9.955   -17.616 1.00 37.24  ? 390  THR A O   1 
ATOM   1592 C CB  . THR A 1 221 ? -49.898 10.439  -18.175 1.00 28.49  ? 390  THR A CB  1 
ATOM   1593 O OG1 . THR A 1 221 ? -49.294 9.666   -17.139 1.00 28.02  ? 390  THR A OG1 1 
ATOM   1594 C CG2 . THR A 1 221 ? -48.831 11.189  -18.904 1.00 34.60  ? 390  THR A CG2 1 
ATOM   1595 N N   . ILE A 1 222 ? -52.273 10.807  -15.633 1.00 29.48  ? 391  ILE A N   1 
ATOM   1596 C CA  . ILE A 1 222 ? -53.337 10.039  -15.009 1.00 31.09  ? 391  ILE A CA  1 
ATOM   1597 C C   . ILE A 1 222 ? -54.677 10.480  -15.547 1.00 29.31  ? 391  ILE A C   1 
ATOM   1598 O O   . ILE A 1 222 ? -54.933 11.664  -15.701 1.00 30.38  ? 391  ILE A O   1 
ATOM   1599 C CB  . ILE A 1 222 ? -53.271 10.070  -13.462 1.00 32.93  ? 391  ILE A CB  1 
ATOM   1600 C CG1 . ILE A 1 222 ? -54.517 9.473   -12.846 1.00 36.47  ? 391  ILE A CG1 1 
ATOM   1601 C CG2 . ILE A 1 222 ? -53.139 11.465  -12.901 1.00 39.92  ? 391  ILE A CG2 1 
ATOM   1602 C CD1 . ILE A 1 222 ? -54.254 8.963   -11.434 1.00 42.90  ? 391  ILE A CD1 1 
ATOM   1603 N N   . GLN A 1 223 ? -55.524 9.514   -15.886 1.00 31.41  ? 392  GLN A N   1 
ATOM   1604 C CA  . GLN A 1 223 ? -56.908 9.806   -16.268 1.00 28.88  ? 392  GLN A CA  1 
ATOM   1605 C C   . GLN A 1 223 ? -57.667 10.136  -14.970 1.00 29.84  ? 392  GLN A C   1 
ATOM   1606 O O   . GLN A 1 223 ? -57.926 9.256   -14.141 1.00 28.04  ? 392  GLN A O   1 
ATOM   1607 C CB  . GLN A 1 223 ? -57.524 8.618   -16.998 1.00 30.63  ? 392  GLN A CB  1 
ATOM   1608 C CG  . GLN A 1 223 ? -59.041 8.621   -17.071 1.00 34.95  ? 392  GLN A CG  1 
ATOM   1609 C CD  . GLN A 1 223 ? -59.624 9.782   -17.868 1.00 42.30  ? 392  GLN A CD  1 
ATOM   1610 O OE1 . GLN A 1 223 ? -60.453 10.550  -17.372 1.00 45.80  ? 392  GLN A OE1 1 
ATOM   1611 N NE2 . GLN A 1 223 ? -59.216 9.885   -19.116 1.00 37.77  ? 392  GLN A NE2 1 
ATOM   1612 N N   . VAL A 1 224 ? -57.974 11.418  -14.789 1.00 31.64  ? 393  VAL A N   1 
ATOM   1613 C CA  . VAL A 1 224 ? -58.462 11.957  -13.512 1.00 32.37  ? 393  VAL A CA  1 
ATOM   1614 C C   . VAL A 1 224 ? -59.829 11.444  -13.078 1.00 29.75  ? 393  VAL A C   1 
ATOM   1615 O O   . VAL A 1 224 ? -60.169 11.577  -11.929 1.00 29.33  ? 393  VAL A O   1 
ATOM   1616 C CB  . VAL A 1 224 ? -58.532 13.518  -13.510 1.00 39.53  ? 393  VAL A CB  1 
ATOM   1617 C CG1 . VAL A 1 224 ? -57.139 14.131  -13.714 1.00 40.73  ? 393  VAL A CG1 1 
ATOM   1618 C CG2 . VAL A 1 224 ? -59.530 14.033  -14.549 1.00 36.37  ? 393  VAL A CG2 1 
ATOM   1619 N N   . ASP A 1 225 ? -60.605 10.883  -14.002 1.00 29.76  ? 394  ASP A N   1 
ATOM   1620 C CA  . ASP A 1 225 ? -61.923 10.315  -13.703 1.00 34.90  ? 394  ASP A CA  1 
ATOM   1621 C C   . ASP A 1 225 ? -61.898 8.790   -13.567 1.00 29.29  ? 394  ASP A C   1 
ATOM   1622 O O   . ASP A 1 225 ? -62.945 8.169   -13.585 1.00 38.67  ? 394  ASP A O   1 
ATOM   1623 C CB  . ASP A 1 225 ? -62.897 10.683  -14.848 1.00 48.60  ? 394  ASP A CB  1 
ATOM   1624 C CG  . ASP A 1 225 ? -63.328 12.153  -14.823 1.00 73.94  ? 394  ASP A CG  1 
ATOM   1625 O OD1 . ASP A 1 225 ? -63.630 12.686  -13.718 1.00 86.22  ? 394  ASP A OD1 1 
ATOM   1626 O OD2 . ASP A 1 225 ? -63.384 12.762  -15.925 1.00 80.07  ? 394  ASP A OD2 1 
ATOM   1627 N N   . CYS A 1 226 ? -60.715 8.177   -13.533 1.00 29.19  ? 395  CYS A N   1 
ATOM   1628 C CA  . CYS A 1 226 ? -60.599 6.723   -13.445 1.00 30.08  ? 395  CYS A CA  1 
ATOM   1629 C C   . CYS A 1 226 ? -60.132 6.358   -12.028 1.00 29.04  ? 395  CYS A C   1 
ATOM   1630 O O   . CYS A 1 226 ? -58.965 6.540   -11.701 1.00 26.44  ? 395  CYS A O   1 
ATOM   1631 C CB  . CYS A 1 226 ? -59.612 6.193   -14.473 1.00 26.32  ? 395  CYS A CB  1 
ATOM   1632 S SG  . CYS A 1 226 ? -59.356 4.400   -14.393 1.00 29.62  ? 395  CYS A SG  1 
ATOM   1633 N N   . PHE A 1 227 ? -61.042 5.840   -11.198 1.00 24.84  ? 396  PHE A N   1 
ATOM   1634 C CA  . PHE A 1 227 ? -60.705 5.538   -9.816  1.00 25.99  ? 396  PHE A CA  1 
ATOM   1635 C C   . PHE A 1 227 ? -59.529 4.584   -9.722  1.00 23.94  ? 396  PHE A C   1 
ATOM   1636 O O   . PHE A 1 227 ? -58.596 4.776   -8.922  1.00 24.49  ? 396  PHE A O   1 
ATOM   1637 C CB  . PHE A 1 227 ? -61.928 5.032   -9.014  1.00 26.00  ? 396  PHE A CB  1 
ATOM   1638 C CG  . PHE A 1 227 ? -61.589 4.618   -7.613  1.00 27.37  ? 396  PHE A CG  1 
ATOM   1639 C CD1 . PHE A 1 227 ? -61.353 5.570   -6.635  1.00 26.66  ? 396  PHE A CD1 1 
ATOM   1640 C CD2 . PHE A 1 227 ? -61.443 3.278   -7.287  1.00 30.27  ? 396  PHE A CD2 1 
ATOM   1641 C CE1 . PHE A 1 227 ? -60.980 5.199   -5.353  1.00 27.82  ? 396  PHE A CE1 1 
ATOM   1642 C CE2 . PHE A 1 227 ? -61.090 2.894   -6.008  1.00 30.44  ? 396  PHE A CE2 1 
ATOM   1643 C CZ  . PHE A 1 227 ? -60.863 3.857   -5.031  1.00 31.00  ? 396  PHE A CZ  1 
ATOM   1644 N N   . ASP A 1 228 ? -59.537 3.564   -10.550 1.00 24.06  ? 397  ASP A N   1 
ATOM   1645 C CA  . ASP A 1 228 ? -58.471 2.569   -10.514 1.00 26.17  ? 397  ASP A CA  1 
ATOM   1646 C C   . ASP A 1 228 ? -57.106 3.202   -10.569 1.00 25.88  ? 397  ASP A C   1 
ATOM   1647 O O   . ASP A 1 228 ? -56.150 2.722   -9.959  1.00 25.16  ? 397  ASP A O   1 
ATOM   1648 C CB  . ASP A 1 228 ? -58.606 1.614   -11.696 1.00 25.32  ? 397  ASP A CB  1 
ATOM   1649 C CG  . ASP A 1 228 ? -57.556 0.545   -11.701 1.00 26.90  ? 397  ASP A CG  1 
ATOM   1650 O OD1 . ASP A 1 228 ? -57.697 -0.410  -10.918 1.00 31.91  ? 397  ASP A OD1 1 
ATOM   1651 O OD2 . ASP A 1 228 ? -56.597 0.622   -12.509 1.00 24.59  ? 397  ASP A OD2 1 
ATOM   1652 N N   . SER A 1 229 ? -56.996 4.258   -11.353 1.00 25.05  ? 398  SER A N   1 
ATOM   1653 C CA  . SER A 1 229 ? -55.711 4.912   -11.535 1.00 26.57  ? 398  SER A CA  1 
ATOM   1654 C C   . SER A 1 229 ? -55.179 5.448   -10.195 1.00 24.57  ? 398  SER A C   1 
ATOM   1655 O O   . SER A 1 229 ? -53.969 5.406   -9.946  1.00 24.89  ? 398  SER A O   1 
ATOM   1656 C CB  . SER A 1 229 ? -55.834 6.009   -12.623 1.00 25.80  ? 398  SER A CB  1 
ATOM   1657 O OG  . SER A 1 229 ? -56.189 5.395   -13.859 1.00 25.55  ? 398  SER A OG  1 
ATOM   1658 N N   . TYR A 1 230 ? -56.076 5.925   -9.341  1.00 22.96  ? 399  TYR A N   1 
ATOM   1659 C CA  . TYR A 1 230 ? -55.664 6.491   -8.060  1.00 25.54  ? 399  TYR A CA  1 
ATOM   1660 C C   . TYR A 1 230 ? -55.209 5.413   -7.100  1.00 23.87  ? 399  TYR A C   1 
ATOM   1661 O O   . TYR A 1 230 ? -54.264 5.625   -6.343  1.00 22.90  ? 399  TYR A O   1 
ATOM   1662 C CB  . TYR A 1 230 ? -56.775 7.311   -7.440  1.00 25.81  ? 399  TYR A CB  1 
ATOM   1663 C CG  . TYR A 1 230 ? -57.062 8.561   -8.205  1.00 27.22  ? 399  TYR A CG  1 
ATOM   1664 C CD1 . TYR A 1 230 ? -56.340 9.719   -7.981  1.00 28.13  ? 399  TYR A CD1 1 
ATOM   1665 C CD2 . TYR A 1 230 ? -58.037 8.586   -9.159  1.00 35.28  ? 399  TYR A CD2 1 
ATOM   1666 C CE1 . TYR A 1 230 ? -56.618 10.881  -8.678  1.00 31.86  ? 399  TYR A CE1 1 
ATOM   1667 C CE2 . TYR A 1 230 ? -58.323 9.734   -9.860  1.00 39.35  ? 399  TYR A CE2 1 
ATOM   1668 C CZ  . TYR A 1 230 ? -57.614 10.880  -9.619  1.00 37.06  ? 399  TYR A CZ  1 
ATOM   1669 O OH  . TYR A 1 230 ? -57.906 12.004  -10.346 1.00 34.59  ? 399  TYR A OH  1 
ATOM   1670 N N   . LYS A 1 231 ? -55.824 4.236   -7.172  1.00 22.56  ? 400  LYS A N   1 
ATOM   1671 C CA  . LYS A 1 231 ? -55.342 3.108   -6.378  1.00 22.50  ? 400  LYS A CA  1 
ATOM   1672 C C   . LYS A 1 231 ? -53.893 2.760   -6.728  1.00 25.16  ? 400  LYS A C   1 
ATOM   1673 O O   . LYS A 1 231 ? -53.066 2.446   -5.849  1.00 22.76  ? 400  LYS A O   1 
ATOM   1674 C CB  . LYS A 1 231 ? -56.249 1.879   -6.560  1.00 23.23  ? 400  LYS A CB  1 
ATOM   1675 C CG  . LYS A 1 231 ? -57.617 1.970   -5.924  1.00 22.94  ? 400  LYS A CG  1 
ATOM   1676 C CD  . LYS A 1 231 ? -58.303 0.617   -5.862  1.00 24.31  ? 400  LYS A CD  1 
ATOM   1677 C CE  . LYS A 1 231 ? -58.684 0.121   -7.257  1.00 27.52  ? 400  LYS A CE  1 
ATOM   1678 N NZ  . LYS A 1 231 ? -59.338 -1.218  -7.296  1.00 24.84  ? 400  LYS A NZ  1 
ATOM   1679 N N   . ARG A 1 232 ? -53.569 2.822   -8.016  1.00 26.38  ? 401  ARG A N   1 
ATOM   1680 C CA  . ARG A 1 232 ? -52.216 2.444   -8.480  1.00 25.27  ? 401  ARG A CA  1 
ATOM   1681 C C   . ARG A 1 232 ? -51.156 3.468   -8.109  1.00 23.20  ? 401  ARG A C   1 
ATOM   1682 O O   . ARG A 1 232 ? -50.005 3.127   -7.913  1.00 22.13  ? 401  ARG A O   1 
ATOM   1683 C CB  . ARG A 1 232 ? -52.236 2.140   -9.981  1.00 25.69  ? 401  ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 232 ? -52.963 0.822   -10.251 1.00 26.70  ? 401  ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 232 ? -53.328 0.589   -11.694 1.00 31.42  ? 401  ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 232 ? -54.245 -0.525  -11.771 1.00 31.37  ? 401  ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 232 ? -53.899 -1.806  -11.650 1.00 29.57  ? 401  ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 232 ? -52.638 -2.183  -11.553 1.00 29.94  ? 401  ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 232 ? -54.833 -2.728  -11.689 1.00 35.25  ? 401  ARG A NH2 1 
ATOM   1690 N N   . VAL A 1 233 ? -51.567 4.713   -7.973  1.00 21.00  ? 402  VAL A N   1 
ATOM   1691 C CA  . VAL A 1 233 ? -50.735 5.757   -7.403  1.00 21.03  ? 402  VAL A CA  1 
ATOM   1692 C C   . VAL A 1 233 ? -50.401 5.440   -5.928  1.00 23.08  ? 402  VAL A C   1 
ATOM   1693 O O   . VAL A 1 233 ? -49.248 5.604   -5.518  1.00 20.53  ? 402  VAL A O   1 
ATOM   1694 C CB  . VAL A 1 233 ? -51.438 7.126   -7.529  1.00 22.45  ? 402  VAL A CB  1 
ATOM   1695 C CG1 . VAL A 1 233 ? -50.734 8.211   -6.730  1.00 22.31  ? 402  VAL A CG1 1 
ATOM   1696 C CG2 . VAL A 1 233 ? -51.559 7.530   -8.986  1.00 25.10  ? 402  VAL A CG2 1 
ATOM   1697 N N   . ASP A 1 234 ? -51.398 4.993   -5.144  1.00 21.26  ? 403  ASP A N   1 
ATOM   1698 C CA  . ASP A 1 234 ? -51.154 4.620   -3.761  1.00 20.05  ? 403  ASP A CA  1 
ATOM   1699 C C   . ASP A 1 234 ? -50.141 3.445   -3.686  1.00 19.76  ? 403  ASP A C   1 
ATOM   1700 O O   . ASP A 1 234 ? -49.323 3.370   -2.761  1.00 21.39  ? 403  ASP A O   1 
ATOM   1701 C CB  . ASP A 1 234 ? -52.442 4.156   -3.056  1.00 20.27  ? 403  ASP A CB  1 
ATOM   1702 C CG  . ASP A 1 234 ? -53.393 5.287   -2.627  1.00 20.55  ? 403  ASP A CG  1 
ATOM   1703 O OD1 . ASP A 1 234 ? -53.072 6.476   -2.640  1.00 22.26  ? 403  ASP A OD1 1 
ATOM   1704 O OD2 . ASP A 1 234 ? -54.534 4.921   -2.255  1.00 18.79  ? 403  ASP A OD2 1 
ATOM   1705 N N   . ILE A 1 235 ? -50.255 2.492   -4.615  1.00 22.40  ? 404  ILE A N   1 
ATOM   1706 C CA  . ILE A 1 235 ? -49.387 1.320   -4.632  1.00 20.67  ? 404  ILE A CA  1 
ATOM   1707 C C   . ILE A 1 235 ? -47.926 1.722   -4.850  1.00 20.38  ? 404  ILE A C   1 
ATOM   1708 O O   . ILE A 1 235 ? -47.024 1.183   -4.199  1.00 23.83  ? 404  ILE A O   1 
ATOM   1709 C CB  . ILE A 1 235 ? -49.810 0.277   -5.669  1.00 23.34  ? 404  ILE A CB  1 
ATOM   1710 C CG1 . ILE A 1 235 ? -51.191 -0.300  -5.365  1.00 23.69  ? 404  ILE A CG1 1 
ATOM   1711 C CG2 . ILE A 1 235 ? -48.758 -0.817  -5.778  1.00 26.18  ? 404  ILE A CG2 1 
ATOM   1712 C CD1 . ILE A 1 235 ? -51.383 -0.977  -4.022  1.00 29.34  ? 404  ILE A CD1 1 
ATOM   1713 N N   . TRP A 1 236 ? -47.687 2.711   -5.700  1.00 23.78  ? 405  TRP A N   1 
ATOM   1714 C CA  . TRP A 1 236 ? -46.317 3.221   -5.897  1.00 24.31  ? 405  TRP A CA  1 
ATOM   1715 C C   . TRP A 1 236 ? -45.776 3.710   -4.555  1.00 24.69  ? 405  TRP A C   1 
ATOM   1716 O O   . TRP A 1 236 ? -44.691 3.305   -4.100  1.00 21.21  ? 405  TRP A O   1 
ATOM   1717 C CB  . TRP A 1 236 ? -46.304 4.320   -6.968  1.00 22.93  ? 405  TRP A CB  1 
ATOM   1718 C CG  . TRP A 1 236 ? -45.064 5.092   -7.046  1.00 21.90  ? 405  TRP A CG  1 
ATOM   1719 C CD1 . TRP A 1 236 ? -44.697 6.118   -6.232  1.00 22.67  ? 405  TRP A CD1 1 
ATOM   1720 C CD2 . TRP A 1 236 ? -44.005 4.924   -7.994  1.00 21.64  ? 405  TRP A CD2 1 
ATOM   1721 N NE1 . TRP A 1 236 ? -43.464 6.597   -6.601  1.00 24.93  ? 405  TRP A NE1 1 
ATOM   1722 C CE2 . TRP A 1 236 ? -43.023 5.880   -7.691  1.00 23.66  ? 405  TRP A CE2 1 
ATOM   1723 C CE3 . TRP A 1 236 ? -43.797 4.065   -9.072  1.00 26.41  ? 405  TRP A CE3 1 
ATOM   1724 C CZ2 . TRP A 1 236 ? -41.854 5.998   -8.420  1.00 23.36  ? 405  TRP A CZ2 1 
ATOM   1725 C CZ3 . TRP A 1 236 ? -42.628 4.176   -9.800  1.00 24.98  ? 405  TRP A CZ3 1 
ATOM   1726 C CH2 . TRP A 1 236 ? -41.667 5.136   -9.460  1.00 27.62  ? 405  TRP A CH2 1 
ATOM   1727 N N   . ALA A 1 237 ? -46.568 4.544   -3.889  1.00 22.42  ? 406  ALA A N   1 
ATOM   1728 C CA  . ALA A 1 237 ? -46.138 5.121   -2.618  1.00 22.22  ? 406  ALA A CA  1 
ATOM   1729 C C   . ALA A 1 237 ? -45.923 4.023   -1.561  1.00 20.81  ? 406  ALA A C   1 
ATOM   1730 O O   . ALA A 1 237 ? -44.956 4.085   -0.804  1.00 20.53  ? 406  ALA A O   1 
ATOM   1731 C CB  . ALA A 1 237 ? -47.142 6.149   -2.143  1.00 24.24  ? 406  ALA A CB  1 
ATOM   1732 N N   . PHE A 1 238 ? -46.790 3.011   -1.546  1.00 19.45  ? 407  PHE A N   1 
ATOM   1733 C CA  A PHE A 1 238 ? -46.648 1.888   -0.614  0.50 20.61  ? 407  PHE A CA  1 
ATOM   1734 C CA  B PHE A 1 238 ? -46.651 1.876   -0.613  0.50 21.03  ? 407  PHE A CA  1 
ATOM   1735 C C   . PHE A 1 238 ? -45.324 1.155   -0.835  1.00 22.80  ? 407  PHE A C   1 
ATOM   1736 O O   . PHE A 1 238 ? -44.641 0.751   0.126   1.00 23.45  ? 407  PHE A O   1 
ATOM   1737 C CB  A PHE A 1 238 ? -47.836 0.938   -0.770  0.50 21.00  ? 407  PHE A CB  1 
ATOM   1738 C CB  B PHE A 1 238 ? -47.826 0.888   -0.749  0.50 22.09  ? 407  PHE A CB  1 
ATOM   1739 C CG  A PHE A 1 238 ? -47.827 -0.225  0.178   0.50 19.70  ? 407  PHE A CG  1 
ATOM   1740 C CG  B PHE A 1 238 ? -47.664 -0.375  0.064   0.50 21.29  ? 407  PHE A CG  1 
ATOM   1741 C CD1 A PHE A 1 238 ? -47.155 -0.157  1.388   0.50 21.13  ? 407  PHE A CD1 1 
ATOM   1742 C CD1 B PHE A 1 238 ? -47.006 -1.471  -0.457  0.50 24.60  ? 407  PHE A CD1 1 
ATOM   1743 C CD2 A PHE A 1 238 ? -48.538 -1.365  -0.122  0.50 19.08  ? 407  PHE A CD2 1 
ATOM   1744 C CD2 B PHE A 1 238 ? -48.170 -0.465  1.348   0.50 21.28  ? 407  PHE A CD2 1 
ATOM   1745 C CE1 A PHE A 1 238 ? -47.164 -1.229  2.261   0.50 21.03  ? 407  PHE A CE1 1 
ATOM   1746 C CE1 B PHE A 1 238 ? -46.839 -2.628  0.295   0.50 23.69  ? 407  PHE A CE1 1 
ATOM   1747 C CE2 A PHE A 1 238 ? -48.554 -2.435  0.744   0.50 20.86  ? 407  PHE A CE2 1 
ATOM   1748 C CE2 B PHE A 1 238 ? -48.011 -1.612  2.097   0.50 21.15  ? 407  PHE A CE2 1 
ATOM   1749 C CZ  A PHE A 1 238 ? -47.871 -2.362  1.942   0.50 21.56  ? 407  PHE A CZ  1 
ATOM   1750 C CZ  B PHE A 1 238 ? -47.342 -2.694  1.570   0.50 23.40  ? 407  PHE A CZ  1 
ATOM   1751 N N   . GLY A 1 239 ? -44.930 0.990   -2.094  1.00 22.54  ? 408  GLY A N   1 
ATOM   1752 C CA  . GLY A 1 239 ? -43.632 0.357   -2.394  1.00 19.53  ? 408  GLY A CA  1 
ATOM   1753 C C   . GLY A 1 239 ? -42.492 1.122   -1.757  1.00 19.95  ? 408  GLY A C   1 
ATOM   1754 O O   . GLY A 1 239 ? -41.585 0.542   -1.191  1.00 19.21  ? 408  GLY A O   1 
ATOM   1755 N N   . LEU A 1 240 ? -42.540 2.438   -1.852  1.00 20.71  ? 409  LEU A N   1 
ATOM   1756 C CA  . LEU A 1 240 ? -41.545 3.283   -1.189  1.00 22.66  ? 409  LEU A CA  1 
ATOM   1757 C C   . LEU A 1 240 ? -41.556 3.085   0.339   1.00 23.84  ? 409  LEU A C   1 
ATOM   1758 O O   . LEU A 1 240 ? -40.494 2.984   0.957   1.00 23.22  ? 409  LEU A O   1 
ATOM   1759 C CB  . LEU A 1 240 ? -41.731 4.767   -1.550  1.00 22.06  ? 409  LEU A CB  1 
ATOM   1760 C CG  . LEU A 1 240 ? -41.726 5.138   -3.055  1.00 23.99  ? 409  LEU A CG  1 
ATOM   1761 C CD1 . LEU A 1 240 ? -41.893 6.629   -3.282  1.00 22.36  ? 409  LEU A CD1 1 
ATOM   1762 C CD2 . LEU A 1 240 ? -40.443 4.679   -3.732  1.00 22.39  ? 409  LEU A CD2 1 
ATOM   1763 N N   . VAL A 1 241 ? -42.742 2.986   0.940   1.00 23.72  ? 410  VAL A N   1 
ATOM   1764 C CA  . VAL A 1 241 ? -42.826 2.744   2.395   1.00 22.35  ? 410  VAL A CA  1 
ATOM   1765 C C   . VAL A 1 241 ? -42.201 1.392   2.735   1.00 22.29  ? 410  VAL A C   1 
ATOM   1766 O O   . VAL A 1 241 ? -41.451 1.268   3.699   1.00 20.06  ? 410  VAL A O   1 
ATOM   1767 C CB  . VAL A 1 241 ? -44.266 2.835   2.938   1.00 20.74  ? 410  VAL A CB  1 
ATOM   1768 C CG1 . VAL A 1 241 ? -44.292 2.494   4.422   1.00 22.44  ? 410  VAL A CG1 1 
ATOM   1769 C CG2 . VAL A 1 241 ? -44.817 4.230   2.706   1.00 21.37  ? 410  VAL A CG2 1 
ATOM   1770 N N   . LEU A 1 242 ? -42.464 0.401   1.893   1.00 21.79  ? 411  LEU A N   1 
ATOM   1771 C CA  A LEU A 1 242 ? -41.917 -0.928  2.068   0.50 22.97  ? 411  LEU A CA  1 
ATOM   1772 C CA  B LEU A 1 242 ? -41.903 -0.936  2.087   0.50 21.46  ? 411  LEU A CA  1 
ATOM   1773 C C   . LEU A 1 242 ? -40.396 -0.903  2.125   1.00 22.63  ? 411  LEU A C   1 
ATOM   1774 O O   . LEU A 1 242 ? -39.768 -1.550  2.982   1.00 22.15  ? 411  LEU A O   1 
ATOM   1775 C CB  A LEU A 1 242 ? -42.386 -1.801  0.915   0.50 24.78  ? 411  LEU A CB  1 
ATOM   1776 C CB  B LEU A 1 242 ? -42.333 -1.910  0.991   0.50 20.70  ? 411  LEU A CB  1 
ATOM   1777 C CG  A LEU A 1 242 ? -42.140 -3.292  0.956   0.50 27.43  ? 411  LEU A CG  1 
ATOM   1778 C CG  B LEU A 1 242 ? -43.776 -2.383  1.003   0.50 20.01  ? 411  LEU A CG  1 
ATOM   1779 C CD1 A LEU A 1 242 ? -42.575 -3.875  2.288   0.50 31.33  ? 411  LEU A CD1 1 
ATOM   1780 C CD1 B LEU A 1 242 ? -44.057 -3.227  -0.222  0.50 21.30  ? 411  LEU A CD1 1 
ATOM   1781 C CD2 A LEU A 1 242 ? -42.892 -3.908  -0.211  0.50 27.60  ? 411  LEU A CD2 1 
ATOM   1782 C CD2 B LEU A 1 242 ? -44.049 -3.162  2.262   0.50 20.52  ? 411  LEU A CD2 1 
ATOM   1783 N N   . TRP A 1 243 ? -39.819 -0.168  1.199   1.00 22.91  ? 412  TRP A N   1 
ATOM   1784 C CA  . TRP A 1 243 ? -38.384 0.006   1.150   1.00 25.34  ? 412  TRP A CA  1 
ATOM   1785 C C   . TRP A 1 243 ? -37.867 0.682   2.426   1.00 23.08  ? 412  TRP A C   1 
ATOM   1786 O O   . TRP A 1 243 ? -36.876 0.238   2.990   1.00 24.46  ? 412  TRP A O   1 
ATOM   1787 C CB  . TRP A 1 243 ? -38.026 0.804   -0.123  1.00 23.83  ? 412  TRP A CB  1 
ATOM   1788 C CG  . TRP A 1 243 ? -36.611 1.134   -0.323  1.00 23.20  ? 412  TRP A CG  1 
ATOM   1789 C CD1 . TRP A 1 243 ? -35.692 0.394   -0.980  1.00 24.41  ? 412  TRP A CD1 1 
ATOM   1790 C CD2 . TRP A 1 243 ? -35.956 2.328   0.078   1.00 23.45  ? 412  TRP A CD2 1 
ATOM   1791 N NE1 . TRP A 1 243 ? -34.489 1.052   -1.014  1.00 23.95  ? 412  TRP A NE1 1 
ATOM   1792 C CE2 . TRP A 1 243 ? -34.620 2.239   -0.364  1.00 25.95  ? 412  TRP A CE2 1 
ATOM   1793 C CE3 . TRP A 1 243 ? -36.355 3.457   0.798   1.00 23.92  ? 412  TRP A CE3 1 
ATOM   1794 C CZ2 . TRP A 1 243 ? -33.676 3.243   -0.116  1.00 26.76  ? 412  TRP A CZ2 1 
ATOM   1795 C CZ3 . TRP A 1 243 ? -35.427 4.447   1.051   1.00 23.80  ? 412  TRP A CZ3 1 
ATOM   1796 C CH2 . TRP A 1 243 ? -34.095 4.334   0.586   1.00 27.60  ? 412  TRP A CH2 1 
ATOM   1797 N N   . GLU A 1 244 ? -38.516 1.753   2.867   1.00 23.02  ? 413  GLU A N   1 
ATOM   1798 C CA  . GLU A 1 244 ? -38.121 2.441   4.095   1.00 23.89  ? 413  GLU A CA  1 
ATOM   1799 C C   . GLU A 1 244 ? -38.038 1.488   5.297   1.00 23.60  ? 413  GLU A C   1 
ATOM   1800 O O   . GLU A 1 244 ? -37.134 1.607   6.133   1.00 24.88  ? 413  GLU A O   1 
ATOM   1801 C CB  . GLU A 1 244 ? -39.145 3.523   4.470   1.00 26.34  ? 413  GLU A CB  1 
ATOM   1802 C CG  . GLU A 1 244 ? -39.131 4.772   3.619   1.00 25.97  ? 413  GLU A CG  1 
ATOM   1803 C CD  . GLU A 1 244 ? -40.215 5.763   4.008   1.00 23.76  ? 413  GLU A CD  1 
ATOM   1804 O OE1 . GLU A 1 244 ? -40.027 6.531   4.996   1.00 21.34  ? 413  GLU A OE1 1 
ATOM   1805 O OE2 . GLU A 1 244 ? -41.255 5.780   3.296   1.00 23.32  ? 413  GLU A OE2 1 
ATOM   1806 N N   . VAL A 1 245 ? -39.019 0.595   5.395   1.00 21.86  ? 414  VAL A N   1 
ATOM   1807 C CA  . VAL A 1 245 ? -39.146 -0.312  6.516   1.00 22.90  ? 414  VAL A CA  1 
ATOM   1808 C C   . VAL A 1 245 ? -38.101 -1.425  6.393   1.00 23.99  ? 414  VAL A C   1 
ATOM   1809 O O   . VAL A 1 245 ? -37.425 -1.753  7.378   1.00 20.41  ? 414  VAL A O   1 
ATOM   1810 C CB  . VAL A 1 245 ? -40.583 -0.891  6.626   1.00 21.42  ? 414  VAL A CB  1 
ATOM   1811 C CG1 . VAL A 1 245 ? -40.673 -1.932  7.712   1.00 22.49  ? 414  VAL A CG1 1 
ATOM   1812 C CG2 . VAL A 1 245 ? -41.609 0.203   6.909   1.00 24.67  ? 414  VAL A CG2 1 
ATOM   1813 N N   . ALA A 1 246 ? -37.959 -2.000  5.191   1.00 22.98  ? 415  ALA A N   1 
ATOM   1814 C CA  . ALA A 1 246 ? -37.071 -3.145  4.998   1.00 23.26  ? 415  ALA A CA  1 
ATOM   1815 C C   . ALA A 1 246 ? -35.623 -2.785  5.313   1.00 24.70  ? 415  ALA A C   1 
ATOM   1816 O O   . ALA A 1 246 ? -34.872 -3.590  5.861   1.00 23.16  ? 415  ALA A O   1 
ATOM   1817 C CB  . ALA A 1 246 ? -37.196 -3.694  3.587   1.00 27.80  ? 415  ALA A CB  1 
ATOM   1818 N N   . ARG A 1 247 ? -35.219 -1.576  4.967   1.00 26.01  ? 416  ARG A N   1 
ATOM   1819 C CA  . ARG A 1 247 ? -33.886 -1.089  5.346   1.00 26.95  ? 416  ARG A CA  1 
ATOM   1820 C C   . ARG A 1 247 ? -33.566 -1.247  6.833   1.00 28.10  ? 416  ARG A C   1 
ATOM   1821 O O   . ARG A 1 247 ? -32.405 -1.435  7.206   1.00 27.93  ? 416  ARG A O   1 
ATOM   1822 C CB  . ARG A 1 247 ? -33.748 0.381   4.977   1.00 27.69  ? 416  ARG A CB  1 
ATOM   1823 C CG  . ARG A 1 247 ? -33.560 0.589   3.495   1.00 28.95  ? 416  ARG A CG  1 
ATOM   1824 C CD  . ARG A 1 247 ? -33.521 2.067   3.156   1.00 32.99  ? 416  ARG A CD  1 
ATOM   1825 N NE  . ARG A 1 247 ? -32.441 2.793   3.820   1.00 32.24  ? 416  ARG A NE  1 
ATOM   1826 C CZ  . ARG A 1 247 ? -31.223 2.981   3.323   1.00 33.11  ? 416  ARG A CZ  1 
ATOM   1827 N NH1 . ARG A 1 247 ? -30.843 2.457   2.155   1.00 34.29  ? 416  ARG A NH1 1 
ATOM   1828 N NH2 . ARG A 1 247 ? -30.355 3.668   4.027   1.00 34.19  ? 416  ARG A NH2 1 
ATOM   1829 N N   . ARG A 1 248 ? -34.590 -1.151  7.675   1.00 27.66  ? 417  ARG A N   1 
ATOM   1830 C CA  . ARG A 1 248 ? -34.405 -1.191  9.128   1.00 27.73  ? 417  ARG A CA  1 
ATOM   1831 C C   . ARG A 1 248 ? -34.538 -2.570  9.745   1.00 28.82  ? 417  ARG A C   1 
ATOM   1832 O O   . ARG A 1 248 ? -34.393 -2.734  10.959  1.00 30.04  ? 417  ARG A O   1 
ATOM   1833 C CB  . ARG A 1 248 ? -35.390 -0.247  9.773   1.00 26.12  ? 417  ARG A CB  1 
ATOM   1834 C CG  . ARG A 1 248 ? -35.312 1.171   9.230   1.00 28.33  ? 417  ARG A CG  1 
ATOM   1835 C CD  . ARG A 1 248 ? -33.948 1.781   9.468   1.00 26.61  ? 417  ARG A CD  1 
ATOM   1836 N NE  . ARG A 1 248 ? -33.837 2.220   10.849  1.00 27.00  ? 417  ARG A NE  1 
ATOM   1837 C CZ  . ARG A 1 248 ? -32.700 2.302   11.550  1.00 28.85  ? 417  ARG A CZ  1 
ATOM   1838 N NH1 . ARG A 1 248 ? -31.545 1.963   11.040  1.00 28.26  ? 417  ARG A NH1 1 
ATOM   1839 N NH2 . ARG A 1 248 ? -32.731 2.707   12.799  1.00 31.28  ? 417  ARG A NH2 1 
ATOM   1840 N N   . MET A 1 249 ? -34.807 -3.573  8.923   1.00 27.49  ? 418  MET A N   1 
ATOM   1841 C CA  . MET A 1 249 ? -34.833 -4.945  9.403   1.00 27.58  ? 418  MET A CA  1 
ATOM   1842 C C   . MET A 1 249 ? -33.420 -5.472  9.395   1.00 29.93  ? 418  MET A C   1 
ATOM   1843 O O   . MET A 1 249 ? -32.722 -5.355  8.402   1.00 29.14  ? 418  MET A O   1 
ATOM   1844 C CB  . MET A 1 249 ? -35.727 -5.819  8.529   1.00 26.73  ? 418  MET A CB  1 
ATOM   1845 C CG  . MET A 1 249 ? -35.882 -7.243  9.034   1.00 28.53  ? 418  MET A CG  1 
ATOM   1846 S SD  . MET A 1 249 ? -36.642 -8.357  7.827   1.00 30.70  ? 418  MET A SD  1 
ATOM   1847 C CE  . MET A 1 249 ? -35.416 -9.654  7.822   1.00 34.88  ? 418  MET A CE  1 
ATOM   1848 N N   . VAL A 1 250 ? -32.995 -6.044  10.511  1.00 27.65  ? 419  VAL A N   1 
ATOM   1849 C CA  . VAL A 1 250 ? -31.661 -6.625  10.596  1.00 28.93  ? 419  VAL A CA  1 
ATOM   1850 C C   . VAL A 1 250 ? -31.597 -7.988  9.892   1.00 30.57  ? 419  VAL A C   1 
ATOM   1851 O O   . VAL A 1 250 ? -32.496 -8.815  10.024  1.00 28.23  ? 419  VAL A O   1 
ATOM   1852 C CB  . VAL A 1 250 ? -31.239 -6.824  12.069  1.00 31.92  ? 419  VAL A CB  1 
ATOM   1853 C CG1 . VAL A 1 250 ? -29.831 -7.386  12.151  1.00 39.38  ? 419  VAL A CG1 1 
ATOM   1854 C CG2 . VAL A 1 250 ? -31.308 -5.505  12.829  1.00 34.75  ? 419  VAL A CG2 1 
ATOM   1855 N N   . SER A 1 251 ? -30.519 -8.238  9.163   1.00 31.78  ? 420  SER A N   1 
ATOM   1856 C CA  . SER A 1 251 ? -30.214 -9.595  8.700   1.00 35.70  ? 420  SER A CA  1 
ATOM   1857 C C   . SER A 1 251 ? -28.718 -9.814  8.813   1.00 37.71  ? 420  SER A C   1 
ATOM   1858 O O   . SER A 1 251 ? -27.948 -8.923  8.465   1.00 32.20  ? 420  SER A O   1 
ATOM   1859 C CB  . SER A 1 251 ? -30.684 -9.826  7.253   1.00 31.43  ? 420  SER A CB  1 
ATOM   1860 O OG  . SER A 1 251 ? -29.945 -9.065  6.310   1.00 34.93  ? 420  SER A OG  1 
ATOM   1861 N N   . ASN A 1 252 ? -28.311 -10.979 9.324   1.00 43.61  ? 421  ASN A N   1 
ATOM   1862 C CA  A ASN A 1 252 ? -26.871 -11.325 9.427   0.50 40.16  ? 421  ASN A CA  1 
ATOM   1863 C CA  B ASN A 1 252 ? -26.909 -11.333 9.409   0.50 42.06  ? 421  ASN A CA  1 
ATOM   1864 C C   . ASN A 1 252 ? -26.102 -10.210 10.095  1.00 38.58  ? 421  ASN A C   1 
ATOM   1865 O O   . ASN A 1 252 ? -25.015 -9.837  9.659   1.00 48.81  ? 421  ASN A O   1 
ATOM   1866 C CB  A ASN A 1 252 ? -26.233 -11.611 8.049   0.50 38.08  ? 421  ASN A CB  1 
ATOM   1867 C CB  B ASN A 1 252 ? -26.424 -11.693 7.988   0.50 42.50  ? 421  ASN A CB  1 
ATOM   1868 C CG  A ASN A 1 252 ? -24.793 -12.153 8.154   0.50 36.19  ? 421  ASN A CG  1 
ATOM   1869 C CG  B ASN A 1 252 ? -27.193 -12.894 7.396   0.50 42.29  ? 421  ASN A CG  1 
ATOM   1870 O OD1 A ASN A 1 252 ? -24.482 -12.970 9.027   0.50 34.13  ? 421  ASN A OD1 1 
ATOM   1871 O OD1 B ASN A 1 252 ? -27.225 -13.968 8.010   0.50 44.02  ? 421  ASN A OD1 1 
ATOM   1872 N ND2 A ASN A 1 252 ? -23.914 -11.685 7.268   0.50 33.30  ? 421  ASN A ND2 1 
ATOM   1873 N ND2 B ASN A 1 252 ? -27.823 -12.715 6.216   0.50 36.25  ? 421  ASN A ND2 1 
ATOM   1874 N N   . GLY A 1 253 ? -26.677 -9.660  11.159  1.00 43.47  ? 422  GLY A N   1 
ATOM   1875 C CA  . GLY A 1 253 ? -26.034 -8.607  11.941  1.00 47.60  ? 422  GLY A CA  1 
ATOM   1876 C C   . GLY A 1 253 ? -25.972 -7.224  11.318  1.00 45.61  ? 422  GLY A C   1 
ATOM   1877 O O   . GLY A 1 253 ? -25.450 -6.295  11.945  1.00 47.43  ? 422  GLY A O   1 
ATOM   1878 N N   . ILE A 1 254 ? -26.560 -7.063  10.128  1.00 40.97  ? 423  ILE A N   1 
ATOM   1879 C CA  . ILE A 1 254 ? -26.406 -5.847  9.302   1.00 39.60  ? 423  ILE A CA  1 
ATOM   1880 C C   . ILE A 1 254 ? -27.750 -5.118  9.171   1.00 37.42  ? 423  ILE A C   1 
ATOM   1881 O O   . ILE A 1 254 ? -28.798 -5.737  9.048   1.00 34.89  ? 423  ILE A O   1 
ATOM   1882 C CB  . ILE A 1 254 ? -25.906 -6.230  7.891   1.00 44.90  ? 423  ILE A CB  1 
ATOM   1883 C CG1 . ILE A 1 254 ? -24.535 -6.902  7.957   1.00 54.75  ? 423  ILE A CG1 1 
ATOM   1884 C CG2 . ILE A 1 254 ? -25.809 -5.024  6.961   1.00 47.93  ? 423  ILE A CG2 1 
ATOM   1885 C CD1 . ILE A 1 254 ? -24.164 -7.628  6.666   1.00 55.66  ? 423  ILE A CD1 1 
ATOM   1886 N N   . VAL A 1 255 ? -27.713 -3.792  9.163   1.00 38.00  ? 424  VAL A N   1 
ATOM   1887 C CA  . VAL A 1 255 ? -28.899 -3.003  8.930   1.00 34.02  ? 424  VAL A CA  1 
ATOM   1888 C C   . VAL A 1 255 ? -28.494 -1.682  8.222   1.00 34.73  ? 424  VAL A C   1 
ATOM   1889 O O   . VAL A 1 255 ? -27.394 -1.243  8.371   1.00 32.31  ? 424  VAL A O   1 
ATOM   1890 C CB  . VAL A 1 255 ? -29.592 -2.773  10.287  1.00 35.16  ? 424  VAL A CB  1 
ATOM   1891 C CG1 . VAL A 1 255 ? -28.938 -1.612  11.038  1.00 37.24  ? 424  VAL A CG1 1 
ATOM   1892 C CG2 . VAL A 1 255 ? -31.090 -2.569  10.122  1.00 32.29  ? 424  VAL A CG2 1 
ATOM   1893 N N   . GLU A 1 256 ? -29.371 -1.066  7.446   1.00 33.08  ? 425  GLU A N   1 
ATOM   1894 C CA  . GLU A 1 256 ? -29.127 0.267   6.907   1.00 29.52  ? 425  GLU A CA  1 
ATOM   1895 C C   . GLU A 1 256 ? -29.690 1.331   7.858   1.00 33.97  ? 425  GLU A C   1 
ATOM   1896 O O   . GLU A 1 256 ? -30.633 1.073   8.615   1.00 31.47  ? 425  GLU A O   1 
ATOM   1897 C CB  . GLU A 1 256 ? -29.798 0.419   5.540   1.00 31.33  ? 425  GLU A CB  1 
ATOM   1898 C CG  . GLU A 1 256 ? -29.127 -0.335  4.384   1.00 30.35  ? 425  GLU A CG  1 
ATOM   1899 C CD  . GLU A 1 256 ? -29.505 -1.809  4.319   1.00 32.90  ? 425  GLU A CD  1 
ATOM   1900 O OE1 . GLU A 1 256 ? -30.726 -2.106  4.233   1.00 31.64  ? 425  GLU A OE1 1 
ATOM   1901 O OE2 . GLU A 1 256 ? -28.588 -2.687  4.343   1.00 34.80  ? 425  GLU A OE2 1 
ATOM   1902 N N   . ASP A 1 257 ? -29.128 2.535   7.805   1.00 30.36  ? 426  ASP A N   1 
ATOM   1903 C CA  . ASP A 1 257 ? -29.690 3.676   8.513   1.00 32.56  ? 426  ASP A CA  1 
ATOM   1904 C C   . ASP A 1 257 ? -31.049 4.022   7.920   1.00 32.31  ? 426  ASP A C   1 
ATOM   1905 O O   . ASP A 1 257 ? -31.274 3.769   6.725   1.00 29.01  ? 426  ASP A O   1 
ATOM   1906 C CB  . ASP A 1 257 ? -28.811 4.914   8.305   1.00 36.21  ? 426  ASP A CB  1 
ATOM   1907 C CG  . ASP A 1 257 ? -27.424 4.764   8.881   1.00 40.29  ? 426  ASP A CG  1 
ATOM   1908 O OD1 . ASP A 1 257 ? -27.266 4.095   9.904   1.00 42.89  ? 426  ASP A OD1 1 
ATOM   1909 O OD2 . ASP A 1 257 ? -26.490 5.336   8.309   1.00 52.23  ? 426  ASP A OD2 1 
ATOM   1910 N N   . TYR A 1 258 ? -31.905 4.692   8.702   1.00 28.68  ? 427  TYR A N   1 
ATOM   1911 C CA  . TYR A 1 258 ? -33.105 5.288   8.144   1.00 26.95  ? 427  TYR A CA  1 
ATOM   1912 C C   . TYR A 1 258 ? -32.762 6.302   7.037   1.00 28.36  ? 427  TYR A C   1 
ATOM   1913 O O   . TYR A 1 258 ? -31.964 7.184   7.244   1.00 28.41  ? 427  TYR A O   1 
ATOM   1914 C CB  . TYR A 1 258 ? -34.042 5.977   9.168   1.00 26.96  ? 427  TYR A CB  1 
ATOM   1915 C CG  . TYR A 1 258 ? -35.239 6.516   8.390   1.00 25.80  ? 427  TYR A CG  1 
ATOM   1916 C CD1 . TYR A 1 258 ? -36.283 5.703   8.031   1.00 26.87  ? 427  TYR A CD1 1 
ATOM   1917 C CD2 . TYR A 1 258 ? -35.230 7.813   7.893   1.00 26.96  ? 427  TYR A CD2 1 
ATOM   1918 C CE1 . TYR A 1 258 ? -37.334 6.184   7.237   1.00 26.15  ? 427  TYR A CE1 1 
ATOM   1919 C CE2 . TYR A 1 258 ? -36.252 8.296   7.123   1.00 27.70  ? 427  TYR A CE2 1 
ATOM   1920 C CZ  . TYR A 1 258 ? -37.299 7.484   6.780   1.00 26.23  ? 427  TYR A CZ  1 
ATOM   1921 O OH  . TYR A 1 258 ? -38.280 8.012   5.964   1.00 27.75  ? 427  TYR A OH  1 
ATOM   1922 N N   . LYS A 1 259 ? -33.411 6.170   5.879   1.00 29.97  ? 428  LYS A N   1 
ATOM   1923 C CA  . LYS A 1 259 ? -33.420 7.241   4.877   1.00 29.22  ? 428  LYS A CA  1 
ATOM   1924 C C   . LYS A 1 259 ? -34.762 7.310   4.235   1.00 26.94  ? 428  LYS A C   1 
ATOM   1925 O O   . LYS A 1 259 ? -35.408 6.296   4.055   1.00 23.20  ? 428  LYS A O   1 
ATOM   1926 C CB  . LYS A 1 259 ? -32.421 6.984   3.756   1.00 31.66  ? 428  LYS A CB  1 
ATOM   1927 C CG  . LYS A 1 259 ? -30.978 6.930   4.188   1.00 31.35  ? 428  LYS A CG  1 
ATOM   1928 C CD  . LYS A 1 259 ? -30.513 8.300   4.647   1.00 37.20  ? 428  LYS A CD  1 
ATOM   1929 C CE  . LYS A 1 259 ? -29.053 8.228   5.086   1.00 44.26  ? 428  LYS A CE  1 
ATOM   1930 N NZ  . LYS A 1 259 ? -28.525 9.586   5.406   1.00 48.37  ? 428  LYS A NZ  1 
ATOM   1931 N N   . PRO A 1 260 ? -35.179 8.519   3.858   1.00 27.81  ? 429  PRO A N   1 
ATOM   1932 C CA  . PRO A 1 260 ? -36.381 8.638   3.072   1.00 25.88  ? 429  PRO A CA  1 
ATOM   1933 C C   . PRO A 1 260 ? -36.104 8.223   1.626   1.00 26.04  ? 429  PRO A C   1 
ATOM   1934 O O   . PRO A 1 260 ? -34.956 8.237   1.197   1.00 25.17  ? 429  PRO A O   1 
ATOM   1935 C CB  . PRO A 1 260 ? -36.714 10.126  3.172   1.00 28.79  ? 429  PRO A CB  1 
ATOM   1936 C CG  . PRO A 1 260 ? -35.368 10.787  3.283   1.00 32.56  ? 429  PRO A CG  1 
ATOM   1937 C CD  . PRO A 1 260 ? -34.509 9.819   4.065   1.00 29.51  ? 429  PRO A CD  1 
ATOM   1938 N N   . PRO A 1 261 ? -37.150 7.846   0.881   1.00 28.36  ? 430  PRO A N   1 
ATOM   1939 C CA  . PRO A 1 261 ? -37.012 7.452   -0.522  1.00 28.72  ? 430  PRO A CA  1 
ATOM   1940 C C   . PRO A 1 261 ? -36.327 8.552   -1.347  1.00 27.47  ? 430  PRO A C   1 
ATOM   1941 O O   . PRO A 1 261 ? -36.690 9.714   -1.200  1.00 25.90  ? 430  PRO A O   1 
ATOM   1942 C CB  . PRO A 1 261 ? -38.472 7.292   -1.002  1.00 27.66  ? 430  PRO A CB  1 
ATOM   1943 C CG  . PRO A 1 261 ? -39.320 7.280   0.207   1.00 29.83  ? 430  PRO A CG  1 
ATOM   1944 C CD  . PRO A 1 261 ? -38.554 7.867   1.340   1.00 29.64  ? 430  PRO A CD  1 
ATOM   1945 N N   . PHE A 1 262 ? -35.361 8.175   -2.188  1.00 26.55  ? 431  PHE A N   1 
ATOM   1946 C CA  . PHE A 1 262 ? -34.661 9.107   -3.082  1.00 29.65  ? 431  PHE A CA  1 
ATOM   1947 C C   . PHE A 1 262 ? -33.760 10.109  -2.351  1.00 30.17  ? 431  PHE A C   1 
ATOM   1948 O O   . PHE A 1 262 ? -33.426 11.173  -2.884  1.00 32.24  ? 431  PHE A O   1 
ATOM   1949 C CB  . PHE A 1 262 ? -35.666 9.829   -4.019  1.00 25.85  ? 431  PHE A CB  1 
ATOM   1950 C CG  . PHE A 1 262 ? -36.453 8.883   -4.887  1.00 26.81  ? 431  PHE A CG  1 
ATOM   1951 C CD1 . PHE A 1 262 ? -35.816 8.108   -5.821  1.00 25.96  ? 431  PHE A CD1 1 
ATOM   1952 C CD2 . PHE A 1 262 ? -37.823 8.752   -4.744  1.00 27.39  ? 431  PHE A CD2 1 
ATOM   1953 C CE1 . PHE A 1 262 ? -36.529 7.222   -6.616  1.00 29.88  ? 431  PHE A CE1 1 
ATOM   1954 C CE2 . PHE A 1 262 ? -38.544 7.868   -5.528  1.00 27.99  ? 431  PHE A CE2 1 
ATOM   1955 C CZ  . PHE A 1 262 ? -37.901 7.093   -6.465  1.00 28.23  ? 431  PHE A CZ  1 
ATOM   1956 N N   . TYR A 1 263 ? -33.342 9.758   -1.137  1.00 31.72  ? 432  TYR A N   1 
ATOM   1957 C CA  . TYR A 1 263 ? -32.430 10.602  -0.344  1.00 31.72  ? 432  TYR A CA  1 
ATOM   1958 C C   . TYR A 1 263 ? -31.134 10.949  -1.046  1.00 32.70  ? 432  TYR A C   1 
ATOM   1959 O O   . TYR A 1 263 ? -30.526 11.954  -0.746  1.00 33.72  ? 432  TYR A O   1 
ATOM   1960 C CB  . TYR A 1 263 ? -32.035 9.908   0.966   1.00 31.00  ? 432  TYR A CB  1 
ATOM   1961 C CG  . TYR A 1 263 ? -31.078 8.746   0.777   1.00 29.42  ? 432  TYR A CG  1 
ATOM   1962 C CD1 . TYR A 1 263 ? -31.527 7.542   0.311   1.00 29.28  ? 432  TYR A CD1 1 
ATOM   1963 C CD2 . TYR A 1 263 ? -29.732 8.863   1.071   1.00 29.40  ? 432  TYR A CD2 1 
ATOM   1964 C CE1 . TYR A 1 263 ? -30.669 6.478   0.134   1.00 32.94  ? 432  TYR A CE1 1 
ATOM   1965 C CE2 . TYR A 1 263 ? -28.844 7.789   0.882   1.00 31.57  ? 432  TYR A CE2 1 
ATOM   1966 C CZ  . TYR A 1 263 ? -29.329 6.601   0.413   1.00 36.09  ? 432  TYR A CZ  1 
ATOM   1967 O OH  . TYR A 1 263 ? -28.517 5.506   0.231   1.00 40.10  ? 432  TYR A OH  1 
ATOM   1968 N N   . ASP A 1 264 ? -30.705 10.083  -1.944  1.00 33.59  ? 433  ASP A N   1 
ATOM   1969 C CA  . ASP A 1 264 ? -29.407 10.211  -2.569  1.00 34.77  ? 433  ASP A CA  1 
ATOM   1970 C C   . ASP A 1 264 ? -29.448 11.039  -3.857  1.00 36.10  ? 433  ASP A C   1 
ATOM   1971 O O   . ASP A 1 264 ? -28.414 11.286  -4.420  1.00 40.31  ? 433  ASP A O   1 
ATOM   1972 C CB  . ASP A 1 264 ? -28.831 8.815   -2.855  1.00 31.88  ? 433  ASP A CB  1 
ATOM   1973 C CG  . ASP A 1 264 ? -29.767 7.940   -3.686  1.00 35.08  ? 433  ASP A CG  1 
ATOM   1974 O OD1 . ASP A 1 264 ? -30.946 8.297   -3.887  1.00 37.90  ? 433  ASP A OD1 1 
ATOM   1975 O OD2 . ASP A 1 264 ? -29.334 6.866   -4.128  1.00 34.92  ? 433  ASP A OD2 1 
ATOM   1976 N N   . VAL A 1 265 ? -30.626 11.433  -4.342  1.00 34.71  ? 434  VAL A N   1 
ATOM   1977 C CA  . VAL A 1 265 ? -30.720 12.126  -5.628  1.00 32.17  ? 434  VAL A CA  1 
ATOM   1978 C C   . VAL A 1 265 ? -31.625 13.349  -5.586  1.00 36.07  ? 434  VAL A C   1 
ATOM   1979 O O   . VAL A 1 265 ? -31.727 14.077  -6.570  1.00 34.06  ? 434  VAL A O   1 
ATOM   1980 C CB  . VAL A 1 265 ? -31.192 11.174  -6.754  1.00 33.45  ? 434  VAL A CB  1 
ATOM   1981 C CG1 . VAL A 1 265 ? -30.157 10.099  -7.001  1.00 32.95  ? 434  VAL A CG1 1 
ATOM   1982 C CG2 . VAL A 1 265 ? -32.536 10.517  -6.420  1.00 36.74  ? 434  VAL A CG2 1 
ATOM   1983 N N   . VAL A 1 266 ? -32.311 13.595  -4.473  1.00 34.00  ? 435  VAL A N   1 
ATOM   1984 C CA  . VAL A 1 266 ? -33.055 14.840  -4.382  1.00 31.24  ? 435  VAL A CA  1 
ATOM   1985 C C   . VAL A 1 266 ? -32.755 15.513  -3.058  1.00 34.09  ? 435  VAL A C   1 
ATOM   1986 O O   . VAL A 1 266 ? -32.346 14.878  -2.096  1.00 35.71  ? 435  VAL A O   1 
ATOM   1987 C CB  . VAL A 1 266 ? -34.575 14.676  -4.597  1.00 30.10  ? 435  VAL A CB  1 
ATOM   1988 C CG1 . VAL A 1 266 ? -34.860 13.978  -5.915  1.00 32.41  ? 435  VAL A CG1 1 
ATOM   1989 C CG2 . VAL A 1 266 ? -35.236 13.919  -3.444  1.00 33.00  ? 435  VAL A CG2 1 
ATOM   1990 N N   . PRO A 1 267 ? -32.939 16.818  -3.013  1.00 37.45  ? 436  PRO A N   1 
ATOM   1991 C CA  . PRO A 1 267 ? -32.690 17.487  -1.756  1.00 38.27  ? 436  PRO A CA  1 
ATOM   1992 C C   . PRO A 1 267 ? -33.881 17.309  -0.837  1.00 40.24  ? 436  PRO A C   1 
ATOM   1993 O O   . PRO A 1 267 ? -34.884 16.702  -1.257  1.00 38.71  ? 436  PRO A O   1 
ATOM   1994 C CB  . PRO A 1 267 ? -32.568 18.952  -2.176  1.00 41.27  ? 436  PRO A CB  1 
ATOM   1995 C CG  . PRO A 1 267 ? -33.451 19.074  -3.374  1.00 44.59  ? 436  PRO A CG  1 
ATOM   1996 C CD  . PRO A 1 267 ? -33.416 17.735  -4.065  1.00 41.64  ? 436  PRO A CD  1 
ATOM   1997 N N   . ASN A 1 268 ? -33.765 17.810  0.402   1.00 38.69  ? 437  ASN A N   1 
ATOM   1998 C CA  A ASN A 1 268 ? -34.917 17.974  1.293   0.50 39.15  ? 437  ASN A CA  1 
ATOM   1999 C CA  B ASN A 1 268 ? -34.924 17.914  1.271   0.50 39.47  ? 437  ASN A CA  1 
ATOM   2000 C C   . ASN A 1 268 ? -35.945 18.864  0.620   1.00 37.20  ? 437  ASN A C   1 
ATOM   2001 O O   . ASN A 1 268 ? -35.586 19.816  -0.082  1.00 37.65  ? 437  ASN A O   1 
ATOM   2002 C CB  A ASN A 1 268 ? -34.502 18.609  2.629   0.50 44.22  ? 437  ASN A CB  1 
ATOM   2003 C CB  B ASN A 1 268 ? -34.513 18.345  2.696   0.50 45.31  ? 437  ASN A CB  1 
ATOM   2004 C CG  A ASN A 1 268 ? -35.671 18.765  3.595   0.50 44.45  ? 437  ASN A CG  1 
ATOM   2005 C CG  B ASN A 1 268 ? -33.805 17.223  3.473   0.50 42.98  ? 437  ASN A CG  1 
ATOM   2006 O OD1 A ASN A 1 268 ? -36.228 17.780  4.089   0.50 47.66  ? 437  ASN A OD1 1 
ATOM   2007 O OD1 B ASN A 1 268 ? -34.412 16.224  3.856   0.50 43.21  ? 437  ASN A OD1 1 
ATOM   2008 N ND2 A ASN A 1 268 ? -36.057 20.004  3.852   0.50 43.88  ? 437  ASN A ND2 1 
ATOM   2009 N ND2 B ASN A 1 268 ? -32.515 17.385  3.689   0.50 44.66  ? 437  ASN A ND2 1 
ATOM   2010 N N   . ASP A 1 269 ? -37.220 18.569  0.814   1.00 38.93  ? 438  ASP A N   1 
ATOM   2011 C CA  . ASP A 1 269 ? -38.292 19.377  0.230   1.00 41.15  ? 438  ASP A CA  1 
ATOM   2012 C C   . ASP A 1 269 ? -38.130 19.512  -1.301  1.00 40.92  ? 438  ASP A C   1 
ATOM   2013 O O   . ASP A 1 269 ? -38.025 20.603  -1.839  1.00 37.25  ? 438  ASP A O   1 
ATOM   2014 C CB  . ASP A 1 269 ? -38.365 20.753  0.909   1.00 45.58  ? 438  ASP A CB  1 
ATOM   2015 C CG  . ASP A 1 269 ? -39.699 21.461  0.665   1.00 60.77  ? 438  ASP A CG  1 
ATOM   2016 O OD1 . ASP A 1 269 ? -40.727 20.777  0.472   1.00 62.16  ? 438  ASP A OD1 1 
ATOM   2017 O OD2 . ASP A 1 269 ? -39.729 22.707  0.666   1.00 75.37  ? 438  ASP A OD2 1 
ATOM   2018 N N   . PRO A 1 270 ? -38.131 18.382  -2.004  1.00 40.48  ? 439  PRO A N   1 
ATOM   2019 C CA  . PRO A 1 270 ? -37.816 18.425  -3.429  1.00 37.25  ? 439  PRO A CA  1 
ATOM   2020 C C   . PRO A 1 270 ? -38.909 19.104  -4.254  1.00 35.61  ? 439  PRO A C   1 
ATOM   2021 O O   . PRO A 1 270 ? -40.075 19.100  -3.863  1.00 39.86  ? 439  PRO A O   1 
ATOM   2022 C CB  . PRO A 1 270 ? -37.655 16.949  -3.800  1.00 38.37  ? 439  PRO A CB  1 
ATOM   2023 C CG  . PRO A 1 270 ? -38.454 16.205  -2.775  1.00 36.59  ? 439  PRO A CG  1 
ATOM   2024 C CD  . PRO A 1 270 ? -38.342 17.010  -1.512  1.00 34.97  ? 439  PRO A CD  1 
ATOM   2025 N N   . SER A 1 271 ? -38.510 19.731  -5.356  1.00 32.35  ? 440  SER A N   1 
ATOM   2026 C CA  . SER A 1 271 ? -39.464 20.328  -6.301  1.00 33.94  ? 440  SER A CA  1 
ATOM   2027 C C   . SER A 1 271 ? -40.100 19.269  -7.194  1.00 31.94  ? 440  SER A C   1 
ATOM   2028 O O   . SER A 1 271 ? -39.589 18.154  -7.303  1.00 30.28  ? 440  SER A O   1 
ATOM   2029 C CB  . SER A 1 271 ? -38.742 21.312  -7.204  1.00 34.73  ? 440  SER A CB  1 
ATOM   2030 O OG  . SER A 1 271 ? -37.752 20.661  -7.985  1.00 37.92  ? 440  SER A OG  1 
ATOM   2031 N N   . PHE A 1 272 ? -41.193 19.624  -7.861  1.00 35.51  ? 441  PHE A N   1 
ATOM   2032 C CA  . PHE A 1 272 ? -41.716 18.780  -8.962  1.00 35.09  ? 441  PHE A CA  1 
ATOM   2033 C C   . PHE A 1 272 ? -40.609 18.410  -9.954  1.00 35.89  ? 441  PHE A C   1 
ATOM   2034 O O   . PHE A 1 272 ? -40.462 17.249  -10.355 1.00 36.08  ? 441  PHE A O   1 
ATOM   2035 C CB  . PHE A 1 272 ? -42.854 19.491  -9.710  1.00 31.73  ? 441  PHE A CB  1 
ATOM   2036 C CG  . PHE A 1 272 ? -44.139 19.547  -8.940  1.00 33.00  ? 441  PHE A CG  1 
ATOM   2037 C CD1 . PHE A 1 272 ? -44.780 18.386  -8.564  1.00 33.57  ? 441  PHE A CD1 1 
ATOM   2038 C CD2 . PHE A 1 272 ? -44.709 20.768  -8.589  1.00 41.17  ? 441  PHE A CD2 1 
ATOM   2039 C CE1 . PHE A 1 272 ? -45.960 18.439  -7.838  1.00 42.68  ? 441  PHE A CE1 1 
ATOM   2040 C CE2 . PHE A 1 272 ? -45.894 20.837  -7.863  1.00 40.66  ? 441  PHE A CE2 1 
ATOM   2041 C CZ  . PHE A 1 272 ? -46.527 19.663  -7.493  1.00 44.75  ? 441  PHE A CZ  1 
ATOM   2042 N N   . GLU A 1 273 ? -39.814 19.402  -10.335 1.00 36.16  ? 442  GLU A N   1 
ATOM   2043 C CA  . GLU A 1 273 ? -38.806 19.199  -11.357 1.00 35.68  ? 442  GLU A CA  1 
ATOM   2044 C C   . GLU A 1 273 ? -37.765 18.206  -10.856 1.00 33.82  ? 442  GLU A C   1 
ATOM   2045 O O   . GLU A 1 273 ? -37.305 17.331  -11.611 1.00 29.56  ? 442  GLU A O   1 
ATOM   2046 C CB  . GLU A 1 273 ? -38.200 20.563  -11.768 1.00 44.52  ? 442  GLU A CB  1 
ATOM   2047 C CG  . GLU A 1 273 ? -36.817 20.516  -12.421 1.00 54.56  ? 442  GLU A CG  1 
ATOM   2048 C CD  . GLU A 1 273 ? -36.800 19.759  -13.743 1.00 66.45  ? 442  GLU A CD  1 
ATOM   2049 O OE1 . GLU A 1 273 ? -37.810 19.838  -14.490 1.00 62.97  ? 442  GLU A OE1 1 
ATOM   2050 O OE2 . GLU A 1 273 ? -35.774 19.081  -14.024 1.00 66.48  ? 442  GLU A OE2 1 
ATOM   2051 N N   . ASP A 1 274 ? -37.379 18.335  -9.585  1.00 33.70  ? 443  ASP A N   1 
ATOM   2052 C CA  . ASP A 1 274 ? -36.429 17.392  -8.982  1.00 33.60  ? 443  ASP A CA  1 
ATOM   2053 C C   . ASP A 1 274 ? -36.938 15.949  -9.135  1.00 28.95  ? 443  ASP A C   1 
ATOM   2054 O O   . ASP A 1 274 ? -36.210 15.043  -9.548  1.00 31.86  ? 443  ASP A O   1 
ATOM   2055 C CB  . ASP A 1 274 ? -36.272 17.679  -7.479  1.00 38.59  ? 443  ASP A CB  1 
ATOM   2056 C CG  . ASP A 1 274 ? -35.505 18.976  -7.178  1.00 42.81  ? 443  ASP A CG  1 
ATOM   2057 O OD1 . ASP A 1 274 ? -34.577 19.324  -7.928  1.00 43.42  ? 443  ASP A OD1 1 
ATOM   2058 O OD2 . ASP A 1 274 ? -35.820 19.621  -6.155  1.00 39.74  ? 443  ASP A OD2 1 
ATOM   2059 N N   . MET A 1 275 ? -38.190 15.749  -8.755  1.00 30.54  ? 444  MET A N   1 
ATOM   2060 C CA  . MET A 1 275 ? -38.796 14.414  -8.707  1.00 31.12  ? 444  MET A CA  1 
ATOM   2061 C C   . MET A 1 275 ? -39.022 13.862  -10.130 1.00 33.53  ? 444  MET A C   1 
ATOM   2062 O O   . MET A 1 275 ? -38.708 12.698  -10.415 1.00 31.31  ? 444  MET A O   1 
ATOM   2063 C CB  . MET A 1 275 ? -40.115 14.468  -7.928  1.00 26.74  ? 444  MET A CB  1 
ATOM   2064 C CG  . MET A 1 275 ? -39.967 14.643  -6.414  1.00 30.55  ? 444  MET A CG  1 
ATOM   2065 S SD  . MET A 1 275 ? -38.772 13.537  -5.661  1.00 28.81  ? 444  MET A SD  1 
ATOM   2066 C CE  . MET A 1 275 ? -39.468 11.957  -6.096  1.00 26.04  ? 444  MET A CE  1 
ATOM   2067 N N   . ARG A 1 276 ? -39.525 14.723  -11.010 1.00 37.40  ? 445  ARG A N   1 
ATOM   2068 C CA  . ARG A 1 276 ? -39.823 14.356  -12.408 1.00 36.58  ? 445  ARG A CA  1 
ATOM   2069 C C   . ARG A 1 276 ? -38.563 13.905  -13.078 1.00 30.97  ? 445  ARG A C   1 
ATOM   2070 O O   . ARG A 1 276 ? -38.549 12.887  -13.746 1.00 29.33  ? 445  ARG A O   1 
ATOM   2071 C CB  . ARG A 1 276 ? -40.442 15.528  -13.163 1.00 39.00  ? 445  ARG A CB  1 
ATOM   2072 C CG  . ARG A 1 276 ? -40.969 15.205  -14.563 1.00 46.22  ? 445  ARG A CG  1 
ATOM   2073 C CD  . ARG A 1 276 ? -41.926 16.273  -15.078 1.00 44.82  ? 445  ARG A CD  1 
ATOM   2074 N NE  . ARG A 1 276 ? -41.448 17.628  -14.740 1.00 61.26  ? 445  ARG A NE  1 
ATOM   2075 C CZ  . ARG A 1 276 ? -42.168 18.587  -14.145 1.00 60.05  ? 445  ARG A CZ  1 
ATOM   2076 N NH1 . ARG A 1 276 ? -43.441 18.387  -13.820 1.00 54.21  ? 445  ARG A NH1 1 
ATOM   2077 N NH2 . ARG A 1 276 ? -41.615 19.772  -13.888 1.00 62.32  ? 445  ARG A NH2 1 
ATOM   2078 N N   . LYS A 1 277 ? -37.468 14.594  -12.810 1.00 32.24  ? 446  LYS A N   1 
ATOM   2079 C CA  . LYS A 1 277 ? -36.207 14.236  -13.448 1.00 34.84  ? 446  LYS A CA  1 
ATOM   2080 C C   . LYS A 1 277 ? -35.704 12.875  -12.968 1.00 35.38  ? 446  LYS A C   1 
ATOM   2081 O O   . LYS A 1 277 ? -35.217 12.061  -13.772 1.00 37.20  ? 446  LYS A O   1 
ATOM   2082 C CB  . LYS A 1 277 ? -35.147 15.318  -13.217 1.00 42.56  ? 446  LYS A CB  1 
ATOM   2083 C CG  . LYS A 1 277 ? -33.869 15.072  -13.996 1.00 52.97  ? 446  LYS A CG  1 
ATOM   2084 C CD  . LYS A 1 277 ? -32.806 16.085  -13.629 1.00 75.84  ? 446  LYS A CD  1 
ATOM   2085 C CE  . LYS A 1 277 ? -31.447 15.758  -14.245 1.00 91.95  ? 446  LYS A CE  1 
ATOM   2086 N NZ  . LYS A 1 277 ? -31.103 14.306  -14.273 1.00 81.30  ? 446  LYS A NZ  1 
ATOM   2087 N N   . VAL A 1 278 ? -35.813 12.630  -11.665 1.00 32.83  ? 447  VAL A N   1 
ATOM   2088 C CA  . VAL A 1 278 ? -35.392 11.337  -11.092 1.00 31.52  ? 447  VAL A CA  1 
ATOM   2089 C C   . VAL A 1 278 ? -36.279 10.186  -11.560 1.00 27.57  ? 447  VAL A C   1 
ATOM   2090 O O   . VAL A 1 278 ? -35.802 9.141   -12.006 1.00 28.37  ? 447  VAL A O   1 
ATOM   2091 C CB  . VAL A 1 278 ? -35.393 11.406  -9.540  1.00 33.26  ? 447  VAL A CB  1 
ATOM   2092 C CG1 . VAL A 1 278 ? -35.228 10.043  -8.899  1.00 33.80  ? 447  VAL A CG1 1 
ATOM   2093 C CG2 . VAL A 1 278 ? -34.283 12.321  -9.055  1.00 37.47  ? 447  VAL A CG2 1 
ATOM   2094 N N   . VAL A 1 279 ? -37.576 10.389  -11.449 1.00 30.51  ? 448  VAL A N   1 
ATOM   2095 C CA  . VAL A 1 279 ? -38.538 9.297   -11.496 1.00 29.30  ? 448  VAL A CA  1 
ATOM   2096 C C   . VAL A 1 279 ? -39.025 9.065   -12.925 1.00 29.53  ? 448  VAL A C   1 
ATOM   2097 O O   . VAL A 1 279 ? -39.151 7.927   -13.360 1.00 33.48  ? 448  VAL A O   1 
ATOM   2098 C CB  . VAL A 1 279 ? -39.724 9.617   -10.544 1.00 28.52  ? 448  VAL A CB  1 
ATOM   2099 C CG1 . VAL A 1 279 ? -40.943 8.778   -10.834 1.00 28.50  ? 448  VAL A CG1 1 
ATOM   2100 C CG2 . VAL A 1 279 ? -39.287 9.392   -9.099  1.00 29.86  ? 448  VAL A CG2 1 
ATOM   2101 N N   . CYS A 1 280 ? -39.326 10.145  -13.634 1.00 30.75  ? 449  CYS A N   1 
ATOM   2102 C CA  . CYS A 1 280 ? -39.831 10.056  -15.009 1.00 30.72  ? 449  CYS A CA  1 
ATOM   2103 C C   . CYS A 1 280 ? -38.715 10.004  -16.050 1.00 31.22  ? 449  CYS A C   1 
ATOM   2104 O O   . CYS A 1 280 ? -38.602 9.021   -16.777 1.00 31.42  ? 449  CYS A O   1 
ATOM   2105 C CB  . CYS A 1 280 ? -40.731 11.211  -15.289 1.00 30.47  ? 449  CYS A CB  1 
ATOM   2106 S SG  . CYS A 1 280 ? -42.165 11.210  -14.213 1.00 31.93  ? 449  CYS A SG  1 
ATOM   2107 N N   . VAL A 1 281 ? -37.852 11.023  -16.070 1.00 31.90  ? 450  VAL A N   1 
ATOM   2108 C CA  . VAL A 1 281 ? -36.814 11.147  -17.117 1.00 31.95  ? 450  VAL A CA  1 
ATOM   2109 C C   . VAL A 1 281 ? -35.722 10.109  -16.963 1.00 30.95  ? 450  VAL A C   1 
ATOM   2110 O O   . VAL A 1 281 ? -35.390 9.451   -17.931 1.00 35.04  ? 450  VAL A O   1 
ATOM   2111 C CB  . VAL A 1 281 ? -36.208 12.575  -17.151 1.00 33.49  ? 450  VAL A CB  1 
ATOM   2112 C CG1 . VAL A 1 281 ? -35.115 12.689  -18.200 1.00 35.71  ? 450  VAL A CG1 1 
ATOM   2113 C CG2 . VAL A 1 281 ? -37.303 13.603  -17.387 1.00 30.26  ? 450  VAL A CG2 1 
ATOM   2114 N N   . ASP A 1 282 ? -35.168 9.953   -15.754 1.00 32.26  ? 451  ASP A N   1 
ATOM   2115 C CA  . ASP A 1 282 ? -34.087 8.982   -15.505 1.00 28.83  ? 451  ASP A CA  1 
ATOM   2116 C C   . ASP A 1 282 ? -34.602 7.597   -15.095 1.00 30.82  ? 451  ASP A C   1 
ATOM   2117 O O   . ASP A 1 282 ? -33.844 6.641   -14.994 1.00 28.58  ? 451  ASP A O   1 
ATOM   2118 C CB  . ASP A 1 282 ? -33.129 9.508   -14.444 1.00 33.91  ? 451  ASP A CB  1 
ATOM   2119 C CG  . ASP A 1 282 ? -32.358 10.743  -14.913 1.00 40.64  ? 451  ASP A CG  1 
ATOM   2120 O OD1 . ASP A 1 282 ? -32.638 11.250  -16.009 1.00 37.65  ? 451  ASP A OD1 1 
ATOM   2121 O OD2 . ASP A 1 282 ? -31.466 11.211  -14.189 1.00 47.51  ? 451  ASP A OD2 1 
ATOM   2122 N N   . GLN A 1 283 ? -35.901 7.484   -14.854 1.00 34.33  ? 452  GLN A N   1 
ATOM   2123 C CA  . GLN A 1 283 ? -36.506 6.196   -14.483 1.00 38.90  ? 452  GLN A CA  1 
ATOM   2124 C C   . GLN A 1 283 ? -35.818 5.534   -13.295 1.00 30.08  ? 452  GLN A C   1 
ATOM   2125 O O   . GLN A 1 283 ? -35.622 4.343   -13.284 1.00 30.69  ? 452  GLN A O   1 
ATOM   2126 C CB  . GLN A 1 283 ? -36.508 5.265   -15.711 1.00 39.29  ? 452  GLN A CB  1 
ATOM   2127 C CG  . GLN A 1 283 ? -37.335 5.859   -16.845 1.00 47.68  ? 452  GLN A CG  1 
ATOM   2128 C CD  . GLN A 1 283 ? -37.381 4.977   -18.059 1.00 48.08  ? 452  GLN A CD  1 
ATOM   2129 O OE1 . GLN A 1 283 ? -36.367 4.698   -18.689 1.00 56.68  ? 452  GLN A OE1 1 
ATOM   2130 N NE2 . GLN A 1 283 ? -38.554 4.537   -18.390 1.00 51.50  ? 452  GLN A NE2 1 
ATOM   2131 N N   . GLN A 1 284 ? -35.415 6.319   -12.317 1.00 27.57  ? 453  GLN A N   1 
ATOM   2132 C CA  . GLN A 1 284 ? -34.703 5.774   -11.174 1.00 33.61  ? 453  GLN A CA  1 
ATOM   2133 C C   . GLN A 1 284 ? -35.669 5.166   -10.146 1.00 32.52  ? 453  GLN A C   1 
ATOM   2134 O O   . GLN A 1 284 ? -36.832 5.553   -10.083 1.00 28.19  ? 453  GLN A O   1 
ATOM   2135 C CB  . GLN A 1 284 ? -33.894 6.868   -10.515 1.00 41.27  ? 453  GLN A CB  1 
ATOM   2136 C CG  . GLN A 1 284 ? -32.837 7.438   -11.442 1.00 47.07  ? 453  GLN A CG  1 
ATOM   2137 C CD  . GLN A 1 284 ? -31.515 7.542   -10.763 1.00 53.52  ? 453  GLN A CD  1 
ATOM   2138 O OE1 . GLN A 1 284 ? -30.826 6.538   -10.571 1.00 69.69  ? 453  GLN A OE1 1 
ATOM   2139 N NE2 . GLN A 1 284 ? -31.158 8.751   -10.361 1.00 59.43  ? 453  GLN A NE2 1 
ATOM   2140 N N   . ARG A 1 285 ? -35.172 4.190   -9.396  1.00 32.17  ? 454  ARG A N   1 
ATOM   2141 C CA  . ARG A 1 285 ? -35.900 3.570   -8.321  1.00 31.34  ? 454  ARG A CA  1 
ATOM   2142 C C   . ARG A 1 285 ? -34.943 3.383   -7.172  1.00 31.52  ? 454  ARG A C   1 
ATOM   2143 O O   . ARG A 1 285 ? -33.738 3.269   -7.398  1.00 33.13  ? 454  ARG A O   1 
ATOM   2144 C CB  . ARG A 1 285 ? -36.438 2.198   -8.733  1.00 30.59  ? 454  ARG A CB  1 
ATOM   2145 C CG  . ARG A 1 285 ? -37.387 2.207   -9.919  1.00 33.42  ? 454  ARG A CG  1 
ATOM   2146 C CD  . ARG A 1 285 ? -38.631 3.052   -9.735  1.00 32.43  ? 454  ARG A CD  1 
ATOM   2147 N NE  . ARG A 1 285 ? -39.477 2.983   -10.938 1.00 30.36  ? 454  ARG A NE  1 
ATOM   2148 C CZ  . ARG A 1 285 ? -39.573 3.918   -11.886 1.00 33.72  ? 454  ARG A CZ  1 
ATOM   2149 N NH1 . ARG A 1 285 ? -38.889 5.060   -11.824 1.00 33.95  ? 454  ARG A NH1 1 
ATOM   2150 N NH2 . ARG A 1 285 ? -40.389 3.719   -12.912 1.00 40.42  ? 454  ARG A NH2 1 
ATOM   2151 N N   . PRO A 1 286 ? -35.471 3.319   -5.930  1.00 29.21  ? 455  PRO A N   1 
ATOM   2152 C CA  . PRO A 1 286 ? -34.604 3.098   -4.786  1.00 28.65  ? 455  PRO A CA  1 
ATOM   2153 C C   . PRO A 1 286 ? -33.739 1.850   -4.989  1.00 27.39  ? 455  PRO A C   1 
ATOM   2154 O O   . PRO A 1 286 ? -34.209 0.870   -5.543  1.00 28.51  ? 455  PRO A O   1 
ATOM   2155 C CB  . PRO A 1 286 ? -35.595 2.899   -3.630  1.00 28.46  ? 455  PRO A CB  1 
ATOM   2156 C CG  . PRO A 1 286 ? -36.825 3.624   -4.051  1.00 30.03  ? 455  PRO A CG  1 
ATOM   2157 C CD  . PRO A 1 286 ? -36.893 3.447   -5.537  1.00 26.61  ? 455  PRO A CD  1 
ATOM   2158 N N   . ASN A 1 287 ? -32.478 1.924   -4.589  1.00 28.50  ? 456  ASN A N   1 
ATOM   2159 C CA  . ASN A 1 287 ? -31.564 0.792   -4.703  1.00 32.45  ? 456  ASN A CA  1 
ATOM   2160 C C   . ASN A 1 287 ? -31.813 -0.273  -3.639  1.00 32.01  ? 456  ASN A C   1 
ATOM   2161 O O   . ASN A 1 287 ? -32.087 0.054   -2.493  1.00 25.00  ? 456  ASN A O   1 
ATOM   2162 C CB  . ASN A 1 287 ? -30.130 1.278   -4.551  1.00 34.56  ? 456  ASN A CB  1 
ATOM   2163 C CG  . ASN A 1 287 ? -29.684 2.152   -5.717  1.00 43.18  ? 456  ASN A CG  1 
ATOM   2164 O OD1 . ASN A 1 287 ? -30.120 1.970   -6.860  1.00 44.12  ? 456  ASN A OD1 1 
ATOM   2165 N ND2 . ASN A 1 287 ? -28.818 3.113   -5.429  1.00 40.70  ? 456  ASN A ND2 1 
ATOM   2166 N N   . ILE A 1 288 ? -31.706 -1.534  -4.037  1.00 33.71  ? 457  ILE A N   1 
ATOM   2167 C CA  . ILE A 1 288 ? -31.791 -2.661  -3.121  1.00 36.35  ? 457  ILE A CA  1 
ATOM   2168 C C   . ILE A 1 288 ? -30.393 -2.982  -2.593  1.00 34.81  ? 457  ILE A C   1 
ATOM   2169 O O   . ILE A 1 288 ? -29.512 -3.320  -3.362  1.00 33.79  ? 457  ILE A O   1 
ATOM   2170 C CB  . ILE A 1 288 ? -32.313 -3.902  -3.839  1.00 31.20  ? 457  ILE A CB  1 
ATOM   2171 C CG1 . ILE A 1 288 ? -33.639 -3.596  -4.540  1.00 34.21  ? 457  ILE A CG1 1 
ATOM   2172 C CG2 . ILE A 1 288 ? -32.435 -5.056  -2.860  1.00 30.98  ? 457  ILE A CG2 1 
ATOM   2173 C CD1 . ILE A 1 288 ? -34.670 -2.905  -3.664  1.00 34.49  ? 457  ILE A CD1 1 
ATOM   2174 N N   . PRO A 1 289 ? -30.176 -2.852  -1.283  1.00 36.14  ? 458  PRO A N   1 
ATOM   2175 C CA  . PRO A 1 289 ? -28.866 -3.209  -0.719  1.00 34.02  ? 458  PRO A CA  1 
ATOM   2176 C C   . PRO A 1 289 ? -28.490 -4.683  -0.964  1.00 39.58  ? 458  PRO A C   1 
ATOM   2177 O O   . PRO A 1 289 ? -29.343 -5.564  -0.826  1.00 37.08  ? 458  PRO A O   1 
ATOM   2178 C CB  . PRO A 1 289 ? -29.067 -2.966  0.777   1.00 40.58  ? 458  PRO A CB  1 
ATOM   2179 C CG  . PRO A 1 289 ? -30.166 -1.963  0.876   1.00 38.18  ? 458  PRO A CG  1 
ATOM   2180 C CD  . PRO A 1 289 ? -31.081 -2.267  -0.273  1.00 34.11  ? 458  PRO A CD  1 
ATOM   2181 N N   . ASN A 1 290 ? -27.226 -4.952  -1.294  1.00 42.43  ? 459  ASN A N   1 
ATOM   2182 C CA  . ASN A 1 290 ? -26.787 -6.320  -1.590  1.00 45.75  ? 459  ASN A CA  1 
ATOM   2183 C C   . ASN A 1 290 ? -27.069 -7.308  -0.492  1.00 39.66  ? 459  ASN A C   1 
ATOM   2184 O O   . ASN A 1 290 ? -27.541 -8.419  -0.767  1.00 37.26  ? 459  ASN A O   1 
ATOM   2185 C CB  . ASN A 1 290 ? -25.303 -6.365  -1.955  1.00 57.74  ? 459  ASN A CB  1 
ATOM   2186 C CG  . ASN A 1 290 ? -25.062 -5.959  -3.395  1.00 75.28  ? 459  ASN A CG  1 
ATOM   2187 O OD1 . ASN A 1 290 ? -25.735 -6.449  -4.318  1.00 81.57  ? 459  ASN A OD1 1 
ATOM   2188 N ND2 . ASN A 1 290 ? -24.121 -5.045  -3.598  1.00 69.32  ? 459  ASN A ND2 1 
ATOM   2189 N N   . ARG A 1 291 ? -26.828 -6.896  0.750   1.00 35.97  ? 460  ARG A N   1 
ATOM   2190 C CA  . ARG A 1 291 ? -27.102 -7.768  1.896   1.00 34.69  ? 460  ARG A CA  1 
ATOM   2191 C C   . ARG A 1 291 ? -28.532 -8.341  1.929   1.00 37.31  ? 460  ARG A C   1 
ATOM   2192 O O   . ARG A 1 291 ? -28.740 -9.401  2.492   1.00 39.61  ? 460  ARG A O   1 
ATOM   2193 C CB  . ARG A 1 291 ? -26.755 -7.060  3.217   1.00 35.01  ? 460  ARG A CB  1 
ATOM   2194 C CG  . ARG A 1 291 ? -27.682 -5.908  3.608   1.00 35.82  ? 460  ARG A CG  1 
ATOM   2195 C CD  . ARG A 1 291 ? -28.603 -6.289  4.759   1.00 33.87  ? 460  ARG A CD  1 
ATOM   2196 N NE  . ARG A 1 291 ? -29.469 -5.174  5.129   1.00 32.46  ? 460  ARG A NE  1 
ATOM   2197 C CZ  . ARG A 1 291 ? -30.438 -5.240  6.037   1.00 31.88  ? 460  ARG A CZ  1 
ATOM   2198 N NH1 . ARG A 1 291 ? -30.662 -6.373  6.692   1.00 32.85  ? 460  ARG A NH1 1 
ATOM   2199 N NH2 . ARG A 1 291 ? -31.206 -4.175  6.271   1.00 30.86  ? 460  ARG A NH2 1 
ATOM   2200 N N   . TRP A 1 292 ? -29.509 -7.682  1.301   1.00 32.51  ? 461  TRP A N   1 
ATOM   2201 C CA  . TRP A 1 292 ? -30.859 -8.229  1.285   1.00 34.06  ? 461  TRP A CA  1 
ATOM   2202 C C   . TRP A 1 292 ? -30.938 -9.556  0.520   1.00 39.82  ? 461  TRP A C   1 
ATOM   2203 O O   . TRP A 1 292 ? -31.827 -10.377 0.797   1.00 40.90  ? 461  TRP A O   1 
ATOM   2204 C CB  . TRP A 1 292 ? -31.869 -7.267  0.647   1.00 31.59  ? 461  TRP A CB  1 
ATOM   2205 C CG  . TRP A 1 292 ? -32.153 -5.998  1.369   1.00 31.49  ? 461  TRP A CG  1 
ATOM   2206 C CD1 . TRP A 1 292 ? -31.449 -5.438  2.399   1.00 31.06  ? 461  TRP A CD1 1 
ATOM   2207 C CD2 . TRP A 1 292 ? -33.204 -5.085  1.057   1.00 31.86  ? 461  TRP A CD2 1 
ATOM   2208 N NE1 . TRP A 1 292 ? -32.018 -4.235  2.758   1.00 29.16  ? 461  TRP A NE1 1 
ATOM   2209 C CE2 . TRP A 1 292 ? -33.102 -4.004  1.947   1.00 30.07  ? 461  TRP A CE2 1 
ATOM   2210 C CE3 . TRP A 1 292 ? -34.235 -5.091  0.119   1.00 34.49  ? 461  TRP A CE3 1 
ATOM   2211 C CZ2 . TRP A 1 292 ? -33.983 -2.928  1.912   1.00 31.84  ? 461  TRP A CZ2 1 
ATOM   2212 C CZ3 . TRP A 1 292 ? -35.121 -4.020  0.091   1.00 34.95  ? 461  TRP A CZ3 1 
ATOM   2213 C CH2 . TRP A 1 292 ? -34.983 -2.956  0.975   1.00 33.99  ? 461  TRP A CH2 1 
ATOM   2214 N N   . PHE A 1 293 ? -30.050 -9.770  -0.454  1.00 35.03  ? 462  PHE A N   1 
ATOM   2215 C CA  . PHE A 1 293 ? -30.156 -10.995 -1.258  1.00 42.80  ? 462  PHE A CA  1 
ATOM   2216 C C   . PHE A 1 293 ? -29.669 -12.248 -0.540  1.00 40.36  ? 462  PHE A C   1 
ATOM   2217 O O   . PHE A 1 293 ? -29.955 -13.339 -0.988  1.00 47.74  ? 462  PHE A O   1 
ATOM   2218 C CB  . PHE A 1 293 ? -29.516 -10.820 -2.629  1.00 39.87  ? 462  PHE A CB  1 
ATOM   2219 C CG  . PHE A 1 293 ? -30.158 -9.731  -3.422  1.00 40.70  ? 462  PHE A CG  1 
ATOM   2220 C CD1 . PHE A 1 293 ? -31.450 -9.894  -3.916  1.00 43.97  ? 462  PHE A CD1 1 
ATOM   2221 C CD2 . PHE A 1 293 ? -29.508 -8.522  -3.624  1.00 42.00  ? 462  PHE A CD2 1 
ATOM   2222 C CE1 . PHE A 1 293 ? -32.078 -8.885  -4.635  1.00 40.18  ? 462  PHE A CE1 1 
ATOM   2223 C CE2 . PHE A 1 293 ? -30.133 -7.503  -4.328  1.00 44.84  ? 462  PHE A CE2 1 
ATOM   2224 C CZ  . PHE A 1 293 ? -31.415 -7.688  -4.837  1.00 39.81  ? 462  PHE A CZ  1 
ATOM   2225 N N   . SER A 1 294 ? -29.024 -12.092 0.608   1.00 41.30  ? 463  SER A N   1 
ATOM   2226 C CA  . SER A 1 294 ? -28.680 -13.242 1.446   1.00 41.61  ? 463  SER A CA  1 
ATOM   2227 C C   . SER A 1 294 ? -29.769 -13.567 2.448   1.00 44.07  ? 463  SER A C   1 
ATOM   2228 O O   . SER A 1 294 ? -29.563 -14.405 3.309   1.00 42.09  ? 463  SER A O   1 
ATOM   2229 C CB  . SER A 1 294 ? -27.395 -12.961 2.227   1.00 44.69  ? 463  SER A CB  1 
ATOM   2230 O OG  . SER A 1 294 ? -26.361 -12.478 1.388   1.00 51.53  ? 463  SER A OG  1 
ATOM   2231 N N   . ASP A 1 295 ? -30.906 -12.876 2.400   1.00 43.51  ? 464  ASP A N   1 
ATOM   2232 C CA  . ASP A 1 295 ? -31.979 -13.145 3.361   1.00 39.13  ? 464  ASP A CA  1 
ATOM   2233 C C   . ASP A 1 295 ? -33.301 -13.422 2.639   1.00 40.77  ? 464  ASP A C   1 
ATOM   2234 O O   . ASP A 1 295 ? -33.753 -12.619 1.823   1.00 43.70  ? 464  ASP A O   1 
ATOM   2235 C CB  . ASP A 1 295 ? -32.122 -11.984 4.349   1.00 35.55  ? 464  ASP A CB  1 
ATOM   2236 C CG  . ASP A 1 295 ? -33.314 -12.150 5.272   1.00 35.83  ? 464  ASP A CG  1 
ATOM   2237 O OD1 . ASP A 1 295 ? -34.410 -11.728 4.886   1.00 36.56  ? 464  ASP A OD1 1 
ATOM   2238 O OD2 . ASP A 1 295 ? -33.172 -12.713 6.373   1.00 40.11  ? 464  ASP A OD2 1 
ATOM   2239 N N   . PRO A 1 296 ? -33.926 -14.563 2.942   1.00 45.07  ? 465  PRO A N   1 
ATOM   2240 C CA  . PRO A 1 296 ? -35.125 -14.946 2.203   1.00 42.30  ? 465  PRO A CA  1 
ATOM   2241 C C   . PRO A 1 296 ? -36.272 -13.942 2.341   1.00 42.45  ? 465  PRO A C   1 
ATOM   2242 O O   . PRO A 1 296 ? -36.984 -13.728 1.379   1.00 41.14  ? 465  PRO A O   1 
ATOM   2243 C CB  . PRO A 1 296 ? -35.518 -16.294 2.817   1.00 49.03  ? 465  PRO A CB  1 
ATOM   2244 C CG  . PRO A 1 296 ? -34.314 -16.789 3.534   1.00 48.26  ? 465  PRO A CG  1 
ATOM   2245 C CD  . PRO A 1 296 ? -33.496 -15.597 3.903   1.00 48.38  ? 465  PRO A CD  1 
ATOM   2246 N N   . THR A 1 297 ? -36.465 -13.346 3.519   1.00 37.08  ? 466  THR A N   1 
ATOM   2247 C CA  . THR A 1 297 ? -37.535 -12.362 3.699   1.00 31.18  ? 466  THR A CA  1 
ATOM   2248 C C   . THR A 1 297 ? -37.280 -11.076 2.905   1.00 31.22  ? 466  THR A C   1 
ATOM   2249 O O   . THR A 1 297 ? -38.180 -10.566 2.208   1.00 33.63  ? 466  THR A O   1 
ATOM   2250 C CB  . THR A 1 297 ? -37.708 -12.017 5.185   1.00 36.19  ? 466  THR A CB  1 
ATOM   2251 O OG1 . THR A 1 297 ? -38.005 -13.216 5.911   1.00 37.57  ? 466  THR A OG1 1 
ATOM   2252 C CG2 . THR A 1 297 ? -38.851 -11.028 5.381   1.00 33.87  ? 466  THR A CG2 1 
ATOM   2253 N N   . LEU A 1 298 ? -36.060 -10.551 2.977   1.00 28.27  ? 467  LEU A N   1 
ATOM   2254 C CA  . LEU A 1 298 ? -35.760 -9.293  2.296   1.00 30.62  ? 467  LEU A CA  1 
ATOM   2255 C C   . LEU A 1 298 ? -35.708 -9.481  0.775   1.00 32.46  ? 467  LEU A C   1 
ATOM   2256 O O   . LEU A 1 298 ? -36.049 -8.573  0.010   1.00 27.82  ? 467  LEU A O   1 
ATOM   2257 C CB  . LEU A 1 298 ? -34.485 -8.671  2.840   1.00 29.30  ? 467  LEU A CB  1 
ATOM   2258 C CG  . LEU A 1 298 ? -34.679 -8.119  4.263   1.00 29.53  ? 467  LEU A CG  1 
ATOM   2259 C CD1 . LEU A 1 298 ? -33.330 -7.960  4.935   1.00 32.28  ? 467  LEU A CD1 1 
ATOM   2260 C CD2 . LEU A 1 298 ? -35.387 -6.780  4.248   1.00 30.81  ? 467  LEU A CD2 1 
ATOM   2261 N N   . THR A 1 299 ? -35.314 -10.674 0.355   1.00 30.74  ? 468  THR A N   1 
ATOM   2262 C CA  . THR A 1 299 ? -35.346 -11.033 -1.043  1.00 33.93  ? 468  THR A CA  1 
ATOM   2263 C C   . THR A 1 299 ? -36.802 -10.989 -1.537  1.00 31.12  ? 468  THR A C   1 
ATOM   2264 O O   . THR A 1 299 ? -37.093 -10.337 -2.535  1.00 29.67  ? 468  THR A O   1 
ATOM   2265 C CB  . THR A 1 299 ? -34.704 -12.421 -1.273  1.00 39.67  ? 468  THR A CB  1 
ATOM   2266 O OG1 . THR A 1 299 ? -33.304 -12.345 -0.963  1.00 38.25  ? 468  THR A OG1 1 
ATOM   2267 C CG2 . THR A 1 299 ? -34.895 -12.866 -2.737  1.00 41.11  ? 468  THR A CG2 1 
ATOM   2268 N N   . SER A 1 300 ? -37.717 -11.629 -0.819  1.00 28.61  ? 469  SER A N   1 
ATOM   2269 C CA  . SER A 1 300 ? -39.123 -11.539 -1.185  1.00 30.19  ? 469  SER A CA  1 
ATOM   2270 C C   . SER A 1 300 ? -39.671 -10.109 -1.116  1.00 28.61  ? 469  SER A C   1 
ATOM   2271 O O   . SER A 1 300 ? -40.471 -9.710  -1.968  1.00 28.43  ? 469  SER A O   1 
ATOM   2272 C CB  . SER A 1 300 ? -39.956 -12.438 -0.309  1.00 31.06  ? 469  SER A CB  1 
ATOM   2273 O OG  . SER A 1 300 ? -39.464 -13.739 -0.402  1.00 37.62  ? 469  SER A OG  1 
ATOM   2274 N N   . LEU A 1 301 ? -39.251 -9.327  -0.127  1.00 28.33  ? 470  LEU A N   1 
ATOM   2275 C CA  . LEU A 1 301 ? -39.733 -7.935  -0.052  1.00 28.15  ? 470  LEU A CA  1 
ATOM   2276 C C   . LEU A 1 301 ? -39.208 -7.086  -1.204  1.00 26.86  ? 470  LEU A C   1 
ATOM   2277 O O   . LEU A 1 301 ? -39.903 -6.181  -1.703  1.00 25.28  ? 470  LEU A O   1 
ATOM   2278 C CB  . LEU A 1 301 ? -39.418 -7.284  1.299   1.00 27.09  ? 470  LEU A CB  1 
ATOM   2279 C CG  . LEU A 1 301 ? -40.081 -7.913  2.550   1.00 32.31  ? 470  LEU A CG  1 
ATOM   2280 C CD1 . LEU A 1 301 ? -39.673 -7.173  3.807   1.00 30.88  ? 470  LEU A CD1 1 
ATOM   2281 C CD2 . LEU A 1 301 ? -41.586 -7.924  2.460   1.00 30.86  ? 470  LEU A CD2 1 
ATOM   2282 N N   . ALA A 1 302 ? -37.980 -7.356  -1.623  1.00 26.44  ? 471  ALA A N   1 
ATOM   2283 C CA  . ALA A 1 302 ? -37.385 -6.589  -2.707  1.00 29.28  ? 471  ALA A CA  1 
ATOM   2284 C C   . ALA A 1 302 ? -38.163 -6.841  -4.003  1.00 27.40  ? 471  ALA A C   1 
ATOM   2285 O O   . ALA A 1 302 ? -38.449 -5.930  -4.786  1.00 28.10  ? 471  ALA A O   1 
ATOM   2286 C CB  . ALA A 1 302 ? -35.932 -6.962  -2.888  1.00 29.52  ? 471  ALA A CB  1 
ATOM   2287 N N   . LYS A 1 303 ? -38.539 -8.079  -4.208  1.00 30.03  ? 472  LYS A N   1 
ATOM   2288 C CA  . LYS A 1 303 ? -39.344 -8.429  -5.358  1.00 34.46  ? 472  LYS A CA  1 
ATOM   2289 C C   . LYS A 1 303 ? -40.698 -7.715  -5.325  1.00 34.08  ? 472  LYS A C   1 
ATOM   2290 O O   . LYS A 1 303 ? -41.194 -7.200  -6.339  1.00 29.00  ? 472  LYS A O   1 
ATOM   2291 C CB  . LYS A 1 303 ? -39.534 -9.943  -5.358  1.00 46.23  ? 472  LYS A CB  1 
ATOM   2292 C CG  . LYS A 1 303 ? -40.278 -10.494 -6.557  1.00 57.49  ? 472  LYS A CG  1 
ATOM   2293 C CD  . LYS A 1 303 ? -40.058 -11.999 -6.683  1.00 71.96  ? 472  LYS A CD  1 
ATOM   2294 C CE  . LYS A 1 303 ? -40.660 -12.548 -7.972  1.00 87.82  ? 472  LYS A CE  1 
ATOM   2295 N NZ  . LYS A 1 303 ? -42.146 -12.625 -7.912  1.00 83.32  ? 472  LYS A NZ  1 
ATOM   2296 N N   . LEU A 1 304 ? -41.310 -7.700  -4.150  1.00 30.63  ? 473  LEU A N   1 
ATOM   2297 C CA  . LEU A 1 304 ? -42.608 -7.082  -3.966  1.00 30.46  ? 473  LEU A CA  1 
ATOM   2298 C C   . LEU A 1 304 ? -42.544 -5.572  -4.237  1.00 27.08  ? 473  LEU A C   1 
ATOM   2299 O O   . LEU A 1 304 ? -43.361 -5.037  -4.965  1.00 27.46  ? 473  LEU A O   1 
ATOM   2300 C CB  . LEU A 1 304 ? -43.032 -7.336  -2.533  1.00 37.57  ? 473  LEU A CB  1 
ATOM   2301 C CG  . LEU A 1 304 ? -44.465 -7.613  -2.172  1.00 37.50  ? 473  LEU A CG  1 
ATOM   2302 C CD1 . LEU A 1 304 ? -45.141 -8.550  -3.140  1.00 38.89  ? 473  LEU A CD1 1 
ATOM   2303 C CD2 . LEU A 1 304 ? -44.460 -8.216  -0.759  1.00 42.41  ? 473  LEU A CD2 1 
ATOM   2304 N N   . MET A 1 305 ? -41.563 -4.895  -3.656  1.00 26.10  ? 474  MET A N   1 
ATOM   2305 C CA  . MET A 1 305 ? -41.315 -3.477  -3.925  1.00 30.57  ? 474  MET A CA  1 
ATOM   2306 C C   . MET A 1 305 ? -41.268 -3.157  -5.405  1.00 29.97  ? 474  MET A C   1 
ATOM   2307 O O   . MET A 1 305 ? -41.861 -2.183  -5.901  1.00 27.17  ? 474  MET A O   1 
ATOM   2308 C CB  . MET A 1 305 ? -39.906 -3.120  -3.465  1.00 31.58  ? 474  MET A CB  1 
ATOM   2309 C CG  . MET A 1 305 ? -39.813 -2.732  -2.057  1.00 34.24  ? 474  MET A CG  1 
ATOM   2310 S SD  . MET A 1 305 ? -38.103 -2.635  -1.502  1.00 26.21  ? 474  MET A SD  1 
ATOM   2311 C CE  . MET A 1 305 ? -38.513 -3.519  0.005   1.00 26.11  ? 474  MET A CE  1 
ATOM   2312 N N   . LYS A 1 306 ? -40.457 -3.945  -6.089  1.00 28.28  ? 475  LYS A N   1 
ATOM   2313 C CA  . LYS A 1 306 ? -40.224 -3.717  -7.499  1.00 32.22  ? 475  LYS A CA  1 
ATOM   2314 C C   . LYS A 1 306 ? -41.529 -3.828  -8.258  1.00 25.19  ? 475  LYS A C   1 
ATOM   2315 O O   . LYS A 1 306 ? -41.743 -3.109  -9.194  1.00 25.45  ? 475  LYS A O   1 
ATOM   2316 C CB  . LYS A 1 306 ? -39.143 -4.666  -8.023  1.00 36.84  ? 475  LYS A CB  1 
ATOM   2317 C CG  . LYS A 1 306 ? -37.747 -4.327  -7.469  1.00 46.64  ? 475  LYS A CG  1 
ATOM   2318 C CD  . LYS A 1 306 ? -36.722 -5.418  -7.771  1.00 56.33  ? 475  LYS A CD  1 
ATOM   2319 C CE  . LYS A 1 306 ? -35.303 -4.877  -7.744  1.00 69.87  ? 475  LYS A CE  1 
ATOM   2320 N NZ  . LYS A 1 306 ? -34.267 -5.949  -7.723  1.00 75.76  ? 475  LYS A NZ  1 
ATOM   2321 N N   . GLU A 1 307 ? -42.434 -4.674  -7.802  1.00 24.54  ? 476  GLU A N   1 
ATOM   2322 C CA  . GLU A 1 307 ? -43.718 -4.828  -8.468  1.00 26.43  ? 476  GLU A CA  1 
ATOM   2323 C C   . GLU A 1 307 ? -44.750 -3.751  -8.129  1.00 27.93  ? 476  GLU A C   1 
ATOM   2324 O O   . GLU A 1 307 ? -45.881 -3.782  -8.668  1.00 24.82  ? 476  GLU A O   1 
ATOM   2325 C CB  . GLU A 1 307 ? -44.275 -6.190  -8.134  1.00 30.03  ? 476  GLU A CB  1 
ATOM   2326 C CG  . GLU A 1 307 ? -43.434 -7.321  -8.696  1.00 37.56  ? 476  GLU A CG  1 
ATOM   2327 C CD  . GLU A 1 307 ? -43.884 -8.691  -8.192  1.00 43.13  ? 476  GLU A CD  1 
ATOM   2328 O OE1 . GLU A 1 307 ? -44.000 -8.905  -6.975  1.00 53.20  ? 476  GLU A OE1 1 
ATOM   2329 O OE2 . GLU A 1 307 ? -44.133 -9.558  -9.019  1.00 56.35  ? 476  GLU A OE2 1 
ATOM   2330 N N   . CYS A 1 308 ? -44.381 -2.821  -7.238  1.00 24.73  ? 477  CYS A N   1 
ATOM   2331 C CA  . CYS A 1 308 ? -45.140 -1.583  -7.027  1.00 24.04  ? 477  CYS A CA  1 
ATOM   2332 C C   . CYS A 1 308 ? -44.605 -0.412  -7.817  1.00 27.00  ? 477  CYS A C   1 
ATOM   2333 O O   . CYS A 1 308 ? -45.227 0.647   -7.810  1.00 28.31  ? 477  CYS A O   1 
ATOM   2334 C CB  . CYS A 1 308 ? -45.118 -1.161  -5.534  1.00 24.17  ? 477  CYS A CB  1 
ATOM   2335 S SG  . CYS A 1 308 ? -45.624 -2.435  -4.382  1.00 26.39  ? 477  CYS A SG  1 
ATOM   2336 N N   . TRP A 1 309 ? -43.434 -0.553  -8.431  1.00 26.16  ? 478  TRP A N   1 
ATOM   2337 C CA  . TRP A 1 309 ? -42.743 0.582   -9.033  1.00 26.85  ? 478  TRP A CA  1 
ATOM   2338 C C   . TRP A 1 309 ? -42.641 0.542   -10.539 1.00 30.01  ? 478  TRP A C   1 
ATOM   2339 O O   . TRP A 1 309 ? -41.861 1.312   -11.132 1.00 32.02  ? 478  TRP A O   1 
ATOM   2340 C CB  . TRP A 1 309 ? -41.281 0.649   -8.534  1.00 30.38  ? 478  TRP A CB  1 
ATOM   2341 C CG  . TRP A 1 309 ? -41.127 0.930   -7.128  1.00 28.90  ? 478  TRP A CG  1 
ATOM   2342 C CD1 . TRP A 1 309 ? -41.995 1.644   -6.322  1.00 30.30  ? 478  TRP A CD1 1 
ATOM   2343 C CD2 . TRP A 1 309 ? -40.025 0.546   -6.297  1.00 30.12  ? 478  TRP A CD2 1 
ATOM   2344 N NE1 . TRP A 1 309 ? -41.495 1.715   -5.053  1.00 34.07  ? 478  TRP A NE1 1 
ATOM   2345 C CE2 . TRP A 1 309 ? -40.293 1.049   -4.996  1.00 30.53  ? 478  TRP A CE2 1 
ATOM   2346 C CE3 . TRP A 1 309 ? -38.842 -0.173  -6.519  1.00 29.27  ? 478  TRP A CE3 1 
ATOM   2347 C CZ2 . TRP A 1 309 ? -39.424 0.858   -3.924  1.00 28.06  ? 478  TRP A CZ2 1 
ATOM   2348 C CZ3 . TRP A 1 309 ? -37.964 -0.369  -5.443  1.00 29.58  ? 478  TRP A CZ3 1 
ATOM   2349 C CH2 . TRP A 1 309 ? -38.264 0.149   -4.160  1.00 30.43  ? 478  TRP A CH2 1 
ATOM   2350 N N   . TYR A 1 310 ? -43.388 -0.338  -11.188 1.00 31.85  ? 479  TYR A N   1 
ATOM   2351 C CA  . TYR A 1 310 ? -43.386 -0.350  -12.649 1.00 31.58  ? 479  TYR A CA  1 
ATOM   2352 C C   . TYR A 1 310 ? -43.829 1.004   -13.160 1.00 31.07  ? 479  TYR A C   1 
ATOM   2353 O O   . TYR A 1 310 ? -44.737 1.629   -12.602 1.00 27.62  ? 479  TYR A O   1 
ATOM   2354 C CB  . TYR A 1 310 ? -44.331 -1.406  -13.182 1.00 29.56  ? 479  TYR A CB  1 
ATOM   2355 C CG  . TYR A 1 310 ? -43.939 -2.837  -12.887 1.00 33.17  ? 479  TYR A CG  1 
ATOM   2356 C CD1 . TYR A 1 310 ? -42.723 -3.376  -13.338 1.00 34.88  ? 479  TYR A CD1 1 
ATOM   2357 C CD2 . TYR A 1 310 ? -44.821 -3.686  -12.241 1.00 33.45  ? 479  TYR A CD2 1 
ATOM   2358 C CE1 . TYR A 1 310 ? -42.388 -4.716  -13.101 1.00 35.13  ? 479  TYR A CE1 1 
ATOM   2359 C CE2 . TYR A 1 310 ? -44.501 -5.012  -12.016 1.00 33.80  ? 479  TYR A CE2 1 
ATOM   2360 C CZ  . TYR A 1 310 ? -43.287 -5.522  -12.444 1.00 33.75  ? 479  TYR A CZ  1 
ATOM   2361 O OH  . TYR A 1 310 ? -43.026 -6.855  -12.203 1.00 38.95  ? 479  TYR A OH  1 
ATOM   2362 N N   . GLN A 1 311 ? -43.205 1.459   -14.232 1.00 29.07  ? 480  GLN A N   1 
ATOM   2363 C CA  . GLN A 1 311 ? -43.570 2.733   -14.826 1.00 30.62  ? 480  GLN A CA  1 
ATOM   2364 C C   . GLN A 1 311 ? -45.007 2.660   -15.315 1.00 30.50  ? 480  GLN A C   1 
ATOM   2365 O O   . GLN A 1 311 ? -45.786 3.617   -15.184 1.00 30.48  ? 480  GLN A O   1 
ATOM   2366 C CB  . GLN A 1 311 ? -42.582 3.122   -15.957 1.00 35.07  ? 480  GLN A CB  1 
ATOM   2367 C CG  . GLN A 1 311 ? -42.863 4.499   -16.568 1.00 49.89  ? 480  GLN A CG  1 
ATOM   2368 C CD  . GLN A 1 311 ? -41.901 4.881   -17.710 1.00 70.63  ? 480  GLN A CD  1 
ATOM   2369 O OE1 . GLN A 1 311 ? -40.755 5.330   -17.488 1.00 56.29  ? 480  GLN A OE1 1 
ATOM   2370 N NE2 . GLN A 1 311 ? -42.380 4.731   -18.945 1.00 54.23  ? 480  GLN A NE2 1 
ATOM   2371 N N   . ASN A 1 312 ? -45.366 1.516   -15.886 1.00 31.51  ? 481  ASN A N   1 
ATOM   2372 C CA  . ASN A 1 312 ? -46.716 1.304   -16.331 1.00 31.67  ? 481  ASN A CA  1 
ATOM   2373 C C   . ASN A 1 312 ? -47.579 0.916   -15.120 1.00 28.35  ? 481  ASN A C   1 
ATOM   2374 O O   . ASN A 1 312 ? -47.504 -0.208  -14.639 1.00 25.75  ? 481  ASN A O   1 
ATOM   2375 C CB  . ASN A 1 312 ? -46.767 0.208   -17.401 1.00 30.57  ? 481  ASN A CB  1 
ATOM   2376 C CG  . ASN A 1 312 ? -48.159 0.010   -17.966 1.00 36.64  ? 481  ASN A CG  1 
ATOM   2377 O OD1 . ASN A 1 312 ? -49.131 0.535   -17.452 1.00 34.56  ? 481  ASN A OD1 1 
ATOM   2378 N ND2 . ASN A 1 312 ? -48.254 -0.728  -19.049 1.00 42.58  ? 481  ASN A ND2 1 
ATOM   2379 N N   . PRO A 1 313 ? -48.469 1.812   -14.700 1.00 27.29  ? 482  PRO A N   1 
ATOM   2380 C CA  . PRO A 1 313 ? -49.301 1.548   -13.538 1.00 26.32  ? 482  PRO A CA  1 
ATOM   2381 C C   . PRO A 1 313 ? -50.088 0.258   -13.624 1.00 28.93  ? 482  PRO A C   1 
ATOM   2382 O O   . PRO A 1 313 ? -50.276 -0.400  -12.611 1.00 30.25  ? 482  PRO A O   1 
ATOM   2383 C CB  . PRO A 1 313 ? -50.246 2.753   -13.503 1.00 26.37  ? 482  PRO A CB  1 
ATOM   2384 C CG  . PRO A 1 313 ? -49.571 3.820   -14.324 1.00 26.90  ? 482  PRO A CG  1 
ATOM   2385 C CD  . PRO A 1 313 ? -48.881 3.039   -15.396 1.00 26.96  ? 482  PRO A CD  1 
ATOM   2386 N N   A SER A 1 314 ? -50.527 -0.110  -14.829 0.50 26.68  ? 483  SER A N   1 
ATOM   2387 N N   B SER A 1 314 ? -50.535 -0.109  -14.822 0.50 27.78  ? 483  SER A N   1 
ATOM   2388 C CA  A SER A 1 314 ? -51.349 -1.308  -15.052 0.50 26.10  ? 483  SER A CA  1 
ATOM   2389 C CA  B SER A 1 314 ? -51.380 -1.290  -15.007 0.50 27.91  ? 483  SER A CA  1 
ATOM   2390 C C   A SER A 1 314 ? -50.669 -2.607  -14.632 0.50 26.04  ? 483  SER A C   1 
ATOM   2391 C C   B SER A 1 314 ? -50.672 -2.609  -14.652 0.50 26.99  ? 483  SER A C   1 
ATOM   2392 O O   A SER A 1 314 ? -51.338 -3.609  -14.412 0.50 27.07  ? 483  SER A O   1 
ATOM   2393 O O   B SER A 1 314 ? -51.331 -3.626  -14.478 0.50 27.96  ? 483  SER A O   1 
ATOM   2394 C CB  A SER A 1 314 ? -51.705 -1.425  -16.543 0.50 27.16  ? 483  SER A CB  1 
ATOM   2395 C CB  B SER A 1 314 ? -51.887 -1.344  -16.462 0.50 31.33  ? 483  SER A CB  1 
ATOM   2396 O OG  A SER A 1 314 ? -50.562 -1.758  -17.315 0.50 24.62  ? 483  SER A OG  1 
ATOM   2397 O OG  B SER A 1 314 ? -52.633 -0.176  -16.803 0.50 30.41  ? 483  SER A OG  1 
ATOM   2398 N N   . ALA A 1 315 ? -49.342 -2.591  -14.534 1.00 28.19  ? 484  ALA A N   1 
ATOM   2399 C CA  . ALA A 1 315 ? -48.577 -3.793  -14.144 1.00 28.70  ? 484  ALA A CA  1 
ATOM   2400 C C   . ALA A 1 315 ? -48.377 -3.904  -12.641 1.00 28.21  ? 484  ALA A C   1 
ATOM   2401 O O   . ALA A 1 315 ? -47.947 -4.941  -12.152 1.00 27.02  ? 484  ALA A O   1 
ATOM   2402 C CB  . ALA A 1 315 ? -47.211 -3.799  -14.826 1.00 28.55  ? 484  ALA A CB  1 
ATOM   2403 N N   . ARG A 1 316 ? -48.670 -2.845  -11.900 1.00 26.86  ? 485  ARG A N   1 
ATOM   2404 C CA  . ARG A 1 316 ? -48.438 -2.897  -10.458 1.00 25.32  ? 485  ARG A CA  1 
ATOM   2405 C C   . ARG A 1 316 ? -49.420 -3.830  -9.749  1.00 26.21  ? 485  ARG A C   1 
ATOM   2406 O O   . ARG A 1 316 ? -50.575 -3.950  -10.147 1.00 24.09  ? 485  ARG A O   1 
ATOM   2407 C CB  . ARG A 1 316 ? -48.489 -1.518  -9.864  1.00 22.77  ? 485  ARG A CB  1 
ATOM   2408 C CG  . ARG A 1 316 ? -47.415 -0.564  -10.378 1.00 24.43  ? 485  ARG A CG  1 
ATOM   2409 C CD  . ARG A 1 316 ? -47.631 0.855   -9.829  1.00 24.02  ? 485  ARG A CD  1 
ATOM   2410 N NE  . ARG A 1 316 ? -46.928 1.805   -10.673 1.00 25.89  ? 485  ARG A NE  1 
ATOM   2411 C CZ  . ARG A 1 316 ? -47.290 3.068   -10.883 1.00 25.33  ? 485  ARG A CZ  1 
ATOM   2412 N NH1 . ARG A 1 316 ? -48.311 3.614   -10.229 1.00 23.24  ? 485  ARG A NH1 1 
ATOM   2413 N NH2 . ARG A 1 316 ? -46.611 3.794   -11.763 1.00 29.54  ? 485  ARG A NH2 1 
ATOM   2414 N N   . LEU A 1 317 ? -48.950 -4.497  -8.704  1.00 25.26  ? 486  LEU A N   1 
ATOM   2415 C CA  . LEU A 1 317 ? -49.820 -5.358  -7.913  1.00 28.89  ? 486  LEU A CA  1 
ATOM   2416 C C   . LEU A 1 317 ? -50.885 -4.575  -7.170  1.00 28.00  ? 486  LEU A C   1 
ATOM   2417 O O   . LEU A 1 317 ? -50.698 -3.392  -6.845  1.00 25.83  ? 486  LEU A O   1 
ATOM   2418 C CB  . LEU A 1 317 ? -48.990 -6.110  -6.879  1.00 32.50  ? 486  LEU A CB  1 
ATOM   2419 C CG  . LEU A 1 317 ? -47.897 -7.004  -7.445  1.00 38.55  ? 486  LEU A CG  1 
ATOM   2420 C CD1 . LEU A 1 317 ? -47.123 -7.691  -6.325  1.00 44.31  ? 486  LEU A CD1 1 
ATOM   2421 C CD2 . LEU A 1 317 ? -48.495 -8.026  -8.418  1.00 42.70  ? 486  LEU A CD2 1 
ATOM   2422 N N   . THR A 1 318 ? -52.007 -5.231  -6.904  1.00 28.21  ? 487  THR A N   1 
ATOM   2423 C CA  . THR A 1 318 ? -53.044 -4.660  -6.077  1.00 25.28  ? 487  THR A CA  1 
ATOM   2424 C C   . THR A 1 318 ? -52.676 -4.772  -4.593  1.00 25.33  ? 487  THR A C   1 
ATOM   2425 O O   . THR A 1 318 ? -51.831 -5.579  -4.202  1.00 22.97  ? 487  THR A O   1 
ATOM   2426 C CB  . THR A 1 318 ? -54.390 -5.353  -6.316  1.00 24.64  ? 487  THR A CB  1 
ATOM   2427 O OG1 . THR A 1 318 ? -54.312 -6.699  -5.859  1.00 26.35  ? 487  THR A OG1 1 
ATOM   2428 C CG2 . THR A 1 318 ? -54.749 -5.320  -7.806  1.00 26.46  ? 487  THR A CG2 1 
ATOM   2429 N N   . ALA A 1 319 ? -53.306 -3.940  -3.769  1.00 27.06  ? 488  ALA A N   1 
ATOM   2430 C CA  . ALA A 1 319 ? -53.057 -3.959  -2.329  1.00 24.84  ? 488  ALA A CA  1 
ATOM   2431 C C   . ALA A 1 319 ? -53.401 -5.347  -1.761  1.00 23.93  ? 488  ALA A C   1 
ATOM   2432 O O   . ALA A 1 319 ? -52.676 -5.918  -0.946  1.00 24.65  ? 488  ALA A O   1 
ATOM   2433 C CB  . ALA A 1 319 ? -53.909 -2.889  -1.674  1.00 30.05  ? 488  ALA A CB  1 
ATOM   2434 N N   . LEU A 1 320 ? -54.511 -5.897  -2.220  1.00 24.78  ? 489  LEU A N   1 
ATOM   2435 C CA  . LEU A 1 320 ? -54.942 -7.225  -1.807  1.00 26.42  ? 489  LEU A CA  1 
ATOM   2436 C C   . LEU A 1 320 ? -53.934 -8.309  -2.194  1.00 27.11  ? 489  LEU A C   1 
ATOM   2437 O O   . LEU A 1 320 ? -53.651 -9.214  -1.408  1.00 30.37  ? 489  LEU A O   1 
ATOM   2438 C CB  . LEU A 1 320 ? -56.313 -7.522  -2.400  1.00 28.83  ? 489  LEU A CB  1 
ATOM   2439 C CG  . LEU A 1 320 ? -57.077 -8.747  -1.898  1.00 37.70  ? 489  LEU A CG  1 
ATOM   2440 C CD1 . LEU A 1 320 ? -57.235 -8.744  -0.379  1.00 36.37  ? 489  LEU A CD1 1 
ATOM   2441 C CD2 . LEU A 1 320 ? -58.451 -8.780  -2.565  1.00 41.75  ? 489  LEU A CD2 1 
ATOM   2442 N N   . ARG A 1 321 ? -53.362 -8.223  -3.388  1.00 27.71  ? 490  ARG A N   1 
ATOM   2443 C CA  . ARG A 1 321 ? -52.339 -9.190  -3.772  1.00 27.18  ? 490  ARG A CA  1 
ATOM   2444 C C   . ARG A 1 321 ? -51.119 -9.071  -2.894  1.00 27.61  ? 490  ARG A C   1 
ATOM   2445 O O   . ARG A 1 321 ? -50.507 -10.093 -2.518  1.00 29.67  ? 490  ARG A O   1 
ATOM   2446 C CB  . ARG A 1 321 ? -51.908 -9.023  -5.243  1.00 29.94  ? 490  ARG A CB  1 
ATOM   2447 C CG  . ARG A 1 321 ? -50.877 -10.072 -5.713  1.00 32.04  ? 490  ARG A CG  1 
ATOM   2448 C CD  . ARG A 1 321 ? -51.398 -11.510 -5.727  1.00 40.43  ? 490  ARG A CD  1 
ATOM   2449 N NE  . ARG A 1 321 ? -52.511 -11.693 -6.674  1.00 69.49  ? 490  ARG A NE  1 
ATOM   2450 C CZ  . ARG A 1 321 ? -52.393 -11.741 -8.013  1.00 81.71  ? 490  ARG A CZ  1 
ATOM   2451 N NH1 . ARG A 1 321 ? -51.202 -11.637 -8.607  1.00 77.47  ? 490  ARG A NH1 1 
ATOM   2452 N NH2 . ARG A 1 321 ? -53.478 -11.892 -8.776  1.00 69.37  ? 490  ARG A NH2 1 
ATOM   2453 N N   . ILE A 1 322 ? -50.722 -7.833  -2.599  1.00 27.22  ? 491  ILE A N   1 
ATOM   2454 C CA  . ILE A 1 322 ? -49.571 -7.604  -1.690  1.00 25.63  ? 491  ILE A CA  1 
ATOM   2455 C C   . ILE A 1 322 ? -49.838 -8.203  -0.305  1.00 25.53  ? 491  ILE A C   1 
ATOM   2456 O O   . ILE A 1 322 ? -49.001 -8.887  0.268   1.00 28.95  ? 491  ILE A O   1 
ATOM   2457 C CB  . ILE A 1 322 ? -49.219 -6.104  -1.571  1.00 27.22  ? 491  ILE A CB  1 
ATOM   2458 C CG1 . ILE A 1 322 ? -48.730 -5.542  -2.919  1.00 29.03  ? 491  ILE A CG1 1 
ATOM   2459 C CG2 . ILE A 1 322 ? -48.159 -5.868  -0.507  1.00 26.81  ? 491  ILE A CG2 1 
ATOM   2460 C CD1 . ILE A 1 322 ? -48.734 -4.022  -2.992  1.00 28.42  ? 491  ILE A CD1 1 
ATOM   2461 N N   . LYS A 1 323 ? -51.008 -7.924  0.230   1.00 24.22  ? 492  LYS A N   1 
ATOM   2462 C CA  . LYS A 1 323 ? -51.436 -8.496  1.494   1.00 27.47  ? 492  LYS A CA  1 
ATOM   2463 C C   . LYS A 1 323 ? -51.345 -10.019 1.502   1.00 26.73  ? 492  LYS A C   1 
ATOM   2464 O O   . LYS A 1 323 ? -50.739 -10.579 2.416   1.00 27.42  ? 492  LYS A O   1 
ATOM   2465 C CB  . LYS A 1 323 ? -52.867 -8.056  1.816   1.00 26.05  ? 492  LYS A CB  1 
ATOM   2466 C CG  . LYS A 1 323 ? -53.386 -8.617  3.122   1.00 28.65  ? 492  LYS A CG  1 
ATOM   2467 C CD  . LYS A 1 323 ? -54.860 -8.389  3.249   1.00 27.20  ? 492  LYS A CD  1 
ATOM   2468 C CE  . LYS A 1 323 ? -55.320 -8.823  4.629   1.00 32.60  ? 492  LYS A CE  1 
ATOM   2469 N NZ  . LYS A 1 323 ? -56.761 -8.538  4.828   1.00 32.19  ? 492  LYS A NZ  1 
ATOM   2470 N N   . LYS A 1 324 ? -51.918 -10.679 0.495   1.00 27.80  ? 493  LYS A N   1 
ATOM   2471 C CA  . LYS A 1 324 ? -51.866 -12.153 0.424   1.00 32.24  ? 493  LYS A CA  1 
ATOM   2472 C C   . LYS A 1 324 ? -50.455 -12.650 0.288   1.00 31.32  ? 493  LYS A C   1 
ATOM   2473 O O   . LYS A 1 324 ? -50.084 -13.626 0.919   1.00 34.76  ? 493  LYS A O   1 
ATOM   2474 C CB  . LYS A 1 324 ? -52.672 -12.732 -0.727  1.00 39.12  ? 493  LYS A CB  1 
ATOM   2475 C CG  . LYS A 1 324 ? -54.176 -12.480 -0.697  1.00 48.44  ? 493  LYS A CG  1 
ATOM   2476 C CD  . LYS A 1 324 ? -54.798 -13.213 -1.892  1.00 65.21  ? 493  LYS A CD  1 
ATOM   2477 C CE  . LYS A 1 324 ? -56.214 -12.778 -2.213  1.00 63.27  ? 493  LYS A CE  1 
ATOM   2478 N NZ  . LYS A 1 324 ? -57.053 -12.729 -0.992  1.00 74.92  ? 493  LYS A NZ  1 
ATOM   2479 N N   . THR A 1 325 ? -49.643 -11.979 -0.502  1.00 27.51  ? 494  THR A N   1 
ATOM   2480 C CA  . THR A 1 325 ? -48.231 -12.393 -0.605  1.00 29.60  ? 494  THR A CA  1 
ATOM   2481 C C   . THR A 1 325 ? -47.497 -12.234 0.737   1.00 32.02  ? 494  THR A C   1 
ATOM   2482 O O   . THR A 1 325 ? -46.769 -13.128 1.191   1.00 27.91  ? 494  THR A O   1 
ATOM   2483 C CB  . THR A 1 325 ? -47.488 -11.577 -1.668  1.00 33.39  ? 494  THR A CB  1 
ATOM   2484 O OG1 . THR A 1 325 ? -48.128 -11.734 -2.931  1.00 37.08  ? 494  THR A OG1 1 
ATOM   2485 C CG2 . THR A 1 325 ? -46.060 -12.011 -1.792  1.00 33.22  ? 494  THR A CG2 1 
ATOM   2486 N N   . LEU A 1 326 ? -47.717 -11.101 1.403   1.00 33.94  ? 495  LEU A N   1 
ATOM   2487 C CA  . LEU A 1 326 ? -47.059 -10.856 2.691   1.00 33.11  ? 495  LEU A CA  1 
ATOM   2488 C C   . LEU A 1 326 ? -47.540 -11.848 3.753   1.00 31.00  ? 495  LEU A C   1 
ATOM   2489 O O   . LEU A 1 326 ? -46.772 -12.199 4.630   1.00 31.37  ? 495  LEU A O   1 
ATOM   2490 C CB  . LEU A 1 326 ? -47.263 -9.425  3.164   1.00 31.35  ? 495  LEU A CB  1 
ATOM   2491 C CG  . LEU A 1 326 ? -46.474 -8.371  2.411   1.00 28.29  ? 495  LEU A CG  1 
ATOM   2492 C CD1 . LEU A 1 326 ? -46.961 -6.966  2.785   1.00 27.18  ? 495  LEU A CD1 1 
ATOM   2493 C CD2 . LEU A 1 326 ? -44.985 -8.535  2.676   1.00 27.18  ? 495  LEU A CD2 1 
ATOM   2494 N N   . THR A 1 327 ? -48.794 -12.292 3.641   1.00 30.77  ? 496  THR A N   1 
ATOM   2495 C CA  . THR A 1 327 ? -49.348 -13.292 4.528   1.00 34.46  ? 496  THR A CA  1 
ATOM   2496 C C   . THR A 1 327 ? -48.603 -14.640 4.413   1.00 38.68  ? 496  THR A C   1 
ATOM   2497 O O   . THR A 1 327 ? -48.425 -15.307 5.410   1.00 35.48  ? 496  THR A O   1 
ATOM   2498 C CB  . THR A 1 327 ? -50.871 -13.435 4.332   1.00 35.16  ? 496  THR A CB  1 
ATOM   2499 O OG1 . THR A 1 327 ? -51.521 -12.173 4.608   1.00 34.68  ? 496  THR A OG1 1 
ATOM   2500 C CG2 . THR A 1 327 ? -51.453 -14.479 5.290   1.00 36.71  ? 496  THR A CG2 1 
ATOM   2501 N N   . LYS A 1 328 ? -48.119 -14.997 3.224   1.00 42.82  ? 497  LYS A N   1 
ATOM   2502 C CA  . LYS A 1 328 ? -47.381 -16.263 3.006   1.00 43.73  ? 497  LYS A CA  1 
ATOM   2503 C C   . LYS A 1 328 ? -45.872 -16.210 3.350   1.00 43.05  ? 497  LYS A C   1 
ATOM   2504 O O   . LYS A 1 328 ? -45.287 -17.224 3.660   1.00 55.13  ? 497  LYS A O   1 
ATOM   2505 C CB  . LYS A 1 328 ? -47.576 -16.762 1.557   1.00 44.65  ? 497  LYS A CB  1 
ATOM   2506 C CG  . LYS A 1 328 ? -49.012 -17.174 1.221   1.00 57.52  ? 497  LYS A CG  1 
ATOM   2507 C CD  . LYS A 1 328 ? -49.216 -17.588 -0.243  1.00 56.93  ? 497  LYS A CD  1 
ATOM   2508 N N   . ILE A 1 329 ? -45.243 -15.043 3.269   1.00 44.06  ? 498  ILE A N   1 
ATOM   2509 C CA  . ILE A 1 329 ? -43.849 -14.844 3.711   1.00 46.33  ? 498  ILE A CA  1 
ATOM   2510 C C   . ILE A 1 329 ? -43.708 -14.931 5.237   1.00 47.78  ? 498  ILE A C   1 
ATOM   2511 O O   . ILE A 1 329 ? -42.652 -15.330 5.743   1.00 48.72  ? 498  ILE A O   1 
ATOM   2512 C CB  . ILE A 1 329 ? -43.338 -13.437 3.308   1.00 44.23  ? 498  ILE A CB  1 
ATOM   2513 C CG1 . ILE A 1 329 ? -43.309 -13.279 1.803   1.00 48.94  ? 498  ILE A CG1 1 
ATOM   2514 C CG2 . ILE A 1 329 ? -41.928 -13.208 3.810   1.00 56.15  ? 498  ILE A CG2 1 
ATOM   2515 C CD1 . ILE A 1 329 ? -43.136 -11.848 1.352   1.00 52.58  ? 498  ILE A CD1 1 
ATOM   2516 N N   . ASP A 1 330 ? -44.776 -14.514 5.932   1.00 60.33  ? 499  ASP A N   1 
ATOM   2517 C CA  . ASP A 1 330 ? -44.840 -14.326 7.404   1.00 84.04  ? 499  ASP A CA  1 
ATOM   2518 C C   . ASP A 1 330 ? -44.711 -15.640 8.188   1.00 82.16  ? 499  ASP A C   1 
ATOM   2519 O O   . ASP A 1 330 ? -45.697 -16.319 8.456   1.00 80.52  ? 499  ASP A O   1 
ATOM   2520 C CB  . ASP A 1 330 ? -46.143 -13.571 7.808   1.00 67.40  ? 499  ASP A CB  1 
ATOM   2521 N N   . MET B 2 1   ? -85.079 34.358  17.763  1.00 93.49  ? 1    MET B N   1 
ATOM   2522 C CA  . MET B 2 1   ? -84.017 33.542  18.430  1.00 96.96  ? 1    MET B CA  1 
ATOM   2523 C C   . MET B 2 1   ? -83.644 32.288  17.620  1.00 87.77  ? 1    MET B C   1 
ATOM   2524 O O   . MET B 2 1   ? -82.833 31.467  18.073  1.00 64.18  ? 1    MET B O   1 
ATOM   2525 C CB  . MET B 2 1   ? -84.463 33.137  19.852  1.00 91.81  ? 1    MET B CB  1 
ATOM   2526 C CG  . MET B 2 1   ? -85.483 31.999  19.910  1.00 77.37  ? 1    MET B CG  1 
ATOM   2527 S SD  . MET B 2 1   ? -86.106 31.593  21.564  1.00 114.94 ? 1    MET B SD  1 
ATOM   2528 C CE  . MET B 2 1   ? -84.659 30.913  22.385  1.00 82.57  ? 1    MET B CE  1 
ATOM   2529 N N   . GLY B 2 2   ? -84.245 32.120  16.442  1.00 70.20  ? 2    GLY B N   1 
ATOM   2530 C CA  . GLY B 2 2   ? -83.993 30.948  15.628  1.00 69.44  ? 2    GLY B CA  1 
ATOM   2531 C C   . GLY B 2 2   ? -84.460 29.604  16.194  1.00 61.13  ? 2    GLY B C   1 
ATOM   2532 O O   . GLY B 2 2   ? -84.222 28.583  15.566  1.00 52.18  ? 2    GLY B O   1 
ATOM   2533 N N   . VAL B 2 3   ? -85.115 29.593  17.359  1.00 61.27  ? 3    VAL B N   1 
ATOM   2534 C CA  . VAL B 2 3   ? -85.657 28.348  17.955  1.00 55.05  ? 3    VAL B CA  1 
ATOM   2535 C C   . VAL B 2 3   ? -87.145 28.458  18.169  1.00 49.49  ? 3    VAL B C   1 
ATOM   2536 O O   . VAL B 2 3   ? -87.598 29.158  19.098  1.00 50.17  ? 3    VAL B O   1 
ATOM   2537 C CB  . VAL B 2 3   ? -85.019 28.000  19.313  1.00 48.72  ? 3    VAL B CB  1 
ATOM   2538 C CG1 . VAL B 2 3   ? -85.645 26.754  19.902  1.00 46.65  ? 3    VAL B CG1 1 
ATOM   2539 C CG2 . VAL B 2 3   ? -83.542 27.775  19.141  1.00 54.41  ? 3    VAL B CG2 1 
ATOM   2540 N N   . GLU B 2 4   ? -87.908 27.751  17.337  1.00 49.36  ? 4    GLU B N   1 
ATOM   2541 C CA  . GLU B 2 4   ? -89.346 27.640  17.574  1.00 55.47  ? 4    GLU B CA  1 
ATOM   2542 C C   . GLU B 2 4   ? -89.706 26.235  18.099  1.00 56.47  ? 4    GLU B C   1 
ATOM   2543 O O   . GLU B 2 4   ? -89.168 25.205  17.659  1.00 48.34  ? 4    GLU B O   1 
ATOM   2544 C CB  . GLU B 2 4   ? -90.172 28.112  16.350  1.00 73.78  ? 4    GLU B CB  1 
ATOM   2545 C CG  . GLU B 2 4   ? -90.615 27.057  15.339  1.00 89.52  ? 4    GLU B CG  1 
ATOM   2546 C CD  . GLU B 2 4   ? -90.973 27.635  13.960  1.00 99.72  ? 4    GLU B CD  1 
ATOM   2547 O OE1 . GLU B 2 4   ? -90.769 28.849  13.726  1.00 94.71  ? 4    GLU B OE1 1 
ATOM   2548 O OE2 . GLU B 2 4   ? -91.455 26.867  13.092  1.00 82.67  ? 4    GLU B OE2 1 
ATOM   2549 N N   . ILE B 2 5   ? -90.612 26.220  19.073  1.00 54.72  ? 5    ILE B N   1 
ATOM   2550 C CA  A ILE B 2 5   ? -90.994 25.006  19.769  0.50 49.39  ? 5    ILE B CA  1 
ATOM   2551 C CA  B ILE B 2 5   ? -90.985 24.996  19.755  0.50 48.61  ? 5    ILE B CA  1 
ATOM   2552 C C   . ILE B 2 5   ? -92.470 24.734  19.554  1.00 55.58  ? 5    ILE B C   1 
ATOM   2553 O O   . ILE B 2 5   ? -93.306 25.611  19.773  1.00 50.08  ? 5    ILE B O   1 
ATOM   2554 C CB  A ILE B 2 5   ? -90.714 25.123  21.276  0.50 52.33  ? 5    ILE B CB  1 
ATOM   2555 C CB  B ILE B 2 5   ? -90.571 25.022  21.253  0.50 49.69  ? 5    ILE B CB  1 
ATOM   2556 C CG1 A ILE B 2 5   ? -89.366 25.789  21.520  0.50 50.01  ? 5    ILE B CG1 1 
ATOM   2557 C CG1 B ILE B 2 5   ? -91.315 23.939  22.053  0.50 52.65  ? 5    ILE B CG1 1 
ATOM   2558 C CG2 A ILE B 2 5   ? -90.738 23.749  21.933  0.50 54.94  ? 5    ILE B CG2 1 
ATOM   2559 C CG2 B ILE B 2 5   ? -90.791 26.395  21.876  0.50 49.24  ? 5    ILE B CG2 1 
ATOM   2560 C CD1 A ILE B 2 5   ? -88.845 25.576  22.916  0.50 54.95  ? 5    ILE B CD1 1 
ATOM   2561 C CD1 B ILE B 2 5   ? -90.770 23.740  23.449  0.50 48.29  ? 5    ILE B CD1 1 
ATOM   2562 N N   . GLU B 2 6   ? -92.780 23.517  19.122  1.00 60.60  ? 6    GLU B N   1 
ATOM   2563 C CA  . GLU B 2 6   ? -94.144 23.090  18.887  1.00 56.60  ? 6    GLU B CA  1 
ATOM   2564 C C   . GLU B 2 6   ? -94.394 21.865  19.770  1.00 52.74  ? 6    GLU B C   1 
ATOM   2565 O O   . GLU B 2 6   ? -93.815 20.800  19.545  1.00 45.33  ? 6    GLU B O   1 
ATOM   2566 C CB  . GLU B 2 6   ? -94.306 22.756  17.405  1.00 67.60  ? 6    GLU B CB  1 
ATOM   2567 C CG  . GLU B 2 6   ? -95.674 22.220  16.993  1.00 93.78  ? 6    GLU B CG  1 
ATOM   2568 C CD  . GLU B 2 6   ? -95.692 21.737  15.550  1.00 102.69 ? 6    GLU B CD  1 
ATOM   2569 O OE1 . GLU B 2 6   ? -95.219 22.484  14.658  1.00 97.18  ? 6    GLU B OE1 1 
ATOM   2570 O OE2 . GLU B 2 6   ? -96.169 20.603  15.315  1.00 102.49 ? 6    GLU B OE2 1 
ATOM   2571 N N   . THR B 2 7   ? -95.233 22.009  20.791  1.00 53.17  ? 7    THR B N   1 
ATOM   2572 C CA  . THR B 2 7   ? -95.451 20.903  21.720  1.00 52.42  ? 7    THR B CA  1 
ATOM   2573 C C   . THR B 2 7   ? -96.115 19.763  20.980  1.00 47.39  ? 7    THR B C   1 
ATOM   2574 O O   . THR B 2 7   ? -96.888 19.969  20.068  1.00 46.75  ? 7    THR B O   1 
ATOM   2575 C CB  . THR B 2 7   ? -96.246 21.323  22.975  1.00 60.59  ? 7    THR B CB  1 
ATOM   2576 O OG1 . THR B 2 7   ? -95.452 22.236  23.742  1.00 58.62  ? 7    THR B OG1 1 
ATOM   2577 C CG2 . THR B 2 7   ? -96.575 20.114  23.872  1.00 61.27  ? 7    THR B CG2 1 
ATOM   2578 N N   . ILE B 2 8   ? -95.732 18.552  21.329  1.00 46.01  ? 8    ILE B N   1 
ATOM   2579 C CA  . ILE B 2 8   ? -96.382 17.369  20.813  1.00 47.86  ? 8    ILE B CA  1 
ATOM   2580 C C   . ILE B 2 8   ? -97.204 16.737  21.936  1.00 49.97  ? 8    ILE B C   1 
ATOM   2581 O O   . ILE B 2 8   ? -98.333 16.320  21.710  1.00 47.75  ? 8    ILE B O   1 
ATOM   2582 C CB  . ILE B 2 8   ? -95.345 16.375  20.252  1.00 49.23  ? 8    ILE B CB  1 
ATOM   2583 C CG1 . ILE B 2 8   ? -94.799 16.893  18.903  1.00 48.13  ? 8    ILE B CG1 1 
ATOM   2584 C CG2 . ILE B 2 8   ? -95.958 14.992  20.099  1.00 48.83  ? 8    ILE B CG2 1 
ATOM   2585 C CD1 . ILE B 2 8   ? -93.460 16.297  18.509  1.00 45.77  ? 8    ILE B CD1 1 
ATOM   2586 N N   . SER B 2 9   ? -96.619 16.644  23.132  1.00 48.37  ? 9    SER B N   1 
ATOM   2587 C CA  . SER B 2 9   ? -97.335 16.177  24.325  1.00 47.26  ? 9    SER B CA  1 
ATOM   2588 C C   . SER B 2 9   ? -96.736 16.865  25.552  1.00 45.17  ? 9    SER B C   1 
ATOM   2589 O O   . SER B 2 9   ? -95.540 17.136  25.585  1.00 43.22  ? 9    SER B O   1 
ATOM   2590 C CB  . SER B 2 9   ? -97.239 14.670  24.455  1.00 46.13  ? 9    SER B CB  1 
ATOM   2591 O OG  . SER B 2 9   ? -95.902 14.260  24.673  1.00 44.82  ? 9    SER B OG  1 
ATOM   2592 N N   . PRO B 2 10  ? -97.571 17.191  26.538  1.00 43.55  ? 10   PRO B N   1 
ATOM   2593 C CA  . PRO B 2 10  ? -97.080 18.027  27.621  1.00 45.36  ? 10   PRO B CA  1 
ATOM   2594 C C   . PRO B 2 10  ? -96.162 17.297  28.604  1.00 39.27  ? 10   PRO B C   1 
ATOM   2595 O O   . PRO B 2 10  ? -96.188 16.089  28.693  1.00 41.57  ? 10   PRO B O   1 
ATOM   2596 C CB  . PRO B 2 10  ? -98.372 18.475  28.337  1.00 48.37  ? 10   PRO B CB  1 
ATOM   2597 C CG  . PRO B 2 10  ? -99.353 17.391  28.046  1.00 46.68  ? 10   PRO B CG  1 
ATOM   2598 C CD  . PRO B 2 10  ? -99.010 16.884  26.670  1.00 47.83  ? 10   PRO B CD  1 
ATOM   2599 N N   . GLY B 2 11  ? -95.365 18.066  29.331  1.00 36.16  ? 11   GLY B N   1 
ATOM   2600 C CA  . GLY B 2 11  ? -94.585 17.581  30.438  1.00 37.06  ? 11   GLY B CA  1 
ATOM   2601 C C   . GLY B 2 11  ? -95.320 17.967  31.690  1.00 38.84  ? 11   GLY B C   1 
ATOM   2602 O O   . GLY B 2 11  ? -96.489 18.276  31.643  1.00 42.83  ? 11   GLY B O   1 
ATOM   2603 N N   . ASP B 2 12  ? -94.638 17.953  32.818  1.00 37.72  ? 12   ASP B N   1 
ATOM   2604 C CA  . ASP B 2 12  ? -95.318 18.172  34.066  1.00 40.47  ? 12   ASP B CA  1 
ATOM   2605 C C   . ASP B 2 12  ? -95.680 19.644  34.256  1.00 42.50  ? 12   ASP B C   1 
ATOM   2606 O O   . ASP B 2 12  ? -96.308 19.968  35.242  1.00 44.33  ? 12   ASP B O   1 
ATOM   2607 C CB  . ASP B 2 12  ? -94.509 17.625  35.264  1.00 35.14  ? 12   ASP B CB  1 
ATOM   2608 C CG  . ASP B 2 12  ? -93.308 18.465  35.599  1.00 35.98  ? 12   ASP B CG  1 
ATOM   2609 O OD1 . ASP B 2 12  ? -92.985 19.348  34.783  1.00 35.95  ? 12   ASP B OD1 1 
ATOM   2610 O OD2 . ASP B 2 12  ? -92.681 18.237  36.657  1.00 34.14  ? 12   ASP B OD2 1 
ATOM   2611 N N   . GLY B 2 13  ? -95.255 20.506  33.326  1.00 47.72  ? 13   GLY B N   1 
ATOM   2612 C CA  . GLY B 2 13  ? -95.513 21.967  33.372  1.00 44.85  ? 13   GLY B CA  1 
ATOM   2613 C C   . GLY B 2 13  ? -94.948 22.637  34.610  1.00 44.61  ? 13   GLY B C   1 
ATOM   2614 O O   . GLY B 2 13  ? -95.423 23.678  35.008  1.00 53.13  ? 13   GLY B O   1 
ATOM   2615 N N   . ARG B 2 14  ? -93.941 22.035  35.231  1.00 38.05  ? 14   ARG B N   1 
ATOM   2616 C CA  . ARG B 2 14  ? -93.407 22.538  36.479  1.00 43.02  ? 14   ARG B CA  1 
ATOM   2617 C C   . ARG B 2 14  ? -91.888 22.410  36.578  1.00 44.38  ? 14   ARG B C   1 
ATOM   2618 O O   . ARG B 2 14  ? -91.253 23.289  37.121  1.00 40.95  ? 14   ARG B O   1 
ATOM   2619 C CB  . ARG B 2 14  ? -94.027 21.774  37.646  1.00 53.17  ? 14   ARG B CB  1 
ATOM   2620 C CG  . ARG B 2 14  ? -93.838 22.452  39.002  1.00 81.43  ? 14   ARG B CG  1 
ATOM   2621 C CD  . ARG B 2 14  ? -94.631 21.798  40.140  1.00 92.46  ? 14   ARG B CD  1 
ATOM   2622 N NE  . ARG B 2 14  ? -93.993 20.553  40.561  1.00 106.82 ? 14   ARG B NE  1 
ATOM   2623 C CZ  . ARG B 2 14  ? -94.253 19.345  40.059  1.00 111.34 ? 14   ARG B CZ  1 
ATOM   2624 N NH1 . ARG B 2 14  ? -95.177 19.162  39.120  1.00 129.27 ? 14   ARG B NH1 1 
ATOM   2625 N NH2 . ARG B 2 14  ? -93.582 18.297  40.500  1.00 97.45  ? 14   ARG B NH2 1 
ATOM   2626 N N   . THR B 2 15  ? -91.315 21.291  36.115  1.00 39.11  ? 15   THR B N   1 
ATOM   2627 C CA  . THR B 2 15  ? -89.893 21.018  36.276  1.00 36.17  ? 15   THR B CA  1 
ATOM   2628 C C   . THR B 2 15  ? -89.165 21.301  34.953  1.00 38.45  ? 15   THR B C   1 
ATOM   2629 O O   . THR B 2 15  ? -89.370 20.592  33.952  1.00 37.70  ? 15   THR B O   1 
ATOM   2630 C CB  . THR B 2 15  ? -89.662 19.567  36.734  1.00 35.68  ? 15   THR B CB  1 
ATOM   2631 O OG1 . THR B 2 15  ? -90.627 19.223  37.742  1.00 35.42  ? 15   THR B OG1 1 
ATOM   2632 C CG2 . THR B 2 15  ? -88.268 19.411  37.312  1.00 36.20  ? 15   THR B CG2 1 
ATOM   2633 N N   . PHE B 2 16  ? -88.370 22.374  34.951  1.00 38.50  ? 16   PHE B N   1 
ATOM   2634 C CA  . PHE B 2 16  ? -87.595 22.824  33.785  1.00 32.54  ? 16   PHE B CA  1 
ATOM   2635 C C   . PHE B 2 16  ? -86.117 22.736  34.085  1.00 29.88  ? 16   PHE B C   1 
ATOM   2636 O O   . PHE B 2 16  ? -85.715 22.851  35.233  1.00 33.40  ? 16   PHE B O   1 
ATOM   2637 C CB  . PHE B 2 16  ? -87.940 24.265  33.416  1.00 32.68  ? 16   PHE B CB  1 
ATOM   2638 C CG  . PHE B 2 16  ? -89.380 24.461  33.075  1.00 33.56  ? 16   PHE B CG  1 
ATOM   2639 C CD1 . PHE B 2 16  ? -90.317 24.605  34.077  1.00 35.22  ? 16   PHE B CD1 1 
ATOM   2640 C CD2 . PHE B 2 16  ? -89.795 24.486  31.769  1.00 29.52  ? 16   PHE B CD2 1 
ATOM   2641 C CE1 . PHE B 2 16  ? -91.655 24.767  33.762  1.00 35.99  ? 16   PHE B CE1 1 
ATOM   2642 C CE2 . PHE B 2 16  ? -91.122 24.651  31.445  1.00 33.38  ? 16   PHE B CE2 1 
ATOM   2643 C CZ  . PHE B 2 16  ? -92.057 24.807  32.437  1.00 33.93  ? 16   PHE B CZ  1 
ATOM   2644 N N   . PRO B 2 17  ? -85.292 22.524  33.048  1.00 27.26  ? 17   PRO B N   1 
ATOM   2645 C CA  . PRO B 2 17  ? -83.862 22.369  33.270  1.00 28.01  ? 17   PRO B CA  1 
ATOM   2646 C C   . PRO B 2 17  ? -83.182 23.580  33.909  1.00 28.87  ? 17   PRO B C   1 
ATOM   2647 O O   . PRO B 2 17  ? -83.450 24.703  33.496  1.00 27.57  ? 17   PRO B O   1 
ATOM   2648 C CB  . PRO B 2 17  ? -83.306 22.139  31.869  1.00 26.99  ? 17   PRO B CB  1 
ATOM   2649 C CG  . PRO B 2 17  ? -84.465 21.688  31.055  1.00 26.08  ? 17   PRO B CG  1 
ATOM   2650 C CD  . PRO B 2 17  ? -85.663 22.347  31.637  1.00 25.88  ? 17   PRO B CD  1 
ATOM   2651 N N   . LYS B 2 18  ? -82.308 23.319  34.880  1.00 29.15  ? 18   LYS B N   1 
ATOM   2652 C CA  . LYS B 2 18  ? -81.601 24.331  35.640  1.00 32.47  ? 18   LYS B CA  1 
ATOM   2653 C C   . LYS B 2 18  ? -80.132 24.160  35.402  1.00 37.08  ? 18   LYS B C   1 
ATOM   2654 O O   . LYS B 2 18  ? -79.667 23.053  35.098  1.00 32.71  ? 18   LYS B O   1 
ATOM   2655 C CB  . LYS B 2 18  ? -81.822 24.196  37.154  1.00 33.17  ? 18   LYS B CB  1 
ATOM   2656 C CG  . LYS B 2 18  ? -83.260 24.273  37.648  1.00 36.53  ? 18   LYS B CG  1 
ATOM   2657 C CD  . LYS B 2 18  ? -84.064 25.358  36.952  1.00 41.92  ? 18   LYS B CD  1 
ATOM   2658 C CE  . LYS B 2 18  ? -85.411 25.597  37.644  1.00 49.54  ? 18   LYS B CE  1 
ATOM   2659 N NZ  . LYS B 2 18  ? -86.191 26.725  37.037  1.00 52.06  ? 18   LYS B NZ  1 
ATOM   2660 N N   . LYS B 2 19  ? -79.398 25.251  35.606  1.00 33.40  ? 19   LYS B N   1 
ATOM   2661 C CA  . LYS B 2 19  ? -77.971 25.263  35.419  1.00 33.81  ? 19   LYS B CA  1 
ATOM   2662 C C   . LYS B 2 19  ? -77.288 24.077  36.083  1.00 33.87  ? 19   LYS B C   1 
ATOM   2663 O O   . LYS B 2 19  ? -77.542 23.780  37.244  1.00 33.14  ? 19   LYS B O   1 
ATOM   2664 C CB  . LYS B 2 19  ? -77.380 26.538  36.019  1.00 40.74  ? 19   LYS B CB  1 
ATOM   2665 C CG  . LYS B 2 19  ? -75.904 26.695  35.693  1.00 48.81  ? 19   LYS B CG  1 
ATOM   2666 C CD  . LYS B 2 19  ? -75.288 27.935  36.295  1.00 58.62  ? 19   LYS B CD  1 
ATOM   2667 C CE  . LYS B 2 19  ? -73.894 28.107  35.719  1.00 67.68  ? 19   LYS B CE  1 
ATOM   2668 N NZ  . LYS B 2 19  ? -73.131 29.070  36.548  1.00 80.65  ? 19   LYS B NZ  1 
ATOM   2669 N N   . GLY B 2 20  ? -76.378 23.421  35.367  1.00 35.11  ? 20   GLY B N   1 
ATOM   2670 C CA  . GLY B 2 20  ? -75.615 22.327  35.963  1.00 37.03  ? 20   GLY B CA  1 
ATOM   2671 C C   . GLY B 2 20  ? -76.336 20.963  35.980  1.00 36.83  ? 20   GLY B C   1 
ATOM   2672 O O   . GLY B 2 20  ? -75.697 19.946  36.181  1.00 38.47  ? 20   GLY B O   1 
ATOM   2673 N N   . GLN B 2 21  ? -77.652 20.941  35.777  1.00 34.36  ? 21   GLN B N   1 
ATOM   2674 C CA  . GLN B 2 21  ? -78.382 19.693  35.635  1.00 34.47  ? 21   GLN B CA  1 
ATOM   2675 C C   . GLN B 2 21  ? -78.035 18.930  34.336  1.00 32.94  ? 21   GLN B C   1 
ATOM   2676 O O   . GLN B 2 21  ? -77.736 19.507  33.289  1.00 28.11  ? 21   GLN B O   1 
ATOM   2677 C CB  . GLN B 2 21  ? -79.890 19.942  35.678  1.00 32.43  ? 21   GLN B CB  1 
ATOM   2678 C CG  . GLN B 2 21  ? -80.380 20.350  37.042  1.00 31.03  ? 21   GLN B CG  1 
ATOM   2679 C CD  . GLN B 2 21  ? -81.869 20.248  37.135  1.00 32.41  ? 21   GLN B CD  1 
ATOM   2680 O OE1 . GLN B 2 21  ? -82.591 20.868  36.364  1.00 30.16  ? 21   GLN B OE1 1 
ATOM   2681 N NE2 . GLN B 2 21  ? -82.345 19.435  38.067  1.00 37.04  ? 21   GLN B NE2 1 
ATOM   2682 N N   . THR B 2 22  ? -78.095 17.613  34.430  1.00 33.43  ? 22   THR B N   1 
ATOM   2683 C CA  . THR B 2 22  ? -77.929 16.766  33.285  1.00 27.91  ? 22   THR B CA  1 
ATOM   2684 C C   . THR B 2 22  ? -79.292 16.522  32.713  1.00 25.57  ? 22   THR B C   1 
ATOM   2685 O O   . THR B 2 22  ? -80.182 16.002  33.381  1.00 28.49  ? 22   THR B O   1 
ATOM   2686 C CB  . THR B 2 22  ? -77.259 15.444  33.645  1.00 28.87  ? 22   THR B CB  1 
ATOM   2687 O OG1 . THR B 2 22  ? -75.957 15.711  34.116  1.00 29.91  ? 22   THR B OG1 1 
ATOM   2688 C CG2 . THR B 2 22  ? -77.093 14.584  32.421  1.00 30.55  ? 22   THR B CG2 1 
ATOM   2689 N N   . CYS B 2 23  ? -79.445 16.945  31.471  1.00 23.79  ? 23   CYS B N   1 
ATOM   2690 C CA  A CYS B 2 23  ? -80.671 16.664  30.704  0.50 26.90  ? 23   CYS B CA  1 
ATOM   2691 C CA  B CYS B 2 23  ? -80.622 16.723  30.687  0.50 27.28  ? 23   CYS B CA  1 
ATOM   2692 C C   . CYS B 2 23  ? -80.514 15.339  30.017  1.00 28.26  ? 23   CYS B C   1 
ATOM   2693 O O   . CYS B 2 23  ? -79.506 15.090  29.363  1.00 26.36  ? 23   CYS B O   1 
ATOM   2694 C CB  A CYS B 2 23  ? -80.939 17.658  29.575  0.50 26.13  ? 23   CYS B CB  1 
ATOM   2695 C CB  B CYS B 2 23  ? -80.609 17.809  29.617  0.50 27.72  ? 23   CYS B CB  1 
ATOM   2696 S SG  A CYS B 2 23  ? -81.320 19.304  30.102  0.50 25.68  ? 23   CYS B SG  1 
ATOM   2697 S SG  B CYS B 2 23  ? -82.185 18.433  29.142  0.50 24.78  ? 23   CYS B SG  1 
ATOM   2698 N N   . VAL B 2 24  ? -81.542 14.501  30.152  1.00 26.44  ? 24   VAL B N   1 
ATOM   2699 C CA  . VAL B 2 24  ? -81.585 13.177  29.548  1.00 24.09  ? 24   VAL B CA  1 
ATOM   2700 C C   . VAL B 2 24  ? -82.727 13.213  28.528  1.00 23.51  ? 24   VAL B C   1 
ATOM   2701 O O   . VAL B 2 24  ? -83.887 13.383  28.895  1.00 26.01  ? 24   VAL B O   1 
ATOM   2702 C CB  . VAL B 2 24  ? -81.830 12.086  30.613  1.00 26.25  ? 24   VAL B CB  1 
ATOM   2703 C CG1 . VAL B 2 24  ? -81.859 10.704  29.978  1.00 30.62  ? 24   VAL B CG1 1 
ATOM   2704 C CG2 . VAL B 2 24  ? -80.787 12.133  31.714  1.00 24.94  ? 24   VAL B CG2 1 
ATOM   2705 N N   . VAL B 2 25  ? -82.397 13.086  27.252  1.00 23.80  ? 25   VAL B N   1 
ATOM   2706 C CA  . VAL B 2 25  ? -83.387 13.191  26.211  1.00 24.82  ? 25   VAL B CA  1 
ATOM   2707 C C   . VAL B 2 25  ? -83.304 12.063  25.205  1.00 24.53  ? 25   VAL B C   1 
ATOM   2708 O O   . VAL B 2 25  ? -82.285 11.449  25.067  1.00 23.32  ? 25   VAL B O   1 
ATOM   2709 C CB  . VAL B 2 25  ? -83.240 14.517  25.452  1.00 24.48  ? 25   VAL B CB  1 
ATOM   2710 C CG1 . VAL B 2 25  ? -83.299 15.688  26.422  1.00 24.62  ? 25   VAL B CG1 1 
ATOM   2711 C CG2 . VAL B 2 25  ? -81.932 14.570  24.671  1.00 23.92  ? 25   VAL B CG2 1 
ATOM   2712 N N   . HIS B 2 26  ? -84.411 11.808  24.517  1.00 25.95  ? 26   HIS B N   1 
ATOM   2713 C CA  . HIS B 2 26  ? -84.364 11.163  23.217  1.00 26.57  ? 26   HIS B CA  1 
ATOM   2714 C C   . HIS B 2 26  ? -84.588 12.246  22.193  1.00 25.52  ? 26   HIS B C   1 
ATOM   2715 O O   . HIS B 2 26  ? -85.353 13.171  22.435  1.00 28.15  ? 26   HIS B O   1 
ATOM   2716 C CB  . HIS B 2 26  ? -85.433 10.071  23.067  1.00 24.39  ? 26   HIS B CB  1 
ATOM   2717 C CG  . HIS B 2 26  ? -84.956 8.719   23.488  1.00 24.27  ? 26   HIS B CG  1 
ATOM   2718 N ND1 . HIS B 2 26  ? -83.780 8.181   23.020  1.00 24.92  ? 26   HIS B ND1 1 
ATOM   2719 C CD2 . HIS B 2 26  ? -85.485 7.793   24.318  1.00 25.36  ? 26   HIS B CD2 1 
ATOM   2720 C CE1 . HIS B 2 26  ? -83.581 6.999   23.564  1.00 24.52  ? 26   HIS B CE1 1 
ATOM   2721 N NE2 . HIS B 2 26  ? -84.606 6.735   24.349  1.00 25.69  ? 26   HIS B NE2 1 
ATOM   2722 N N   . TYR B 2 27  ? -83.903 12.139  21.070  1.00 24.73  ? 27   TYR B N   1 
ATOM   2723 C CA  . TYR B 2 27  ? -84.093 13.057  19.957  1.00 29.34  ? 27   TYR B CA  1 
ATOM   2724 C C   . TYR B 2 27  ? -83.996 12.314  18.642  1.00 28.95  ? 27   TYR B C   1 
ATOM   2725 O O   . TYR B 2 27  ? -83.285 11.307  18.543  1.00 30.16  ? 27   TYR B O   1 
ATOM   2726 C CB  . TYR B 2 27  ? -83.033 14.177  19.963  1.00 25.67  ? 27   TYR B CB  1 
ATOM   2727 C CG  . TYR B 2 27  ? -81.653 13.706  19.641  1.00 23.85  ? 27   TYR B CG  1 
ATOM   2728 C CD1 . TYR B 2 27  ? -80.808 13.287  20.632  1.00 25.42  ? 27   TYR B CD1 1 
ATOM   2729 C CD2 . TYR B 2 27  ? -81.192 13.674  18.341  1.00 26.34  ? 27   TYR B CD2 1 
ATOM   2730 C CE1 . TYR B 2 27  ? -79.534 12.858  20.351  1.00 24.74  ? 27   TYR B CE1 1 
ATOM   2731 C CE2 . TYR B 2 27  ? -79.916 13.215  18.048  1.00 29.72  ? 27   TYR B CE2 1 
ATOM   2732 C CZ  . TYR B 2 27  ? -79.094 12.808  19.071  1.00 23.36  ? 27   TYR B CZ  1 
ATOM   2733 O OH  . TYR B 2 27  ? -77.805 12.367  18.838  1.00 26.59  ? 27   TYR B OH  1 
ATOM   2734 N N   . THR B 2 28  ? -84.739 12.803  17.658  1.00 27.67  ? 28   THR B N   1 
ATOM   2735 C CA  . THR B 2 28  ? -84.543 12.439  16.274  1.00 28.61  ? 28   THR B CA  1 
ATOM   2736 C C   . THR B 2 28  ? -84.343 13.743  15.526  1.00 29.38  ? 28   THR B C   1 
ATOM   2737 O O   . THR B 2 28  ? -85.183 14.636  15.602  1.00 31.22  ? 28   THR B O   1 
ATOM   2738 C CB  . THR B 2 28  ? -85.748 11.673  15.714  1.00 31.38  ? 28   THR B CB  1 
ATOM   2739 O OG1 . THR B 2 28  ? -85.942 10.490  16.487  1.00 27.11  ? 28   THR B OG1 1 
ATOM   2740 C CG2 . THR B 2 28  ? -85.540 11.284  14.201  1.00 29.43  ? 28   THR B CG2 1 
ATOM   2741 N N   . GLY B 2 29  ? -83.226 13.855  14.831  1.00 30.15  ? 29   GLY B N   1 
ATOM   2742 C CA  . GLY B 2 29  ? -82.894 15.069  14.095  1.00 37.18  ? 29   GLY B CA  1 
ATOM   2743 C C   . GLY B 2 29  ? -83.089 14.896  12.596  1.00 37.28  ? 29   GLY B C   1 
ATOM   2744 O O   . GLY B 2 29  ? -82.647 13.899  12.008  1.00 36.30  ? 29   GLY B O   1 
ATOM   2745 N N   . MET B 2 30  ? -83.737 15.878  11.975  1.00 37.51  ? 30   MET B N   1 
ATOM   2746 C CA  . MET B 2 30  ? -83.968 15.856  10.542  1.00 42.97  ? 30   MET B CA  1 
ATOM   2747 C C   . MET B 2 30  ? -83.586 17.177  9.887   1.00 42.91  ? 30   MET B C   1 
ATOM   2748 O O   . MET B 2 30  ? -83.631 18.232  10.522  1.00 39.89  ? 30   MET B O   1 
ATOM   2749 C CB  . MET B 2 30  ? -85.447 15.582  10.270  1.00 44.41  ? 30   MET B CB  1 
ATOM   2750 C CG  . MET B 2 30  ? -85.943 14.226  10.764  1.00 54.09  ? 30   MET B CG  1 
ATOM   2751 S SD  . MET B 2 30  ? -87.713 14.222  11.104  1.00 59.30  ? 30   MET B SD  1 
ATOM   2752 C CE  . MET B 2 30  ? -87.754 14.894  12.785  1.00 51.22  ? 30   MET B CE  1 
ATOM   2753 N N   . LEU B 2 31  ? -83.253 17.114  8.599   1.00 40.71  ? 31   LEU B N   1 
ATOM   2754 C CA  . LEU B 2 31  ? -83.154 18.319  7.771   1.00 39.70  ? 31   LEU B CA  1 
ATOM   2755 C C   . LEU B 2 31  ? -84.564 18.811  7.441   1.00 42.30  ? 31   LEU B C   1 
ATOM   2756 O O   . LEU B 2 31  ? -85.559 18.087  7.631   1.00 43.54  ? 31   LEU B O   1 
ATOM   2757 C CB  . LEU B 2 31  ? -82.363 18.043  6.485   1.00 37.99  ? 31   LEU B CB  1 
ATOM   2758 C CG  . LEU B 2 31  ? -81.004 17.361  6.710   1.00 39.09  ? 31   LEU B CG  1 
ATOM   2759 C CD1 . LEU B 2 31  ? -80.275 17.139  5.398   1.00 40.59  ? 31   LEU B CD1 1 
ATOM   2760 C CD2 . LEU B 2 31  ? -80.145 18.150  7.678   1.00 38.76  ? 31   LEU B CD2 1 
ATOM   2761 N N   . GLN B 2 32  ? -84.658 20.040  6.957   1.00 44.15  ? 32   GLN B N   1 
ATOM   2762 C CA  . GLN B 2 32  ? -85.951 20.579  6.513   1.00 52.87  ? 32   GLN B CA  1 
ATOM   2763 C C   . GLN B 2 32  ? -86.707 19.727  5.501   1.00 50.14  ? 32   GLN B C   1 
ATOM   2764 O O   . GLN B 2 32  ? -87.931 19.747  5.484   1.00 56.23  ? 32   GLN B O   1 
ATOM   2765 C CB  . GLN B 2 32  ? -85.795 21.984  5.956   1.00 54.87  ? 32   GLN B CB  1 
ATOM   2766 C CG  . GLN B 2 32  ? -86.472 22.998  6.838   1.00 60.50  ? 32   GLN B CG  1 
ATOM   2767 C CD  . GLN B 2 32  ? -86.194 24.402  6.399   1.00 58.87  ? 32   GLN B CD  1 
ATOM   2768 O OE1 . GLN B 2 32  ? -85.238 24.661  5.678   1.00 50.06  ? 32   GLN B OE1 1 
ATOM   2769 N NE2 . GLN B 2 32  ? -87.007 25.327  6.867   1.00 63.07  ? 32   GLN B NE2 1 
ATOM   2770 N N   . ASN B 2 33  ? -85.995 18.984  4.662   1.00 51.44  ? 33   ASN B N   1 
ATOM   2771 C CA  . ASN B 2 33  ? -86.649 18.097  3.695   1.00 55.53  ? 33   ASN B CA  1 
ATOM   2772 C C   . ASN B 2 33  ? -87.131 16.782  4.316   1.00 59.18  ? 33   ASN B C   1 
ATOM   2773 O O   . ASN B 2 33  ? -87.560 15.885  3.596   1.00 64.04  ? 33   ASN B O   1 
ATOM   2774 C CB  . ASN B 2 33  ? -85.699 17.782  2.540   1.00 54.56  ? 33   ASN B CB  1 
ATOM   2775 C CG  . ASN B 2 33  ? -84.510 16.962  2.979   1.00 57.67  ? 33   ASN B CG  1 
ATOM   2776 O OD1 . ASN B 2 33  ? -84.506 16.408  4.077   1.00 59.14  ? 33   ASN B OD1 1 
ATOM   2777 N ND2 . ASN B 2 33  ? -83.484 16.903  2.143   1.00 57.50  ? 33   ASN B ND2 1 
ATOM   2778 N N   . GLY B 2 34  ? -87.029 16.657  5.638   1.00 58.34  ? 34   GLY B N   1 
ATOM   2779 C CA  . GLY B 2 34  ? -87.470 15.454  6.343   1.00 57.34  ? 34   GLY B CA  1 
ATOM   2780 C C   . GLY B 2 34  ? -86.436 14.338  6.468   1.00 54.04  ? 34   GLY B C   1 
ATOM   2781 O O   . GLY B 2 34  ? -86.692 13.339  7.133   1.00 56.81  ? 34   GLY B O   1 
ATOM   2782 N N   . LYS B 2 35  ? -85.269 14.487  5.845   1.00 52.23  ? 35   LYS B N   1 
ATOM   2783 C CA  . LYS B 2 35  ? -84.268 13.429  5.897   1.00 51.92  ? 35   LYS B CA  1 
ATOM   2784 C C   . LYS B 2 35  ? -83.680 13.400  7.306   1.00 46.75  ? 35   LYS B C   1 
ATOM   2785 O O   . LYS B 2 35  ? -83.246 14.423  7.832   1.00 38.81  ? 35   LYS B O   1 
ATOM   2786 C CB  . LYS B 2 35  ? -83.174 13.633  4.843   1.00 53.92  ? 35   LYS B CB  1 
ATOM   2787 C CG  . LYS B 2 35  ? -82.082 12.563  4.845   1.00 62.36  ? 35   LYS B CG  1 
ATOM   2788 N N   . LYS B 2 36  ? -83.711 12.224  7.913   1.00 41.26  ? 36   LYS B N   1 
ATOM   2789 C CA  . LYS B 2 36  ? -83.194 12.015  9.251   1.00 46.32  ? 36   LYS B CA  1 
ATOM   2790 C C   . LYS B 2 36  ? -81.677 11.991  9.151   1.00 39.89  ? 36   LYS B C   1 
ATOM   2791 O O   . LYS B 2 36  ? -81.147 11.388  8.246   1.00 40.13  ? 36   LYS B O   1 
ATOM   2792 C CB  . LYS B 2 36  ? -83.730 10.692  9.804   1.00 41.84  ? 36   LYS B CB  1 
ATOM   2793 C CG  . LYS B 2 36  ? -83.013 10.231  11.056  1.00 47.00  ? 36   LYS B CG  1 
ATOM   2794 C CD  . LYS B 2 36  ? -83.231 8.749   11.323  1.00 46.52  ? 36   LYS B CD  1 
ATOM   2795 C CE  . LYS B 2 36  ? -84.689 8.386   11.427  1.00 41.71  ? 36   LYS B CE  1 
ATOM   2796 N NZ  . LYS B 2 36  ? -84.880 6.937   11.724  1.00 40.48  ? 36   LYS B NZ  1 
ATOM   2797 N N   . PHE B 2 37  ? -80.984 12.690  10.038  1.00 39.74  ? 37   PHE B N   1 
ATOM   2798 C CA  . PHE B 2 37  ? -79.529 12.640  10.074  1.00 32.22  ? 37   PHE B CA  1 
ATOM   2799 C C   . PHE B 2 37  ? -78.957 12.015  11.362  1.00 33.18  ? 37   PHE B C   1 
ATOM   2800 O O   . PHE B 2 37  ? -77.802 11.610  11.384  1.00 36.02  ? 37   PHE B O   1 
ATOM   2801 C CB  . PHE B 2 37  ? -78.929 14.026  9.821   1.00 32.80  ? 37   PHE B CB  1 
ATOM   2802 C CG  . PHE B 2 37  ? -79.274 15.060  10.872  1.00 33.40  ? 37   PHE B CG  1 
ATOM   2803 C CD1 . PHE B 2 37  ? -78.553 15.146  12.048  1.00 34.60  ? 37   PHE B CD1 1 
ATOM   2804 C CD2 . PHE B 2 37  ? -80.300 15.956  10.667  1.00 36.75  ? 37   PHE B CD2 1 
ATOM   2805 C CE1 . PHE B 2 37  ? -78.868 16.086  13.008  1.00 31.06  ? 37   PHE B CE1 1 
ATOM   2806 C CE2 . PHE B 2 37  ? -80.620 16.901  11.624  1.00 39.76  ? 37   PHE B CE2 1 
ATOM   2807 C CZ  . PHE B 2 37  ? -79.902 16.955  12.805  1.00 33.69  ? 37   PHE B CZ  1 
ATOM   2808 N N   . ASP B 2 38  ? -79.741 11.940  12.439  1.00 32.51  ? 38   ASP B N   1 
ATOM   2809 C CA  . ASP B 2 38  ? -79.242 11.402  13.727  1.00 27.33  ? 38   ASP B CA  1 
ATOM   2810 C C   . ASP B 2 38  ? -80.457 11.100  14.604  1.00 27.57  ? 38   ASP B C   1 
ATOM   2811 O O   . ASP B 2 38  ? -81.439 11.831  14.581  1.00 30.39  ? 38   ASP B O   1 
ATOM   2812 C CB  . ASP B 2 38  ? -78.303 12.420  14.401  1.00 25.74  ? 38   ASP B CB  1 
ATOM   2813 C CG  . ASP B 2 38  ? -77.567 11.865  15.640  1.00 28.83  ? 38   ASP B CG  1 
ATOM   2814 O OD1 . ASP B 2 38  ? -77.538 10.631  15.869  1.00 27.28  ? 38   ASP B OD1 1 
ATOM   2815 O OD2 . ASP B 2 38  ? -77.018 12.697  16.408  1.00 27.95  ? 38   ASP B OD2 1 
ATOM   2816 N N   . SER B 2 39  ? -80.383 10.021  15.362  1.00 25.38  ? 39   SER B N   1 
ATOM   2817 C CA  . SER B 2 39  ? -81.480 9.600   16.205  1.00 27.23  ? 39   SER B CA  1 
ATOM   2818 C C   . SER B 2 39  ? -81.021 8.783   17.399  1.00 25.86  ? 39   SER B C   1 
ATOM   2819 O O   . SER B 2 39  ? -80.519 7.679   17.226  1.00 25.76  ? 39   SER B O   1 
ATOM   2820 C CB  . SER B 2 39  ? -82.435 8.708   15.427  1.00 28.71  ? 39   SER B CB  1 
ATOM   2821 O OG  . SER B 2 39  ? -83.385 8.202   16.341  1.00 29.53  ? 39   SER B OG  1 
ATOM   2822 N N   . SER B 2 40  ? -81.199 9.295   18.609  1.00 24.72  ? 40   SER B N   1 
ATOM   2823 C CA  . SER B 2 40  ? -80.870 8.492   19.806  1.00 25.51  ? 40   SER B CA  1 
ATOM   2824 C C   . SER B 2 40  ? -81.872 7.333   19.942  1.00 24.75  ? 40   SER B C   1 
ATOM   2825 O O   . SER B 2 40  ? -81.601 6.349   20.581  1.00 24.43  ? 40   SER B O   1 
ATOM   2826 C CB  . SER B 2 40  ? -80.910 9.364   21.069  1.00 23.46  ? 40   SER B CB  1 
ATOM   2827 O OG  . SER B 2 40  ? -82.222 9.858   21.299  1.00 23.82  ? 40   SER B OG  1 
ATOM   2828 N N   . ARG B 2 41  ? -83.041 7.486   19.347  1.00 27.57  ? 41   ARG B N   1 
ATOM   2829 C CA  . ARG B 2 41  ? -84.090 6.479   19.465  1.00 31.86  ? 41   ARG B CA  1 
ATOM   2830 C C   . ARG B 2 41  ? -83.670 5.229   18.700  1.00 32.13  ? 41   ARG B C   1 
ATOM   2831 O O   . ARG B 2 41  ? -83.748 4.136   19.239  1.00 29.02  ? 41   ARG B O   1 
ATOM   2832 C CB  . ARG B 2 41  ? -85.419 7.015   18.932  1.00 32.09  ? 41   ARG B CB  1 
ATOM   2833 C CG  . ARG B 2 41  ? -86.041 8.141   19.741  1.00 30.51  ? 41   ARG B CG  1 
ATOM   2834 C CD  . ARG B 2 41  ? -87.348 8.599   19.112  1.00 30.79  ? 41   ARG B CD  1 
ATOM   2835 N NE  . ARG B 2 41  ? -88.065 9.554   19.966  1.00 29.84  ? 41   ARG B NE  1 
ATOM   2836 C CZ  . ARG B 2 41  ? -88.046 10.881  19.815  1.00 28.56  ? 41   ARG B CZ  1 
ATOM   2837 N NH1 . ARG B 2 41  ? -87.360 11.459  18.835  1.00 27.20  ? 41   ARG B NH1 1 
ATOM   2838 N NH2 . ARG B 2 41  ? -88.722 11.645  20.662  1.00 32.91  ? 41   ARG B NH2 1 
ATOM   2839 N N   . ASP B 2 42  ? -83.186 5.416   17.471  1.00 31.02  ? 42   ASP B N   1 
ATOM   2840 C CA  . ASP B 2 42  ? -82.644 4.315   16.678  1.00 32.43  ? 42   ASP B CA  1 
ATOM   2841 C C   . ASP B 2 42  ? -81.531 3.554   17.386  1.00 31.32  ? 42   ASP B C   1 
ATOM   2842 O O   . ASP B 2 42  ? -81.459 2.357   17.231  1.00 32.37  ? 42   ASP B O   1 
ATOM   2843 C CB  . ASP B 2 42  ? -82.155 4.795   15.311  1.00 36.10  ? 42   ASP B CB  1 
ATOM   2844 C CG  . ASP B 2 42  ? -83.289 5.197   14.400  1.00 36.53  ? 42   ASP B CG  1 
ATOM   2845 O OD1 . ASP B 2 42  ? -84.444 4.719   14.569  1.00 39.88  ? 42   ASP B OD1 1 
ATOM   2846 O OD2 . ASP B 2 42  ? -83.032 6.013   13.518  1.00 36.75  ? 42   ASP B OD2 1 
ATOM   2847 N N   . ARG B 2 43  ? -80.705 4.210   18.198  1.00 29.00  ? 43   ARG B N   1 
ATOM   2848 C CA  . ARG B 2 43  ? -79.707 3.470   18.974  1.00 27.09  ? 43   ARG B CA  1 
ATOM   2849 C C   . ARG B 2 43  ? -80.132 3.036   20.337  1.00 25.17  ? 43   ARG B C   1 
ATOM   2850 O O   . ARG B 2 43  ? -79.356 2.425   21.060  1.00 27.19  ? 43   ARG B O   1 
ATOM   2851 C CB  . ARG B 2 43  ? -78.339 4.176   19.022  1.00 35.89  ? 43   ARG B CB  1 
ATOM   2852 C CG  . ARG B 2 43  ? -78.316 5.662   19.104  1.00 38.87  ? 43   ARG B CG  1 
ATOM   2853 C CD  . ARG B 2 43  ? -76.885 6.223   19.204  1.00 33.24  ? 43   ARG B CD  1 
ATOM   2854 N NE  . ARG B 2 43  ? -76.956 7.522   19.855  1.00 26.93  ? 43   ARG B NE  1 
ATOM   2855 C CZ  . ARG B 2 43  ? -77.287 8.668   19.253  1.00 25.81  ? 43   ARG B CZ  1 
ATOM   2856 N NH1 . ARG B 2 43  ? -77.554 8.724   17.964  1.00 29.52  ? 43   ARG B NH1 1 
ATOM   2857 N NH2 . ARG B 2 43  ? -77.313 9.793   19.954  1.00 27.01  ? 43   ARG B NH2 1 
ATOM   2858 N N   . ASN B 2 44  ? -81.388 3.295   20.700  1.00 27.01  ? 44   ASN B N   1 
ATOM   2859 C CA  . ASN B 2 44  ? -81.885 2.964   22.024  1.00 26.84  ? 44   ASN B CA  1 
ATOM   2860 C C   . ASN B 2 44  ? -81.001 3.397   23.156  1.00 26.46  ? 44   ASN B C   1 
ATOM   2861 O O   . ASN B 2 44  ? -80.894 2.719   24.159  1.00 25.90  ? 44   ASN B O   1 
ATOM   2862 C CB  . ASN B 2 44  ? -82.248 1.460   22.134  1.00 27.02  ? 44   ASN B CB  1 
ATOM   2863 C CG  . ASN B 2 44  ? -83.585 1.170   21.481  1.00 29.23  ? 44   ASN B CG  1 
ATOM   2864 O OD1 . ASN B 2 44  ? -84.608 1.626   21.969  1.00 33.64  ? 44   ASN B OD1 1 
ATOM   2865 N ND2 . ASN B 2 44  ? -83.583 0.490   20.350  1.00 28.77  ? 44   ASN B ND2 1 
ATOM   2866 N N   . LYS B 2 45  ? -80.439 4.584   23.036  1.00 30.20  ? 45   LYS B N   1 
ATOM   2867 C CA  . LYS B 2 45  ? -79.593 5.120   24.102  1.00 33.26  ? 45   LYS B CA  1 
ATOM   2868 C C   . LYS B 2 45  ? -79.882 6.619   24.299  1.00 25.51  ? 45   LYS B C   1 
ATOM   2869 O O   . LYS B 2 45  ? -79.507 7.446   23.473  1.00 24.66  ? 45   LYS B O   1 
ATOM   2870 C CB  . LYS B 2 45  ? -78.087 4.880   23.785  1.00 35.41  ? 45   LYS B CB  1 
ATOM   2871 C CG  . LYS B 2 45  ? -77.245 4.766   25.054  1.00 49.53  ? 45   LYS B CG  1 
ATOM   2872 C CD  . LYS B 2 45  ? -75.746 4.941   24.824  1.00 66.59  ? 45   LYS B CD  1 
ATOM   2873 N N   . PRO B 2 46  ? -80.503 6.978   25.406  1.00 22.71  ? 46   PRO B N   1 
ATOM   2874 C CA  . PRO B 2 46  ? -80.709 8.416   25.652  1.00 26.26  ? 46   PRO B CA  1 
ATOM   2875 C C   . PRO B 2 46  ? -79.419 9.239   25.588  1.00 24.99  ? 46   PRO B C   1 
ATOM   2876 O O   . PRO B 2 46  ? -78.340 8.728   25.897  1.00 22.07  ? 46   PRO B O   1 
ATOM   2877 C CB  . PRO B 2 46  ? -81.279 8.454   27.050  1.00 26.65  ? 46   PRO B CB  1 
ATOM   2878 C CG  . PRO B 2 46  ? -81.871 7.103   27.248  1.00 28.87  ? 46   PRO B CG  1 
ATOM   2879 C CD  . PRO B 2 46  ? -80.963 6.158   26.532  1.00 27.37  ? 46   PRO B CD  1 
ATOM   2880 N N   . PHE B 2 47  ? -79.556 10.477  25.118  1.00 22.62  ? 47   PHE B N   1 
ATOM   2881 C CA  . PHE B 2 47  ? -78.487 11.487  25.066  1.00 21.38  ? 47   PHE B CA  1 
ATOM   2882 C C   . PHE B 2 47  ? -78.528 12.383  26.316  1.00 23.30  ? 47   PHE B C   1 
ATOM   2883 O O   . PHE B 2 47  ? -79.609 12.811  26.791  1.00 22.74  ? 47   PHE B O   1 
ATOM   2884 C CB  . PHE B 2 47  ? -78.705 12.318  23.797  1.00 25.27  ? 47   PHE B CB  1 
ATOM   2885 C CG  . PHE B 2 47  ? -77.756 13.481  23.605  1.00 23.22  ? 47   PHE B CG  1 
ATOM   2886 C CD1 . PHE B 2 47  ? -76.388 13.303  23.619  1.00 27.90  ? 47   PHE B CD1 1 
ATOM   2887 C CD2 . PHE B 2 47  ? -78.251 14.739  23.354  1.00 26.56  ? 47   PHE B CD2 1 
ATOM   2888 C CE1 . PHE B 2 47  ? -75.525 14.364  23.441  1.00 28.28  ? 47   PHE B CE1 1 
ATOM   2889 C CE2 . PHE B 2 47  ? -77.404 15.812  23.174  1.00 25.55  ? 47   PHE B CE2 1 
ATOM   2890 C CZ  . PHE B 2 47  ? -76.035 15.624  23.197  1.00 28.19  ? 47   PHE B CZ  1 
ATOM   2891 N N   . LYS B 2 48  ? -77.355 12.657  26.855  1.00 22.33  ? 48   LYS B N   1 
ATOM   2892 C CA  . LYS B 2 48  ? -77.214 13.459  28.055  1.00 25.80  ? 48   LYS B CA  1 
ATOM   2893 C C   . LYS B 2 48  ? -76.303 14.628  27.798  1.00 29.86  ? 48   LYS B C   1 
ATOM   2894 O O   . LYS B 2 48  ? -75.258 14.470  27.154  1.00 29.82  ? 48   LYS B O   1 
ATOM   2895 C CB  . LYS B 2 48  ? -76.603 12.628  29.143  1.00 26.38  ? 48   LYS B CB  1 
ATOM   2896 C CG  . LYS B 2 48  ? -77.475 11.468  29.542  1.00 27.58  ? 48   LYS B CG  1 
ATOM   2897 C CD  . LYS B 2 48  ? -76.810 10.703  30.656  1.00 31.19  ? 48   LYS B CD  1 
ATOM   2898 C CE  . LYS B 2 48  ? -77.753 9.648   31.172  1.00 36.28  ? 48   LYS B CE  1 
ATOM   2899 N NZ  . LYS B 2 48  ? -77.215 9.066   32.424  1.00 40.13  ? 48   LYS B NZ  1 
ATOM   2900 N N   . PHE B 2 49  ? -76.694 15.794  28.303  1.00 27.13  ? 49   PHE B N   1 
ATOM   2901 C CA  . PHE B 2 49  ? -75.875 16.999  28.203  1.00 26.65  ? 49   PHE B CA  1 
ATOM   2902 C C   . PHE B 2 49  ? -76.171 17.910  29.399  1.00 30.80  ? 49   PHE B C   1 
ATOM   2903 O O   . PHE B 2 49  ? -77.286 17.908  29.932  1.00 27.84  ? 49   PHE B O   1 
ATOM   2904 C CB  . PHE B 2 49  ? -76.102 17.712  26.872  1.00 26.58  ? 49   PHE B CB  1 
ATOM   2905 C CG  . PHE B 2 49  ? -77.474 18.270  26.716  1.00 27.23  ? 49   PHE B CG  1 
ATOM   2906 C CD1 . PHE B 2 49  ? -78.514 17.472  26.266  1.00 30.68  ? 49   PHE B CD1 1 
ATOM   2907 C CD2 . PHE B 2 49  ? -77.737 19.609  27.006  1.00 25.24  ? 49   PHE B CD2 1 
ATOM   2908 C CE1 . PHE B 2 49  ? -79.797 17.992  26.114  1.00 26.63  ? 49   PHE B CE1 1 
ATOM   2909 C CE2 . PHE B 2 49  ? -79.012 20.128  26.869  1.00 25.34  ? 49   PHE B CE2 1 
ATOM   2910 C CZ  . PHE B 2 49  ? -80.044 19.318  26.430  1.00 24.90  ? 49   PHE B CZ  1 
ATOM   2911 N N   . ARG B 2 50  ? -75.149 18.640  29.844  1.00 33.34  ? 50   ARG B N   1 
ATOM   2912 C CA  . ARG B 2 50  ? -75.244 19.446  31.062  1.00 31.79  ? 50   ARG B CA  1 
ATOM   2913 C C   . ARG B 2 50  ? -75.655 20.874  30.697  1.00 30.88  ? 50   ARG B C   1 
ATOM   2914 O O   . ARG B 2 50  ? -75.044 21.509  29.825  1.00 25.59  ? 50   ARG B O   1 
ATOM   2915 C CB  . ARG B 2 50  ? -73.920 19.429  31.816  1.00 41.52  ? 50   ARG B CB  1 
ATOM   2916 C CG  . ARG B 2 50  ? -73.991 18.851  33.223  1.00 61.27  ? 50   ARG B CG  1 
ATOM   2917 C CD  . ARG B 2 50  ? -72.869 17.887  33.583  1.00 74.95  ? 50   ARG B CD  1 
ATOM   2918 N NE  . ARG B 2 50  ? -71.521 18.479  33.582  1.00 97.84  ? 50   ARG B NE  1 
ATOM   2919 C CZ  . ARG B 2 50  ? -70.618 18.356  32.600  1.00 72.77  ? 50   ARG B CZ  1 
ATOM   2920 N NH1 . ARG B 2 50  ? -70.895 17.682  31.494  1.00 67.60  ? 50   ARG B NH1 1 
ATOM   2921 N NH2 . ARG B 2 50  ? -69.427 18.928  32.719  1.00 67.37  ? 50   ARG B NH2 1 
ATOM   2922 N N   . ILE B 2 51  ? -76.697 21.374  31.354  1.00 27.64  ? 51   ILE B N   1 
ATOM   2923 C CA  . ILE B 2 51  ? -77.175 22.722  31.093  1.00 30.13  ? 51   ILE B CA  1 
ATOM   2924 C C   . ILE B 2 51  ? -76.056 23.734  31.419  1.00 32.83  ? 51   ILE B C   1 
ATOM   2925 O O   . ILE B 2 51  ? -75.433 23.663  32.495  1.00 30.80  ? 51   ILE B O   1 
ATOM   2926 C CB  . ILE B 2 51  ? -78.419 23.036  31.922  1.00 31.87  ? 51   ILE B CB  1 
ATOM   2927 C CG1 . ILE B 2 51  ? -79.578 22.113  31.508  1.00 32.39  ? 51   ILE B CG1 1 
ATOM   2928 C CG2 . ILE B 2 51  ? -78.815 24.507  31.737  1.00 35.03  ? 51   ILE B CG2 1 
ATOM   2929 C CD1 . ILE B 2 51  ? -80.031 22.284  30.057  1.00 35.44  ? 51   ILE B CD1 1 
ATOM   2930 N N   . GLY B 2 52  ? -75.765 24.627  30.468  1.00 32.99  ? 52   GLY B N   1 
ATOM   2931 C CA  . GLY B 2 52  ? -74.778 25.713  30.690  1.00 32.16  ? 52   GLY B CA  1 
ATOM   2932 C C   . GLY B 2 52  ? -73.344 25.326  30.379  1.00 37.21  ? 52   GLY B C   1 
ATOM   2933 O O   . GLY B 2 52  ? -72.448 26.123  30.587  1.00 33.47  ? 52   GLY B O   1 
ATOM   2934 N N   . LYS B 2 53  ? -73.101 24.106  29.887  1.00 30.73  ? 53   LYS B N   1 
ATOM   2935 C CA  . LYS B 2 53  ? -71.744 23.679  29.619  1.00 30.32  ? 53   LYS B CA  1 
ATOM   2936 C C   . LYS B 2 53  ? -71.418 23.709  28.144  1.00 29.16  ? 53   LYS B C   1 
ATOM   2937 O O   . LYS B 2 53  ? -70.355 23.251  27.756  1.00 30.53  ? 53   LYS B O   1 
ATOM   2938 C CB  . LYS B 2 53  ? -71.498 22.270  30.179  1.00 31.89  ? 53   LYS B CB  1 
ATOM   2939 C CG  . LYS B 2 53  ? -71.540 22.201  31.702  1.00 39.93  ? 53   LYS B CG  1 
ATOM   2940 C CD  . LYS B 2 53  ? -70.295 22.826  32.315  1.00 48.57  ? 53   LYS B CD  1 
ATOM   2941 C CE  . LYS B 2 53  ? -70.237 22.623  33.817  1.00 63.05  ? 53   LYS B CE  1 
ATOM   2942 N NZ  . LYS B 2 53  ? -69.259 23.545  34.465  1.00 73.77  ? 53   LYS B NZ  1 
ATOM   2943 N N   . GLN B 2 54  ? -72.345 24.203  27.328  1.00 28.59  ? 54   GLN B N   1 
ATOM   2944 C CA  . GLN B 2 54  ? -72.149 24.358  25.891  1.00 33.66  ? 54   GLN B CA  1 
ATOM   2945 C C   . GLN B 2 54  ? -71.788 23.041  25.205  1.00 36.69  ? 54   GLN B C   1 
ATOM   2946 O O   . GLN B 2 54  ? -70.898 22.992  24.352  1.00 38.01  ? 54   GLN B O   1 
ATOM   2947 C CB  . GLN B 2 54  ? -71.071 25.417  25.620  1.00 38.54  ? 54   GLN B CB  1 
ATOM   2948 C CG  . GLN B 2 54  ? -71.391 26.767  26.258  1.00 51.82  ? 54   GLN B CG  1 
ATOM   2949 C CD  . GLN B 2 54  ? -70.284 27.769  26.060  1.00 65.21  ? 54   GLN B CD  1 
ATOM   2950 O OE1 . GLN B 2 54  ? -69.538 28.076  26.986  1.00 74.82  ? 54   GLN B OE1 1 
ATOM   2951 N NE2 . GLN B 2 54  ? -70.151 28.263  24.841  1.00 64.12  ? 54   GLN B NE2 1 
ATOM   2952 N N   . GLU B 2 55  ? -72.486 21.982  25.597  1.00 31.39  ? 55   GLU B N   1 
ATOM   2953 C CA  . GLU B 2 55  ? -72.152 20.622  25.166  1.00 34.36  ? 55   GLU B CA  1 
ATOM   2954 C C   . GLU B 2 55  ? -73.028 20.181  24.036  1.00 31.72  ? 55   GLU B C   1 
ATOM   2955 O O   . GLU B 2 55  ? -73.026 19.002  23.663  1.00 30.30  ? 55   GLU B O   1 
ATOM   2956 C CB  . GLU B 2 55  ? -72.372 19.651  26.314  1.00 30.47  ? 55   GLU B CB  1 
ATOM   2957 C CG  . GLU B 2 55  ? -71.363 19.853  27.381  1.00 32.67  ? 55   GLU B CG  1 
ATOM   2958 C CD  . GLU B 2 55  ? -71.450 18.832  28.490  1.00 29.26  ? 55   GLU B CD  1 
ATOM   2959 O OE1 . GLU B 2 55  ? -72.524 18.246  28.744  1.00 29.86  ? 55   GLU B OE1 1 
ATOM   2960 O OE2 . GLU B 2 55  ? -70.412 18.680  29.129  1.00 29.07  ? 55   GLU B OE2 1 
ATOM   2961 N N   . VAL B 2 56  ? -73.833 21.114  23.551  1.00 27.97  ? 56   VAL B N   1 
ATOM   2962 C CA  . VAL B 2 56  ? -74.738 20.874  22.449  1.00 27.08  ? 56   VAL B CA  1 
ATOM   2963 C C   . VAL B 2 56  ? -74.957 22.209  21.724  1.00 29.76  ? 56   VAL B C   1 
ATOM   2964 O O   . VAL B 2 56  ? -74.810 23.275  22.322  1.00 33.25  ? 56   VAL B O   1 
ATOM   2965 C CB  . VAL B 2 56  ? -76.058 20.211  22.953  1.00 28.46  ? 56   VAL B CB  1 
ATOM   2966 C CG1 . VAL B 2 56  ? -76.973 21.210  23.660  1.00 31.26  ? 56   VAL B CG1 1 
ATOM   2967 C CG2 . VAL B 2 56  ? -76.796 19.563  21.807  1.00 29.19  ? 56   VAL B CG2 1 
ATOM   2968 N N   . ILE B 2 57  ? -75.274 22.168  20.443  1.00 27.60  ? 57   ILE B N   1 
ATOM   2969 C CA  . ILE B 2 57  ? -75.627 23.408  19.730  1.00 32.80  ? 57   ILE B CA  1 
ATOM   2970 C C   . ILE B 2 57  ? -76.678 24.246  20.458  1.00 34.87  ? 57   ILE B C   1 
ATOM   2971 O O   . ILE B 2 57  ? -77.660 23.727  21.032  1.00 31.73  ? 57   ILE B O   1 
ATOM   2972 C CB  . ILE B 2 57  ? -76.088 23.160  18.272  1.00 32.02  ? 57   ILE B CB  1 
ATOM   2973 C CG1 . ILE B 2 57  ? -77.196 22.105  18.195  1.00 36.67  ? 57   ILE B CG1 1 
ATOM   2974 C CG2 . ILE B 2 57  ? -74.902 22.730  17.420  1.00 31.27  ? 57   ILE B CG2 1 
ATOM   2975 C CD1 . ILE B 2 57  ? -77.974 22.140  16.892  1.00 37.15  ? 57   ILE B CD1 1 
ATOM   2976 N N   . LYS B 2 58  ? -76.455 25.551  20.414  1.00 32.55  ? 58   LYS B N   1 
ATOM   2977 C CA  . LYS B 2 58  ? -77.222 26.523  21.173  1.00 36.92  ? 58   LYS B CA  1 
ATOM   2978 C C   . LYS B 2 58  ? -78.725 26.326  21.009  1.00 32.61  ? 58   LYS B C   1 
ATOM   2979 O O   . LYS B 2 58  ? -79.483 26.354  21.984  1.00 33.43  ? 58   LYS B O   1 
ATOM   2980 C CB  . LYS B 2 58  ? -76.816 27.952  20.751  1.00 41.00  ? 58   LYS B CB  1 
ATOM   2981 C CG  . LYS B 2 58  ? -77.296 29.071  21.680  1.00 55.61  ? 58   LYS B CG  1 
ATOM   2982 N N   . GLY B 2 59  ? -79.169 26.127  19.782  1.00 30.59  ? 59   GLY B N   1 
ATOM   2983 C CA  . GLY B 2 59  ? -80.609 25.978  19.535  1.00 33.33  ? 59   GLY B CA  1 
ATOM   2984 C C   . GLY B 2 59  ? -81.240 24.809  20.279  1.00 33.32  ? 59   GLY B C   1 
ATOM   2985 O O   . GLY B 2 59  ? -82.362 24.906  20.794  1.00 33.53  ? 59   GLY B O   1 
ATOM   2986 N N   . PHE B 2 60  ? -80.520 23.692  20.329  1.00 33.11  ? 60   PHE B N   1 
ATOM   2987 C CA  . PHE B 2 60  ? -81.041 22.468  20.955  1.00 31.04  ? 60   PHE B CA  1 
ATOM   2988 C C   . PHE B 2 60  ? -81.212 22.690  22.444  1.00 28.42  ? 60   PHE B C   1 
ATOM   2989 O O   . PHE B 2 60  ? -82.252 22.381  22.981  1.00 29.67  ? 60   PHE B O   1 
ATOM   2990 C CB  . PHE B 2 60  ? -80.102 21.313  20.680  1.00 31.57  ? 60   PHE B CB  1 
ATOM   2991 C CG  . PHE B 2 60  ? -80.658 19.965  21.038  1.00 33.28  ? 60   PHE B CG  1 
ATOM   2992 C CD1 . PHE B 2 60  ? -80.619 19.507  22.348  1.00 32.95  ? 60   PHE B CD1 1 
ATOM   2993 C CD2 . PHE B 2 60  ? -81.159 19.138  20.065  1.00 34.34  ? 60   PHE B CD2 1 
ATOM   2994 C CE1 . PHE B 2 60  ? -81.112 18.264  22.664  1.00 37.01  ? 60   PHE B CE1 1 
ATOM   2995 C CE2 . PHE B 2 60  ? -81.656 17.883  20.378  1.00 34.97  ? 60   PHE B CE2 1 
ATOM   2996 C CZ  . PHE B 2 60  ? -81.616 17.445  21.673  1.00 31.59  ? 60   PHE B CZ  1 
ATOM   2997 N N   . GLU B 2 61  ? -80.207 23.282  23.085  1.00 27.86  ? 61   GLU B N   1 
ATOM   2998 C CA  . GLU B 2 61  ? -80.242 23.576  24.503  1.00 30.99  ? 61   GLU B CA  1 
ATOM   2999 C C   . GLU B 2 61  ? -81.304 24.616  24.864  1.00 36.87  ? 61   GLU B C   1 
ATOM   3000 O O   . GLU B 2 61  ? -81.959 24.525  25.907  1.00 37.19  ? 61   GLU B O   1 
ATOM   3001 C CB  . GLU B 2 61  ? -78.865 24.051  25.008  1.00 28.62  ? 61   GLU B CB  1 
ATOM   3002 C CG  . GLU B 2 61  ? -78.909 24.327  26.508  1.00 29.21  ? 61   GLU B CG  1 
ATOM   3003 C CD  . GLU B 2 61  ? -77.561 24.517  27.174  1.00 33.12  ? 61   GLU B CD  1 
ATOM   3004 O OE1 . GLU B 2 61  ? -76.476 24.408  26.533  1.00 32.39  ? 61   GLU B OE1 1 
ATOM   3005 O OE2 . GLU B 2 61  ? -77.602 24.782  28.391  1.00 31.99  ? 61   GLU B OE2 1 
ATOM   3006 N N   . GLU B 2 62  ? -81.461 25.616  24.010  1.00 36.95  ? 62   GLU B N   1 
ATOM   3007 C CA  . GLU B 2 62  ? -82.445 26.658  24.251  1.00 38.11  ? 62   GLU B CA  1 
ATOM   3008 C C   . GLU B 2 62  ? -83.859 26.137  24.198  1.00 36.32  ? 62   GLU B C   1 
ATOM   3009 O O   . GLU B 2 62  ? -84.731 26.571  24.989  1.00 34.55  ? 62   GLU B O   1 
ATOM   3010 C CB  . GLU B 2 62  ? -82.306 27.796  23.238  1.00 41.63  ? 62   GLU B CB  1 
ATOM   3011 C CG  . GLU B 2 62  ? -81.244 28.790  23.656  1.00 55.75  ? 62   GLU B CG  1 
ATOM   3012 C CD  . GLU B 2 62  ? -80.933 29.854  22.601  1.00 63.81  ? 62   GLU B CD  1 
ATOM   3013 O OE1 . GLU B 2 62  ? -81.603 29.906  21.534  1.00 47.97  ? 62   GLU B OE1 1 
ATOM   3014 O OE2 . GLU B 2 62  ? -79.999 30.642  22.862  1.00 53.65  ? 62   GLU B OE2 1 
ATOM   3015 N N   . GLY B 2 63  ? -84.107 25.272  23.228  1.00 30.47  ? 63   GLY B N   1 
ATOM   3016 C CA  . GLY B 2 63  ? -85.401 24.597  23.131  1.00 32.02  ? 63   GLY B CA  1 
ATOM   3017 C C   . GLY B 2 63  ? -85.638 23.668  24.309  1.00 34.38  ? 63   GLY B C   1 
ATOM   3018 O O   . GLY B 2 63  ? -86.666 23.757  24.965  1.00 36.00  ? 63   GLY B O   1 
ATOM   3019 N N   . ALA B 2 64  ? -84.672 22.796  24.605  1.00 33.11  ? 64   ALA B N   1 
ATOM   3020 C CA  . ALA B 2 64  ? -84.803 21.888  25.753  1.00 29.10  ? 64   ALA B CA  1 
ATOM   3021 C C   . ALA B 2 64  ? -85.029 22.650  27.060  1.00 34.22  ? 64   ALA B C   1 
ATOM   3022 O O   . ALA B 2 64  ? -85.793 22.192  27.913  1.00 36.23  ? 64   ALA B O   1 
ATOM   3023 C CB  . ALA B 2 64  ? -83.587 20.987  25.894  1.00 28.33  ? 64   ALA B CB  1 
ATOM   3024 N N   . ALA B 2 65  ? -84.390 23.808  27.226  1.00 32.75  ? 65   ALA B N   1 
ATOM   3025 C CA  . ALA B 2 65  ? -84.489 24.550  28.483  1.00 32.27  ? 65   ALA B CA  1 
ATOM   3026 C C   . ALA B 2 65  ? -85.895 25.121  28.719  1.00 34.54  ? 65   ALA B C   1 
ATOM   3027 O O   . ALA B 2 65  ? -86.263 25.488  29.852  1.00 34.39  ? 65   ALA B O   1 
ATOM   3028 C CB  . ALA B 2 65  ? -83.464 25.670  28.500  1.00 36.53  ? 65   ALA B CB  1 
ATOM   3029 N N   . GLN B 2 66  ? -86.657 25.209  27.640  1.00 33.09  ? 66   GLN B N   1 
ATOM   3030 C CA  . GLN B 2 66  ? -88.045 25.616  27.694  1.00 35.62  ? 66   GLN B CA  1 
ATOM   3031 C C   . GLN B 2 66  ? -89.023 24.455  27.907  1.00 40.94  ? 66   GLN B C   1 
ATOM   3032 O O   . GLN B 2 66  ? -90.205 24.674  28.147  1.00 40.01  ? 66   GLN B O   1 
ATOM   3033 C CB  . GLN B 2 66  ? -88.402 26.331  26.391  1.00 36.55  ? 66   GLN B CB  1 
ATOM   3034 C CG  . GLN B 2 66  ? -87.742 27.695  26.273  1.00 36.24  ? 66   GLN B CG  1 
ATOM   3035 C CD  . GLN B 2 66  ? -87.916 28.284  24.898  1.00 39.10  ? 66   GLN B CD  1 
ATOM   3036 O OE1 . GLN B 2 66  ? -86.981 28.331  24.093  1.00 42.54  ? 66   GLN B OE1 1 
ATOM   3037 N NE2 . GLN B 2 66  ? -89.120 28.697  24.607  1.00 41.38  ? 66   GLN B NE2 1 
ATOM   3038 N N   . MET B 2 67  ? -88.535 23.223  27.811  1.00 42.38  ? 67   MET B N   1 
ATOM   3039 C CA  . MET B 2 67  ? -89.385 22.054  27.997  1.00 37.65  ? 67   MET B CA  1 
ATOM   3040 C C   . MET B 2 67  ? -89.438 21.652  29.460  1.00 34.68  ? 67   MET B C   1 
ATOM   3041 O O   . MET B 2 67  ? -88.474 21.819  30.196  1.00 32.49  ? 67   MET B O   1 
ATOM   3042 C CB  . MET B 2 67  ? -88.866 20.912  27.148  1.00 38.23  ? 67   MET B CB  1 
ATOM   3043 C CG  . MET B 2 67  ? -88.935 21.192  25.657  1.00 37.84  ? 67   MET B CG  1 
ATOM   3044 S SD  . MET B 2 67  ? -88.158 19.923  24.641  1.00 34.70  ? 67   MET B SD  1 
ATOM   3045 C CE  . MET B 2 67  ? -89.165 18.515  25.107  1.00 35.77  ? 67   MET B CE  1 
ATOM   3046 N N   . SER B 2 68  ? -90.586 21.155  29.894  1.00 36.42  ? 68   SER B N   1 
ATOM   3047 C CA  . SER B 2 68  ? -90.710 20.588  31.236  1.00 33.95  ? 68   SER B CA  1 
ATOM   3048 C C   . SER B 2 68  ? -90.564 19.061  31.206  1.00 31.05  ? 68   SER B C   1 
ATOM   3049 O O   . SER B 2 68  ? -90.729 18.423  30.191  1.00 31.69  ? 68   SER B O   1 
ATOM   3050 C CB  . SER B 2 68  ? -92.060 20.975  31.870  1.00 34.45  ? 68   SER B CB  1 
ATOM   3051 O OG  . SER B 2 68  ? -93.124 20.483  31.087  1.00 32.63  ? 68   SER B OG  1 
ATOM   3052 N N   . LEU B 2 69  ? -90.260 18.487  32.349  1.00 31.73  ? 69   LEU B N   1 
ATOM   3053 C CA  . LEU B 2 69  ? -89.981 17.065  32.462  1.00 33.00  ? 69   LEU B CA  1 
ATOM   3054 C C   . LEU B 2 69  ? -91.087 16.184  31.853  1.00 34.03  ? 69   LEU B C   1 
ATOM   3055 O O   . LEU B 2 69  ? -92.277 16.349  32.182  1.00 29.31  ? 69   LEU B O   1 
ATOM   3056 C CB  . LEU B 2 69  ? -89.803 16.760  33.920  1.00 34.59  ? 69   LEU B CB  1 
ATOM   3057 C CG  . LEU B 2 69  ? -89.574 15.350  34.315  1.00 34.97  ? 69   LEU B CG  1 
ATOM   3058 C CD1 . LEU B 2 69  ? -88.279 14.868  33.701  1.00 39.70  ? 69   LEU B CD1 1 
ATOM   3059 C CD2 . LEU B 2 69  ? -89.514 15.306  35.821  1.00 36.41  ? 69   LEU B CD2 1 
ATOM   3060 N N   . GLY B 2 70  ? -90.696 15.305  30.919  1.00 28.01  ? 70   GLY B N   1 
ATOM   3061 C CA  . GLY B 2 70  ? -91.638 14.422  30.250  1.00 29.34  ? 70   GLY B CA  1 
ATOM   3062 C C   . GLY B 2 70  ? -92.245 14.975  28.988  1.00 33.36  ? 70   GLY B C   1 
ATOM   3063 O O   . GLY B 2 70  ? -92.928 14.267  28.264  1.00 33.07  ? 70   GLY B O   1 
ATOM   3064 N N   . GLN B 2 71  ? -92.005 16.248  28.709  1.00 34.82  ? 71   GLN B N   1 
ATOM   3065 C CA  . GLN B 2 71  ? -92.574 16.882  27.527  1.00 33.85  ? 71   GLN B CA  1 
ATOM   3066 C C   . GLN B 2 71  ? -91.914 16.343  26.288  1.00 32.88  ? 71   GLN B C   1 
ATOM   3067 O O   . GLN B 2 71  ? -90.769 15.911  26.308  1.00 29.93  ? 71   GLN B O   1 
ATOM   3068 C CB  . GLN B 2 71  ? -92.370 18.400  27.581  1.00 38.11  ? 71   GLN B CB  1 
ATOM   3069 C CG  . GLN B 2 71  ? -93.021 19.182  26.459  1.00 35.18  ? 71   GLN B CG  1 
ATOM   3070 C CD  . GLN B 2 71  ? -92.879 20.679  26.654  1.00 39.53  ? 71   GLN B CD  1 
ATOM   3071 O OE1 . GLN B 2 71  ? -92.365 21.133  27.675  1.00 40.11  ? 71   GLN B OE1 1 
ATOM   3072 N NE2 . GLN B 2 71  ? -93.367 21.457  25.695  1.00 43.50  ? 71   GLN B NE2 1 
ATOM   3073 N N   . ARG B 2 72  ? -92.658 16.337  25.205  1.00 32.08  ? 72   ARG B N   1 
ATOM   3074 C CA  . ARG B 2 72  ? -92.095 16.010  23.926  1.00 33.61  ? 72   ARG B CA  1 
ATOM   3075 C C   . ARG B 2 72  ? -92.467 17.155  22.996  1.00 36.17  ? 72   ARG B C   1 
ATOM   3076 O O   . ARG B 2 72  ? -93.572 17.684  23.062  1.00 36.27  ? 72   ARG B O   1 
ATOM   3077 C CB  . ARG B 2 72  ? -92.668 14.711  23.432  1.00 37.06  ? 72   ARG B CB  1 
ATOM   3078 C CG  . ARG B 2 72  ? -92.149 14.288  22.078  1.00 37.85  ? 72   ARG B CG  1 
ATOM   3079 C CD  . ARG B 2 72  ? -92.842 13.022  21.641  1.00 38.72  ? 72   ARG B CD  1 
ATOM   3080 N NE  . ARG B 2 72  ? -92.391 12.606  20.328  1.00 45.52  ? 72   ARG B NE  1 
ATOM   3081 C CZ  . ARG B 2 72  ? -93.023 11.724  19.561  1.00 57.26  ? 72   ARG B CZ  1 
ATOM   3082 N NH1 . ARG B 2 72  ? -94.134 11.135  19.984  1.00 71.06  ? 72   ARG B NH1 1 
ATOM   3083 N NH2 . ARG B 2 72  ? -92.539 11.423  18.366  1.00 53.98  ? 72   ARG B NH2 1 
ATOM   3084 N N   . ALA B 2 73  ? -91.523 17.569  22.169  1.00 34.00  ? 73   ALA B N   1 
ATOM   3085 C CA  . ALA B 2 73  ? -91.717 18.758  21.347  1.00 36.73  ? 73   ALA B CA  1 
ATOM   3086 C C   . ALA B 2 73  ? -90.833 18.746  20.129  1.00 33.09  ? 73   ALA B C   1 
ATOM   3087 O O   . ALA B 2 73  ? -89.787 18.088  20.102  1.00 30.99  ? 73   ALA B O   1 
ATOM   3088 C CB  . ALA B 2 73  ? -91.447 20.014  22.161  1.00 37.00  ? 73   ALA B CB  1 
ATOM   3089 N N   . LYS B 2 74  ? -91.273 19.495  19.128  1.00 37.96  ? 74   LYS B N   1 
ATOM   3090 C CA  . LYS B 2 74  ? -90.539 19.708  17.900  1.00 39.74  ? 74   LYS B CA  1 
ATOM   3091 C C   . LYS B 2 74  ? -89.767 21.012  18.041  1.00 42.04  ? 74   LYS B C   1 
ATOM   3092 O O   . LYS B 2 74  ? -90.369 22.058  18.283  1.00 42.46  ? 74   LYS B O   1 
ATOM   3093 C CB  . LYS B 2 74  ? -91.528 19.770  16.746  1.00 47.84  ? 74   LYS B CB  1 
ATOM   3094 C CG  . LYS B 2 74  ? -90.912 19.710  15.361  1.00 59.14  ? 74   LYS B CG  1 
ATOM   3095 C CD  . LYS B 2 74  ? -91.942 19.315  14.303  1.00 72.17  ? 74   LYS B CD  1 
ATOM   3096 C CE  . LYS B 2 74  ? -92.862 20.465  13.912  1.00 75.00  ? 74   LYS B CE  1 
ATOM   3097 N NZ  . LYS B 2 74  ? -92.327 21.286  12.793  1.00 80.23  ? 74   LYS B NZ  1 
ATOM   3098 N N   . LEU B 2 75  ? -88.438 20.933  17.949  1.00 39.78  ? 75   LEU B N   1 
ATOM   3099 C CA  . LEU B 2 75  ? -87.577 22.116  17.956  1.00 36.59  ? 75   LEU B CA  1 
ATOM   3100 C C   . LEU B 2 75  ? -87.061 22.376  16.561  1.00 37.90  ? 75   LEU B C   1 
ATOM   3101 O O   . LEU B 2 75  ? -86.375 21.533  15.984  1.00 39.66  ? 75   LEU B O   1 
ATOM   3102 C CB  . LEU B 2 75  ? -86.359 21.933  18.866  1.00 33.68  ? 75   LEU B CB  1 
ATOM   3103 C CG  . LEU B 2 75  ? -86.601 21.350  20.238  1.00 38.16  ? 75   LEU B CG  1 
ATOM   3104 C CD1 . LEU B 2 75  ? -85.274 21.276  20.987  1.00 35.61  ? 75   LEU B CD1 1 
ATOM   3105 C CD2 . LEU B 2 75  ? -87.619 22.159  21.008  1.00 39.48  ? 75   LEU B CD2 1 
ATOM   3106 N N   . THR B 2 76  ? -87.355 23.560  16.033  1.00 38.30  ? 76   THR B N   1 
ATOM   3107 C CA  . THR B 2 76  ? -86.834 23.982  14.743  1.00 40.40  ? 76   THR B CA  1 
ATOM   3108 C C   . THR B 2 76  ? -85.712 24.988  15.006  1.00 41.46  ? 76   THR B C   1 
ATOM   3109 O O   . THR B 2 76  ? -85.934 25.992  15.683  1.00 42.06  ? 76   THR B O   1 
ATOM   3110 C CB  . THR B 2 76  ? -87.950 24.602  13.894  1.00 45.35  ? 76   THR B CB  1 
ATOM   3111 O OG1 . THR B 2 76  ? -89.033 23.650  13.742  1.00 42.55  ? 76   THR B OG1 1 
ATOM   3112 C CG2 . THR B 2 76  ? -87.417 25.007  12.539  1.00 45.57  ? 76   THR B CG2 1 
ATOM   3113 N N   . CYS B 2 77  ? -84.508 24.688  14.507  1.00 37.67  ? 77   CYS B N   1 
ATOM   3114 C CA  . CYS B 2 77  ? -83.304 25.467  14.791  1.00 39.43  ? 77   CYS B CA  1 
ATOM   3115 C C   . CYS B 2 77  ? -82.745 26.033  13.504  1.00 40.79  ? 77   CYS B C   1 
ATOM   3116 O O   . CYS B 2 77  ? -82.389 25.272  12.616  1.00 39.18  ? 77   CYS B O   1 
ATOM   3117 C CB  . CYS B 2 77  ? -82.216 24.602  15.455  1.00 38.94  ? 77   CYS B CB  1 
ATOM   3118 S SG  . CYS B 2 77  ? -82.710 23.919  17.058  1.00 41.61  ? 77   CYS B SG  1 
ATOM   3119 N N   . THR B 2 78  ? -82.672 27.361  13.411  1.00 37.81  ? 78   THR B N   1 
ATOM   3120 C CA  . THR B 2 78  ? -82.069 28.017  12.253  1.00 40.61  ? 78   THR B CA  1 
ATOM   3121 C C   . THR B 2 78  ? -80.569 27.817  12.321  1.00 39.97  ? 78   THR B C   1 
ATOM   3122 O O   . THR B 2 78  ? -80.016 27.552  13.393  1.00 42.16  ? 78   THR B O   1 
ATOM   3123 C CB  . THR B 2 78  ? -82.364 29.543  12.225  1.00 38.71  ? 78   THR B CB  1 
ATOM   3124 O OG1 . THR B 2 78  ? -81.926 30.137  13.451  1.00 38.43  ? 78   THR B OG1 1 
ATOM   3125 C CG2 . THR B 2 78  ? -83.828 29.813  12.053  1.00 34.61  ? 78   THR B CG2 1 
ATOM   3126 N N   . PRO B 2 79  ? -79.889 27.973  11.184  1.00 40.50  ? 79   PRO B N   1 
ATOM   3127 C CA  . PRO B 2 79  ? -78.451 27.678  11.155  1.00 36.57  ? 79   PRO B CA  1 
ATOM   3128 C C   . PRO B 2 79  ? -77.616 28.505  12.110  1.00 37.07  ? 79   PRO B C   1 
ATOM   3129 O O   . PRO B 2 79  ? -76.544 28.067  12.545  1.00 40.16  ? 79   PRO B O   1 
ATOM   3130 C CB  . PRO B 2 79  ? -78.040 28.002  9.715   1.00 37.61  ? 79   PRO B CB  1 
ATOM   3131 C CG  . PRO B 2 79  ? -79.241 28.523  9.025   1.00 39.30  ? 79   PRO B CG  1 
ATOM   3132 C CD  . PRO B 2 79  ? -80.447 28.262  9.852   1.00 37.32  ? 79   PRO B CD  1 
ATOM   3133 N N   . ASP B 2 80  ? -78.074 29.700  12.435  1.00 36.98  ? 80   ASP B N   1 
ATOM   3134 C CA  . ASP B 2 80  ? -77.284 30.571  13.303  1.00 37.72  ? 80   ASP B CA  1 
ATOM   3135 C C   . ASP B 2 80  ? -77.267 30.082  14.761  1.00 39.42  ? 80   ASP B C   1 
ATOM   3136 O O   . ASP B 2 80  ? -76.403 30.496  15.536  1.00 34.33  ? 80   ASP B O   1 
ATOM   3137 C CB  . ASP B 2 80  ? -77.763 32.033  13.193  1.00 50.39  ? 80   ASP B CB  1 
ATOM   3138 C CG  . ASP B 2 80  ? -79.103 32.263  13.853  1.00 61.96  ? 80   ASP B CG  1 
ATOM   3139 O OD1 . ASP B 2 80  ? -80.057 31.523  13.547  1.00 73.20  ? 80   ASP B OD1 1 
ATOM   3140 O OD2 . ASP B 2 80  ? -79.206 33.183  14.690  1.00 88.29  ? 80   ASP B OD2 1 
ATOM   3141 N N   . VAL B 2 81  ? -78.210 29.208  15.142  1.00 35.36  ? 81   VAL B N   1 
ATOM   3142 C CA  . VAL B 2 81  ? -78.104 28.501  16.430  1.00 33.54  ? 81   VAL B CA  1 
ATOM   3143 C C   . VAL B 2 81  ? -77.862 26.997  16.272  1.00 33.60  ? 81   VAL B C   1 
ATOM   3144 O O   . VAL B 2 81  ? -78.136 26.225  17.202  1.00 32.21  ? 81   VAL B O   1 
ATOM   3145 C CB  . VAL B 2 81  ? -79.333 28.748  17.331  1.00 32.30  ? 81   VAL B CB  1 
ATOM   3146 C CG1 . VAL B 2 81  ? -79.385 30.205  17.738  1.00 34.64  ? 81   VAL B CG1 1 
ATOM   3147 C CG2 . VAL B 2 81  ? -80.620 28.321  16.647  1.00 29.65  ? 81   VAL B CG2 1 
ATOM   3148 N N   . ALA B 2 82  ? -77.365 26.584  15.102  1.00 29.47  ? 82   ALA B N   1 
ATOM   3149 C CA  . ALA B 2 82  ? -76.989 25.213  14.862  1.00 29.32  ? 82   ALA B CA  1 
ATOM   3150 C C   . ALA B 2 82  ? -75.582 25.154  14.253  1.00 27.80  ? 82   ALA B C   1 
ATOM   3151 O O   . ALA B 2 82  ? -74.646 25.583  14.896  1.00 30.22  ? 82   ALA B O   1 
ATOM   3152 C CB  . ALA B 2 82  ? -78.034 24.517  14.013  1.00 30.91  ? 82   ALA B CB  1 
ATOM   3153 N N   . TYR B 2 83  ? -75.415 24.655  13.036  1.00 30.46  ? 83   TYR B N   1 
ATOM   3154 C CA  . TYR B 2 83  ? -74.062 24.470  12.464  1.00 31.28  ? 83   TYR B CA  1 
ATOM   3155 C C   . TYR B 2 83  ? -73.645 25.552  11.408  1.00 34.70  ? 83   TYR B C   1 
ATOM   3156 O O   . TYR B 2 83  ? -72.626 25.417  10.742  1.00 34.77  ? 83   TYR B O   1 
ATOM   3157 C CB  . TYR B 2 83  ? -73.917 23.026  11.921  1.00 32.22  ? 83   TYR B CB  1 
ATOM   3158 C CG  . TYR B 2 83  ? -73.936 21.989  13.020  1.00 33.46  ? 83   TYR B CG  1 
ATOM   3159 C CD1 . TYR B 2 83  ? -75.129 21.455  13.490  1.00 32.29  ? 83   TYR B CD1 1 
ATOM   3160 C CD2 . TYR B 2 83  ? -72.758 21.579  13.634  1.00 33.69  ? 83   TYR B CD2 1 
ATOM   3161 C CE1 . TYR B 2 83  ? -75.138 20.513  14.519  1.00 31.77  ? 83   TYR B CE1 1 
ATOM   3162 C CE2 . TYR B 2 83  ? -72.764 20.659  14.666  1.00 34.20  ? 83   TYR B CE2 1 
ATOM   3163 C CZ  . TYR B 2 83  ? -73.960 20.121  15.111  1.00 35.73  ? 83   TYR B CZ  1 
ATOM   3164 O OH  . TYR B 2 83  ? -73.952 19.202  16.163  1.00 34.98  ? 83   TYR B OH  1 
ATOM   3165 N N   . GLY B 2 84  ? -74.423 26.624  11.273  1.00 36.18  ? 84   GLY B N   1 
ATOM   3166 C CA  . GLY B 2 84  ? -73.980 27.803  10.502  1.00 34.10  ? 84   GLY B CA  1 
ATOM   3167 C C   . GLY B 2 84  ? -73.724 27.576  9.021   1.00 37.40  ? 84   GLY B C   1 
ATOM   3168 O O   . GLY B 2 84  ? -74.366 26.746  8.382   1.00 40.83  ? 84   GLY B O   1 
ATOM   3169 N N   . ALA B 2 85  ? -72.786 28.338  8.464   1.00 42.47  ? 85   ALA B N   1 
ATOM   3170 C CA  . ALA B 2 85  ? -72.488 28.269  7.034   1.00 40.71  ? 85   ALA B CA  1 
ATOM   3171 C C   . ALA B 2 85  ? -71.653 27.048  6.682   1.00 39.37  ? 85   ALA B C   1 
ATOM   3172 O O   . ALA B 2 85  ? -71.792 26.502  5.603   1.00 45.60  ? 85   ALA B O   1 
ATOM   3173 C CB  . ALA B 2 85  ? -71.773 29.535  6.578   1.00 44.92  ? 85   ALA B CB  1 
ATOM   3174 N N   . THR B 2 86  ? -70.766 26.632  7.568   1.00 39.58  ? 86   THR B N   1 
ATOM   3175 C CA  . THR B 2 86  ? -69.979 25.422  7.327   1.00 43.35  ? 86   THR B CA  1 
ATOM   3176 C C   . THR B 2 86  ? -70.825 24.140  7.324   1.00 47.51  ? 86   THR B C   1 
ATOM   3177 O O   . THR B 2 86  ? -70.620 23.256  6.493   1.00 46.00  ? 86   THR B O   1 
ATOM   3178 C CB  . THR B 2 86  ? -68.900 25.255  8.403   1.00 42.74  ? 86   THR B CB  1 
ATOM   3179 O OG1 . THR B 2 86  ? -68.007 26.363  8.341   1.00 45.95  ? 86   THR B OG1 1 
ATOM   3180 C CG2 . THR B 2 86  ? -68.107 23.953  8.203   1.00 47.17  ? 86   THR B CG2 1 
ATOM   3181 N N   . GLY B 2 87  ? -71.760 24.041  8.262   1.00 40.49  ? 87   GLY B N   1 
ATOM   3182 C CA  . GLY B 2 87  ? -72.474 22.797  8.491   1.00 41.88  ? 87   GLY B CA  1 
ATOM   3183 C C   . GLY B 2 87  ? -71.599 21.817  9.255   1.00 40.20  ? 87   GLY B C   1 
ATOM   3184 O O   . GLY B 2 87  ? -70.694 22.211  9.989   1.00 39.44  ? 87   GLY B O   1 
ATOM   3185 N N   . HIS B 2 88  ? -71.903 20.538  9.112   1.00 33.21  ? 88   HIS B N   1 
ATOM   3186 C CA  . HIS B 2 88  ? -71.066 19.480  9.647   1.00 33.81  ? 88   HIS B CA  1 
ATOM   3187 C C   . HIS B 2 88  ? -70.792 18.484  8.519   1.00 30.42  ? 88   HIS B C   1 
ATOM   3188 O O   . HIS B 2 88  ? -71.703 17.808  8.073   1.00 28.88  ? 88   HIS B O   1 
ATOM   3189 C CB  . HIS B 2 88  ? -71.732 18.800  10.826  1.00 37.15  ? 88   HIS B CB  1 
ATOM   3190 C CG  . HIS B 2 88  ? -70.793 17.940  11.608  1.00 45.45  ? 88   HIS B CG  1 
ATOM   3191 N ND1 . HIS B 2 88  ? -69.627 18.428  12.143  1.00 40.45  ? 88   HIS B ND1 1 
ATOM   3192 C CD2 . HIS B 2 88  ? -70.828 16.620  11.915  1.00 49.65  ? 88   HIS B CD2 1 
ATOM   3193 C CE1 . HIS B 2 88  ? -68.992 17.453  12.765  1.00 42.93  ? 88   HIS B CE1 1 
ATOM   3194 N NE2 . HIS B 2 88  ? -69.700 16.346  12.645  1.00 46.74  ? 88   HIS B NE2 1 
ATOM   3195 N N   . PRO B 2 89  ? -69.538 18.402  8.053   1.00 28.70  ? 89   PRO B N   1 
ATOM   3196 C CA  . PRO B 2 89  ? -69.297 17.671  6.811   1.00 30.84  ? 89   PRO B CA  1 
ATOM   3197 C C   . PRO B 2 89  ? -69.775 16.250  6.833   1.00 33.50  ? 89   PRO B C   1 
ATOM   3198 O O   . PRO B 2 89  ? -69.503 15.525  7.781   1.00 32.95  ? 89   PRO B O   1 
ATOM   3199 C CB  . PRO B 2 89  ? -67.782 17.709  6.661   1.00 32.55  ? 89   PRO B CB  1 
ATOM   3200 C CG  . PRO B 2 89  ? -67.383 18.967  7.347   1.00 30.69  ? 89   PRO B CG  1 
ATOM   3201 C CD  . PRO B 2 89  ? -68.342 19.141  8.495   1.00 27.91  ? 89   PRO B CD  1 
ATOM   3202 N N   . GLY B 2 90  ? -70.495 15.880  5.783   1.00 33.28  ? 90   GLY B N   1 
ATOM   3203 C CA  . GLY B 2 90  ? -71.058 14.570  5.633   1.00 35.03  ? 90   GLY B CA  1 
ATOM   3204 C C   . GLY B 2 90  ? -72.367 14.329  6.355   1.00 39.50  ? 90   GLY B C   1 
ATOM   3205 O O   . GLY B 2 90  ? -72.871 13.212  6.347   1.00 44.46  ? 90   GLY B O   1 
ATOM   3206 N N   . VAL B 2 91  ? -72.888 15.341  7.037   1.00 36.40  ? 91   VAL B N   1 
ATOM   3207 C CA  . VAL B 2 91  ? -74.090 15.165  7.848   1.00 37.88  ? 91   VAL B CA  1 
ATOM   3208 C C   . VAL B 2 91  ? -75.071 16.338  7.676   1.00 36.95  ? 91   VAL B C   1 
ATOM   3209 O O   . VAL B 2 91  ? -76.222 16.133  7.324   1.00 34.21  ? 91   VAL B O   1 
ATOM   3210 C CB  . VAL B 2 91  ? -73.742 15.014  9.331   1.00 37.56  ? 91   VAL B CB  1 
ATOM   3211 C CG1 . VAL B 2 91  ? -74.982 14.691  10.136  1.00 35.16  ? 91   VAL B CG1 1 
ATOM   3212 C CG2 . VAL B 2 91  ? -72.680 13.941  9.518   1.00 43.07  ? 91   VAL B CG2 1 
ATOM   3213 N N   . ILE B 2 92  ? -74.602 17.548  7.948   1.00 31.86  ? 92   ILE B N   1 
ATOM   3214 C CA  . ILE B 2 92  ? -75.420 18.725  7.888   1.00 31.60  ? 92   ILE B CA  1 
ATOM   3215 C C   . ILE B 2 92  ? -74.856 19.640  6.827   1.00 30.85  ? 92   ILE B C   1 
ATOM   3216 O O   . ILE B 2 92  ? -73.700 20.033  6.896   1.00 32.06  ? 92   ILE B O   1 
ATOM   3217 C CB  . ILE B 2 92  ? -75.398 19.513  9.215   1.00 33.41  ? 92   ILE B CB  1 
ATOM   3218 C CG1 . ILE B 2 92  ? -75.811 18.642  10.410  1.00 34.41  ? 92   ILE B CG1 1 
ATOM   3219 C CG2 . ILE B 2 92  ? -76.282 20.748  9.115   1.00 32.20  ? 92   ILE B CG2 1 
ATOM   3220 C CD1 . ILE B 2 92  ? -77.138 17.993  10.259  1.00 33.40  ? 92   ILE B CD1 1 
ATOM   3221 N N   . PRO B 2 93  ? -75.673 20.014  5.849   1.00 36.91  ? 93   PRO B N   1 
ATOM   3222 C CA  . PRO B 2 93  ? -75.172 20.964  4.854   1.00 38.87  ? 93   PRO B CA  1 
ATOM   3223 C C   . PRO B 2 93  ? -75.065 22.390  5.374   1.00 38.32  ? 93   PRO B C   1 
ATOM   3224 O O   . PRO B 2 93  ? -75.596 22.707  6.451   1.00 36.55  ? 93   PRO B O   1 
ATOM   3225 C CB  . PRO B 2 93  ? -76.218 20.916  3.730   1.00 41.54  ? 93   PRO B CB  1 
ATOM   3226 C CG  . PRO B 2 93  ? -77.305 20.021  4.176   1.00 45.64  ? 93   PRO B CG  1 
ATOM   3227 C CD  . PRO B 2 93  ? -76.995 19.461  5.529   1.00 37.63  ? 93   PRO B CD  1 
ATOM   3228 N N   . PRO B 2 94  ? -74.421 23.260  4.594   1.00 36.09  ? 94   PRO B N   1 
ATOM   3229 C CA  . PRO B 2 94  ? -74.344 24.685  4.876   1.00 36.31  ? 94   PRO B CA  1 
ATOM   3230 C C   . PRO B 2 94  ? -75.705 25.290  5.045   1.00 34.84  ? 94   PRO B C   1 
ATOM   3231 O O   . PRO B 2 94  ? -76.637 24.895  4.364   1.00 36.88  ? 94   PRO B O   1 
ATOM   3232 C CB  . PRO B 2 94  ? -73.716 25.261  3.593   1.00 45.24  ? 94   PRO B CB  1 
ATOM   3233 C CG  . PRO B 2 94  ? -72.912 24.146  3.020   1.00 40.22  ? 94   PRO B CG  1 
ATOM   3234 C CD  . PRO B 2 94  ? -73.730 22.916  3.328   1.00 45.54  ? 94   PRO B CD  1 
ATOM   3235 N N   . ASN B 2 95  ? -75.821 26.237  5.962   1.00 37.01  ? 95   ASN B N   1 
ATOM   3236 C CA  . ASN B 2 95  ? -77.075 26.965  6.186   1.00 44.09  ? 95   ASN B CA  1 
ATOM   3237 C C   . ASN B 2 95  ? -78.314 26.113  6.350   1.00 45.57  ? 95   ASN B C   1 
ATOM   3238 O O   . ASN B 2 95  ? -79.413 26.504  5.904   1.00 38.04  ? 95   ASN B O   1 
ATOM   3239 C CB  . ASN B 2 95  ? -77.294 27.973  5.066   1.00 51.97  ? 95   ASN B CB  1 
ATOM   3240 C CG  . ASN B 2 95  ? -76.130 28.910  4.941   1.00 60.10  ? 95   ASN B CG  1 
ATOM   3241 O OD1 . ASN B 2 95  ? -75.853 29.683  5.862   1.00 73.62  ? 95   ASN B OD1 1 
ATOM   3242 N ND2 . ASN B 2 95  ? -75.399 28.806  3.840   1.00 57.99  ? 95   ASN B ND2 1 
ATOM   3243 N N   . ALA B 2 96  ? -78.157 24.974  7.029   1.00 38.19  ? 96   ALA B N   1 
ATOM   3244 C CA  . ALA B 2 96  ? -79.293 24.112  7.245   1.00 37.11  ? 96   ALA B CA  1 
ATOM   3245 C C   . ALA B 2 96  ? -80.089 24.522  8.491   1.00 40.14  ? 96   ALA B C   1 
ATOM   3246 O O   . ALA B 2 96  ? -79.522 24.773  9.563   1.00 40.01  ? 96   ALA B O   1 
ATOM   3247 C CB  . ALA B 2 96  ? -78.849 22.676  7.338   1.00 43.24  ? 96   ALA B CB  1 
ATOM   3248 N N   . THR B 2 97  ? -81.402 24.623  8.312   1.00 35.84  ? 97   THR B N   1 
ATOM   3249 C CA  . THR B 2 97  ? -82.357 24.632  9.417   1.00 37.96  ? 97   THR B CA  1 
ATOM   3250 C C   . THR B 2 97  ? -82.662 23.170  9.755   1.00 35.53  ? 97   THR B C   1 
ATOM   3251 O O   . THR B 2 97  ? -82.932 22.369  8.868   1.00 41.18  ? 97   THR B O   1 
ATOM   3252 C CB  . THR B 2 97  ? -83.659 25.359  9.012   1.00 38.47  ? 97   THR B CB  1 
ATOM   3253 O OG1 . THR B 2 97  ? -83.366 26.741  8.776   1.00 39.95  ? 97   THR B OG1 1 
ATOM   3254 C CG2 . THR B 2 97  ? -84.752 25.229  10.081  1.00 41.75  ? 97   THR B CG2 1 
ATOM   3255 N N   . LEU B 2 98  ? -82.616 22.843  11.034  1.00 32.71  ? 98   LEU B N   1 
ATOM   3256 C CA  . LEU B 2 98  ? -82.767 21.470  11.515  1.00 35.75  ? 98   LEU B CA  1 
ATOM   3257 C C   . LEU B 2 98  ? -84.015 21.339  12.361  1.00 32.99  ? 98   LEU B C   1 
ATOM   3258 O O   . LEU B 2 98  ? -84.340 22.233  13.114  1.00 35.54  ? 98   LEU B O   1 
ATOM   3259 C CB  . LEU B 2 98  ? -81.566 21.109  12.388  1.00 33.09  ? 98   LEU B CB  1 
ATOM   3260 C CG  . LEU B 2 98  ? -80.200 21.398  11.797  1.00 34.16  ? 98   LEU B CG  1 
ATOM   3261 C CD1 . LEU B 2 98  ? -79.114 21.046  12.795  1.00 39.09  ? 98   LEU B CD1 1 
ATOM   3262 C CD2 . LEU B 2 98  ? -80.008 20.615  10.516  1.00 33.78  ? 98   LEU B CD2 1 
ATOM   3263 N N   . ILE B 2 99  ? -84.698 20.208  12.242  1.00 40.56  ? 99   ILE B N   1 
ATOM   3264 C CA  . ILE B 2 99  ? -85.863 19.875  13.066  1.00 39.72  ? 99   ILE B CA  1 
ATOM   3265 C C   . ILE B 2 99  ? -85.462 18.730  13.985  1.00 37.90  ? 99   ILE B C   1 
ATOM   3266 O O   . ILE B 2 99  ? -84.975 17.726  13.495  1.00 36.69  ? 99   ILE B O   1 
ATOM   3267 C CB  . ILE B 2 99  ? -87.041 19.336  12.224  1.00 43.75  ? 99   ILE B CB  1 
ATOM   3268 C CG1 . ILE B 2 99  ? -87.265 20.178  10.964  1.00 48.79  ? 99   ILE B CG1 1 
ATOM   3269 C CG2 . ILE B 2 99  ? -88.308 19.256  13.065  1.00 46.05  ? 99   ILE B CG2 1 
ATOM   3270 C CD1 . ILE B 2 99  ? -87.483 21.638  11.236  1.00 55.16  ? 99   ILE B CD1 1 
ATOM   3271 N N   . PHE B 2 100 ? -85.669 18.886  15.294  1.00 38.29  ? 100  PHE B N   1 
ATOM   3272 C CA  . PHE B 2 100 ? -85.443 17.812  16.274  1.00 36.67  ? 100  PHE B CA  1 
ATOM   3273 C C   . PHE B 2 100 ? -86.760 17.472  16.944  1.00 36.69  ? 100  PHE B C   1 
ATOM   3274 O O   . PHE B 2 100 ? -87.448 18.358  17.446  1.00 43.92  ? 100  PHE B O   1 
ATOM   3275 C CB  . PHE B 2 100 ? -84.480 18.236  17.382  1.00 30.28  ? 100  PHE B CB  1 
ATOM   3276 C CG  . PHE B 2 100 ? -83.090 18.504  16.921  1.00 30.04  ? 100  PHE B CG  1 
ATOM   3277 C CD1 . PHE B 2 100 ? -82.171 17.486  16.814  1.00 29.12  ? 100  PHE B CD1 1 
ATOM   3278 C CD2 . PHE B 2 100 ? -82.688 19.792  16.609  1.00 32.17  ? 100  PHE B CD2 1 
ATOM   3279 C CE1 . PHE B 2 100 ? -80.877 17.744  16.378  1.00 31.62  ? 100  PHE B CE1 1 
ATOM   3280 C CE2 . PHE B 2 100 ? -81.407 20.053  16.172  1.00 31.83  ? 100  PHE B CE2 1 
ATOM   3281 C CZ  . PHE B 2 100 ? -80.495 19.024  16.060  1.00 33.17  ? 100  PHE B CZ  1 
ATOM   3282 N N   . ASP B 2 101 ? -87.109 16.191  16.958  1.00 34.92  ? 101  ASP B N   1 
ATOM   3283 C CA  . ASP B 2 101 ? -88.239 15.712  17.734  1.00 32.31  ? 101  ASP B CA  1 
ATOM   3284 C C   . ASP B 2 101 ? -87.621 15.282  19.043  1.00 29.77  ? 101  ASP B C   1 
ATOM   3285 O O   . ASP B 2 101 ? -86.888 14.327  19.065  1.00 27.06  ? 101  ASP B O   1 
ATOM   3286 C CB  . ASP B 2 101 ? -88.895 14.523  17.031  1.00 36.22  ? 101  ASP B CB  1 
ATOM   3287 C CG  . ASP B 2 101 ? -89.998 13.868  17.866  1.00 39.07  ? 101  ASP B CG  1 
ATOM   3288 O OD1 . ASP B 2 101 ? -89.966 13.876  19.113  1.00 39.55  ? 101  ASP B OD1 1 
ATOM   3289 O OD2 . ASP B 2 101 ? -90.920 13.335  17.254  1.00 46.77  ? 101  ASP B OD2 1 
ATOM   3290 N N   . VAL B 2 102 ? -87.908 15.979  20.138  1.00 31.23  ? 102  VAL B N   1 
ATOM   3291 C CA  . VAL B 2 102 ? -87.169 15.764  21.374  1.00 26.78  ? 102  VAL B CA  1 
ATOM   3292 C C   . VAL B 2 102 ? -88.106 15.364  22.484  1.00 30.56  ? 102  VAL B C   1 
ATOM   3293 O O   . VAL B 2 102 ? -89.181 15.912  22.621  1.00 28.86  ? 102  VAL B O   1 
ATOM   3294 C CB  . VAL B 2 102 ? -86.436 17.030  21.839  1.00 28.34  ? 102  VAL B CB  1 
ATOM   3295 C CG1 . VAL B 2 102 ? -85.627 16.765  23.113  1.00 26.15  ? 102  VAL B CG1 1 
ATOM   3296 C CG2 . VAL B 2 102 ? -85.579 17.586  20.737  1.00 28.52  ? 102  VAL B CG2 1 
ATOM   3297 N N   . GLU B 2 103 ? -87.678 14.421  23.306  1.00 26.68  ? 103  GLU B N   1 
ATOM   3298 C CA  . GLU B 2 103 ? -88.436 14.080  24.483  1.00 27.50  ? 103  GLU B CA  1 
ATOM   3299 C C   . GLU B 2 103 ? -87.533 14.288  25.655  1.00 23.59  ? 103  GLU B C   1 
ATOM   3300 O O   . GLU B 2 103 ? -86.436 13.768  25.673  1.00 23.72  ? 103  GLU B O   1 
ATOM   3301 C CB  . GLU B 2 103 ? -88.858 12.625  24.391  1.00 31.80  ? 103  GLU B CB  1 
ATOM   3302 C CG  . GLU B 2 103 ? -89.785 12.177  25.475  1.00 39.25  ? 103  GLU B CG  1 
ATOM   3303 C CD  . GLU B 2 103 ? -90.053 10.665  25.437  1.00 58.12  ? 103  GLU B CD  1 
ATOM   3304 O OE1 . GLU B 2 103 ? -89.353 9.868   24.690  1.00 45.06  ? 103  GLU B OE1 1 
ATOM   3305 O OE2 . GLU B 2 103 ? -90.957 10.290  26.219  1.00 43.83  ? 103  GLU B OE2 1 
ATOM   3306 N N   . LEU B 2 104 ? -87.982 15.043  26.647  1.00 27.10  ? 104  LEU B N   1 
ATOM   3307 C CA  . LEU B 2 104 ? -87.181 15.263  27.854  1.00 26.97  ? 104  LEU B CA  1 
ATOM   3308 C C   . LEU B 2 104 ? -87.497 14.172  28.861  1.00 27.95  ? 104  LEU B C   1 
ATOM   3309 O O   . LEU B 2 104 ? -88.501 14.216  29.552  1.00 25.92  ? 104  LEU B O   1 
ATOM   3310 C CB  . LEU B 2 104 ? -87.427 16.657  28.420  1.00 26.76  ? 104  LEU B CB  1 
ATOM   3311 C CG  . LEU B 2 104 ? -86.689 17.041  29.703  1.00 27.92  ? 104  LEU B CG  1 
ATOM   3312 C CD1 . LEU B 2 104 ? -85.193 17.002  29.547  1.00 25.35  ? 104  LEU B CD1 1 
ATOM   3313 C CD2 . LEU B 2 104 ? -87.141 18.431  30.129  1.00 32.42  ? 104  LEU B CD2 1 
ATOM   3314 N N   . LEU B 2 105 ? -86.635 13.175  28.924  1.00 30.03  ? 105  LEU B N   1 
ATOM   3315 C CA  . LEU B 2 105 ? -86.919 11.983  29.707  1.00 31.73  ? 105  LEU B CA  1 
ATOM   3316 C C   . LEU B 2 105 ? -86.686 12.151  31.159  1.00 27.87  ? 105  LEU B C   1 
ATOM   3317 O O   . LEU B 2 105 ? -87.383 11.548  31.952  1.00 26.92  ? 105  LEU B O   1 
ATOM   3318 C CB  . LEU B 2 105 ? -86.033 10.833  29.289  1.00 34.68  ? 105  LEU B CB  1 
ATOM   3319 C CG  . LEU B 2 105 ? -86.260 10.328  27.889  1.00 39.18  ? 105  LEU B CG  1 
ATOM   3320 C CD1 . LEU B 2 105 ? -85.101 9.405   27.560  1.00 42.80  ? 105  LEU B CD1 1 
ATOM   3321 C CD2 . LEU B 2 105 ? -87.598 9.600   27.811  1.00 43.21  ? 105  LEU B CD2 1 
ATOM   3322 N N   . ASN B 2 106 ? -85.653 12.905  31.503  1.00 26.72  ? 106  ASN B N   1 
ATOM   3323 C CA  . ASN B 2 106 ? -85.314 13.116  32.873  1.00 26.04  ? 106  ASN B CA  1 
ATOM   3324 C C   . ASN B 2 106 ? -84.348 14.291  33.072  1.00 26.85  ? 106  ASN B C   1 
ATOM   3325 O O   . ASN B 2 106 ? -83.709 14.742  32.120  1.00 25.90  ? 106  ASN B O   1 
ATOM   3326 C CB  . ASN B 2 106 ? -84.673 11.825  33.461  1.00 27.03  ? 106  ASN B CB  1 
ATOM   3327 C CG  . ASN B 2 106 ? -84.931 11.679  34.955  1.00 27.46  ? 106  ASN B CG  1 
ATOM   3328 O OD1 . ASN B 2 106 ? -85.684 12.447  35.556  1.00 34.09  ? 106  ASN B OD1 1 
ATOM   3329 N ND2 . ASN B 2 106 ? -84.298 10.736  35.550  1.00 31.65  ? 106  ASN B ND2 1 
ATOM   3330 N N   . LEU B 2 107 ? -84.254 14.741  34.328  1.00 28.89  ? 107  LEU B N   1 
ATOM   3331 C CA  . LEU B 2 107 ? -83.266 15.705  34.788  1.00 32.32  ? 107  LEU B CA  1 
ATOM   3332 C C   . LEU B 2 107 ? -82.554 15.166  36.022  1.00 31.64  ? 107  LEU B C   1 
ATOM   3333 O O   . LEU B 2 107 ? -83.225 14.864  36.987  1.00 39.75  ? 107  LEU B O   1 
ATOM   3334 C CB  . LEU B 2 107 ? -83.976 17.024  35.118  1.00 31.38  ? 107  LEU B CB  1 
ATOM   3335 C CG  . LEU B 2 107 ? -84.382 17.831  33.889  1.00 33.71  ? 107  LEU B CG  1 
ATOM   3336 C CD1 . LEU B 2 107 ? -85.414 18.900  34.251  1.00 33.83  ? 107  LEU B CD1 1 
ATOM   3337 C CD2 . LEU B 2 107 ? -83.164 18.492  33.274  1.00 30.38  ? 107  LEU B CD2 1 
ATOM   3338 N N   . GLU B 2 108 ? -81.222 15.081  35.999  1.00 33.28  ? 108  GLU B N   1 
ATOM   3339 C CA  . GLU B 2 108 ? -80.408 14.451  37.081  1.00 44.05  ? 108  GLU B CA  1 
ATOM   3340 C C   . GLU B 2 108 ? -79.426 15.433  37.721  1.00 49.44  ? 108  GLU B C   1 
ATOM   3341 O O   . GLU B 2 108 ? -78.786 16.221  37.009  1.00 50.41  ? 108  GLU B O   1 
ATOM   3342 C CB  . GLU B 2 108 ? -79.592 13.274  36.507  1.00 44.68  ? 108  GLU B CB  1 
ATOM   3343 C CG  . GLU B 2 108 ? -80.477 12.317  35.742  1.00 50.92  ? 108  GLU B CG  1 
ATOM   3344 C CD  . GLU B 2 108 ? -79.798 11.129  35.085  1.00 44.79  ? 108  GLU B CD  1 
ATOM   3345 O OE1 . GLU B 2 108 ? -78.598 11.134  34.690  1.00 39.23  ? 108  GLU B OE1 1 
ATOM   3346 O OE2 . GLU B 2 108 ? -80.567 10.177  34.913  1.00 55.93  ? 108  GLU B OE2 1 
HETATM 3347 C CAC . FLC C 3 .   ? -61.950 -10.514 4.310   1.00 57.44  ? 1500 FLC A CAC 1 
HETATM 3348 C CA  . FLC C 3 .   ? -61.875 -9.222  3.498   1.00 46.57  ? 1500 FLC A CA  1 
HETATM 3349 C CB  . FLC C 3 .   ? -60.556 -8.951  2.733   1.00 57.13  ? 1500 FLC A CB  1 
HETATM 3350 C CBC . FLC C 3 .   ? -59.408 -9.195  3.580   1.00 52.94  ? 1500 FLC A CBC 1 
HETATM 3351 C CG  . FLC C 3 .   ? -60.374 -7.447  2.332   1.00 47.85  ? 1500 FLC A CG  1 
HETATM 3352 C CGC . FLC C 3 .   ? -61.002 -6.380  3.274   1.00 49.12  ? 1500 FLC A CGC 1 
HETATM 3353 O OA1 . FLC C 3 .   ? -63.080 -11.040 4.393   1.00 67.63  ? 1500 FLC A OA1 1 
HETATM 3354 O OA2 . FLC C 3 .   ? -60.947 -11.006 4.895   1.00 48.38  ? 1500 FLC A OA2 1 
HETATM 3355 O OB1 . FLC C 3 .   ? -59.559 -8.642  4.707   1.00 38.13  ? 1500 FLC A OB1 1 
HETATM 3356 O OB2 . FLC C 3 .   ? -58.476 -9.918  3.040   1.00 36.07  ? 1500 FLC A OB2 1 
HETATM 3357 O OG1 . FLC C 3 .   ? -60.332 -5.626  4.036   1.00 39.48  ? 1500 FLC A OG1 1 
HETATM 3358 O OG2 . FLC C 3 .   ? -62.236 -6.231  3.276   1.00 37.17  ? 1500 FLC A OG2 1 
HETATM 3359 O OHB . FLC C 3 .   ? -60.226 -10.012 1.763   1.00 43.14  ? 1500 FLC A OHB 1 
HETATM 3360 C CAC . FLC D 3 .   ? -75.468 -2.834  -4.151  1.00 46.39  ? 1501 FLC A CAC 1 
HETATM 3361 C CA  . FLC D 3 .   ? -75.317 -3.588  -5.456  1.00 44.59  ? 1501 FLC A CA  1 
HETATM 3362 C CB  . FLC D 3 .   ? -76.619 -3.713  -6.246  1.00 46.07  ? 1501 FLC A CB  1 
HETATM 3363 C CBC . FLC D 3 .   ? -76.199 -4.441  -7.526  1.00 45.70  ? 1501 FLC A CBC 1 
HETATM 3364 C CG  . FLC D 3 .   ? -77.307 -2.375  -6.522  1.00 48.65  ? 1501 FLC A CG  1 
HETATM 3365 C CGC . FLC D 3 .   ? -78.559 -2.507  -7.374  1.00 60.73  ? 1501 FLC A CGC 1 
HETATM 3366 O OA1 . FLC D 3 .   ? -75.685 -3.455  -3.094  1.00 45.06  ? 1501 FLC A OA1 1 
HETATM 3367 O OA2 . FLC D 3 .   ? -75.316 -1.610  -4.170  1.00 42.81  ? 1501 FLC A OA2 1 
HETATM 3368 O OB1 . FLC D 3 .   ? -75.683 -3.810  -8.495  1.00 36.62  ? 1501 FLC A OB1 1 
HETATM 3369 O OB2 . FLC D 3 .   ? -76.364 -5.687  -7.559  1.00 40.36  ? 1501 FLC A OB2 1 
HETATM 3370 O OG1 . FLC D 3 .   ? -78.984 -3.631  -7.722  1.00 49.62  ? 1501 FLC A OG1 1 
HETATM 3371 O OG2 . FLC D 3 .   ? -79.135 -1.450  -7.708  1.00 60.19  ? 1501 FLC A OG2 1 
HETATM 3372 O OHB . FLC D 3 .   ? -77.555 -4.500  -5.475  1.00 38.50  ? 1501 FLC A OHB 1 
HETATM 3373 C CAC . FLC E 3 .   ? -51.361 2.980   21.707  1.00 61.68  ? 1502 FLC A CAC 1 
HETATM 3374 C CA  . FLC E 3 .   ? -52.292 2.238   22.655  1.00 50.85  ? 1502 FLC A CA  1 
HETATM 3375 C CB  . FLC E 3 .   ? -53.559 1.572   22.058  1.00 64.69  ? 1502 FLC A CB  1 
HETATM 3376 C CBC . FLC E 3 .   ? -53.615 1.059   20.587  1.00 82.56  ? 1502 FLC A CBC 1 
HETATM 3377 C CG  . FLC E 3 .   ? -54.918 1.632   22.809  1.00 52.85  ? 1502 FLC A CG  1 
HETATM 3378 C CGC . FLC E 3 .   ? -54.829 1.303   24.282  1.00 71.36  ? 1502 FLC A CGC 1 
HETATM 3379 O OA1 . FLC E 3 .   ? -51.143 2.538   20.517  1.00 28.29  ? 1502 FLC A OA1 1 
HETATM 3380 O OA2 . FLC E 3 .   ? -50.836 4.024   22.214  1.00 38.93  ? 1502 FLC A OA2 1 
HETATM 3381 O OB1 . FLC E 3 .   ? -52.589 1.179   19.884  1.00 63.90  ? 1502 FLC A OB1 1 
HETATM 3382 O OB2 . FLC E 3 .   ? -54.632 0.485   20.070  1.00 53.32  ? 1502 FLC A OB2 1 
HETATM 3383 O OG1 . FLC E 3 .   ? -55.902 1.107   24.897  1.00 102.87 ? 1502 FLC A OG1 1 
HETATM 3384 O OG2 . FLC E 3 .   ? -53.727 1.245   24.863  1.00 82.07  ? 1502 FLC A OG2 1 
HETATM 3385 O OHB . FLC E 3 .   ? -53.763 2.962   21.658  1.00 51.89  ? 1502 FLC A OHB 1 
HETATM 3386 C CAC . FLC F 3 .   ? -56.678 2.466   15.600  1.00 24.90  ? 1503 FLC A CAC 1 
HETATM 3387 C CA  . FLC F 3 .   ? -57.770 1.791   14.807  1.00 25.43  ? 1503 FLC A CA  1 
HETATM 3388 C CB  . FLC F 3 .   ? -58.928 1.422   15.715  1.00 31.22  ? 1503 FLC A CB  1 
HETATM 3389 C CBC . FLC F 3 .   ? -58.549 0.277   16.609  1.00 38.85  ? 1503 FLC A CBC 1 
HETATM 3390 C CG  . FLC F 3 .   ? -60.114 0.939   14.903  1.00 29.41  ? 1503 FLC A CG  1 
HETATM 3391 C CGC . FLC F 3 .   ? -61.281 0.516   15.796  1.00 40.97  ? 1503 FLC A CGC 1 
HETATM 3392 O OA1 . FLC F 3 .   ? -56.520 3.713   15.526  1.00 18.29  ? 1503 FLC A OA1 1 
HETATM 3393 O OA2 . FLC F 3 .   ? -55.974 1.734   16.310  1.00 27.95  ? 1503 FLC A OA2 1 
HETATM 3394 O OB1 . FLC F 3 .   ? -58.187 -0.778  16.049  1.00 32.56  ? 1503 FLC A OB1 1 
HETATM 3395 O OB2 . FLC F 3 .   ? -58.628 0.465   17.847  1.00 33.98  ? 1503 FLC A OB2 1 
HETATM 3396 O OG1 . FLC F 3 .   ? -62.303 0.060   15.261  1.00 43.34  ? 1503 FLC A OG1 1 
HETATM 3397 O OG2 . FLC F 3 .   ? -61.214 0.617   17.040  1.00 52.04  ? 1503 FLC A OG2 1 
HETATM 3398 O OHB . FLC F 3 .   ? -59.236 2.559   16.558  1.00 30.36  ? 1503 FLC A OHB 1 
HETATM 3399 C CAC . FLC G 3 .   ? -42.550 14.942  4.352   1.00 101.91 ? 1504 FLC A CAC 1 
HETATM 3400 C CA  . FLC G 3 .   ? -41.389 15.691  4.996   1.00 90.03  ? 1504 FLC A CA  1 
HETATM 3401 C CB  . FLC G 3 .   ? -40.503 16.547  4.050   1.00 91.89  ? 1504 FLC A CB  1 
HETATM 3402 C CBC . FLC G 3 .   ? -39.380 17.365  4.660   1.00 106.65 ? 1504 FLC A CBC 1 
HETATM 3403 C CG  . FLC G 3 .   ? -40.794 16.756  2.552   1.00 67.17  ? 1504 FLC A CG  1 
HETATM 3404 C CGC . FLC G 3 .   ? -39.761 15.910  1.830   1.00 47.48  ? 1504 FLC A CGC 1 
HETATM 3405 O OA1 . FLC G 3 .   ? -43.584 15.603  4.134   1.00 105.88 ? 1504 FLC A OA1 1 
HETATM 3406 O OA2 . FLC G 3 .   ? -42.473 13.707  4.082   1.00 79.90  ? 1504 FLC A OA2 1 
HETATM 3407 O OB1 . FLC G 3 .   ? -38.988 18.401  4.059   1.00 91.21  ? 1504 FLC A OB1 1 
HETATM 3408 O OB2 . FLC G 3 .   ? -38.864 16.944  5.726   1.00 98.53  ? 1504 FLC A OB2 1 
HETATM 3409 O OG1 . FLC G 3 .   ? -40.165 14.879  1.262   1.00 38.16  ? 1504 FLC A OG1 1 
HETATM 3410 O OG2 . FLC G 3 .   ? -38.536 16.227  1.858   1.00 34.89  ? 1504 FLC A OG2 1 
HETATM 3411 O OHB . FLC G 3 .   ? -41.378 17.666  4.307   1.00 89.34  ? 1504 FLC A OHB 1 
HETATM 3412 C CAC . FLC H 3 .   ? -55.850 -10.408 -6.014  1.00 98.70  ? 1505 FLC A CAC 1 
HETATM 3413 C CA  . FLC H 3 .   ? -57.208 -9.965  -5.511  1.00 98.36  ? 1505 FLC A CA  1 
HETATM 3414 C CB  . FLC H 3 .   ? -58.348 -10.628 -6.288  1.00 94.89  ? 1505 FLC A CB  1 
HETATM 3415 C CBC . FLC H 3 .   ? -58.104 -10.411 -7.769  1.00 98.86  ? 1505 FLC A CBC 1 
HETATM 3416 C CG  . FLC H 3 .   ? -59.716 -10.031 -5.935  1.00 88.18  ? 1505 FLC A CG  1 
HETATM 3417 C CGC . FLC H 3 .   ? -60.760 -11.078 -5.629  1.00 80.02  ? 1505 FLC A CGC 1 
HETATM 3418 O OA1 . FLC H 3 .   ? -55.258 -9.646  -6.836  1.00 95.55  ? 1505 FLC A OA1 1 
HETATM 3419 O OA2 . FLC H 3 .   ? -55.400 -11.505 -5.575  1.00 59.77  ? 1505 FLC A OA2 1 
HETATM 3420 O OB1 . FLC H 3 .   ? -58.226 -9.249  -8.309  1.00 66.83  ? 1505 FLC A OB1 1 
HETATM 3421 O OB2 . FLC H 3 .   ? -57.756 -11.457 -8.376  1.00 57.65  ? 1505 FLC A OB2 1 
HETATM 3422 O OG1 . FLC H 3 .   ? -60.981 -11.949 -6.498  1.00 64.00  ? 1505 FLC A OG1 1 
HETATM 3423 O OG2 . FLC H 3 .   ? -61.355 -11.026 -4.523  1.00 80.21  ? 1505 FLC A OG2 1 
HETATM 3424 O OHB . FLC H 3 .   ? -58.315 -12.042 -5.963  1.00 63.15  ? 1505 FLC A OHB 1 
HETATM 3425 C CAC . FLC I 3 .   ? -57.554 -4.178  -4.055  1.00 64.64  ? 1506 FLC A CAC 1 
HETATM 3426 C CA  . FLC I 3 .   ? -57.932 -3.922  -5.504  1.00 64.02  ? 1506 FLC A CA  1 
HETATM 3427 C CB  . FLC I 3 .   ? -58.756 -5.099  -6.106  1.00 96.86  ? 1506 FLC A CB  1 
HETATM 3428 C CBC . FLC I 3 .   ? -58.585 -5.230  -7.602  1.00 88.77  ? 1506 FLC A CBC 1 
HETATM 3429 C CG  . FLC I 3 .   ? -60.260 -4.869  -5.847  1.00 97.42  ? 1506 FLC A CG  1 
HETATM 3430 C CGC . FLC I 3 .   ? -61.099 -6.121  -5.657  1.00 97.36  ? 1506 FLC A CGC 1 
HETATM 3431 O OA1 . FLC I 3 .   ? -58.409 -3.978  -3.177  1.00 96.48  ? 1506 FLC A OA1 1 
HETATM 3432 O OA2 . FLC I 3 .   ? -56.414 -4.585  -3.734  1.00 47.05  ? 1506 FLC A OA2 1 
HETATM 3433 O OB1 . FLC I 3 .   ? -58.718 -6.398  -8.058  1.00 94.92  ? 1506 FLC A OB1 1 
HETATM 3434 O OB2 . FLC I 3 .   ? -58.318 -4.216  -8.313  1.00 81.27  ? 1506 FLC A OB2 1 
HETATM 3435 O OG1 . FLC I 3 .   ? -60.648 -7.241  -5.989  1.00 94.60  ? 1506 FLC A OG1 1 
HETATM 3436 O OG2 . FLC I 3 .   ? -62.244 -5.979  -5.170  1.00 62.76  ? 1506 FLC A OG2 1 
HETATM 3437 O OHB . FLC I 3 .   ? -58.283 -6.383  -5.609  1.00 62.17  ? 1506 FLC A OHB 1 
HETATM 3438 C C7  . TAK J 4 .   ? -43.828 10.653  22.343  1.00 71.25  ? 1507 TAK A C7  1 
HETATM 3439 O O1  . TAK J 4 .   ? -43.863 11.258  21.072  1.00 60.08  ? 1507 TAK A O1  1 
HETATM 3440 C C8  . TAK J 4 .   ? -45.087 11.205  20.310  1.00 43.86  ? 1507 TAK A C8  1 
HETATM 3441 C C9  . TAK J 4 .   ? -46.347 10.881  20.867  1.00 45.37  ? 1507 TAK A C9  1 
HETATM 3442 C C10 . TAK J 4 .   ? -47.495 10.844  20.080  1.00 38.01  ? 1507 TAK A C10 1 
HETATM 3443 C C11 . TAK J 4 .   ? -45.039 11.500  18.974  1.00 47.54  ? 1507 TAK A C11 1 
HETATM 3444 C C12 . TAK J 4 .   ? -46.193 11.461  18.175  1.00 40.66  ? 1507 TAK A C12 1 
HETATM 3445 C C13 . TAK J 4 .   ? -47.436 11.114  18.714  1.00 33.22  ? 1507 TAK A C13 1 
HETATM 3446 C C14 . TAK J 4 .   ? -48.641 11.094  17.893  1.00 28.26  ? 1507 TAK A C14 1 
HETATM 3447 C C15 . TAK J 4 .   ? -49.754 10.329  18.243  1.00 25.84  ? 1507 TAK A C15 1 
HETATM 3448 C C16 . TAK J 4 .   ? -48.758 11.854  16.716  1.00 28.35  ? 1507 TAK A C16 1 
HETATM 3449 N N2  . TAK J 4 .   ? -49.892 11.860  15.981  1.00 25.94  ? 1507 TAK A N2  1 
HETATM 3450 C C17 . TAK J 4 .   ? -50.980 11.080  16.358  1.00 22.01  ? 1507 TAK A C17 1 
HETATM 3451 N N3  . TAK J 4 .   ? -50.892 10.340  17.439  1.00 23.43  ? 1507 TAK A N3  1 
HETATM 3452 N N4  . TAK J 4 .   ? -52.064 9.648   17.645  1.00 23.48  ? 1507 TAK A N4  1 
HETATM 3453 C C18 . TAK J 4 .   ? -52.896 10.002  16.627  1.00 24.61  ? 1507 TAK A C18 1 
HETATM 3454 C C19 . TAK J 4 .   ? -52.267 10.911  15.780  1.00 21.97  ? 1507 TAK A C19 1 
HETATM 3455 C C20 . TAK J 4 .   ? -52.840 11.470  14.634  1.00 25.65  ? 1507 TAK A C20 1 
HETATM 3456 C C21 . TAK J 4 .   ? -54.191 11.785  14.645  1.00 27.05  ? 1507 TAK A C21 1 
HETATM 3457 C C22 . TAK J 4 .   ? -54.819 12.327  13.535  1.00 28.31  ? 1507 TAK A C22 1 
HETATM 3458 N N5  . TAK J 4 .   ? -54.103 12.542  12.430  1.00 32.04  ? 1507 TAK A N5  1 
HETATM 3459 C C23 . TAK J 4 .   ? -52.799 12.246  12.363  1.00 23.64  ? 1507 TAK A C23 1 
HETATM 3460 C C24 . TAK J 4 .   ? -52.149 11.696  13.459  1.00 33.87  ? 1507 TAK A C24 1 
HETATM 3461 C C1  . EDO K 5 .   ? -31.524 5.519   -6.850  1.00 42.37  ? 1508 EDO A C1  1 
HETATM 3462 O O1  . EDO K 5 .   ? -30.250 6.124   -6.564  1.00 45.08  ? 1508 EDO A O1  1 
HETATM 3463 C C2  . EDO K 5 .   ? -32.611 6.501   -6.443  1.00 45.34  ? 1508 EDO A C2  1 
HETATM 3464 O O2  . EDO K 5 .   ? -32.644 6.650   -5.020  1.00 36.46  ? 1508 EDO A O2  1 
HETATM 3465 C C1  . EDO L 5 .   ? -53.730 3.002   -14.902 1.00 65.98  ? 1509 EDO A C1  1 
HETATM 3466 O O1  . EDO L 5 .   ? -52.880 2.309   -15.834 1.00 62.07  ? 1509 EDO A O1  1 
HETATM 3467 C C2  . EDO L 5 .   ? -54.889 2.070   -14.563 1.00 48.91  ? 1509 EDO A C2  1 
HETATM 3468 O O2  . EDO L 5 .   ? -56.070 2.736   -14.079 1.00 43.50  ? 1509 EDO A O2  1 
HETATM 3469 C C1  . EDO M 5 .   ? -55.961 -3.449  18.469  1.00 88.35  ? 1510 EDO A C1  1 
HETATM 3470 O O1  . EDO M 5 .   ? -56.032 -2.121  19.024  1.00 85.49  ? 1510 EDO A O1  1 
HETATM 3471 C C2  . EDO M 5 .   ? -57.356 -4.014  18.175  1.00 86.77  ? 1510 EDO A C2  1 
HETATM 3472 O O2  . EDO M 5 .   ? -58.024 -3.220  17.168  1.00 51.41  ? 1510 EDO A O2  1 
HETATM 3473 C C1  . EDO N 5 .   ? -35.016 -14.872 9.945   1.00 66.80  ? 1511 EDO A C1  1 
HETATM 3474 O O1  . EDO N 5 .   ? -35.215 -13.571 9.383   1.00 63.93  ? 1511 EDO A O1  1 
HETATM 3475 C C2  . EDO N 5 .   ? -33.525 -15.069 10.248  1.00 69.89  ? 1511 EDO A C2  1 
HETATM 3476 O O2  . EDO N 5 .   ? -33.288 -16.464 10.494  1.00 70.56  ? 1511 EDO A O2  1 
HETATM 3477 C C1  . EDO O 5 .   ? -35.659 -1.627  -9.268  1.00 74.80  ? 1512 EDO A C1  1 
HETATM 3478 O O1  . EDO O 5 .   ? -37.043 -1.383  -9.589  1.00 56.06  ? 1512 EDO A O1  1 
HETATM 3479 C C2  . EDO O 5 .   ? -35.374 -1.340  -7.783  1.00 59.54  ? 1512 EDO A C2  1 
HETATM 3480 O O2  . EDO O 5 .   ? -34.018 -0.907  -7.536  1.00 47.24  ? 1512 EDO A O2  1 
HETATM 3481 C C1  . EDO P 5 .   ? -60.952 4.839   18.890  1.00 49.51  ? 1513 EDO A C1  1 
HETATM 3482 O O1  . EDO P 5 .   ? -60.695 4.422   20.234  1.00 59.54  ? 1513 EDO A O1  1 
HETATM 3483 C C2  . EDO P 5 .   ? -61.645 3.714   18.143  1.00 67.23  ? 1513 EDO A C2  1 
HETATM 3484 O O2  . EDO P 5 .   ? -62.392 4.220   17.024  1.00 77.51  ? 1513 EDO A O2  1 
HETATM 3485 C C1  . EDO Q 5 .   ? -71.203 27.200  20.276  1.00 84.65  ? 1514 EDO A C1  1 
HETATM 3486 O O1  . EDO Q 5 .   ? -70.098 27.097  19.354  1.00 64.75  ? 1514 EDO A O1  1 
HETATM 3487 C C2  . EDO Q 5 .   ? -70.684 27.371  21.701  1.00 83.01  ? 1514 EDO A C2  1 
HETATM 3488 O O2  . EDO Q 5 .   ? -69.340 27.869  21.676  1.00 80.97  ? 1514 EDO A O2  1 
HETATM 3489 C C1  . EDO R 5 .   ? -49.153 16.579  30.780  1.00 57.04  ? 1515 EDO A C1  1 
HETATM 3490 O O1  . EDO R 5 .   ? -48.102 16.527  29.807  1.00 65.01  ? 1515 EDO A O1  1 
HETATM 3491 C C2  . EDO R 5 .   ? -49.720 17.990  30.946  1.00 56.46  ? 1515 EDO A C2  1 
HETATM 3492 O O2  . EDO R 5 .   ? -48.857 18.785  31.763  1.00 61.97  ? 1515 EDO A O2  1 
HETATM 3493 C C1  . EDO S 5 .   ? -49.277 8.223   27.913  1.00 50.00  ? 1516 EDO A C1  1 
HETATM 3494 O O1  . EDO S 5 .   ? -48.824 7.992   26.569  1.00 60.45  ? 1516 EDO A O1  1 
HETATM 3495 C C2  . EDO S 5 .   ? -49.652 6.899   28.559  1.00 45.95  ? 1516 EDO A C2  1 
HETATM 3496 O O2  . EDO S 5 .   ? -50.942 7.159   29.109  1.00 46.44  ? 1516 EDO A O2  1 
HETATM 3497 C CAC . FLC T 3 .   ? -68.313 29.652  9.581   1.00 80.59  ? 1108 FLC B CAC 1 
HETATM 3498 C CA  . FLC T 3 .   ? -68.476 28.939  10.923  1.00 77.62  ? 1108 FLC B CA  1 
HETATM 3499 C CB  . FLC T 3 .   ? -69.936 28.550  11.215  1.00 80.42  ? 1108 FLC B CB  1 
HETATM 3500 C CBC . FLC T 3 .   ? -70.686 29.873  11.428  1.00 67.80  ? 1108 FLC B CBC 1 
HETATM 3501 C CG  . FLC T 3 .   ? -70.018 27.514  12.379  1.00 76.60  ? 1108 FLC B CG  1 
HETATM 3502 C CGC . FLC T 3 .   ? -71.031 27.633  13.527  1.00 81.58  ? 1108 FLC B CGC 1 
HETATM 3503 O OA1 . FLC T 3 .   ? -67.633 30.701  9.542   1.00 96.40  ? 1108 FLC B OA1 1 
HETATM 3504 O OA2 . FLC T 3 .   ? -68.839 29.179  8.545   1.00 67.54  ? 1108 FLC B OA2 1 
HETATM 3505 O OB1 . FLC T 3 .   ? -70.413 30.572  12.439  1.00 59.60  ? 1108 FLC B OB1 1 
HETATM 3506 O OB2 . FLC T 3 .   ? -71.530 30.242  10.573  1.00 51.24  ? 1108 FLC B OB2 1 
HETATM 3507 O OG1 . FLC T 3 .   ? -72.278 27.698  13.340  1.00 62.99  ? 1108 FLC B OG1 1 
HETATM 3508 O OG2 . FLC T 3 .   ? -70.566 27.601  14.690  1.00 59.10  ? 1108 FLC B OG2 1 
HETATM 3509 O OHB . FLC T 3 .   ? -70.383 27.836  10.031  1.00 55.85  ? 1108 FLC B OHB 1 
HETATM 3510 C C1  . EDO U 5 .   ? -82.460 20.542  2.438   1.00 94.35  ? 1109 EDO B C1  1 
HETATM 3511 O O1  . EDO U 5 .   ? -83.410 20.228  3.475   1.00 65.28  ? 1109 EDO B O1  1 
HETATM 3512 C C2  . EDO U 5 .   ? -81.029 20.124  2.802   1.00 82.83  ? 1109 EDO B C2  1 
HETATM 3513 O O2  . EDO U 5 .   ? -80.719 18.861  2.187   1.00 74.12  ? 1109 EDO B O2  1 
HETATM 3514 C C1  . EDO V 5 .   ? -72.570 12.121  27.246  1.00 77.29  ? 1110 EDO B C1  1 
HETATM 3515 O O1  . EDO V 5 .   ? -71.119 12.149  27.079  1.00 69.57  ? 1110 EDO B O1  1 
HETATM 3516 C C2  . EDO V 5 .   ? -73.386 12.002  25.934  1.00 51.41  ? 1110 EDO B C2  1 
HETATM 3517 O O2  . EDO V 5 .   ? -74.610 11.185  26.016  1.00 36.27  ? 1110 EDO B O2  1 
HETATM 3518 C C1  . EDO W 5 .   ? -94.675 22.644  28.674  1.00 54.77  ? 1111 EDO B C1  1 
HETATM 3519 O O1  . EDO W 5 .   ? -94.033 22.690  29.977  1.00 42.18  ? 1111 EDO B O1  1 
HETATM 3520 C C2  . EDO W 5 .   ? -95.562 21.410  28.379  1.00 52.39  ? 1111 EDO B C2  1 
HETATM 3521 O O2  . EDO W 5 .   ? -96.199 20.930  29.563  1.00 71.64  ? 1111 EDO B O2  1 
HETATM 3522 C C1  . EDO X 5 .   ? -77.712 27.660  30.972  1.00 66.72  ? 1112 EDO B C1  1 
HETATM 3523 O O1  . EDO X 5 .   ? -76.788 28.594  31.570  1.00 59.61  ? 1112 EDO B O1  1 
HETATM 3524 C C2  . EDO X 5 .   ? -77.942 27.764  29.451  1.00 57.22  ? 1112 EDO B C2  1 
HETATM 3525 O O2  . EDO X 5 .   ? -79.197 27.149  29.038  1.00 47.58  ? 1112 EDO B O2  1 
HETATM 3526 O O   . HOH Y 6 .   ? -62.099 3.416   25.617  1.00 56.89  ? 2001 HOH A O   1 
HETATM 3527 O O   . HOH Y 6 .   ? -73.146 6.312   22.043  1.00 52.60  ? 2002 HOH A O   1 
HETATM 3528 O O   . HOH Y 6 .   ? -71.569 8.952   13.374  1.00 45.72  ? 2003 HOH A O   1 
HETATM 3529 O O   . HOH Y 6 .   ? -71.845 5.029   7.328   1.00 44.61  ? 2004 HOH A O   1 
HETATM 3530 O O   . HOH Y 6 .   ? -69.150 9.076   12.411  1.00 30.40  ? 2005 HOH A O   1 
HETATM 3531 O O   . HOH Y 6 .   ? -64.002 4.608   14.791  1.00 35.75  ? 2006 HOH A O   1 
HETATM 3532 O O   . HOH Y 6 .   ? -75.369 9.557   14.556  1.00 34.01  ? 2007 HOH A O   1 
HETATM 3533 O O   . HOH Y 6 .   ? -71.820 17.581  16.750  1.00 25.25  ? 2008 HOH A O   1 
HETATM 3534 O O   . HOH Y 6 .   ? -73.926 18.004  21.186  1.00 42.85  ? 2009 HOH A O   1 
HETATM 3535 O O   . HOH Y 6 .   ? -69.366 18.469  16.200  1.00 25.54  ? 2010 HOH A O   1 
HETATM 3536 O O   . HOH Y 6 .   ? -71.874 23.831  21.585  1.00 48.73  ? 2011 HOH A O   1 
HETATM 3537 O O   . HOH Y 6 .   ? -69.093 21.105  14.996  1.00 32.85  ? 2012 HOH A O   1 
HETATM 3538 O O   . HOH Y 6 .   ? -62.556 20.811  24.664  1.00 30.52  ? 2013 HOH A O   1 
HETATM 3539 O O   . HOH Y 6 .   ? -62.950 20.931  29.029  1.00 50.20  ? 2014 HOH A O   1 
HETATM 3540 O O   . HOH Y 6 .   ? -64.024 21.622  20.142  1.00 49.23  ? 2015 HOH A O   1 
HETATM 3541 O O   . HOH Y 6 .   ? -67.676 24.077  25.219  1.00 46.33  ? 2016 HOH A O   1 
HETATM 3542 O O   . HOH Y 6 .   ? -63.445 15.029  30.385  1.00 37.76  ? 2017 HOH A O   1 
HETATM 3543 O O   . HOH Y 6 .   ? -61.240 16.232  30.475  1.00 42.88  ? 2018 HOH A O   1 
HETATM 3544 O O   . HOH Y 6 .   ? -66.613 15.097  30.886  1.00 51.36  ? 2019 HOH A O   1 
HETATM 3545 O O   . HOH Y 6 .   ? -72.678 15.688  30.055  1.00 36.92  ? 2020 HOH A O   1 
HETATM 3546 O O   . HOH Y 6 .   ? -58.318 22.218  26.855  1.00 31.52  ? 2021 HOH A O   1 
HETATM 3547 O O   . HOH Y 6 .   ? -47.241 21.698  24.152  1.00 43.66  ? 2022 HOH A O   1 
HETATM 3548 O O   . HOH Y 6 .   ? -59.759 14.051  31.374  1.00 32.31  ? 2023 HOH A O   1 
HETATM 3549 O O   . HOH Y 6 .   ? -62.950 7.596   30.216  1.00 42.11  ? 2024 HOH A O   1 
HETATM 3550 O O   . HOH Y 6 .   ? -57.303 7.033   22.296  1.00 22.77  ? 2025 HOH A O   1 
HETATM 3551 O O   . HOH Y 6 .   ? -52.820 5.939   25.882  1.00 43.61  ? 2026 HOH A O   1 
HETATM 3552 O O   . HOH Y 6 .   ? -55.451 13.700  9.727   1.00 36.62  ? 2027 HOH A O   1 
HETATM 3553 O O   . HOH Y 6 .   ? -50.905 14.993  10.712  1.00 49.45  ? 2028 HOH A O   1 
HETATM 3554 O O   . HOH Y 6 .   ? -58.443 25.247  13.018  1.00 35.55  ? 2029 HOH A O   1 
HETATM 3555 O O   . HOH Y 6 .   ? -55.784 14.788  6.363   1.00 37.46  ? 2030 HOH A O   1 
HETATM 3556 O O   . HOH Y 6 .   ? -57.000 9.889   9.908   1.00 27.85  ? 2031 HOH A O   1 
HETATM 3557 O O   . HOH Y 6 .   ? -69.950 2.701   4.886   1.00 36.28  ? 2032 HOH A O   1 
HETATM 3558 O O   . HOH Y 6 .   ? -64.421 -0.507  7.777   1.00 30.33  ? 2033 HOH A O   1 
HETATM 3559 O O   . HOH Y 6 .   ? -60.686 2.740   11.778  1.00 25.12  ? 2034 HOH A O   1 
HETATM 3560 O O   . HOH Y 6 .   ? -63.293 -3.828  9.171   1.00 48.45  ? 2035 HOH A O   1 
HETATM 3561 O O   . HOH Y 6 .   ? -59.593 -6.723  6.770   1.00 36.32  ? 2036 HOH A O   1 
HETATM 3562 O O   . HOH Y 6 .   ? -59.858 -4.906  11.338  1.00 32.50  ? 2037 HOH A O   1 
HETATM 3563 O O   . HOH Y 6 .   ? -54.533 -6.568  10.688  1.00 36.86  ? 2038 HOH A O   1 
HETATM 3564 O O   . HOH Y 6 .   ? -62.584 4.872   12.358  1.00 26.01  ? 2039 HOH A O   1 
HETATM 3565 O O   . HOH Y 6 .   ? -63.576 23.316  22.643  1.00 58.22  ? 2040 HOH A O   1 
HETATM 3566 O O   . HOH Y 6 .   ? -52.059 -7.444  9.753   1.00 32.33  ? 2041 HOH A O   1 
HETATM 3567 O O   . HOH Y 6 .   ? -54.819 5.073   23.710  1.00 35.36  ? 2042 HOH A O   1 
HETATM 3568 O O   . HOH Y 6 .   ? -47.770 9.880   25.220  1.00 35.43  ? 2043 HOH A O   1 
HETATM 3569 O O   . HOH Y 6 .   ? -48.695 3.645   19.786  1.00 23.55  ? 2044 HOH A O   1 
HETATM 3570 O O   . HOH Y 6 .   ? -50.753 4.312   24.905  1.00 55.62  ? 2045 HOH A O   1 
HETATM 3571 O O   . HOH Y 6 .   ? -32.978 11.148  8.054   1.00 55.37  ? 2046 HOH A O   1 
HETATM 3572 O O   . HOH Y 6 .   ? -44.117 10.689  15.507  1.00 31.22  ? 2047 HOH A O   1 
HETATM 3573 O O   . HOH Y 6 .   ? -43.906 12.137  11.889  1.00 36.61  ? 2048 HOH A O   1 
HETATM 3574 O O   . HOH Y 6 .   ? -46.813 -10.793 10.004  1.00 38.41  ? 2049 HOH A O   1 
HETATM 3575 O O   . HOH Y 6 .   ? -43.462 -13.618 11.471  1.00 43.18  ? 2050 HOH A O   1 
HETATM 3576 O O   . HOH Y 6 .   ? -35.828 11.989  6.494   1.00 43.00  ? 2051 HOH A O   1 
HETATM 3577 O O   . HOH Y 6 .   ? -48.973 -10.020 11.641  1.00 36.85  ? 2052 HOH A O   1 
HETATM 3578 O O   . HOH Y 6 .   ? -36.690 6.067   16.991  1.00 50.20  ? 2053 HOH A O   1 
HETATM 3579 O O   . HOH Y 6 .   ? -43.198 -2.432  16.663  1.00 39.70  ? 2054 HOH A O   1 
HETATM 3580 O O   . HOH Y 6 .   ? -31.177 5.478   11.275  1.00 33.68  ? 2055 HOH A O   1 
HETATM 3581 O O   . HOH Y 6 .   ? -54.373 -1.190  -7.259  1.00 28.30  ? 2056 HOH A O   1 
HETATM 3582 O O   . HOH Y 6 .   ? -34.130 -10.068 11.625  1.00 35.86  ? 2057 HOH A O   1 
HETATM 3583 O O   . HOH Y 6 .   ? -44.685 -11.131 11.723  1.00 39.08  ? 2058 HOH A O   1 
HETATM 3584 O O   . HOH Y 6 .   ? -44.130 -4.456  14.908  1.00 35.02  ? 2059 HOH A O   1 
HETATM 3585 O O   . HOH Y 6 .   ? -43.870 -6.691  16.369  1.00 48.40  ? 2060 HOH A O   1 
HETATM 3586 O O   . HOH Y 6 .   ? -49.731 -7.443  10.760  1.00 27.60  ? 2061 HOH A O   1 
HETATM 3587 O O   . HOH Y 6 .   ? -50.281 -8.003  16.147  1.00 45.43  ? 2062 HOH A O   1 
HETATM 3588 O O   . HOH Y 6 .   ? -57.738 -5.897  4.236   1.00 25.47  ? 2063 HOH A O   1 
HETATM 3589 O O   . HOH Y 6 .   ? -56.069 -7.903  8.578   1.00 44.87  ? 2064 HOH A O   1 
HETATM 3590 O O   . HOH Y 6 .   ? -53.560 -9.053  8.018   1.00 38.34  ? 2065 HOH A O   1 
HETATM 3591 O O   . HOH Y 6 .   ? -63.903 -6.267  5.141   1.00 43.73  ? 2066 HOH A O   1 
HETATM 3592 O O   . HOH Y 6 .   ? -61.499 -1.221  -5.804  1.00 25.27  ? 2067 HOH A O   1 
HETATM 3593 O O   . HOH Y 6 .   ? -55.181 -1.935  -4.872  1.00 22.04  ? 2068 HOH A O   1 
HETATM 3594 O O   . HOH Y 6 .   ? -66.675 -6.506  -2.335  1.00 36.04  ? 2069 HOH A O   1 
HETATM 3595 O O   . HOH Y 6 .   ? -65.833 -1.693  -7.065  1.00 30.11  ? 2070 HOH A O   1 
HETATM 3596 O O   . HOH Y 6 .   ? -70.637 0.776   -2.359  1.00 40.42  ? 2071 HOH A O   1 
HETATM 3597 O O   . HOH Y 6 .   ? -74.132 -7.151  -0.948  1.00 41.51  ? 2072 HOH A O   1 
HETATM 3598 O O   . HOH Y 6 .   ? -72.324 -5.830  3.260   1.00 49.08  ? 2073 HOH A O   1 
HETATM 3599 O O   . HOH Y 6 .   ? -75.757 -5.599  -2.257  1.00 36.08  ? 2074 HOH A O   1 
HETATM 3600 O O   . HOH Y 6 .   ? -73.686 -0.924  -1.942  1.00 45.76  ? 2075 HOH A O   1 
HETATM 3601 O O   . HOH Y 6 .   ? -55.545 11.591  2.275   1.00 23.61  ? 2076 HOH A O   1 
HETATM 3602 O O   . HOH Y 6 .   ? -53.983 7.925   -5.042  1.00 34.80  ? 2077 HOH A O   1 
HETATM 3603 O O   . HOH Y 6 .   ? -51.275 11.416  -4.742  1.00 22.48  ? 2078 HOH A O   1 
HETATM 3604 O O   . HOH Y 6 .   ? -49.339 9.689   -3.926  1.00 28.48  ? 2079 HOH A O   1 
HETATM 3605 O O   . HOH Y 6 .   ? -53.672 12.573  -7.510  1.00 44.06  ? 2080 HOH A O   1 
HETATM 3606 O O   . HOH Y 6 .   ? -53.336 10.576  -6.189  1.00 28.92  ? 2081 HOH A O   1 
HETATM 3607 O O   . HOH Y 6 .   ? -26.270 -0.552  1.468   1.00 54.14  ? 2082 HOH A O   1 
HETATM 3608 O O   . HOH Y 6 .   ? -50.596 7.848   -1.969  1.00 22.38  ? 2083 HOH A O   1 
HETATM 3609 O O   . HOH Y 6 .   ? -47.321 10.639  -0.072  1.00 28.22  ? 2084 HOH A O   1 
HETATM 3610 O O   . HOH Y 6 .   ? -52.305 14.706  3.664   1.00 44.70  ? 2085 HOH A O   1 
HETATM 3611 O O   . HOH Y 6 .   ? -43.105 10.271  5.260   1.00 23.73  ? 2086 HOH A O   1 
HETATM 3612 O O   . HOH Y 6 .   ? -39.851 9.734   4.193   1.00 32.58  ? 2087 HOH A O   1 
HETATM 3613 O O   . HOH Y 6 .   ? -49.818 11.430  10.886  1.00 49.73  ? 2088 HOH A O   1 
HETATM 3614 O O   . HOH Y 6 .   ? -46.142 12.607  11.047  1.00 46.18  ? 2089 HOH A O   1 
HETATM 3615 O O   . HOH Y 6 .   ? -48.827 14.520  8.052   1.00 52.61  ? 2090 HOH A O   1 
HETATM 3616 O O   . HOH Y 6 .   ? -52.152 -1.545  20.064  1.00 42.26  ? 2091 HOH A O   1 
HETATM 3617 O O   . HOH Y 6 .   ? -45.145 -4.934  19.699  1.00 54.67  ? 2092 HOH A O   1 
HETATM 3618 O O   . HOH Y 6 .   ? -46.970 0.593   27.170  1.00 38.58  ? 2093 HOH A O   1 
HETATM 3619 O O   . HOH Y 6 .   ? -32.661 -12.948 -5.905  1.00 48.23  ? 2094 HOH A O   1 
HETATM 3620 O O   . HOH Y 6 .   ? -38.652 -17.415 -0.228  1.00 53.02  ? 2095 HOH A O   1 
HETATM 3621 O O   . HOH Y 6 .   ? -34.152 -16.141 -1.048  1.00 44.74  ? 2096 HOH A O   1 
HETATM 3622 O O   . HOH Y 6 .   ? -36.996 -13.341 -5.778  1.00 48.63  ? 2097 HOH A O   1 
HETATM 3623 O O   . HOH Y 6 .   ? -44.365 -3.370  -17.549 1.00 52.64  ? 2098 HOH A O   1 
HETATM 3624 O O   . HOH Y 6 .   ? -49.513 -7.151  -16.102 1.00 51.78  ? 2099 HOH A O   1 
HETATM 3625 O O   . HOH Y 6 .   ? -64.082 12.045  -3.099  1.00 39.94  ? 2100 HOH A O   1 
HETATM 3626 O O   . HOH Y 6 .   ? -66.306 6.809   -9.267  1.00 47.76  ? 2101 HOH A O   1 
HETATM 3627 O O   . HOH Y 6 .   ? -73.343 7.016   -12.923 1.00 58.18  ? 2102 HOH A O   1 
HETATM 3628 O O   . HOH Y 6 .   ? -65.186 9.855   -12.841 1.00 54.80  ? 2103 HOH A O   1 
HETATM 3629 O O   . HOH Y 6 .   ? -50.689 13.879  -5.598  1.00 45.77  ? 2104 HOH A O   1 
HETATM 3630 O O   . HOH Y 6 .   ? -48.879 18.903  -3.938  1.00 49.85  ? 2105 HOH A O   1 
HETATM 3631 O O   . HOH Y 6 .   ? -52.953 19.313  -2.041  1.00 44.84  ? 2106 HOH A O   1 
HETATM 3632 O O   . HOH Y 6 .   ? -47.646 11.409  -2.773  1.00 26.74  ? 2107 HOH A O   1 
HETATM 3633 O O   . HOH Y 6 .   ? -44.437 17.841  -1.257  1.00 38.02  ? 2108 HOH A O   1 
HETATM 3634 O O   . HOH Y 6 .   ? -41.655 15.759  -0.809  1.00 26.35  ? 2109 HOH A O   1 
HETATM 3635 O O   . HOH Y 6 .   ? -41.909 8.973   -6.007  1.00 22.83  ? 2110 HOH A O   1 
HETATM 3636 O O   . HOH Y 6 .   ? -33.677 13.985  0.051   1.00 31.56  ? 2111 HOH A O   1 
HETATM 3637 O O   . HOH Y 6 .   ? -47.782 8.110   -5.586  1.00 25.10  ? 2112 HOH A O   1 
HETATM 3638 O O   . HOH Y 6 .   ? -46.622 5.884   -15.264 1.00 38.23  ? 2113 HOH A O   1 
HETATM 3639 O O   . HOH Y 6 .   ? -51.974 5.258   -11.961 1.00 24.87  ? 2114 HOH A O   1 
HETATM 3640 O O   . HOH Y 6 .   ? -44.412 16.292  -17.701 1.00 49.45  ? 2115 HOH A O   1 
HETATM 3641 O O   . HOH Y 6 .   ? -41.182 13.469  -18.148 1.00 45.70  ? 2116 HOH A O   1 
HETATM 3642 O O   . HOH Y 6 .   ? -43.577 8.570   -17.162 1.00 64.18  ? 2117 HOH A O   1 
HETATM 3643 O O   . HOH Y 6 .   ? -53.458 13.975  -15.401 1.00 43.37  ? 2118 HOH A O   1 
HETATM 3644 O O   . HOH Y 6 .   ? -57.448 12.976  -17.365 1.00 38.20  ? 2119 HOH A O   1 
HETATM 3645 O O   . HOH Y 6 .   ? -54.887 6.763   -15.761 1.00 32.13  ? 2120 HOH A O   1 
HETATM 3646 O O   . HOH Y 6 .   ? -65.629 7.631   -11.700 1.00 54.30  ? 2121 HOH A O   1 
HETATM 3647 O O   . HOH Y 6 .   ? -63.869 5.721   -11.963 1.00 31.15  ? 2122 HOH A O   1 
HETATM 3648 O O   . HOH Y 6 .   ? -61.900 2.534   -11.810 1.00 29.63  ? 2123 HOH A O   1 
HETATM 3649 O O   . HOH Y 6 .   ? -59.893 -1.515  -10.113 1.00 26.01  ? 2124 HOH A O   1 
HETATM 3650 O O   . HOH Y 6 .   ? -56.423 -1.930  -8.809  1.00 43.77  ? 2125 HOH A O   1 
HETATM 3651 O O   . HOH Y 6 .   ? -51.956 -1.857  -8.493  1.00 30.68  ? 2126 HOH A O   1 
HETATM 3652 O O   . HOH Y 6 .   ? -35.116 3.772   5.459   1.00 25.37  ? 2127 HOH A O   1 
HETATM 3653 O O   . HOH Y 6 .   ? -30.518 1.405   -0.765  1.00 31.84  ? 2128 HOH A O   1 
HETATM 3654 O O   . HOH Y 6 .   ? -27.961 2.974   1.777   1.00 40.33  ? 2129 HOH A O   1 
HETATM 3655 O O   . HOH Y 6 .   ? -30.490 3.034   14.620  1.00 49.56  ? 2130 HOH A O   1 
HETATM 3656 O O   . HOH Y 6 .   ? -27.982 -10.387 5.012   1.00 40.05  ? 2131 HOH A O   1 
HETATM 3657 O O   . HOH Y 6 .   ? -30.009 -13.181 9.680   1.00 45.86  ? 2132 HOH A O   1 
HETATM 3658 O O   . HOH Y 6 .   ? -28.993 -10.888 12.588  1.00 35.84  ? 2133 HOH A O   1 
HETATM 3659 O O   . HOH Y 6 .   ? -25.072 -10.391 4.989   1.00 49.67  ? 2134 HOH A O   1 
HETATM 3660 O O   . HOH Y 6 .   ? -30.813 -14.131 6.936   1.00 49.56  ? 2135 HOH A O   1 
HETATM 3661 O O   . HOH Y 6 .   ? -26.036 -2.537  3.704   1.00 46.96  ? 2136 HOH A O   1 
HETATM 3662 O O   . HOH Y 6 .   ? -26.832 2.738   5.806   1.00 36.20  ? 2137 HOH A O   1 
HETATM 3663 O O   . HOH Y 6 .   ? -34.164 5.729   -2.814  1.00 26.20  ? 2138 HOH A O   1 
HETATM 3664 O O   . HOH Y 6 .   ? -31.548 13.774  1.443   1.00 54.87  ? 2139 HOH A O   1 
HETATM 3665 O O   . HOH Y 6 .   ? -29.322 14.543  -1.794  1.00 41.34  ? 2140 HOH A O   1 
HETATM 3666 O O   . HOH Y 6 .   ? -29.511 3.633   -1.551  1.00 40.23  ? 2141 HOH A O   1 
HETATM 3667 O O   . HOH Y 6 .   ? -31.640 4.335   -3.130  1.00 36.65  ? 2142 HOH A O   1 
HETATM 3668 O O   . HOH Y 6 .   ? -29.853 14.162  -8.631  1.00 38.22  ? 2143 HOH A O   1 
HETATM 3669 O O   . HOH Y 6 .   ? -32.747 16.784  -7.546  1.00 36.30  ? 2144 HOH A O   1 
HETATM 3670 O O   . HOH Y 6 .   ? -29.252 15.565  -4.303  1.00 48.95  ? 2145 HOH A O   1 
HETATM 3671 O O   . HOH Y 6 .   ? -31.156 19.080  0.885   1.00 47.87  ? 2146 HOH A O   1 
HETATM 3672 O O   . HOH Y 6 .   ? -41.384 18.581  -1.448  1.00 34.88  ? 2147 HOH A O   1 
HETATM 3673 O O   . HOH Y 6 .   ? -36.121 22.762  -8.734  1.00 50.24  ? 2148 HOH A O   1 
HETATM 3674 O O   . HOH Y 6 .   ? -42.282 22.585  -7.209  1.00 48.63  ? 2149 HOH A O   1 
HETATM 3675 O O   . HOH Y 6 .   ? -40.576 22.528  -10.098 1.00 41.70  ? 2150 HOH A O   1 
HETATM 3676 O O   . HOH Y 6 .   ? -38.884 18.525  -16.394 1.00 38.82  ? 2151 HOH A O   1 
HETATM 3677 O O   . HOH Y 6 .   ? -33.640 15.866  -9.907  1.00 34.83  ? 2152 HOH A O   1 
HETATM 3678 O O   . HOH Y 6 .   ? -35.165 21.979  -5.211  1.00 44.82  ? 2153 HOH A O   1 
HETATM 3679 O O   . HOH Y 6 .   ? -31.544 14.345  -10.730 1.00 48.30  ? 2154 HOH A O   1 
HETATM 3680 O O   . HOH Y 6 .   ? -40.730 5.705   -14.715 1.00 38.84  ? 2155 HOH A O   1 
HETATM 3681 O O   . HOH Y 6 .   ? -34.474 6.919   -18.422 1.00 45.97  ? 2156 HOH A O   1 
HETATM 3682 O O   . HOH Y 6 .   ? -31.551 11.299  -11.377 1.00 44.73  ? 2157 HOH A O   1 
HETATM 3683 O O   . HOH Y 6 .   ? -32.697 3.227   -10.370 1.00 37.09  ? 2158 HOH A O   1 
HETATM 3684 O O   . HOH Y 6 .   ? -39.319 0.203   -12.645 1.00 52.79  ? 2159 HOH A O   1 
HETATM 3685 O O   . HOH Y 6 .   ? -31.315 -2.125  -7.037  1.00 37.81  ? 2160 HOH A O   1 
HETATM 3686 O O   . HOH Y 6 .   ? -25.622 -4.460  1.438   1.00 38.95  ? 2161 HOH A O   1 
HETATM 3687 O O   . HOH Y 6 .   ? -25.427 -2.707  -1.552  1.00 47.65  ? 2162 HOH A O   1 
HETATM 3688 O O   . HOH Y 6 .   ? -31.182 -13.830 -3.495  1.00 55.33  ? 2163 HOH A O   1 
HETATM 3689 O O   . HOH Y 6 .   ? -35.486 -14.042 6.946   1.00 44.88  ? 2164 HOH A O   1 
HETATM 3690 O O   . HOH Y 6 .   ? -36.853 -15.297 -0.796  1.00 46.56  ? 2165 HOH A O   1 
HETATM 3691 O O   . HOH Y 6 .   ? -39.461 -15.639 2.303   1.00 47.62  ? 2166 HOH A O   1 
HETATM 3692 O O   . HOH Y 6 .   ? -35.575 -10.249 -5.107  1.00 50.49  ? 2167 HOH A O   1 
HETATM 3693 O O   . HOH Y 6 .   ? -42.166 -11.432 -2.944  1.00 36.22  ? 2168 HOH A O   1 
HETATM 3694 O O   . HOH Y 6 .   ? -41.954 -14.336 -2.245  1.00 50.82  ? 2169 HOH A O   1 
HETATM 3695 O O   . HOH Y 6 .   ? -39.699 -2.023  -10.966 1.00 38.18  ? 2170 HOH A O   1 
HETATM 3696 O O   . HOH Y 6 .   ? -31.684 -5.302  -7.343  1.00 53.04  ? 2171 HOH A O   1 
HETATM 3697 O O   . HOH Y 6 .   ? -43.421 -0.796  -16.660 1.00 28.00  ? 2172 HOH A O   1 
HETATM 3698 O O   . HOH Y 6 .   ? -40.852 -0.158  -15.202 1.00 46.11  ? 2173 HOH A O   1 
HETATM 3699 O O   . HOH Y 6 .   ? -45.216 3.330   -19.333 1.00 40.17  ? 2174 HOH A O   1 
HETATM 3700 O O   . HOH Y 6 .   ? -45.236 6.303   -18.554 1.00 72.66  ? 2175 HOH A O   1 
HETATM 3701 O O   . HOH Y 6 .   ? -53.676 -4.665  -15.484 1.00 40.46  ? 2176 HOH A O   1 
HETATM 3702 O O   . HOH Y 6 .   ? -49.260 -4.789  -17.739 1.00 58.01  ? 2177 HOH A O   1 
HETATM 3703 O O   . HOH Y 6 .   ? -50.645 -3.673  -18.363 1.00 73.10  ? 2178 HOH A O   1 
HETATM 3704 O O   . HOH Y 6 .   ? -52.270 -7.840  -8.369  1.00 28.86  ? 2179 HOH A O   1 
HETATM 3705 O O   . HOH Y 6 .   ? -57.715 -9.522  7.589   1.00 52.85  ? 2180 HOH A O   1 
HETATM 3706 O O   . HOH Y 6 .   ? -47.243 -11.542 -5.347  1.00 49.53  ? 2181 HOH A O   1 
HETATM 3707 O O   . HOH Y 6 .   ? -53.146 -11.495 6.619   1.00 34.66  ? 2182 HOH A O   1 
HETATM 3708 O O   . HOH Y 6 .   ? -60.578 1.147   19.889  1.00 42.17  ? 2183 HOH A O   1 
HETATM 3709 O O   . HOH Y 6 .   ? -40.107 12.282  4.043   1.00 55.71  ? 2184 HOH A O   1 
HETATM 3710 O O   . HOH Y 6 .   ? -37.908 13.609  4.862   1.00 59.11  ? 2185 HOH A O   1 
HETATM 3711 O O   . HOH Y 6 .   ? -62.384 -8.557  -3.425  1.00 49.78  ? 2186 HOH A O   1 
HETATM 3712 O O   . HOH Y 6 .   ? -65.180 -7.399  -4.202  1.00 43.41  ? 2187 HOH A O   1 
HETATM 3713 O O   . HOH Y 6 .   ? -48.950 13.363  13.089  1.00 56.48  ? 2188 HOH A O   1 
HETATM 3714 O O   . HOH Y 6 .   ? -59.399 5.403   22.069  1.00 43.12  ? 2189 HOH A O   1 
HETATM 3715 O O   . HOH Z 6 .   ? -90.749 23.459  15.563  1.00 37.08  ? 2001 HOH B O   1 
HETATM 3716 O O   . HOH Z 6 .   ? -95.488 14.368  27.376  1.00 36.02  ? 2002 HOH B O   1 
HETATM 3717 O O   . HOH Z 6 .   ? -95.886 12.218  23.155  1.00 36.82  ? 2003 HOH B O   1 
HETATM 3718 O O   . HOH Z 6 .   ? -97.491 18.244  36.943  1.00 42.53  ? 2004 HOH B O   1 
HETATM 3719 O O   . HOH Z 6 .   ? -96.871 16.862  39.776  1.00 56.33  ? 2005 HOH B O   1 
HETATM 3720 O O   . HOH Z 6 .   ? -92.453 25.725  38.130  1.00 51.09  ? 2006 HOH B O   1 
HETATM 3721 O O   . HOH Z 6 .   ? -90.122 20.510  40.263  1.00 39.82  ? 2007 HOH B O   1 
HETATM 3722 O O   . HOH Z 6 .   ? -85.200 21.376  37.444  1.00 37.45  ? 2008 HOH B O   1 
HETATM 3723 O O   . HOH Z 6 .   ? -77.000 21.287  39.514  1.00 49.74  ? 2009 HOH B O   1 
HETATM 3724 O O   . HOH Z 6 .   ? -75.453 17.055  36.494  1.00 39.80  ? 2010 HOH B O   1 
HETATM 3725 O O   . HOH Z 6 .   ? -85.154 18.820  38.675  1.00 38.46  ? 2011 HOH B O   1 
HETATM 3726 O O   . HOH Z 6 .   ? -80.357 17.913  39.843  1.00 45.69  ? 2012 HOH B O   1 
HETATM 3727 O O   . HOH Z 6 .   ? -81.967 21.396  6.049   1.00 56.23  ? 2013 HOH B O   1 
HETATM 3728 O O   . HOH Z 6 .   ? -82.524 24.170  5.777   1.00 44.02  ? 2014 HOH B O   1 
HETATM 3729 O O   . HOH Z 6 .   ? -90.009 9.420   22.166  1.00 43.32  ? 2015 HOH B O   1 
HETATM 3730 O O   . HOH Z 6 .   ? -80.663 6.395   12.590  1.00 41.49  ? 2016 HOH B O   1 
HETATM 3731 O O   . HOH Z 6 .   ? -77.202 8.923   22.794  1.00 33.65  ? 2017 HOH B O   1 
HETATM 3732 O O   . HOH Z 6 .   ? -74.859 22.162  27.273  1.00 26.36  ? 2018 HOH B O   1 
HETATM 3733 O O   . HOH Z 6 .   ? -73.039 24.681  34.058  1.00 41.31  ? 2019 HOH B O   1 
HETATM 3734 O O   . HOH Z 6 .   ? -74.671 25.815  27.660  1.00 29.59  ? 2020 HOH B O   1 
HETATM 3735 O O   . HOH Z 6 .   ? -67.772 22.698  28.329  1.00 54.49  ? 2021 HOH B O   1 
HETATM 3736 O O   . HOH Z 6 .   ? -68.268 20.220  29.068  1.00 42.44  ? 2022 HOH B O   1 
HETATM 3737 O O   . HOH Z 6 .   ? -75.501 25.129  24.138  1.00 29.65  ? 2023 HOH B O   1 
HETATM 3738 O O   . HOH Z 6 .   ? -74.600 19.685  19.049  1.00 26.25  ? 2024 HOH B O   1 
HETATM 3739 O O   . HOH Z 6 .   ? -73.880 26.422  18.917  1.00 38.87  ? 2025 HOH B O   1 
HETATM 3740 O O   . HOH Z 6 .   ? -90.352 23.288  11.343  1.00 49.29  ? 2026 HOH B O   1 
HETATM 3741 O O   . HOH Z 6 .   ? -79.915 31.597  10.786  1.00 50.27  ? 2027 HOH B O   1 
HETATM 3742 O O   . HOH Z 6 .   ? -77.215 24.018  10.923  1.00 30.14  ? 2028 HOH B O   1 
HETATM 3743 O O   . HOH Z 6 .   ? -75.626 24.309  8.686   1.00 32.07  ? 2029 HOH B O   1 
HETATM 3744 O O   . HOH Z 6 .   ? -71.498 20.802  5.425   1.00 40.44  ? 2030 HOH B O   1 
HETATM 3745 O O   . HOH Z 6 .   ? -69.034 20.976  12.363  1.00 40.08  ? 2031 HOH B O   1 
HETATM 3746 O O   . HOH Z 6 .   ? -77.575 13.783  6.533   1.00 44.11  ? 2032 HOH B O   1 
HETATM 3747 O O   . HOH Z 6 .   ? -81.863 27.408  6.639   1.00 39.05  ? 2033 HOH B O   1 
HETATM 3748 O O   . HOH Z 6 .   ? -85.487 28.394  8.611   1.00 48.69  ? 2034 HOH B O   1 
HETATM 3749 O O   . HOH Z 6 .   ? -91.183 7.412   27.736  1.00 36.51  ? 2035 HOH B O   1 
HETATM 3750 O O   . HOH Z 6 .   ? -91.399 9.962   29.172  1.00 36.37  ? 2036 HOH B O   1 
HETATM 3751 O O   . HOH Z 6 .   ? -85.622 16.564  38.613  1.00 61.72  ? 2037 HOH B O   1 
HETATM 3752 O O   . HOH Z 6 .   ? -83.588 31.508  9.066   1.00 54.04  ? 2038 HOH B O   1 
HETATM 3753 O O   . HOH Z 6 .   ? -88.209 27.647  10.206  1.00 43.88  ? 2039 HOH B O   1 
HETATM 3754 O O   . HOH Z 6 .   ? -70.649 9.497   29.104  1.00 60.06  ? 2040 HOH B O   1 
HETATM 3755 O O   . HOH Z 6 .   ? -75.034 8.531   23.787  1.00 55.60  ? 2041 HOH B O   1 
HETATM 3756 O O   . HOH Z 6 .   ? -74.517 8.953   28.576  1.00 57.18  ? 2042 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 9   ? 1.1757 1.1427 1.1356 0.0312  0.0330  -0.0014 178 SER A N   
2    C CA  . SER A 9   ? 1.2466 1.2149 1.2023 0.0342  0.0309  -0.0017 178 SER A CA  
3    C C   . SER A 9   ? 0.9406 0.9088 0.8951 0.0325  0.0272  -0.0014 178 SER A C   
4    O O   . SER A 9   ? 0.9139 0.8836 0.8702 0.0318  0.0230  -0.0029 178 SER A O   
5    C CB  . SER A 9   ? 0.9414 0.9089 0.8912 0.0380  0.0352  -0.0002 178 SER A CB  
6    N N   . THR A 10  ? 0.7570 0.7234 0.7086 0.0319  0.0289  0.0003  179 THR A N   
7    C CA  . THR A 10  ? 0.7380 0.7047 0.6880 0.0306  0.0260  0.0007  179 THR A CA  
8    C C   . THR A 10  ? 0.8384 0.8046 0.7930 0.0264  0.0228  0.0001  179 THR A C   
9    O O   . THR A 10  ? 0.7636 0.7291 0.7223 0.0245  0.0236  -0.0002 179 THR A O   
10   C CB  . THR A 10  ? 0.8356 0.8003 0.7804 0.0320  0.0295  0.0030  179 THR A CB  
11   O OG1 . THR A 10  ? 0.9277 0.8932 0.8712 0.0307  0.0268  0.0034  179 THR A OG1 
12   C CG2 . THR A 10  ? 0.8341 0.7948 0.7797 0.0302  0.0336  0.0040  179 THR A CG2 
13   N N   . LEU A 11  ? 0.6294 0.5965 0.5835 0.0251  0.0193  0.0001  180 LEU A N   
14   C CA  . LEU A 11  ? 0.6967 0.6634 0.6546 0.0214  0.0163  -0.0001 180 LEU A CA  
15   C C   . LEU A 11  ? 0.6829 0.6475 0.6411 0.0193  0.0188  0.0009  180 LEU A C   
16   O O   . LEU A 11  ? 0.5917 0.5563 0.5539 0.0165  0.0175  0.0005  180 LEU A O   
17   C CB  . LEU A 11  ? 0.5756 0.5434 0.5325 0.0201  0.0124  -0.0002 180 LEU A CB  
18   C CG  . LEU A 11  ? 0.5902 0.5590 0.5489 0.0200  0.0086  -0.0018 180 LEU A CG  
19   C CD1 . LEU A 11  ? 0.6809 0.6506 0.6382 0.0184  0.0054  -0.0018 180 LEU A CD1 
20   C CD2 . LEU A 11  ? 0.5954 0.5633 0.5590 0.0185  0.0071  -0.0026 180 LEU A CD2 
21   N N   . ALA A 12  ? 0.7443 0.7071 0.6982 0.0207  0.0225  0.0024  181 ALA A N   
22   C CA  . ALA A 12  ? 0.8525 0.8121 0.8059 0.0187  0.0256  0.0032  181 ALA A CA  
23   C C   . ALA A 12  ? 0.7254 0.6842 0.6825 0.0172  0.0283  0.0024  181 ALA A C   
24   O O   . ALA A 12  ? 0.9640 0.9220 0.9237 0.0139  0.0285  0.0020  181 ALA A O   
25   C CB  . ALA A 12  ? 0.6964 0.6536 0.6438 0.0212  0.0295  0.0050  181 ALA A CB  
26   N N   . ASP A 13  ? 0.6621 0.6217 0.6196 0.0196  0.0300  0.0020  182 ASP A N   
27   C CA  . ASP A 13  ? 0.9524 0.9121 0.9137 0.0183  0.0325  0.0011  182 ASP A CA  
28   C C   . ASP A 13  ? 0.8835 0.8464 0.8510 0.0155  0.0285  -0.0003 182 ASP A C   
29   O O   . ASP A 13  ? 1.1454 1.1086 1.1161 0.0123  0.0294  -0.0009 182 ASP A O   
30   C CB  . ASP A 13  ? 0.9981 0.9591 0.9591 0.0217  0.0343  0.0008  182 ASP A CB  
31   C CG  . ASP A 13  ? 1.0874 1.0456 1.0422 0.0251  0.0387  0.0025  182 ASP A CG  
32   O OD1 . ASP A 13  ? 0.9696 0.9242 0.9205 0.0248  0.0415  0.0040  182 ASP A OD1 
33   O OD2 . ASP A 13  ? 1.0433 1.0029 0.9969 0.0283  0.0394  0.0023  182 ASP A OD2 
34   N N   . LEU A 14  ? 0.7546 0.7198 0.7233 0.0167  0.0242  -0.0010 183 LEU A N   
35   C CA  . LEU A 14  ? 0.7100 0.6778 0.6839 0.0149  0.0203  -0.0021 183 LEU A CA  
36   C C   . LEU A 14  ? 0.7138 0.6815 0.6890 0.0113  0.0186  -0.0019 183 LEU A C   
37   O O   . LEU A 14  ? 0.6953 0.6655 0.6751 0.0094  0.0167  -0.0027 183 LEU A O   
38   C CB  . LEU A 14  ? 0.7116 0.6803 0.6853 0.0168  0.0163  -0.0027 183 LEU A CB  
39   C CG  . LEU A 14  ? 0.8396 0.8095 0.8141 0.0199  0.0168  -0.0038 183 LEU A CG  
40   C CD1 . LEU A 14  ? 0.8733 0.8432 0.8469 0.0212  0.0130  -0.0046 183 LEU A CD1 
41   C CD2 . LEU A 14  ? 0.8927 0.8650 0.8726 0.0194  0.0174  -0.0048 183 LEU A CD2 
42   N N   . LEU A 15  ? 0.6754 0.6406 0.6464 0.0108  0.0193  -0.0007 184 LEU A N   
43   C CA  . LEU A 15  ? 0.7635 0.7284 0.7349 0.0076  0.0179  -0.0004 184 LEU A CA  
44   C C   . LEU A 15  ? 0.7665 0.7299 0.7383 0.0050  0.0216  -0.0007 184 LEU A C   
45   O O   . LEU A 15  ? 0.7264 0.6907 0.7001 0.0019  0.0203  -0.0012 184 LEU A O   
46   C CB  . LEU A 15  ? 0.8034 0.7667 0.7702 0.0082  0.0166  0.0007  184 LEU A CB  
47   C CG  . LEU A 15  ? 0.7986 0.7635 0.7658 0.0088  0.0119  0.0006  184 LEU A CG  
48   C CD1 . LEU A 15  ? 0.7980 0.7622 0.7603 0.0103  0.0117  0.0016  184 LEU A CD1 
49   C CD2 . LEU A 15  ? 0.7207 0.6867 0.6909 0.0060  0.0083  0.0004  184 LEU A CD2 
50   N N   . ASP A 16  ? 0.9941 0.9552 0.9638 0.0062  0.0264  -0.0004 185 ASP A N   
51   C CA  . ASP A 16  ? 1.0678 1.0259 1.0365 0.0037  0.0310  -0.0005 185 ASP A CA  
52   C C   . ASP A 16  ? 0.9715 0.9324 0.9455 -0.0005 0.0302  -0.0023 185 ASP A C   
53   O O   . ASP A 16  ? 0.8107 0.7758 0.7897 -0.0009 0.0292  -0.0035 185 ASP A O   
54   C CB  . ASP A 16  ? 1.3346 1.2904 1.3016 0.0056  0.0362  -0.0001 185 ASP A CB  
55   C CG  . ASP A 16  ? 1.5452 1.4959 1.5092 0.0037  0.0416  0.0001  185 ASP A CG  
56   O OD1 . ASP A 16  ? 1.6537 1.6005 1.6130 0.0039  0.0424  0.0013  185 ASP A OD1 
57   O OD2 . ASP A 16  ? 1.6232 1.5735 1.5893 0.0019  0.0452  -0.0007 185 ASP A OD2 
58   N N   . SER A 21  ? 1.1735 1.1603 1.1727 -0.0069 0.0156  -0.0080 190 SER A N   
59   C CA  . SER A 21  ? 1.5665 1.5557 1.5677 -0.0114 0.0170  -0.0096 190 SER A CA  
60   C C   . SER A 21  ? 1.4596 1.4560 1.4656 -0.0125 0.0126  -0.0105 190 SER A C   
61   O O   . SER A 21  ? 0.8200 0.8228 0.8313 -0.0118 0.0117  -0.0116 190 SER A O   
62   C CB  . SER A 21  ? 1.3846 1.3744 1.3877 -0.0132 0.0222  -0.0110 190 SER A CB  
63   N N   . GLY A 22  ? 1.3533 1.3491 1.3574 -0.0139 0.0098  -0.0100 191 GLY A N   
64   C CA  . GLY A 22  ? 1.3373 1.3392 1.3447 -0.0144 0.0053  -0.0104 191 GLY A CA  
65   C C   . GLY A 22  ? 1.3774 1.3765 1.3809 -0.0151 0.0025  -0.0091 191 GLY A C   
66   O O   . GLY A 22  ? 1.2317 1.2304 1.2337 -0.0186 0.0036  -0.0100 191 GLY A O   
67   N N   . SER A 23  ? 1.1538 1.1508 1.1554 -0.0120 -0.0007 -0.0071 192 SER A N   
68   C CA  . SER A 23  ? 1.0733 1.0680 1.0713 -0.0125 -0.0035 -0.0057 192 SER A CA  
69   C C   . SER A 23  ? 0.9414 0.9307 0.9357 -0.0095 -0.0050 -0.0036 192 SER A C   
70   O O   . SER A 23  ? 0.7244 0.7124 0.7192 -0.0066 -0.0048 -0.0032 192 SER A O   
71   C CB  . SER A 23  ? 0.9225 0.9234 0.9235 -0.0132 -0.0075 -0.0059 192 SER A CB  
72   O OG  . SER A 23  ? 0.9312 0.9341 0.9343 -0.0097 -0.0106 -0.0048 192 SER A OG  
73   N N   . GLY A 24  ? 0.5327 0.5192 0.5231 -0.0105 -0.0063 -0.0024 193 GLY A N   
74   C CA  . GLY A 24  ? 0.5482 0.5300 0.5348 -0.0086 -0.0072 -0.0006 193 GLY A CA  
75   C C   . GLY A 24  ? 0.4244 0.4019 0.4072 -0.0084 -0.0036 -0.0005 193 GLY A C   
76   O O   . GLY A 24  ? 0.4319 0.4089 0.4146 -0.0096 0.0000  -0.0015 193 GLY A O   
77   N N   . SER A 25  ? 0.3855 0.3599 0.3649 -0.0069 -0.0044 0.0007  194 SER A N   
78   C CA  . SER A 25  ? 0.3562 0.3271 0.3314 -0.0064 -0.0015 0.0012  194 SER A CA  
79   C C   . SER A 25  ? 0.3506 0.3202 0.3254 -0.0035 0.0000  0.0011  194 SER A C   
80   O O   . SER A 25  ? 0.3282 0.2957 0.3001 -0.0026 0.0033  0.0013  194 SER A O   
81   C CB  . SER A 25  ? 0.3265 0.2960 0.2982 -0.0067 -0.0035 0.0026  194 SER A CB  
82   O OG  . SER A 25  ? 0.3364 0.3068 0.3076 -0.0092 -0.0046 0.0028  194 SER A OG  
83   N N   . GLY A 26  ? 0.3523 0.3229 0.3294 -0.0018 -0.0022 0.0009  195 GLY A N   
84   C CA  . GLY A 26  ? 0.4019 0.3712 0.3780 0.0009  -0.0013 0.0007  195 GLY A CA  
85   C C   . GLY A 26  ? 0.3558 0.3266 0.3352 0.0024  0.0001  -0.0003 195 GLY A C   
86   O O   . GLY A 26  ? 0.3224 0.2947 0.3040 0.0013  0.0023  -0.0010 195 GLY A O   
87   N N   . LEU A 27  ? 0.3151 0.2854 0.2949 0.0049  -0.0009 -0.0007 196 LEU A N   
88   C CA  . LEU A 27  ? 0.2801 0.2520 0.2630 0.0067  0.0003  -0.0018 196 LEU A CA  
89   C C   . LEU A 27  ? 0.3246 0.2997 0.3122 0.0061  -0.0015 -0.0022 196 LEU A C   
90   O O   . LEU A 27  ? 0.3443 0.3198 0.3326 0.0051  -0.0047 -0.0016 196 LEU A O   
91   C CB  . LEU A 27  ? 0.3125 0.2829 0.2942 0.0095  -0.0004 -0.0022 196 LEU A CB  
92   C CG  . LEU A 27  ? 0.3188 0.2874 0.2959 0.0107  0.0015  -0.0020 196 LEU A CG  
93   C CD1 . LEU A 27  ? 0.3720 0.3394 0.3476 0.0127  -0.0001 -0.0027 196 LEU A CD1 
94   C CD2 . LEU A 27  ? 0.3722 0.3413 0.3491 0.0118  0.0058  -0.0023 196 LEU A CD2 
95   N N   . PRO A 28  ? 0.3175 0.2955 0.3086 0.0068  0.0003  -0.0033 197 PRO A N   
96   C CA  . PRO A 28  ? 0.3289 0.3110 0.3249 0.0070  -0.0016 -0.0038 197 PRO A CA  
97   C C   . PRO A 28  ? 0.3326 0.3132 0.3284 0.0091  -0.0054 -0.0032 197 PRO A C   
98   O O   . PRO A 28  ? 0.3151 0.2920 0.3081 0.0109  -0.0057 -0.0031 197 PRO A O   
99   C CB  . PRO A 28  ? 0.3597 0.3446 0.3587 0.0084  0.0013  -0.0051 197 PRO A CB  
100  C CG  . PRO A 28  ? 0.3437 0.3260 0.3395 0.0077  0.0054  -0.0051 197 PRO A CG  
101  C CD  . PRO A 28  ? 0.3559 0.3336 0.3466 0.0081  0.0043  -0.0040 197 PRO A CD  
102  N N   A PHE A 29  ? 0.3267 0.3100 0.3251 0.0089  -0.0081 -0.0029 198 PHE A N   
103  N N   B PHE A 29  ? 0.3196 0.3030 0.3180 0.0088  -0.0081 -0.0028 198 PHE A N   
104  C CA  A PHE A 29  ? 0.3770 0.3577 0.3742 0.0104  -0.0117 -0.0018 198 PHE A CA  
105  C CA  B PHE A 29  ? 0.3542 0.3351 0.3517 0.0105  -0.0116 -0.0018 198 PHE A CA  
106  C C   A PHE A 29  ? 0.4065 0.3844 0.4035 0.0139  -0.0119 -0.0023 198 PHE A C   
107  C C   B PHE A 29  ? 0.3803 0.3581 0.3771 0.0139  -0.0116 -0.0024 198 PHE A C   
108  O O   A PHE A 29  ? 0.4042 0.3770 0.3977 0.0145  -0.0132 -0.0018 198 PHE A O   
109  O O   B PHE A 29  ? 0.3771 0.3499 0.3702 0.0143  -0.0124 -0.0020 198 PHE A O   
110  C CB  A PHE A 29  ? 0.3810 0.3657 0.3809 0.0100  -0.0144 -0.0011 198 PHE A CB  
111  C CB  B PHE A 29  ? 0.3464 0.3320 0.3475 0.0109  -0.0140 -0.0015 198 PHE A CB  
112  C CG  A PHE A 29  ? 0.4111 0.3981 0.4107 0.0062  -0.0144 -0.0008 198 PHE A CG  
113  C CG  B PHE A 29  ? 0.3799 0.3629 0.3805 0.0137  -0.0170 -0.0004 198 PHE A CG  
114  C CD1 A PHE A 29  ? 0.3838 0.3670 0.3792 0.0040  -0.0143 0.0000  198 PHE A CD1 
115  C CD1 B PHE A 29  ? 0.4098 0.3870 0.4062 0.0132  -0.0188 0.0008  198 PHE A CD1 
116  C CD2 A PHE A 29  ? 0.4184 0.4120 0.4219 0.0050  -0.0146 -0.0016 198 PHE A CD2 
117  C CD2 B PHE A 29  ? 0.4081 0.3945 0.4123 0.0168  -0.0178 -0.0007 198 PHE A CD2 
118  C CE1 A PHE A 29  ? 0.3780 0.3631 0.3728 0.0009  -0.0141 0.0001  198 PHE A CE1 
119  C CE1 B PHE A 29  ? 0.4081 0.3820 0.4036 0.0157  -0.0212 0.0019  198 PHE A CE1 
120  C CE2 A PHE A 29  ? 0.4661 0.4618 0.4690 0.0015  -0.0145 -0.0017 198 PHE A CE2 
121  C CE2 B PHE A 29  ? 0.4152 0.3984 0.4183 0.0198  -0.0203 0.0003  198 PHE A CE2 
122  C CZ  A PHE A 29  ? 0.3974 0.3883 0.3958 -0.0004 -0.0142 -0.0008 198 PHE A CZ  
123  C CZ  B PHE A 29  ? 0.4099 0.3864 0.4086 0.0191  -0.0219 0.0017  198 PHE A CZ  
124  N N   . LEU A 30  ? 0.3799 0.3610 0.3802 0.0162  -0.0105 -0.0034 199 LEU A N   
125  C CA  . LEU A 30  ? 0.4064 0.3849 0.4063 0.0197  -0.0106 -0.0041 199 LEU A CA  
126  C C   . LEU A 30  ? 0.3866 0.3612 0.3828 0.0197  -0.0085 -0.0049 199 LEU A C   
127  O O   . LEU A 30  ? 0.4707 0.4412 0.4646 0.0216  -0.0092 -0.0053 199 LEU A O   
128  C CB  . LEU A 30  ? 0.4351 0.4190 0.4399 0.0221  -0.0095 -0.0052 199 LEU A CB  
129  C CG  . LEU A 30  ? 0.4275 0.4110 0.4338 0.0260  -0.0115 -0.0051 199 LEU A CG  
130  C CD1 . LEU A 30  ? 0.4512 0.4355 0.4581 0.0258  -0.0148 -0.0035 199 LEU A CD1 
131  C CD2 . LEU A 30  ? 0.4204 0.4098 0.4313 0.0285  -0.0097 -0.0064 199 LEU A CD2 
132  N N   . VAL A 31  ? 0.3668 0.3427 0.3621 0.0177  -0.0059 -0.0050 200 VAL A N   
133  C CA  . VAL A 31  ? 0.3637 0.3368 0.3552 0.0181  -0.0038 -0.0054 200 VAL A CA  
134  C C   . VAL A 31  ? 0.3618 0.3307 0.3490 0.0169  -0.0057 -0.0048 200 VAL A C   
135  O O   . VAL A 31  ? 0.3147 0.2814 0.2987 0.0179  -0.0050 -0.0055 200 VAL A O   
136  C CB  . VAL A 31  ? 0.3841 0.3593 0.3755 0.0165  -0.0002 -0.0054 200 VAL A CB  
137  C CG1 . VAL A 31  ? 0.4097 0.3825 0.3967 0.0173  0.0019  -0.0055 200 VAL A CG1 
138  C CG2 . VAL A 31  ? 0.4491 0.4285 0.4449 0.0175  0.0018  -0.0063 200 VAL A CG2 
139  N N   . GLN A 32  ? 0.3564 0.3246 0.3434 0.0149  -0.0082 -0.0036 201 GLN A N   
140  C CA  . GLN A 32  ? 0.3172 0.2819 0.3003 0.0134  -0.0099 -0.0029 201 GLN A CA  
141  C C   . GLN A 32  ? 0.3092 0.2700 0.2907 0.0151  -0.0114 -0.0038 201 GLN A C   
142  O O   . GLN A 32  ? 0.3317 0.2905 0.3099 0.0146  -0.0113 -0.0043 201 GLN A O   
143  C CB  . GLN A 32  ? 0.3139 0.2785 0.2971 0.0110  -0.0123 -0.0013 201 GLN A CB  
144  C CG  . GLN A 32  ? 0.2951 0.2630 0.2792 0.0089  -0.0108 -0.0008 201 GLN A CG  
145  C CD  . GLN A 32  ? 0.3115 0.2796 0.2952 0.0065  -0.0129 0.0005  201 GLN A CD  
146  O OE1 . GLN A 32  ? 0.3078 0.2732 0.2897 0.0060  -0.0153 0.0014  201 GLN A OE1 
147  N NE2 . GLN A 32  ? 0.2868 0.2581 0.2720 0.0048  -0.0119 0.0006  201 GLN A NE2 
148  N N   . ARG A 33  ? 0.3531 0.3130 0.3368 0.0172  -0.0126 -0.0040 202 ARG A N   
149  C CA  . ARG A 33  ? 0.3757 0.3311 0.3578 0.0191  -0.0135 -0.0052 202 ARG A CA  
150  C C   . ARG A 33  ? 0.3520 0.3078 0.3328 0.0207  -0.0112 -0.0071 202 ARG A C   
151  O O   . ARG A 33  ? 0.3456 0.2984 0.3232 0.0205  -0.0115 -0.0083 202 ARG A O   
152  C CB  . ARG A 33  ? 0.3963 0.3513 0.3813 0.0217  -0.0147 -0.0049 202 ARG A CB  
153  C CG  . ARG A 33  ? 0.4151 0.3654 0.3989 0.0246  -0.0150 -0.0063 202 ARG A CG  
154  C CD  . ARG A 33  ? 0.4664 0.4099 0.4464 0.0233  -0.0168 -0.0063 202 ARG A CD  
155  N NE  . ARG A 33  ? 0.5366 0.4783 0.5166 0.0221  -0.0190 -0.0040 202 ARG A NE  
156  C CZ  . ARG A 33  ? 0.5273 0.4657 0.5077 0.0244  -0.0204 -0.0030 202 ARG A CZ  
157  N NH1 . ARG A 33  ? 0.5618 0.4980 0.5429 0.0281  -0.0199 -0.0042 202 ARG A NH1 
158  N NH2 . ARG A 33  ? 0.4955 0.4327 0.4754 0.0231  -0.0223 -0.0007 202 ARG A NH2 
159  N N   . THR A 34  ? 0.3599 0.3196 0.3430 0.0222  -0.0089 -0.0075 203 THR A N   
160  C CA  . THR A 34  ? 0.3495 0.3098 0.3313 0.0241  -0.0066 -0.0092 203 THR A CA  
161  C C   . THR A 34  ? 0.3274 0.2872 0.3050 0.0226  -0.0059 -0.0094 203 THR A C   
162  O O   . THR A 34  ? 0.3178 0.2759 0.2927 0.0236  -0.0059 -0.0109 203 THR A O   
163  C CB  . THR A 34  ? 0.3902 0.3551 0.3751 0.0254  -0.0037 -0.0092 203 THR A CB  
164  O OG1 . THR A 34  ? 0.3984 0.3649 0.3874 0.0268  -0.0046 -0.0091 203 THR A OG1 
165  C CG2 . THR A 34  ? 0.4438 0.4091 0.4271 0.0278  -0.0012 -0.0107 203 THR A CG2 
166  N N   . VAL A 35  ? 0.3245 0.2862 0.3016 0.0204  -0.0053 -0.0079 204 VAL A N   
167  C CA  . VAL A 35  ? 0.3051 0.2672 0.2783 0.0195  -0.0045 -0.0079 204 VAL A CA  
168  C C   . VAL A 35  ? 0.3173 0.2768 0.2881 0.0179  -0.0071 -0.0084 204 VAL A C   
169  O O   . VAL A 35  ? 0.3067 0.2663 0.2743 0.0181  -0.0069 -0.0096 204 VAL A O   
170  C CB  . VAL A 35  ? 0.3682 0.3324 0.3413 0.0178  -0.0030 -0.0062 204 VAL A CB  
171  C CG1 . VAL A 35  ? 0.3779 0.3425 0.3468 0.0168  -0.0028 -0.0058 204 VAL A CG1 
172  C CG2 . VAL A 35  ? 0.3784 0.3448 0.3529 0.0193  0.0004  -0.0062 204 VAL A CG2 
173  N N   . ALA A 36  ? 0.3123 0.2693 0.2843 0.0163  -0.0096 -0.0075 205 ALA A N   
174  C CA  . ALA A 36  ? 0.3105 0.2645 0.2800 0.0142  -0.0118 -0.0078 205 ALA A CA  
175  C C   . ALA A 36  ? 0.3526 0.3038 0.3205 0.0155  -0.0121 -0.0102 205 ALA A C   
176  O O   . ALA A 36  ? 0.3450 0.2957 0.3100 0.0140  -0.0127 -0.0114 205 ALA A O   
177  C CB  . ALA A 36  ? 0.3294 0.2807 0.3002 0.0126  -0.0140 -0.0062 205 ALA A CB  
178  N N   . ARG A 37  ? 0.3422 0.2919 0.3120 0.0182  -0.0117 -0.0111 206 ARG A N   
179  C CA  . ARG A 37  ? 0.4034 0.3501 0.3715 0.0197  -0.0118 -0.0136 206 ARG A CA  
180  C C   . ARG A 37  ? 0.3951 0.3451 0.3611 0.0210  -0.0098 -0.0154 206 ARG A C   
181  O O   . ARG A 37  ? 0.3889 0.3372 0.3527 0.0215  -0.0100 -0.0178 206 ARG A O   
182  C CB  . ARG A 37  ? 0.4092 0.3534 0.3797 0.0227  -0.0117 -0.0140 206 ARG A CB  
183  C CG  . ARG A 37  ? 0.4752 0.4160 0.4474 0.0221  -0.0137 -0.0121 206 ARG A CG  
184  C CD  . ARG A 37  ? 0.5189 0.4553 0.4883 0.0188  -0.0157 -0.0117 206 ARG A CD  
185  N NE  . ARG A 37  ? 0.5014 0.4346 0.4719 0.0185  -0.0174 -0.0095 206 ARG A NE  
186  C CZ  . ARG A 37  ? 0.5616 0.4896 0.5322 0.0206  -0.0182 -0.0096 206 ARG A CZ  
187  N NH1 . ARG A 37  ? 0.5818 0.5069 0.5517 0.0232  -0.0173 -0.0118 206 ARG A NH1 
188  N NH2 . ARG A 37  ? 0.5477 0.4732 0.5189 0.0206  -0.0197 -0.0072 206 ARG A NH2 
189  N N   . GLN A 38  ? 0.3561 0.3108 0.3226 0.0218  -0.0078 -0.0143 207 GLN A N   
190  C CA  . GLN A 38  ? 0.3536 0.3117 0.3176 0.0234  -0.0058 -0.0156 207 GLN A CA  
191  C C   . GLN A 38  ? 0.3806 0.3411 0.3412 0.0214  -0.0063 -0.0156 207 GLN A C   
192  O O   . GLN A 38  ? 0.4309 0.3947 0.3889 0.0229  -0.0049 -0.0166 207 GLN A O   
193  C CB  . GLN A 38  ? 0.3732 0.3345 0.3389 0.0254  -0.0029 -0.0142 207 GLN A CB  
194  C CG  . GLN A 38  ? 0.3785 0.3389 0.3473 0.0279  -0.0021 -0.0148 207 GLN A CG  
195  C CD  . GLN A 38  ? 0.4274 0.3910 0.3986 0.0290  0.0006  -0.0134 207 GLN A CD  
196  O OE1 . GLN A 38  ? 0.4250 0.3903 0.3958 0.0276  0.0018  -0.0117 207 GLN A OE1 
197  N NE2 . GLN A 38  ? 0.4200 0.3842 0.3937 0.0314  0.0019  -0.0141 207 GLN A NE2 
198  N N   . ILE A 39  ? 0.3813 0.3405 0.3419 0.0183  -0.0083 -0.0146 208 ILE A N   
199  C CA  . ILE A 39  ? 0.3613 0.3236 0.3192 0.0163  -0.0087 -0.0144 208 ILE A CA  
200  C C   . ILE A 39  ? 0.3564 0.3181 0.3119 0.0150  -0.0102 -0.0172 208 ILE A C   
201  O O   . ILE A 39  ? 0.4196 0.3764 0.3757 0.0138  -0.0117 -0.0184 208 ILE A O   
202  C CB  . ILE A 39  ? 0.3266 0.2882 0.2854 0.0133  -0.0100 -0.0121 208 ILE A CB  
203  C CG1 . ILE A 39  ? 0.3643 0.3280 0.3244 0.0142  -0.0082 -0.0097 208 ILE A CG1 
204  C CG2 . ILE A 39  ? 0.3272 0.2917 0.2834 0.0109  -0.0110 -0.0124 208 ILE A CG2 
205  C CD1 . ILE A 39  ? 0.3629 0.3254 0.3244 0.0115  -0.0095 -0.0076 208 ILE A CD1 
206  N N   . THR A 40  ? 0.3736 0.3403 0.3263 0.0152  -0.0097 -0.0183 209 THR A N   
207  C CA  . THR A 40  ? 0.3897 0.3575 0.3402 0.0130  -0.0113 -0.0210 209 THR A CA  
208  C C   . THR A 40  ? 0.3777 0.3488 0.3272 0.0099  -0.0124 -0.0200 209 THR A C   
209  O O   . THR A 40  ? 0.3907 0.3670 0.3393 0.0111  -0.0112 -0.0183 209 THR A O   
210  C CB  . THR A 40  ? 0.4424 0.4153 0.3901 0.0157  -0.0100 -0.0233 209 THR A CB  
211  O OG1 . THR A 40  ? 0.4426 0.4133 0.3910 0.0191  -0.0085 -0.0239 209 THR A OG1 
212  C CG2 . THR A 40  ? 0.4250 0.3992 0.3706 0.0133  -0.0117 -0.0269 209 THR A CG2 
213  N N   . LEU A 41  ? 0.3502 0.3183 0.2998 0.0060  -0.0143 -0.0209 210 LEU A N   
214  C CA  . LEU A 41  ? 0.3732 0.3447 0.3220 0.0026  -0.0154 -0.0204 210 LEU A CA  
215  C C   . LEU A 41  ? 0.4353 0.4140 0.3816 0.0022  -0.0156 -0.0231 210 LEU A C   
216  O O   . LEU A 41  ? 0.3996 0.3776 0.3448 0.0018  -0.0160 -0.0264 210 LEU A O   
217  C CB  . LEU A 41  ? 0.4120 0.3773 0.3616 -0.0015 -0.0172 -0.0206 210 LEU A CB  
218  C CG  . LEU A 41  ? 0.4346 0.3932 0.3864 -0.0011 -0.0175 -0.0180 210 LEU A CG  
219  C CD1 . LEU A 41  ? 0.4624 0.4147 0.4141 -0.0050 -0.0191 -0.0181 210 LEU A CD1 
220  C CD2 . LEU A 41  ? 0.4651 0.4268 0.4181 -0.0002 -0.0168 -0.0147 210 LEU A CD2 
221  N N   . LEU A 42  ? 0.4370 0.4227 0.3824 0.0022  -0.0153 -0.0218 211 LEU A N   
222  C CA  . LEU A 42  ? 0.4649 0.4591 0.4079 0.0025  -0.0154 -0.0240 211 LEU A CA  
223  C C   . LEU A 42  ? 0.5255 0.5240 0.4683 -0.0018 -0.0169 -0.0248 211 LEU A C   
224  O O   . LEU A 42  ? 0.6075 0.6088 0.5494 -0.0043 -0.0180 -0.0282 211 LEU A O   
225  C CB  . LEU A 42  ? 0.4526 0.4528 0.3941 0.0073  -0.0134 -0.0220 211 LEU A CB  
226  C CG  . LEU A 42  ? 0.4793 0.4762 0.4207 0.0116  -0.0114 -0.0214 211 LEU A CG  
227  C CD1 . LEU A 42  ? 0.5020 0.5033 0.4417 0.0161  -0.0090 -0.0189 211 LEU A CD1 
228  C CD2 . LEU A 42  ? 0.5323 0.5295 0.4725 0.0126  -0.0117 -0.0251 211 LEU A CD2 
229  N N   . GLU A 43  ? 0.5096 0.5090 0.4532 -0.0029 -0.0170 -0.0218 212 GLU A N   
230  C CA  . GLU A 43  ? 0.5225 0.5265 0.4660 -0.0073 -0.0183 -0.0225 212 GLU A CA  
231  C C   . GLU A 43  ? 0.4951 0.4953 0.4401 -0.0094 -0.0185 -0.0193 212 GLU A C   
232  O O   . GLU A 43  ? 0.4783 0.4763 0.4238 -0.0067 -0.0174 -0.0162 212 GLU A O   
233  C CB  . GLU A 43  ? 0.5926 0.6082 0.5343 -0.0054 -0.0179 -0.0230 212 GLU A CB  
234  C CG  . GLU A 43  ? 0.7082 0.7264 0.6488 0.0000  -0.0158 -0.0198 212 GLU A CG  
235  C CD  . GLU A 43  ? 0.7891 0.8185 0.7276 0.0023  -0.0153 -0.0197 212 GLU A CD  
236  O OE1 . GLU A 43  ? 0.9246 0.9611 0.8627 -0.0001 -0.0167 -0.0225 212 GLU A OE1 
237  O OE2 . GLU A 43  ? 0.6946 0.7258 0.6318 0.0066  -0.0134 -0.0167 212 GLU A OE2 
238  N N   . CYS A 44  ? 0.4523 0.4516 0.3978 -0.0145 -0.0199 -0.0202 213 CYS A N   
239  C CA  . CYS A 44  ? 0.4749 0.4716 0.4213 -0.0170 -0.0203 -0.0174 213 CYS A CA  
240  C C   . CYS A 44  ? 0.5281 0.5339 0.4738 -0.0159 -0.0197 -0.0158 213 CYS A C   
241  O O   . CYS A 44  ? 0.4326 0.4468 0.3776 -0.0169 -0.0200 -0.0178 213 CYS A O   
242  C CB  . CYS A 44  ? 0.4623 0.4557 0.4090 -0.0229 -0.0216 -0.0190 213 CYS A CB  
243  S SG  . CYS A 44  ? 0.5361 0.5254 0.4837 -0.0259 -0.0219 -0.0153 213 CYS A SG  
244  N N   . VAL A 45  ? 0.4795 0.4840 0.4255 -0.0137 -0.0188 -0.0123 214 VAL A N   
245  C CA  . VAL A 45  ? 0.4448 0.4571 0.3898 -0.0124 -0.0180 -0.0106 214 VAL A CA  
246  C C   . VAL A 45  ? 0.4775 0.4886 0.4231 -0.0158 -0.0185 -0.0085 214 VAL A C   
247  O O   . VAL A 45  ? 0.5426 0.5597 0.4874 -0.0150 -0.0179 -0.0070 214 VAL A O   
248  C CB  . VAL A 45  ? 0.4550 0.4677 0.3989 -0.0068 -0.0159 -0.0084 214 VAL A CB  
249  C CG1 . VAL A 45  ? 0.4596 0.4760 0.4022 -0.0032 -0.0151 -0.0103 214 VAL A CG1 
250  C CG2 . VAL A 45  ? 0.4565 0.4601 0.4017 -0.0061 -0.0154 -0.0063 214 VAL A CG2 
251  N N   . GLY A 46  ? 0.4835 0.4867 0.4303 -0.0192 -0.0196 -0.0082 215 GLY A N   
252  C CA  . GLY A 46  ? 0.4783 0.4797 0.4256 -0.0224 -0.0201 -0.0061 215 GLY A CA  
253  C C   . GLY A 46  ? 0.5724 0.5656 0.5204 -0.0265 -0.0213 -0.0067 215 GLY A C   
254  O O   . GLY A 46  ? 0.5267 0.5131 0.4752 -0.0255 -0.0216 -0.0075 215 GLY A O   
255  N N   . LYS A 47  ? 0.6151 0.6088 0.5630 -0.0310 -0.0219 -0.0062 216 LYS A N   
256  C CA  . LYS A 47  ? 0.6916 0.6773 0.6395 -0.0352 -0.0228 -0.0065 216 LYS A CA  
257  C C   . LYS A 47  ? 0.7110 0.6964 0.6587 -0.0382 -0.0229 -0.0039 216 LYS A C   
258  O O   . LYS A 47  ? 0.6927 0.6862 0.6402 -0.0390 -0.0226 -0.0035 216 LYS A O   
259  C CB  . LYS A 47  ? 0.7395 0.7268 0.6872 -0.0387 -0.0231 -0.0103 216 LYS A CB  
260  C CG  . LYS A 47  ? 0.9781 0.9550 0.9253 -0.0424 -0.0236 -0.0111 216 LYS A CG  
261  C CD  . LYS A 47  ? 0.8551 0.8321 0.8019 -0.0448 -0.0237 -0.0155 216 LYS A CD  
262  N N   . GLY A 48  ? 0.7168 0.6933 0.6643 -0.0395 -0.0234 -0.0020 217 GLY A N   
263  C CA  . GLY A 48  ? 0.7335 0.7088 0.6802 -0.0421 -0.0235 0.0007  217 GLY A CA  
264  C C   . GLY A 48  ? 0.7111 0.6755 0.6572 -0.0434 -0.0240 0.0022  217 GLY A C   
265  O O   . GLY A 48  ? 0.6896 0.6476 0.6357 -0.0429 -0.0242 0.0007  217 GLY A O   
266  N N   . ARG A 49  ? 0.8468 0.8089 0.7920 -0.0449 -0.0242 0.0051  218 ARG A N   
267  C CA  . ARG A 49  ? 0.9237 0.8757 0.8678 -0.0454 -0.0247 0.0072  218 ARG A CA  
268  C C   . ARG A 49  ? 0.7665 0.7148 0.7116 -0.0403 -0.0252 0.0083  218 ARG A C   
269  O O   . ARG A 49  ? 0.6769 0.6171 0.6215 -0.0395 -0.0257 0.0091  218 ARG A O   
270  C CB  . ARG A 49  ? 0.8671 0.8185 0.8097 -0.0481 -0.0246 0.0103  218 ARG A CB  
271  N N   . TYR A 50  ? 0.7963 0.7508 0.7427 -0.0370 -0.0250 0.0083  219 TYR A N   
272  C CA  . TYR A 50  ? 0.7279 0.6802 0.6756 -0.0325 -0.0253 0.0088  219 TYR A CA  
273  C C   . TYR A 50  ? 0.6228 0.5709 0.5714 -0.0307 -0.0253 0.0066  219 TYR A C   
274  O O   . TYR A 50  ? 0.6071 0.5513 0.5566 -0.0276 -0.0257 0.0072  219 TYR A O   
275  C CB  . TYR A 50  ? 0.6543 0.6138 0.6029 -0.0297 -0.0245 0.0089  219 TYR A CB  
276  C CG  . TYR A 50  ? 0.6958 0.6621 0.6445 -0.0293 -0.0235 0.0065  219 TYR A CG  
277  C CD1 . TYR A 50  ? 0.5997 0.5661 0.5493 -0.0269 -0.0231 0.0043  219 TYR A CD1 
278  C CD2 . TYR A 50  ? 0.7535 0.7264 0.7013 -0.0313 -0.0230 0.0065  219 TYR A CD2 
279  C CE1 . TYR A 50  ? 0.6400 0.6129 0.5894 -0.0262 -0.0223 0.0022  219 TYR A CE1 
280  C CE2 . TYR A 50  ? 0.8280 0.8079 0.7758 -0.0305 -0.0222 0.0044  219 TYR A CE2 
281  C CZ  . TYR A 50  ? 0.6787 0.6584 0.6271 -0.0279 -0.0219 0.0023  219 TYR A CZ  
282  O OH  . TYR A 50  ? 0.6991 0.6860 0.6472 -0.0268 -0.0212 0.0003  219 TYR A OH  
283  N N   . GLY A 51  ? 0.5415 0.4906 0.4896 -0.0326 -0.0249 0.0038  220 GLY A N   
284  C CA  . GLY A 51  ? 0.4964 0.4432 0.4452 -0.0307 -0.0248 0.0012  220 GLY A CA  
285  C C   . GLY A 51  ? 0.5430 0.4980 0.4921 -0.0302 -0.0241 -0.0012 220 GLY A C   
286  O O   . GLY A 51  ? 0.5452 0.5056 0.4937 -0.0331 -0.0239 -0.0020 220 GLY A O   
287  N N   . GLU A 52  ? 0.5149 0.4712 0.4650 -0.0264 -0.0236 -0.0025 221 GLU A N   
288  C CA  . GLU A 52  ? 0.4651 0.4290 0.4151 -0.0252 -0.0228 -0.0048 221 GLU A CA  
289  C C   . GLU A 52  ? 0.4390 0.4059 0.3899 -0.0205 -0.0218 -0.0039 221 GLU A C   
290  O O   . GLU A 52  ? 0.4641 0.4265 0.4161 -0.0182 -0.0218 -0.0028 221 GLU A O   
291  C CB  . GLU A 52  ? 0.5755 0.5373 0.5251 -0.0257 -0.0229 -0.0082 221 GLU A CB  
292  C CG  . GLU A 52  ? 0.6744 0.6332 0.6229 -0.0309 -0.0235 -0.0098 221 GLU A CG  
293  C CD  . GLU A 52  ? 0.7433 0.6988 0.6911 -0.0315 -0.0234 -0.0135 221 GLU A CD  
294  O OE1 . GLU A 52  ? 0.7030 0.6548 0.6512 -0.0279 -0.0232 -0.0141 221 GLU A OE1 
295  O OE2 . GLU A 52  ? 0.9000 0.8567 0.8468 -0.0358 -0.0236 -0.0159 221 GLU A OE2 
296  N N   . VAL A 53  ? 0.4121 0.3867 0.3624 -0.0191 -0.0209 -0.0043 222 VAL A N   
297  C CA  . VAL A 53  ? 0.4096 0.3868 0.3602 -0.0146 -0.0195 -0.0040 222 VAL A CA  
298  C C   . VAL A 53  ? 0.4418 0.4230 0.3915 -0.0129 -0.0189 -0.0068 222 VAL A C   
299  O O   . VAL A 53  ? 0.4441 0.4310 0.3927 -0.0146 -0.0192 -0.0084 222 VAL A O   
300  C CB  . VAL A 53  ? 0.3588 0.3411 0.3086 -0.0132 -0.0183 -0.0020 222 VAL A CB  
301  C CG1 . VAL A 53  ? 0.3476 0.3309 0.2973 -0.0087 -0.0164 -0.0017 222 VAL A CG1 
302  C CG2 . VAL A 53  ? 0.3608 0.3397 0.3111 -0.0149 -0.0189 0.0004  222 VAL A CG2 
303  N N   . TRP A 54  ? 0.4059 0.3845 0.3562 -0.0097 -0.0181 -0.0075 223 TRP A N   
304  C CA  . TRP A 54  ? 0.4012 0.3830 0.3506 -0.0077 -0.0175 -0.0101 223 TRP A CA  
305  C C   . TRP A 54  ? 0.3718 0.3568 0.3205 -0.0031 -0.0155 -0.0091 223 TRP A C   
306  O O   . TRP A 54  ? 0.4115 0.3935 0.3613 -0.0014 -0.0145 -0.0071 223 TRP A O   
307  C CB  . TRP A 54  ? 0.3968 0.3723 0.3469 -0.0076 -0.0181 -0.0121 223 TRP A CB  
308  C CG  . TRP A 54  ? 0.4422 0.4147 0.3919 -0.0118 -0.0196 -0.0141 223 TRP A CG  
309  C CD1 . TRP A 54  ? 0.4729 0.4406 0.4231 -0.0153 -0.0207 -0.0128 223 TRP A CD1 
310  C CD2 . TRP A 54  ? 0.4722 0.4459 0.4208 -0.0131 -0.0200 -0.0178 223 TRP A CD2 
311  N NE1 . TRP A 54  ? 0.5123 0.4775 0.4615 -0.0189 -0.0216 -0.0154 223 TRP A NE1 
312  C CE2 . TRP A 54  ? 0.5209 0.4899 0.4692 -0.0178 -0.0212 -0.0186 223 TRP A CE2 
313  C CE3 . TRP A 54  ? 0.4906 0.4691 0.4379 -0.0109 -0.0195 -0.0205 223 TRP A CE3 
314  C CZ2 . TRP A 54  ? 0.5584 0.5268 0.5055 -0.0208 -0.0217 -0.0224 223 TRP A CZ2 
315  C CZ3 . TRP A 54  ? 0.5363 0.5150 0.4824 -0.0137 -0.0202 -0.0243 223 TRP A CZ3 
316  C CH2 . TRP A 54  ? 0.4918 0.4652 0.4379 -0.0187 -0.0213 -0.0254 223 TRP A CH2 
317  N N   . ARG A 55  ? 0.3555 0.3466 0.3024 -0.0011 -0.0147 -0.0107 224 ARG A N   
318  C CA  . ARG A 55  ? 0.3585 0.3512 0.3045 0.0035  -0.0126 -0.0102 224 ARG A CA  
319  C C   . ARG A 55  ? 0.3787 0.3674 0.3253 0.0047  -0.0125 -0.0122 224 ARG A C   
320  O O   . ARG A 55  ? 0.3695 0.3585 0.3159 0.0031  -0.0138 -0.0150 224 ARG A O   
321  C CB  . ARG A 55  ? 0.3800 0.3813 0.3233 0.0056  -0.0117 -0.0109 224 ARG A CB  
322  C CG  . ARG A 55  ? 0.4358 0.4385 0.3773 0.0108  -0.0092 -0.0101 224 ARG A CG  
323  C CD  . ARG A 55  ? 0.5442 0.5559 0.4826 0.0132  -0.0086 -0.0107 224 ARG A CD  
324  N NE  . ARG A 55  ? 0.6241 0.6375 0.5606 0.0176  -0.0069 -0.0114 224 ARG A NE  
325  C CZ  . ARG A 55  ? 0.7062 0.7268 0.6403 0.0193  -0.0071 -0.0134 224 ARG A CZ  
326  N NH1 . ARG A 55  ? 0.7345 0.7618 0.6684 0.0167  -0.0092 -0.0151 224 ARG A NH1 
327  N NH2 . ARG A 55  ? 0.8736 0.8950 0.8057 0.0236  -0.0054 -0.0137 224 ARG A NH2 
328  N N   . GLY A 56  ? 0.3393 0.3247 0.2869 0.0076  -0.0109 -0.0109 225 GLY A N   
329  C CA  . GLY A 56  ? 0.3286 0.3105 0.2771 0.0093  -0.0105 -0.0125 225 GLY A CA  
330  C C   . GLY A 56  ? 0.3434 0.3269 0.2909 0.0137  -0.0077 -0.0117 225 GLY A C   
331  O O   . GLY A 56  ? 0.3437 0.3298 0.2898 0.0153  -0.0060 -0.0096 225 GLY A O   
332  N N   . SER A 57  ? 0.3558 0.3372 0.3037 0.0157  -0.0071 -0.0132 226 SER A N   
333  C CA  . SER A 57  ? 0.3582 0.3409 0.3051 0.0198  -0.0042 -0.0124 226 SER A CA  
334  C C   . SER A 57  ? 0.3448 0.3227 0.2945 0.0208  -0.0033 -0.0123 226 SER A C   
335  O O   . SER A 57  ? 0.3902 0.3649 0.3412 0.0199  -0.0049 -0.0142 226 SER A O   
336  C CB  . SER A 57  ? 0.3767 0.3643 0.3203 0.0222  -0.0038 -0.0146 226 SER A CB  
337  O OG  . SER A 57  ? 0.3779 0.3660 0.3204 0.0263  -0.0008 -0.0139 226 SER A OG  
338  N N   . TRP A 58  ? 0.3566 0.3337 0.3069 0.0226  -0.0007 -0.0103 227 TRP A N   
339  C CA  . TRP A 58  ? 0.3831 0.3573 0.3361 0.0239  0.0006  -0.0102 227 TRP A CA  
340  C C   . TRP A 58  ? 0.3623 0.3385 0.3131 0.0277  0.0041  -0.0098 227 TRP A C   
341  O O   . TRP A 58  ? 0.3423 0.3196 0.2914 0.0286  0.0064  -0.0078 227 TRP A O   
342  C CB  . TRP A 58  ? 0.3611 0.3326 0.3173 0.0221  0.0007  -0.0082 227 TRP A CB  
343  C CG  . TRP A 58  ? 0.3714 0.3410 0.3308 0.0233  0.0021  -0.0083 227 TRP A CG  
344  C CD1 . TRP A 58  ? 0.3753 0.3428 0.3374 0.0231  0.0004  -0.0096 227 TRP A CD1 
345  C CD2 . TRP A 58  ? 0.3754 0.3455 0.3354 0.0250  0.0056  -0.0072 227 TRP A CD2 
346  N NE1 . TRP A 58  ? 0.4071 0.3745 0.3719 0.0247  0.0024  -0.0094 227 TRP A NE1 
347  C CE2 . TRP A 58  ? 0.3866 0.3556 0.3503 0.0256  0.0057  -0.0081 227 TRP A CE2 
348  C CE3 . TRP A 58  ? 0.4009 0.3720 0.3586 0.0260  0.0089  -0.0056 227 TRP A CE3 
349  C CZ2 . TRP A 58  ? 0.3744 0.3438 0.3398 0.0267  0.0088  -0.0075 227 TRP A CZ2 
350  C CZ3 . TRP A 58  ? 0.4045 0.3750 0.3636 0.0271  0.0122  -0.0049 227 TRP A CZ3 
351  C CH2 . TRP A 58  ? 0.4295 0.3995 0.3926 0.0272  0.0122  -0.0060 227 TRP A CH2 
352  N N   . GLN A 59  ? 0.4127 0.3891 0.3633 0.0299  0.0046  -0.0116 228 GLN A N   
353  C CA  . GLN A 59  ? 0.3832 0.3615 0.3314 0.0337  0.0081  -0.0113 228 GLN A CA  
354  C C   . GLN A 59  ? 0.3637 0.3456 0.3073 0.0355  0.0097  -0.0099 228 GLN A C   
355  O O   . GLN A 59  ? 0.3751 0.3569 0.3170 0.0376  0.0131  -0.0078 228 GLN A O   
356  C CB  . GLN A 59  ? 0.4177 0.3936 0.3686 0.0344  0.0109  -0.0099 228 GLN A CB  
357  C CG  . GLN A 59  ? 0.5422 0.5157 0.4974 0.0334  0.0092  -0.0114 228 GLN A CG  
358  C CD  . GLN A 59  ? 0.6280 0.6005 0.5865 0.0341  0.0118  -0.0105 228 GLN A CD  
359  O OE1 . GLN A 59  ? 0.6267 0.5996 0.5844 0.0349  0.0153  -0.0088 228 GLN A OE1 
360  N NE2 . GLN A 59  ? 0.7119 0.6830 0.6741 0.0338  0.0103  -0.0118 228 GLN A NE2 
361  N N   . GLY A 60  ? 0.3641 0.3493 0.3057 0.0346  0.0072  -0.0111 229 GLY A N   
362  C CA  . GLY A 60  ? 0.3994 0.3892 0.3367 0.0367  0.0083  -0.0101 229 GLY A CA  
363  C C   . GLY A 60  ? 0.4367 0.4265 0.3735 0.0355  0.0088  -0.0074 229 GLY A C   
364  O O   . GLY A 60  ? 0.3805 0.3742 0.3135 0.0378  0.0100  -0.0063 229 GLY A O   
365  N N   . GLU A 61  ? 0.3838 0.3695 0.3241 0.0322  0.0080  -0.0065 230 GLU A N   
366  C CA  . GLU A 61  ? 0.4167 0.4025 0.3563 0.0309  0.0083  -0.0043 230 GLU A CA  
367  C C   . GLU A 61  ? 0.3620 0.3475 0.3038 0.0268  0.0047  -0.0049 230 GLU A C   
368  O O   . GLU A 61  ? 0.4053 0.3878 0.3506 0.0242  0.0026  -0.0060 230 GLU A O   
369  C CB  . GLU A 61  ? 0.4387 0.4202 0.3790 0.0312  0.0115  -0.0020 230 GLU A CB  
370  C CG  . GLU A 61  ? 0.5865 0.5639 0.5315 0.0288  0.0111  -0.0024 230 GLU A CG  
371  C CD  . GLU A 61  ? 0.6226 0.5966 0.5680 0.0289  0.0147  -0.0004 230 GLU A CD  
372  O OE1 . GLU A 61  ? 0.6143 0.5873 0.5589 0.0276  0.0153  0.0010  230 GLU A OE1 
373  O OE2 . GLU A 61  ? 0.4806 0.4531 0.4273 0.0301  0.0170  -0.0007 230 GLU A OE2 
374  N N   . ASN A 62  ? 0.3693 0.3584 0.3090 0.0263  0.0040  -0.0041 231 ASN A N   
375  C CA  . ASN A 62  ? 0.3554 0.3448 0.2968 0.0223  0.0010  -0.0044 231 ASN A CA  
376  C C   . ASN A 62  ? 0.3477 0.3319 0.2924 0.0194  0.0005  -0.0031 231 ASN A C   
377  O O   . ASN A 62  ? 0.3004 0.2819 0.2452 0.0204  0.0030  -0.0015 231 ASN A O   
378  C CB  . ASN A 62  ? 0.3757 0.3700 0.3142 0.0229  0.0012  -0.0032 231 ASN A CB  
379  C CG  . ASN A 62  ? 0.4527 0.4539 0.3885 0.0246  0.0004  -0.0048 231 ASN A CG  
380  O OD1 . ASN A 62  ? 0.4437 0.4462 0.3806 0.0231  -0.0017 -0.0075 231 ASN A OD1 
381  N ND2 . ASN A 62  ? 0.3870 0.3930 0.3193 0.0278  0.0022  -0.0034 231 ASN A ND2 
382  N N   . VAL A 63  ? 0.3006 0.2832 0.2476 0.0159  -0.0025 -0.0041 232 VAL A N   
383  C CA  . VAL A 63  ? 0.3147 0.2935 0.2644 0.0130  -0.0036 -0.0029 232 VAL A CA  
384  C C   . VAL A 63  ? 0.3104 0.2904 0.2601 0.0096  -0.0066 -0.0034 232 VAL A C   
385  O O   . VAL A 63  ? 0.3166 0.2995 0.2652 0.0093  -0.0078 -0.0052 232 VAL A O   
386  C CB  . VAL A 63  ? 0.3231 0.2976 0.2763 0.0125  -0.0042 -0.0035 232 VAL A CB  
387  C CG1 . VAL A 63  ? 0.3384 0.3120 0.2919 0.0153  -0.0011 -0.0030 232 VAL A CG1 
388  C CG2 . VAL A 63  ? 0.3478 0.3213 0.3015 0.0122  -0.0061 -0.0058 232 VAL A CG2 
389  N N   . ALA A 64  ? 0.3008 0.2790 0.2518 0.0071  -0.0076 -0.0020 233 ALA A N   
390  C CA  . ALA A 64  ? 0.2892 0.2675 0.2405 0.0036  -0.0102 -0.0022 233 ALA A CA  
391  C C   . ALA A 64  ? 0.3185 0.2914 0.2724 0.0016  -0.0121 -0.0025 233 ALA A C   
392  O O   . ALA A 64  ? 0.3150 0.2851 0.2709 0.0022  -0.0116 -0.0015 233 ALA A O   
393  C CB  . ALA A 64  ? 0.2814 0.2614 0.2316 0.0022  -0.0101 -0.0003 233 ALA A CB  
394  N N   . VAL A 65  ? 0.3335 0.3052 0.2874 -0.0006 -0.0142 -0.0038 234 VAL A N   
395  C CA  . VAL A 65  ? 0.3133 0.2795 0.2691 -0.0020 -0.0158 -0.0038 234 VAL A CA  
396  C C   . VAL A 65  ? 0.3369 0.3022 0.2920 -0.0058 -0.0176 -0.0032 234 VAL A C   
397  O O   . VAL A 65  ? 0.3450 0.3121 0.2986 -0.0077 -0.0183 -0.0046 234 VAL A O   
398  C CB  . VAL A 65  ? 0.3068 0.2704 0.2626 -0.0012 -0.0163 -0.0063 234 VAL A CB  
399  C CG1 . VAL A 65  ? 0.3430 0.3001 0.3003 -0.0024 -0.0179 -0.0061 234 VAL A CG1 
400  C CG2 . VAL A 65  ? 0.3423 0.3071 0.2986 0.0024  -0.0144 -0.0070 234 VAL A CG2 
401  N N   . LYS A 66  ? 0.3686 0.3314 0.3246 -0.0070 -0.0184 -0.0010 235 LYS A N   
402  C CA  . LYS A 66  ? 0.3727 0.3337 0.3281 -0.0104 -0.0200 -0.0001 235 LYS A CA  
403  C C   . LYS A 66  ? 0.3689 0.3232 0.3251 -0.0110 -0.0213 -0.0003 235 LYS A C   
404  O O   . LYS A 66  ? 0.3560 0.3075 0.3139 -0.0089 -0.0214 0.0004  235 LYS A O   
405  C CB  . LYS A 66  ? 0.4200 0.3821 0.3755 -0.0111 -0.0200 0.0023  235 LYS A CB  
406  C CG  . LYS A 66  ? 0.4167 0.3771 0.3712 -0.0146 -0.0215 0.0035  235 LYS A CG  
407  C CD  . LYS A 66  ? 0.5064 0.4698 0.4603 -0.0153 -0.0211 0.0055  235 LYS A CD  
408  C CE  . LYS A 66  ? 0.5778 0.5391 0.5307 -0.0186 -0.0225 0.0071  235 LYS A CE  
409  N NZ  . LYS A 66  ? 0.7029 0.6671 0.6550 -0.0190 -0.0221 0.0089  235 LYS A NZ  
410  N N   . ILE A 67  ? 0.3833 0.3351 0.3381 -0.0136 -0.0222 -0.0014 236 ILE A N   
411  C CA  . ILE A 67  ? 0.4070 0.3514 0.3617 -0.0143 -0.0232 -0.0018 236 ILE A CA  
412  C C   . ILE A 67  ? 0.4276 0.3694 0.3811 -0.0176 -0.0242 0.0001  236 ILE A C   
413  O O   . ILE A 67  ? 0.4353 0.3796 0.3875 -0.0208 -0.0242 -0.0002 236 ILE A O   
414  C CB  . ILE A 67  ? 0.4135 0.3564 0.3671 -0.0152 -0.0230 -0.0049 236 ILE A CB  
415  C CG1 . ILE A 67  ? 0.4641 0.4110 0.4183 -0.0119 -0.0218 -0.0069 236 ILE A CG1 
416  C CG2 . ILE A 67  ? 0.4026 0.3367 0.3557 -0.0153 -0.0236 -0.0053 236 ILE A CG2 
417  C CD1 . ILE A 67  ? 0.5333 0.4793 0.4862 -0.0125 -0.0217 -0.0104 236 ILE A CD1 
418  N N   . PHE A 68  ? 0.4905 0.4281 0.4447 -0.0167 -0.0249 0.0024  237 PHE A N   
419  C CA  . PHE A 68  ? 0.5039 0.4397 0.4567 -0.0193 -0.0258 0.0049  237 PHE A CA  
420  C C   . PHE A 68  ? 0.5338 0.4623 0.4847 -0.0219 -0.0262 0.0046  237 PHE A C   
421  O O   . PHE A 68  ? 0.4323 0.3550 0.3831 -0.0203 -0.0262 0.0036  237 PHE A O   
422  C CB  . PHE A 68  ? 0.4473 0.3821 0.4014 -0.0171 -0.0265 0.0075  237 PHE A CB  
423  C CG  . PHE A 68  ? 0.4271 0.3685 0.3825 -0.0161 -0.0260 0.0082  237 PHE A CG  
424  C CD1 . PHE A 68  ? 0.3797 0.3246 0.3369 -0.0133 -0.0249 0.0068  237 PHE A CD1 
425  C CD2 . PHE A 68  ? 0.3987 0.3424 0.3532 -0.0178 -0.0264 0.0103  237 PHE A CD2 
426  C CE1 . PHE A 68  ? 0.3902 0.3400 0.3482 -0.0125 -0.0241 0.0074  237 PHE A CE1 
427  C CE2 . PHE A 68  ? 0.3970 0.3459 0.3523 -0.0169 -0.0257 0.0107  237 PHE A CE2 
428  C CZ  . PHE A 68  ? 0.4050 0.3567 0.3620 -0.0143 -0.0245 0.0093  237 PHE A CZ  
429  N N   . SER A 69  ? 0.5356 0.4641 0.4847 -0.0258 -0.0263 0.0056  238 SER A N   
430  C CA  . SER A 69  ? 0.5946 0.5153 0.5414 -0.0288 -0.0264 0.0060  238 SER A CA  
431  C C   . SER A 69  ? 0.6032 0.5173 0.5494 -0.0264 -0.0271 0.0089  238 SER A C   
432  O O   . SER A 69  ? 0.5275 0.4450 0.4752 -0.0237 -0.0277 0.0108  238 SER A O   
433  C CB  . SER A 69  ? 0.6452 0.5683 0.5903 -0.0335 -0.0262 0.0067  238 SER A CB  
434  O OG  . SER A 69  ? 0.6259 0.5540 0.5715 -0.0331 -0.0265 0.0094  238 SER A OG  
435  N N   . SER A 70  ? 0.7242 0.6291 0.6683 -0.0271 -0.0269 0.0092  239 SER A N   
436  C CA  . SER A 70  ? 0.8736 0.7721 0.8166 -0.0244 -0.0276 0.0124  239 SER A CA  
437  C C   . SER A 70  ? 0.7608 0.6606 0.7025 -0.0261 -0.0282 0.0159  239 SER A C   
438  O O   . SER A 70  ? 0.7704 0.6698 0.7123 -0.0230 -0.0292 0.0186  239 SER A O   
439  C CB  . SER A 70  ? 0.9043 0.7915 0.8446 -0.0245 -0.0269 0.0120  239 SER A CB  
440  O OG  . SER A 70  ? 0.8777 0.7613 0.8154 -0.0299 -0.0259 0.0112  239 SER A OG  
441  N N   . ARG A 71  ? 0.6721 0.5745 0.6126 -0.0307 -0.0276 0.0157  240 ARG A N   
442  C CA  . ARG A 71  ? 0.6961 0.6015 0.6355 -0.0322 -0.0281 0.0187  240 ARG A CA  
443  C C   . ARG A 71  ? 0.7363 0.6498 0.6783 -0.0292 -0.0290 0.0196  240 ARG A C   
444  O O   . ARG A 71  ? 0.7341 0.6485 0.6752 -0.0286 -0.0297 0.0224  240 ARG A O   
445  C CB  . ARG A 71  ? 0.7392 0.6480 0.6776 -0.0376 -0.0271 0.0179  240 ARG A CB  
446  N N   . ASP A 72  ? 0.7747 0.6939 0.7195 -0.0274 -0.0288 0.0171  241 ASP A N   
447  C CA  . ASP A 72  ? 0.6612 0.5877 0.6081 -0.0250 -0.0292 0.0175  241 ASP A CA  
448  C C   . ASP A 72  ? 0.5299 0.4564 0.4792 -0.0205 -0.0297 0.0172  241 ASP A C   
449  O O   . ASP A 72  ? 0.5559 0.4883 0.5074 -0.0189 -0.0295 0.0165  241 ASP A O   
450  C CB  . ASP A 72  ? 0.7314 0.6651 0.6795 -0.0261 -0.0282 0.0152  241 ASP A CB  
451  C CG  . ASP A 72  ? 0.7898 0.7285 0.7368 -0.0287 -0.0279 0.0163  241 ASP A CG  
452  O OD1 . ASP A 72  ? 0.9633 0.8992 0.9081 -0.0314 -0.0281 0.0180  241 ASP A OD1 
453  O OD2 . ASP A 72  ? 0.8828 0.8280 0.8308 -0.0278 -0.0273 0.0155  241 ASP A OD2 
454  N N   . GLU A 73  ? 0.4961 0.4160 0.4450 -0.0185 -0.0302 0.0178  242 GLU A N   
455  C CA  . GLU A 73  ? 0.4960 0.4164 0.4473 -0.0141 -0.0308 0.0177  242 GLU A CA  
456  C C   . GLU A 73  ? 0.4622 0.3889 0.4153 -0.0127 -0.0316 0.0191  242 GLU A C   
457  O O   . GLU A 73  ? 0.4962 0.4272 0.4522 -0.0104 -0.0315 0.0179  242 GLU A O   
458  C CB  . GLU A 73  ? 0.5149 0.4271 0.4648 -0.0119 -0.0313 0.0190  242 GLU A CB  
459  N N   . LYS A 74  ? 0.4473 0.3746 0.3984 -0.0144 -0.0323 0.0215  243 LYS A N   
460  C CA  . LYS A 74  ? 0.4614 0.3941 0.4137 -0.0132 -0.0332 0.0227  243 LYS A CA  
461  C C   . LYS A 74  ? 0.4001 0.3398 0.3541 -0.0143 -0.0322 0.0209  243 LYS A C   
462  O O   . LYS A 74  ? 0.3567 0.3011 0.3128 -0.0128 -0.0324 0.0207  243 LYS A O   
463  C CB  . LYS A 74  ? 0.4945 0.4260 0.4438 -0.0146 -0.0342 0.0258  243 LYS A CB  
464  C CG  . LYS A 74  ? 0.5254 0.4503 0.4727 -0.0125 -0.0352 0.0282  243 LYS A CG  
465  N N   . SER A 75  ? 0.3968 0.3373 0.3499 -0.0167 -0.0309 0.0196  244 SER A N   
466  C CA  . SER A 75  ? 0.4002 0.3466 0.3546 -0.0170 -0.0296 0.0181  244 SER A CA  
467  C C   . SER A 75  ? 0.3917 0.3394 0.3489 -0.0143 -0.0288 0.0159  244 SER A C   
468  O O   . SER A 75  ? 0.3877 0.3396 0.3466 -0.0134 -0.0280 0.0152  244 SER A O   
469  C CB  . SER A 75  ? 0.4239 0.3716 0.3763 -0.0198 -0.0285 0.0174  244 SER A CB  
470  O OG  . SER A 75  ? 0.5263 0.4742 0.4764 -0.0223 -0.0290 0.0194  244 SER A OG  
471  N N   . TRP A 76  ? 0.3872 0.3311 0.3449 -0.0133 -0.0287 0.0148  245 TRP A N   
472  C CA  . TRP A 76  ? 0.4026 0.3474 0.3628 -0.0106 -0.0279 0.0128  245 TRP A CA  
473  C C   . TRP A 76  ? 0.3310 0.2779 0.2937 -0.0083 -0.0285 0.0135  245 TRP A C   
474  O O   . TRP A 76  ? 0.3453 0.2963 0.3101 -0.0073 -0.0274 0.0123  245 TRP A O   
475  C CB  . TRP A 76  ? 0.3794 0.3190 0.3393 -0.0096 -0.0280 0.0117  245 TRP A CB  
476  C CG  . TRP A 76  ? 0.3934 0.3338 0.3561 -0.0063 -0.0272 0.0099  245 TRP A CG  
477  C CD1 . TRP A 76  ? 0.3894 0.3325 0.3529 -0.0056 -0.0256 0.0077  245 TRP A CD1 
478  C CD2 . TRP A 76  ? 0.3846 0.3236 0.3493 -0.0032 -0.0280 0.0103  245 TRP A CD2 
479  N NE1 . TRP A 76  ? 0.3699 0.3130 0.3358 -0.0025 -0.0252 0.0067  245 TRP A NE1 
480  C CE2 . TRP A 76  ? 0.3771 0.3180 0.3440 -0.0010 -0.0267 0.0082  245 TRP A CE2 
481  C CE3 . TRP A 76  ? 0.4301 0.3668 0.3948 -0.0019 -0.0296 0.0124  245 TRP A CE3 
482  C CZ2 . TRP A 76  ? 0.4191 0.3600 0.3885 0.0022  -0.0269 0.0080  245 TRP A CZ2 
483  C CZ3 . TRP A 76  ? 0.4267 0.3636 0.3939 0.0016  -0.0299 0.0121  245 TRP A CZ3 
484  C CH2 . TRP A 76  ? 0.4539 0.3931 0.4236 0.0036  -0.0285 0.0099  245 TRP A CH2 
485  N N   . PHE A 77  ? 0.3598 0.3041 0.3219 -0.0076 -0.0302 0.0154  246 PHE A N   
486  C CA  . PHE A 77  ? 0.3828 0.3299 0.3472 -0.0054 -0.0313 0.0161  246 PHE A CA  
487  C C   . PHE A 77  ? 0.3582 0.3114 0.3236 -0.0067 -0.0308 0.0160  246 PHE A C   
488  O O   . PHE A 77  ? 0.3541 0.3113 0.3224 -0.0054 -0.0303 0.0147  246 PHE A O   
489  C CB  . PHE A 77  ? 0.4024 0.3459 0.3653 -0.0043 -0.0332 0.0186  246 PHE A CB  
490  C CG  . PHE A 77  ? 0.4480 0.3953 0.4136 -0.0014 -0.0344 0.0192  246 PHE A CG  
491  C CD1 . PHE A 77  ? 0.4436 0.3970 0.4101 -0.0022 -0.0350 0.0196  246 PHE A CD1 
492  C CD2 . PHE A 77  ? 0.4994 0.4447 0.4665 0.0021  -0.0349 0.0191  246 PHE A CD2 
493  C CE1 . PHE A 77  ? 0.5038 0.4620 0.4731 0.0001  -0.0362 0.0197  246 PHE A CE1 
494  C CE2 . PHE A 77  ? 0.5966 0.5467 0.5665 0.0050  -0.0361 0.0195  246 PHE A CE2 
495  C CZ  . PHE A 77  ? 0.5088 0.4657 0.4799 0.0038  -0.0368 0.0197  246 PHE A CZ  
496  N N   . ARG A 78  ? 0.3829 0.3367 0.3457 -0.0093 -0.0309 0.0171  247 ARG A N   
497  C CA  . ARG A 78  ? 0.4028 0.3615 0.3659 -0.0106 -0.0305 0.0169  247 ARG A CA  
498  C C   . ARG A 78  ? 0.3436 0.3049 0.3079 -0.0108 -0.0281 0.0147  247 ARG A C   
499  O O   . ARG A 78  ? 0.2935 0.2585 0.2595 -0.0108 -0.0273 0.0137  247 ARG A O   
500  C CB  . ARG A 78  ? 0.5109 0.4695 0.4706 -0.0131 -0.0310 0.0186  247 ARG A CB  
501  C CG  . ARG A 78  ? 0.9514 0.9094 0.9099 -0.0128 -0.0333 0.0210  247 ARG A CG  
502  C CD  . ARG A 78  ? 1.1109 1.0691 1.0659 -0.0153 -0.0336 0.0228  247 ARG A CD  
503  N NE  . ARG A 78  ? 1.1593 1.1139 1.1120 -0.0173 -0.0328 0.0232  247 ARG A NE  
504  C CZ  . ARG A 78  ? 1.1492 1.0988 1.0996 -0.0180 -0.0335 0.0250  247 ARG A CZ  
505  N NH1 . ARG A 78  ? 1.1631 1.1101 1.1127 -0.0164 -0.0352 0.0271  247 ARG A NH1 
506  N NH2 . ARG A 78  ? 0.8725 0.8200 0.8212 -0.0203 -0.0325 0.0248  247 ARG A NH2 
507  N N   . GLU A 79  ? 0.3569 0.3164 0.3200 -0.0112 -0.0268 0.0140  248 GLU A N   
508  C CA  . GLU A 79  ? 0.3566 0.3182 0.3200 -0.0111 -0.0244 0.0122  248 GLU A CA  
509  C C   . GLU A 79  ? 0.3176 0.2802 0.2843 -0.0088 -0.0235 0.0107  248 GLU A C   
510  O O   . GLU A 79  ? 0.3114 0.2767 0.2793 -0.0087 -0.0216 0.0097  248 GLU A O   
511  C CB  . GLU A 79  ? 0.3617 0.3220 0.3231 -0.0117 -0.0235 0.0118  248 GLU A CB  
512  C CG  . GLU A 79  ? 0.4240 0.3867 0.3848 -0.0112 -0.0209 0.0105  248 GLU A CG  
513  C CD  . GLU A 79  ? 0.4144 0.3778 0.3727 -0.0121 -0.0202 0.0104  248 GLU A CD  
514  O OE1 . GLU A 79  ? 0.4425 0.4040 0.4001 -0.0130 -0.0215 0.0105  248 GLU A OE1 
515  O OE2 . GLU A 79  ? 0.4161 0.3819 0.3730 -0.0118 -0.0183 0.0102  248 GLU A OE2 
516  N N   . THR A 80  ? 0.3329 0.2931 0.3009 -0.0071 -0.0246 0.0106  249 THR A N   
517  C CA  . THR A 80  ? 0.3094 0.2707 0.2806 -0.0048 -0.0239 0.0093  249 THR A CA  
518  C C   . THR A 80  ? 0.3272 0.2926 0.3011 -0.0047 -0.0242 0.0093  249 THR A C   
519  O O   . THR A 80  ? 0.3294 0.2976 0.3055 -0.0043 -0.0223 0.0078  249 THR A O   
520  C CB  . THR A 80  ? 0.3053 0.2630 0.2772 -0.0027 -0.0252 0.0093  249 THR A CB  
521  O OG1 . THR A 80  ? 0.3053 0.2597 0.2750 -0.0031 -0.0246 0.0087  249 THR A OG1 
522  C CG2 . THR A 80  ? 0.3089 0.2688 0.2844 0.0000  -0.0244 0.0080  249 THR A CG2 
523  N N   . GLU A 81  ? 0.3331 0.2989 0.3065 -0.0052 -0.0264 0.0108  250 GLU A N   
524  C CA  . GLU A 81  ? 0.3555 0.3261 0.3313 -0.0052 -0.0272 0.0107  250 GLU A CA  
525  C C   . GLU A 81  ? 0.3455 0.3192 0.3213 -0.0075 -0.0251 0.0095  250 GLU A C   
526  O O   . GLU A 81  ? 0.4119 0.3894 0.3906 -0.0076 -0.0241 0.0080  250 GLU A O   
527  C CB  . GLU A 81  ? 0.3754 0.3458 0.3497 -0.0054 -0.0299 0.0128  250 GLU A CB  
528  C CG  . GLU A 81  ? 0.4744 0.4506 0.4507 -0.0056 -0.0311 0.0128  250 GLU A CG  
529  C CD  . GLU A 81  ? 0.5274 0.5030 0.5014 -0.0052 -0.0339 0.0153  250 GLU A CD  
530  O OE1 . GLU A 81  ? 0.5370 0.5096 0.5073 -0.0070 -0.0341 0.0167  250 GLU A OE1 
531  O OE2 . GLU A 81  ? 0.5652 0.5430 0.5410 -0.0028 -0.0357 0.0160  250 GLU A OE2 
532  N N   . LEU A 82  ? 0.3281 0.3002 0.3005 -0.0094 -0.0244 0.0101  251 LEU A N   
533  C CA  . LEU A 82  ? 0.3376 0.3115 0.3091 -0.0114 -0.0223 0.0091  251 LEU A CA  
534  C C   . LEU A 82  ? 0.3570 0.3311 0.3299 -0.0108 -0.0192 0.0073  251 LEU A C   
535  O O   . LEU A 82  ? 0.3274 0.3041 0.3020 -0.0117 -0.0176 0.0058  251 LEU A O   
536  C CB  . LEU A 82  ? 0.4350 0.4067 0.4023 -0.0128 -0.0220 0.0102  251 LEU A CB  
537  C CG  . LEU A 82  ? 0.5007 0.4737 0.4661 -0.0147 -0.0198 0.0095  251 LEU A CG  
538  C CD1 . LEU A 82  ? 0.6338 0.6098 0.5998 -0.0162 -0.0213 0.0095  251 LEU A CD1 
539  C CD2 . LEU A 82  ? 0.5325 0.5037 0.4940 -0.0154 -0.0194 0.0107  251 LEU A CD2 
540  N N   . TYR A 83  ? 0.3019 0.2733 0.2739 -0.0093 -0.0182 0.0072  252 TYR A N   
541  C CA  . TYR A 83  ? 0.3203 0.2916 0.2930 -0.0084 -0.0151 0.0058  252 TYR A CA  
542  C C   . TYR A 83  ? 0.3176 0.2912 0.2945 -0.0073 -0.0147 0.0045  252 TYR A C   
543  O O   . TYR A 83  ? 0.2860 0.2604 0.2639 -0.0074 -0.0118 0.0033  252 TYR A O   
544  C CB  . TYR A 83  ? 0.3525 0.3212 0.3234 -0.0068 -0.0145 0.0060  252 TYR A CB  
545  C CG  . TYR A 83  ? 0.3001 0.2677 0.2670 -0.0075 -0.0132 0.0066  252 TYR A CG  
546  C CD1 . TYR A 83  ? 0.3157 0.2835 0.2809 -0.0077 -0.0102 0.0062  252 TYR A CD1 
547  C CD2 . TYR A 83  ? 0.3568 0.3232 0.3216 -0.0076 -0.0148 0.0074  252 TYR A CD2 
548  C CE1 . TYR A 83  ? 0.3093 0.2766 0.2708 -0.0076 -0.0089 0.0068  252 TYR A CE1 
549  C CE2 . TYR A 83  ? 0.3714 0.3381 0.3330 -0.0080 -0.0136 0.0078  252 TYR A CE2 
550  C CZ  . TYR A 83  ? 0.3532 0.3206 0.3131 -0.0077 -0.0107 0.0076  252 TYR A CZ  
551  O OH  . TYR A 83  ? 0.3031 0.2712 0.2596 -0.0074 -0.0096 0.0081  252 TYR A OH  
552  N N   . ASN A 84  ? 0.3077 0.2822 0.2869 -0.0061 -0.0173 0.0050  253 ASN A N   
553  C CA  . ASN A 84  ? 0.3325 0.3102 0.3160 -0.0047 -0.0171 0.0038  253 ASN A CA  
554  C C   . ASN A 84  ? 0.3692 0.3518 0.3552 -0.0065 -0.0175 0.0030  253 ASN A C   
555  O O   . ASN A 84  ? 0.3886 0.3750 0.3785 -0.0059 -0.0167 0.0017  253 ASN A O   
556  C CB  . ASN A 84  ? 0.3496 0.3264 0.3346 -0.0020 -0.0196 0.0045  253 ASN A CB  
557  C CG  . ASN A 84  ? 0.3393 0.3126 0.3235 0.0000  -0.0185 0.0040  253 ASN A CG  
558  O OD1 . ASN A 84  ? 0.3601 0.3332 0.3440 0.0000  -0.0157 0.0029  253 ASN A OD1 
559  N ND2 . ASN A 84  ? 0.3800 0.3505 0.3637 0.0017  -0.0205 0.0048  253 ASN A ND2 
560  N N   . THR A 85  ? 0.3618 0.3450 0.3458 -0.0086 -0.0187 0.0038  254 THR A N   
561  C CA  . THR A 85  ? 0.4168 0.4053 0.4031 -0.0104 -0.0193 0.0028  254 THR A CA  
562  C C   . THR A 85  ? 0.4225 0.4109 0.4070 -0.0136 -0.0167 0.0015  254 THR A C   
563  O O   . THR A 85  ? 0.4591 0.4517 0.4457 -0.0156 -0.0162 0.0000  254 THR A O   
564  C CB  . THR A 85  ? 0.4068 0.3973 0.3925 -0.0103 -0.0231 0.0043  254 THR A CB  
565  O OG1 . THR A 85  ? 0.3879 0.3745 0.3692 -0.0113 -0.0237 0.0059  254 THR A OG1 
566  C CG2 . THR A 85  ? 0.4521 0.4428 0.4397 -0.0069 -0.0256 0.0055  254 THR A CG2 
567  N N   . VAL A 86  ? 0.3982 0.3819 0.3788 -0.0139 -0.0148 0.0022  255 VAL A N   
568  C CA  . VAL A 86  ? 0.3447 0.3271 0.3228 -0.0163 -0.0119 0.0012  255 VAL A CA  
569  C C   . VAL A 86  ? 0.3571 0.3360 0.3341 -0.0154 -0.0080 0.0007  255 VAL A C   
570  O O   . VAL A 86  ? 0.3583 0.3347 0.3344 -0.0130 -0.0079 0.0016  255 VAL A O   
571  C CB  . VAL A 86  ? 0.3217 0.3019 0.2954 -0.0172 -0.0130 0.0027  255 VAL A CB  
572  C CG1 . VAL A 86  ? 0.3740 0.3522 0.3447 -0.0192 -0.0098 0.0018  255 VAL A CG1 
573  C CG2 . VAL A 86  ? 0.3434 0.3268 0.3177 -0.0179 -0.0167 0.0035  255 VAL A CG2 
574  N N   . MET A 87  ? 0.3639 0.3423 0.3407 -0.0173 -0.0045 -0.0009 256 MET A N   
575  C CA  . MET A 87  ? 0.4134 0.3879 0.3884 -0.0163 -0.0003 -0.0011 256 MET A CA  
576  C C   . MET A 87  ? 0.4139 0.3843 0.3835 -0.0161 0.0010  0.0000  256 MET A C   
577  O O   . MET A 87  ? 0.4365 0.4056 0.4038 -0.0183 0.0027  -0.0006 256 MET A O   
578  C CB  . MET A 87  ? 0.4701 0.4452 0.4470 -0.0184 0.0033  -0.0032 256 MET A CB  
579  C CG  . MET A 87  ? 0.5495 0.5219 0.5263 -0.0164 0.0069  -0.0033 256 MET A CG  
580  S SD  . MET A 87  ? 0.5973 0.5633 0.5677 -0.0139 0.0100  -0.0016 256 MET A SD  
581  C CE  . MET A 87  ? 0.5740 0.5364 0.5409 -0.0171 0.0137  -0.0026 256 MET A CE  
582  N N   . LEU A 88  ? 0.3984 0.3671 0.3659 -0.0136 0.0003  0.0015  257 LEU A N   
583  C CA  . LEU A 88  ? 0.4634 0.4300 0.4264 -0.0132 0.0004  0.0029  257 LEU A CA  
584  C C   . LEU A 88  ? 0.4872 0.4507 0.4469 -0.0107 0.0037  0.0035  257 LEU A C   
585  O O   . LEU A 88  ? 0.5655 0.5284 0.5219 -0.0095 0.0034  0.0048  257 LEU A O   
586  C CB  . LEU A 88  ? 0.4627 0.4309 0.4260 -0.0128 -0.0037 0.0042  257 LEU A CB  
587  C CG  . LEU A 88  ? 0.4963 0.4647 0.4567 -0.0140 -0.0054 0.0053  257 LEU A CG  
588  C CD1 . LEU A 88  ? 0.4756 0.4444 0.4353 -0.0166 -0.0045 0.0044  257 LEU A CD1 
589  C CD2 . LEU A 88  ? 0.4919 0.4619 0.4539 -0.0140 -0.0096 0.0064  257 LEU A CD2 
590  N N   . ARG A 89  ? 0.4207 0.3828 0.3811 -0.0099 0.0070  0.0026  258 ARG A N   
591  C CA  . ARG A 89  ? 0.4215 0.3806 0.3784 -0.0073 0.0107  0.0033  258 ARG A CA  
592  C C   . ARG A 89  ? 0.3891 0.3449 0.3412 -0.0076 0.0137  0.0038  258 ARG A C   
593  O O   . ARG A 89  ? 0.4305 0.3845 0.3824 -0.0100 0.0155  0.0028  258 ARG A O   
594  C CB  . ARG A 89  ? 0.4722 0.4301 0.4308 -0.0067 0.0139  0.0024  258 ARG A CB  
595  C CG  . ARG A 89  ? 0.6125 0.5733 0.5751 -0.0054 0.0115  0.0020  258 ARG A CG  
596  C CD  . ARG A 89  ? 0.5982 0.5584 0.5627 -0.0048 0.0148  0.0011  258 ARG A CD  
597  N NE  . ARG A 89  ? 0.7092 0.6728 0.6783 -0.0042 0.0122  0.0004  258 ARG A NE  
598  C CZ  . ARG A 89  ? 0.9019 0.8659 0.8728 -0.0025 0.0140  -0.0001 258 ARG A CZ  
599  N NH1 . ARG A 89  ? 0.8869 0.8479 0.8552 -0.0014 0.0187  0.0000  258 ARG A NH1 
600  N NH2 . ARG A 89  ? 0.8721 0.8393 0.8471 -0.0018 0.0114  -0.0007 258 ARG A NH2 
601  N N   . HIS A 90  ? 0.3799 0.3350 0.3280 -0.0050 0.0142  0.0053  259 HIS A N   
602  C CA  . HIS A 90  ? 0.3537 0.3060 0.2969 -0.0044 0.0167  0.0061  259 HIS A CA  
603  C C   . HIS A 90  ? 0.3588 0.3123 0.2988 -0.0007 0.0169  0.0077  259 HIS A C   
604  O O   . HIS A 90  ? 0.3343 0.2915 0.2761 0.0000  0.0135  0.0080  259 HIS A O   
605  C CB  . HIS A 90  ? 0.3665 0.3203 0.3095 -0.0072 0.0141  0.0060  259 HIS A CB  
606  C CG  . HIS A 90  ? 0.3640 0.3145 0.3021 -0.0070 0.0171  0.0064  259 HIS A CG  
607  N ND1 . HIS A 90  ? 0.4074 0.3585 0.3416 -0.0044 0.0174  0.0079  259 HIS A ND1 
608  C CD2 . HIS A 90  ? 0.3758 0.3224 0.3121 -0.0089 0.0201  0.0052  259 HIS A CD2 
609  C CE1 . HIS A 90  ? 0.3967 0.3441 0.3267 -0.0043 0.0205  0.0080  259 HIS A CE1 
610  N NE2 . HIS A 90  ? 0.4171 0.3614 0.3482 -0.0072 0.0222  0.0063  259 HIS A NE2 
611  N N   . GLU A 91  ? 0.3567 0.3069 0.2920 0.0017  0.0209  0.0085  260 GLU A N   
612  C CA  . GLU A 91  ? 0.3771 0.3288 0.3087 0.0058  0.0218  0.0101  260 GLU A CA  
613  C C   . GLU A 91  ? 0.3939 0.3507 0.3255 0.0057  0.0179  0.0108  260 GLU A C   
614  O O   . GLU A 91  ? 0.3164 0.2768 0.2470 0.0084  0.0170  0.0115  260 GLU A O   
615  C CB  . GLU A 91  ? 0.5006 0.4474 0.4266 0.0083  0.0269  0.0111  260 GLU A CB  
616  C CG  . GLU A 91  ? 0.7808 0.7294 0.7023 0.0132  0.0282  0.0129  260 GLU A CG  
617  C CD  . GLU A 91  ? 0.9908 0.9336 0.9072 0.0167  0.0341  0.0140  260 GLU A CD  
618  O OE1 . GLU A 91  ? 0.8111 0.7477 0.7251 0.0154  0.0374  0.0137  260 GLU A OE1 
619  O OE2 . GLU A 91  ? 1.2647 1.2090 1.1791 0.0209  0.0353  0.0151  260 GLU A OE2 
620  N N   . ASN A 92  ? 0.3257 0.2830 0.2582 0.0026  0.0159  0.0105  261 ASN A N   
621  C CA  . ASN A 92  ? 0.3088 0.2704 0.2408 0.0022  0.0128  0.0112  261 ASN A CA  
622  C C   . ASN A 92  ? 0.2970 0.2612 0.2332 -0.0011 0.0082  0.0107  261 ASN A C   
623  O O   . ASN A 92  ? 0.2742 0.2409 0.2100 -0.0026 0.0058  0.0112  261 ASN A O   
624  C CB  . ASN A 92  ? 0.3014 0.2615 0.2293 0.0022  0.0146  0.0119  261 ASN A CB  
625  C CG  . ASN A 92  ? 0.3195 0.2756 0.2426 0.0058  0.0197  0.0126  261 ASN A CG  
626  O OD1 . ASN A 92  ? 0.3258 0.2766 0.2470 0.0049  0.0228  0.0121  261 ASN A OD1 
627  N ND2 . ASN A 92  ? 0.3082 0.2667 0.2293 0.0098  0.0207  0.0137  261 ASN A ND2 
628  N N   . ILE A 93  ? 0.2987 0.2623 0.2387 -0.0021 0.0070  0.0097  262 ILE A N   
629  C CA  . ILE A 93  ? 0.2963 0.2621 0.2401 -0.0044 0.0027  0.0094  262 ILE A CA  
630  C C   . ILE A 93  ? 0.3045 0.2714 0.2502 -0.0026 0.0019  0.0089  262 ILE A C   
631  O O   . ILE A 93  ? 0.2920 0.2573 0.2382 -0.0010 0.0042  0.0084  262 ILE A O   
632  C CB  . ILE A 93  ? 0.3053 0.2698 0.2521 -0.0071 0.0018  0.0084  262 ILE A CB  
633  C CG1 . ILE A 93  ? 0.3474 0.3110 0.2919 -0.0090 0.0025  0.0086  262 ILE A CG1 
634  C CG2 . ILE A 93  ? 0.3200 0.2864 0.2705 -0.0086 -0.0022 0.0084  262 ILE A CG2 
635  C CD1 . ILE A 93  ? 0.3421 0.3051 0.2892 -0.0117 0.0020  0.0073  262 ILE A CD1 
636  N N   . LEU A 94  ? 0.2810 0.2505 0.2275 -0.0029 -0.0009 0.0092  263 LEU A N   
637  C CA  . LEU A 94  ? 0.2706 0.2410 0.2184 -0.0012 -0.0015 0.0085  263 LEU A CA  
638  C C   . LEU A 94  ? 0.2993 0.2676 0.2503 -0.0011 -0.0011 0.0075  263 LEU A C   
639  O O   . LEU A 94  ? 0.2909 0.2584 0.2446 -0.0032 -0.0030 0.0072  263 LEU A O   
640  C CB  . LEU A 94  ? 0.2892 0.2617 0.2380 -0.0027 -0.0050 0.0084  263 LEU A CB  
641  C CG  . LEU A 94  ? 0.2859 0.2592 0.2357 -0.0014 -0.0058 0.0073  263 LEU A CG  
642  C CD1 . LEU A 94  ? 0.3104 0.2861 0.2575 0.0016  -0.0034 0.0071  263 LEU A CD1 
643  C CD2 . LEU A 94  ? 0.3084 0.2828 0.2590 -0.0035 -0.0090 0.0071  263 LEU A CD2 
644  N N   . GLY A 95  ? 0.3109 0.2787 0.2614 0.0013  0.0012  0.0069  264 GLY A N   
645  C CA  . GLY A 95  ? 0.2959 0.2621 0.2494 0.0017  0.0019  0.0060  264 GLY A CA  
646  C C   . GLY A 95  ? 0.2850 0.2519 0.2417 0.0014  -0.0010 0.0051  264 GLY A C   
647  O O   . GLY A 95  ? 0.3128 0.2808 0.2689 0.0027  -0.0020 0.0047  264 GLY A O   
648  N N   . PHE A 96  ? 0.2877 0.2540 0.2478 -0.0002 -0.0026 0.0048  265 PHE A N   
649  C CA  . PHE A 96  ? 0.3044 0.2707 0.2675 -0.0002 -0.0053 0.0042  265 PHE A CA  
650  C C   . PHE A 96  ? 0.3057 0.2719 0.2708 0.0018  -0.0037 0.0031  265 PHE A C   
651  O O   . PHE A 96  ? 0.3170 0.2832 0.2829 0.0020  -0.0010 0.0028  265 PHE A O   
652  C CB  . PHE A 96  ? 0.2837 0.2502 0.2494 -0.0024 -0.0076 0.0045  265 PHE A CB  
653  C CG  . PHE A 96  ? 0.2739 0.2400 0.2427 -0.0018 -0.0100 0.0040  265 PHE A CG  
654  C CD1 . PHE A 96  ? 0.2910 0.2558 0.2594 -0.0021 -0.0127 0.0045  265 PHE A CD1 
655  C CD2 . PHE A 96  ? 0.2884 0.2556 0.2607 -0.0011 -0.0093 0.0032  265 PHE A CD2 
656  C CE1 . PHE A 96  ? 0.3021 0.2658 0.2729 -0.0012 -0.0147 0.0042  265 PHE A CE1 
657  C CE2 . PHE A 96  ? 0.2789 0.2462 0.2541 -0.0002 -0.0115 0.0030  265 PHE A CE2 
658  C CZ  . PHE A 96  ? 0.2871 0.2522 0.2612 0.0000  -0.0141 0.0035  265 PHE A CZ  
659  N N   . ILE A 97  ? 0.3032 0.2692 0.2689 0.0031  -0.0051 0.0023  266 ILE A N   
660  C CA  . ILE A 97  ? 0.3224 0.2883 0.2900 0.0053  -0.0038 0.0012  266 ILE A CA  
661  C C   . ILE A 97  ? 0.2881 0.2537 0.2595 0.0053  -0.0062 0.0006  266 ILE A C   
662  O O   . ILE A 97  ? 0.3131 0.2797 0.2875 0.0059  -0.0052 0.0001  266 ILE A O   
663  C CB  . ILE A 97  ? 0.2981 0.2643 0.2631 0.0075  -0.0031 0.0005  266 ILE A CB  
664  C CG1 . ILE A 97  ? 0.2974 0.2644 0.2587 0.0083  -0.0002 0.0013  266 ILE A CG1 
665  C CG2 . ILE A 97  ? 0.3092 0.2754 0.2758 0.0098  -0.0018 -0.0007 266 ILE A CG2 
666  C CD1 . ILE A 97  ? 0.3101 0.2787 0.2684 0.0106  0.0002  0.0007  266 ILE A CD1 
667  N N   . ALA A 98  ? 0.2902 0.2544 0.2611 0.0046  -0.0092 0.0008  267 ALA A N   
668  C CA  . ALA A 98  ? 0.3078 0.2707 0.2813 0.0052  -0.0115 0.0005  267 ALA A CA  
669  C C   . ALA A 98  ? 0.3161 0.2765 0.2882 0.0038  -0.0144 0.0013  267 ALA A C   
670  O O   . ALA A 98  ? 0.2993 0.2592 0.2685 0.0025  -0.0147 0.0014  267 ALA A O   
671  C CB  . ALA A 98  ? 0.3346 0.2968 0.3088 0.0079  -0.0106 -0.0009 267 ALA A CB  
672  N N   A SER A 99  ? 0.3201 0.2791 0.2942 0.0041  -0.0164 0.0017  268 SER A N   
673  N N   B SER A 99  ? 0.3424 0.3014 0.3165 0.0041  -0.0164 0.0018  268 SER A N   
674  C CA  A SER A 99  ? 0.3154 0.2708 0.2882 0.0033  -0.0189 0.0024  268 SER A CA  
675  C CA  B SER A 99  ? 0.3548 0.3101 0.3276 0.0033  -0.0189 0.0024  268 SER A CA  
676  C C   A SER A 99  ? 0.3339 0.2865 0.3080 0.0058  -0.0196 0.0016  268 SER A C   
677  C C   B SER A 99  ? 0.3539 0.3066 0.3281 0.0059  -0.0195 0.0015  268 SER A C   
678  O O   A SER A 99  ? 0.3238 0.2784 0.3009 0.0079  -0.0190 0.0012  268 SER A O   
679  O O   B SER A 99  ? 0.3418 0.2965 0.3189 0.0080  -0.0188 0.0010  268 SER A O   
680  C CB  A SER A 99  ? 0.3044 0.2602 0.2774 0.0016  -0.0206 0.0043  268 SER A CB  
681  C CB  B SER A 99  ? 0.3750 0.3304 0.3481 0.0018  -0.0208 0.0043  268 SER A CB  
682  O OG  A SER A 99  ? 0.2772 0.2288 0.2490 0.0013  -0.0228 0.0053  268 SER A OG  
683  O OG  B SER A 99  ? 0.3997 0.3568 0.3710 -0.0005 -0.0204 0.0052  268 SER A OG  
684  N N   . ASP A 100 ? 0.3490 0.2970 0.3210 0.0055  -0.0207 0.0012  269 ASP A N   
685  C CA  . ASP A 100 ? 0.3706 0.3149 0.3432 0.0081  -0.0211 0.0003  269 ASP A CA  
686  C C   . ASP A 100 ? 0.4040 0.3420 0.3741 0.0070  -0.0228 0.0008  269 ASP A C   
687  O O   . ASP A 100 ? 0.3762 0.3128 0.3437 0.0040  -0.0232 0.0010  269 ASP A O   
688  C CB  . ASP A 100 ? 0.3775 0.3223 0.3498 0.0097  -0.0193 -0.0020 269 ASP A CB  
689  C CG  . ASP A 100 ? 0.3967 0.3390 0.3704 0.0129  -0.0192 -0.0032 269 ASP A CG  
690  O OD1 . ASP A 100 ? 0.4349 0.3789 0.4116 0.0151  -0.0194 -0.0024 269 ASP A OD1 
691  O OD2 . ASP A 100 ? 0.3973 0.3360 0.3689 0.0134  -0.0190 -0.0050 269 ASP A OD2 
692  N N   . MET A 101 ? 0.4217 0.3559 0.3926 0.0095  -0.0236 0.0011  270 MET A N   
693  C CA  . MET A 101 ? 0.5783 0.5047 0.5463 0.0093  -0.0246 0.0013  270 MET A CA  
694  C C   . MET A 101 ? 0.6096 0.5324 0.5770 0.0113  -0.0236 -0.0011 270 MET A C   
695  O O   . MET A 101 ? 0.7141 0.6392 0.6840 0.0147  -0.0229 -0.0020 270 MET A O   
696  C CB  . MET A 101 ? 0.5959 0.5198 0.5646 0.0115  -0.0260 0.0036  270 MET A CB  
697  C CG  . MET A 101 ? 0.6692 0.5960 0.6382 0.0098  -0.0273 0.0062  270 MET A CG  
698  S SD  . MET A 101 ? 0.8693 0.7919 0.8379 0.0129  -0.0291 0.0090  270 MET A SD  
699  C CE  . MET A 101 ? 0.7197 0.6472 0.6928 0.0179  -0.0286 0.0079  270 MET A CE  
700  N N   . THR A 102 ? 0.8016 0.7190 0.7657 0.0092  -0.0236 -0.0025 271 THR A N   
701  C CA  . THR A 102 ? 0.8793 0.7935 0.8422 0.0106  -0.0225 -0.0055 271 THR A CA  
702  C C   . THR A 102 ? 0.8981 0.8033 0.8573 0.0086  -0.0229 -0.0062 271 THR A C   
703  O O   . THR A 102 ? 0.9132 0.8177 0.8704 0.0044  -0.0232 -0.0061 271 THR A O   
704  C CB  . THR A 102 ? 0.9344 0.8545 0.8973 0.0093  -0.0212 -0.0078 271 THR A CB  
705  O OG1 . THR A 102 ? 0.9156 0.8331 0.8772 0.0107  -0.0203 -0.0109 271 THR A OG1 
706  C CG2 . THR A 102 ? 0.7324 0.6545 0.6932 0.0048  -0.0216 -0.0078 271 THR A CG2 
707  N N   . SER A 103 ? 1.4286 1.3268 1.3869 0.0114  -0.0227 -0.0068 272 SER A N   
708  C CA  . SER A 103 ? 1.5771 1.4652 1.5313 0.0095  -0.0226 -0.0077 272 SER A CA  
709  C C   . SER A 103 ? 1.5490 1.4367 1.5011 0.0066  -0.0216 -0.0117 272 SER A C   
710  O O   . SER A 103 ? 1.0986 0.9861 1.0507 0.0090  -0.0207 -0.0144 272 SER A O   
711  C CB  . SER A 103 ? 1.0601 0.9403 1.0135 0.0139  -0.0223 -0.0072 272 SER A CB  
712  N N   . ARG A 104 ? 1.7964 1.6847 1.7466 0.0015  -0.0219 -0.0121 273 ARG A N   
713  C CA  . ARG A 104 ? 1.6204 1.5101 1.5689 -0.0017 -0.0213 -0.0159 273 ARG A CA  
714  C C   . ARG A 104 ? 1.4823 1.3673 1.4277 -0.0074 -0.0215 -0.0162 273 ARG A C   
715  O O   . ARG A 104 ? 1.3061 1.1843 1.2487 -0.0095 -0.0208 -0.0189 273 ARG A O   
716  C CB  . ARG A 104 ? 1.2017 1.1027 1.1523 -0.0019 -0.0212 -0.0166 273 ARG A CB  
717  N N   . SER A 107 ? 1.3551 1.2101 1.2943 -0.0054 -0.0218 -0.0067 276 SER A N   
718  C CA  . SER A 107 ? 1.4938 1.3542 1.4349 -0.0048 -0.0231 -0.0025 276 SER A CA  
719  C C   . SER A 107 ? 1.4959 1.3690 1.4415 -0.0030 -0.0239 -0.0026 276 SER A C   
720  O O   . SER A 107 ? 1.2262 1.1052 1.1728 -0.0045 -0.0235 -0.0056 276 SER A O   
721  C CB  . SER A 107 ? 1.2335 1.0929 1.1724 -0.0106 -0.0232 -0.0013 276 SER A CB  
722  N N   . THR A 108 ? 1.2346 1.1116 1.1825 0.0000  -0.0249 0.0005  277 THR A N   
723  C CA  . THR A 108 ? 1.2364 1.1243 1.1884 0.0018  -0.0254 0.0005  277 THR A CA  
724  C C   . THR A 108 ? 0.9425 0.8376 0.8950 -0.0023 -0.0256 0.0005  277 THR A C   
725  O O   . THR A 108 ? 0.8183 0.7121 0.7692 -0.0054 -0.0261 0.0024  277 THR A O   
726  C CB  . THR A 108 ? 0.9626 0.8531 0.9170 0.0059  -0.0264 0.0037  277 THR A CB  
727  N N   . GLN A 109 ? 0.6797 0.5820 0.6341 -0.0023 -0.0250 -0.0017 278 GLN A N   
728  C CA  . GLN A 109 ? 0.5490 0.4588 0.5039 -0.0053 -0.0249 -0.0018 278 GLN A CA  
729  C C   . GLN A 109 ? 0.4931 0.4098 0.4509 -0.0032 -0.0252 0.0001  278 GLN A C   
730  O O   . GLN A 109 ? 0.4437 0.3617 0.4038 0.0005  -0.0250 0.0001  278 GLN A O   
731  C CB  . GLN A 109 ? 0.7145 0.6282 0.6691 -0.0060 -0.0239 -0.0052 278 GLN A CB  
732  C CG  . GLN A 109 ? 0.8095 0.7188 0.7612 -0.0095 -0.0236 -0.0078 278 GLN A CG  
733  C CD  . GLN A 109 ? 0.8312 0.7477 0.7826 -0.0113 -0.0230 -0.0106 278 GLN A CD  
734  O OE1 . GLN A 109 ? 0.5768 0.4998 0.5299 -0.0088 -0.0225 -0.0112 278 GLN A OE1 
735  N NE2 . GLN A 109 ? 0.8308 0.7462 0.7801 -0.0157 -0.0231 -0.0123 278 GLN A NE2 
736  N N   . LEU A 110 ? 0.4134 0.3345 0.3710 -0.0058 -0.0255 0.0015  279 LEU A N   
737  C CA  . LEU A 110 ? 0.4401 0.3675 0.4001 -0.0046 -0.0256 0.0032  279 LEU A CA  
738  C C   . LEU A 110 ? 0.3816 0.3158 0.3418 -0.0056 -0.0244 0.0019  279 LEU A C   
739  O O   . LEU A 110 ? 0.4187 0.3545 0.3772 -0.0085 -0.0244 0.0018  279 LEU A O   
740  C CB  . LEU A 110 ? 0.4561 0.3827 0.4152 -0.0063 -0.0268 0.0062  279 LEU A CB  
741  C CG  . LEU A 110 ? 0.4991 0.4185 0.4571 -0.0052 -0.0279 0.0079  279 LEU A CG  
742  C CD1 . LEU A 110 ? 0.4973 0.4158 0.4535 -0.0074 -0.0289 0.0108  279 LEU A CD1 
743  C CD2 . LEU A 110 ? 0.4898 0.4098 0.4504 -0.0007 -0.0282 0.0083  279 LEU A CD2 
744  N N   . TRP A 111 ? 0.3696 0.3079 0.3321 -0.0029 -0.0233 0.0012  280 TRP A N   
745  C CA  . TRP A 111 ? 0.3445 0.2883 0.3068 -0.0029 -0.0218 0.0000  280 TRP A CA  
746  C C   . TRP A 111 ? 0.3452 0.2934 0.3090 -0.0024 -0.0212 0.0016  280 TRP A C   
747  O O   . TRP A 111 ? 0.3227 0.2709 0.2889 -0.0007 -0.0213 0.0024  280 TRP A O   
748  C CB  . TRP A 111 ? 0.3216 0.2660 0.2848 0.0000  -0.0205 -0.0021 280 TRP A CB  
749  C CG  . TRP A 111 ? 0.3842 0.3258 0.3454 -0.0007 -0.0206 -0.0045 280 TRP A CG  
750  C CD1 . TRP A 111 ? 0.4269 0.3637 0.3863 -0.0032 -0.0218 -0.0049 280 TRP A CD1 
751  C CD2 . TRP A 111 ? 0.3961 0.3394 0.3569 0.0011  -0.0194 -0.0070 280 TRP A CD2 
752  N NE1 . TRP A 111 ? 0.4263 0.3617 0.3841 -0.0034 -0.0214 -0.0077 280 TRP A NE1 
753  C CE2 . TRP A 111 ? 0.4712 0.4108 0.4298 -0.0006 -0.0200 -0.0091 280 TRP A CE2 
754  C CE3 . TRP A 111 ? 0.3965 0.3439 0.3582 0.0039  -0.0176 -0.0078 280 TRP A CE3 
755  C CZ2 . TRP A 111 ? 0.4649 0.4054 0.4223 0.0003  -0.0192 -0.0122 280 TRP A CZ2 
756  C CZ3 . TRP A 111 ? 0.4495 0.3977 0.4099 0.0052  -0.0167 -0.0104 280 TRP A CZ3 
757  C CH2 . TRP A 111 ? 0.4442 0.3892 0.4024 0.0035  -0.0176 -0.0127 280 TRP A CH2 
758  N N   . LEU A 112 ? 0.3442 0.2962 0.3066 -0.0039 -0.0204 0.0019  281 LEU A N   
759  C CA  . LEU A 112 ? 0.3440 0.2998 0.3073 -0.0033 -0.0190 0.0028  281 LEU A CA  
760  C C   . LEU A 112 ? 0.3169 0.2761 0.2790 -0.0020 -0.0169 0.0015  281 LEU A C   
761  O O   . LEU A 112 ? 0.3535 0.3144 0.3134 -0.0031 -0.0168 0.0010  281 LEU A O   
762  C CB  . LEU A 112 ? 0.3558 0.3128 0.3179 -0.0057 -0.0197 0.0046  281 LEU A CB  
763  C CG  . LEU A 112 ? 0.3830 0.3431 0.3458 -0.0053 -0.0182 0.0053  281 LEU A CG  
764  C CD1 . LEU A 112 ? 0.4277 0.3869 0.3926 -0.0054 -0.0195 0.0064  281 LEU A CD1 
765  C CD2 . LEU A 112 ? 0.4484 0.4110 0.4087 -0.0070 -0.0177 0.0062  281 LEU A CD2 
766  N N   . ILE A 113 ? 0.2710 0.2316 0.2345 0.0002  -0.0150 0.0011  282 ILE A N   
767  C CA  . ILE A 113 ? 0.2770 0.2401 0.2391 0.0021  -0.0127 0.0000  282 ILE A CA  
768  C C   . ILE A 113 ? 0.2850 0.2504 0.2464 0.0024  -0.0105 0.0012  282 ILE A C   
769  O O   . ILE A 113 ? 0.2632 0.2281 0.2266 0.0024  -0.0099 0.0018  282 ILE A O   
770  C CB  . ILE A 113 ? 0.3102 0.2724 0.2739 0.0048  -0.0117 -0.0013 282 ILE A CB  
771  C CG1 . ILE A 113 ? 0.3141 0.2731 0.2781 0.0046  -0.0137 -0.0026 282 ILE A CG1 
772  C CG2 . ILE A 113 ? 0.3343 0.2991 0.2962 0.0070  -0.0093 -0.0022 282 ILE A CG2 
773  C CD1 . ILE A 113 ? 0.3285 0.2856 0.2951 0.0068  -0.0136 -0.0033 282 ILE A CD1 
774  N N   . THR A 114 ? 0.2802 0.2482 0.2388 0.0028  -0.0092 0.0013  283 THR A N   
775  C CA  . THR A 114 ? 0.3040 0.2733 0.2610 0.0031  -0.0070 0.0026  283 THR A CA  
776  C C   . THR A 114 ? 0.2999 0.2716 0.2541 0.0059  -0.0044 0.0023  283 THR A C   
777  O O   . THR A 114 ? 0.3208 0.2940 0.2742 0.0072  -0.0047 0.0011  283 THR A O   
778  C CB  . THR A 114 ? 0.3147 0.2851 0.2703 0.0008  -0.0082 0.0038  283 THR A CB  
779  O OG1 . THR A 114 ? 0.3013 0.2746 0.2545 0.0009  -0.0086 0.0034  283 THR A OG1 
780  C CG2 . THR A 114 ? 0.3505 0.3188 0.3080 -0.0017 -0.0110 0.0042  283 THR A CG2 
781  N N   . HIS A 115 ? 0.3243 0.2961 0.2769 0.0068  -0.0017 0.0034  284 HIS A N   
782  C CA  . HIS A 115 ? 0.3273 0.3012 0.2762 0.0097  0.0009  0.0039  284 HIS A CA  
783  C C   . HIS A 115 ? 0.3267 0.3047 0.2736 0.0095  -0.0008 0.0036  284 HIS A C   
784  O O   . HIS A 115 ? 0.3080 0.2865 0.2554 0.0067  -0.0030 0.0040  284 HIS A O   
785  C CB  . HIS A 115 ? 0.3666 0.3390 0.3137 0.0098  0.0036  0.0054  284 HIS A CB  
786  C CG  . HIS A 115 ? 0.3993 0.3721 0.3426 0.0134  0.0074  0.0062  284 HIS A CG  
787  N ND1 . HIS A 115 ? 0.5591 0.5285 0.5009 0.0141  0.0109  0.0071  284 HIS A ND1 
788  C CD2 . HIS A 115 ? 0.4369 0.4130 0.3772 0.0165  0.0082  0.0062  284 HIS A CD2 
789  C CE1 . HIS A 115 ? 0.4967 0.4665 0.4345 0.0178  0.0140  0.0080  284 HIS A CE1 
790  N NE2 . HIS A 115 ? 0.4271 0.4014 0.3639 0.0195  0.0123  0.0075  284 HIS A NE2 
791  N N   . TYR A 116 ? 0.2879 0.2691 0.2327 0.0122  0.0000  0.0029  285 TYR A N   
792  C CA  . TYR A 116 ? 0.2874 0.2738 0.2304 0.0121  -0.0014 0.0023  285 TYR A CA  
793  C C   . TYR A 116 ? 0.3031 0.2928 0.2424 0.0145  0.0006  0.0038  285 TYR A C   
794  O O   . TYR A 116 ? 0.3236 0.3126 0.2606 0.0180  0.0038  0.0048  285 TYR A O   
795  C CB  . TYR A 116 ? 0.3177 0.3066 0.2601 0.0141  -0.0017 0.0004  285 TYR A CB  
796  C CG  . TYR A 116 ? 0.3225 0.3178 0.2634 0.0138  -0.0033 -0.0007 285 TYR A CG  
797  C CD1 . TYR A 116 ? 0.3536 0.3496 0.2962 0.0098  -0.0064 -0.0020 285 TYR A CD1 
798  C CD2 . TYR A 116 ? 0.3233 0.3242 0.2608 0.0174  -0.0017 -0.0006 285 TYR A CD2 
799  C CE1 . TYR A 116 ? 0.3661 0.3683 0.3075 0.0088  -0.0078 -0.0034 285 TYR A CE1 
800  C CE2 . TYR A 116 ? 0.3453 0.3533 0.2817 0.0169  -0.0034 -0.0020 285 TYR A CE2 
801  C CZ  . TYR A 116 ? 0.3919 0.4006 0.3304 0.0124  -0.0064 -0.0035 285 TYR A CZ  
802  O OH  . TYR A 116 ? 0.4352 0.4514 0.3728 0.0112  -0.0080 -0.0052 285 TYR A OH  
803  N N   . HIS A 117 ? 0.3068 0.3002 0.2455 0.0128  -0.0008 0.0042  286 HIS A N   
804  C CA  . HIS A 117 ? 0.2867 0.2839 0.2219 0.0152  0.0010  0.0057  286 HIS A CA  
805  C C   . HIS A 117 ? 0.2972 0.3024 0.2314 0.0153  -0.0006 0.0046  286 HIS A C   
806  O O   . HIS A 117 ? 0.2674 0.2750 0.2032 0.0117  -0.0032 0.0040  286 HIS A O   
807  C CB  . HIS A 117 ? 0.2888 0.2834 0.2241 0.0131  0.0012  0.0072  286 HIS A CB  
808  C CG  . HIS A 117 ? 0.2771 0.2650 0.2131 0.0130  0.0031  0.0080  286 HIS A CG  
809  N ND1 . HIS A 117 ? 0.2887 0.2740 0.2220 0.0164  0.0070  0.0090  286 HIS A ND1 
810  C CD2 . HIS A 117 ? 0.3141 0.2974 0.2532 0.0098  0.0019  0.0078  286 HIS A CD2 
811  C CE1 . HIS A 117 ? 0.2668 0.2464 0.2017 0.0149  0.0081  0.0092  286 HIS A CE1 
812  N NE2 . HIS A 117 ? 0.2794 0.2582 0.2179 0.0111  0.0050  0.0084  286 HIS A NE2 
813  N N   . GLU A 118 ? 0.3059 0.3156 0.2374 0.0194  0.0007  0.0044  287 GLU A N   
814  C CA  . GLU A 118 ? 0.3517 0.3699 0.2827 0.0195  -0.0010 0.0027  287 GLU A CA  
815  C C   . GLU A 118 ? 0.3607 0.3854 0.2904 0.0191  -0.0014 0.0036  287 GLU A C   
816  O O   . GLU A 118 ? 0.3199 0.3518 0.2501 0.0175  -0.0035 0.0020  287 GLU A O   
817  C CB  . GLU A 118 ? 0.3750 0.3971 0.3032 0.0244  0.0005  0.0021  287 GLU A CB  
818  C CG  . GLU A 118 ? 0.4621 0.4879 0.3858 0.0298  0.0035  0.0044  287 GLU A CG  
819  C CD  . GLU A 118 ? 0.5135 0.5436 0.4340 0.0350  0.0051  0.0041  287 GLU A CD  
820  O OE1 . GLU A 118 ? 0.4971 0.5364 0.4166 0.0361  0.0036  0.0026  287 GLU A OE1 
821  O OE2 . GLU A 118 ? 0.5374 0.5620 0.4560 0.0382  0.0081  0.0055  287 GLU A OE2 
822  N N   . MET A 119 ? 0.3517 0.3739 0.2797 0.0205  0.0005  0.0060  288 MET A N   
823  C CA  . MET A 119 ? 0.3459 0.3745 0.2726 0.0203  0.0002  0.0069  288 MET A CA  
824  C C   . MET A 119 ? 0.3097 0.3380 0.2397 0.0144  -0.0026 0.0061  288 MET A C   
825  O O   . MET A 119 ? 0.4276 0.4621 0.3573 0.0134  -0.0033 0.0064  288 MET A O   
826  C CB  . MET A 119 ? 0.4141 0.4399 0.3377 0.0236  0.0034  0.0096  288 MET A CB  
827  C CG  . MET A 119 ? 0.5509 0.5737 0.4707 0.0294  0.0072  0.0110  288 MET A CG  
828  S SD  . MET A 119 ? 0.8150 0.8468 0.7299 0.0358  0.0093  0.0125  288 MET A SD  
829  C CE  . MET A 119 ? 0.5203 0.5623 0.4376 0.0342  0.0055  0.0095  288 MET A CE  
830  N N   . GLY A 120 ? 0.3213 0.3427 0.2543 0.0107  -0.0041 0.0054  289 GLY A N   
831  C CA  . GLY A 120 ? 0.3422 0.3624 0.2778 0.0052  -0.0067 0.0049  289 GLY A CA  
832  C C   . GLY A 120 ? 0.3211 0.3387 0.2562 0.0040  -0.0060 0.0070  289 GLY A C   
833  O O   . GLY A 120 ? 0.3172 0.3308 0.2506 0.0067  -0.0036 0.0086  289 GLY A O   
834  N N   . SER A 121 ? 0.2845 0.3040 0.2210 0.0000  -0.0080 0.0069  290 SER A N   
835  C CA  . SER A 121 ? 0.2776 0.2943 0.2137 -0.0016 -0.0077 0.0087  290 SER A CA  
836  C C   . SER A 121 ? 0.2885 0.3109 0.2218 0.0011  -0.0058 0.0101  290 SER A C   
837  O O   . SER A 121 ? 0.2841 0.3144 0.2163 0.0031  -0.0055 0.0095  290 SER A O   
838  C CB  . SER A 121 ? 0.3010 0.3172 0.2392 -0.0069 -0.0103 0.0084  290 SER A CB  
839  O OG  . SER A 121 ? 0.3360 0.3605 0.2741 -0.0084 -0.0111 0.0076  290 SER A OG  
840  N N   . LEU A 122 ? 0.2922 0.3108 0.2242 0.0013  -0.0045 0.0118  291 LEU A N   
841  C CA  . LEU A 122 ? 0.2828 0.3059 0.2119 0.0037  -0.0027 0.0132  291 LEU A CA  
842  C C   . LEU A 122 ? 0.3110 0.3427 0.2409 0.0011  -0.0045 0.0127  291 LEU A C   
843  O O   . LEU A 122 ? 0.2908 0.3305 0.2190 0.0039  -0.0034 0.0130  291 LEU A O   
844  C CB  . LEU A 122 ? 0.2714 0.2881 0.1995 0.0028  -0.0016 0.0145  291 LEU A CB  
845  C CG  . LEU A 122 ? 0.3010 0.3204 0.2256 0.0053  0.0005  0.0160  291 LEU A CG  
846  C CD1 . LEU A 122 ? 0.3213 0.3426 0.2426 0.0114  0.0036  0.0166  291 LEU A CD1 
847  C CD2 . LEU A 122 ? 0.3019 0.3142 0.2256 0.0039  0.0013  0.0168  291 LEU A CD2 
848  N N   . TYR A 123 ? 0.2880 0.3183 0.2207 -0.0040 -0.0070 0.0121  292 TYR A N   
849  C CA  . TYR A 123 ? 0.3196 0.3577 0.2535 -0.0074 -0.0086 0.0114  292 TYR A CA  
850  C C   . TYR A 123 ? 0.3451 0.3922 0.2792 -0.0057 -0.0088 0.0098  292 TYR A C   
851  O O   . TYR A 123 ? 0.3232 0.3795 0.2563 -0.0047 -0.0084 0.0099  292 TYR A O   
852  C CB  . TYR A 123 ? 0.3483 0.3818 0.2848 -0.0131 -0.0111 0.0108  292 TYR A CB  
853  C CG  . TYR A 123 ? 0.3581 0.3986 0.2959 -0.0173 -0.0125 0.0100  292 TYR A CG  
854  C CD1 . TYR A 123 ? 0.3765 0.4199 0.3137 -0.0193 -0.0123 0.0114  292 TYR A CD1 
855  C CD2 . TYR A 123 ? 0.3931 0.4369 0.3327 -0.0196 -0.0139 0.0076  292 TYR A CD2 
856  C CE1 . TYR A 123 ? 0.3738 0.4237 0.3123 -0.0235 -0.0134 0.0106  292 TYR A CE1 
857  C CE2 . TYR A 123 ? 0.4387 0.4888 0.3795 -0.0241 -0.0150 0.0066  292 TYR A CE2 
858  C CZ  . TYR A 123 ? 0.4153 0.4684 0.3556 -0.0261 -0.0147 0.0082  292 TYR A CZ  
859  O OH  . TYR A 123 ? 0.4099 0.4693 0.3515 -0.0308 -0.0154 0.0073  292 TYR A OH  
860  N N   . ASP A 124 ? 0.3634 0.4085 0.2984 -0.0052 -0.0095 0.0081  293 ASP A N   
861  C CA  . ASP A 124 ? 0.3790 0.4331 0.3139 -0.0036 -0.0098 0.0063  293 ASP A CA  
862  C C   . ASP A 124 ? 0.3666 0.4264 0.2985 0.0027  -0.0074 0.0073  293 ASP A C   
863  O O   . ASP A 124 ? 0.3452 0.4157 0.2765 0.0041  -0.0075 0.0067  293 ASP A O   
864  C CB  . ASP A 124 ? 0.4144 0.4647 0.3508 -0.0045 -0.0110 0.0042  293 ASP A CB  
865  C CG  . ASP A 124 ? 0.4666 0.5133 0.4058 -0.0109 -0.0134 0.0026  293 ASP A CG  
866  O OD1 . ASP A 124 ? 0.5056 0.5574 0.4459 -0.0150 -0.0145 0.0020  293 ASP A OD1 
867  O OD2 . ASP A 124 ? 0.4991 0.5374 0.4394 -0.0118 -0.0140 0.0022  293 ASP A OD2 
868  N N   . TYR A 125 ? 0.3117 0.3643 0.2413 0.0067  -0.0052 0.0091  294 TYR A N   
869  C CA  . TYR A 125 ? 0.3123 0.3685 0.2382 0.0134  -0.0024 0.0104  294 TYR A CA  
870  C C   . TYR A 125 ? 0.3559 0.4194 0.2799 0.0152  -0.0013 0.0118  294 TYR A C   
871  O O   . TYR A 125 ? 0.3538 0.4259 0.2757 0.0198  -0.0002 0.0121  294 TYR A O   
872  C CB  . TYR A 125 ? 0.3067 0.3523 0.2306 0.0162  0.0000  0.0120  294 TYR A CB  
873  C CG  . TYR A 125 ? 0.3649 0.4111 0.2844 0.0231  0.0035  0.0136  294 TYR A CG  
874  C CD1 . TYR A 125 ? 0.3604 0.4105 0.2784 0.0273  0.0042  0.0131  294 TYR A CD1 
875  C CD2 . TYR A 125 ? 0.3609 0.4031 0.2773 0.0256  0.0062  0.0158  294 TYR A CD2 
876  C CE1 . TYR A 125 ? 0.3368 0.3869 0.2501 0.0340  0.0077  0.0150  294 TYR A CE1 
877  C CE2 . TYR A 125 ? 0.3771 0.4187 0.2889 0.0321  0.0098  0.0174  294 TYR A CE2 
878  C CZ  . TYR A 125 ? 0.3649 0.4102 0.2752 0.0364  0.0106  0.0172  294 TYR A CZ  
879  O OH  . TYR A 125 ? 0.3431 0.3869 0.2483 0.0432  0.0145  0.0192  294 TYR A OH  
880  N N   . LEU A 126 ? 0.3171 0.3773 0.2418 0.0119  -0.0016 0.0128  295 LEU A N   
881  C CA  . LEU A 126 ? 0.3730 0.4397 0.2959 0.0134  -0.0004 0.0142  295 LEU A CA  
882  C C   . LEU A 126 ? 0.3604 0.4402 0.2851 0.0117  -0.0022 0.0128  295 LEU A C   
883  O O   . LEU A 126 ? 0.3141 0.4025 0.2373 0.0143  -0.0012 0.0137  295 LEU A O   
884  C CB  . LEU A 126 ? 0.3552 0.4156 0.2785 0.0097  -0.0006 0.0153  295 LEU A CB  
885  C CG  . LEU A 126 ? 0.3699 0.4187 0.2912 0.0111  0.0013  0.0166  295 LEU A CG  
886  C CD1 . LEU A 126 ? 0.3595 0.4041 0.2815 0.0068  0.0005  0.0173  295 LEU A CD1 
887  C CD2 . LEU A 126 ? 0.3814 0.4300 0.2981 0.0179  0.0049  0.0182  295 LEU A CD2 
888  N N   . GLN A 127 ? 0.4241 0.5058 0.3522 0.0071  -0.0049 0.0105  296 GLN A N   
889  C CA  . GLN A 127 ? 0.5039 0.5981 0.4340 0.0045  -0.0065 0.0088  296 GLN A CA  
890  C C   . GLN A 127 ? 0.5472 0.6541 0.4758 0.0095  -0.0059 0.0081  296 GLN A C   
891  O O   . GLN A 127 ? 0.6545 0.7727 0.5834 0.0096  -0.0059 0.0081  296 GLN A O   
892  C CB  . GLN A 127 ? 0.4873 0.5796 0.4210 -0.0024 -0.0092 0.0063  296 GLN A CB  
893  C CG  . GLN A 127 ? 0.6434 0.7361 0.5787 -0.0078 -0.0100 0.0069  296 GLN A CG  
894  C CD  . GLN A 127 ? 0.5691 0.6531 0.5068 -0.0139 -0.0118 0.0060  296 GLN A CD  
895  O OE1 . GLN A 127 ? 0.7821 0.8700 0.7221 -0.0192 -0.0134 0.0040  296 GLN A OE1 
896  N NE2 . GLN A 127 ? 0.6779 0.7498 0.6148 -0.0133 -0.0115 0.0073  296 GLN A NE2 
897  N N   . LEU A 128 ? 0.5282 0.6341 0.4552 0.0138  -0.0052 0.0077  297 LEU A N   
898  C CA  . LEU A 128 ? 0.8239 0.9419 0.7488 0.0197  -0.0044 0.0075  297 LEU A CA  
899  C C   . LEU A 128 ? 0.7075 0.8209 0.6275 0.0281  -0.0010 0.0102  297 LEU A C   
900  O O   . LEU A 128 ? 0.7627 0.8829 0.6805 0.0334  -0.0003 0.0101  297 LEU A O   
901  C CB  . LEU A 128 ? 1.0300 1.1559 0.9570 0.0179  -0.0067 0.0042  297 LEU A CB  
902  C CG  . LEU A 128 ? 1.0576 1.1921 0.9889 0.0105  -0.0095 0.0011  297 LEU A CG  
903  C CD1 . LEU A 128 ? 1.1257 1.2668 1.0579 0.0100  -0.0112 -0.0022 297 LEU A CD1 
904  C CD2 . LEU A 128 ? 0.8290 0.9766 0.7608 0.0102  -0.0095 0.0014  297 LEU A CD2 
905  N N   . THR A 129 ? 0.4975 0.5993 0.4155 0.0291  0.0010  0.0126  298 THR A N   
906  C CA  . THR A 129 ? 0.4757 0.5737 0.3887 0.0366  0.0046  0.0152  298 THR A CA  
907  C C   . THR A 129 ? 0.3797 0.4746 0.2907 0.0375  0.0066  0.0174  298 THR A C   
908  O O   . THR A 129 ? 0.4213 0.5094 0.3344 0.0322  0.0058  0.0174  298 THR A O   
909  C CB  . THR A 129 ? 0.5196 0.6038 0.4314 0.0374  0.0061  0.0158  298 THR A CB  
910  O OG1 . THR A 129 ? 0.6711 0.7563 0.5852 0.0355  0.0040  0.0135  298 THR A OG1 
911  C CG2 . THR A 129 ? 0.4764 0.5569 0.3827 0.0452  0.0102  0.0183  298 THR A CG2 
912  N N   . THR A 130 ? 0.3522 0.4516 0.2589 0.0446  0.0094  0.0194  299 THR A N   
913  C CA  . THR A 130 ? 0.3832 0.4777 0.2865 0.0472  0.0123  0.0218  299 THR A CA  
914  C C   . THR A 130 ? 0.4128 0.4948 0.3115 0.0522  0.0160  0.0236  299 THR A C   
915  O O   . THR A 130 ? 0.4134 0.4940 0.3111 0.0547  0.0165  0.0234  299 THR A O   
916  C CB  . THR A 130 ? 0.4020 0.5094 0.3033 0.0520  0.0133  0.0229  299 THR A CB  
917  O OG1 . THR A 130 ? 0.4220 0.5363 0.3202 0.0592  0.0146  0.0236  299 THR A OG1 
918  C CG2 . THR A 130 ? 0.4304 0.5505 0.3367 0.0463  0.0098  0.0208  299 THR A CG2 
919  N N   . LEU A 131 ? 0.3518 0.4245 0.2475 0.0530  0.0187  0.0252  300 LEU A N   
920  C CA  . LEU A 131 ? 0.3480 0.4064 0.2402 0.0551  0.0221  0.0264  300 LEU A CA  
921  C C   . LEU A 131 ? 0.3401 0.3962 0.2257 0.0627  0.0268  0.0290  300 LEU A C   
922  O O   . LEU A 131 ? 0.3758 0.4373 0.2603 0.0640  0.0272  0.0297  300 LEU A O   
923  C CB  . LEU A 131 ? 0.3470 0.3952 0.2417 0.0484  0.0212  0.0256  300 LEU A CB  
924  C CG  . LEU A 131 ? 0.3431 0.3921 0.2441 0.0405  0.0167  0.0233  300 LEU A CG  
925  C CD1 . LEU A 131 ? 0.3566 0.3957 0.2590 0.0351  0.0163  0.0230  300 LEU A CD1 
926  C CD2 . LEU A 131 ? 0.3509 0.3980 0.2537 0.0402  0.0157  0.0222  300 LEU A CD2 
927  N N   . ASP A 132 ? 0.3357 0.3834 0.2168 0.0677  0.0305  0.0304  301 ASP A N   
928  C CA  . ASP A 132 ? 0.3357 0.3767 0.2099 0.0741  0.0356  0.0328  301 ASP A CA  
929  C C   . ASP A 132 ? 0.3954 0.4233 0.2694 0.0695  0.0370  0.0324  301 ASP A C   
930  O O   . ASP A 132 ? 0.3563 0.3820 0.2354 0.0620  0.0338  0.0305  301 ASP A O   
931  C CB  . ASP A 132 ? 0.3396 0.3767 0.2082 0.0817  0.0395  0.0348  301 ASP A CB  
932  C CG  . ASP A 132 ? 0.4063 0.4322 0.2756 0.0792  0.0404  0.0342  301 ASP A CG  
933  O OD1 . ASP A 132 ? 0.4106 0.4324 0.2851 0.0716  0.0376  0.0321  301 ASP A OD1 
934  O OD2 . ASP A 132 ? 0.4081 0.4297 0.2726 0.0852  0.0440  0.0359  301 ASP A OD2 
935  N N   . THR A 133 ? 0.3949 0.4147 0.2628 0.0740  0.0417  0.0341  302 THR A N   
936  C CA  . THR A 133 ? 0.4059 0.4142 0.2730 0.0699  0.0433  0.0335  302 THR A CA  
937  C C   . THR A 133 ? 0.4186 0.4152 0.2873 0.0656  0.0438  0.0323  302 THR A C   
938  O O   . THR A 133 ? 0.4107 0.4032 0.2834 0.0586  0.0415  0.0304  302 THR A O   
939  C CB  . THR A 133 ? 0.4042 0.4067 0.2638 0.0762  0.0485  0.0355  302 THR A CB  
940  O OG1 . THR A 133 ? 0.4360 0.4511 0.2951 0.0798  0.0475  0.0364  302 THR A OG1 
941  C CG2 . THR A 133 ? 0.4276 0.4186 0.2861 0.0718  0.0502  0.0344  302 THR A CG2 
942  N N   . VAL A 134 ? 0.3903 0.3825 0.2559 0.0700  0.0467  0.0334  303 VAL A N   
943  C CA  . VAL A 134 ? 0.4405 0.4229 0.3076 0.0666  0.0474  0.0324  303 VAL A CA  
944  C C   . VAL A 134 ? 0.3913 0.3781 0.2663 0.0591  0.0418  0.0300  303 VAL A C   
945  O O   . VAL A 134 ? 0.3649 0.3443 0.2426 0.0536  0.0413  0.0285  303 VAL A O   
946  C CB  . VAL A 134 ? 0.4944 0.4750 0.3576 0.0729  0.0506  0.0342  303 VAL A CB  
947  C CG1 . VAL A 134 ? 0.4925 0.4636 0.3574 0.0695  0.0516  0.0332  303 VAL A CG1 
948  C CG2 . VAL A 134 ? 0.5029 0.4782 0.3575 0.0809  0.0565  0.0369  303 VAL A CG2 
949  N N   . SER A 135 ? 0.3471 0.3462 0.2257 0.0591  0.0379  0.0296  304 SER A N   
950  C CA  . SER A 135 ? 0.3541 0.3570 0.2395 0.0528  0.0330  0.0274  304 SER A CA  
951  C C   . SER A 135 ? 0.3209 0.3245 0.2101 0.0464  0.0299  0.0261  304 SER A C   
952  O O   . SER A 135 ? 0.3457 0.3455 0.2391 0.0407  0.0275  0.0245  304 SER A O   
953  C CB  . SER A 135 ? 0.3639 0.3793 0.2515 0.0544  0.0299  0.0270  304 SER A CB  
954  O OG  . SER A 135 ? 0.4773 0.4926 0.3611 0.0607  0.0327  0.0283  304 SER A OG  
955  N N   . CYS A 136 ? 0.3546 0.3639 0.2425 0.0474  0.0297  0.0267  305 CYS A N   
956  C CA  . CYS A 136 ? 0.3291 0.3379 0.2196 0.0418  0.0274  0.0258  305 CYS A CA  
957  C C   . CYS A 136 ? 0.3269 0.3233 0.2169 0.0385  0.0291  0.0251  305 CYS A C   
958  O O   . CYS A 136 ? 0.3335 0.3280 0.2277 0.0326  0.0261  0.0237  305 CYS A O   
959  C CB  . CYS A 136 ? 0.3597 0.3740 0.2472 0.0446  0.0286  0.0270  305 CYS A CB  
960  S SG  . CYS A 136 ? 0.3715 0.3852 0.2616 0.0379  0.0261  0.0260  305 CYS A SG  
961  N N   . LEU A 137 ? 0.3380 0.3261 0.2225 0.0424  0.0339  0.0261  306 LEU A N   
962  C CA  . LEU A 137 ? 0.3722 0.3488 0.2558 0.0391  0.0359  0.0251  306 LEU A CA  
963  C C   . LEU A 137 ? 0.3938 0.3657 0.2813 0.0355  0.0348  0.0238  306 LEU A C   
964  O O   . LEU A 137 ? 0.3679 0.3352 0.2582 0.0301  0.0334  0.0223  306 LEU A O   
965  C CB  . LEU A 137 ? 0.3697 0.3378 0.2462 0.0440  0.0418  0.0263  306 LEU A CB  
966  C CG  . LEU A 137 ? 0.4387 0.4100 0.3116 0.0465  0.0429  0.0273  306 LEU A CG  
967  C CD1 . LEU A 137 ? 0.4563 0.4197 0.3213 0.0528  0.0491  0.0288  306 LEU A CD1 
968  C CD2 . LEU A 137 ? 0.4863 0.4564 0.3616 0.0404  0.0406  0.0256  306 LEU A CD2 
969  N N   . ARG A 138 ? 0.3620 0.3357 0.2496 0.0386  0.0352  0.0244  307 ARG A N   
970  C CA  . ARG A 138 ? 0.3853 0.3549 0.2763 0.0357  0.0344  0.0232  307 ARG A CA  
971  C C   . ARG A 138 ? 0.3555 0.3301 0.2531 0.0298  0.0289  0.0216  307 ARG A C   
972  O O   . ARG A 138 ? 0.3307 0.3006 0.2316 0.0254  0.0278  0.0202  307 ARG A O   
973  C CB  . ARG A 138 ? 0.4521 0.4238 0.3418 0.0406  0.0358  0.0242  307 ARG A CB  
974  C CG  . ARG A 138 ? 0.4769 0.4437 0.3692 0.0385  0.0359  0.0232  307 ARG A CG  
975  C CD  . ARG A 138 ? 0.5598 0.5293 0.4500 0.0439  0.0374  0.0244  307 ARG A CD  
976  N NE  . ARG A 138 ? 0.5902 0.5525 0.4736 0.0493  0.0433  0.0263  307 ARG A NE  
977  C CZ  . ARG A 138 ? 0.7662 0.7312 0.6450 0.0562  0.0458  0.0283  307 ARG A CZ  
978  N NH1 . ARG A 138 ? 0.8863 0.8620 0.7665 0.0585  0.0428  0.0284  307 ARG A NH1 
979  N NH2 . ARG A 138 ? 0.6830 0.6396 0.5554 0.0608  0.0515  0.0302  307 ARG A NH2 
980  N N   . ILE A 139 ? 0.3146 0.2987 0.2141 0.0297  0.0257  0.0217  308 ILE A N   
981  C CA  . ILE A 139 ? 0.3253 0.3135 0.2303 0.0243  0.0208  0.0204  308 ILE A CA  
982  C C   . ILE A 139 ? 0.3263 0.3102 0.2325 0.0195  0.0198  0.0197  308 ILE A C   
983  O O   . ILE A 139 ? 0.3303 0.3107 0.2401 0.0155  0.0180  0.0185  308 ILE A O   
984  C CB  . ILE A 139 ? 0.3493 0.3484 0.2556 0.0248  0.0180  0.0206  308 ILE A CB  
985  C CG1 . ILE A 139 ? 0.3124 0.3161 0.2187 0.0283  0.0180  0.0206  308 ILE A CG1 
986  C CG2 . ILE A 139 ? 0.3497 0.3519 0.2610 0.0187  0.0134  0.0195  308 ILE A CG2 
987  C CD1 . ILE A 139 ? 0.3249 0.3402 0.2321 0.0293  0.0158  0.0206  308 ILE A CD1 
988  N N   . VAL A 140 ? 0.3242 0.3084 0.2273 0.0204  0.0212  0.0204  309 VAL A N   
989  C CA  . VAL A 140 ? 0.3304 0.3122 0.2347 0.0157  0.0197  0.0197  309 VAL A CA  
990  C C   . VAL A 140 ? 0.3245 0.2967 0.2281 0.0139  0.0218  0.0187  309 VAL A C   
991  O O   . VAL A 140 ? 0.3288 0.2993 0.2355 0.0093  0.0194  0.0175  309 VAL A O   
992  C CB  . VAL A 140 ? 0.3435 0.3291 0.2449 0.0168  0.0202  0.0206  309 VAL A CB  
993  C CG1 . VAL A 140 ? 0.3087 0.3048 0.2119 0.0173  0.0176  0.0213  309 VAL A CG1 
994  C CG2 . VAL A 140 ? 0.3651 0.3467 0.2605 0.0219  0.0251  0.0216  309 VAL A CG2 
995  N N   . LEU A 141 ? 0.3148 0.2809 0.2144 0.0175  0.0263  0.0190  310 LEU A N   
996  C CA  . LEU A 141 ? 0.3228 0.2800 0.2222 0.0154  0.0286  0.0177  310 LEU A CA  
997  C C   . LEU A 141 ? 0.3307 0.2879 0.2355 0.0121  0.0260  0.0165  310 LEU A C   
998  O O   . LEU A 141 ? 0.3143 0.2681 0.2215 0.0079  0.0251  0.0150  310 LEU A O   
999  C CB  . LEU A 141 ? 0.3510 0.3014 0.2451 0.0200  0.0343  0.0185  310 LEU A CB  
1000 C CG  . LEU A 141 ? 0.3676 0.3083 0.2609 0.0178  0.0376  0.0171  310 LEU A CG  
1001 C CD1 . LEU A 141 ? 0.3947 0.3320 0.2881 0.0132  0.0372  0.0153  310 LEU A CD1 
1002 C CD2 . LEU A 141 ? 0.3634 0.2970 0.2503 0.0229  0.0436  0.0183  310 LEU A CD2 
1003 N N   . SER A 142 ? 0.2986 0.2599 0.2052 0.0142  0.0248  0.0171  311 SER A N   
1004 C CA  . SER A 142 ? 0.3013 0.2623 0.2127 0.0116  0.0225  0.0160  311 SER A CA  
1005 C C   . SER A 142 ? 0.2880 0.2524 0.2041 0.0068  0.0177  0.0151  311 SER A C   
1006 O O   . SER A 142 ? 0.3279 0.2900 0.2474 0.0036  0.0164  0.0139  311 SER A O   
1007 C CB  . SER A 142 ? 0.3047 0.2693 0.2167 0.0150  0.0224  0.0166  311 SER A CB  
1008 O OG  . SER A 142 ? 0.2910 0.2636 0.2044 0.0154  0.0192  0.0171  311 SER A OG  
1009 N N   . ILE A 143 ? 0.2852 0.2553 0.2013 0.0063  0.0152  0.0158  312 ILE A N   
1010 C CA  . ILE A 143 ? 0.2957 0.2684 0.2157 0.0018  0.0109  0.0153  312 ILE A CA  
1011 C C   . ILE A 143 ? 0.3014 0.2698 0.2212 -0.0012 0.0112  0.0145  312 ILE A C   
1012 O O   . ILE A 143 ? 0.3355 0.3031 0.2588 -0.0044 0.0087  0.0136  312 ILE A O   
1013 C CB  . ILE A 143 ? 0.3095 0.2888 0.2292 0.0017  0.0087  0.0163  312 ILE A CB  
1014 C CG1 . ILE A 143 ? 0.3110 0.2953 0.2316 0.0040  0.0080  0.0165  312 ILE A CG1 
1015 C CG2 . ILE A 143 ? 0.3122 0.2931 0.2352 -0.0027 0.0047  0.0161  312 ILE A CG2 
1016 C CD1 . ILE A 143 ? 0.3610 0.3527 0.2804 0.0051  0.0072  0.0174  312 ILE A CD1 
1017 N N   . ALA A 144 ? 0.2963 0.2620 0.2118 0.0000  0.0142  0.0147  313 ALA A N   
1018 C CA  . ALA A 144 ? 0.3355 0.2972 0.2502 -0.0027 0.0149  0.0135  313 ALA A CA  
1019 C C   . ALA A 144 ? 0.3442 0.3007 0.2608 -0.0045 0.0161  0.0119  313 ALA A C   
1020 O O   . ALA A 144 ? 0.3119 0.2678 0.2307 -0.0082 0.0144  0.0106  313 ALA A O   
1021 C CB  . ALA A 144 ? 0.3739 0.3326 0.2829 -0.0004 0.0188  0.0138  313 ALA A CB  
1022 N N   A SER A 145 ? 0.3182 0.2717 0.2340 -0.0018 0.0191  0.0119  314 SER A N   
1023 N N   B SER A 145 ? 0.3296 0.2831 0.2455 -0.0018 0.0191  0.0119  314 SER A N   
1024 C CA  A SER A 145 ? 0.3173 0.2664 0.2351 -0.0034 0.0206  0.0104  314 SER A CA  
1025 C CA  B SER A 145 ? 0.3379 0.2870 0.2557 -0.0035 0.0206  0.0104  314 SER A CA  
1026 C C   A SER A 145 ? 0.3231 0.2757 0.2468 -0.0062 0.0164  0.0097  314 SER A C   
1027 C C   B SER A 145 ? 0.3351 0.2877 0.2589 -0.0062 0.0164  0.0097  314 SER A C   
1028 O O   A SER A 145 ? 0.3125 0.2637 0.2388 -0.0093 0.0158  0.0081  314 SER A O   
1029 O O   B SER A 145 ? 0.3242 0.2754 0.2506 -0.0093 0.0158  0.0081  314 SER A O   
1030 C CB  A SER A 145 ? 0.3265 0.2722 0.2421 0.0004  0.0246  0.0111  314 SER A CB  
1031 C CB  B SER A 145 ? 0.3660 0.3112 0.2814 0.0001  0.0248  0.0109  314 SER A CB  
1032 O OG  A SER A 145 ? 0.3096 0.2503 0.2264 -0.0013 0.0270  0.0096  314 SER A OG  
1033 O OG  B SER A 145 ? 0.3753 0.3168 0.2848 0.0030  0.0289  0.0118  314 SER A OG  
1034 N N   . GLY A 146 ? 0.3327 0.2900 0.2584 -0.0049 0.0135  0.0108  315 GLY A N   
1035 C CA  . GLY A 146 ? 0.3174 0.2775 0.2481 -0.0070 0.0096  0.0104  315 GLY A CA  
1036 C C   . GLY A 146 ? 0.3438 0.3057 0.2763 -0.0105 0.0063  0.0101  315 GLY A C   
1037 O O   . GLY A 146 ? 0.2921 0.2544 0.2282 -0.0126 0.0043  0.0091  315 GLY A O   
1038 N N   . LEU A 147 ? 0.3004 0.2641 0.2302 -0.0107 0.0057  0.0110  316 LEU A N   
1039 C CA  . LEU A 147 ? 0.2963 0.2620 0.2272 -0.0137 0.0025  0.0110  316 LEU A CA  
1040 C C   . LEU A 147 ? 0.2846 0.2475 0.2151 -0.0160 0.0037  0.0093  316 LEU A C   
1041 O O   . LEU A 147 ? 0.3051 0.2695 0.2381 -0.0186 0.0011  0.0087  316 LEU A O   
1042 C CB  . LEU A 147 ? 0.2965 0.2649 0.2243 -0.0133 0.0020  0.0124  316 LEU A CB  
1043 C CG  . LEU A 147 ? 0.3324 0.3032 0.2607 -0.0161 -0.0011 0.0130  316 LEU A CG  
1044 C CD1 . LEU A 147 ? 0.3256 0.2984 0.2579 -0.0175 -0.0049 0.0135  316 LEU A CD1 
1045 C CD2 . LEU A 147 ? 0.3553 0.3288 0.2803 -0.0154 -0.0007 0.0143  316 LEU A CD2 
1046 N N   . ALA A 148 ? 0.2717 0.2307 0.1988 -0.0151 0.0078  0.0085  317 ALA A N   
1047 C CA  . ALA A 148 ? 0.3014 0.2576 0.2282 -0.0178 0.0093  0.0064  317 ALA A CA  
1048 C C   . ALA A 148 ? 0.3391 0.2953 0.2706 -0.0194 0.0086  0.0049  317 ALA A C   
1049 O O   . ALA A 148 ? 0.3173 0.2749 0.2509 -0.0223 0.0069  0.0035  317 ALA A O   
1050 C CB  . ALA A 148 ? 0.3021 0.2528 0.2242 -0.0165 0.0143  0.0057  317 ALA A CB  
1051 N N   . HIS A 149 ? 0.3363 0.2916 0.2693 -0.0172 0.0097  0.0054  318 HIS A N   
1052 C CA  . HIS A 149 ? 0.3406 0.2964 0.2781 -0.0184 0.0090  0.0041  318 HIS A CA  
1053 C C   . HIS A 149 ? 0.3132 0.2739 0.2550 -0.0199 0.0040  0.0044  318 HIS A C   
1054 O O   . HIS A 149 ? 0.3314 0.2937 0.2766 -0.0220 0.0028  0.0029  318 HIS A O   
1055 C CB  . HIS A 149 ? 0.3516 0.3058 0.2897 -0.0155 0.0111  0.0047  318 HIS A CB  
1056 C CG  . HIS A 149 ? 0.3339 0.2878 0.2760 -0.0168 0.0117  0.0031  318 HIS A CG  
1057 N ND1 . HIS A 149 ? 0.3568 0.3074 0.2984 -0.0188 0.0153  0.0012  318 HIS A ND1 
1058 C CD2 . HIS A 149 ? 0.3217 0.2785 0.2683 -0.0166 0.0094  0.0030  318 HIS A CD2 
1059 C CE1 . HIS A 149 ? 0.3545 0.3065 0.3005 -0.0198 0.0151  0.0000  318 HIS A CE1 
1060 N NE2 . HIS A 149 ? 0.3616 0.3175 0.3107 -0.0183 0.0115  0.0011  318 HIS A NE2 
1061 N N   . LEU A 150 ? 0.3329 0.2960 0.2746 -0.0187 0.0012  0.0063  319 LEU A N   
1062 C CA  . LEU A 150 ? 0.3207 0.2874 0.2655 -0.0200 -0.0032 0.0069  319 LEU A CA  
1063 C C   . LEU A 150 ? 0.3512 0.3194 0.2955 -0.0227 -0.0046 0.0061  319 LEU A C   
1064 O O   . LEU A 150 ? 0.3145 0.2851 0.2621 -0.0242 -0.0068 0.0052  319 LEU A O   
1065 C CB  . LEU A 150 ? 0.3067 0.2750 0.2504 -0.0188 -0.0053 0.0090  319 LEU A CB  
1066 C CG  . LEU A 150 ? 0.3210 0.2892 0.2660 -0.0165 -0.0053 0.0096  319 LEU A CG  
1067 C CD1 . LEU A 150 ? 0.3382 0.3081 0.2816 -0.0159 -0.0069 0.0112  319 LEU A CD1 
1068 C CD2 . LEU A 150 ? 0.3099 0.2787 0.2593 -0.0167 -0.0075 0.0091  319 LEU A CD2 
1069 N N   . HIS A 151 ? 0.3353 0.3026 0.2756 -0.0232 -0.0033 0.0063  320 HIS A N   
1070 C CA  . HIS A 151 ? 0.3463 0.3154 0.2854 -0.0256 -0.0048 0.0057  320 HIS A CA  
1071 C C   . HIS A 151 ? 0.3439 0.3131 0.2842 -0.0281 -0.0038 0.0029  320 HIS A C   
1072 O O   . HIS A 151 ? 0.3682 0.3405 0.3091 -0.0302 -0.0062 0.0023  320 HIS A O   
1073 C CB  . HIS A 151 ? 0.3314 0.2993 0.2655 -0.0253 -0.0032 0.0064  320 HIS A CB  
1074 C CG  . HIS A 151 ? 0.3000 0.2700 0.2332 -0.0242 -0.0054 0.0089  320 HIS A CG  
1075 N ND1 . HIS A 151 ? 0.3124 0.2828 0.2416 -0.0240 -0.0047 0.0099  320 HIS A ND1 
1076 C CD2 . HIS A 151 ? 0.3022 0.2741 0.2379 -0.0235 -0.0082 0.0105  320 HIS A CD2 
1077 C CE1 . HIS A 151 ? 0.3506 0.3235 0.2801 -0.0234 -0.0070 0.0120  320 HIS A CE1 
1078 N NE2 . HIS A 151 ? 0.3466 0.3200 0.2798 -0.0233 -0.0091 0.0124  320 HIS A NE2 
1079 N N   . ILE A 152 ? 0.3600 0.3259 0.3005 -0.0280 -0.0002 0.0013  321 ILE A N   
1080 C CA  A ILE A 152 ? 0.3347 0.3000 0.2758 -0.0310 0.0016  -0.0016 321 ILE A CA  
1081 C CA  B ILE A 152 ? 0.3446 0.3099 0.2857 -0.0309 0.0016  -0.0016 321 ILE A CA  
1082 C C   . ILE A 152 ? 0.3637 0.3331 0.3105 -0.0322 -0.0005 -0.0028 321 ILE A C   
1083 O O   . ILE A 152 ? 0.3392 0.3090 0.2891 -0.0304 -0.0009 -0.0019 321 ILE A O   
1084 C CB  A ILE A 152 ? 0.3726 0.3318 0.3110 -0.0306 0.0070  -0.0028 321 ILE A CB  
1085 C CB  B ILE A 152 ? 0.4048 0.3639 0.3431 -0.0304 0.0071  -0.0027 321 ILE A CB  
1086 C CG1 A ILE A 152 ? 0.3816 0.3370 0.3140 -0.0295 0.0094  -0.0021 321 ILE A CG1 
1087 C CG1 B ILE A 152 ? 0.4637 0.4209 0.4007 -0.0340 0.0096  -0.0059 321 ILE A CG1 
1088 C CG2 A ILE A 152 ? 0.4067 0.3653 0.3466 -0.0341 0.0091  -0.0062 321 ILE A CG2 
1089 C CG2 B ILE A 152 ? 0.4128 0.3706 0.3540 -0.0287 0.0085  -0.0024 321 ILE A CG2 
1090 C CD1 A ILE A 152 ? 0.3542 0.3028 0.2830 -0.0280 0.0150  -0.0025 321 ILE A CD1 
1091 C CD1 B ILE A 152 ? 0.4990 0.4493 0.4336 -0.0338 0.0154  -0.0071 321 ILE A CD1 
1092 N N   . GLU A 153 ? 0.3745 0.3476 0.3227 -0.0352 -0.0020 -0.0049 322 GLU A N   
1093 C CA  . GLU A 153 ? 0.3468 0.3248 0.3004 -0.0365 -0.0038 -0.0064 322 GLU A CA  
1094 C C   . GLU A 153 ? 0.3350 0.3106 0.2895 -0.0388 0.0004  -0.0095 322 GLU A C   
1095 O O   . GLU A 153 ? 0.3546 0.3275 0.3060 -0.0413 0.0031  -0.0115 322 GLU A O   
1096 C CB  . GLU A 153 ? 0.3873 0.3716 0.3421 -0.0384 -0.0076 -0.0072 322 GLU A CB  
1097 C CG  . GLU A 153 ? 0.4261 0.4166 0.3867 -0.0393 -0.0095 -0.0088 322 GLU A CG  
1098 C CD  . GLU A 153 ? 0.4771 0.4749 0.4390 -0.0400 -0.0141 -0.0088 322 GLU A CD  
1099 O OE1 . GLU A 153 ? 0.4431 0.4410 0.4013 -0.0405 -0.0154 -0.0081 322 GLU A OE1 
1100 O OE2 . GLU A 153 ? 0.5083 0.5120 0.4751 -0.0398 -0.0162 -0.0095 322 GLU A OE2 
1101 N N   . ILE A 154 ? 0.3343 0.3107 0.2928 -0.0381 0.0012  -0.0098 323 ILE A N   
1102 C CA  . ILE A 154 ? 0.3667 0.3411 0.3265 -0.0405 0.0054  -0.0126 323 ILE A CA  
1103 C C   . ILE A 154 ? 0.3958 0.3780 0.3617 -0.0423 0.0029  -0.0145 323 ILE A C   
1104 O O   . ILE A 154 ? 0.3692 0.3555 0.3388 -0.0399 -0.0003 -0.0128 323 ILE A O   
1105 C CB  . ILE A 154 ? 0.3949 0.3635 0.3539 -0.0378 0.0090  -0.0112 323 ILE A CB  
1106 C CG1 . ILE A 154 ? 0.4055 0.3681 0.3586 -0.0350 0.0107  -0.0088 323 ILE A CG1 
1107 C CG2 . ILE A 154 ? 0.4213 0.3867 0.3808 -0.0404 0.0141  -0.0139 323 ILE A CG2 
1108 C CD1 . ILE A 154 ? 0.4485 0.4055 0.3998 -0.0320 0.0145  -0.0075 323 ILE A CD1 
1109 N N   . PHE A 155 ? 0.3765 0.3610 0.3434 -0.0467 0.0044  -0.0180 324 PHE A N   
1110 C CA  . PHE A 155 ? 0.4301 0.4232 0.4029 -0.0489 0.0022  -0.0204 324 PHE A CA  
1111 C C   . PHE A 155 ? 0.4127 0.4051 0.3890 -0.0502 0.0060  -0.0221 324 PHE A C   
1112 O O   . PHE A 155 ? 0.4578 0.4422 0.4310 -0.0506 0.0110  -0.0224 324 PHE A O   
1113 C CB  . PHE A 155 ? 0.4097 0.4070 0.3818 -0.0533 0.0015  -0.0237 324 PHE A CB  
1114 C CG  . PHE A 155 ? 0.4137 0.4119 0.3821 -0.0522 -0.0019 -0.0220 324 PHE A CG  
1115 C CD1 . PHE A 155 ? 0.4092 0.4151 0.3801 -0.0505 -0.0073 -0.0205 324 PHE A CD1 
1116 C CD2 . PHE A 155 ? 0.3845 0.3756 0.3467 -0.0525 0.0003  -0.0216 324 PHE A CD2 
1117 C CE1 . PHE A 155 ? 0.3680 0.3744 0.3352 -0.0494 -0.0102 -0.0186 324 PHE A CE1 
1118 C CE2 . PHE A 155 ? 0.4082 0.4003 0.3670 -0.0514 -0.0026 -0.0199 324 PHE A CE2 
1119 C CZ  . PHE A 155 ? 0.3763 0.3760 0.3376 -0.0500 -0.0079 -0.0184 324 PHE A CZ  
1120 N N   . GLY A 156 ? 0.5385 0.5393 0.5210 -0.0508 0.0038  -0.0234 325 GLY A N   
1121 C CA  . GLY A 156 ? 0.5999 0.6014 0.5863 -0.0524 0.0072  -0.0253 325 GLY A CA  
1122 C C   . GLY A 156 ? 0.7984 0.7998 0.7873 -0.0478 0.0064  -0.0225 325 GLY A C   
1123 O O   . GLY A 156 ? 0.6787 0.6798 0.6666 -0.0437 0.0029  -0.0194 325 GLY A O   
1124 N N   . THR A 157 ? 0.8208 0.8220 0.8128 -0.0486 0.0098  -0.0238 326 THR A N   
1125 C CA  . THR A 157 ? 0.9033 0.9067 0.8988 -0.0447 0.0087  -0.0219 326 THR A CA  
1126 C C   . THR A 157 ? 0.8367 0.8315 0.8278 -0.0404 0.0100  -0.0185 326 THR A C   
1127 O O   . THR A 157 ? 0.7957 0.7917 0.7883 -0.0364 0.0075  -0.0163 326 THR A O   
1128 C CB  . THR A 157 ? 1.0313 1.0383 1.0318 -0.0471 0.0120  -0.0244 326 THR A CB  
1129 O OG1 . THR A 157 ? 0.8564 0.8553 0.8535 -0.0499 0.0181  -0.0257 326 THR A OG1 
1130 C CG2 . THR A 157 ? 0.9217 0.9400 0.9277 -0.0508 0.0096  -0.0278 326 THR A CG2 
1131 N N   . GLN A 158 ? 0.6133 0.5996 0.5988 -0.0413 0.0138  -0.0183 327 GLN A N   
1132 C CA  . GLN A 158 ? 0.7293 0.7082 0.7101 -0.0373 0.0152  -0.0153 327 GLN A CA  
1133 C C   . GLN A 158 ? 0.6842 0.6614 0.6608 -0.0359 0.0121  -0.0133 327 GLN A C   
1134 O O   . GLN A 158 ? 0.6379 0.6086 0.6095 -0.0338 0.0139  -0.0115 327 GLN A O   
1135 C CB  . GLN A 158 ? 0.8779 0.8485 0.8547 -0.0383 0.0216  -0.0158 327 GLN A CB  
1136 N N   . GLY A 159 ? 0.5132 0.4965 0.4918 -0.0368 0.0075  -0.0137 328 GLY A N   
1137 C CA  . GLY A 159 ? 0.4955 0.4775 0.4701 -0.0363 0.0051  -0.0122 328 GLY A CA  
1138 C C   . GLY A 159 ? 0.3972 0.3796 0.3713 -0.0323 0.0013  -0.0091 328 GLY A C   
1139 O O   . GLY A 159 ? 0.3995 0.3822 0.3759 -0.0296 0.0007  -0.0079 328 GLY A O   
1140 N N   . LYS A 160 ? 0.3521 0.3346 0.3233 -0.0323 -0.0012 -0.0078 329 LYS A N   
1141 C CA  . LYS A 160 ? 0.3548 0.3377 0.3252 -0.0293 -0.0049 -0.0049 329 LYS A CA  
1142 C C   . LYS A 160 ? 0.3843 0.3696 0.3527 -0.0304 -0.0081 -0.0044 329 LYS A C   
1143 O O   . LYS A 160 ? 0.3861 0.3702 0.3515 -0.0328 -0.0066 -0.0056 329 LYS A O   
1144 C CB  . LYS A 160 ? 0.3738 0.3506 0.3404 -0.0267 -0.0028 -0.0029 329 LYS A CB  
1145 C CG  . LYS A 160 ? 0.4027 0.3748 0.3640 -0.0278 0.0002  -0.0031 329 LYS A CG  
1146 C CD  . LYS A 160 ? 0.3757 0.3433 0.3331 -0.0248 0.0018  -0.0010 329 LYS A CD  
1147 C CE  . LYS A 160 ? 0.4346 0.4037 0.3908 -0.0233 -0.0018 0.0012  329 LYS A CE  
1148 N NZ  . LYS A 160 ? 0.4106 0.3808 0.3643 -0.0251 -0.0035 0.0015  329 LYS A NZ  
1149 N N   . PRO A 161 ? 0.4036 0.3918 0.3732 -0.0287 -0.0122 -0.0024 330 PRO A N   
1150 C CA  . PRO A 161 ? 0.3781 0.3673 0.3446 -0.0294 -0.0147 -0.0012 330 PRO A CA  
1151 C C   . PRO A 161 ? 0.3517 0.3356 0.3132 -0.0287 -0.0132 0.0003  330 PRO A C   
1152 O O   . PRO A 161 ? 0.3541 0.3340 0.3146 -0.0270 -0.0109 0.0011  330 PRO A O   
1153 C CB  . PRO A 161 ? 0.3986 0.3909 0.3672 -0.0271 -0.0189 0.0008  330 PRO A CB  
1154 C CG  . PRO A 161 ? 0.4507 0.4407 0.4216 -0.0247 -0.0181 0.0014  330 PRO A CG  
1155 C CD  . PRO A 161 ? 0.4009 0.3912 0.3741 -0.0260 -0.0147 -0.0011 330 PRO A CD  
1156 N N   . ALA A 162 ? 0.3295 0.3141 0.2878 -0.0299 -0.0144 0.0008  331 ALA A N   
1157 C CA  . ALA A 162 ? 0.3453 0.3263 0.2990 -0.0293 -0.0135 0.0025  331 ALA A CA  
1158 C C   . ALA A 162 ? 0.3692 0.3500 0.3232 -0.0270 -0.0161 0.0054  331 ALA A C   
1159 O O   . ALA A 162 ? 0.3452 0.3288 0.3014 -0.0265 -0.0194 0.0063  331 ALA A O   
1160 C CB  . ALA A 162 ? 0.3837 0.3660 0.3341 -0.0313 -0.0141 0.0021  331 ALA A CB  
1161 N N   . ILE A 163 ? 0.3200 0.2974 0.2714 -0.0257 -0.0147 0.0067  332 ILE A N   
1162 C CA  . ILE A 163 ? 0.3060 0.2829 0.2575 -0.0241 -0.0167 0.0091  332 ILE A CA  
1163 C C   . ILE A 163 ? 0.3050 0.2807 0.2524 -0.0241 -0.0161 0.0106  332 ILE A C   
1164 O O   . ILE A 163 ? 0.2928 0.2668 0.2377 -0.0238 -0.0131 0.0100  332 ILE A O   
1165 C CB  . ILE A 163 ? 0.3160 0.2910 0.2696 -0.0220 -0.0155 0.0089  332 ILE A CB  
1166 C CG1 . ILE A 163 ? 0.3797 0.3563 0.3377 -0.0218 -0.0160 0.0075  332 ILE A CG1 
1167 C CG2 . ILE A 163 ? 0.3456 0.3197 0.2990 -0.0208 -0.0174 0.0109  332 ILE A CG2 
1168 C CD1 . ILE A 163 ? 0.4286 0.4033 0.3882 -0.0202 -0.0135 0.0067  332 ILE A CD1 
1169 N N   . ALA A 164 ? 0.2976 0.2741 0.2441 -0.0243 -0.0188 0.0126  333 ALA A N   
1170 C CA  . ALA A 164 ? 0.3227 0.2988 0.2659 -0.0244 -0.0185 0.0142  333 ALA A CA  
1171 C C   . ALA A 164 ? 0.3463 0.3214 0.2907 -0.0234 -0.0195 0.0155  333 ALA A C   
1172 O O   . ALA A 164 ? 0.3235 0.2982 0.2702 -0.0231 -0.0218 0.0161  333 ALA A O   
1173 C CB  . ALA A 164 ? 0.3604 0.3383 0.3014 -0.0259 -0.0205 0.0155  333 ALA A CB  
1174 N N   . HIS A 165 ? 0.3294 0.3041 0.2720 -0.0227 -0.0179 0.0159  334 HIS A N   
1175 C CA  . HIS A 165 ? 0.3165 0.2906 0.2602 -0.0219 -0.0184 0.0165  334 HIS A CA  
1176 C C   . HIS A 165 ? 0.3307 0.3048 0.2739 -0.0232 -0.0207 0.0183  334 HIS A C   
1177 O O   . HIS A 165 ? 0.3405 0.3129 0.2855 -0.0230 -0.0221 0.0186  334 HIS A O   
1178 C CB  . HIS A 165 ? 0.3115 0.2864 0.2535 -0.0207 -0.0157 0.0160  334 HIS A CB  
1179 C CG  . HIS A 165 ? 0.3072 0.2822 0.2502 -0.0196 -0.0157 0.0159  334 HIS A CG  
1180 N ND1 . HIS A 165 ? 0.3156 0.2914 0.2585 -0.0208 -0.0174 0.0169  334 HIS A ND1 
1181 C CD2 . HIS A 165 ? 0.2963 0.2709 0.2404 -0.0176 -0.0142 0.0148  334 HIS A CD2 
1182 C CE1 . HIS A 165 ? 0.3334 0.3095 0.2772 -0.0197 -0.0170 0.0162  334 HIS A CE1 
1183 N NE2 . HIS A 165 ? 0.3478 0.3232 0.2923 -0.0176 -0.0151 0.0149  334 HIS A NE2 
1184 N N   . ARG A 166 ? 0.3410 0.3166 0.2814 -0.0246 -0.0207 0.0195  335 ARG A N   
1185 C CA  . ARG A 166 ? 0.2940 0.2695 0.2331 -0.0263 -0.0226 0.0215  335 ARG A CA  
1186 C C   . ARG A 166 ? 0.3289 0.3048 0.2679 -0.0270 -0.0223 0.0219  335 ARG A C   
1187 O O   . ARG A 166 ? 0.2838 0.2594 0.2217 -0.0289 -0.0235 0.0235  335 ARG A O   
1188 C CB  . ARG A 166 ? 0.3309 0.3041 0.2714 -0.0265 -0.0251 0.0225  335 ARG A CB  
1189 C CG  . ARG A 166 ? 0.3547 0.3289 0.2952 -0.0263 -0.0257 0.0221  335 ARG A CG  
1190 C CD  . ARG A 166 ? 0.3849 0.3576 0.3265 -0.0260 -0.0283 0.0234  335 ARG A CD  
1191 N NE  . ARG A 166 ? 0.5408 0.5130 0.4798 -0.0273 -0.0296 0.0258  335 ARG A NE  
1192 C CZ  . ARG A 166 ? 0.6094 0.5789 0.5483 -0.0270 -0.0315 0.0277  335 ARG A CZ  
1193 N NH1 . ARG A 166 ? 0.5539 0.5210 0.4954 -0.0253 -0.0323 0.0274  335 ARG A NH1 
1194 N NH2 . ARG A 166 ? 0.6025 0.5713 0.5384 -0.0283 -0.0323 0.0301  335 ARG A NH2 
1195 N N   . ASP A 167 ? 0.3143 0.2913 0.2540 -0.0256 -0.0207 0.0205  336 ASP A N   
1196 C CA  . ASP A 167 ? 0.3051 0.2839 0.2446 -0.0262 -0.0203 0.0204  336 ASP A CA  
1197 C C   . ASP A 167 ? 0.3095 0.2915 0.2486 -0.0242 -0.0180 0.0191  336 ASP A C   
1198 O O   . ASP A 167 ? 0.2966 0.2797 0.2366 -0.0235 -0.0176 0.0182  336 ASP A O   
1199 C CB  . ASP A 167 ? 0.3083 0.2842 0.2498 -0.0268 -0.0218 0.0201  336 ASP A CB  
1200 C CG  . ASP A 167 ? 0.3875 0.3652 0.3285 -0.0288 -0.0219 0.0202  336 ASP A CG  
1201 O OD1 . ASP A 167 ? 0.3943 0.3756 0.3335 -0.0303 -0.0213 0.0210  336 ASP A OD1 
1202 O OD2 . ASP A 167 ? 0.4346 0.4103 0.3771 -0.0290 -0.0224 0.0193  336 ASP A OD2 
1203 N N   . LEU A 168 ? 0.3160 0.2993 0.2532 -0.0231 -0.0163 0.0191  337 LEU A N   
1204 C CA  . LEU A 168 ? 0.3092 0.2950 0.2452 -0.0206 -0.0137 0.0183  337 LEU A CA  
1205 C C   . LEU A 168 ? 0.3386 0.3295 0.2733 -0.0210 -0.0133 0.0188  337 LEU A C   
1206 O O   . LEU A 168 ? 0.3850 0.3780 0.3183 -0.0229 -0.0138 0.0199  337 LEU A O   
1207 C CB  . LEU A 168 ? 0.3458 0.3306 0.2796 -0.0194 -0.0117 0.0181  337 LEU A CB  
1208 C CG  . LEU A 168 ? 0.3857 0.3711 0.3178 -0.0163 -0.0086 0.0174  337 LEU A CG  
1209 C CD1 . LEU A 168 ? 0.4025 0.3855 0.3367 -0.0145 -0.0079 0.0162  337 LEU A CD1 
1210 C CD2 . LEU A 168 ? 0.3982 0.3818 0.3276 -0.0157 -0.0065 0.0172  337 LEU A CD2 
1211 N N   . LYS A 169 ? 0.3157 0.3090 0.2510 -0.0193 -0.0125 0.0178  338 LYS A N   
1212 C CA  . LYS A 169 ? 0.2970 0.2967 0.2314 -0.0193 -0.0120 0.0179  338 LYS A CA  
1213 C C   . LYS A 169 ? 0.3022 0.3044 0.2368 -0.0162 -0.0106 0.0166  338 LYS A C   
1214 O O   . LYS A 169 ? 0.3019 0.3004 0.2376 -0.0145 -0.0103 0.0158  338 LYS A O   
1215 C CB  . LYS A 169 ? 0.2953 0.2962 0.2310 -0.0230 -0.0142 0.0181  338 LYS A CB  
1216 C CG  . LYS A 169 ? 0.2999 0.2967 0.2381 -0.0240 -0.0158 0.0171  338 LYS A CG  
1217 C CD  . LYS A 169 ? 0.3467 0.3443 0.2856 -0.0278 -0.0174 0.0173  338 LYS A CD  
1218 C CE  . LYS A 169 ? 0.3987 0.3910 0.3397 -0.0288 -0.0189 0.0165  338 LYS A CE  
1219 N NZ  . LYS A 169 ? 0.4180 0.4101 0.3592 -0.0328 -0.0201 0.0165  338 LYS A NZ  
1220 N N   . SER A 170 ? 0.2901 0.2991 0.2238 -0.0153 -0.0100 0.0165  339 SER A N   
1221 C CA  . SER A 170 ? 0.3158 0.3283 0.2489 -0.0116 -0.0085 0.0155  339 SER A CA  
1222 C C   . SER A 170 ? 0.3202 0.3320 0.2557 -0.0123 -0.0099 0.0140  339 SER A C   
1223 O O   . SER A 170 ? 0.3279 0.3399 0.2630 -0.0090 -0.0087 0.0132  339 SER A O   
1224 C CB  . SER A 170 ? 0.2619 0.2833 0.1935 -0.0104 -0.0075 0.0158  339 SER A CB  
1225 O OG  . SER A 170 ? 0.2842 0.3101 0.2172 -0.0144 -0.0094 0.0156  339 SER A OG  
1226 N N   . LYS A 171 ? 0.3163 0.3267 0.2539 -0.0164 -0.0122 0.0135  340 LYS A N   
1227 C CA  . LYS A 171 ? 0.3268 0.3347 0.2665 -0.0173 -0.0136 0.0120  340 LYS A CA  
1228 C C   . LYS A 171 ? 0.3504 0.3509 0.2912 -0.0161 -0.0136 0.0119  340 LYS A C   
1229 O O   . LYS A 171 ? 0.3122 0.3109 0.2543 -0.0156 -0.0142 0.0105  340 LYS A O   
1230 C CB  . LYS A 171 ? 0.3513 0.3587 0.2924 -0.0220 -0.0157 0.0116  340 LYS A CB  
1231 C CG  . LYS A 171 ? 0.3942 0.4100 0.3353 -0.0235 -0.0158 0.0106  340 LYS A CG  
1232 C CD  . LYS A 171 ? 0.4579 0.4723 0.4002 -0.0288 -0.0175 0.0101  340 LYS A CD  
1233 C CE  . LYS A 171 ? 0.5337 0.5575 0.4761 -0.0306 -0.0175 0.0087  340 LYS A CE  
1234 N NZ  . LYS A 171 ? 0.5473 0.5696 0.4908 -0.0361 -0.0188 0.0077  340 LYS A NZ  
1235 N N   . ASN A 172 ? 0.3290 0.3256 0.2692 -0.0158 -0.0131 0.0132  341 ASN A N   
1236 C CA  . ASN A 172 ? 0.3221 0.3126 0.2637 -0.0150 -0.0132 0.0130  341 ASN A CA  
1237 C C   . ASN A 172 ? 0.2879 0.2777 0.2281 -0.0115 -0.0106 0.0130  341 ASN A C   
1238 O O   . ASN A 172 ? 0.2931 0.2785 0.2341 -0.0110 -0.0101 0.0129  341 ASN A O   
1239 C CB  . ASN A 172 ? 0.3252 0.3118 0.2673 -0.0176 -0.0147 0.0142  341 ASN A CB  
1240 C CG  . ASN A 172 ? 0.3700 0.3546 0.3134 -0.0207 -0.0172 0.0143  341 ASN A CG  
1241 O OD1 . ASN A 172 ? 0.3586 0.3441 0.3029 -0.0212 -0.0177 0.0131  341 ASN A OD1 
1242 N ND2 . ASN A 172 ? 0.3428 0.3246 0.2862 -0.0228 -0.0185 0.0157  341 ASN A ND2 
1243 N N   . ILE A 173 ? 0.3212 0.3154 0.2593 -0.0089 -0.0087 0.0129  342 ILE A N   
1244 C CA  . ILE A 173 ? 0.3055 0.2987 0.2416 -0.0051 -0.0057 0.0130  342 ILE A CA  
1245 C C   . ILE A 173 ? 0.3085 0.3054 0.2442 -0.0023 -0.0049 0.0122  342 ILE A C   
1246 O O   . ILE A 173 ? 0.3005 0.3034 0.2359 -0.0026 -0.0058 0.0118  342 ILE A O   
1247 C CB  . ILE A 173 ? 0.3116 0.3066 0.2446 -0.0039 -0.0037 0.0143  342 ILE A CB  
1248 C CG1 . ILE A 173 ? 0.3254 0.3167 0.2587 -0.0067 -0.0045 0.0149  342 ILE A CG1 
1249 C CG2 . ILE A 173 ? 0.3157 0.3093 0.2459 0.0003  -0.0001 0.0145  342 ILE A CG2 
1250 C CD1 . ILE A 173 ? 0.3146 0.3081 0.2449 -0.0063 -0.0031 0.0160  342 ILE A CD1 
1251 N N   . LEU A 174 ? 0.2965 0.2902 0.2321 0.0003  -0.0031 0.0117  343 LEU A N   
1252 C CA  . LEU A 174 ? 0.3045 0.3013 0.2394 0.0034  -0.0022 0.0109  343 LEU A CA  
1253 C C   . LEU A 174 ? 0.2931 0.2903 0.2242 0.0080  0.0013  0.0120  343 LEU A C   
1254 O O   . LEU A 174 ? 0.3071 0.2994 0.2369 0.0087  0.0036  0.0128  343 LEU A O   
1255 C CB  . LEU A 174 ? 0.3238 0.3165 0.2611 0.0032  -0.0028 0.0097  343 LEU A CB  
1256 C CG  . LEU A 174 ? 0.3224 0.3143 0.2630 -0.0006 -0.0062 0.0087  343 LEU A CG  
1257 C CD1 . LEU A 174 ? 0.3300 0.3171 0.2728 -0.0003 -0.0063 0.0078  343 LEU A CD1 
1258 C CD2 . LEU A 174 ? 0.3622 0.3597 0.3028 -0.0013 -0.0078 0.0075  343 LEU A CD2 
1259 N N   . VAL A 175 ? 0.2810 0.2841 0.2103 0.0111  0.0020  0.0118  344 VAL A N   
1260 C CA  . VAL A 175 ? 0.2948 0.2985 0.2199 0.0162  0.0056  0.0131  344 VAL A CA  
1261 C C   . VAL A 175 ? 0.3140 0.3148 0.2387 0.0191  0.0074  0.0127  344 VAL A C   
1262 O O   . VAL A 175 ? 0.3355 0.3390 0.2618 0.0189  0.0057  0.0113  344 VAL A O   
1263 C CB  . VAL A 175 ? 0.3131 0.3261 0.2362 0.0187  0.0054  0.0133  344 VAL A CB  
1264 C CG1 . VAL A 175 ? 0.3187 0.3323 0.2371 0.0249  0.0093  0.0149  344 VAL A CG1 
1265 C CG2 . VAL A 175 ? 0.3518 0.3679 0.2754 0.0158  0.0040  0.0138  344 VAL A CG2 
1266 N N   . LYS A 176 ? 0.3397 0.3345 0.2619 0.0215  0.0109  0.0138  345 LYS A N   
1267 C CA  . LYS A 176 ? 0.3713 0.3626 0.2925 0.0244  0.0134  0.0138  345 LYS A CA  
1268 C C   . LYS A 176 ? 0.3792 0.3739 0.2955 0.0304  0.0163  0.0152  345 LYS A C   
1269 O O   . LYS A 176 ? 0.3857 0.3834 0.2989 0.0325  0.0174  0.0165  345 LYS A O   
1270 C CB  . LYS A 176 ? 0.3540 0.3365 0.2753 0.0233  0.0160  0.0142  345 LYS A CB  
1271 C CG  . LYS A 176 ? 0.3942 0.3741 0.3202 0.0180  0.0131  0.0130  345 LYS A CG  
1272 C CD  . LYS A 176 ? 0.4275 0.4001 0.3534 0.0165  0.0156  0.0132  345 LYS A CD  
1273 C CE  . LYS A 176 ? 0.4042 0.3727 0.3294 0.0187  0.0188  0.0131  345 LYS A CE  
1274 N NZ  . LYS A 176 ? 0.4135 0.3766 0.3414 0.0157  0.0196  0.0123  345 LYS A NZ  
1275 N N   . LYS A 177 ? 0.3844 0.3788 0.2998 0.0332  0.0177  0.0150  346 LYS A N   
1276 C CA  . LYS A 177 ? 0.4096 0.4070 0.3200 0.0395  0.0206  0.0164  346 LYS A CA  
1277 C C   . LYS A 177 ? 0.3714 0.3628 0.2769 0.0430  0.0254  0.0188  346 LYS A C   
1278 O O   . LYS A 177 ? 0.3914 0.3861 0.2923 0.0481  0.0276  0.0204  346 LYS A O   
1279 C CB  . LYS A 177 ? 0.4913 0.4884 0.4018 0.0415  0.0213  0.0157  346 LYS A CB  
1280 C CG  . LYS A 177 ? 0.4813 0.4858 0.3949 0.0398  0.0171  0.0134  346 LYS A CG  
1281 C CD  . LYS A 177 ? 0.6140 0.6285 0.5249 0.0432  0.0163  0.0136  346 LYS A CD  
1282 C CE  . LYS A 177 ? 0.6470 0.6684 0.5599 0.0426  0.0133  0.0112  346 LYS A CE  
1283 N NZ  . LYS A 177 ? 0.9045 0.9226 0.8162 0.0454  0.0152  0.0110  346 LYS A NZ  
1284 N N   . ASN A 178 ? 0.4137 0.3962 0.3198 0.0404  0.0273  0.0189  347 ASN A N   
1285 C CA  . ASN A 178 ? 0.3705 0.3464 0.2717 0.0432  0.0322  0.0208  347 ASN A CA  
1286 C C   . ASN A 178 ? 0.3920 0.3698 0.2916 0.0429  0.0318  0.0216  347 ASN A C   
1287 O O   . ASN A 178 ? 0.4279 0.3999 0.3233 0.0450  0.0357  0.0230  347 ASN A O   
1288 C CB  . ASN A 178 ? 0.4226 0.3887 0.3249 0.0403  0.0346  0.0204  347 ASN A CB  
1289 C CG  . ASN A 178 ? 0.4889 0.4534 0.3960 0.0338  0.0316  0.0187  347 ASN A CG  
1290 O OD1 . ASN A 178 ? 0.3953 0.3650 0.3044 0.0317  0.0281  0.0182  347 ASN A OD1 
1291 N ND2 . ASN A 178 ? 0.4712 0.4288 0.3801 0.0308  0.0332  0.0179  347 ASN A ND2 
1292 N N   . GLY A 179 ? 0.3680 0.3536 0.2708 0.0403  0.0274  0.0205  348 GLY A N   
1293 C CA  . GLY A 179 ? 0.4087 0.3975 0.3101 0.0402  0.0268  0.0212  348 GLY A CA  
1294 C C   . GLY A 179 ? 0.3786 0.3631 0.2829 0.0345  0.0254  0.0203  348 GLY A C   
1295 O O   . GLY A 179 ? 0.4294 0.4167 0.3333 0.0335  0.0243  0.0206  348 GLY A O   
1296 N N   . GLN A 180 ? 0.3707 0.3488 0.2778 0.0309  0.0252  0.0192  349 GLN A N   
1297 C CA  . GLN A 180 ? 0.3663 0.3415 0.2768 0.0254  0.0231  0.0181  349 GLN A CA  
1298 C C   . GLN A 180 ? 0.3696 0.3503 0.2852 0.0214  0.0180  0.0168  349 GLN A C   
1299 O O   . GLN A 180 ? 0.3574 0.3430 0.2744 0.0224  0.0163  0.0163  349 GLN A O   
1300 C CB  . GLN A 180 ? 0.3817 0.3483 0.2928 0.0235  0.0254  0.0174  349 GLN A CB  
1301 C CG  . GLN A 180 ? 0.4192 0.3790 0.3249 0.0265  0.0307  0.0186  349 GLN A CG  
1302 C CD  . GLN A 180 ? 0.4557 0.4072 0.3622 0.0238  0.0332  0.0176  349 GLN A CD  
1303 O OE1 . GLN A 180 ? 0.4849 0.4358 0.3958 0.0189  0.0307  0.0161  349 GLN A OE1 
1304 N NE2 . GLN A 180 ? 0.5367 0.4819 0.4388 0.0269  0.0383  0.0186  349 GLN A NE2 
1305 N N   . CYS A 181 ? 0.3157 0.2952 0.2339 0.0169  0.0157  0.0161  350 CYS A N   
1306 C CA  . CYS A 181 ? 0.2952 0.2779 0.2180 0.0128  0.0112  0.0150  350 CYS A CA  
1307 C C   . CYS A 181 ? 0.3143 0.2918 0.2405 0.0093  0.0103  0.0140  350 CYS A C   
1308 O O   . CYS A 181 ? 0.3227 0.2945 0.2478 0.0092  0.0129  0.0140  350 CYS A O   
1309 C CB  . CYS A 181 ? 0.3256 0.3126 0.2486 0.0105  0.0090  0.0154  350 CYS A CB  
1310 S SG  . CYS A 181 ? 0.3449 0.3407 0.2650 0.0141  0.0093  0.0163  350 CYS A SG  
1311 N N   . CYS A 182 ? 0.3457 0.3250 0.2759 0.0065  0.0067  0.0131  351 CYS A N   
1312 C CA  . CYS A 182 ? 0.3010 0.2765 0.2345 0.0031  0.0051  0.0123  351 CYS A CA  
1313 C C   . CYS A 182 ? 0.2983 0.2763 0.2344 -0.0003 0.0011  0.0122  351 CYS A C   
1314 O O   . CYS A 182 ? 0.2938 0.2760 0.2302 -0.0005 -0.0007 0.0122  351 CYS A O   
1315 C CB  . CYS A 182 ? 0.2942 0.2677 0.2302 0.0039  0.0054  0.0113  351 CYS A CB  
1316 S SG  . CYS A 182 ? 0.3210 0.2988 0.2585 0.0049  0.0030  0.0106  351 CYS A SG  
1317 N N   . ILE A 183 ? 0.2982 0.2735 0.2359 -0.0031 0.0000  0.0121  352 ILE A N   
1318 C CA  . ILE A 183 ? 0.2936 0.2701 0.2331 -0.0063 -0.0034 0.0123  352 ILE A CA  
1319 C C   . ILE A 183 ? 0.2904 0.2659 0.2336 -0.0073 -0.0058 0.0115  352 ILE A C   
1320 O O   . ILE A 183 ? 0.2789 0.2517 0.2239 -0.0070 -0.0052 0.0108  352 ILE A O   
1321 C CB  . ILE A 183 ? 0.3090 0.2835 0.2482 -0.0085 -0.0035 0.0126  352 ILE A CB  
1322 C CG1 . ILE A 183 ? 0.3152 0.2905 0.2504 -0.0074 -0.0012 0.0133  352 ILE A CG1 
1323 C CG2 . ILE A 183 ? 0.3311 0.3064 0.2722 -0.0115 -0.0071 0.0131  352 ILE A CG2 
1324 C CD1 . ILE A 183 ? 0.3280 0.3007 0.2620 -0.0090 -0.0003 0.0131  352 ILE A CD1 
1325 N N   . ALA A 184 ? 0.2891 0.2665 0.2331 -0.0088 -0.0084 0.0117  353 ALA A N   
1326 C CA  . ALA A 184 ? 0.3043 0.2802 0.2512 -0.0097 -0.0107 0.0110  353 ALA A CA  
1327 C C   . ALA A 184 ? 0.3368 0.3119 0.2846 -0.0127 -0.0135 0.0118  353 ALA A C   
1328 O O   . ALA A 184 ? 0.3220 0.2983 0.2683 -0.0142 -0.0138 0.0129  353 ALA A O   
1329 C CB  . ALA A 184 ? 0.3085 0.2869 0.2552 -0.0087 -0.0109 0.0101  353 ALA A CB  
1330 N N   . ASP A 185 ? 0.3589 0.3317 0.3090 -0.0133 -0.0155 0.0114  354 ASP A N   
1331 C CA  . ASP A 185 ? 0.3881 0.3593 0.3387 -0.0158 -0.0181 0.0123  354 ASP A CA  
1332 C C   . ASP A 185 ? 0.3875 0.3574 0.3384 -0.0168 -0.0189 0.0135  354 ASP A C   
1333 O O   . ASP A 185 ? 0.2995 0.2705 0.2486 -0.0185 -0.0194 0.0147  354 ASP A O   
1334 C CB  . ASP A 185 ? 0.4678 0.4414 0.4166 -0.0177 -0.0186 0.0128  354 ASP A CB  
1335 C CG  . ASP A 185 ? 0.7015 0.6772 0.6502 -0.0170 -0.0181 0.0112  354 ASP A CG  
1336 O OD1 . ASP A 185 ? 0.9064 0.8797 0.8562 -0.0175 -0.0192 0.0103  354 ASP A OD1 
1337 O OD2 . ASP A 185 ? 0.7776 0.7576 0.7248 -0.0158 -0.0164 0.0109  354 ASP A OD2 
1338 N N   . LEU A 186 ? 0.3339 0.3021 0.2869 -0.0156 -0.0191 0.0129  355 LEU A N   
1339 C CA  . LEU A 186 ? 0.3494 0.3173 0.3032 -0.0163 -0.0200 0.0136  355 LEU A CA  
1340 C C   . LEU A 186 ? 0.3502 0.3160 0.3051 -0.0170 -0.0227 0.0147  355 LEU A C   
1341 O O   . LEU A 186 ? 0.3434 0.3094 0.2993 -0.0170 -0.0238 0.0151  355 LEU A O   
1342 C CB  . LEU A 186 ? 0.3838 0.3520 0.3396 -0.0148 -0.0184 0.0122  355 LEU A CB  
1343 C CG  . LEU A 186 ? 0.4286 0.3978 0.3830 -0.0138 -0.0153 0.0114  355 LEU A CG  
1344 C CD1 . LEU A 186 ? 0.4559 0.4247 0.4123 -0.0129 -0.0136 0.0101  355 LEU A CD1 
1345 C CD2 . LEU A 186 ? 0.4450 0.4154 0.3964 -0.0151 -0.0145 0.0121  355 LEU A CD2 
1346 N N   . GLY A 187 ? 0.3556 0.3193 0.3098 -0.0176 -0.0238 0.0151  356 GLY A N   
1347 C CA  . GLY A 187 ? 0.4127 0.3731 0.3673 -0.0178 -0.0260 0.0163  356 GLY A CA  
1348 C C   . GLY A 187 ? 0.4073 0.3677 0.3602 -0.0194 -0.0274 0.0185  356 GLY A C   
1349 O O   . GLY A 187 ? 0.3754 0.3332 0.3285 -0.0189 -0.0291 0.0197  356 GLY A O   
1350 N N   . LEU A 188 ? 0.3873 0.3504 0.3382 -0.0209 -0.0267 0.0190  357 LEU A N   
1351 C CA  . LEU A 188 ? 0.3793 0.3429 0.3283 -0.0223 -0.0279 0.0209  357 LEU A CA  
1352 C C   . LEU A 188 ? 0.4008 0.3674 0.3501 -0.0218 -0.0276 0.0204  357 LEU A C   
1353 O O   . LEU A 188 ? 0.3687 0.3365 0.3163 -0.0228 -0.0285 0.0216  357 LEU A O   
1354 C CB  . LEU A 188 ? 0.4104 0.3749 0.3565 -0.0246 -0.0273 0.0219  357 LEU A CB  
1355 C CG  . LEU A 188 ? 0.4531 0.4146 0.3983 -0.0261 -0.0278 0.0227  357 LEU A CG  
1356 C CD1 . LEU A 188 ? 0.5641 0.5279 0.5069 -0.0286 -0.0271 0.0235  357 LEU A CD1 
1357 C CD2 . LEU A 188 ? 0.5653 0.5222 0.5101 -0.0260 -0.0297 0.0245  357 LEU A CD2 
1358 N N   . ALA A 189 ? 0.3944 0.3624 0.3458 -0.0205 -0.0262 0.0184  358 ALA A N   
1359 C CA  . ALA A 189 ? 0.3525 0.3232 0.3039 -0.0208 -0.0253 0.0175  358 ALA A CA  
1360 C C   . ALA A 189 ? 0.3685 0.3405 0.3211 -0.0207 -0.0273 0.0179  358 ALA A C   
1361 O O   . ALA A 189 ? 0.4257 0.3965 0.3799 -0.0195 -0.0291 0.0186  358 ALA A O   
1362 C CB  . ALA A 189 ? 0.3549 0.3260 0.3081 -0.0196 -0.0229 0.0153  358 ALA A CB  
1363 N N   . VAL A 190 ? 0.3517 0.3263 0.3033 -0.0218 -0.0269 0.0173  359 VAL A N   
1364 C CA  . VAL A 190 ? 0.3765 0.3539 0.3293 -0.0218 -0.0288 0.0172  359 VAL A CA  
1365 C C   . VAL A 190 ? 0.3979 0.3780 0.3522 -0.0224 -0.0271 0.0146  359 VAL A C   
1366 O O   . VAL A 190 ? 0.3593 0.3388 0.3119 -0.0234 -0.0246 0.0135  359 VAL A O   
1367 C CB  . VAL A 190 ? 0.4378 0.4162 0.3874 -0.0229 -0.0305 0.0191  359 VAL A CB  
1368 C CG1 . VAL A 190 ? 0.5962 0.5714 0.5444 -0.0225 -0.0320 0.0218  359 VAL A CG1 
1369 C CG2 . VAL A 190 ? 0.4736 0.4527 0.4200 -0.0247 -0.0286 0.0187  359 VAL A CG2 
1370 N N   . MET A 191 ? 0.4533 0.4364 0.4103 -0.0220 -0.0286 0.0138  360 MET A N   
1371 C CA  . MET A 191 ? 0.4719 0.4578 0.4314 -0.0228 -0.0270 0.0110  360 MET A CA  
1372 C C   . MET A 191 ? 0.5009 0.4914 0.4599 -0.0244 -0.0284 0.0102  360 MET A C   
1373 O O   . MET A 191 ? 0.4466 0.4393 0.4053 -0.0237 -0.0314 0.0118  360 MET A O   
1374 C CB  . MET A 191 ? 0.4729 0.4601 0.4369 -0.0210 -0.0276 0.0102  360 MET A CB  
1375 C CG  . MET A 191 ? 0.5839 0.5681 0.5494 -0.0200 -0.0250 0.0093  360 MET A CG  
1376 S SD  . MET A 191 ? 0.7891 0.7755 0.7598 -0.0177 -0.0258 0.0084  360 MET A SD  
1377 C CE  . MET A 191 ? 0.8035 0.7972 0.7771 -0.0189 -0.0275 0.0069  360 MET A CE  
1378 N N   . HIS A 192 ? 0.5408 0.5327 0.4998 -0.0265 -0.0262 0.0075  361 HIS A N   
1379 C CA  . HIS A 192 ? 0.5246 0.5213 0.4833 -0.0285 -0.0273 0.0059  361 HIS A CA  
1380 C C   . HIS A 192 ? 0.6212 0.6206 0.5833 -0.0301 -0.0253 0.0025  361 HIS A C   
1381 O O   . HIS A 192 ? 0.6118 0.6078 0.5730 -0.0314 -0.0216 0.0007  361 HIS A O   
1382 C CB  . HIS A 192 ? 0.5119 0.5068 0.4657 -0.0302 -0.0261 0.0061  361 HIS A CB  
1383 C CG  . HIS A 192 ? 0.6240 0.6232 0.5769 -0.0327 -0.0264 0.0037  361 HIS A CG  
1384 N ND1 . HIS A 192 ? 0.6133 0.6179 0.5662 -0.0327 -0.0298 0.0043  361 HIS A ND1 
1385 C CD2 . HIS A 192 ? 0.6424 0.6410 0.5938 -0.0353 -0.0236 0.0008  361 HIS A CD2 
1386 C CE1 . HIS A 192 ? 0.7146 0.7225 0.6665 -0.0354 -0.0293 0.0016  361 HIS A CE1 
1387 N NE2 . HIS A 192 ? 0.6745 0.6785 0.6254 -0.0372 -0.0254 -0.0006 361 HIS A NE2 
1388 N N   . SER A 193 ? 0.7290 0.7345 0.6946 -0.0300 -0.0275 0.0014  362 SER A N   
1389 C CA  . SER A 193 ? 0.7539 0.7633 0.7231 -0.0322 -0.0259 -0.0020 362 SER A CA  
1390 C C   . SER A 193 ? 0.9023 0.9192 0.8721 -0.0343 -0.0280 -0.0040 362 SER A C   
1391 O O   . SER A 193 ? 0.8443 0.8630 0.8112 -0.0340 -0.0305 -0.0025 362 SER A O   
1392 C CB  . SER A 193 ? 0.7164 0.7276 0.6908 -0.0301 -0.0261 -0.0022 362 SER A CB  
1393 O OG  . SER A 193 ? 0.8850 0.9023 0.8619 -0.0281 -0.0300 -0.0011 362 SER A OG  
1394 N N   . GLN A 194 ? 1.0261 1.0475 0.9996 -0.0365 -0.0268 -0.0074 363 GLN A N   
1395 C CA  . GLN A 194 ? 0.9992 1.0296 0.9746 -0.0385 -0.0290 -0.0098 363 GLN A CA  
1396 C C   . GLN A 194 ? 1.0597 1.0971 1.0380 -0.0351 -0.0334 -0.0078 363 GLN A C   
1397 O O   . GLN A 194 ? 0.9458 0.9896 0.9233 -0.0353 -0.0364 -0.0080 363 GLN A O   
1398 C CB  . GLN A 194 ? 1.0794 1.1130 1.0584 -0.0421 -0.0262 -0.0142 363 GLN A CB  
1399 C CG  . GLN A 194 ? 1.0437 1.0762 1.0197 -0.0467 -0.0237 -0.0176 363 GLN A CG  
1400 C CD  . GLN A 194 ? 1.1460 1.1833 1.1262 -0.0507 -0.0214 -0.0221 363 GLN A CD  
1401 O OE1 . GLN A 194 ? 0.9732 1.0088 0.9568 -0.0504 -0.0190 -0.0226 363 GLN A OE1 
1402 N NE2 . GLN A 194 ? 1.0298 1.0735 1.0099 -0.0545 -0.0222 -0.0256 363 GLN A NE2 
1403 N N   . SER A 195 ? 1.2414 1.2774 1.2227 -0.0318 -0.0338 -0.0059 364 SER A N   
1404 C CA  . SER A 195 ? 1.2879 1.3285 1.2711 -0.0277 -0.0377 -0.0034 364 SER A CA  
1405 C C   . SER A 195 ? 1.2539 1.2904 1.2319 -0.0255 -0.0400 0.0005  364 SER A C   
1406 O O   . SER A 195 ? 0.9735 1.0059 0.9509 -0.0220 -0.0412 0.0038  364 SER A O   
1407 C CB  . SER A 195 ? 1.2552 1.2939 1.2422 -0.0248 -0.0370 -0.0025 364 SER A CB  
1408 N N   . THR A 196 ? 1.2908 1.3286 1.2651 -0.0279 -0.0405 0.0000  365 THR A N   
1409 C CA  . THR A 196 ? 1.2686 1.3012 1.2374 -0.0271 -0.0413 0.0031  365 THR A CA  
1410 C C   . THR A 196 ? 1.5639 1.6007 1.5316 -0.0239 -0.0454 0.0061  365 THR A C   
1411 O O   . THR A 196 ? 1.3487 1.3922 1.3151 -0.0247 -0.0475 0.0053  365 THR A O   
1412 C CB  . THR A 196 ? 1.1036 1.1355 1.0685 -0.0309 -0.0398 0.0011  365 THR A CB  
1413 N N   . ASN A 197 ? 1.5648 1.5973 1.5325 -0.0202 -0.0464 0.0095  366 ASN A N   
1414 C CA  . ASN A 197 ? 1.5107 1.5435 1.4755 -0.0169 -0.0495 0.0134  366 ASN A CA  
1415 C C   . ASN A 197 ? 1.4044 1.4302 1.3634 -0.0181 -0.0487 0.0158  366 ASN A C   
1416 O O   . ASN A 197 ? 1.1360 1.1609 1.0931 -0.0215 -0.0469 0.0138  366 ASN A O   
1417 C CB  . ASN A 197 ? 1.3978 1.4281 1.3649 -0.0126 -0.0505 0.0158  366 ASN A CB  
1418 C CG  . ASN A 197 ? 1.1777 1.2153 1.1508 -0.0114 -0.0509 0.0133  366 ASN A CG  
1419 O OD1 . ASN A 197 ? 0.9686 1.0032 0.9448 -0.0103 -0.0495 0.0129  366 ASN A OD1 
1420 N ND2 . ASN A 197 ? 1.2626 1.3103 1.2373 -0.0119 -0.0529 0.0115  366 ASN A ND2 
1421 N N   . GLN A 198 ? 1.4069 1.4276 1.3632 -0.0154 -0.0499 0.0199  367 GLN A N   
1422 C CA  . GLN A 198 ? 1.3124 1.3257 1.2641 -0.0166 -0.0486 0.0221  367 GLN A CA  
1423 C C   . GLN A 198 ? 1.1594 1.1660 1.1125 -0.0176 -0.0457 0.0212  367 GLN A C   
1424 O O   . GLN A 198 ? 0.8590 0.8653 0.8161 -0.0163 -0.0451 0.0201  367 GLN A O   
1425 C CB  . GLN A 198 ? 1.0994 1.1093 1.0474 -0.0137 -0.0506 0.0267  367 GLN A CB  
1426 N N   . LEU A 199 ? 0.9728 0.9748 0.9226 -0.0198 -0.0438 0.0217  368 LEU A N   
1427 C CA  A LEU A 199 ? 0.8483 0.8442 0.7987 -0.0202 -0.0413 0.0215  368 LEU A CA  
1428 C CA  B LEU A 199 ? 0.9663 0.9621 0.9166 -0.0203 -0.0413 0.0216  368 LEU A CA  
1429 C C   . LEU A 199 ? 0.9431 0.9340 0.8936 -0.0177 -0.0422 0.0243  368 LEU A C   
1430 O O   . LEU A 199 ? 1.1299 1.1192 1.0775 -0.0165 -0.0439 0.0274  368 LEU A O   
1431 C CB  A LEU A 199 ? 0.6620 0.6548 0.6085 -0.0226 -0.0395 0.0219  368 LEU A CB  
1432 C CB  B LEU A 199 ? 0.9077 0.9004 0.8539 -0.0226 -0.0396 0.0221  368 LEU A CB  
1433 C CG  A LEU A 199 ? 0.5274 0.5221 0.4736 -0.0251 -0.0371 0.0189  368 LEU A CG  
1434 C CG  B LEU A 199 ? 0.8469 0.8399 0.7933 -0.0248 -0.0367 0.0192  368 LEU A CG  
1435 C CD1 A LEU A 199 ? 0.5160 0.5076 0.4579 -0.0266 -0.0356 0.0200  368 LEU A CD1 
1436 C CD1 B LEU A 199 ? 0.8710 0.8686 0.8209 -0.0254 -0.0364 0.0158  368 LEU A CD1 
1437 C CD2 A LEU A 199 ? 0.4964 0.4899 0.4463 -0.0251 -0.0349 0.0163  368 LEU A CD2 
1438 C CD2 B LEU A 199 ? 0.8747 0.8680 0.8166 -0.0268 -0.0360 0.0196  368 LEU A CD2 
1439 N N   . ASP A 200 ? 0.9390 0.9270 0.8924 -0.0169 -0.0409 0.0233  369 ASP A N   
1440 C CA  . ASP A 200 ? 1.0363 1.0189 0.9897 -0.0147 -0.0415 0.0254  369 ASP A CA  
1441 C C   . ASP A 200 ? 1.0533 1.0300 1.0038 -0.0164 -0.0399 0.0265  369 ASP A C   
1442 O O   . ASP A 200 ? 1.0743 1.0494 1.0261 -0.0173 -0.0378 0.0248  369 ASP A O   
1443 C CB  . ASP A 200 ? 1.1759 1.1588 1.1338 -0.0128 -0.0410 0.0236  369 ASP A CB  
1444 C CG  . ASP A 200 ? 1.2341 1.2130 1.1923 -0.0095 -0.0423 0.0258  369 ASP A CG  
1445 O OD1 . ASP A 200 ? 1.1191 1.0921 1.0738 -0.0096 -0.0425 0.0283  369 ASP A OD1 
1446 O OD2 . ASP A 200 ? 1.4017 1.3832 1.3632 -0.0070 -0.0431 0.0250  369 ASP A OD2 
1447 N N   . VAL A 201 ? 1.0812 1.0552 1.0279 -0.0168 -0.0407 0.0294  370 VAL A N   
1448 C CA  . VAL A 201 ? 1.1675 1.1362 1.1118 -0.0185 -0.0394 0.0306  370 VAL A CA  
1449 C C   . VAL A 201 ? 1.2560 1.2193 1.1975 -0.0176 -0.0405 0.0340  370 VAL A C   
1450 O O   . VAL A 201 ? 1.2044 1.1679 1.1426 -0.0177 -0.0416 0.0364  370 VAL A O   
1451 C CB  . VAL A 201 ? 1.1091 1.0799 1.0509 -0.0214 -0.0380 0.0301  370 VAL A CB  
1452 C CG1 . VAL A 201 ? 0.9524 0.9286 0.8931 -0.0218 -0.0389 0.0298  370 VAL A CG1 
1453 C CG2 . VAL A 201 ? 1.1928 1.1596 1.1312 -0.0232 -0.0374 0.0324  370 VAL A CG2 
1454 N N   . PRO A 205 ? 1.0496 1.0082 0.9766 -0.0306 -0.0353 0.0397  374 PRO A N   
1455 C CA  . PRO A 205 ? 1.1655 1.1291 1.0908 -0.0323 -0.0343 0.0394  374 PRO A CA  
1456 C C   . PRO A 205 ? 1.1189 1.0842 1.0449 -0.0344 -0.0322 0.0377  374 PRO A C   
1457 O O   . PRO A 205 ? 0.7032 0.6722 0.6307 -0.0339 -0.0311 0.0352  374 PRO A O   
1458 C CB  . PRO A 205 ? 1.1157 1.0778 1.0367 -0.0333 -0.0349 0.0428  374 PRO A CB  
1459 C CG  . PRO A 205 ? 1.0753 1.0304 0.9957 -0.0331 -0.0353 0.0450  374 PRO A CG  
1460 C CD  . PRO A 205 ? 1.1015 1.0544 1.0258 -0.0314 -0.0355 0.0428  374 PRO A CD  
1461 N N   . ARG A 206 ? 0.8700 0.8326 0.7947 -0.0366 -0.0314 0.0390  375 ARG A N   
1462 C CA  . ARG A 206 ? 0.8187 0.7833 0.7445 -0.0385 -0.0296 0.0374  375 ARG A CA  
1463 C C   . ARG A 206 ? 0.7523 0.7141 0.6811 -0.0380 -0.0294 0.0355  375 ARG A C   
1464 O O   . ARG A 206 ? 0.6065 0.5646 0.5350 -0.0399 -0.0291 0.0361  375 ARG A O   
1465 C CB  . ARG A 206 ? 0.7572 0.7211 0.6802 -0.0418 -0.0287 0.0395  375 ARG A CB  
1466 C CG  . ARG A 206 ? 0.9110 0.8765 0.8305 -0.0424 -0.0290 0.0420  375 ARG A CG  
1467 C CD  . ARG A 206 ? 0.9369 0.9049 0.8547 -0.0457 -0.0273 0.0428  375 ARG A CD  
1468 N NE  . ARG A 206 ? 1.0156 0.9833 0.9295 -0.0470 -0.0273 0.0459  375 ARG A NE  
1469 C CZ  . ARG A 206 ? 1.1320 1.0953 1.0435 -0.0494 -0.0269 0.0485  375 ARG A CZ  
1470 N NH1 . ARG A 206 ? 0.9284 0.8869 0.8412 -0.0511 -0.0264 0.0482  375 ARG A NH1 
1471 N NH2 . ARG A 206 ? 1.1808 1.1444 1.0886 -0.0502 -0.0268 0.0513  375 ARG A NH2 
1472 N N   . VAL A 207 ? 0.6738 0.6372 0.6053 -0.0357 -0.0294 0.0332  376 VAL A N   
1473 C CA  . VAL A 207 ? 0.7603 0.7208 0.6945 -0.0347 -0.0294 0.0315  376 VAL A CA  
1474 C C   . VAL A 207 ? 0.6471 0.6108 0.5827 -0.0354 -0.0278 0.0292  376 VAL A C   
1475 O O   . VAL A 207 ? 0.5576 0.5191 0.4945 -0.0357 -0.0276 0.0280  376 VAL A O   
1476 C CB  . VAL A 207 ? 0.7698 0.7294 0.7063 -0.0316 -0.0305 0.0305  376 VAL A CB  
1477 C CG1 . VAL A 207 ? 0.8153 0.7710 0.7507 -0.0305 -0.0323 0.0328  376 VAL A CG1 
1478 C CG2 . VAL A 207 ? 0.7270 0.6915 0.6641 -0.0304 -0.0298 0.0291  376 VAL A CG2 
1479 N N   . GLY A 208 ? 0.4845 0.4535 0.4196 -0.0353 -0.0266 0.0285  377 GLY A N   
1480 C CA  . GLY A 208 ? 0.4567 0.4294 0.3930 -0.0348 -0.0251 0.0263  377 GLY A CA  
1481 C C   . GLY A 208 ? 0.4360 0.4111 0.3718 -0.0374 -0.0243 0.0262  377 GLY A C   
1482 O O   . GLY A 208 ? 0.4974 0.4694 0.4324 -0.0400 -0.0249 0.0274  377 GLY A O   
1483 N N   . THR A 209 ? 0.3749 0.3555 0.3110 -0.0367 -0.0228 0.0248  378 THR A N   
1484 C CA  . THR A 209 ? 0.3432 0.3284 0.2789 -0.0390 -0.0220 0.0244  378 THR A CA  
1485 C C   . THR A 209 ? 0.3569 0.3459 0.2903 -0.0405 -0.0213 0.0261  378 THR A C   
1486 O O   . THR A 209 ? 0.3719 0.3631 0.3040 -0.0385 -0.0205 0.0264  378 THR A O   
1487 C CB  . THR A 209 ? 0.3567 0.3468 0.2935 -0.0368 -0.0207 0.0222  378 THR A CB  
1488 O OG1 . THR A 209 ? 0.3674 0.3538 0.3061 -0.0353 -0.0212 0.0207  378 THR A OG1 
1489 C CG2 . THR A 209 ? 0.3307 0.3270 0.2676 -0.0390 -0.0200 0.0215  378 THR A CG2 
1490 N N   . LYS A 210 ? 0.3805 0.3699 0.3131 -0.0441 -0.0214 0.0271  379 LYS A N   
1491 C CA  . LYS A 210 ? 0.3869 0.3787 0.3171 -0.0459 -0.0209 0.0292  379 LYS A CA  
1492 C C   . LYS A 210 ? 0.3710 0.3705 0.3004 -0.0446 -0.0193 0.0286  379 LYS A C   
1493 O O   . LYS A 210 ? 0.3632 0.3639 0.2906 -0.0437 -0.0189 0.0298  379 LYS A O   
1494 C CB  . LYS A 210 ? 0.4188 0.4094 0.3484 -0.0504 -0.0210 0.0303  379 LYS A CB  
1495 C CG  . LYS A 210 ? 0.4455 0.4271 0.3747 -0.0514 -0.0223 0.0316  379 LYS A CG  
1496 C CD  . LYS A 210 ? 0.5784 0.5576 0.5061 -0.0560 -0.0218 0.0332  379 LYS A CD  
1497 C CE  . LYS A 210 ? 0.6975 0.6706 0.6262 -0.0580 -0.0221 0.0322  379 LYS A CE  
1498 N NZ  . LYS A 210 ? 0.8237 0.7881 0.7519 -0.0556 -0.0235 0.0333  379 LYS A NZ  
1499 N N   . ARG A 211 ? 0.3388 0.3436 0.2698 -0.0441 -0.0184 0.0267  380 ARG A N   
1500 C CA  . ARG A 211 ? 0.3386 0.3514 0.2689 -0.0423 -0.0168 0.0262  380 ARG A CA  
1501 C C   . ARG A 211 ? 0.3314 0.3433 0.2602 -0.0382 -0.0159 0.0262  380 ARG A C   
1502 O O   . ARG A 211 ? 0.3398 0.3565 0.2668 -0.0368 -0.0144 0.0265  380 ARG A O   
1503 C CB  . ARG A 211 ? 0.3722 0.3903 0.3045 -0.0415 -0.0163 0.0240  380 ARG A CB  
1504 C CG  . ARG A 211 ? 0.3431 0.3705 0.2749 -0.0393 -0.0145 0.0234  380 ARG A CG  
1505 C CD  . ARG A 211 ? 0.3353 0.3677 0.2690 -0.0383 -0.0144 0.0211  380 ARG A CD  
1506 N NE  . ARG A 211 ? 0.3465 0.3812 0.2820 -0.0430 -0.0152 0.0202  380 ARG A NE  
1507 C CZ  . ARG A 211 ? 0.3988 0.4417 0.3346 -0.0457 -0.0146 0.0201  380 ARG A CZ  
1508 N NH1 . ARG A 211 ? 0.3858 0.4358 0.3202 -0.0438 -0.0132 0.0210  380 ARG A NH1 
1509 N NH2 . ARG A 211 ? 0.3974 0.4413 0.3349 -0.0506 -0.0153 0.0190  380 ARG A NH2 
1510 N N   . TYR A 212 ? 0.3132 0.3189 0.2427 -0.0364 -0.0167 0.0257  381 TYR A N   
1511 C CA  . TYR A 212 ? 0.3552 0.3595 0.2836 -0.0330 -0.0157 0.0253  381 TYR A CA  
1512 C C   . TYR A 212 ? 0.3619 0.3616 0.2887 -0.0336 -0.0167 0.0265  381 TYR A C   
1513 O O   . TYR A 212 ? 0.3405 0.3383 0.2665 -0.0314 -0.0160 0.0259  381 TYR A O   
1514 C CB  . TYR A 212 ? 0.3201 0.3216 0.2503 -0.0304 -0.0156 0.0236  381 TYR A CB  
1515 C CG  . TYR A 212 ? 0.3026 0.3091 0.2335 -0.0284 -0.0142 0.0222  381 TYR A CG  
1516 C CD1 . TYR A 212 ? 0.3120 0.3212 0.2448 -0.0301 -0.0150 0.0214  381 TYR A CD1 
1517 C CD2 . TYR A 212 ? 0.3198 0.3281 0.2493 -0.0246 -0.0121 0.0216  381 TYR A CD2 
1518 C CE1 . TYR A 212 ? 0.3139 0.3285 0.2473 -0.0281 -0.0140 0.0200  381 TYR A CE1 
1519 C CE2 . TYR A 212 ? 0.2938 0.3069 0.2235 -0.0221 -0.0108 0.0206  381 TYR A CE2 
1520 C CZ  . TYR A 212 ? 0.3360 0.3528 0.2677 -0.0238 -0.0119 0.0198  381 TYR A CZ  
1521 O OH  . TYR A 212 ? 0.2845 0.3071 0.2163 -0.0212 -0.0108 0.0186  381 TYR A OH  
1535 N N   . PRO A 215 ? 0.3948 0.3952 0.3069 -0.0372 -0.0173 0.0327  384 PRO A N   
1536 C CA  . PRO A 215 ? 0.4109 0.4122 0.3204 -0.0394 -0.0180 0.0351  384 PRO A CA  
1537 C C   . PRO A 215 ? 0.3668 0.3639 0.2759 -0.0399 -0.0205 0.0362  384 PRO A C   
1538 O O   . PRO A 215 ? 0.3626 0.3583 0.2711 -0.0418 -0.0216 0.0385  384 PRO A O   
1539 C CB  . PRO A 215 ? 0.4157 0.4204 0.3218 -0.0384 -0.0163 0.0346  384 PRO A CB  
1540 C CG  . PRO A 215 ? 0.4910 0.4976 0.3979 -0.0360 -0.0141 0.0325  384 PRO A CG  
1541 C CD  . PRO A 215 ? 0.4455 0.4487 0.3558 -0.0350 -0.0148 0.0311  384 PRO A CD  
1542 N N   . GLU A 216 ? 0.3258 0.3211 0.2353 -0.0382 -0.0210 0.0344  385 GLU A N   
1543 C CA  . GLU A 216 ? 0.3437 0.3365 0.2529 -0.0383 -0.0234 0.0352  385 GLU A CA  
1544 C C   . GLU A 216 ? 0.3811 0.3701 0.2933 -0.0384 -0.0252 0.0361  385 GLU A C   
1545 O O   . GLU A 216 ? 0.3810 0.3678 0.2926 -0.0383 -0.0272 0.0376  385 GLU A O   
1546 C CB  . GLU A 216 ? 0.3876 0.3804 0.2967 -0.0368 -0.0234 0.0327  385 GLU A CB  
1547 C CG  . GLU A 216 ? 0.3350 0.3261 0.2476 -0.0353 -0.0227 0.0301  385 GLU A CG  
1548 C CD  . GLU A 216 ? 0.3573 0.3495 0.2694 -0.0342 -0.0198 0.0282  385 GLU A CD  
1549 O OE1 . GLU A 216 ? 0.3467 0.3414 0.2568 -0.0344 -0.0182 0.0290  385 GLU A OE1 
1550 O OE2 . GLU A 216 ? 0.3499 0.3405 0.2637 -0.0329 -0.0188 0.0259  385 GLU A OE2 
1551 N N   . VAL A 217 ? 0.3672 0.3554 0.2822 -0.0383 -0.0244 0.0352  386 VAL A N   
1552 C CA  . VAL A 217 ? 0.3383 0.3226 0.2557 -0.0387 -0.0258 0.0361  386 VAL A CA  
1553 C C   . VAL A 217 ? 0.3545 0.3381 0.2702 -0.0411 -0.0257 0.0387  386 VAL A C   
1554 O O   . VAL A 217 ? 0.3480 0.3277 0.2630 -0.0418 -0.0271 0.0408  386 VAL A O   
1555 C CB  . VAL A 217 ? 0.4001 0.3838 0.3211 -0.0377 -0.0250 0.0339  386 VAL A CB  
1556 C CG1 . VAL A 217 ? 0.3870 0.3663 0.3099 -0.0383 -0.0263 0.0348  386 VAL A CG1 
1557 C CG2 . VAL A 217 ? 0.4353 0.4190 0.3577 -0.0354 -0.0247 0.0315  386 VAL A CG2 
1558 N N   . LEU A 218 ? 0.3870 0.3744 0.3019 -0.0425 -0.0239 0.0386  387 LEU A N   
1559 C CA  . LEU A 218 ? 0.3671 0.3547 0.2807 -0.0455 -0.0234 0.0408  387 LEU A CA  
1560 C C   . LEU A 218 ? 0.4151 0.4014 0.3248 -0.0465 -0.0241 0.0438  387 LEU A C   
1561 O O   . LEU A 218 ? 0.3820 0.3648 0.2907 -0.0485 -0.0244 0.0461  387 LEU A O   
1562 C CB  . LEU A 218 ? 0.3922 0.3857 0.3059 -0.0464 -0.0213 0.0398  387 LEU A CB  
1563 C CG  . LEU A 218 ? 0.4011 0.3962 0.3182 -0.0457 -0.0205 0.0374  387 LEU A CG  
1564 C CD1 . LEU A 218 ? 0.4271 0.4294 0.3439 -0.0457 -0.0184 0.0365  387 LEU A CD1 
1565 C CD2 . LEU A 218 ? 0.4144 0.4063 0.3334 -0.0481 -0.0211 0.0377  387 LEU A CD2 
1566 N N   . ASP A 219 ? 0.4047 0.3934 0.3121 -0.0451 -0.0243 0.0437  388 ASP A N   
1567 C CA  A ASP A 219 ? 0.4035 0.3915 0.3070 -0.0457 -0.0251 0.0464  388 ASP A CA  
1568 C CA  B ASP A 219 ? 0.4198 0.4079 0.3232 -0.0456 -0.0251 0.0464  388 ASP A CA  
1569 C C   . ASP A 219 ? 0.4041 0.3886 0.3073 -0.0436 -0.0275 0.0470  388 ASP A C   
1570 O O   . ASP A 219 ? 0.4160 0.3999 0.3159 -0.0435 -0.0285 0.0492  388 ASP A O   
1571 C CB  A ASP A 219 ? 0.3902 0.3834 0.2906 -0.0457 -0.0238 0.0462  388 ASP A CB  
1572 C CB  B ASP A 219 ? 0.4373 0.4306 0.3376 -0.0454 -0.0239 0.0459  388 ASP A CB  
1573 C CG  A ASP A 219 ? 0.4425 0.4389 0.3416 -0.0483 -0.0218 0.0476  388 ASP A CG  
1574 C CG  B ASP A 219 ? 0.5397 0.5348 0.4404 -0.0429 -0.0241 0.0430  388 ASP A CG  
1575 O OD1 A ASP A 219 ? 0.4590 0.4530 0.3585 -0.0507 -0.0216 0.0494  388 ASP A OD1 
1576 O OD1 B ASP A 219 ? 0.5492 0.5418 0.4518 -0.0414 -0.0256 0.0419  388 ASP A OD1 
1577 O OD2 A ASP A 219 ? 0.4639 0.4653 0.3613 -0.0480 -0.0203 0.0468  388 ASP A OD2 
1578 O OD2 B ASP A 219 ? 0.5673 0.5662 0.4662 -0.0426 -0.0224 0.0419  388 ASP A OD2 
1579 N N   . GLU A 220 ? 0.4520 0.4345 0.3587 -0.0420 -0.0284 0.0450  389 GLU A N   
1580 C CA  . GLU A 220 ? 0.4303 0.4103 0.3376 -0.0399 -0.0307 0.0452  389 GLU A CA  
1581 C C   . GLU A 220 ? 0.4492 0.4325 0.3541 -0.0386 -0.0317 0.0449  389 GLU A C   
1582 O O   . GLU A 220 ? 0.4286 0.4109 0.3319 -0.0375 -0.0336 0.0466  389 GLU A O   
1583 C CB  . GLU A 220 ? 0.4937 0.4683 0.4001 -0.0401 -0.0318 0.0483  389 GLU A CB  
1584 C CG  . GLU A 220 ? 0.6174 0.5882 0.5262 -0.0416 -0.0308 0.0482  389 GLU A CG  
1585 C CD  . GLU A 220 ? 0.6695 0.6334 0.5771 -0.0416 -0.0316 0.0510  389 GLU A CD  
1586 O OE1 . GLU A 220 ? 0.7627 0.7250 0.6665 -0.0422 -0.0317 0.0542  389 GLU A OE1 
1587 O OE2 . GLU A 220 ? 0.7993 0.7593 0.7096 -0.0409 -0.0319 0.0501  389 GLU A OE2 
1588 N N   . THR A 221 ? 0.3888 0.3761 0.2933 -0.0387 -0.0305 0.0425  390 THR A N   
1589 C CA  . THR A 221 ? 0.4308 0.4212 0.3333 -0.0378 -0.0313 0.0414  390 THR A CA  
1590 C C   . THR A 221 ? 0.4693 0.4602 0.3750 -0.0363 -0.0320 0.0381  390 THR A C   
1591 O O   . THR A 221 ? 0.5055 0.4991 0.4101 -0.0359 -0.0327 0.0366  390 THR A O   
1592 C CB  . THR A 221 ? 0.3964 0.3903 0.2958 -0.0387 -0.0293 0.0405  390 THR A CB  
1593 O OG1 . THR A 221 ? 0.3895 0.3839 0.2912 -0.0387 -0.0271 0.0382  390 THR A OG1 
1594 C CG2 . THR A 221 ? 0.4746 0.4688 0.3708 -0.0403 -0.0287 0.0438  390 THR A CG2 
1595 N N   . ILE A 222 ? 0.4073 0.3958 0.3170 -0.0358 -0.0316 0.0369  391 ILE A N   
1596 C CA  . ILE A 222 ? 0.4264 0.4155 0.3393 -0.0346 -0.0318 0.0337  391 ILE A CA  
1597 C C   . ILE A 222 ? 0.4034 0.3933 0.3168 -0.0334 -0.0345 0.0341  391 ILE A C   
1598 O O   . ILE A 222 ? 0.4177 0.4056 0.3310 -0.0327 -0.0362 0.0368  391 ILE A O   
1599 C CB  . ILE A 222 ? 0.4493 0.4359 0.3661 -0.0341 -0.0306 0.0324  391 ILE A CB  
1600 C CG1 . ILE A 222 ? 0.4928 0.4797 0.4129 -0.0329 -0.0310 0.0296  391 ILE A CG1 
1601 C CG2 . ILE A 222 ? 0.5384 0.5215 0.4566 -0.0341 -0.0316 0.0347  391 ILE A CG2 
1602 C CD1 . ILE A 222 ? 0.5739 0.5593 0.4968 -0.0325 -0.0288 0.0276  391 ILE A CD1 
1603 N N   . GLN A 223 ? 0.4288 0.4219 0.3427 -0.0332 -0.0349 0.0314  392 GLN A N   
1604 C CA  . GLN A 223 ? 0.3954 0.3908 0.3108 -0.0320 -0.0375 0.0311  392 GLN A CA  
1605 C C   . GLN A 223 ? 0.4066 0.3999 0.3269 -0.0307 -0.0377 0.0301  392 GLN A C   
1606 O O   . GLN A 223 ? 0.3830 0.3763 0.3059 -0.0311 -0.0361 0.0271  392 GLN A O   
1607 C CB  . GLN A 223 ? 0.4164 0.4164 0.3308 -0.0327 -0.0376 0.0280  392 GLN A CB  
1608 C CG  . GLN A 223 ? 0.4690 0.4726 0.3862 -0.0318 -0.0398 0.0264  392 GLN A CG  
1609 C CD  . GLN A 223 ? 0.5619 0.5673 0.4779 -0.0299 -0.0430 0.0295  392 GLN A CD  
1610 O OE1 . GLN A 223 ? 0.6052 0.6104 0.5243 -0.0279 -0.0446 0.0304  392 GLN A OE1 
1611 N NE2 . GLN A 223 ? 0.5054 0.5129 0.4168 -0.0301 -0.0438 0.0312  392 GLN A NE2 
1612 N N   . VAL A 224 ? 0.4300 0.4209 0.3511 -0.0292 -0.0394 0.0328  393 VAL A N   
1613 C CA  . VAL A 224 ? 0.4389 0.4268 0.3642 -0.0279 -0.0394 0.0324  393 VAL A CA  
1614 C C   . VAL A 224 ? 0.4033 0.3943 0.3326 -0.0268 -0.0402 0.0296  393 VAL A C   
1615 O O   . VAL A 224 ? 0.3975 0.3864 0.3303 -0.0260 -0.0396 0.0285  393 VAL A O   
1616 C CB  . VAL A 224 ? 0.5311 0.5149 0.4557 -0.0263 -0.0409 0.0360  393 VAL A CB  
1617 C CG1 . VAL A 224 ? 0.5487 0.5287 0.4700 -0.0280 -0.0397 0.0386  393 VAL A CG1 
1618 C CG2 . VAL A 224 ? 0.4907 0.4773 0.4140 -0.0243 -0.0437 0.0377  393 VAL A CG2 
1619 N N   . ASP A 225 ? 0.4019 0.3982 0.3306 -0.0269 -0.0415 0.0283  394 ASP A N   
1620 C CA  . ASP A 225 ? 0.4643 0.4648 0.3969 -0.0264 -0.0422 0.0252  394 ASP A CA  
1621 C C   . ASP A 225 ? 0.3923 0.3947 0.3255 -0.0288 -0.0399 0.0213  394 ASP A C   
1622 O O   . ASP A 225 ? 0.5090 0.5156 0.4447 -0.0292 -0.0403 0.0184  394 ASP A O   
1623 C CB  . ASP A 225 ? 0.6361 0.6423 0.5679 -0.0250 -0.0453 0.0260  394 ASP A CB  
1624 C CG  . ASP A 225 ? 0.9576 0.9620 0.8896 -0.0218 -0.0475 0.0296  394 ASP A CG  
1625 O OD1 . ASP A 225 ? 1.1132 1.1143 1.0485 -0.0204 -0.0472 0.0297  394 ASP A OD1 
1626 O OD2 . ASP A 225 ? 1.0358 1.0419 0.9644 -0.0205 -0.0495 0.0323  394 ASP A OD2 
1627 N N   . CYS A 226 ? 0.3930 0.3926 0.3234 -0.0303 -0.0375 0.0211  395 CYS A N   
1628 C CA  . CYS A 226 ? 0.4042 0.4044 0.3342 -0.0323 -0.0349 0.0176  395 CYS A CA  
1629 C C   . CYS A 226 ? 0.3918 0.3876 0.3239 -0.0321 -0.0320 0.0167  395 CYS A C   
1630 O O   . CYS A 226 ? 0.3606 0.3531 0.2908 -0.0319 -0.0307 0.0183  395 CYS A O   
1631 C CB  . CYS A 226 ? 0.3582 0.3587 0.2831 -0.0336 -0.0340 0.0179  395 CYS A CB  
1632 S SG  . CYS A 226 ? 0.4007 0.4004 0.3241 -0.0357 -0.0303 0.0138  395 CYS A SG  
1633 N N   . PHE A 227 ? 0.3373 0.3334 0.2731 -0.0321 -0.0311 0.0140  396 PHE A N   
1634 C CA  . PHE A 227 ? 0.3525 0.3446 0.2901 -0.0315 -0.0285 0.0133  396 PHE A CA  
1635 C C   . PHE A 227 ? 0.3287 0.3180 0.2629 -0.0323 -0.0253 0.0128  396 PHE A C   
1636 O O   . PHE A 227 ? 0.3368 0.3231 0.2705 -0.0313 -0.0239 0.0140  396 PHE A O   
1637 C CB  . PHE A 227 ? 0.3509 0.3440 0.2928 -0.0316 -0.0276 0.0105  396 PHE A CB  
1638 C CG  . PHE A 227 ? 0.3692 0.3583 0.3124 -0.0309 -0.0247 0.0098  396 PHE A CG  
1639 C CD1 . PHE A 227 ? 0.3603 0.3471 0.3054 -0.0290 -0.0252 0.0116  396 PHE A CD1 
1640 C CD2 . PHE A 227 ? 0.4069 0.3940 0.3490 -0.0321 -0.0211 0.0073  396 PHE A CD2 
1641 C CE1 . PHE A 227 ? 0.3758 0.3593 0.3217 -0.0281 -0.0225 0.0110  396 PHE A CE1 
1642 C CE2 . PHE A 227 ? 0.4102 0.3935 0.3529 -0.0310 -0.0183 0.0070  396 PHE A CE2 
1643 C CZ  . PHE A 227 ? 0.4170 0.3990 0.3618 -0.0289 -0.0191 0.0088  396 PHE A CZ  
1644 N N   . ASP A 228 ? 0.3307 0.3213 0.2623 -0.0339 -0.0242 0.0108  397 ASP A N   
1645 C CA  . ASP A 228 ? 0.3594 0.3472 0.2874 -0.0343 -0.0209 0.0101  397 ASP A CA  
1646 C C   . ASP A 228 ? 0.3570 0.3438 0.2825 -0.0333 -0.0210 0.0132  397 ASP A C   
1647 O O   . ASP A 228 ? 0.3492 0.3336 0.2732 -0.0325 -0.0183 0.0133  397 ASP A O   
1648 C CB  . ASP A 228 ? 0.3493 0.3387 0.2739 -0.0362 -0.0202 0.0080  397 ASP A CB  
1649 C CG  . ASP A 228 ? 0.3718 0.3580 0.2923 -0.0362 -0.0166 0.0072  397 ASP A CG  
1650 O OD1 . ASP A 228 ? 0.4363 0.4191 0.3571 -0.0362 -0.0134 0.0051  397 ASP A OD1 
1651 O OD2 . ASP A 228 ? 0.3435 0.3304 0.2602 -0.0361 -0.0168 0.0087  397 ASP A OD2 
1652 N N   . SER A 229 ? 0.3460 0.3348 0.2709 -0.0333 -0.0239 0.0156  398 SER A N   
1653 C CA  . SER A 229 ? 0.3662 0.3544 0.2887 -0.0330 -0.0240 0.0185  398 SER A CA  
1654 C C   . SER A 229 ? 0.3410 0.3267 0.2657 -0.0318 -0.0231 0.0195  398 SER A C   
1655 O O   . SER A 229 ? 0.3458 0.3311 0.2688 -0.0315 -0.0216 0.0205  398 SER A O   
1656 C CB  . SER A 229 ? 0.3562 0.3465 0.2775 -0.0333 -0.0272 0.0211  398 SER A CB  
1657 O OG  . SER A 229 ? 0.3529 0.3461 0.2715 -0.0344 -0.0277 0.0199  398 SER A OG  
1658 N N   . TYR A 230 ? 0.3197 0.3044 0.2483 -0.0310 -0.0241 0.0190  399 TYR A N   
1659 C CA  . TYR A 230 ? 0.3523 0.3349 0.2831 -0.0298 -0.0235 0.0197  399 TYR A CA  
1660 C C   . TYR A 230 ? 0.3316 0.3129 0.2622 -0.0290 -0.0202 0.0180  399 TYR A C   
1661 O O   . TYR A 230 ? 0.3196 0.3003 0.2500 -0.0282 -0.0191 0.0188  399 TYR A O   
1662 C CB  . TYR A 230 ? 0.3546 0.3364 0.2893 -0.0289 -0.0253 0.0197  399 TYR A CB  
1663 C CG  . TYR A 230 ? 0.3725 0.3547 0.3070 -0.0290 -0.0284 0.0221  399 TYR A CG  
1664 C CD1 . TYR A 230 ? 0.3848 0.3649 0.3189 -0.0289 -0.0292 0.0244  399 TYR A CD1 
1665 C CD2 . TYR A 230 ? 0.4737 0.4584 0.4082 -0.0291 -0.0303 0.0219  399 TYR A CD2 
1666 C CE1 . TYR A 230 ? 0.4325 0.4119 0.3659 -0.0288 -0.0316 0.0269  399 TYR A CE1 
1667 C CE2 . TYR A 230 ? 0.5254 0.5102 0.4593 -0.0286 -0.0330 0.0244  399 TYR A CE2 
1668 C CZ  . TYR A 230 ? 0.4977 0.4793 0.4309 -0.0283 -0.0335 0.0270  399 TYR A CZ  
1669 O OH  . TYR A 230 ? 0.4670 0.4479 0.3990 -0.0277 -0.0358 0.0297  399 TYR A OH  
1670 N N   . LYS A 231 ? 0.3152 0.2962 0.2455 -0.0292 -0.0184 0.0156  400 LYS A N   
1671 C CA  . LYS A 231 ? 0.3155 0.2945 0.2446 -0.0282 -0.0148 0.0142  400 LYS A CA  
1672 C C   . LYS A 231 ? 0.3504 0.3299 0.2756 -0.0278 -0.0132 0.0153  400 LYS A C   
1673 O O   . LYS A 231 ? 0.3205 0.2992 0.2449 -0.0261 -0.0110 0.0156  400 LYS A O   
1674 C CB  . LYS A 231 ? 0.3253 0.3031 0.2542 -0.0290 -0.0128 0.0114  400 LYS A CB  
1675 C CG  . LYS A 231 ? 0.3204 0.2979 0.2534 -0.0292 -0.0134 0.0098  400 LYS A CG  
1676 C CD  . LYS A 231 ? 0.3384 0.3141 0.2709 -0.0303 -0.0104 0.0068  400 LYS A CD  
1677 C CE  . LYS A 231 ? 0.3792 0.3568 0.3097 -0.0326 -0.0111 0.0053  400 LYS A CE  
1678 N NZ  . LYS A 231 ? 0.3462 0.3217 0.2758 -0.0343 -0.0080 0.0020  400 LYS A NZ  
1679 N N   . ARG A 232 ? 0.3661 0.3475 0.2887 -0.0291 -0.0143 0.0161  401 ARG A N   
1680 C CA  . ARG A 232 ? 0.3530 0.3355 0.2717 -0.0287 -0.0127 0.0171  401 ARG A CA  
1681 C C   . ARG A 232 ? 0.3260 0.3103 0.2452 -0.0283 -0.0136 0.0195  401 ARG A C   
1682 O O   . ARG A 232 ? 0.3126 0.2983 0.2299 -0.0273 -0.0118 0.0200  401 ARG A O   
1683 C CB  . ARG A 232 ? 0.3589 0.3428 0.2743 -0.0302 -0.0133 0.0169  401 ARG A CB  
1684 C CG  . ARG A 232 ? 0.3728 0.3548 0.2868 -0.0307 -0.0113 0.0139  401 ARG A CG  
1685 C CD  . ARG A 232 ? 0.4328 0.4165 0.3443 -0.0325 -0.0125 0.0131  401 ARG A CD  
1686 N NE  . ARG A 232 ? 0.4330 0.4147 0.3441 -0.0335 -0.0107 0.0098  401 ARG A NE  
1687 C CZ  . ARG A 232 ? 0.4124 0.3908 0.3204 -0.0330 -0.0069 0.0079  401 ARG A CZ  
1688 N NH1 . ARG A 232 ? 0.4183 0.3959 0.3231 -0.0312 -0.0046 0.0090  401 ARG A NH1 
1689 N NH2 . ARG A 232 ? 0.4850 0.4612 0.3929 -0.0345 -0.0054 0.0047  401 ARG A NH2 
1690 N N   . VAL A 233 ? 0.2972 0.2816 0.2191 -0.0291 -0.0164 0.0207  402 VAL A N   
1691 C CA  . VAL A 233 ? 0.2969 0.2822 0.2199 -0.0292 -0.0171 0.0225  402 VAL A CA  
1692 C C   . VAL A 233 ? 0.3224 0.3072 0.2470 -0.0273 -0.0152 0.0215  402 VAL A C   
1693 O O   . VAL A 233 ? 0.2896 0.2768 0.2136 -0.0269 -0.0144 0.0223  402 VAL A O   
1694 C CB  . VAL A 233 ? 0.3144 0.2985 0.2398 -0.0303 -0.0202 0.0238  402 VAL A CB  
1695 C CG1 . VAL A 233 ? 0.3122 0.2962 0.2391 -0.0306 -0.0207 0.0251  402 VAL A CG1 
1696 C CG2 . VAL A 233 ? 0.3485 0.3335 0.2716 -0.0317 -0.0220 0.0254  402 VAL A CG2 
1697 N N   . ASP A 234 ? 0.2995 0.2820 0.2262 -0.0262 -0.0146 0.0198  403 ASP A N   
1698 C CA  . ASP A 234 ? 0.2840 0.2660 0.2118 -0.0241 -0.0126 0.0190  403 ASP A CA  
1699 C C   . ASP A 234 ? 0.2810 0.2641 0.2054 -0.0224 -0.0094 0.0187  403 ASP A C   
1700 O O   . ASP A 234 ? 0.3012 0.2860 0.2255 -0.0206 -0.0081 0.0189  403 ASP A O   
1701 C CB  . ASP A 234 ? 0.2870 0.2660 0.2170 -0.0232 -0.0119 0.0172  403 ASP A CB  
1702 C CG  . ASP A 234 ? 0.2895 0.2676 0.2234 -0.0238 -0.0145 0.0173  403 ASP A CG  
1703 O OD1 . ASP A 234 ? 0.3108 0.2894 0.2456 -0.0245 -0.0166 0.0187  403 ASP A OD1 
1704 O OD2 . ASP A 234 ? 0.2672 0.2436 0.2031 -0.0234 -0.0141 0.0159  403 ASP A OD2 
1705 N N   . ILE A 235 ? 0.3157 0.2979 0.2373 -0.0227 -0.0081 0.0180  404 ILE A N   
1706 C CA  . ILE A 235 ? 0.2950 0.2774 0.2129 -0.0207 -0.0048 0.0177  404 ILE A CA  
1707 C C   . ILE A 235 ? 0.2902 0.2773 0.2066 -0.0203 -0.0049 0.0194  404 ILE A C   
1708 O O   . ILE A 235 ? 0.3339 0.3227 0.2487 -0.0178 -0.0026 0.0196  404 ILE A O   
1709 C CB  . ILE A 235 ? 0.3306 0.3107 0.2455 -0.0214 -0.0033 0.0164  404 ILE A CB  
1710 C CG1 . ILE A 235 ? 0.3359 0.3118 0.2522 -0.0219 -0.0026 0.0143  404 ILE A CG1 
1711 C CG2 . ILE A 235 ? 0.3680 0.3481 0.2784 -0.0191 0.0000  0.0164  404 ILE A CG2 
1712 C CD1 . ILE A 235 ? 0.4083 0.3812 0.3251 -0.0195 0.0002  0.0134  404 ILE A CD1 
1713 N N   . TRP A 236 ? 0.3324 0.3218 0.2492 -0.0228 -0.0075 0.0208  405 TRP A N   
1714 C CA  . TRP A 236 ? 0.3377 0.3320 0.2536 -0.0231 -0.0077 0.0224  405 TRP A CA  
1715 C C   . TRP A 236 ? 0.3410 0.3376 0.2593 -0.0219 -0.0076 0.0225  405 TRP A C   
1716 O O   . TRP A 236 ? 0.2960 0.2966 0.2130 -0.0200 -0.0058 0.0227  405 TRP A O   
1717 C CB  . TRP A 236 ? 0.3198 0.3152 0.2360 -0.0263 -0.0104 0.0239  405 TRP A CB  
1718 C CG  . TRP A 236 ? 0.3053 0.3054 0.2215 -0.0274 -0.0108 0.0255  405 TRP A CG  
1719 C CD1 . TRP A 236 ? 0.3135 0.3152 0.2324 -0.0284 -0.0120 0.0260  405 TRP A CD1 
1720 C CD2 . TRP A 236 ? 0.3015 0.3056 0.2149 -0.0281 -0.0100 0.0266  405 TRP A CD2 
1721 N NE1 . TRP A 236 ? 0.3407 0.3473 0.2589 -0.0299 -0.0118 0.0272  405 TRP A NE1 
1722 C CE2 . TRP A 236 ? 0.3252 0.3335 0.2400 -0.0296 -0.0106 0.0278  405 TRP A CE2 
1723 C CE3 . TRP A 236 ? 0.3630 0.3677 0.2728 -0.0276 -0.0087 0.0267  405 TRP A CE3 
1724 C CZ2 . TRP A 236 ? 0.3204 0.3338 0.2334 -0.0307 -0.0100 0.0291  405 TRP A CZ2 
1725 C CZ3 . TRP A 236 ? 0.3439 0.3534 0.2516 -0.0283 -0.0080 0.0280  405 TRP A CZ3 
1726 C CH2 . TRP A 236 ? 0.3753 0.3893 0.2847 -0.0299 -0.0086 0.0293  405 TRP A CH2 
1727 N N   . ALA A 237 ? 0.3119 0.3063 0.2335 -0.0228 -0.0094 0.0222  406 ALA A N   
1728 C CA  . ALA A 237 ? 0.3080 0.3044 0.2318 -0.0220 -0.0096 0.0219  406 ALA A CA  
1729 C C   . ALA A 237 ? 0.2903 0.2871 0.2131 -0.0183 -0.0068 0.0209  406 ALA A C   
1730 O O   . ALA A 237 ? 0.2853 0.2865 0.2080 -0.0168 -0.0060 0.0210  406 ALA A O   
1731 C CB  . ALA A 237 ? 0.3335 0.3266 0.2606 -0.0234 -0.0119 0.0216  406 ALA A CB  
1732 N N   . PHE A 238 ? 0.2749 0.2673 0.1966 -0.0167 -0.0051 0.0200  407 PHE A N   
1733 C CA  A PHE A 238 ? 0.2905 0.2819 0.2104 -0.0130 -0.0019 0.0192  407 PHE A CA  
1734 C CA  B PHE A 238 ? 0.2958 0.2873 0.2158 -0.0130 -0.0018 0.0192  407 PHE A CA  
1735 C C   . PHE A 238 ? 0.3180 0.3135 0.2345 -0.0107 0.0003  0.0200  407 PHE A C   
1736 O O   . PHE A 238 ? 0.3257 0.3240 0.2413 -0.0074 0.0021  0.0201  407 PHE A O   
1737 C CB  A PHE A 238 ? 0.2978 0.2832 0.2169 -0.0126 -0.0002 0.0180  407 PHE A CB  
1738 C CB  B PHE A 238 ? 0.3116 0.2969 0.2306 -0.0125 -0.0001 0.0180  407 PHE A CB  
1739 C CG  A PHE A 238 ? 0.2829 0.2657 0.1999 -0.0089 0.0034  0.0174  407 PHE A CG  
1740 C CG  B PHE A 238 ? 0.3031 0.2862 0.2194 -0.0086 0.0037  0.0175  407 PHE A CG  
1741 C CD1 A PHE A 238 ? 0.2999 0.2856 0.2170 -0.0059 0.0043  0.0179  407 PHE A CD1 
1742 C CD1 B PHE A 238 ? 0.3468 0.3293 0.2587 -0.0067 0.0066  0.0177  407 PHE A CD1 
1743 C CD2 A PHE A 238 ? 0.2776 0.2550 0.1923 -0.0084 0.0060  0.0164  407 PHE A CD2 
1744 C CD2 B PHE A 238 ? 0.3032 0.2843 0.2209 -0.0067 0.0047  0.0170  407 PHE A CD2 
1745 C CE1 A PHE A 238 ? 0.3004 0.2835 0.2149 -0.0021 0.0078  0.0177  407 PHE A CE1 
1746 C CE1 B PHE A 238 ? 0.3372 0.3168 0.2460 -0.0027 0.0106  0.0176  407 PHE A CE1 
1747 C CE2 A PHE A 238 ? 0.3021 0.2761 0.2143 -0.0050 0.0098  0.0160  407 PHE A CE2 
1748 C CE2 B PHE A 238 ? 0.3034 0.2820 0.2180 -0.0029 0.0086  0.0169  407 PHE A CE2 
1749 C CZ  A PHE A 238 ? 0.3101 0.2869 0.2222 -0.0016 0.0107  0.0169  407 PHE A CZ  
1750 C CZ  B PHE A 238 ? 0.3337 0.3113 0.2438 -0.0009 0.0115  0.0172  407 PHE A CZ  
1751 N N   . GLY A 239 ? 0.3151 0.3117 0.2295 -0.0121 0.0002  0.0206  408 GLY A N   
1752 C CA  . GLY A 239 ? 0.2766 0.2777 0.1877 -0.0098 0.0023  0.0214  408 GLY A CA  
1753 C C   . GLY A 239 ? 0.2788 0.2874 0.1915 -0.0095 0.0013  0.0222  408 GLY A C   
1754 O O   . GLY A 239 ? 0.2686 0.2814 0.1796 -0.0060 0.0033  0.0224  408 GLY A O   
1755 N N   . LEU A 240 ? 0.2867 0.2972 0.2027 -0.0131 -0.0017 0.0225  409 LEU A N   
1756 C CA  . LEU A 240 ? 0.3085 0.3259 0.2265 -0.0137 -0.0027 0.0227  409 LEU A CA  
1757 C C   . LEU A 240 ? 0.3227 0.3412 0.2417 -0.0105 -0.0018 0.0218  409 LEU A C   
1758 O O   . LEU A 240 ? 0.3126 0.3381 0.2313 -0.0084 -0.0010 0.0219  409 LEU A O   
1759 C CB  . LEU A 240 ? 0.2999 0.3173 0.2209 -0.0185 -0.0059 0.0231  409 LEU A CB  
1760 C CG  . LEU A 240 ? 0.3250 0.3415 0.2449 -0.0217 -0.0070 0.0243  409 LEU A CG  
1761 C CD1 . LEU A 240 ? 0.3038 0.3195 0.2263 -0.0260 -0.0097 0.0249  409 LEU A CD1 
1762 C CD2 . LEU A 240 ? 0.3035 0.3263 0.2209 -0.0211 -0.0055 0.0252  409 LEU A CD2 
1763 N N   . VAL A 241 ? 0.3228 0.3351 0.2429 -0.0100 -0.0019 0.0210  410 VAL A N   
1764 C CA  . VAL A 241 ? 0.3052 0.3181 0.2259 -0.0067 -0.0009 0.0202  410 VAL A CA  
1765 C C   . VAL A 241 ? 0.3052 0.3197 0.2220 -0.0017 0.0025  0.0206  410 VAL A C   
1766 O O   . VAL A 241 ? 0.2752 0.2951 0.1916 0.0013  0.0034  0.0206  410 VAL A O   
1767 C CB  . VAL A 241 ? 0.2865 0.2923 0.2089 -0.0070 -0.0013 0.0193  410 VAL A CB  
1768 C CG1 . VAL A 241 ? 0.3079 0.3144 0.2303 -0.0034 0.0001  0.0187  410 VAL A CG1 
1769 C CG2 . VAL A 241 ? 0.2938 0.2982 0.2198 -0.0113 -0.0047 0.0190  410 VAL A CG2 
1770 N N   . LEU A 242 ? 0.3014 0.3114 0.2151 -0.0007 0.0046  0.0210  411 LEU A N   
1771 C CA  A LEU A 242 ? 0.3178 0.3278 0.2272 0.0041  0.0083  0.0215  411 LEU A CA  
1772 C CA  B LEU A 242 ? 0.2986 0.3087 0.2080 0.0042  0.0083  0.0215  411 LEU A CA  
1773 C C   . LEU A 242 ? 0.3105 0.3301 0.2189 0.0062  0.0087  0.0224  411 LEU A C   
1774 O O   . LEU A 242 ? 0.3041 0.3270 0.2103 0.0111  0.0109  0.0228  411 LEU A O   
1775 C CB  A LEU A 242 ? 0.3437 0.3475 0.2501 0.0035  0.0100  0.0214  411 LEU A CB  
1776 C CB  B LEU A 242 ? 0.2921 0.2959 0.1982 0.0041  0.0104  0.0215  411 LEU A CB  
1777 C CG  A LEU A 242 ? 0.3802 0.3805 0.2814 0.0082  0.0144  0.0217  411 LEU A CG  
1778 C CG  B LEU A 242 ? 0.2865 0.2811 0.1925 0.0031  0.0113  0.0204  411 LEU A CG  
1779 C CD1 A LEU A 242 ? 0.4311 0.4278 0.3315 0.0120  0.0168  0.0216  411 LEU A CD1 
1780 C CD1 B LEU A 242 ? 0.3055 0.2952 0.2084 0.0022  0.0129  0.0200  411 LEU A CD1 
1781 C CD2 A LEU A 242 ? 0.3855 0.3786 0.2846 0.0061  0.0154  0.0209  411 LEU A CD2 
1782 C CD2 B LEU A 242 ? 0.2945 0.2858 0.1990 0.0073  0.0142  0.0202  411 LEU A CD2 
1783 N N   . TRP A 243 ? 0.3122 0.3364 0.2219 0.0027  0.0066  0.0227  412 TRP A N   
1784 C CA  . TRP A 243 ? 0.3396 0.3739 0.2491 0.0037  0.0067  0.0234  412 TRP A CA  
1785 C C   . TRP A 243 ? 0.3077 0.3491 0.2198 0.0045  0.0054  0.0229  412 TRP A C   
1786 O O   . TRP A 243 ? 0.3232 0.3721 0.2339 0.0085  0.0069  0.0232  412 TRP A O   
1787 C CB  . TRP A 243 ? 0.3193 0.3562 0.2300 -0.0011 0.0046  0.0239  412 TRP A CB  
1788 C CG  . TRP A 243 ? 0.3076 0.3552 0.2187 -0.0012 0.0044  0.0245  412 TRP A CG  
1789 C CD1 . TRP A 243 ? 0.3223 0.3744 0.2304 0.0012  0.0065  0.0254  412 TRP A CD1 
1790 C CD2 . TRP A 243 ? 0.3069 0.3622 0.2217 -0.0045 0.0021  0.0241  412 TRP A CD2 
1791 N NE1 . TRP A 243 ? 0.3122 0.3753 0.2222 -0.0002 0.0055  0.0256  412 TRP A NE1 
1792 C CE2 . TRP A 243 ? 0.3355 0.4007 0.2497 -0.0039 0.0029  0.0247  412 TRP A CE2 
1793 C CE3 . TRP A 243 ? 0.3117 0.3666 0.2302 -0.0078 -0.0003 0.0230  412 TRP A CE3 
1794 C CZ2 . TRP A 243 ? 0.3415 0.4164 0.2588 -0.0070 0.0013  0.0243  412 TRP A CZ2 
1795 C CZ3 . TRP A 243 ? 0.3064 0.3701 0.2277 -0.0108 -0.0018 0.0225  412 TRP A CZ3 
1796 C CH2 . TRP A 243 ? 0.3513 0.4251 0.2721 -0.0106 -0.0010 0.0231  412 TRP A CH2 
1797 N N   . GLU A 244 ? 0.3064 0.3459 0.2222 0.0008  0.0028  0.0219  413 GLU A N   
1798 C CA  . GLU A 244 ? 0.3145 0.3602 0.2328 0.0011  0.0015  0.0210  413 GLU A CA  
1799 C C   . GLU A 244 ? 0.3113 0.3579 0.2272 0.0073  0.0040  0.0210  413 GLU A C   
1800 O O   . GLU A 244 ? 0.3244 0.3801 0.2406 0.0096  0.0039  0.0207  413 GLU A O   
1801 C CB  . GLU A 244 ? 0.3462 0.3865 0.2679 -0.0028 -0.0010 0.0198  413 GLU A CB  
1802 C CG  . GLU A 244 ? 0.3406 0.3809 0.2650 -0.0088 -0.0037 0.0198  413 GLU A CG  
1803 C CD  . GLU A 244 ? 0.3138 0.3478 0.2411 -0.0119 -0.0059 0.0188  413 GLU A CD  
1804 O OE1 . GLU A 244 ? 0.2813 0.3186 0.2108 -0.0127 -0.0071 0.0175  413 GLU A OE1 
1805 O OE2 . GLU A 244 ? 0.3108 0.3370 0.2381 -0.0134 -0.0064 0.0193  413 GLU A OE2 
1806 N N   . VAL A 245 ? 0.2932 0.3307 0.2068 0.0098  0.0061  0.0213  414 VAL A N   
1807 C CA  . VAL A 245 ? 0.3076 0.3438 0.2186 0.0155  0.0087  0.0215  414 VAL A CA  
1808 C C   . VAL A 245 ? 0.3214 0.3621 0.2280 0.0210  0.0118  0.0229  414 VAL A C   
1809 O O   . VAL A 245 ? 0.2744 0.3213 0.1795 0.0258  0.0130  0.0233  414 VAL A O   
1810 C CB  . VAL A 245 ? 0.2932 0.3176 0.2031 0.0158  0.0102  0.0213  414 VAL A CB  
1811 C CG1 . VAL A 245 ? 0.3086 0.3308 0.2151 0.0219  0.0136  0.0219  414 VAL A CG1 
1812 C CG2 . VAL A 245 ? 0.3340 0.3549 0.2483 0.0114  0.0073  0.0200  414 VAL A CG2 
1813 N N   . ALA A 246 ? 0.3103 0.3482 0.2146 0.0206  0.0131  0.0237  415 ALA A N   
1814 C CA  . ALA A 246 ? 0.3145 0.3551 0.2141 0.0262  0.0165  0.0250  415 ALA A CA  
1815 C C   . ALA A 246 ? 0.3279 0.3823 0.2283 0.0281  0.0156  0.0253  415 ALA A C   
1816 O O   . ALA A 246 ? 0.3079 0.3670 0.2050 0.0343  0.0181  0.0264  415 ALA A O   
1817 C CB  . ALA A 246 ? 0.3746 0.4097 0.2718 0.0247  0.0177  0.0254  415 ALA A CB  
1818 N N   . ARG A 247 ? 0.3406 0.4019 0.2454 0.0227  0.0122  0.0245  416 ARG A N   
1819 C CA  . ARG A 247 ? 0.3474 0.4228 0.2539 0.0235  0.0111  0.0243  416 ARG A CA  
1820 C C   . ARG A 247 ? 0.3600 0.4414 0.2661 0.0283  0.0115  0.0240  416 ARG A C   
1821 O O   . ARG A 247 ? 0.3543 0.4472 0.2597 0.0319  0.0121  0.0244  416 ARG A O   
1822 C CB  . ARG A 247 ? 0.3535 0.4333 0.2651 0.0160  0.0073  0.0231  416 ARG A CB  
1823 C CG  . ARG A 247 ? 0.3698 0.4485 0.2815 0.0120  0.0069  0.0237  416 ARG A CG  
1824 C CD  . ARG A 247 ? 0.4186 0.4998 0.3349 0.0046  0.0035  0.0226  416 ARG A CD  
1825 N NE  . ARG A 247 ? 0.4040 0.4979 0.3231 0.0035  0.0022  0.0216  416 ARG A NE  
1826 C CZ  . ARG A 247 ? 0.4111 0.5159 0.3310 0.0025  0.0022  0.0218  416 ARG A CZ  
1827 N NH1 . ARG A 247 ? 0.4268 0.5317 0.3444 0.0029  0.0036  0.0232  416 ARG A NH1 
1828 N NH2 . ARG A 247 ? 0.4199 0.5362 0.3427 0.0010  0.0009  0.0204  416 ARG A NH2 
1829 N N   . ARG A 248 ? 0.3567 0.4308 0.2633 0.0284  0.0113  0.0234  417 ARG A N   
1830 C CA  . ARG A 248 ? 0.3560 0.4353 0.2623 0.0325  0.0115  0.0230  417 ARG A CA  
1831 C C   . ARG A 248 ? 0.3731 0.4480 0.2738 0.0405  0.0155  0.0247  417 ARG A C   
1832 O O   . ARG A 248 ? 0.3876 0.4664 0.2872 0.0448  0.0161  0.0248  417 ARG A O   
1833 C CB  . ARG A 248 ? 0.3361 0.4106 0.2458 0.0283  0.0090  0.0213  417 ARG A CB  
1834 C CG  . ARG A 248 ? 0.3614 0.4388 0.2761 0.0206  0.0053  0.0197  417 ARG A CG  
1835 C CD  . ARG A 248 ? 0.3340 0.4262 0.2507 0.0198  0.0038  0.0188  417 ARG A CD  
1836 N NE  . ARG A 248 ? 0.3366 0.4346 0.2546 0.0211  0.0026  0.0172  417 ARG A NE  
1837 C CZ  . ARG A 248 ? 0.3553 0.4671 0.2736 0.0236  0.0022  0.0165  417 ARG A CZ  
1838 N NH1 . ARG A 248 ? 0.3447 0.4664 0.2623 0.0252  0.0029  0.0172  417 ARG A NH1 
1839 N NH2 . ARG A 248 ? 0.3842 0.5005 0.3035 0.0246  0.0011  0.0148  417 ARG A NH2 
1840 N N   . MET A 249 ? 0.3603 0.4269 0.2572 0.0424  0.0185  0.0261  418 MET A N   
1841 C CA  . MET A 249 ? 0.3650 0.4267 0.2559 0.0501  0.0229  0.0279  418 MET A CA  
1842 C C   . MET A 249 ? 0.3921 0.4649 0.2802 0.0558  0.0243  0.0292  418 MET A C   
1843 O O   . MET A 249 ? 0.3802 0.4579 0.2690 0.0540  0.0238  0.0293  418 MET A O   
1844 C CB  . MET A 249 ? 0.3601 0.4076 0.2478 0.0496  0.0257  0.0285  418 MET A CB  
1845 C CG  . MET A 249 ? 0.3875 0.4276 0.2686 0.0570  0.0307  0.0303  418 MET A CG  
1846 S SD  . MET A 249 ? 0.4215 0.4465 0.2983 0.0562  0.0345  0.0306  418 MET A SD  
1847 C CE  . MET A 249 ? 0.4759 0.5040 0.3454 0.0655  0.0391  0.0330  418 MET A CE  
1848 N N   . VAL A 250 ? 0.3627 0.4399 0.2477 0.0629  0.0263  0.0304  419 VAL A N   
1849 C CA  . VAL A 250 ? 0.3762 0.4646 0.2581 0.0695  0.0279  0.0318  419 VAL A CA  
1850 C C   . VAL A 250 ? 0.4020 0.4819 0.2775 0.0748  0.0326  0.0340  419 VAL A C   
1851 O O   . VAL A 250 ? 0.3783 0.4444 0.2497 0.0769  0.0359  0.0348  419 VAL A O   
1852 C CB  . VAL A 250 ? 0.4122 0.5083 0.2922 0.0762  0.0286  0.0325  419 VAL A CB  
1853 C CG1 . VAL A 250 ? 0.5032 0.6124 0.3804 0.0834  0.0300  0.0341  419 VAL A CG1 
1854 C CG2 . VAL A 250 ? 0.4434 0.5477 0.3293 0.0712  0.0241  0.0301  419 VAL A CG2 
1855 N N   . SER A 251 ? 0.4150 0.5030 0.2895 0.0769  0.0332  0.0347  420 SER A N   
1856 C CA  . SER A 251 ? 0.4689 0.5510 0.3365 0.0837  0.0381  0.0368  420 SER A CA  
1857 C C   . SER A 251 ? 0.4895 0.5872 0.3557 0.0899  0.0386  0.0381  420 SER A C   
1858 O O   . SER A 251 ? 0.4136 0.5246 0.2849 0.0860  0.0352  0.0368  420 SER A O   
1859 C CB  . SER A 251 ? 0.4185 0.4903 0.2854 0.0790  0.0389  0.0363  420 SER A CB  
1860 O OG  . SER A 251 ? 0.4580 0.5399 0.3290 0.0743  0.0360  0.0354  420 SER A OG  
1861 N N   . ASN A 252 ? 0.5670 0.6634 0.4265 0.0996  0.0429  0.0405  421 ASN A N   
1862 C CA  A ASN A 252 ? 0.5189 0.6305 0.3764 0.1068  0.0438  0.0419  421 ASN A CA  
1863 C CA  B ASN A 252 ? 0.5431 0.6541 0.4006 0.1067  0.0439  0.0419  421 ASN A CA  
1864 C C   . ASN A 252 ? 0.4905 0.6211 0.3542 0.1047  0.0393  0.0405  421 ASN A C   
1865 O O   . ASN A 252 ? 0.6142 0.7595 0.4807 0.1043  0.0376  0.0400  421 ASN A O   
1866 C CB  A ASN A 252 ? 0.4923 0.6056 0.3490 0.1061  0.0449  0.0422  421 ASN A CB  
1867 C CB  B ASN A 252 ? 0.5495 0.6596 0.4057 0.1058  0.0452  0.0422  421 ASN A CB  
1868 C CG  A ASN A 252 ? 0.4644 0.5923 0.3182 0.1148  0.0466  0.0440  421 ASN A CG  
1869 C CG  B ASN A 252 ? 0.5556 0.6464 0.4049 0.1083  0.0502  0.0433  421 ASN A CG  
1870 O OD1 A ASN A 252 ? 0.4398 0.5687 0.2883 0.1242  0.0497  0.0462  421 ASN A OD1 
1871 O OD1 B ASN A 252 ? 0.5820 0.6661 0.4244 0.1166  0.0546  0.0455  421 ASN A OD1 
1872 N ND2 A ASN A 252 ? 0.4227 0.5623 0.2800 0.1119  0.0448  0.0432  421 ASN A ND2 
1873 N ND2 B ASN A 252 ? 0.4817 0.5632 0.3324 0.1011  0.0496  0.0419  421 ASN A ND2 
1874 N N   . GLY A 253 ? 0.5517 0.6821 0.4177 0.1030  0.0372  0.0395  422 GLY A N   
1875 C CA  . GLY A 253 ? 0.5965 0.7441 0.4680 0.1009  0.0331  0.0377  422 GLY A CA  
1876 C C   . GLY A 253 ? 0.5664 0.7204 0.4459 0.0902  0.0283  0.0347  422 GLY A C   
1877 O O   . GLY A 253 ? 0.5833 0.7510 0.4675 0.0876  0.0249  0.0328  422 GLY A O   
1878 N N   . ILE A 254 ? 0.5109 0.6542 0.3916 0.0838  0.0282  0.0342  423 ILE A N   
1879 C CA  . ILE A 254 ? 0.4896 0.6381 0.3769 0.0742  0.0243  0.0320  423 ILE A CA  
1880 C C   . ILE A 254 ? 0.4653 0.6006 0.3556 0.0663  0.0223  0.0304  423 ILE A C   
1881 O O   . ILE A 254 ? 0.4395 0.5593 0.3266 0.0671  0.0244  0.0312  423 ILE A O   
1882 C CB  . ILE A 254 ? 0.5573 0.7054 0.4433 0.0735  0.0258  0.0329  423 ILE A CB  
1883 C CG1 . ILE A 254 ? 0.6782 0.8405 0.5615 0.0814  0.0278  0.0344  423 ILE A CG1 
1884 C CG2 . ILE A 254 ? 0.5923 0.7442 0.4844 0.0636  0.0223  0.0309  423 ILE A CG2 
1885 C CD1 . ILE A 254 ? 0.6920 0.8509 0.5720 0.0831  0.0305  0.0358  423 ILE A CD1 
1886 N N   . VAL A 255 ? 0.4687 0.6100 0.3651 0.0585  0.0182  0.0281  424 VAL A N   
1887 C CA  . VAL A 255 ? 0.4210 0.5509 0.3206 0.0509  0.0161  0.0267  424 VAL A CA  
1888 C C   . VAL A 255 ? 0.4257 0.5626 0.3311 0.0421  0.0125  0.0248  424 VAL A C   
1889 O O   . VAL A 255 ? 0.3893 0.5409 0.2971 0.0417  0.0113  0.0240  424 VAL A O   
1890 C CB  . VAL A 255 ? 0.4362 0.5633 0.3361 0.0521  0.0153  0.0258  424 VAL A CB  
1891 C CG1 . VAL A 255 ? 0.4562 0.5974 0.3611 0.0487  0.0117  0.0234  424 VAL A CG1 
1892 C CG2 . VAL A 255 ? 0.4051 0.5160 0.3057 0.0478  0.0150  0.0253  424 VAL A CG2 
1893 N N   . GLU A 256 ? 0.4075 0.5341 0.3151 0.0353  0.0111  0.0241  425 GLU A N   
1894 C CA  . GLU A 256 ? 0.3591 0.4905 0.2720 0.0269  0.0078  0.0225  425 GLU A CA  
1895 C C   . GLU A 256 ? 0.4145 0.5450 0.3310 0.0227  0.0050  0.0203  425 GLU A C   
1896 O O   . GLU A 256 ? 0.3861 0.5081 0.3013 0.0249  0.0055  0.0203  425 GLU A O   
1897 C CB  . GLU A 256 ? 0.3857 0.5061 0.2985 0.0219  0.0077  0.0231  425 GLU A CB  
1898 C CG  . GLU A 256 ? 0.3735 0.4960 0.2835 0.0241  0.0099  0.0247  425 GLU A CG  
1899 C CD  . GLU A 256 ? 0.4106 0.5246 0.3147 0.0312  0.0136  0.0265  425 GLU A CD  
1900 O OE1 . GLU A 256 ? 0.3998 0.5000 0.3024 0.0306  0.0142  0.0266  425 GLU A OE1 
1901 O OE2 . GLU A 256 ? 0.4333 0.5544 0.3342 0.0375  0.0161  0.0277  425 GLU A OE2 
1902 N N   . ASP A 257 ? 0.3645 0.5035 0.2855 0.0164  0.0023  0.0184  426 ASP A N   
1903 C CA  . ASP A 257 ? 0.3918 0.5286 0.3164 0.0113  -0.0003 0.0161  426 ASP A CA  
1904 C C   . ASP A 257 ? 0.3940 0.5147 0.3188 0.0072  -0.0009 0.0165  426 ASP A C   
1905 O O   . ASP A 257 ? 0.3546 0.4691 0.2782 0.0057  -0.0001 0.0180  426 ASP A O   
1906 C CB  . ASP A 257 ? 0.4332 0.5805 0.3622 0.0044  -0.0026 0.0141  426 ASP A CB  
1907 C CG  . ASP A 257 ? 0.4785 0.6438 0.4082 0.0073  -0.0025 0.0132  426 ASP A CG  
1908 O OD1 . ASP A 257 ? 0.5105 0.6807 0.4383 0.0138  -0.0016 0.0133  426 ASP A OD1 
1909 O OD2 . ASP A 257 ? 0.6256 0.8006 0.5580 0.0029  -0.0032 0.0124  426 ASP A OD2 
1910 N N   . TYR A 258 ? 0.3494 0.4643 0.2759 0.0050  -0.0025 0.0150  427 TYR A N   
1911 C CA  . TYR A 258 ? 0.3315 0.4332 0.2591 0.0003  -0.0036 0.0150  427 TYR A CA  
1912 C C   . TYR A 258 ? 0.3482 0.4508 0.2785 -0.0068 -0.0052 0.0148  427 TYR A C   
1913 O O   . TYR A 258 ? 0.3450 0.4563 0.2780 -0.0107 -0.0066 0.0131  427 TYR A O   
1914 C CB  . TYR A 258 ? 0.3330 0.4290 0.2624 -0.0011 -0.0051 0.0132  427 TYR A CB  
1915 C CG  . TYR A 258 ? 0.3222 0.4052 0.2526 -0.0055 -0.0061 0.0136  427 TYR A CG  
1916 C CD1 . TYR A 258 ? 0.3401 0.4125 0.2683 -0.0029 -0.0047 0.0151  427 TYR A CD1 
1917 C CD2 . TYR A 258 ? 0.3363 0.4182 0.2697 -0.0124 -0.0083 0.0126  427 TYR A CD2 
1918 C CE1 . TYR A 258 ? 0.3341 0.3960 0.2632 -0.0068 -0.0057 0.0155  427 TYR A CE1 
1919 C CE2 . TYR A 258 ? 0.3492 0.4200 0.2831 -0.0158 -0.0092 0.0133  427 TYR A CE2 
1920 C CZ  . TYR A 258 ? 0.3344 0.3958 0.2663 -0.0130 -0.0080 0.0147  427 TYR A CZ  
1921 O OH  . TYR A 258 ? 0.3566 0.4084 0.2893 -0.0165 -0.0091 0.0153  427 TYR A OH  
1922 N N   . LYS A 259 ? 0.3721 0.4653 0.3014 -0.0086 -0.0049 0.0163  428 LYS A N   
1923 C CA  . LYS A 259 ? 0.3627 0.4533 0.2940 -0.0156 -0.0065 0.0164  428 LYS A CA  
1924 C C   . LYS A 259 ? 0.3386 0.4156 0.2692 -0.0170 -0.0069 0.0173  428 LYS A C   
1925 O O   . LYS A 259 ? 0.2942 0.3651 0.2222 -0.0130 -0.0054 0.0185  428 LYS A O   
1926 C CB  . LYS A 259 ? 0.3916 0.4888 0.3221 -0.0164 -0.0055 0.0177  428 LYS A CB  
1927 C CG  . LYS A 259 ? 0.3824 0.4949 0.3139 -0.0153 -0.0051 0.0168  428 LYS A CG  
1928 C CD  . LYS A 259 ? 0.4532 0.5715 0.3886 -0.0215 -0.0072 0.0146  428 LYS A CD  
1929 C CE  . LYS A 259 ? 0.5366 0.6716 0.4733 -0.0206 -0.0068 0.0134  428 LYS A CE  
1930 N NZ  . LYS A 259 ? 0.5854 0.7264 0.5260 -0.0276 -0.0086 0.0109  428 LYS A NZ  
1931 N N   . PRO A 260 ? 0.3505 0.4227 0.2833 -0.0228 -0.0088 0.0169  429 PRO A N   
1932 C CA  . PRO A 260 ? 0.3302 0.3906 0.2624 -0.0243 -0.0094 0.0180  429 PRO A CA  
1933 C C   . PRO A 260 ? 0.3330 0.3929 0.2632 -0.0250 -0.0085 0.0200  429 PRO A C   
1934 O O   . PRO A 260 ? 0.3192 0.3876 0.2493 -0.0261 -0.0079 0.0204  429 PRO A O   
1935 C CB  . PRO A 260 ? 0.3674 0.4241 0.3022 -0.0299 -0.0116 0.0170  429 PRO A CB  
1936 C CG  . PRO A 260 ? 0.4112 0.4783 0.3476 -0.0333 -0.0118 0.0160  429 PRO A CG  
1937 C CD  . PRO A 260 ? 0.3693 0.4467 0.3050 -0.0284 -0.0104 0.0154  429 PRO A CD  
1938 N N   . PRO A 261 ? 0.3661 0.4168 0.2947 -0.0245 -0.0084 0.0212  430 PRO A N   
1939 C CA  . PRO A 261 ? 0.3718 0.4213 0.2981 -0.0252 -0.0077 0.0229  430 PRO A CA  
1940 C C   . PRO A 261 ? 0.3545 0.4072 0.2820 -0.0307 -0.0088 0.0236  430 PRO A C   
1941 O O   . PRO A 261 ? 0.3351 0.3842 0.2646 -0.0346 -0.0105 0.0232  430 PRO A O   
1942 C CB  . PRO A 261 ? 0.3622 0.4007 0.2877 -0.0252 -0.0083 0.0234  430 PRO A CB  
1943 C CG  . PRO A 261 ? 0.3906 0.4251 0.3175 -0.0232 -0.0087 0.0220  430 PRO A CG  
1944 C CD  . PRO A 261 ? 0.3853 0.4266 0.3144 -0.0236 -0.0091 0.0207  430 PRO A CD  
1945 N N   . PHE A 262 ? 0.3413 0.4002 0.2672 -0.0308 -0.0076 0.0246  431 PHE A N   
1946 C CA  . PHE A 262 ? 0.3793 0.4413 0.3059 -0.0359 -0.0082 0.0256  431 PHE A CA  
1947 C C   . PHE A 262 ? 0.3823 0.4518 0.3120 -0.0395 -0.0088 0.0242  431 PHE A C   
1948 O O   . PHE A 262 ? 0.4082 0.4778 0.3389 -0.0449 -0.0095 0.0247  431 PHE A O   
1949 C CB  . PHE A 262 ? 0.3346 0.3867 0.2606 -0.0393 -0.0096 0.0269  431 PHE A CB  
1950 C CG  . PHE A 262 ? 0.3498 0.3959 0.2727 -0.0365 -0.0090 0.0280  431 PHE A CG  
1951 C CD1 . PHE A 262 ? 0.3386 0.3887 0.2588 -0.0351 -0.0074 0.0291  431 PHE A CD1 
1952 C CD2 . PHE A 262 ? 0.3601 0.3973 0.2829 -0.0352 -0.0099 0.0278  431 PHE A CD2 
1953 C CE1 . PHE A 262 ? 0.3911 0.4358 0.3083 -0.0328 -0.0068 0.0297  431 PHE A CE1 
1954 C CE2 . PHE A 262 ? 0.3703 0.4027 0.2904 -0.0330 -0.0094 0.0284  431 PHE A CE2 
1955 C CZ  . PHE A 262 ? 0.3730 0.4090 0.2903 -0.0319 -0.0078 0.0292  431 PHE A CZ  
1956 N N   . TYR A 263 ? 0.3994 0.4753 0.3303 -0.0366 -0.0085 0.0225  432 TYR A N   
1957 C CA  . TYR A 263 ? 0.3955 0.4801 0.3295 -0.0398 -0.0091 0.0206  432 TYR A CA  
1958 C C   . TYR A 263 ? 0.4045 0.4988 0.3391 -0.0434 -0.0084 0.0210  432 TYR A C   
1959 O O   . TYR A 263 ? 0.4149 0.5140 0.3521 -0.0483 -0.0090 0.0197  432 TYR A O   
1960 C CB  . TYR A 263 ? 0.3836 0.4758 0.3181 -0.0350 -0.0085 0.0189  432 TYR A CB  
1961 C CG  . TYR A 263 ? 0.3610 0.4629 0.2937 -0.0302 -0.0066 0.0197  432 TYR A CG  
1962 C CD1 . TYR A 263 ? 0.3620 0.4591 0.2914 -0.0251 -0.0050 0.0213  432 TYR A CD1 
1963 C CD2 . TYR A 263 ? 0.3556 0.4714 0.2899 -0.0308 -0.0061 0.0187  432 TYR A CD2 
1964 C CE1 . TYR A 263 ? 0.4065 0.5114 0.3337 -0.0204 -0.0029 0.0220  432 TYR A CE1 
1965 C CE2 . TYR A 263 ? 0.3806 0.5057 0.3131 -0.0259 -0.0042 0.0196  432 TYR A CE2 
1966 C CZ  . TYR A 263 ? 0.4411 0.5601 0.3699 -0.0205 -0.0025 0.0213  432 TYR A CZ  
1967 O OH  . TYR A 263 ? 0.4901 0.6168 0.4166 -0.0151 -0.0003 0.0223  432 TYR A OH  
1968 N N   . ASP A 264 ? 0.4154 0.5129 0.3477 -0.0409 -0.0068 0.0227  433 ASP A N   
1969 C CA  . ASP A 264 ? 0.4267 0.5349 0.3595 -0.0432 -0.0058 0.0232  433 ASP A CA  
1970 C C   . ASP A 264 ? 0.4452 0.5487 0.3774 -0.0489 -0.0059 0.0249  433 ASP A C   
1971 O O   . ASP A 264 ? 0.4955 0.6074 0.4284 -0.0517 -0.0050 0.0253  433 ASP A O   
1972 C CB  . ASP A 264 ? 0.3887 0.5035 0.3189 -0.0370 -0.0037 0.0241  433 ASP A CB  
1973 C CG  . ASP A 264 ? 0.4340 0.5384 0.3604 -0.0336 -0.0030 0.0259  433 ASP A CG  
1974 O OD1 . ASP A 264 ? 0.4738 0.5665 0.3997 -0.0352 -0.0042 0.0263  433 ASP A OD1 
1975 O OD2 . ASP A 264 ? 0.4317 0.5397 0.3555 -0.0292 -0.0011 0.0268  433 ASP A OD2 
1976 N N   . VAL A 265 ? 0.4324 0.5230 0.3633 -0.0503 -0.0070 0.0260  434 VAL A N   
1977 C CA  . VAL A 265 ? 0.4023 0.4880 0.3319 -0.0548 -0.0070 0.0281  434 VAL A CA  
1978 C C   . VAL A 265 ? 0.4551 0.5299 0.3853 -0.0590 -0.0086 0.0283  434 VAL A C   
1979 O O   . VAL A 265 ? 0.4317 0.5017 0.3606 -0.0630 -0.0086 0.0301  434 VAL A O   
1980 C CB  . VAL A 265 ? 0.4213 0.5025 0.3471 -0.0513 -0.0062 0.0302  434 VAL A CB  
1981 C CG1 . VAL A 265 ? 0.4118 0.5034 0.3364 -0.0477 -0.0042 0.0304  434 VAL A CG1 
1982 C CG2 . VAL A 265 ? 0.4666 0.5381 0.3910 -0.0470 -0.0070 0.0300  434 VAL A CG2 
1983 N N   . VAL A 266 ? 0.4298 0.5003 0.3617 -0.0581 -0.0099 0.0265  435 VAL A N   
1984 C CA  . VAL A 266 ? 0.3978 0.4587 0.3304 -0.0622 -0.0112 0.0265  435 VAL A CA  
1985 C C   . VAL A 266 ? 0.4319 0.4959 0.3675 -0.0642 -0.0118 0.0236  435 VAL A C   
1986 O O   . VAL A 266 ? 0.4493 0.5211 0.3864 -0.0611 -0.0116 0.0217  435 VAL A O   
1987 C CB  . VAL A 266 ? 0.3879 0.4367 0.3188 -0.0594 -0.0124 0.0276  435 VAL A CB  
1988 C CG1 . VAL A 266 ? 0.4190 0.4654 0.3467 -0.0575 -0.0119 0.0301  435 VAL A CG1 
1989 C CG2 . VAL A 266 ? 0.4246 0.4726 0.3565 -0.0544 -0.0129 0.0258  435 VAL A CG2 
1990 N N   . PRO A 267 ? 0.4761 0.5341 0.4125 -0.0694 -0.0124 0.0233  436 PRO A N   
1991 C CA  . PRO A 267 ? 0.4848 0.5452 0.4238 -0.0717 -0.0129 0.0202  436 PRO A CA  
1992 C C   . PRO A 267 ? 0.5122 0.5653 0.4514 -0.0677 -0.0143 0.0191  436 PRO A C   
1993 O O   . PRO A 267 ? 0.4957 0.5419 0.4332 -0.0637 -0.0147 0.0209  436 PRO A O   
1994 C CB  . PRO A 267 ? 0.5249 0.5792 0.4639 -0.0787 -0.0127 0.0205  436 PRO A CB  
1995 C CG  . PRO A 267 ? 0.5715 0.6150 0.5074 -0.0781 -0.0129 0.0240  436 PRO A CG  
1996 C CD  . PRO A 267 ? 0.5332 0.5813 0.4676 -0.0732 -0.0125 0.0257  436 PRO A CD  
1997 N N   . ASN A 268 ? 0.4912 0.5463 0.4326 -0.0689 -0.0148 0.0161  437 ASN A N   
1998 C CA  A ASN A 268 ? 0.4996 0.5465 0.4413 -0.0664 -0.0160 0.0149  437 ASN A CA  
1999 C CA  B ASN A 268 ? 0.5036 0.5506 0.4452 -0.0662 -0.0160 0.0150  437 ASN A CA  
2000 C C   . ASN A 268 ? 0.4800 0.5132 0.4202 -0.0685 -0.0167 0.0167  437 ASN A C   
2001 O O   . ASN A 268 ? 0.4869 0.5171 0.4265 -0.0737 -0.0162 0.0177  437 ASN A O   
2002 C CB  A ASN A 268 ? 0.5616 0.6128 0.5056 -0.0686 -0.0165 0.0112  437 ASN A CB  
2003 C CB  B ASN A 268 ? 0.5750 0.6273 0.5190 -0.0673 -0.0165 0.0112  437 ASN A CB  
2004 C CG  A ASN A 268 ? 0.5672 0.6103 0.5114 -0.0658 -0.0176 0.0099  437 ASN A CG  
2005 C CG  B ASN A 268 ? 0.5410 0.6060 0.4859 -0.0629 -0.0161 0.0098  437 ASN A CG  
2006 O OD1 A ASN A 268 ? 0.6077 0.6514 0.5516 -0.0601 -0.0178 0.0099  437 ASN A OD1 
2007 O OD1 B ASN A 268 ? 0.5445 0.6085 0.4885 -0.0570 -0.0161 0.0103  437 ASN A OD1 
2008 N ND2 A ASN A 268 ? 0.5625 0.5976 0.5069 -0.0698 -0.0181 0.0087  437 ASN A ND2 
2009 N ND2 B ASN A 268 ? 0.5578 0.6347 0.5042 -0.0658 -0.0156 0.0081  437 ASN A ND2 
2010 N N   . ASP A 269 ? 0.5047 0.5299 0.4443 -0.0645 -0.0176 0.0174  438 ASP A N   
2011 C CA  . ASP A 269 ? 0.5375 0.5502 0.4757 -0.0655 -0.0183 0.0192  438 ASP A CA  
2012 C C   . ASP A 269 ? 0.5362 0.5465 0.4720 -0.0675 -0.0178 0.0225  438 ASP A C   
2013 O O   . ASP A 269 ? 0.4918 0.4966 0.4266 -0.0719 -0.0175 0.0236  438 ASP A O   
2014 C CB  . ASP A 269 ? 0.5953 0.6023 0.5342 -0.0696 -0.0186 0.0173  438 ASP A CB  
2015 C CG  . ASP A 269 ? 0.7924 0.7863 0.7301 -0.0688 -0.0194 0.0187  438 ASP A CG  
2016 O OD1 . ASP A 269 ? 0.8113 0.8018 0.7485 -0.0641 -0.0202 0.0200  438 ASP A OD1 
2017 O OD2 . ASP A 269 ? 0.9800 0.9668 0.9169 -0.0728 -0.0192 0.0185  438 ASP A OD2 
2018 N N   . PRO A 270 ? 0.5296 0.5437 0.4644 -0.0642 -0.0175 0.0241  439 PRO A N   
2019 C CA  . PRO A 270 ? 0.4897 0.5033 0.4221 -0.0660 -0.0168 0.0270  439 PRO A CA  
2020 C C   . PRO A 270 ? 0.4734 0.4757 0.4037 -0.0663 -0.0177 0.0295  439 PRO A C   
2021 O O   . PRO A 270 ? 0.5293 0.5251 0.4599 -0.0634 -0.0189 0.0293  439 PRO A O   
2022 C CB  . PRO A 270 ? 0.5019 0.5221 0.4336 -0.0616 -0.0163 0.0276  439 PRO A CB  
2023 C CG  . PRO A 270 ? 0.4793 0.4985 0.4122 -0.0569 -0.0169 0.0258  439 PRO A CG  
2024 C CD  . PRO A 270 ? 0.4581 0.4772 0.3934 -0.0587 -0.0174 0.0233  439 PRO A CD  
2025 N N   . SER A 271 ? 0.4335 0.4337 0.3616 -0.0698 -0.0170 0.0320  440 SER A N   
2026 C CA  . SER A 271 ? 0.4579 0.4482 0.3833 -0.0696 -0.0177 0.0349  440 SER A CA  
2027 C C   . SER A 271 ? 0.4329 0.4238 0.3565 -0.0654 -0.0183 0.0367  440 SER A C   
2028 O O   . SER A 271 ? 0.4092 0.4079 0.3331 -0.0635 -0.0177 0.0360  440 SER A O   
2029 C CB  . SER A 271 ? 0.4694 0.4575 0.3926 -0.0747 -0.0164 0.0371  440 SER A CB  
2030 O OG  . SER A 271 ? 0.5073 0.5039 0.4297 -0.0756 -0.0152 0.0381  440 SER A OG  
2031 N N   . PHE A 272 ? 0.4815 0.4644 0.4032 -0.0639 -0.0194 0.0388  441 PHE A N   
2032 C CA  . PHE A 272 ? 0.4767 0.4603 0.3960 -0.0610 -0.0200 0.0407  441 PHE A CA  
2033 C C   . PHE A 272 ? 0.4855 0.4754 0.4028 -0.0629 -0.0185 0.0421  441 PHE A C   
2034 O O   . PHE A 272 ? 0.4862 0.4816 0.4029 -0.0605 -0.0182 0.0419  441 PHE A O   
2035 C CB  . PHE A 272 ? 0.4378 0.4126 0.3548 -0.0600 -0.0213 0.0433  441 PHE A CB  
2036 C CG  . PHE A 272 ? 0.4551 0.4248 0.3739 -0.0568 -0.0229 0.0421  441 PHE A CG  
2037 C CD1 . PHE A 272 ? 0.4606 0.4336 0.3811 -0.0530 -0.0236 0.0402  441 PHE A CD1 
2038 C CD2 . PHE A 272 ? 0.5612 0.5227 0.4800 -0.0575 -0.0234 0.0427  441 PHE A CD2 
2039 C CE1 . PHE A 272 ? 0.5768 0.5456 0.4992 -0.0502 -0.0249 0.0391  441 PHE A CE1 
2040 C CE2 . PHE A 272 ? 0.5557 0.5129 0.4762 -0.0543 -0.0248 0.0415  441 PHE A CE2 
2041 C CZ  . PHE A 272 ? 0.6053 0.5667 0.5279 -0.0508 -0.0256 0.0397  441 PHE A CZ  
2042 N N   . GLU A 273 ? 0.4895 0.4784 0.4057 -0.0674 -0.0174 0.0436  442 GLU A N   
2043 C CA  . GLU A 273 ? 0.4823 0.4767 0.3963 -0.0696 -0.0159 0.0453  442 GLU A CA  
2044 C C   . GLU A 273 ? 0.4544 0.4598 0.3706 -0.0691 -0.0148 0.0429  442 GLU A C   
2045 O O   . GLU A 273 ? 0.3990 0.4102 0.3137 -0.0678 -0.0140 0.0437  442 GLU A O   
2046 C CB  . GLU A 273 ? 0.5962 0.5866 0.5087 -0.0749 -0.0146 0.0472  442 GLU A CB  
2047 C CG  . GLU A 273 ? 0.7211 0.7191 0.6328 -0.0786 -0.0125 0.0481  442 GLU A CG  
2048 C CD  . GLU A 273 ? 0.8718 0.8727 0.7801 -0.0766 -0.0123 0.0505  442 GLU A CD  
2049 O OE1 . GLU A 273 ? 0.8309 0.8252 0.7363 -0.0742 -0.0135 0.0527  442 GLU A OE1 
2050 O OE2 . GLU A 273 ? 0.8691 0.8792 0.7776 -0.0772 -0.0109 0.0500  442 GLU A OE2 
2051 N N   . ASP A 274 ? 0.4508 0.4592 0.3704 -0.0699 -0.0146 0.0401  443 ASP A N   
2052 C CA  . ASP A 274 ? 0.4453 0.4644 0.3669 -0.0688 -0.0137 0.0379  443 ASP A CA  
2053 C C   . ASP A 274 ? 0.3859 0.4073 0.3067 -0.0632 -0.0140 0.0376  443 ASP A C   
2054 O O   . ASP A 274 ? 0.4205 0.4493 0.3404 -0.0618 -0.0127 0.0376  443 ASP A O   
2055 C CB  . ASP A 274 ? 0.5067 0.5277 0.4319 -0.0693 -0.0140 0.0348  443 ASP A CB  
2056 C CG  . ASP A 274 ? 0.5597 0.5808 0.4861 -0.0753 -0.0132 0.0342  443 ASP A CG  
2057 O OD1 . ASP A 274 ? 0.5665 0.5913 0.4919 -0.0791 -0.0118 0.0354  443 ASP A OD1 
2058 O OD2 . ASP A 274 ? 0.5213 0.5387 0.4496 -0.0763 -0.0139 0.0322  443 ASP A OD2 
2059 N N   . MET A 275 ? 0.4081 0.4230 0.3292 -0.0601 -0.0154 0.0370  444 MET A N   
2060 C CA  . MET A 275 ? 0.4153 0.4311 0.3359 -0.0552 -0.0156 0.0362  444 MET A CA  
2061 C C   . MET A 275 ? 0.4472 0.4623 0.3643 -0.0542 -0.0154 0.0383  444 MET A C   
2062 O O   . MET A 275 ? 0.4179 0.4377 0.3337 -0.0516 -0.0143 0.0378  444 MET A O   
2063 C CB  . MET A 275 ? 0.3616 0.3706 0.2837 -0.0528 -0.0171 0.0351  444 MET A CB  
2064 C CG  . MET A 275 ? 0.4083 0.4189 0.3335 -0.0525 -0.0171 0.0325  444 MET A CG  
2065 S SD  . MET A 275 ? 0.3822 0.4038 0.3085 -0.0504 -0.0154 0.0305  444 MET A SD  
2066 C CE  . MET A 275 ? 0.3481 0.3688 0.2723 -0.0453 -0.0148 0.0307  444 MET A CE  
2067 N N   . ARG A 276 ? 0.4988 0.5080 0.4139 -0.0562 -0.0163 0.0406  445 ARG A N   
2068 C CA  . ARG A 276 ? 0.4900 0.4981 0.4015 -0.0554 -0.0164 0.0427  445 ARG A CA  
2069 C C   . ARG A 276 ? 0.4171 0.4327 0.3269 -0.0565 -0.0145 0.0433  445 ARG A C   
2070 O O   . ARG A 276 ? 0.3960 0.4144 0.3037 -0.0542 -0.0140 0.0433  445 ARG A O   
2071 C CB  . ARG A 276 ? 0.5238 0.5247 0.4333 -0.0574 -0.0176 0.0454  445 ARG A CB  
2072 C CG  . ARG A 276 ? 0.6169 0.6165 0.5226 -0.0561 -0.0182 0.0475  445 ARG A CG  
2073 C CD  . ARG A 276 ? 0.6024 0.5940 0.5064 -0.0566 -0.0198 0.0499  445 ARG A CD  
2074 N NE  . ARG A 276 ? 0.8118 0.7996 0.7163 -0.0602 -0.0192 0.0512  445 ARG A NE  
2075 C CZ  . ARG A 276 ? 0.7984 0.7790 0.7040 -0.0604 -0.0203 0.0514  445 ARG A CZ  
2076 N NH1 . ARG A 276 ? 0.7253 0.7022 0.6320 -0.0570 -0.0221 0.0506  445 ARG A NH1 
2077 N NH2 . ARG A 276 ? 0.8283 0.8053 0.7340 -0.0641 -0.0193 0.0524  445 ARG A NH2 
2078 N N   . LYS A 277 ? 0.4314 0.4510 0.3425 -0.0601 -0.0134 0.0435  446 LYS A N   
2079 C CA  . LYS A 277 ? 0.4620 0.4897 0.3718 -0.0613 -0.0115 0.0442  446 LYS A CA  
2080 C C   . LYS A 277 ? 0.4661 0.5014 0.3767 -0.0576 -0.0103 0.0420  446 LYS A C   
2081 O O   . LYS A 277 ? 0.4885 0.5283 0.3967 -0.0561 -0.0091 0.0426  446 LYS A O   
2082 C CB  . LYS A 277 ? 0.5583 0.5892 0.4697 -0.0664 -0.0104 0.0446  446 LYS A CB  
2083 C CG  . LYS A 277 ? 0.6876 0.7271 0.5977 -0.0682 -0.0083 0.0456  446 LYS A CG  
2084 C CD  . LYS A 277 ? 0.9752 1.0188 0.8875 -0.0736 -0.0071 0.0454  446 LYS A CD  
2085 C CE  . LYS A 277 ? 1.1758 1.2300 1.0877 -0.0752 -0.0049 0.0459  446 LYS A CE  
2086 N NZ  . LYS A 277 ? 1.0385 1.1004 0.9499 -0.0702 -0.0042 0.0448  446 LYS A NZ  
2087 N N   . VAL A 278 ? 0.4325 0.4688 0.3461 -0.0559 -0.0106 0.0396  447 VAL A N   
2088 C CA  . VAL A 278 ? 0.4136 0.4562 0.3277 -0.0518 -0.0094 0.0378  447 VAL A CA  
2089 C C   . VAL A 278 ? 0.3658 0.4044 0.2773 -0.0476 -0.0094 0.0376  447 VAL A C   
2090 O O   . VAL A 278 ? 0.3752 0.4181 0.2845 -0.0450 -0.0078 0.0374  447 VAL A O   
2091 C CB  . VAL A 278 ? 0.4340 0.4780 0.3517 -0.0508 -0.0098 0.0354  447 VAL A CB  
2092 C CG1 . VAL A 278 ? 0.4394 0.4877 0.3569 -0.0456 -0.0086 0.0338  447 VAL A CG1 
2093 C CG2 . VAL A 278 ? 0.4843 0.5347 0.4045 -0.0548 -0.0094 0.0349  447 VAL A CG2 
2094 N N   . VAL A 279 ? 0.4057 0.4362 0.3173 -0.0470 -0.0111 0.0374  448 VAL A N   
2095 C CA  . VAL A 279 ? 0.3920 0.4188 0.3023 -0.0432 -0.0112 0.0363  448 VAL A CA  
2096 C C   . VAL A 279 ? 0.3971 0.4211 0.3038 -0.0434 -0.0116 0.0378  448 VAL A C   
2097 O O   . VAL A 279 ? 0.4477 0.4722 0.3519 -0.0408 -0.0105 0.0370  448 VAL A O   
2098 C CB  . VAL A 279 ? 0.3834 0.4038 0.2962 -0.0425 -0.0128 0.0352  448 VAL A CB  
2099 C CG1 . VAL A 279 ? 0.3853 0.4007 0.2968 -0.0398 -0.0133 0.0344  448 VAL A CG1 
2100 C CG2 . VAL A 279 ? 0.3983 0.4221 0.3140 -0.0409 -0.0121 0.0333  448 VAL A CG2 
2101 N N   . CYS A 280 ? 0.4138 0.4345 0.3198 -0.0464 -0.0130 0.0398  449 CYS A N   
2102 C CA  . CYS A 280 ? 0.4154 0.4337 0.3178 -0.0465 -0.0136 0.0414  449 CYS A CA  
2103 C C   . CYS A 280 ? 0.4210 0.4446 0.3203 -0.0480 -0.0121 0.0430  449 CYS A C   
2104 O O   . CYS A 280 ? 0.4239 0.4496 0.3203 -0.0461 -0.0110 0.0426  449 CYS A O   
2105 C CB  . CYS A 280 ? 0.4143 0.4264 0.3168 -0.0483 -0.0158 0.0431  449 CYS A CB  
2106 S SG  . CYS A 280 ? 0.4337 0.4398 0.3394 -0.0463 -0.0176 0.0412  449 CYS A SG  
2107 N N   . VAL A 281 ? 0.4286 0.4546 0.3289 -0.0514 -0.0116 0.0446  450 VAL A N   
2108 C CA  . VAL A 281 ? 0.4285 0.4594 0.3260 -0.0533 -0.0101 0.0465  450 VAL A CA  
2109 C C   . VAL A 281 ? 0.4131 0.4523 0.3105 -0.0515 -0.0078 0.0452  450 VAL A C   
2110 O O   . VAL A 281 ? 0.4651 0.5071 0.3591 -0.0504 -0.0067 0.0457  450 VAL A O   
2111 C CB  . VAL A 281 ? 0.4477 0.4784 0.3462 -0.0580 -0.0100 0.0486  450 VAL A CB  
2112 C CG1 . VAL A 281 ? 0.4749 0.5112 0.3708 -0.0602 -0.0081 0.0506  450 VAL A CG1 
2113 C CG2 . VAL A 281 ? 0.4100 0.4317 0.3078 -0.0593 -0.0120 0.0503  450 VAL A CG2 
2114 N N   . ASP A 282 ? 0.4272 0.4704 0.3280 -0.0508 -0.0071 0.0434  451 ASP A N   
2115 C CA  . ASP A 282 ? 0.3809 0.4327 0.2818 -0.0484 -0.0049 0.0422  451 ASP A CA  
2116 C C   . ASP A 282 ? 0.4069 0.4572 0.3067 -0.0433 -0.0043 0.0401  451 ASP A C   
2117 O O   . ASP A 282 ? 0.3770 0.4330 0.2758 -0.0404 -0.0022 0.0392  451 ASP A O   
2118 C CB  . ASP A 282 ? 0.4418 0.5001 0.3466 -0.0501 -0.0043 0.0414  451 ASP A CB  
2119 C CG  . ASP A 282 ? 0.5257 0.5869 0.4313 -0.0556 -0.0041 0.0432  451 ASP A CG  
2120 O OD1 . ASP A 282 ? 0.4901 0.5472 0.3929 -0.0577 -0.0044 0.0454  451 ASP A OD1 
2121 O OD2 . ASP A 282 ? 0.6096 0.6772 0.5182 -0.0577 -0.0034 0.0424  451 ASP A OD2 
2122 N N   . GLN A 283 ? 0.4540 0.4964 0.3539 -0.0422 -0.0059 0.0393  452 GLN A N   
2123 C CA  . GLN A 283 ? 0.5131 0.5528 0.4119 -0.0379 -0.0051 0.0373  452 GLN A CA  
2124 C C   . GLN A 283 ? 0.3992 0.4437 0.2998 -0.0349 -0.0034 0.0357  452 GLN A C   
2125 O O   . GLN A 283 ? 0.4073 0.4529 0.3056 -0.0311 -0.0014 0.0347  452 GLN A O   
2126 C CB  . GLN A 283 ? 0.5196 0.5593 0.4137 -0.0363 -0.0038 0.0374  452 GLN A CB  
2127 C CG  . GLN A 283 ? 0.6281 0.6630 0.5202 -0.0388 -0.0057 0.0388  452 GLN A CG  
2128 C CD  . GLN A 283 ? 0.6348 0.6698 0.5221 -0.0374 -0.0046 0.0386  452 GLN A CD  
2129 O OE1 . GLN A 283 ? 0.7427 0.7831 0.6277 -0.0372 -0.0028 0.0393  452 GLN A OE1 
2130 N NE2 . GLN A 283 ? 0.6805 0.7099 0.5664 -0.0366 -0.0057 0.0374  452 GLN A NE2 
2131 N N   . GLN A 284 ? 0.3652 0.4126 0.2695 -0.0364 -0.0040 0.0356  453 GLN A N   
2132 C CA  . GLN A 284 ? 0.4392 0.4924 0.3452 -0.0335 -0.0026 0.0342  453 GLN A CA  
2133 C C   . GLN A 284 ? 0.4270 0.4745 0.3338 -0.0302 -0.0028 0.0325  453 GLN A C   
2134 O O   . GLN A 284 ? 0.3744 0.4145 0.2821 -0.0315 -0.0046 0.0323  453 GLN A O   
2135 C CB  . GLN A 284 ? 0.5331 0.5923 0.4428 -0.0367 -0.0033 0.0343  453 GLN A CB  
2136 C CG  . GLN A 284 ? 0.6045 0.6702 0.5136 -0.0401 -0.0027 0.0359  453 GLN A CG  
2137 C CD  . GLN A 284 ? 0.6817 0.7584 0.5932 -0.0403 -0.0015 0.0353  453 GLN A CD  
2138 O OE1 . GLN A 284 ? 0.8848 0.9679 0.7952 -0.0361 0.0003  0.0347  453 GLN A OE1 
2139 N NE2 . GLN A 284 ? 0.7546 0.8337 0.6694 -0.0449 -0.0026 0.0352  453 GLN A NE2 
2140 N N   . ARG A 285 ? 0.4216 0.4728 0.3279 -0.0259 -0.0008 0.0315  454 ARG A N   
2141 C CA  . ARG A 285 ? 0.4124 0.4591 0.3192 -0.0226 -0.0004 0.0300  454 ARG A CA  
2142 C C   . ARG A 285 ? 0.4116 0.4660 0.3200 -0.0199 0.0006  0.0294  454 ARG A C   
2143 O O   . ARG A 285 ? 0.4293 0.4923 0.3371 -0.0193 0.0018  0.0300  454 ARG A O   
2144 C CB  . ARG A 285 ? 0.4060 0.4474 0.3088 -0.0189 0.0015  0.0294  454 ARG A CB  
2145 C CG  . ARG A 285 ? 0.4447 0.4794 0.3456 -0.0211 0.0005  0.0296  454 ARG A CG  
2146 C CD  . ARG A 285 ? 0.4333 0.4617 0.3368 -0.0240 -0.0021 0.0294  454 ARG A CD  
2147 N NE  . ARG A 285 ? 0.4095 0.4329 0.3109 -0.0257 -0.0031 0.0296  454 ARG A NE  
2148 C CZ  . ARG A 285 ? 0.4522 0.4756 0.3535 -0.0293 -0.0050 0.0311  454 ARG A CZ  
2149 N NH1 . ARG A 285 ? 0.4530 0.4804 0.3564 -0.0320 -0.0061 0.0325  454 ARG A NH1 
2150 N NH2 . ARG A 285 ? 0.5391 0.5585 0.4381 -0.0301 -0.0058 0.0310  454 ARG A NH2 
2151 N N   . PRO A 286 ? 0.3826 0.4345 0.2928 -0.0181 0.0003  0.0283  455 PRO A N   
2152 C CA  . PRO A 286 ? 0.3725 0.4320 0.2838 -0.0150 0.0013  0.0277  455 PRO A CA  
2153 C C   . PRO A 286 ? 0.3561 0.4205 0.2638 -0.0099 0.0044  0.0281  455 PRO A C   
2154 O O   . PRO A 286 ? 0.3735 0.4319 0.2777 -0.0074 0.0061  0.0282  455 PRO A O   
2155 C CB  . PRO A 286 ? 0.3718 0.4252 0.2841 -0.0130 0.0010  0.0265  455 PRO A CB  
2156 C CG  . PRO A 286 ? 0.3941 0.4389 0.3078 -0.0169 -0.0011 0.0265  455 PRO A CG  
2157 C CD  . PRO A 286 ? 0.3525 0.3950 0.2636 -0.0186 -0.0009 0.0275  455 PRO A CD  
2158 N N   . ASN A 287 ? 0.3661 0.4417 0.2749 -0.0086 0.0051  0.0282  456 ASN A N   
2159 C CA  . ASN A 287 ? 0.4154 0.4967 0.3208 -0.0031 0.0080  0.0287  456 ASN A CA  
2160 C C   . ASN A 287 ? 0.4114 0.4900 0.3147 0.0032  0.0101  0.0283  456 ASN A C   
2161 O O   . ASN A 287 ? 0.3218 0.4007 0.2274 0.0036  0.0091  0.0275  456 ASN A O   
2162 C CB  . ASN A 287 ? 0.4366 0.5320 0.3443 -0.0037 0.0079  0.0289  456 ASN A CB  
2163 C CG  . ASN A 287 ? 0.5443 0.6431 0.4532 -0.0095 0.0068  0.0297  456 ASN A CG  
2164 O OD1 . ASN A 287 ? 0.5590 0.6516 0.4654 -0.0109 0.0071  0.0305  456 ASN A OD1 
2165 N ND2 . ASN A 287 ? 0.5083 0.6170 0.4209 -0.0130 0.0056  0.0294  456 ASN A ND2 
2166 N N   . ILE A 288 ? 0.4355 0.5112 0.3340 0.0081  0.0132  0.0288  457 ILE A N   
2167 C CA  . ILE A 288 ? 0.4709 0.5439 0.3663 0.0148  0.0159  0.0288  457 ILE A CA  
2168 C C   . ILE A 288 ? 0.4472 0.5330 0.3422 0.0197  0.0174  0.0294  457 ILE A C   
2169 O O   . ILE A 288 ? 0.4330 0.5246 0.3260 0.0212  0.0188  0.0302  457 ILE A O   
2170 C CB  . ILE A 288 ? 0.4107 0.4739 0.3007 0.0179  0.0189  0.0290  457 ILE A CB  
2171 C CG1 . ILE A 288 ? 0.4523 0.5045 0.3428 0.0128  0.0173  0.0282  457 ILE A CG1 
2172 C CG2 . ILE A 288 ? 0.4105 0.4695 0.2968 0.0248  0.0222  0.0291  457 ILE A CG2 
2173 C CD1 . ILE A 288 ? 0.4562 0.5037 0.3504 0.0101  0.0150  0.0273  457 ILE A CD1 
2174 N N   . PRO A 289 ? 0.4618 0.5526 0.3585 0.0223  0.0170  0.0291  458 PRO A N   
2175 C CA  . PRO A 289 ? 0.4308 0.5346 0.3269 0.0276  0.0184  0.0297  458 PRO A CA  
2176 C C   . PRO A 289 ? 0.5041 0.6057 0.3939 0.0353  0.0226  0.0310  458 PRO A C   
2177 O O   . PRO A 289 ? 0.4777 0.5672 0.3636 0.0384  0.0248  0.0312  458 PRO A O   
2178 C CB  . PRO A 289 ? 0.5125 0.6185 0.4105 0.0295  0.0174  0.0290  458 PRO A CB  
2179 C CG  . PRO A 289 ? 0.4835 0.5818 0.3852 0.0228  0.0144  0.0278  458 PRO A CG  
2180 C CD  . PRO A 289 ? 0.4368 0.5228 0.3363 0.0203  0.0150  0.0281  458 PRO A CD  
2181 N N   . ASN A 290 ? 0.5367 0.6498 0.4256 0.0385  0.0239  0.0318  459 ASN A N   
2182 C CA  . ASN A 290 ? 0.5813 0.6926 0.4641 0.0461  0.0281  0.0331  459 ASN A CA  
2183 C C   . ASN A 290 ? 0.5073 0.6133 0.3860 0.0536  0.0309  0.0337  459 ASN A C   
2184 O O   . ASN A 290 ? 0.4827 0.5773 0.3557 0.0577  0.0343  0.0343  459 ASN A O   
2185 C CB  . ASN A 290 ? 0.7280 0.8547 0.6110 0.0488  0.0289  0.0338  459 ASN A CB  
2186 C CG  . ASN A 290 ? 0.9495 1.0773 0.8332 0.0436  0.0282  0.0338  459 ASN A CG  
2187 O OD1 . ASN A 290 ? 1.0342 1.1504 0.9145 0.0426  0.0296  0.0338  459 ASN A OD1 
2188 N ND2 . ASN A 290 ? 0.8678 1.0097 0.7561 0.0398  0.0262  0.0335  459 ASN A ND2 
2189 N N   . ARG A 291 ? 0.4572 0.5708 0.3386 0.0552  0.0294  0.0335  460 ARG A N   
2190 C CA  . ARG A 291 ? 0.4438 0.5528 0.3214 0.0624  0.0319  0.0344  460 ARG A CA  
2191 C C   . ARG A 291 ? 0.4842 0.5746 0.3586 0.0619  0.0336  0.0342  460 ARG A C   
2192 O O   . ARG A 291 ? 0.5174 0.6010 0.3866 0.0685  0.0372  0.0353  460 ARG A O   
2193 C CB  . ARG A 291 ? 0.4428 0.5629 0.3244 0.0629  0.0295  0.0339  460 ARG A CB  
2194 C CG  . ARG A 291 ? 0.4527 0.5688 0.3395 0.0553  0.0257  0.0321  460 ARG A CG  
2195 C CD  . ARG A 291 ? 0.4315 0.5387 0.3165 0.0584  0.0267  0.0322  460 ARG A CD  
2196 N NE  . ARG A 291 ? 0.4131 0.5170 0.3031 0.0513  0.0231  0.0304  460 ARG A NE  
2197 C CZ  . ARG A 291 ? 0.4086 0.5043 0.2982 0.0520  0.0232  0.0301  460 ARG A CZ  
2198 N NH1 . ARG A 291 ? 0.4247 0.5143 0.3090 0.0593  0.0268  0.0315  460 ARG A NH1 
2199 N NH2 . ARG A 291 ? 0.3951 0.4879 0.2894 0.0455  0.0199  0.0284  460 ARG A NH2 
2200 N N   . TRP A 292 ? 0.4251 0.5075 0.3025 0.0541  0.0313  0.0329  461 TRP A N   
2201 C CA  . TRP A 292 ? 0.4511 0.5170 0.3258 0.0533  0.0328  0.0324  461 TRP A CA  
2202 C C   . TRP A 292 ? 0.5296 0.5858 0.3975 0.0574  0.0373  0.0331  461 TRP A C   
2203 O O   . TRP A 292 ? 0.5488 0.5922 0.4129 0.0595  0.0401  0.0331  461 TRP A O   
2204 C CB  . TRP A 292 ? 0.4203 0.4804 0.2995 0.0444  0.0294  0.0309  461 TRP A CB  
2205 C CG  . TRP A 292 ? 0.4154 0.4802 0.3006 0.0396  0.0253  0.0299  461 TRP A CG  
2206 C CD1 . TRP A 292 ? 0.4053 0.4814 0.2934 0.0412  0.0238  0.0299  461 TRP A CD1 
2207 C CD2 . TRP A 292 ? 0.4209 0.4795 0.3101 0.0324  0.0223  0.0286  461 TRP A CD2 
2208 N NE1 . TRP A 292 ? 0.3794 0.4558 0.2727 0.0351  0.0201  0.0286  461 TRP A NE1 
2209 C CE2 . TRP A 292 ? 0.3943 0.4599 0.2883 0.0299  0.0191  0.0279  461 TRP A CE2 
2210 C CE3 . TRP A 292 ? 0.4578 0.5059 0.3466 0.0280  0.0219  0.0280  461 TRP A CE3 
2211 C CZ2 . TRP A 292 ? 0.4165 0.4781 0.3149 0.0235  0.0159  0.0268  461 TRP A CZ2 
2212 C CZ3 . TRP A 292 ? 0.4632 0.5082 0.3565 0.0218  0.0184  0.0269  461 TRP A CZ3 
2213 C CH2 . TRP A 292 ? 0.4473 0.4987 0.3452 0.0197  0.0156  0.0264  461 TRP A CH2 
2214 N N   . PHE A 293 ? 0.4676 0.5295 0.3339 0.0584  0.0382  0.0336  462 PHE A N   
2215 C CA  . PHE A 293 ? 0.5715 0.6235 0.4311 0.0619  0.0425  0.0339  462 PHE A CA  
2216 C C   . PHE A 293 ? 0.5434 0.5934 0.3965 0.0716  0.0473  0.0356  462 PHE A C   
2217 O O   . PHE A 293 ? 0.6427 0.6815 0.4897 0.0748  0.0514  0.0357  462 PHE A O   
2218 C CB  . PHE A 293 ? 0.5328 0.5898 0.3923 0.0594  0.0420  0.0337  462 PHE A CB  
2219 C CG  . PHE A 293 ? 0.5419 0.5980 0.4065 0.0502  0.0379  0.0323  462 PHE A CG  
2220 C CD1 . PHE A 293 ? 0.5882 0.6307 0.4518 0.0460  0.0379  0.0310  462 PHE A CD1 
2221 C CD2 . PHE A 293 ? 0.5523 0.6208 0.4225 0.0457  0.0341  0.0323  462 PHE A CD2 
2222 C CE1 . PHE A 293 ? 0.5390 0.5807 0.4069 0.0380  0.0341  0.0299  462 PHE A CE1 
2223 C CE2 . PHE A 293 ? 0.5875 0.6542 0.4618 0.0376  0.0306  0.0314  462 PHE A CE2 
2224 C CZ  . PHE A 293 ? 0.5286 0.5820 0.4017 0.0341  0.0305  0.0303  462 PHE A CZ  
2225 N N   . SER A 294 ? 0.5516 0.6114 0.4060 0.0763  0.0469  0.0368  463 SER A N   
2226 C CA  . SER A 294 ? 0.5586 0.6156 0.4066 0.0860  0.0515  0.0387  463 SER A CA  
2227 C C   . SER A 294 ? 0.5941 0.6395 0.4406 0.0868  0.0528  0.0387  463 SER A C   
2228 O O   . SER A 294 ? 0.5715 0.6146 0.4130 0.0946  0.0564  0.0404  463 SER A O   
2229 C CB  . SER A 294 ? 0.5912 0.6659 0.4409 0.0914  0.0505  0.0400  463 SER A CB  
2230 O OG  . SER A 294 ? 0.6726 0.7603 0.5250 0.0898  0.0487  0.0398  463 SER A OG  
2231 N N   . ASP A 295 ? 0.5878 0.6266 0.4385 0.0791  0.0500  0.0369  464 ASP A N   
2232 C CA  . ASP A 295 ? 0.5362 0.5645 0.3860 0.0795  0.0513  0.0368  464 ASP A CA  
2233 C C   . ASP A 295 ? 0.5625 0.5751 0.4114 0.0739  0.0522  0.0351  464 ASP A C   
2234 O O   . ASP A 295 ? 0.5979 0.6109 0.4514 0.0663  0.0487  0.0334  464 ASP A O   
2235 C CB  . ASP A 295 ? 0.4859 0.5227 0.3421 0.0764  0.0469  0.0363  464 ASP A CB  
2236 C CG  . ASP A 295 ? 0.4931 0.5193 0.3489 0.0760  0.0478  0.0360  464 ASP A CG  
2237 O OD1 . ASP A 295 ? 0.5039 0.5222 0.3627 0.0691  0.0461  0.0343  464 ASP A OD1 
2238 O OD2 . ASP A 295 ? 0.5486 0.5743 0.4009 0.0826  0.0504  0.0375  464 ASP A OD2 
2239 N N   . PRO A 296 ? 0.6234 0.6224 0.4663 0.0776  0.0570  0.0356  465 PRO A N   
2240 C CA  . PRO A 296 ? 0.5936 0.5783 0.4352 0.0723  0.0583  0.0337  465 PRO A CA  
2241 C C   . PRO A 296 ? 0.5938 0.5769 0.4421 0.0643  0.0541  0.0318  465 PRO A C   
2242 O O   . PRO A 296 ? 0.5783 0.5564 0.4284 0.0580  0.0527  0.0299  465 PRO A O   
2243 C CB  . PRO A 296 ? 0.6857 0.6571 0.5199 0.0783  0.0645  0.0347  465 PRO A CB  
2244 C CG  . PRO A 296 ? 0.6751 0.6535 0.5050 0.0877  0.0670  0.0375  465 PRO A CG  
2245 C CD  . PRO A 296 ? 0.6685 0.6647 0.5049 0.0869  0.0618  0.0379  465 PRO A CD  
2246 N N   . THR A 297 ? 0.5232 0.5107 0.3750 0.0647  0.0522  0.0323  466 THR A N   
2247 C CA  . THR A 297 ? 0.4467 0.4330 0.3048 0.0576  0.0482  0.0306  466 THR A CA  
2248 C C   . THR A 297 ? 0.4420 0.4378 0.3064 0.0512  0.0428  0.0295  466 THR A C   
2249 O O   . THR A 297 ? 0.4728 0.4643 0.3405 0.0446  0.0404  0.0278  466 THR A O   
2250 C CB  . THR A 297 ? 0.5085 0.4977 0.3684 0.0600  0.0476  0.0314  466 THR A CB  
2251 O OG1 . THR A 297 ? 0.5314 0.5108 0.3851 0.0659  0.0530  0.0326  466 THR A OG1 
2252 C CG2 . THR A 297 ? 0.4778 0.4651 0.3439 0.0531  0.0438  0.0296  466 THR A CG2 
2253 N N   . LEU A 298 ? 0.3997 0.4086 0.2657 0.0532  0.0409  0.0305  467 LEU A N   
2254 C CA  . LEU A 298 ? 0.4245 0.4424 0.2963 0.0471  0.0360  0.0296  467 LEU A CA  
2255 C C   . LEU A 298 ? 0.4492 0.4643 0.3196 0.0440  0.0362  0.0290  467 LEU A C   
2256 O O   . LEU A 298 ? 0.3886 0.4052 0.2631 0.0375  0.0326  0.0280  467 LEU A O   
2257 C CB  . LEU A 298 ? 0.4020 0.4349 0.2762 0.0496  0.0341  0.0305  467 LEU A CB  
2258 C CG  . LEU A 298 ? 0.4027 0.4394 0.2798 0.0506  0.0325  0.0305  467 LEU A CG  
2259 C CD1 . LEU A 298 ? 0.4326 0.4837 0.3099 0.0553  0.0321  0.0315  467 LEU A CD1 
2260 C CD2 . LEU A 298 ? 0.4165 0.4540 0.3001 0.0429  0.0279  0.0289  467 LEU A CD2 
2261 N N   . THR A 299 ? 0.4310 0.4416 0.2952 0.0488  0.0405  0.0297  468 THR A N   
2262 C CA  . THR A 299 ? 0.4736 0.4801 0.3354 0.0464  0.0413  0.0289  468 THR A CA  
2263 C C   . THR A 299 ? 0.4413 0.4365 0.3042 0.0404  0.0406  0.0269  468 THR A C   
2264 O O   . THR A 299 ? 0.4217 0.4180 0.2874 0.0347  0.0377  0.0259  468 THR A O   
2265 C CB  . THR A 299 ? 0.5502 0.5525 0.4043 0.0534  0.0467  0.0299  468 THR A CB  
2266 O OG1 . THR A 299 ? 0.5281 0.5430 0.3820 0.0587  0.0468  0.0317  468 THR A OG1 
2267 C CG2 . THR A 299 ? 0.5715 0.5677 0.4226 0.0506  0.0478  0.0286  468 THR A CG2 
2268 N N   . SER A 300 ? 0.4136 0.3988 0.2745 0.0417  0.0431  0.0265  469 SER A N   
2269 C CA  . SER A 300 ? 0.4361 0.4120 0.2988 0.0359  0.0422  0.0244  469 SER A CA  
2270 C C   . SER A 300 ? 0.4119 0.3932 0.2819 0.0298  0.0367  0.0238  469 SER A C   
2271 O O   . SER A 300 ? 0.4099 0.3882 0.2822 0.0241  0.0345  0.0223  469 SER A O   
2272 C CB  . SER A 300 ? 0.4517 0.4169 0.3113 0.0383  0.0461  0.0242  469 SER A CB  
2273 O OG  . SER A 300 ? 0.5392 0.4984 0.3916 0.0440  0.0514  0.0249  469 SER A OG  
2274 N N   . LEU A 301 ? 0.4044 0.3937 0.2781 0.0310  0.0345  0.0248  470 LEU A N   
2275 C CA  . LEU A 301 ? 0.3984 0.3922 0.2788 0.0253  0.0295  0.0241  470 LEU A CA  
2276 C C   . LEU A 301 ? 0.3791 0.3796 0.2618 0.0211  0.0262  0.0241  470 LEU A C   
2277 O O   . LEU A 301 ? 0.3579 0.3579 0.2446 0.0155  0.0228  0.0233  470 LEU A O   
2278 C CB  . LEU A 301 ? 0.3817 0.3821 0.2652 0.0273  0.0280  0.0249  470 LEU A CB  
2279 C CG  . LEU A 301 ? 0.4506 0.4445 0.3324 0.0308  0.0306  0.0250  470 LEU A CG  
2280 C CD1 . LEU A 301 ? 0.4289 0.4307 0.3137 0.0326  0.0287  0.0256  470 LEU A CD1 
2281 C CD2 . LEU A 301 ? 0.4349 0.4191 0.3183 0.0266  0.0304  0.0234  470 LEU A CD2 
2282 N N   . ALA A 302 ? 0.3723 0.3794 0.2526 0.0241  0.0273  0.0252  471 ALA A N   
2283 C CA  . ALA A 302 ? 0.4054 0.4193 0.2876 0.0203  0.0247  0.0254  471 ALA A CA  
2284 C C   . ALA A 302 ? 0.3846 0.3911 0.2651 0.0165  0.0247  0.0242  471 ALA A C   
2285 O O   . ALA A 302 ? 0.3919 0.4002 0.2754 0.0113  0.0214  0.0239  471 ALA A O   
2286 C CB  . ALA A 302 ? 0.4065 0.4290 0.2861 0.0247  0.0264  0.0267  471 ALA A CB  
2287 N N   . LYS A 303 ? 0.4225 0.4204 0.2981 0.0191  0.0284  0.0235  472 LYS A N   
2288 C CA  . LYS A 303 ? 0.4816 0.4724 0.3553 0.0156  0.0287  0.0220  472 LYS A CA  
2289 C C   . LYS A 303 ? 0.4766 0.4633 0.3547 0.0102  0.0256  0.0207  472 LYS A C   
2290 O O   . LYS A 303 ? 0.4120 0.3984 0.2915 0.0055  0.0231  0.0199  472 LYS A O   
2291 C CB  . LYS A 303 ? 0.6358 0.6172 0.5032 0.0195  0.0338  0.0212  472 LYS A CB  
2292 C CG  . LYS A 303 ? 0.7820 0.7558 0.6465 0.0162  0.0348  0.0191  472 LYS A CG  
2293 C CD  . LYS A 303 ? 0.9703 0.9362 0.8277 0.0207  0.0404  0.0185  472 LYS A CD  
2294 C CE  . LYS A 303 ? 1.1744 1.1337 1.0285 0.0172  0.0413  0.0161  472 LYS A CE  
2295 N NZ  . LYS A 303 ? 1.1194 1.0709 0.9753 0.0127  0.0408  0.0137  472 LYS A NZ  
2296 N N   . LEU A 304 ? 0.4334 0.4170 0.3134 0.0112  0.0259  0.0205  473 LEU A N   
2297 C CA  . LEU A 304 ? 0.4310 0.4110 0.3152 0.0068  0.0233  0.0193  473 LEU A CA  
2298 C C   . LEU A 304 ? 0.3841 0.3711 0.2735 0.0027  0.0184  0.0199  473 LEU A C   
2299 O O   . LEU A 304 ? 0.3888 0.3741 0.2803 -0.0016 0.0158  0.0191  473 LEU A O   
2300 C CB  . LEU A 304 ? 0.5218 0.4987 0.4068 0.0095  0.0249  0.0194  473 LEU A CB  
2301 C CG  . LEU A 304 ? 0.5233 0.4920 0.4094 0.0074  0.0255  0.0177  473 LEU A CG  
2302 C CD1 . LEU A 304 ? 0.5446 0.5057 0.4273 0.0056  0.0278  0.0159  473 LEU A CD1 
2303 C CD2 . LEU A 304 ? 0.5870 0.5527 0.4717 0.0120  0.0287  0.0184  473 LEU A CD2 
2304 N N   . MET A 305 ? 0.3684 0.3634 0.2598 0.0041  0.0171  0.0214  474 MET A N   
2305 C CA  . MET A 305 ? 0.4213 0.4228 0.3171 0.0003  0.0129  0.0221  474 MET A CA  
2306 C C   . MET A 305 ? 0.4138 0.4161 0.3088 -0.0032 0.0114  0.0222  474 MET A C   
2307 O O   . MET A 305 ? 0.3773 0.3795 0.2753 -0.0075 0.0081  0.0222  474 MET A O   
2308 C CB  . MET A 305 ? 0.4308 0.4417 0.3270 0.0025  0.0129  0.0234  474 MET A CB  
2309 C CG  . MET A 305 ? 0.4628 0.4765 0.3617 0.0043  0.0124  0.0235  474 MET A CG  
2310 S SD  . MET A 305 ? 0.3571 0.3828 0.2557 0.0079  0.0130  0.0247  474 MET A SD  
2311 C CE  . MET A 305 ? 0.3579 0.3793 0.2548 0.0134  0.0158  0.0245  474 MET A CE  
2312 N N   . LYS A 306 ? 0.3932 0.3970 0.2841 -0.0010 0.0138  0.0225  475 LYS A N   
2313 C CA  . LYS A 306 ? 0.4429 0.4485 0.3324 -0.0037 0.0127  0.0228  475 LYS A CA  
2314 C C   . LYS A 306 ? 0.3564 0.3549 0.2456 -0.0070 0.0117  0.0213  475 LYS A C   
2315 O O   . LYS A 306 ? 0.3589 0.3589 0.2491 -0.0106 0.0091  0.0216  475 LYS A O   
2316 C CB  . LYS A 306 ? 0.5023 0.5103 0.3869 -0.0001 0.0159  0.0232  475 LYS A CB  
2317 C CG  . LYS A 306 ? 0.6228 0.6406 0.5085 0.0023  0.0162  0.0248  475 LYS A CG  
2318 C CD  . LYS A 306 ? 0.7465 0.7665 0.6272 0.0072  0.0199  0.0253  475 LYS A CD  
2319 C CE  . LYS A 306 ? 0.9136 0.9454 0.7957 0.0082  0.0194  0.0268  475 LYS A CE  
2320 N NZ  . LYS A 306 ? 0.9886 1.0236 0.8662 0.0142  0.0232  0.0274  475 LYS A NZ  
2321 N N   . GLU A 307 ? 0.3510 0.3422 0.2391 -0.0059 0.0137  0.0197  476 GLU A N   
2322 C CA  . GLU A 307 ? 0.3768 0.3622 0.2649 -0.0091 0.0128  0.0179  476 GLU A CA  
2323 C C   . GLU A 307 ? 0.3942 0.3794 0.2875 -0.0125 0.0092  0.0178  476 GLU A C   
2324 O O   . GLU A 307 ? 0.3558 0.3373 0.2497 -0.0152 0.0080  0.0163  476 GLU A O   
2325 C CB  . GLU A 307 ? 0.4262 0.4038 0.3109 -0.0070 0.0168  0.0161  476 GLU A CB  
2326 C CG  . GLU A 307 ? 0.5240 0.5001 0.4027 -0.0039 0.0206  0.0159  476 GLU A CG  
2327 C CD  . GLU A 307 ? 0.5988 0.5661 0.4736 -0.0013 0.0252  0.0142  476 GLU A CD  
2328 O OE1 . GLU A 307 ? 0.7268 0.6919 0.6025 0.0011  0.0267  0.0147  476 GLU A OE1 
2329 O OE2 . GLU A 307 ? 0.7694 0.7316 0.6400 -0.0020 0.0274  0.0125  476 GLU A OE2 
2330 N N   . CYS A 308 ? 0.3511 0.3403 0.2480 -0.0122 0.0074  0.0192  477 CYS A N   
2331 C CA  . CYS A 308 ? 0.3406 0.3305 0.2423 -0.0152 0.0037  0.0195  477 CYS A CA  
2332 C C   . CYS A 308 ? 0.3759 0.3709 0.2788 -0.0180 0.0007  0.0212  477 CYS A C   
2333 O O   . CYS A 308 ? 0.3914 0.3863 0.2976 -0.0205 -0.0022 0.0216  477 CYS A O   
2334 C CB  . CYS A 308 ? 0.3408 0.3316 0.2457 -0.0136 0.0035  0.0198  477 CYS A CB  
2335 S SG  . CYS A 308 ? 0.3713 0.3564 0.2747 -0.0099 0.0073  0.0184  477 CYS A SG  
2336 N N   . TRP A 309 ? 0.3647 0.3641 0.2651 -0.0173 0.0016  0.0222  478 TRP A N   
2337 C CA  . TRP A 309 ? 0.3712 0.3759 0.2727 -0.0198 -0.0006 0.0241  478 TRP A CA  
2338 C C   . TRP A 309 ? 0.4121 0.4174 0.3107 -0.0217 -0.0011 0.0245  478 TRP A C   
2339 O O   . TRP A 309 ? 0.4359 0.4460 0.3346 -0.0234 -0.0022 0.0263  478 TRP A O   
2340 C CB  . TRP A 309 ? 0.4137 0.4252 0.3151 -0.0179 0.0006  0.0251  478 TRP A CB  
2341 C CG  . TRP A 309 ? 0.3935 0.4065 0.2978 -0.0164 0.0006  0.0250  478 TRP A CG  
2342 C CD1 . TRP A 309 ? 0.4110 0.4211 0.3189 -0.0177 -0.0013 0.0245  478 TRP A CD1 
2343 C CD2 . TRP A 309 ? 0.4073 0.4257 0.3111 -0.0131 0.0026  0.0252  478 TRP A CD2 
2344 N NE1 . TRP A 309 ? 0.4573 0.4704 0.3668 -0.0156 -0.0006 0.0243  478 TRP A NE1 
2345 C CE2 . TRP A 309 ? 0.4114 0.4300 0.3186 -0.0127 0.0016  0.0248  478 TRP A CE2 
2346 C CE3 . TRP A 309 ? 0.3958 0.4195 0.2967 -0.0101 0.0050  0.0257  478 TRP A CE3 
2347 C CZ2 . TRP A 309 ? 0.3782 0.4022 0.2858 -0.0095 0.0029  0.0248  478 TRP A CZ2 
2348 C CZ3 . TRP A 309 ? 0.3976 0.4270 0.2990 -0.0067 0.0063  0.0259  478 TRP A CZ3 
2349 C CH2 . TRP A 309 ? 0.4073 0.4369 0.3120 -0.0065 0.0052  0.0254  478 TRP A CH2 
2350 N N   . TYR A 310 ? 0.4377 0.4386 0.3336 -0.0215 -0.0001 0.0230  479 TYR A N   
2351 C CA  . TYR A 310 ? 0.4350 0.4367 0.3279 -0.0234 -0.0008 0.0233  479 TYR A CA  
2352 C C   . TYR A 310 ? 0.4274 0.4303 0.3228 -0.0268 -0.0045 0.0248  479 TYR A C   
2353 O O   . TYR A 310 ? 0.3833 0.3838 0.2821 -0.0278 -0.0065 0.0246  479 TYR A O   
2354 C CB  . TYR A 310 ? 0.4121 0.4086 0.3023 -0.0233 0.0003  0.0209  479 TYR A CB  
2355 C CG  . TYR A 310 ? 0.4600 0.4538 0.3466 -0.0201 0.0045  0.0193  479 TYR A CG  
2356 C CD1 . TYR A 310 ? 0.4819 0.4787 0.3647 -0.0179 0.0068  0.0200  479 TYR A CD1 
2357 C CD2 . TYR A 310 ? 0.4655 0.4533 0.3521 -0.0191 0.0062  0.0171  479 TYR A CD2 
2358 C CE1 . TYR A 310 ? 0.4875 0.4809 0.3663 -0.0145 0.0109  0.0186  479 TYR A CE1 
2359 C CE2 . TYR A 310 ? 0.4725 0.4565 0.3551 -0.0161 0.0104  0.0158  479 TYR A CE2 
2360 C CZ  . TYR A 310 ? 0.4723 0.4589 0.3509 -0.0136 0.0127  0.0166  479 TYR A CZ  
2361 O OH  . TYR A 310 ? 0.5413 0.5232 0.4155 -0.0102 0.0171  0.0153  479 TYR A OH  
2362 N N   . GLN A 311 ? 0.4016 0.4079 0.2949 -0.0283 -0.0052 0.0264  480 GLN A N   
2363 C CA  . GLN A 311 ? 0.4206 0.4275 0.3153 -0.0312 -0.0084 0.0283  480 GLN A CA  
2364 C C   . GLN A 311 ? 0.4204 0.4233 0.3151 -0.0322 -0.0102 0.0271  480 GLN A C   
2365 O O   . GLN A 311 ? 0.4196 0.4212 0.3171 -0.0336 -0.0128 0.0279  480 GLN A O   
2366 C CB  . GLN A 311 ? 0.4764 0.4877 0.3683 -0.0325 -0.0083 0.0304  480 GLN A CB  
2367 C CG  . GLN A 311 ? 0.6638 0.6751 0.5566 -0.0354 -0.0112 0.0328  480 GLN A CG  
2368 C CD  . GLN A 311 ? 0.9261 0.9416 0.8158 -0.0369 -0.0108 0.0350  480 GLN A CD  
2369 O OE1 . GLN A 311 ? 0.7429 0.7624 0.6332 -0.0376 -0.0098 0.0364  480 GLN A OE1 
2370 N NE2 . GLN A 311 ? 0.7198 0.7346 0.6060 -0.0375 -0.0116 0.0352  480 GLN A NE2 
2371 N N   . ASN A 312 ? 0.4347 0.4361 0.3264 -0.0314 -0.0087 0.0249  481 ASN A N   
2372 C CA  . ASN A 312 ? 0.4377 0.4363 0.3294 -0.0325 -0.0102 0.0232  481 ASN A CA  
2373 C C   . ASN A 312 ? 0.3957 0.3907 0.2908 -0.0316 -0.0097 0.0212  481 ASN A C   
2374 O O   . ASN A 312 ? 0.3639 0.3564 0.2577 -0.0300 -0.0068 0.0192  481 ASN A O   
2375 C CB  . ASN A 312 ? 0.4254 0.4237 0.3123 -0.0324 -0.0087 0.0212  481 ASN A CB  
2376 C CG  . ASN A 312 ? 0.5027 0.4995 0.3897 -0.0340 -0.0105 0.0191  481 ASN A CG  
2377 O OD1 . ASN A 312 ? 0.4755 0.4713 0.3663 -0.0346 -0.0125 0.0189  481 ASN A OD1 
2378 N ND2 . ASN A 312 ? 0.5792 0.5764 0.4620 -0.0346 -0.0097 0.0175  481 ASN A ND2 
2379 N N   . PRO A 313 ? 0.3812 0.3753 0.2801 -0.0325 -0.0123 0.0217  482 PRO A N   
2380 C CA  . PRO A 313 ? 0.3689 0.3599 0.2712 -0.0317 -0.0119 0.0200  482 PRO A CA  
2381 C C   . PRO A 313 ? 0.4034 0.3916 0.3043 -0.0316 -0.0100 0.0168  482 PRO A C   
2382 O O   . PRO A 313 ? 0.4206 0.4058 0.3227 -0.0303 -0.0078 0.0153  482 PRO A O   
2383 C CB  . PRO A 313 ? 0.3682 0.3594 0.2740 -0.0329 -0.0154 0.0211  482 PRO A CB  
2384 C CG  . PRO A 313 ? 0.3746 0.3684 0.2790 -0.0340 -0.0173 0.0241  482 PRO A CG  
2385 C CD  . PRO A 313 ? 0.3762 0.3719 0.2760 -0.0342 -0.0157 0.0238  482 PRO A CD  
2386 N N   A SER A 314 ? 0.3754 0.3644 0.2736 -0.0331 -0.0106 0.0156  483 SER A N   
2387 N N   B SER A 314 ? 0.3893 0.3783 0.2876 -0.0331 -0.0107 0.0155  483 SER A N   
2388 C CA  A SER A 314 ? 0.3694 0.3558 0.2662 -0.0338 -0.0089 0.0120  483 SER A CA  
2389 C CA  B SER A 314 ? 0.3923 0.3787 0.2893 -0.0338 -0.0090 0.0120  483 SER A CA  
2390 C C   A SER A 314 ? 0.3710 0.3538 0.2646 -0.0321 -0.0044 0.0104  483 SER A C   
2391 C C   B SER A 314 ? 0.3830 0.3658 0.2766 -0.0321 -0.0045 0.0104  483 SER A C   
2392 O O   A SER A 314 ? 0.3855 0.3645 0.2785 -0.0325 -0.0023 0.0075  483 SER A O   
2393 O O   B SER A 314 ? 0.3968 0.3758 0.2895 -0.0326 -0.0023 0.0075  483 SER A O   
2394 C CB  A SER A 314 ? 0.3830 0.3719 0.2767 -0.0357 -0.0104 0.0111  483 SER A CB  
2395 C CB  B SER A 314 ? 0.4356 0.4245 0.3300 -0.0358 -0.0108 0.0110  483 SER A CB  
2396 O OG  A SER A 314 ? 0.3521 0.3421 0.2411 -0.0351 -0.0089 0.0119  483 SER A OG  
2397 O OG  B SER A 314 ? 0.4221 0.4141 0.3193 -0.0369 -0.0148 0.0125  483 SER A OG  
2398 N N   . ALA A 315 ? 0.3985 0.3825 0.2900 -0.0301 -0.0029 0.0124  484 ALA A N   
2399 C CA  . ALA A 315 ? 0.4071 0.3880 0.2952 -0.0277 0.0013  0.0114  484 ALA A CA  
2400 C C   . ALA A 315 ? 0.4008 0.3795 0.2913 -0.0252 0.0031  0.0119  484 ALA A C   
2401 O O   . ALA A 315 ? 0.3878 0.3631 0.2756 -0.0228 0.0069  0.0110  484 ALA A O   
2402 C CB  . ALA A 315 ? 0.4054 0.3896 0.2897 -0.0264 0.0023  0.0132  484 ALA A CB  
2403 N N   . ARG A 316 ? 0.3816 0.3622 0.2768 -0.0256 0.0005  0.0134  485 ARG A N   
2404 C CA  . ARG A 316 ? 0.3619 0.3410 0.2592 -0.0232 0.0021  0.0139  485 ARG A CA  
2405 C C   . ARG A 316 ? 0.3749 0.3483 0.2725 -0.0229 0.0044  0.0114  485 ARG A C   
2406 O O   . ARG A 316 ? 0.3483 0.3200 0.2471 -0.0253 0.0035  0.0095  485 ARG A O   
2407 C CB  . ARG A 316 ? 0.3269 0.3092 0.2289 -0.0239 -0.0011 0.0158  485 ARG A CB  
2408 C CG  . ARG A 316 ? 0.3463 0.3337 0.2480 -0.0244 -0.0029 0.0184  485 ARG A CG  
2409 C CD  . ARG A 316 ? 0.3391 0.3283 0.2452 -0.0256 -0.0060 0.0200  485 ARG A CD  
2410 N NE  . ARG A 316 ? 0.3616 0.3547 0.2672 -0.0273 -0.0080 0.0222  485 ARG A NE  
2411 C CZ  . ARG A 316 ? 0.3535 0.3472 0.2614 -0.0293 -0.0111 0.0236  485 ARG A CZ  
2412 N NH1 . ARG A 316 ? 0.3266 0.3180 0.2381 -0.0297 -0.0128 0.0232  485 ARG A NH1 
2413 N NH2 . ARG A 316 ? 0.4063 0.4030 0.3129 -0.0309 -0.0123 0.0257  485 ARG A NH2 
2414 N N   . LEU A 317 ? 0.3640 0.3349 0.2606 -0.0198 0.0077  0.0115  486 LEU A N   
2415 C CA  . LEU A 317 ? 0.4119 0.3769 0.3087 -0.0193 0.0104  0.0095  486 LEU A CA  
2416 C C   . LEU A 317 ? 0.3987 0.3641 0.3009 -0.0208 0.0080  0.0093  486 LEU A C   
2417 O O   . LEU A 317 ? 0.3687 0.3382 0.2743 -0.0209 0.0049  0.0111  486 LEU A O   
2418 C CB  . LEU A 317 ? 0.4593 0.4218 0.3535 -0.0150 0.0143  0.0103  486 LEU A CB  
2419 C CG  . LEU A 317 ? 0.5381 0.4999 0.4266 -0.0125 0.0175  0.0106  486 LEU A CG  
2420 C CD1 . LEU A 317 ? 0.6124 0.5723 0.4986 -0.0075 0.0212  0.0117  486 LEU A CD1 
2421 C CD2 . LEU A 317 ? 0.5937 0.5501 0.4784 -0.0144 0.0196  0.0079  486 LEU A CD2 
2422 N N   . THR A 318 ? 0.4026 0.3636 0.3055 -0.0220 0.0095  0.0070  487 THR A N   
2423 C CA  . THR A 318 ? 0.3639 0.3248 0.2717 -0.0230 0.0079  0.0066  487 THR A CA  
2424 C C   . THR A 318 ? 0.3649 0.3241 0.2734 -0.0196 0.0101  0.0077  487 THR A C   
2425 O O   . THR A 318 ? 0.3371 0.2938 0.2417 -0.0166 0.0136  0.0082  487 THR A O   
2426 C CB  . THR A 318 ? 0.3567 0.3143 0.2653 -0.0258 0.0090  0.0035  487 THR A CB  
2427 O OG1 . THR A 318 ? 0.3817 0.3329 0.2866 -0.0245 0.0141  0.0021  487 THR A OG1 
2428 C CG2 . THR A 318 ? 0.3792 0.3393 0.2868 -0.0289 0.0069  0.0021  487 THR A CG2 
2429 N N   . ALA A 319 ? 0.3848 0.3454 0.2979 -0.0199 0.0081  0.0081  488 ALA A N   
2430 C CA  . ALA A 319 ? 0.3568 0.3162 0.2707 -0.0168 0.0098  0.0090  488 ALA A CA  
2431 C C   . ALA A 319 ? 0.3484 0.3014 0.2595 -0.0155 0.0148  0.0075  488 ALA A C   
2432 O O   . ALA A 319 ? 0.3592 0.3100 0.2674 -0.0119 0.0179  0.0086  488 ALA A O   
2433 C CB  . ALA A 319 ? 0.4202 0.3817 0.3396 -0.0178 0.0068  0.0091  488 ALA A CB  
2434 N N   . LEU A 320 ? 0.3600 0.3098 0.2716 -0.0185 0.0157  0.0051  489 LEU A N   
2435 C CA  . LEU A 320 ? 0.3842 0.3269 0.2928 -0.0181 0.0207  0.0035  489 LEU A CA  
2436 C C   . LEU A 320 ? 0.3964 0.3351 0.2985 -0.0158 0.0245  0.0037  489 LEU A C   
2437 O O   . LEU A 320 ? 0.4407 0.3739 0.3393 -0.0128 0.0290  0.0041  489 LEU A O   
2438 C CB  . LEU A 320 ? 0.4144 0.3558 0.3252 -0.0226 0.0205  0.0004  489 LEU A CB  
2439 C CG  . LEU A 320 ? 0.5297 0.4639 0.4388 -0.0234 0.0254  -0.0017 489 LEU A CG  
2440 C CD1 . LEU A 320 ? 0.5132 0.4451 0.4236 -0.0207 0.0275  -0.0005 489 LEU A CD1 
2441 C CD2 . LEU A 320 ? 0.5794 0.5149 0.4918 -0.0285 0.0241  -0.0048 489 LEU A CD2 
2442 N N   . ARG A 321 ? 0.4038 0.3450 0.3039 -0.0168 0.0230  0.0037  490 ARG A N   
2443 C CA  . ARG A 321 ? 0.4003 0.3382 0.2942 -0.0142 0.0265  0.0041  490 ARG A CA  
2444 C C   . ARG A 321 ? 0.4057 0.3454 0.2979 -0.0091 0.0276  0.0069  490 ARG A C   
2445 O O   . ARG A 321 ? 0.4350 0.3699 0.3222 -0.0055 0.0321  0.0074  490 ARG A O   
2446 C CB  . ARG A 321 ? 0.4347 0.3759 0.3268 -0.0162 0.0244  0.0037  490 ARG A CB  
2447 C CG  . ARG A 321 ? 0.4647 0.4023 0.3501 -0.0134 0.0283  0.0038  490 ARG A CG  
2448 C CD  . ARG A 321 ? 0.5757 0.5038 0.4565 -0.0138 0.0336  0.0013  490 ARG A CD  
2449 N NE  . ARG A 321 ? 0.9438 0.8706 0.8256 -0.0192 0.0326  -0.0020 490 ARG A NE  
2450 C CZ  . ARG A 321 ? 1.0987 1.0275 0.9785 -0.0216 0.0312  -0.0034 490 ARG A CZ  
2451 N NH1 . ARG A 321 ? 1.0450 0.9767 0.9216 -0.0191 0.0308  -0.0016 490 ARG A NH1 
2452 N NH2 . ARG A 321 ? 0.9420 0.8704 0.8230 -0.0264 0.0302  -0.0066 490 ARG A NH2 
2453 N N   . ILE A 322 ? 0.3970 0.3439 0.2932 -0.0088 0.0235  0.0088  491 ILE A N   
2454 C CA  . ILE A 322 ? 0.3760 0.3263 0.2714 -0.0042 0.0241  0.0113  491 ILE A CA  
2455 C C   . ILE A 322 ? 0.3766 0.3223 0.2711 -0.0010 0.0276  0.0115  491 ILE A C   
2456 O O   . ILE A 322 ? 0.4217 0.3660 0.3122 0.0035  0.0309  0.0128  491 ILE A O   
2457 C CB  . ILE A 322 ? 0.3920 0.3503 0.2920 -0.0052 0.0191  0.0128  491 ILE A CB  
2458 C CG1 . ILE A 322 ? 0.4133 0.3761 0.3133 -0.0077 0.0162  0.0131  491 ILE A CG1 
2459 C CG2 . ILE A 322 ? 0.3855 0.3477 0.2852 -0.0010 0.0197  0.0147  491 ILE A CG2 
2460 C CD1 . ILE A 322 ? 0.4021 0.3709 0.3068 -0.0100 0.0114  0.0141  491 ILE A CD1 
2461 N N   . LYS A 323 ? 0.3593 0.3031 0.2576 -0.0033 0.0268  0.0104  492 LYS A N   
2462 C CA  . LYS A 323 ? 0.4024 0.3414 0.2999 -0.0008 0.0302  0.0105  492 LYS A CA  
2463 C C   . LYS A 323 ? 0.3979 0.3284 0.2892 0.0012  0.0361  0.0100  492 LYS A C   
2464 O O   . LYS A 323 ? 0.4086 0.3368 0.2964 0.0061  0.0395  0.0116  492 LYS A O   
2465 C CB  . LYS A 323 ? 0.3830 0.3210 0.2855 -0.0044 0.0287  0.0089  492 LYS A CB  
2466 C CG  . LYS A 323 ? 0.4177 0.3508 0.3198 -0.0022 0.0323  0.0090  492 LYS A CG  
2467 C CD  . LYS A 323 ? 0.3983 0.3301 0.3049 -0.0062 0.0314  0.0069  492 LYS A CD  
2468 C CE  . LYS A 323 ? 0.4682 0.3959 0.3745 -0.0038 0.0349  0.0073  492 LYS A CE  
2469 N NZ  . LYS A 323 ? 0.4615 0.3888 0.3727 -0.0076 0.0340  0.0054  492 LYS A NZ  
2470 N N   . LYS A 324 ? 0.4135 0.3393 0.3032 -0.0021 0.0375  0.0077  493 LYS A N   
2471 C CA  . LYS A 324 ? 0.4750 0.3915 0.3583 -0.0005 0.0435  0.0069  493 LYS A CA  
2472 C C   . LYS A 324 ? 0.4652 0.3818 0.3428 0.0045  0.0456  0.0089  493 LYS A C   
2473 O O   . LYS A 324 ? 0.5126 0.4229 0.3850 0.0088  0.0506  0.0099  493 LYS A O   
2474 C CB  . LYS A 324 ? 0.5639 0.4760 0.4463 -0.0055 0.0443  0.0037  493 LYS A CB  
2475 C CG  . LYS A 324 ? 0.6805 0.5921 0.5679 -0.0108 0.0430  0.0012  493 LYS A CG  
2476 C CD  . LYS A 324 ? 0.8949 0.8023 0.7803 -0.0154 0.0443  -0.0021 493 LYS A CD  
2477 C CE  . LYS A 324 ? 0.8676 0.7777 0.7587 -0.0212 0.0416  -0.0049 493 LYS A CE  
2478 N NZ  . LYS A 324 ? 1.0146 0.9229 0.9090 -0.0212 0.0430  -0.0048 493 LYS A NZ  
2479 N N   . THR A 325 ? 0.4143 0.3382 0.2928 0.0043  0.0421  0.0097  494 THR A N   
2480 C CA  . THR A 325 ? 0.4418 0.3673 0.3154 0.0094  0.0440  0.0117  494 THR A CA  
2481 C C   . THR A 325 ? 0.4715 0.4002 0.3448 0.0150  0.0448  0.0144  494 THR A C   
2482 O O   . THR A 325 ? 0.4224 0.3477 0.2901 0.0205  0.0491  0.0158  494 THR A O   
2483 C CB  . THR A 325 ? 0.4865 0.4204 0.3617 0.0078  0.0398  0.0121  494 THR A CB  
2484 O OG1 . THR A 325 ? 0.5340 0.4655 0.4090 0.0030  0.0389  0.0097  494 THR A OG1 
2485 C CG2 . THR A 325 ? 0.4851 0.4215 0.3555 0.0130  0.0418  0.0140  494 THR A CG2 
2486 N N   . LEU A 326 ? 0.4918 0.4269 0.3708 0.0139  0.0408  0.0150  495 LEU A N   
2487 C CA  . LEU A 326 ? 0.4799 0.4191 0.3590 0.0188  0.0412  0.0172  495 LEU A CA  
2488 C C   . LEU A 326 ? 0.4572 0.3880 0.3327 0.0221  0.0462  0.0175  495 LEU A C   
2489 O O   . LEU A 326 ? 0.4625 0.3943 0.3348 0.0279  0.0485  0.0196  495 LEU A O   
2490 C CB  . LEU A 326 ? 0.4528 0.3999 0.3385 0.0165  0.0359  0.0174  495 LEU A CB  
2491 C CG  . LEU A 326 ? 0.4100 0.3663 0.2986 0.0146  0.0314  0.0179  495 LEU A CG  
2492 C CD1 . LEU A 326 ? 0.3920 0.3536 0.2871 0.0112  0.0265  0.0176  495 LEU A CD1 
2493 C CD2 . LEU A 326 ? 0.3948 0.3572 0.2804 0.0197  0.0324  0.0199  495 LEU A CD2 
2494 N N   . THR A 327 ? 0.4567 0.3796 0.3328 0.0184  0.0480  0.0155  496 THR A N   
2495 C CA  . THR A 327 ? 0.5076 0.4214 0.3801 0.0207  0.0533  0.0157  496 THR A CA  
2496 C C   . THR A 327 ? 0.5663 0.4726 0.4305 0.0257  0.0592  0.0167  496 THR A C   
2497 O O   . THR A 327 ? 0.5287 0.4304 0.3888 0.0306  0.0633  0.0184  496 THR A O   
2498 C CB  . THR A 327 ? 0.5176 0.4253 0.3930 0.0148  0.0538  0.0129  496 THR A CB  
2499 O OG1 . THR A 327 ? 0.5067 0.4214 0.3895 0.0115  0.0487  0.0124  496 THR A OG1 
2500 C CG2 . THR A 327 ? 0.5418 0.4395 0.4133 0.0169  0.0598  0.0131  496 THR A CG2 
2501 N N   . LYS A 328 ? 0.6199 0.5255 0.4813 0.0248  0.0594  0.0159  497 LYS A N   
2502 C CA  . LYS A 328 ? 0.6366 0.5350 0.4898 0.0297  0.0650  0.0168  497 LYS A CA  
2503 C C   . LYS A 328 ? 0.6266 0.5320 0.4769 0.0368  0.0651  0.0199  497 LYS A C   
2504 O O   . LYS A 328 ? 0.7838 0.6835 0.6273 0.0426  0.0701  0.0214  497 LYS A O   
2505 C CB  . LYS A 328 ? 0.6505 0.5443 0.5015 0.0256  0.0658  0.0142  497 LYS A CB  
2506 C CG  . LYS A 328 ? 0.8159 0.7013 0.6681 0.0193  0.0673  0.0109  497 LYS A CG  
2507 C CD  . LYS A 328 ? 0.8102 0.6923 0.6604 0.0148  0.0675  0.0080  497 LYS A CD  
2508 N N   . ILE A 329 ? 0.6336 0.5514 0.4888 0.0363  0.0596  0.0207  498 ILE A N   
2509 C CA  . ILE A 329 ? 0.6600 0.5866 0.5136 0.0426  0.0590  0.0234  498 ILE A CA  
2510 C C   . ILE A 329 ? 0.6784 0.6059 0.5311 0.0479  0.0608  0.0255  498 ILE A C   
2511 O O   . ILE A 329 ? 0.6905 0.6213 0.5391 0.0549  0.0628  0.0279  498 ILE A O   
2512 C CB  . ILE A 329 ? 0.6267 0.5666 0.4869 0.0394  0.0525  0.0233  498 ILE A CB  
2513 C CG1 . ILE A 329 ? 0.6859 0.6265 0.5468 0.0349  0.0506  0.0217  498 ILE A CG1 
2514 C CG2 . ILE A 329 ? 0.7747 0.7248 0.6339 0.0453  0.0519  0.0257  498 ILE A CG2 
2515 C CD1 . ILE A 329 ? 0.7263 0.6776 0.5938 0.0304  0.0444  0.0214  498 ILE A CD1 
2516 N N   . ASP A 330 ? 0.8368 0.7619 0.6934 0.0447  0.0597  0.0246  499 ASP A N   
2517 C CA  . ASP A 330 ? 1.1363 1.0634 0.9935 0.0485  0.0602  0.0262  499 ASP A CA  
2518 C C   . ASP A 330 ? 1.1181 1.0359 0.9675 0.0552  0.0669  0.0282  499 ASP A C   
2519 O O   . ASP A 330 ? 1.1016 1.0085 0.9490 0.0538  0.0707  0.0275  499 ASP A O   
2520 C CB  . ASP A 330 ? 0.9237 0.8498 0.7871 0.0428  0.0575  0.0245  499 ASP A CB  
2529 N N   . GLY B 2   ? 0.7776 0.8373 1.0522 0.0739  0.1441  0.1815  2   GLY B N   
2530 C CA  . GLY B 2   ? 0.7691 0.8411 1.0280 0.0645  0.1237  0.1809  2   GLY B CA  
2531 C C   . GLY B 2   ? 0.6652 0.7461 0.9114 0.0602  0.1083  0.1785  2   GLY B C   
2532 O O   . GLY B 2   ? 0.5540 0.6426 0.7858 0.0517  0.0924  0.1764  2   GLY B O   
2533 N N   . VAL B 3   ? 0.6662 0.7446 0.9171 0.0660  0.1142  0.1788  3   VAL B N   
2534 C CA  . VAL B 3   ? 0.5883 0.6744 0.8289 0.0630  0.1019  0.1782  3   VAL B CA  
2535 C C   . VAL B 3   ? 0.5074 0.6076 0.7654 0.0686  0.1061  0.2014  3   VAL B C   
2536 O O   . VAL B 3   ? 0.5152 0.6069 0.7840 0.0777  0.1214  0.2036  3   VAL B O   
2537 C CB  . VAL B 3   ? 0.5182 0.5879 0.7447 0.0648  0.1037  0.1553  3   VAL B CB  
2538 C CG1 . VAL B 3   ? 0.4928 0.5699 0.7099 0.0630  0.0931  0.1570  3   VAL B CG1 
2539 C CG2 . VAL B 3   ? 0.5990 0.6581 0.8099 0.0591  0.0979  0.1328  3   VAL B CG2 
2540 N N   . GLU B 4   ? 0.4979 0.6192 0.7584 0.0628  0.0928  0.2184  4   GLU B N   
2541 C CA  . GLU B 4   ? 0.5638 0.7020 0.8417 0.0666  0.0940  0.2403  4   GLU B CA  
2542 C C   . GLU B 4   ? 0.5786 0.7223 0.8446 0.0605  0.0809  0.2358  4   GLU B C   
2543 O O   . GLU B 4   ? 0.4816 0.6263 0.7286 0.0503  0.0658  0.2254  4   GLU B O   
2544 C CB  . GLU B 4   ? 0.7818 0.9430 1.0783 0.0663  0.0917  0.2672  4   GLU B CB  
2545 C CG  . GLU B 4   ? 0.9758 1.1594 1.2660 0.0544  0.0708  0.2773  4   GLU B CG  
2546 C CD  . GLU B 4   ? 1.0950 1.2975 1.3961 0.0531  0.0674  0.2983  4   GLU B CD  
2547 O OE1 . GLU B 4   ? 1.0297 1.2262 1.3426 0.0619  0.0818  0.3044  4   GLU B OE1 
2548 O OE2 . GLU B 4   ? 0.8737 1.0966 1.1705 0.0431  0.0504  0.3087  4   GLU B OE2 
2549 N N   . ILE B 5   ? 0.5522 0.6972 0.8293 0.0674  0.0888  0.2436  5   ILE B N   
2550 C CA  A ILE B 5   ? 0.4873 0.6342 0.7551 0.0639  0.0807  0.2394  5   ILE B CA  
2551 C CA  B ILE B 5   ? 0.4775 0.6245 0.7450 0.0638  0.0805  0.2393  5   ILE B CA  
2552 C C   . ILE B 5   ? 0.5505 0.7214 0.8397 0.0634  0.0779  0.2648  5   ILE B C   
2553 O O   . ILE B 5   ? 0.4711 0.6480 0.7835 0.0727  0.0910  0.2822  5   ILE B O   
2554 C CB  A ILE B 5   ? 0.5345 0.6598 0.7940 0.0728  0.0931  0.2241  5   ILE B CB  
2555 C CB  B ILE B 5   ? 0.5024 0.6266 0.7588 0.0717  0.0915  0.2215  5   ILE B CB  
2556 C CG1 A ILE B 5   ? 0.5168 0.6206 0.7625 0.0750  0.0994  0.2020  5   ILE B CG1 
2557 C CG1 B ILE B 5   ? 0.5397 0.6676 0.7929 0.0715  0.0877  0.2241  5   ILE B CG1 
2558 C CG2 A ILE B 5   ? 0.5738 0.6969 0.8166 0.0686  0.0835  0.2147  5   ILE B CG2 
2559 C CG2 B ILE B 5   ? 0.4956 0.6085 0.7667 0.0839  0.1125  0.2256  5   ILE B CG2 
2560 C CD1 A ILE B 5   ? 0.5915 0.6754 0.8207 0.0801  0.1052  0.1822  5   ILE B CD1 
2561 C CD1 B ILE B 5   ? 0.4978 0.6036 0.7334 0.0780  0.0950  0.2048  5   ILE B CD1 
2562 N N   . GLU B 6   ? 0.6121 0.7964 0.8941 0.0523  0.0614  0.2669  6   GLU B N   
2563 C CA  . GLU B 6   ? 0.5465 0.7557 0.8484 0.0490  0.0559  0.2894  6   GLU B CA  
2564 C C   . GLU B 6   ? 0.5026 0.7067 0.7943 0.0458  0.0520  0.2812  6   GLU B C   
2565 O O   . GLU B 6   ? 0.4176 0.6169 0.6875 0.0356  0.0396  0.2671  6   GLU B O   
2566 C CB  . GLU B 6   ? 0.6784 0.9096 0.9805 0.0363  0.0388  0.2999  6   GLU B CB  
2567 C CG  . GLU B 6   ? 0.9933 1.2545 1.3154 0.0295  0.0292  0.3225  6   GLU B CG  
2568 C CD  . GLU B 6   ? 1.1021 1.3824 1.4169 0.0146  0.0100  0.3283  6   GLU B CD  
2569 O OE1 . GLU B 6   ? 1.0326 1.3146 1.3450 0.0152  0.0093  0.3313  6   GLU B OE1 
2570 O OE2 . GLU B 6   ? 1.0971 1.3894 1.4074 0.0018  -0.0036 0.3294  6   GLU B OE2 
2571 N N   . THR B 7   ? 0.5033 0.7067 0.8101 0.0551  0.0641  0.2900  7   THR B N   
2572 C CA  . THR B 7   ? 0.4996 0.6956 0.7965 0.0538  0.0631  0.2823  7   THR B CA  
2573 C C   . THR B 7   ? 0.4274 0.6449 0.7280 0.0394  0.0465  0.2915  7   THR B C   
2574 O O   . THR B 7   ? 0.4043 0.6469 0.7248 0.0338  0.0396  0.3107  7   THR B O   
2575 C CB  . THR B 7   ? 0.6002 0.7897 0.9122 0.0675  0.0811  0.2906  7   THR B CB  
2576 O OG1 . THR B 7   ? 0.5872 0.7519 0.8883 0.0788  0.0957  0.2764  7   THR B OG1 
2577 C CG2 . THR B 7   ? 0.6139 0.7974 0.9167 0.0661  0.0801  0.2853  7   THR B CG2 
2578 N N   . ILE B 8   ? 0.4205 0.6275 0.7001 0.0328  0.0397  0.2767  8   ILE B N   
2579 C CA  . ILE B 8   ? 0.4378 0.6610 0.7194 0.0187  0.0262  0.2831  8   ILE B CA  
2580 C C   . ILE B 8   ? 0.4624 0.6833 0.7528 0.0233  0.0344  0.2878  8   ILE B C   
2581 O O   . ILE B 8   ? 0.4202 0.6622 0.7316 0.0169  0.0303  0.3046  8   ILE B O   
2582 C CB  . ILE B 8   ? 0.4692 0.6811 0.7201 0.0064  0.0133  0.2636  8   ILE B CB  
2583 C CG1 . ILE B 8   ? 0.4542 0.6741 0.7002 -0.0008 0.0035  0.2640  8   ILE B CG1 
2584 C CG2 . ILE B 8   ? 0.4622 0.6823 0.7108 -0.0068 0.0036  0.2657  8   ILE B CG2 
2585 C CD1 . ILE B 8   ? 0.4412 0.6425 0.6554 -0.0075 -0.0034 0.2420  8   ILE B CD1 
2586 N N   . SER B 9   ? 0.4562 0.6517 0.7298 0.0340  0.0456  0.2727  9   SER B N   
2587 C CA  . SER B 9   ? 0.4421 0.6314 0.7219 0.0415  0.0566  0.2768  9   SER B CA  
2588 C C   . SER B 9   ? 0.4284 0.5923 0.6955 0.0581  0.0727  0.2650  9   SER B C   
2589 O O   . SER B 9   ? 0.4164 0.5642 0.6613 0.0603  0.0715  0.2468  9   SER B O   
2590 C CB  . SER B 9   ? 0.4351 0.6191 0.6983 0.0318  0.0488  0.2675  9   SER B CB  
2591 O OG  . SER B 9   ? 0.4369 0.5983 0.6675 0.0325  0.0462  0.2444  9   SER B OG  
2592 N N   . PRO B 10  ? 0.4039 0.5648 0.6857 0.0696  0.0881  0.2756  10  PRO B N   
2593 C CA  . PRO B 10  ? 0.4385 0.5760 0.7089 0.0849  0.1041  0.2656  10  PRO B CA  
2594 C C   . PRO B 10  ? 0.3806 0.4935 0.6178 0.0890  0.1053  0.2436  10  PRO B C   
2595 O O   . PRO B 10  ? 0.4132 0.5258 0.6404 0.0831  0.0984  0.2400  10  PRO B O   
2596 C CB  . PRO B 10  ? 0.4664 0.6085 0.7629 0.0952  0.1207  0.2856  10  PRO B CB  
2597 C CG  . PRO B 10  ? 0.4332 0.5946 0.7457 0.0859  0.1131  0.2995  10  PRO B CG  
2598 C CD  . PRO B 10  ? 0.4425 0.6216 0.7531 0.0689  0.0922  0.2976  10  PRO B CD  
2599 N N   . GLY B 11  ? 0.3535 0.4461 0.5743 0.0992  0.1144  0.2294  11  GLY B N   
2600 C CA  . GLY B 11  ? 0.3822 0.4524 0.5732 0.1061  0.1179  0.2106  11  GLY B CA  
2601 C C   . GLY B 11  ? 0.4079 0.4656 0.6022 0.1198  0.1367  0.2171  11  GLY B C   
2602 O O   . GLY B 11  ? 0.4460 0.5144 0.6667 0.1222  0.1453  0.2370  11  GLY B O   
2603 N N   . ASP B 12  ? 0.4101 0.4454 0.5775 0.1290  0.1434  0.2007  12  ASP B N   
2604 C CA  . ASP B 12  ? 0.4504 0.4712 0.6159 0.1420  0.1615  0.2058  12  ASP B CA  
2605 C C   . ASP B 12  ? 0.4733 0.4883 0.6529 0.1498  0.1773  0.2121  12  ASP B C   
2606 O O   . ASP B 12  ? 0.5009 0.5027 0.6806 0.1609  0.1946  0.2177  12  ASP B O   
2607 C CB  . ASP B 12  ? 0.4023 0.4011 0.5316 0.1498  0.1634  0.1868  12  ASP B CB  
2608 C CG  . ASP B 12  ? 0.4251 0.4093 0.5325 0.1530  0.1633  0.1661  12  ASP B CG  
2609 O OD1 . ASP B 12  ? 0.4184 0.4094 0.5380 0.1476  0.1602  0.1650  12  ASP B OD1 
2610 O OD2 . ASP B 12  ? 0.4172 0.3841 0.4956 0.1604  0.1661  0.1511  12  ASP B OD2 
2611 N N   . GLY B 13  ? 0.5333 0.5563 0.7234 0.1443  0.1724  0.2110  13  GLY B N   
2612 C CA  . GLY B 13  ? 0.4943 0.5111 0.6987 0.1510  0.1880  0.2168  13  GLY B CA  
2613 C C   . GLY B 13  ? 0.5092 0.4972 0.6886 0.1613  0.2024  0.1997  13  GLY B C   
2614 O O   . GLY B 13  ? 0.6174 0.5948 0.8062 0.1694  0.2208  0.2061  13  GLY B O   
2615 N N   . ARG B 14  ? 0.4411 0.4165 0.5880 0.1610  0.1944  0.1781  14  ARG B N   
2616 C CA  . ARG B 14  ? 0.5218 0.4711 0.6413 0.1700  0.2060  0.1610  14  ARG B CA  
2617 C C   . ARG B 14  ? 0.5508 0.4933 0.6419 0.1653  0.1925  0.1348  14  ARG B C   
2618 O O   . ARG B 14  ? 0.5177 0.4437 0.5942 0.1682  0.1996  0.1196  14  ARG B O   
2619 C CB  . ARG B 14  ? 0.6588 0.5968 0.7645 0.1794  0.2148  0.1648  14  ARG B CB  
2620 C CG  . ARG B 14  ? 1.0346 0.9443 1.1149 0.1905  0.2318  0.1523  14  ARG B CG  
2621 C CD  . ARG B 14  ? 1.1822 1.0796 1.2511 0.2014  0.2441  0.1598  14  ARG B CD  
2622 N NE  . ARG B 14  ? 1.3730 1.2702 1.4155 0.2009  0.2305  0.1484  14  ARG B NE  
2623 C CZ  . ARG B 14  ? 1.4216 1.3355 1.4732 0.1958  0.2187  0.1575  14  ARG B CZ  
2624 N NH1 . ARG B 14  ? 1.6305 1.5643 1.7167 0.1898  0.2172  0.1779  14  ARG B NH1 
2625 N NH2 . ARG B 14  ? 1.2554 1.1661 1.2809 0.1966  0.2085  0.1462  14  ARG B NH2 
2626 N N   . THR B 15  ? 0.4828 0.4374 0.5658 0.1582  0.1739  0.1295  15  THR B N   
2627 C CA  . THR B 15  ? 0.4557 0.4057 0.5127 0.1548  0.1610  0.1064  15  THR B CA  
2628 C C   . THR B 15  ? 0.4757 0.4397 0.5453 0.1434  0.1480  0.1026  15  THR B C   
2629 O O   . THR B 15  ? 0.4561 0.4372 0.5390 0.1356  0.1368  0.1125  15  THR B O   
2630 C CB  . THR B 15  ? 0.4557 0.4070 0.4929 0.1562  0.1512  0.1027  15  THR B CB  
2631 O OG1 . THR B 15  ? 0.4574 0.3986 0.4897 0.1664  0.1645  0.1125  15  THR B OG1 
2632 C CG2 . THR B 15  ? 0.4751 0.4181 0.4823 0.1572  0.1423  0.0791  15  THR B CG2 
2633 N N   . PHE B 16  ? 0.4803 0.4361 0.5462 0.1423  0.1509  0.0887  16  PHE B N   
2634 C CA  . PHE B 16  ? 0.3978 0.3635 0.4748 0.1326  0.1415  0.0836  16  PHE B CA  
2635 C C   . PHE B 16  ? 0.3734 0.3338 0.4280 0.1298  0.1314  0.0593  16  PHE B C   
2636 O O   . PHE B 16  ? 0.4298 0.3764 0.4627 0.1357  0.1355  0.0454  16  PHE B O   
2637 C CB  . PHE B 16  ? 0.3943 0.3558 0.4913 0.1333  0.1554  0.0897  16  PHE B CB  
2638 C CG  . PHE B 16  ? 0.3944 0.3637 0.5170 0.1367  0.1659  0.1153  16  PHE B CG  
2639 C CD1 . PHE B 16  ? 0.4193 0.3773 0.5413 0.1467  0.1817  0.1236  16  PHE B CD1 
2640 C CD2 . PHE B 16  ? 0.3286 0.3171 0.4758 0.1301  0.1598  0.1315  16  PHE B CD2 
2641 C CE1 . PHE B 16  ? 0.4171 0.3844 0.5657 0.1501  0.1914  0.1486  16  PHE B CE1 
2642 C CE2 . PHE B 16  ? 0.3654 0.3646 0.5381 0.1331  0.1680  0.1561  16  PHE B CE2 
2643 C CZ  . PHE B 16  ? 0.3749 0.3642 0.5501 0.1432  0.1841  0.1651  16  PHE B CZ  
2644 N N   . PRO B 17  ? 0.3348 0.3067 0.3942 0.1207  0.1180  0.0543  17  PRO B N   
2645 C CA  . PRO B 17  ? 0.3510 0.3209 0.3923 0.1179  0.1076  0.0325  17  PRO B CA  
2646 C C   . PRO B 17  ? 0.3687 0.3250 0.4032 0.1192  0.1156  0.0153  17  PRO B C   
2647 O O   . PRO B 17  ? 0.3480 0.3002 0.3991 0.1175  0.1262  0.0191  17  PRO B O   
2648 C CB  . PRO B 17  ? 0.3292 0.3130 0.3830 0.1079  0.0957  0.0343  17  PRO B CB  
2649 C CG  . PRO B 17  ? 0.3084 0.3030 0.3794 0.1055  0.0957  0.0565  17  PRO B CG  
2650 C CD  . PRO B 17  ? 0.3047 0.2928 0.3857 0.1128  0.1115  0.0692  17  PRO B CD  
2651 N N   . LYS B 18  ? 0.3822 0.3325 0.3928 0.1218  0.1104  -0.0030 18  LYS B N   
2652 C CA  . LYS B 18  ? 0.4321 0.3698 0.4318 0.1220  0.1162  -0.0221 18  LYS B CA  
2653 C C   . LYS B 18  ? 0.4897 0.4358 0.4832 0.1153  0.1015  -0.0402 18  LYS B C   
2654 O O   . LYS B 18  ? 0.4320 0.3902 0.4204 0.1143  0.0876  -0.0396 18  LYS B O   
2655 C CB  . LYS B 18  ? 0.4543 0.3780 0.4278 0.1310  0.1222  -0.0293 18  LYS B CB  
2656 C CG  . LYS B 18  ? 0.4996 0.4127 0.4755 0.1395  0.1382  -0.0124 18  LYS B CG  
2657 C CD  . LYS B 18  ? 0.5602 0.4695 0.5628 0.1378  0.1531  0.0005  18  LYS B CD  
2658 C CE  . LYS B 18  ? 0.6606 0.5570 0.6647 0.1474  0.1716  0.0153  18  LYS B CE  
2659 N NZ  . LYS B 18  ? 0.6848 0.5772 0.7156 0.1473  0.1880  0.0290  18  LYS B NZ  
2660 N N   . LYS B 19  ? 0.4456 0.3842 0.4390 0.1111  0.1056  -0.0567 19  LYS B N   
2661 C CA  . LYS B 19  ? 0.4490 0.3959 0.4397 0.1042  0.0930  -0.0748 19  LYS B CA  
2662 C C   . LYS B 19  ? 0.4539 0.4098 0.4229 0.1079  0.0779  -0.0826 19  LYS B C   
2663 O O   . LYS B 19  ? 0.4543 0.4032 0.4015 0.1153  0.0796  -0.0860 19  LYS B O   
2664 C CB  . LYS B 19  ? 0.5421 0.4766 0.5290 0.1004  0.1008  -0.0942 19  LYS B CB  
2665 C CG  . LYS B 19  ? 0.6397 0.5846 0.6302 0.0917  0.0888  -0.1123 19  LYS B CG  
2666 C CD  . LYS B 19  ? 0.7690 0.7021 0.7560 0.0862  0.0960  -0.1329 19  LYS B CD  
2667 C CE  . LYS B 19  ? 0.8757 0.8216 0.8740 0.0765  0.0848  -0.1476 19  LYS B CE  
2668 N NZ  . LYS B 19  ? 1.0457 0.9832 1.0355 0.0703  0.0875  -0.1714 19  LYS B NZ  
2669 N N   . GLY B 20  ? 0.4629 0.4338 0.4373 0.1032  0.0641  -0.0854 20  GLY B N   
2670 C CA  . GLY B 20  ? 0.4903 0.4707 0.4459 0.1071  0.0502  -0.0926 20  GLY B CA  
2671 C C   . GLY B 20  ? 0.4893 0.4729 0.4368 0.1142  0.0473  -0.0763 20  GLY B C   
2672 O O   . GLY B 20  ? 0.5109 0.5035 0.4471 0.1172  0.0364  -0.0789 20  GLY B O   
2673 N N   . GLN B 21  ? 0.4581 0.4347 0.4126 0.1168  0.0576  -0.0593 21  GLN B N   
2674 C CA  . GLN B 21  ? 0.4596 0.4395 0.4106 0.1213  0.0556  -0.0435 21  GLN B CA  
2675 C C   . GLN B 21  ? 0.4319 0.4238 0.3958 0.1143  0.0463  -0.0366 21  GLN B C   
2676 O O   . GLN B 21  ? 0.3633 0.3596 0.3449 0.1060  0.0454  -0.0369 21  GLN B O   
2677 C CB  . GLN B 21  ? 0.4338 0.4052 0.3931 0.1246  0.0691  -0.0266 21  GLN B CB  
2678 C CG  . GLN B 21  ? 0.4264 0.3837 0.3687 0.1335  0.0796  -0.0304 21  GLN B CG  
2679 C CD  . GLN B 21  ? 0.4436 0.3944 0.3934 0.1385  0.0920  -0.0113 21  GLN B CD  
2680 O OE1 . GLN B 21  ? 0.4072 0.3589 0.3795 0.1345  0.0994  0.0002  21  GLN B OE1 
2681 N NE2 . GLN B 21  ? 0.5099 0.4552 0.4421 0.1476  0.0946  -0.0068 21  GLN B NE2 
2682 N N   . THR B 22  ? 0.4403 0.4360 0.3938 0.1181  0.0406  -0.0304 22  THR B N   
2683 C CA  . THR B 22  ? 0.3649 0.3685 0.3269 0.1119  0.0338  -0.0229 22  THR B CA  
2684 C C   . THR B 22  ? 0.3321 0.3341 0.3054 0.1095  0.0400  -0.0044 22  THR B C   
2685 O O   . THR B 22  ? 0.3731 0.3702 0.3392 0.1158  0.0454  0.0043  22  THR B O   
2686 C CB  . THR B 22  ? 0.3814 0.3887 0.3268 0.1168  0.0257  -0.0257 22  THR B CB  
2687 O OG1 . THR B 22  ? 0.3954 0.4077 0.3332 0.1185  0.0187  -0.0421 22  THR B OG1 
2688 C CG2 . THR B 22  ? 0.3983 0.4108 0.3514 0.1096  0.0205  -0.0185 22  THR B CG2 
2689 N N   . CYS B 23  ? 0.3018 0.3087 0.2935 0.1004  0.0394  0.0016  23  CYS B N   
2690 C CA  A CYS B 23  ? 0.3358 0.3455 0.3406 0.0959  0.0426  0.0199  23  CYS B CA  
2691 C CA  B CYS B 23  ? 0.3404 0.3502 0.3456 0.0958  0.0426  0.0193  23  CYS B CA  
2692 C C   . CYS B 23  ? 0.3533 0.3673 0.3531 0.0910  0.0346  0.0244  23  CYS B C   
2693 O O   . CYS B 23  ? 0.3288 0.3459 0.3266 0.0862  0.0274  0.0168  23  CYS B O   
2694 C CB  A CYS B 23  ? 0.3175 0.3318 0.3434 0.0881  0.0449  0.0261  23  CYS B CB  
2695 C CB  B CYS B 23  ? 0.3382 0.3519 0.3629 0.0881  0.0442  0.0217  23  CYS B CB  
2696 S SG  A CYS B 23  ? 0.3104 0.3181 0.3472 0.0923  0.0575  0.0246  23  CYS B SG  
2697 S SG  B CYS B 23  ? 0.2932 0.3098 0.3386 0.0865  0.0533  0.0421  23  CYS B SG  
2698 N N   . VAL B 24  ? 0.3309 0.3442 0.3295 0.0920  0.0371  0.0370  24  VAL B N   
2699 C CA  . VAL B 24  ? 0.3023 0.3172 0.2955 0.0866  0.0317  0.0423  24  VAL B CA  
2700 C C   . VAL B 24  ? 0.2871 0.3087 0.2975 0.0771  0.0322  0.0580  24  VAL B C   
2701 O O   . VAL B 24  ? 0.3153 0.3381 0.3347 0.0795  0.0386  0.0696  24  VAL B O   
2702 C CB  . VAL B 24  ? 0.3373 0.3456 0.3143 0.0953  0.0346  0.0436  24  VAL B CB  
2703 C CG1 . VAL B 24  ? 0.3948 0.4025 0.3662 0.0892  0.0308  0.0485  24  VAL B CG1 
2704 C CG2 . VAL B 24  ? 0.3279 0.3319 0.2876 0.1058  0.0337  0.0294  24  VAL B CG2 
2705 N N   . VAL B 25  ? 0.2875 0.3141 0.3027 0.0664  0.0256  0.0589  25  VAL B N   
2706 C CA  . VAL B 25  ? 0.2924 0.3276 0.3228 0.0565  0.0242  0.0732  25  VAL B CA  
2707 C C   . VAL B 25  ? 0.2907 0.3268 0.3144 0.0454  0.0171  0.0755  25  VAL B C   
2708 O O   . VAL B 25  ? 0.2820 0.3119 0.2918 0.0447  0.0136  0.0652  25  VAL B O   
2709 C CB  . VAL B 25  ? 0.2812 0.3223 0.3265 0.0532  0.0244  0.0743  25  VAL B CB  
2710 C CG1 . VAL B 25  ? 0.2821 0.3197 0.3335 0.0633  0.0332  0.0709  25  VAL B CG1 
2711 C CG2 . VAL B 25  ? 0.2769 0.3161 0.3157 0.0483  0.0185  0.0625  25  VAL B CG2 
2712 N N   . HIS B 26  ? 0.3026 0.3466 0.3367 0.0365  0.0154  0.0894  26  HIS B N   
2713 C CA  . HIS B 26  ? 0.3106 0.3575 0.3413 0.0227  0.0078  0.0919  26  HIS B CA  
2714 C C   . HIS B 26  ? 0.2887 0.3465 0.3343 0.0167  0.0049  0.0988  26  HIS B C   
2715 O O   . HIS B 26  ? 0.3135 0.3795 0.3762 0.0209  0.0090  0.1082  26  HIS B O   
2716 C CB  . HIS B 26  ? 0.2820 0.3315 0.3131 0.0147  0.0066  0.1022  26  HIS B CB  
2717 C CG  . HIS B 26  ? 0.2913 0.3276 0.3031 0.0155  0.0078  0.0944  26  HIS B CG  
2718 N ND1 . HIS B 26  ? 0.3083 0.3349 0.3035 0.0128  0.0049  0.0830  26  HIS B ND1 
2719 C CD2 . HIS B 26  ? 0.3086 0.3391 0.3157 0.0192  0.0129  0.0973  26  HIS B CD2 
2720 C CE1 . HIS B 26  ? 0.3116 0.3272 0.2927 0.0155  0.0083  0.0792  26  HIS B CE1 
2721 N NE2 . HIS B 26  ? 0.3237 0.3411 0.3112 0.0192  0.0132  0.0876  26  HIS B NE2 
2722 N N   . TYR B 27  ? 0.2814 0.3381 0.3199 0.0079  -0.0010 0.0945  27  TYR B N   
2723 C CA  . TYR B 27  ? 0.3326 0.3993 0.3828 0.0016  -0.0041 0.1019  27  TYR B CA  
2724 C C   . TYR B 27  ? 0.3312 0.3981 0.3704 -0.0126 -0.0122 0.1033  27  TYR B C   
2725 O O   . TYR B 27  ? 0.3566 0.4118 0.3776 -0.0160 -0.0137 0.0935  27  TYR B O   
2726 C CB  . TYR B 27  ? 0.2866 0.3491 0.3395 0.0083  -0.0006 0.0924  27  TYR B CB  
2727 C CG  . TYR B 27  ? 0.2727 0.3242 0.3092 0.0066  -0.0030 0.0777  27  TYR B CG  
2728 C CD1 . TYR B 27  ? 0.2991 0.3413 0.3253 0.0148  -0.0005 0.0648  27  TYR B CD1 
2729 C CD2 . TYR B 27  ? 0.3061 0.3571 0.3374 -0.0027 -0.0074 0.0774  27  TYR B CD2 
2730 C CE1 . TYR B 27  ? 0.2974 0.3313 0.3113 0.0141  -0.0022 0.0526  27  TYR B CE1 
2731 C CE2 . TYR B 27  ? 0.3572 0.3973 0.3745 -0.0037 -0.0081 0.0646  27  TYR B CE2 
2732 C CZ  . TYR B 27  ? 0.2817 0.3140 0.2917 0.0049  -0.0054 0.0525  27  TYR B CZ  
2733 O OH  . TYR B 27  ? 0.3293 0.3527 0.3281 0.0051  -0.0056 0.0409  27  TYR B OH  
2734 N N   . THR B 28  ? 0.3070 0.3872 0.3569 -0.0207 -0.0167 0.1160  28  THR B N   
2735 C CA  . THR B 28  ? 0.3224 0.4032 0.3613 -0.0340 -0.0243 0.1170  28  THR B CA  
2736 C C   . THR B 28  ? 0.3261 0.4143 0.3757 -0.0324 -0.0239 0.1221  28  THR B C   
2737 O O   . THR B 28  ? 0.3382 0.4402 0.4076 -0.0286 -0.0221 0.1351  28  THR B O   
2738 C CB  . THR B 28  ? 0.3535 0.4454 0.3933 -0.0471 -0.0317 0.1290  28  THR B CB  
2739 O OG1 . THR B 28  ? 0.3050 0.3885 0.3363 -0.0477 -0.0299 0.1243  28  THR B OG1 
2740 C CG2 . THR B 28  ? 0.3341 0.4257 0.3584 -0.0625 -0.0402 0.1292  28  THR B CG2 
2741 N N   . GLY B 29  ? 0.3433 0.4214 0.3806 -0.0344 -0.0241 0.1125  29  GLY B N   
2742 C CA  . GLY B 29  ? 0.4280 0.5103 0.4741 -0.0325 -0.0222 0.1162  29  GLY B CA  
2743 C C   . GLY B 29  ? 0.4310 0.5181 0.4674 -0.0452 -0.0298 0.1237  29  GLY B C   
2744 O O   . GLY B 29  ? 0.4289 0.5060 0.4442 -0.0546 -0.0341 0.1166  29  GLY B O   
2745 N N   . MET B 30  ? 0.4241 0.5259 0.4751 -0.0452 -0.0307 0.1383  30  MET B N   
2746 C CA  . MET B 30  ? 0.4941 0.6026 0.5359 -0.0563 -0.0383 0.1470  30  MET B CA  
2747 C C   . MET B 30  ? 0.4894 0.6005 0.5404 -0.0505 -0.0331 0.1526  30  MET B C   
2748 O O   . MET B 30  ? 0.4433 0.5576 0.5146 -0.0389 -0.0245 0.1558  30  MET B O   
2749 C CB  . MET B 30  ? 0.5023 0.6320 0.5529 -0.0643 -0.0472 0.1644  30  MET B CB  
2750 C CG  . MET B 30  ? 0.6286 0.7564 0.6702 -0.0723 -0.0524 0.1603  30  MET B CG  
2751 S SD  . MET B 30  ? 0.6775 0.8321 0.7433 -0.0750 -0.0578 0.1806  30  MET B SD  
2752 C CE  . MET B 30  ? 0.5691 0.7202 0.6568 -0.0559 -0.0443 0.1788  30  MET B CE  
2753 N N   . LEU B 31  ? 0.4674 0.5762 0.5029 -0.0589 -0.0376 0.1544  31  LEU B N   
2754 C CA  . LEU B 31  ? 0.4500 0.5644 0.4938 -0.0549 -0.0339 0.1645  31  LEU B CA  
2755 C C   . LEU B 31  ? 0.4688 0.6087 0.5294 -0.0560 -0.0395 0.1871  31  LEU B C   
2756 O O   . LEU B 31  ? 0.4797 0.6326 0.5418 -0.0630 -0.0483 0.1940  31  LEU B O   
2757 C CB  . LEU B 31  ? 0.4402 0.5433 0.4596 -0.0633 -0.0365 0.1597  31  LEU B CB  
2758 C CG  . LEU B 31  ? 0.4681 0.5469 0.4700 -0.0636 -0.0317 0.1386  31  LEU B CG  
2759 C CD1 . LEU B 31  ? 0.4991 0.5657 0.4773 -0.0713 -0.0325 0.1355  31  LEU B CD1 
2760 C CD2 . LEU B 31  ? 0.4611 0.5317 0.4799 -0.0501 -0.0198 0.1284  31  LEU B CD2 
2761 N N   . GLN B 32  ? 0.4850 0.6326 0.5596 -0.0489 -0.0339 0.1993  32  GLN B N   
2762 C CA  . GLN B 32  ? 0.5812 0.7548 0.6726 -0.0489 -0.0389 0.2232  32  GLN B CA  
2763 C C   . GLN B 32  ? 0.5468 0.7356 0.6226 -0.0644 -0.0554 0.2328  32  GLN B C   
2764 O O   . GLN B 32  ? 0.6108 0.8238 0.7018 -0.0668 -0.0626 0.2501  32  GLN B O   
2765 C CB  . GLN B 32  ? 0.6010 0.7780 0.7058 -0.0391 -0.0295 0.2349  32  GLN B CB  
2766 C CG  . GLN B 32  ? 0.6584 0.8454 0.7949 -0.0258 -0.0188 0.2465  32  GLN B CG  
2767 C CD  . GLN B 32  ? 0.6337 0.8194 0.7837 -0.0150 -0.0061 0.2560  32  GLN B CD  
2768 O OE1 . GLN B 32  ? 0.5311 0.7032 0.6677 -0.0158 -0.0025 0.2488  32  GLN B OE1 
2769 N NE2 . GLN B 32  ? 0.6736 0.8717 0.8510 -0.0044 0.0025  0.2720  32  GLN B NE2 
2770 N N   . ASN B 33  ? 0.5778 0.7527 0.6238 -0.0753 -0.0612 0.2218  33  ASN B N   
2771 C CA  . ASN B 33  ? 0.6321 0.8186 0.6589 -0.0921 -0.0770 0.2281  33  ASN B CA  
2772 C C   . ASN B 33  ? 0.6805 0.8668 0.7011 -0.1025 -0.0846 0.2202  33  ASN B C   
2773 O O   . ASN B 33  ? 0.7466 0.9379 0.7484 -0.1185 -0.0971 0.2210  33  ASN B O   
2774 C CB  . ASN B 33  ? 0.6367 0.8052 0.6309 -0.1002 -0.0786 0.2188  33  ASN B CB  
2775 C CG  . ASN B 33  ? 0.6922 0.8310 0.6676 -0.1016 -0.0722 0.1949  33  ASN B CG  
2776 O OD1 . ASN B 33  ? 0.7103 0.8437 0.6928 -0.0993 -0.0697 0.1854  33  ASN B OD1 
2777 N ND2 . ASN B 33  ? 0.7044 0.8239 0.6564 -0.1042 -0.0685 0.1860  33  ASN B ND2 
2778 N N   . GLY B 34  ? 0.6675 0.8465 0.7024 -0.0939 -0.0766 0.2118  34  GLY B N   
2779 C CA  . GLY B 34  ? 0.6567 0.8340 0.6878 -0.1016 -0.0813 0.2048  34  GLY B CA  
2780 C C   . GLY B 34  ? 0.6333 0.7829 0.6368 -0.1074 -0.0791 0.1829  34  GLY B C   
2781 O O   . GLY B 34  ? 0.6712 0.8161 0.6712 -0.1121 -0.0805 0.1761  34  GLY B O   
2782 N N   . LYS B 35  ? 0.6229 0.7537 0.6077 -0.1066 -0.0746 0.1726  35  LYS B N   
2783 C CA  . LYS B 35  ? 0.6361 0.7410 0.5955 -0.1116 -0.0715 0.1533  35  LYS B CA  
2784 C C   . LYS B 35  ? 0.5705 0.6641 0.5417 -0.0984 -0.0612 0.1418  35  LYS B C   
2785 O O   . LYS B 35  ? 0.4640 0.5579 0.4524 -0.0847 -0.0529 0.1415  35  LYS B O   
2786 C CB  . LYS B 35  ? 0.6742 0.7623 0.6120 -0.1135 -0.0682 0.1465  35  LYS B CB  
2787 C CG  . LYS B 35  ? 0.7988 0.8593 0.7112 -0.1178 -0.0633 0.1276  35  LYS B CG  
2788 N N   . LYS B 36  ? 0.5073 0.5914 0.4688 -0.1030 -0.0618 0.1327  36  LYS B N   
2789 C CA  . LYS B 36  ? 0.5723 0.6461 0.5412 -0.0913 -0.0533 0.1220  36  LYS B CA  
2790 C C   . LYS B 36  ? 0.5027 0.5550 0.4578 -0.0861 -0.0456 0.1067  36  LYS B C   
2791 O O   . LYS B 36  ? 0.5176 0.5569 0.4502 -0.0953 -0.0469 0.1010  36  LYS B O   
2792 C CB  . LYS B 36  ? 0.5195 0.5894 0.4805 -0.0985 -0.0559 0.1186  36  LYS B CB  
2793 C CG  . LYS B 36  ? 0.5899 0.6450 0.5506 -0.0874 -0.0472 0.1059  36  LYS B CG  
2794 C CD  . LYS B 36  ? 0.5927 0.6368 0.5377 -0.0958 -0.0477 0.1001  36  LYS B CD  
2795 C CE  . LYS B 36  ? 0.5230 0.5835 0.4782 -0.1045 -0.0543 0.1121  36  LYS B CE  
2796 N NZ  . LYS B 36  ? 0.5164 0.5642 0.4572 -0.1127 -0.0531 0.1058  36  LYS B NZ  
2797 N N   . PHE B 37  ? 0.4971 0.5463 0.4663 -0.0718 -0.0375 0.1005  37  PHE B N   
2798 C CA  . PHE B 37  ? 0.4109 0.4422 0.3709 -0.0663 -0.0305 0.0860  37  PHE B CA  
2799 C C   . PHE B 37  ? 0.4260 0.4483 0.3863 -0.0577 -0.0255 0.0741  37  PHE B C   
2800 O O   . PHE B 37  ? 0.4703 0.4781 0.4201 -0.0551 -0.0209 0.0623  37  PHE B O   
2801 C CB  . PHE B 37  ? 0.4127 0.4467 0.3868 -0.0582 -0.0250 0.0868  37  PHE B CB  
2802 C CG  . PHE B 37  ? 0.4080 0.4532 0.4076 -0.0462 -0.0208 0.0902  37  PHE B CG  
2803 C CD1 . PHE B 37  ? 0.4231 0.4621 0.4294 -0.0359 -0.0149 0.0784  37  PHE B CD1 
2804 C CD2 . PHE B 37  ? 0.4396 0.5010 0.4556 -0.0454 -0.0222 0.1055  37  PHE B CD2 
2805 C CE1 . PHE B 37  ? 0.3687 0.4157 0.3955 -0.0258 -0.0103 0.0804  37  PHE B CE1 
2806 C CE2 . PHE B 37  ? 0.4678 0.5367 0.5060 -0.0344 -0.0163 0.1085  37  PHE B CE2 
2807 C CZ  . PHE B 37  ? 0.3924 0.4529 0.4348 -0.0250 -0.0102 0.0952  37  PHE B CZ  
2808 N N   . ASP B 38  ? 0.4105 0.4416 0.3828 -0.0525 -0.0260 0.0779  38  ASP B N   
2809 C CA  . ASP B 38  ? 0.3477 0.3713 0.3195 -0.0430 -0.0214 0.0678  38  ASP B CA  
2810 C C   . ASP B 38  ? 0.3446 0.3776 0.3251 -0.0416 -0.0231 0.0757  38  ASP B C   
2811 O O   . ASP B 38  ? 0.3703 0.4178 0.3665 -0.0417 -0.0251 0.0875  38  ASP B O   
2812 C CB  . ASP B 38  ? 0.3233 0.3465 0.3079 -0.0302 -0.0156 0.0598  38  ASP B CB  
2813 C CG  . ASP B 38  ? 0.3660 0.3820 0.3473 -0.0203 -0.0118 0.0481  38  ASP B CG  
2814 O OD1 . ASP B 38  ? 0.3538 0.3616 0.3208 -0.0225 -0.0122 0.0452  38  ASP B OD1 
2815 O OD2 . ASP B 38  ? 0.3500 0.3687 0.3431 -0.0102 -0.0083 0.0420  38  ASP B OD2 
2816 N N   . SER B 39  ? 0.3229 0.3473 0.2938 -0.0397 -0.0212 0.0701  39  SER B N   
2817 C CA  . SER B 39  ? 0.3420 0.3729 0.3196 -0.0384 -0.0214 0.0771  39  SER B CA  
2818 C C   . SER B 39  ? 0.3307 0.3510 0.3007 -0.0291 -0.0160 0.0685  39  SER B C   
2819 O O   . SER B 39  ? 0.3396 0.3466 0.2924 -0.0329 -0.0147 0.0622  39  SER B O   
2820 C CB  . SER B 39  ? 0.3626 0.3957 0.3324 -0.0537 -0.0270 0.0849  39  SER B CB  
2821 O OG  . SER B 39  ? 0.3691 0.4066 0.3461 -0.0516 -0.0256 0.0905  39  SER B OG  
2822 N N   . SER B 40  ? 0.3109 0.3359 0.2923 -0.0166 -0.0122 0.0687  40  SER B N   
2823 C CA  . SER B 40  ? 0.3267 0.3428 0.2997 -0.0070 -0.0074 0.0622  40  SER B CA  
2824 C C   . SER B 40  ? 0.3197 0.3332 0.2874 -0.0135 -0.0069 0.0691  40  SER B C   
2825 O O   . SER B 40  ? 0.3230 0.3259 0.2792 -0.0092 -0.0027 0.0647  40  SER B O   
2826 C CB  . SER B 40  ? 0.2951 0.3165 0.2796 0.0071  -0.0034 0.0610  40  SER B CB  
2827 O OG  . SER B 40  ? 0.2911 0.3231 0.2907 0.0066  -0.0028 0.0733  40  SER B OG  
2828 N N   . ARG B 41  ? 0.3485 0.3728 0.3261 -0.0237 -0.0110 0.0807  41  ARG B N   
2829 C CA  . ARG B 41  ? 0.4033 0.4275 0.3797 -0.0313 -0.0107 0.0878  41  ARG B CA  
2830 C C   . ARG B 41  ? 0.4184 0.4282 0.3742 -0.0430 -0.0114 0.0817  41  ARG B C   
2831 O O   . ARG B 41  ? 0.3859 0.3845 0.3322 -0.0422 -0.0062 0.0795  41  ARG B O   
2832 C CB  . ARG B 41  ? 0.3940 0.4366 0.3887 -0.0403 -0.0162 0.1024  41  ARG B CB  
2833 C CG  . ARG B 41  ? 0.3623 0.4179 0.3787 -0.0288 -0.0130 0.1107  41  ARG B CG  
2834 C CD  . ARG B 41  ? 0.3528 0.4282 0.3886 -0.0379 -0.0183 0.1269  41  ARG B CD  
2835 N NE  . ARG B 41  ? 0.3300 0.4161 0.3874 -0.0264 -0.0128 0.1365  41  ARG B NE  
2836 C CZ  . ARG B 41  ? 0.3063 0.4013 0.3776 -0.0204 -0.0118 0.1412  41  ARG B CZ  
2837 N NH1 . ARG B 41  ? 0.2901 0.3861 0.3572 -0.0245 -0.0164 0.1378  41  ARG B NH1 
2838 N NH2 . ARG B 41  ? 0.3531 0.4548 0.4425 -0.0098 -0.0046 0.1496  41  ARG B NH2 
2839 N N   . ASP B 42  ? 0.4074 0.4156 0.3553 -0.0528 -0.0164 0.0789  42  ASP B N   
2840 C CA  . ASP B 42  ? 0.4383 0.4296 0.3640 -0.0636 -0.0156 0.0718  42  ASP B CA  
2841 C C   . ASP B 42  ? 0.4350 0.4082 0.3468 -0.0529 -0.0071 0.0611  42  ASP B C   
2842 O O   . ASP B 42  ? 0.4585 0.4166 0.3547 -0.0592 -0.0027 0.0578  42  ASP B O   
2843 C CB  . ASP B 42  ? 0.4873 0.4786 0.4057 -0.0732 -0.0210 0.0700  42  ASP B CB  
2844 C CG  . ASP B 42  ? 0.4847 0.4922 0.4110 -0.0871 -0.0302 0.0812  42  ASP B CG  
2845 O OD1 . ASP B 42  ? 0.5222 0.5377 0.4550 -0.0947 -0.0329 0.0890  42  ASP B OD1 
2846 O OD2 . ASP B 42  ? 0.4852 0.4986 0.4123 -0.0902 -0.0347 0.0830  42  ASP B OD2 
2847 N N   . ARG B 43  ? 0.4029 0.3780 0.3207 -0.0370 -0.0042 0.0561  43  ARG B N   
2848 C CA  . ARG B 43  ? 0.3871 0.3486 0.2935 -0.0256 0.0030  0.0477  43  ARG B CA  
2849 C C   . ARG B 43  ? 0.3619 0.3233 0.2711 -0.0144 0.0081  0.0501  43  ARG B C   
2850 O O   . ARG B 43  ? 0.3937 0.3455 0.2937 -0.0036 0.0141  0.0446  43  ARG B O   
2851 C CB  . ARG B 43  ? 0.4981 0.4597 0.4056 -0.0157 0.0033  0.0390  43  ARG B CB  
2852 C CG  . ARG B 43  ? 0.5251 0.5019 0.4498 -0.0109 -0.0011 0.0399  43  ARG B CG  
2853 C CD  . ARG B 43  ? 0.4538 0.4296 0.3796 -0.0020 0.0000  0.0300  43  ARG B CD  
2854 N NE  . ARG B 43  ? 0.3639 0.3528 0.3065 0.0062  -0.0019 0.0298  43  ARG B NE  
2855 C CZ  . ARG B 43  ? 0.3424 0.3404 0.2976 0.0018  -0.0049 0.0336  43  ARG B CZ  
2856 N NH1 . ARG B 43  ? 0.3903 0.3877 0.3433 -0.0104 -0.0077 0.0382  43  ARG B NH1 
2857 N NH2 . ARG B 43  ? 0.3499 0.3570 0.3194 0.0100  -0.0045 0.0326  43  ARG B NH2 
2858 N N   . ASN B 44  ? 0.3776 0.3494 0.2993 -0.0164 0.0065  0.0593  44  ASN B N   
2859 C CA  . ASN B 44  ? 0.3744 0.3459 0.2992 -0.0052 0.0124  0.0627  44  ASN B CA  
2860 C C   . ASN B 44  ? 0.3699 0.3415 0.2938 0.0131  0.0154  0.0564  44  ASN B C   
2861 O O   . ASN B 44  ? 0.3677 0.3321 0.2840 0.0236  0.0217  0.0557  44  ASN B O   
2862 C CB  . ASN B 44  ? 0.3857 0.3426 0.2981 -0.0102 0.0191  0.0641  44  ASN B CB  
2863 C CG  . ASN B 44  ? 0.4095 0.3718 0.3293 -0.0269 0.0161  0.0729  44  ASN B CG  
2864 O OD1 . ASN B 44  ? 0.4558 0.4305 0.3917 -0.0253 0.0152  0.0817  44  ASN B OD1 
2865 N ND2 . ASN B 44  ? 0.4100 0.3641 0.3189 -0.0433 0.0141  0.0708  44  ASN B ND2 
2866 N N   . LYS B 45  ? 0.4116 0.3921 0.3436 0.0170  0.0109  0.0524  45  LYS B N   
2867 C CA  . LYS B 45  ? 0.4497 0.4323 0.3815 0.0330  0.0124  0.0453  45  LYS B CA  
2868 C C   . LYS B 45  ? 0.3419 0.3373 0.2900 0.0360  0.0094  0.0464  45  LYS B C   
2869 O O   . LYS B 45  ? 0.3270 0.3275 0.2822 0.0304  0.0053  0.0441  45  LYS B O   
2870 C CB  . LYS B 45  ? 0.4822 0.4588 0.4042 0.0359  0.0118  0.0348  45  LYS B CB  
2871 C CG  . LYS B 45  ? 0.6631 0.6396 0.5792 0.0525  0.0142  0.0284  45  LYS B CG  
2872 C CD  . LYS B 45  ? 0.8797 0.8568 0.7934 0.0565  0.0121  0.0185  45  LYS B CD  
2873 N N   . PRO B 46  ? 0.3036 0.3025 0.2567 0.0453  0.0129  0.0499  46  PRO B N   
2874 C CA  . PRO B 46  ? 0.3407 0.3489 0.3080 0.0490  0.0122  0.0502  46  PRO B CA  
2875 C C   . PRO B 46  ? 0.3239 0.3340 0.2915 0.0529  0.0093  0.0382  46  PRO B C   
2876 O O   . PRO B 46  ? 0.2922 0.2978 0.2484 0.0583  0.0085  0.0291  46  PRO B O   
2877 C CB  . PRO B 46  ? 0.3465 0.3534 0.3126 0.0610  0.0181  0.0527  46  PRO B CB  
2878 C CG  . PRO B 46  ? 0.3798 0.3796 0.3373 0.0597  0.0216  0.0591  46  PRO B CG  
2879 C CD  . PRO B 46  ? 0.3673 0.3601 0.3124 0.0542  0.0190  0.0531  46  PRO B CD  
2880 N N   . PHE B 47  ? 0.2868 0.3039 0.2686 0.0495  0.0081  0.0392  47  PHE B N   
2881 C CA  . PHE B 47  ? 0.2687 0.2883 0.2551 0.0523  0.0067  0.0284  47  PHE B CA  
2882 C C   . PHE B 47  ? 0.2915 0.3124 0.2812 0.0630  0.0106  0.0237  47  PHE B C   
2883 O O   . PHE B 47  ? 0.2818 0.3039 0.2783 0.0656  0.0153  0.0319  47  PHE B O   
2884 C CB  . PHE B 47  ? 0.3119 0.3366 0.3117 0.0423  0.0050  0.0334  47  PHE B CB  
2885 C CG  . PHE B 47  ? 0.2825 0.3092 0.2905 0.0436  0.0052  0.0240  47  PHE B CG  
2886 C CD1 . PHE B 47  ? 0.3446 0.3688 0.3464 0.0457  0.0029  0.0115  47  PHE B CD1 
2887 C CD2 . PHE B 47  ? 0.3180 0.3494 0.3416 0.0425  0.0084  0.0287  47  PHE B CD2 
2888 C CE1 . PHE B 47  ? 0.3455 0.3720 0.3569 0.0460  0.0035  0.0027  47  PHE B CE1 
2889 C CE2 . PHE B 47  ? 0.3023 0.3341 0.3343 0.0431  0.0101  0.0200  47  PHE B CE2 
2890 C CZ  . PHE B 47  ? 0.3383 0.3679 0.3646 0.0443  0.0074  0.0066  47  PHE B CZ  
2891 N N   . LYS B 48  ? 0.2810 0.3017 0.2657 0.0690  0.0089  0.0104  48  LYS B N   
2892 C CA  . LYS B 48  ? 0.3251 0.3460 0.3090 0.0781  0.0117  0.0030  48  LYS B CA  
2893 C C   . LYS B 48  ? 0.3721 0.3964 0.3657 0.0760  0.0105  -0.0078 48  LYS B C   
2894 O O   . LYS B 48  ? 0.3705 0.3971 0.3651 0.0722  0.0060  -0.0146 48  LYS B O   
2895 C CB  . LYS B 48  ? 0.3388 0.3578 0.3056 0.0878  0.0098  -0.0038 48  LYS B CB  
2896 C CG  . LYS B 48  ? 0.3591 0.3730 0.3158 0.0913  0.0128  0.0063  48  LYS B CG  
2897 C CD  . LYS B 48  ? 0.4113 0.4233 0.3503 0.1026  0.0118  0.0001  48  LYS B CD  
2898 C CE  . LYS B 48  ? 0.4813 0.4865 0.4106 0.1073  0.0170  0.0107  48  LYS B CE  
2899 N NZ  . LYS B 48  ? 0.5367 0.5400 0.4479 0.1206  0.0173  0.0057  48  LYS B NZ  
2900 N N   . PHE B 49  ? 0.3354 0.3588 0.3367 0.0784  0.0159  -0.0095 49  PHE B N   
2901 C CA  . PHE B 49  ? 0.3255 0.3504 0.3365 0.0764  0.0167  -0.0210 49  PHE B CA  
2902 C C   . PHE B 49  ? 0.3802 0.4006 0.3892 0.0829  0.0229  -0.0269 49  PHE B C   
2903 O O   . PHE B 49  ? 0.3450 0.3610 0.3518 0.0872  0.0291  -0.0177 49  PHE B O   
2904 C CB  . PHE B 49  ? 0.3185 0.3449 0.3466 0.0675  0.0191  -0.0142 49  PHE B CB  
2905 C CG  . PHE B 49  ? 0.3238 0.3489 0.3619 0.0670  0.0263  0.0000  49  PHE B CG  
2906 C CD1 . PHE B 49  ? 0.3668 0.3942 0.4045 0.0645  0.0253  0.0151  49  PHE B CD1 
2907 C CD2 . PHE B 49  ? 0.2958 0.3178 0.3451 0.0688  0.0348  -0.0015 49  PHE B CD2 
2908 C CE1 . PHE B 49  ? 0.3109 0.3401 0.3607 0.0642  0.0315  0.0297  49  PHE B CE1 
2909 C CE2 . PHE B 49  ? 0.2935 0.3152 0.3539 0.0696  0.0426  0.0131  49  PHE B CE2 
2910 C CZ  . PHE B 49  ? 0.2859 0.3125 0.3474 0.0675  0.0405  0.0292  49  PHE B CZ  
2911 N N   . ARG B 50  ? 0.4120 0.4333 0.4212 0.0834  0.0216  -0.0427 50  ARG B N   
2912 C CA  . ARG B 50  ? 0.3964 0.4120 0.3992 0.0888  0.0268  -0.0518 50  ARG B CA  
2913 C C   . ARG B 50  ? 0.3813 0.3911 0.4006 0.0846  0.0370  -0.0511 50  ARG B C   
2914 O O   . ARG B 50  ? 0.3087 0.3210 0.3424 0.0776  0.0370  -0.0551 50  ARG B O   
2915 C CB  . ARG B 50  ? 0.5213 0.5419 0.5142 0.0908  0.0192  -0.0700 50  ARG B CB  
2916 C CG  . ARG B 50  ? 0.7794 0.7984 0.7500 0.1006  0.0170  -0.0741 50  ARG B CG  
2917 C CD  . ARG B 50  ? 0.9531 0.9825 0.9120 0.1043  0.0054  -0.0817 50  ARG B CD  
2918 N NE  . ARG B 50  ? 1.2378 1.2763 1.2033 0.0998  -0.0012 -0.0982 50  ARG B NE  
2919 C CZ  . ARG B 50  ? 0.9128 0.9598 0.8923 0.0937  -0.0063 -0.1005 50  ARG B CZ  
2920 N NH1 . ARG B 50  ? 0.8452 0.8914 0.8317 0.0907  -0.0056 -0.0881 50  ARG B NH1 
2921 N NH2 . ARG B 50  ? 0.8390 0.8950 0.8257 0.0899  -0.0119 -0.1157 50  ARG B NH2 
2922 N N   . ILE B 51  ? 0.3437 0.3449 0.3614 0.0893  0.0470  -0.0452 51  ILE B N   
2923 C CA  . ILE B 51  ? 0.3725 0.3666 0.4057 0.0869  0.0591  -0.0429 51  ILE B CA  
2924 C C   . ILE B 51  ? 0.4074 0.3980 0.4419 0.0833  0.0602  -0.0630 51  ILE B C   
2925 O O   . ILE B 51  ? 0.3875 0.3766 0.4059 0.0862  0.0563  -0.0780 51  ILE B O   
2926 C CB  . ILE B 51  ? 0.3992 0.3832 0.4285 0.0940  0.0709  -0.0340 51  ILE B CB  
2927 C CG1 . ILE B 51  ? 0.4029 0.3919 0.4356 0.0961  0.0704  -0.0132 51  ILE B CG1 
2928 C CG2 . ILE B 51  ? 0.4370 0.4118 0.4820 0.0925  0.0854  -0.0328 51  ILE B CG2 
2929 C CD1 . ILE B 51  ? 0.4320 0.4287 0.4859 0.0893  0.0706  0.0015  51  ILE B CD1 
2930 N N   . GLY B 52  ? 0.4031 0.3935 0.4565 0.0766  0.0648  -0.0633 52  GLY B N   
2931 C CA  . GLY B 52  ? 0.3924 0.3784 0.4509 0.0718  0.0682  -0.0820 52  GLY B CA  
2932 C C   . GLY B 52  ? 0.4524 0.4494 0.5117 0.0665  0.0557  -0.0954 52  GLY B C   
2933 O O   . GLY B 52  ? 0.4038 0.3995 0.4682 0.0616  0.0568  -0.1117 52  GLY B O   
2934 N N   . LYS B 53  ? 0.3682 0.3758 0.4233 0.0671  0.0444  -0.0889 53  LYS B N   
2935 C CA  . LYS B 53  ? 0.3591 0.3773 0.4156 0.0633  0.0336  -0.1003 53  LYS B CA  
2936 C C   . LYS B 53  ? 0.3376 0.3593 0.4109 0.0569  0.0337  -0.0934 53  LYS B C   
2937 O O   . LYS B 53  ? 0.3513 0.3813 0.4272 0.0541  0.0258  -0.0999 53  LYS B O   
2938 C CB  . LYS B 53  ? 0.3823 0.4087 0.4207 0.0692  0.0219  -0.0997 53  LYS B CB  
2939 C CG  . LYS B 53  ? 0.4911 0.5157 0.5104 0.0760  0.0200  -0.1091 53  LYS B CG  
2940 C CD  . LYS B 53  ? 0.5985 0.6287 0.6182 0.0725  0.0150  -0.1301 53  LYS B CD  
2941 C CE  . LYS B 53  ? 0.7894 0.8198 0.7864 0.0792  0.0107  -0.1397 53  LYS B CE  
2942 N NZ  . LYS B 53  ? 0.9239 0.9574 0.9216 0.0738  0.0080  -0.1609 53  LYS B NZ  
2943 N N   . GLN B 54  ? 0.3289 0.3446 0.4128 0.0553  0.0427  -0.0792 54  GLN B N   
2944 C CA  . GLN B 54  ? 0.3876 0.4051 0.4859 0.0494  0.0442  -0.0714 54  GLN B CA  
2945 C C   . GLN B 54  ? 0.4259 0.4510 0.5171 0.0482  0.0337  -0.0659 54  GLN B C   
2946 O O   . GLN B 54  ? 0.4391 0.4672 0.5377 0.0435  0.0314  -0.0693 54  GLN B O   
2947 C CB  . GLN B 54  ? 0.4449 0.4609 0.5583 0.0437  0.0487  -0.0854 54  GLN B CB  
2948 C CG  . GLN B 54  ? 0.6142 0.6199 0.7345 0.0438  0.0612  -0.0920 54  GLN B CG  
2949 C CD  . GLN B 54  ? 0.7796 0.7832 0.9149 0.0372  0.0658  -0.1075 54  GLN B CD  
2950 O OE1 . GLN B 54  ? 0.9020 0.9064 1.0342 0.0354  0.0634  -0.1257 54  GLN B OE1 
2951 N NE2 . GLN B 54  ? 0.7610 0.7627 0.9125 0.0332  0.0723  -0.1004 54  GLN B NE2 
2952 N N   . GLU B 55  ? 0.3631 0.3897 0.4398 0.0527  0.0288  -0.0575 55  GLU B N   
2953 C CA  . GLU B 55  ? 0.4024 0.4339 0.4691 0.0523  0.0198  -0.0538 55  GLU B CA  
2954 C C   . GLU B 55  ? 0.3690 0.3993 0.4367 0.0484  0.0206  -0.0367 55  GLU B C   
2955 O O   . GLU B 55  ? 0.3540 0.3857 0.4114 0.0474  0.0148  -0.0316 55  GLU B O   
2956 C CB  . GLU B 55  ? 0.3585 0.3915 0.4076 0.0596  0.0146  -0.0551 55  GLU B CB  
2957 C CG  . GLU B 55  ? 0.3866 0.4235 0.4312 0.0633  0.0108  -0.0720 55  GLU B CG  
2958 C CD  . GLU B 55  ? 0.3490 0.3881 0.3745 0.0715  0.0052  -0.0730 55  GLU B CD  
2959 O OE1 . GLU B 55  ? 0.3611 0.3959 0.3773 0.0753  0.0073  -0.0615 55  GLU B OE1 
2960 O OE2 . GLU B 55  ? 0.3457 0.3918 0.3667 0.0741  -0.0010 -0.0854 55  GLU B OE2 
2961 N N   . VAL B 56  ? 0.3184 0.3462 0.3980 0.0463  0.0282  -0.0275 56  VAL B N   
2962 C CA  . VAL B 56  ? 0.3058 0.3349 0.3881 0.0420  0.0286  -0.0104 56  VAL B CA  
2963 C C   . VAL B 56  ? 0.3345 0.3618 0.4342 0.0395  0.0375  -0.0052 56  VAL B C   
2964 O O   . VAL B 56  ? 0.3771 0.4005 0.4857 0.0423  0.0452  -0.0124 56  VAL B O   
2965 C CB  . VAL B 56  ? 0.3252 0.3557 0.4002 0.0452  0.0277  0.0019  56  VAL B CB  
2966 C CG1 . VAL B 56  ? 0.3584 0.3867 0.4426 0.0503  0.0369  0.0067  56  VAL B CG1 
2967 C CG2 . VAL B 56  ? 0.3335 0.3679 0.4076 0.0389  0.0239  0.0174  56  VAL B CG2 
2968 N N   . ILE B 57  ? 0.3051 0.3346 0.4087 0.0341  0.0370  0.0068  57  ILE B N   
2969 C CA  . ILE B 57  ? 0.3659 0.3945 0.4858 0.0331  0.0462  0.0152  57  ILE B CA  
2970 C C   . ILE B 57  ? 0.3892 0.4168 0.5186 0.0388  0.0552  0.0226  57  ILE B C   
2971 O O   . ILE B 57  ? 0.3501 0.3809 0.4746 0.0420  0.0533  0.0309  57  ILE B O   
2972 C CB  . ILE B 57  ? 0.3546 0.3875 0.4745 0.0272  0.0434  0.0309  57  ILE B CB  
2973 C CG1 . ILE B 57  ? 0.4144 0.4542 0.5246 0.0255  0.0357  0.0441  57  ILE B CG1 
2974 C CG2 . ILE B 57  ? 0.3482 0.3781 0.4618 0.0219  0.0393  0.0227  57  ILE B CG2 
2975 C CD1 . ILE B 57  ? 0.4173 0.4638 0.5303 0.0199  0.0337  0.0620  57  ILE B CD1 
2976 N N   . LYS B 58  ? 0.3570 0.3791 0.5007 0.0402  0.0665  0.0197  58  LYS B N   
2977 C CA  . LYS B 58  ? 0.4107 0.4280 0.5640 0.0461  0.0783  0.0234  58  LYS B CA  
2978 C C   . LYS B 58  ? 0.3525 0.3769 0.5097 0.0489  0.0793  0.0451  58  LYS B C   
2979 O O   . LYS B 58  ? 0.3638 0.3862 0.5201 0.0545  0.0836  0.0479  58  LYS B O   
2980 C CB  . LYS B 58  ? 0.4593 0.4691 0.6294 0.0458  0.0918  0.0210  58  LYS B CB  
2981 C CG  . LYS B 58  ? 0.6446 0.6445 0.8235 0.0515  0.1068  0.0191  58  LYS B CG  
2982 N N   . GLY B 59  ? 0.3226 0.3556 0.4840 0.0450  0.0754  0.0609  59  GLY B N   
2983 C CA  . GLY B 59  ? 0.3516 0.3949 0.5197 0.0468  0.0754  0.0828  59  GLY B CA  
2984 C C   . GLY B 59  ? 0.3538 0.4017 0.5105 0.0475  0.0671  0.0845  59  GLY B C   
2985 O O   . GLY B 59  ? 0.3528 0.4045 0.5167 0.0523  0.0718  0.0968  59  GLY B O   
2986 N N   . PHE B 60  ? 0.3571 0.4040 0.4967 0.0431  0.0560  0.0731  60  PHE B N   
2987 C CA  . PHE B 60  ? 0.3338 0.3840 0.4614 0.0434  0.0484  0.0746  60  PHE B CA  
2988 C C   . PHE B 60  ? 0.3039 0.3466 0.4292 0.0519  0.0554  0.0671  60  PHE B C   
2989 O O   . PHE B 60  ? 0.3181 0.3639 0.4451 0.0554  0.0572  0.0774  60  PHE B O   
2990 C CB  . PHE B 60  ? 0.3470 0.3953 0.4569 0.0378  0.0374  0.0633  60  PHE B CB  
2991 C CG  . PHE B 60  ? 0.3717 0.4231 0.4694 0.0365  0.0299  0.0670  60  PHE B CG  
2992 C CD1 . PHE B 60  ? 0.3724 0.4185 0.4610 0.0432  0.0311  0.0589  60  PHE B CD1 
2993 C CD2 . PHE B 60  ? 0.3842 0.4425 0.4778 0.0283  0.0221  0.0778  60  PHE B CD2 
2994 C CE1 . PHE B 60  ? 0.4269 0.4745 0.5046 0.0424  0.0257  0.0627  60  PHE B CE1 
2995 C CE2 . PHE B 60  ? 0.3954 0.4550 0.4781 0.0261  0.0164  0.0805  60  PHE B CE2 
2996 C CZ  . PHE B 60  ? 0.3569 0.4108 0.4323 0.0335  0.0188  0.0732  60  PHE B CZ  
2997 N N   . GLU B 61  ? 0.3011 0.3341 0.4232 0.0548  0.0598  0.0495  61  GLU B N   
2998 C CA  . GLU B 61  ? 0.3453 0.3697 0.4622 0.0622  0.0664  0.0400  61  GLU B CA  
2999 C C   . GLU B 61  ? 0.4162 0.4371 0.5473 0.0680  0.0806  0.0515  61  GLU B C   
3000 O O   . GLU B 61  ? 0.4233 0.4397 0.5500 0.0745  0.0858  0.0532  61  GLU B O   
3001 C CB  . GLU B 61  ? 0.3199 0.3363 0.4310 0.0621  0.0670  0.0178  61  GLU B CB  
3002 C CG  . GLU B 61  ? 0.3334 0.3407 0.4354 0.0692  0.0729  0.0071  61  GLU B CG  
3003 C CD  . GLU B 61  ? 0.3877 0.3903 0.4803 0.0685  0.0697  -0.0157 61  GLU B CD  
3004 O OE1 . GLU B 61  ? 0.3764 0.3831 0.4709 0.0629  0.0630  -0.0246 61  GLU B OE1 
3005 O OE2 . GLU B 61  ? 0.3792 0.3741 0.4622 0.0736  0.0742  -0.0249 61  GLU B OE2 
3006 N N   . GLU B 62  ? 0.4111 0.4333 0.5592 0.0665  0.0879  0.0600  62  GLU B N   
3007 C CA  . GLU B 62  ? 0.4217 0.4405 0.5855 0.0726  0.1031  0.0727  62  GLU B CA  
3008 C C   . GLU B 62  ? 0.3932 0.4228 0.5639 0.0752  0.1024  0.0943  62  GLU B C   
3009 O O   . GLU B 62  ? 0.3702 0.3951 0.5473 0.0827  0.1141  0.1018  62  GLU B O   
3010 C CB  . GLU B 62  ? 0.4605 0.4793 0.6419 0.0710  0.1115  0.0794  62  GLU B CB  
3011 C CG  . GLU B 62  ? 0.6444 0.6480 0.8256 0.0711  0.1209  0.0598  62  GLU B CG  
3012 C CD  . GLU B 62  ? 0.7415 0.7435 0.9392 0.0690  0.1296  0.0647  62  GLU B CD  
3013 O OE1 . GLU B 62  ? 0.5334 0.5465 0.7426 0.0685  0.1289  0.0850  62  GLU B OE1 
3014 O OE2 . GLU B 62  ? 0.6166 0.6063 0.8154 0.0676  0.1371  0.0479  62  GLU B OE2 
3015 N N   . GLY B 63  ? 0.3144 0.3582 0.4850 0.0688  0.0898  0.1047  63  GLY B N   
3016 C CA  . GLY B 63  ? 0.3275 0.3842 0.5045 0.0689  0.0863  0.1240  63  GLY B CA  
3017 C C   . GLY B 63  ? 0.3637 0.4156 0.5268 0.0725  0.0842  0.1180  63  GLY B C   
3018 O O   . GLY B 63  ? 0.3814 0.4340 0.5523 0.0787  0.0922  0.1291  63  GLY B O   
3019 N N   . ALA B 64  ? 0.3561 0.4027 0.4989 0.0695  0.0747  0.1009  64  ALA B N   
3020 C CA  . ALA B 64  ? 0.3124 0.3534 0.4398 0.0739  0.0731  0.0947  64  ALA B CA  
3021 C C   . ALA B 64  ? 0.3819 0.4101 0.5082 0.0841  0.0869  0.0897  64  ALA B C   
3022 O O   . ALA B 64  ? 0.4094 0.4352 0.5319 0.0898  0.0909  0.0953  64  ALA B O   
3023 C CB  . ALA B 64  ? 0.3109 0.3477 0.4175 0.0708  0.0623  0.0767  64  ALA B CB  
3024 N N   . ALA B 65  ? 0.3655 0.3841 0.4944 0.0861  0.0952  0.0792  65  ALA B N   
3025 C CA  . ALA B 65  ? 0.3663 0.3696 0.4902 0.0945  0.1088  0.0714  65  ALA B CA  
3026 C C   . ALA B 65  ? 0.3896 0.3925 0.5302 0.1012  0.1232  0.0909  65  ALA B C   
3027 O O   . ALA B 65  ? 0.3940 0.3837 0.5286 0.1091  0.1354  0.0881  65  ALA B O   
3028 C CB  . ALA B 65  ? 0.4236 0.4165 0.5477 0.0931  0.1145  0.0550  65  ALA B CB  
3029 N N   . GLN B 66  ? 0.3595 0.3769 0.5206 0.0980  0.1221  0.1109  66  GLN B N   
3030 C CA  . GLN B 66  ? 0.3832 0.4057 0.5642 0.1038  0.1338  0.1331  66  GLN B CA  
3031 C C   . GLN B 66  ? 0.4468 0.4802 0.6285 0.1042  0.1278  0.1464  66  GLN B C   
3032 O O   . GLN B 66  ? 0.4282 0.4658 0.6261 0.1098  0.1378  0.1644  66  GLN B O   
3033 C CB  . GLN B 66  ? 0.3828 0.4185 0.5873 0.1005  0.1351  0.1497  66  GLN B CB  
3034 C CG  . GLN B 66  ? 0.3814 0.4043 0.5911 0.1025  0.1474  0.1413  66  GLN B CG  
3035 C CD  . GLN B 66  ? 0.4066 0.4427 0.6363 0.0991  0.1469  0.1567  66  GLN B CD  
3036 O OE1 . GLN B 66  ? 0.4512 0.4887 0.6764 0.0923  0.1389  0.1478  66  GLN B OE1 
3037 N NE2 . GLN B 66  ? 0.4246 0.4712 0.6763 0.1040  0.1553  0.1808  66  GLN B NE2 
3038 N N   . MET B 67  ? 0.4689 0.5066 0.6343 0.0982  0.1126  0.1381  67  MET B N   
3039 C CA  . MET B 67  ? 0.4062 0.4528 0.5714 0.0973  0.1071  0.1490  67  MET B CA  
3040 C C   . MET B 67  ? 0.3794 0.4108 0.5274 0.1061  0.1142  0.1403  67  MET B C   
3041 O O   . MET B 67  ? 0.3633 0.3799 0.4913 0.1095  0.1154  0.1209  67  MET B O   
3042 C CB  . MET B 67  ? 0.4134 0.4699 0.5691 0.0865  0.0892  0.1449  67  MET B CB  
3043 C CG  . MET B 67  ? 0.3984 0.4705 0.5689 0.0773  0.0816  0.1553  67  MET B CG  
3044 S SD  . MET B 67  ? 0.3616 0.4403 0.5162 0.0641  0.0623  0.1473  67  MET B SD  
3045 C CE  . MET B 67  ? 0.3741 0.4586 0.5263 0.0622  0.0584  0.1567  67  MET B CE  
3046 N N   . SER B 68  ? 0.3973 0.4328 0.5535 0.1099  0.1193  0.1553  68  SER B N   
3047 C CA  . SER B 68  ? 0.3766 0.3983 0.5150 0.1183  0.1256  0.1490  68  SER B CA  
3048 C C   . SER B 68  ? 0.3427 0.3693 0.4677 0.1133  0.1128  0.1463  68  SER B C   
3049 O O   . SER B 68  ? 0.3430 0.3845 0.4766 0.1034  0.1015  0.1537  68  SER B O   
3050 C CB  . SER B 68  ? 0.3780 0.3979 0.5330 0.1272  0.1422  0.1669  68  SER B CB  
3051 O OG  . SER B 68  ? 0.3400 0.3805 0.5191 0.1216  0.1378  0.1883  68  SER B OG  
3052 N N   . LEU B 69  ? 0.3635 0.3761 0.4659 0.1205  0.1157  0.1358  69  LEU B N   
3053 C CA  . LEU B 69  ? 0.3846 0.3981 0.4712 0.1177  0.1059  0.1314  69  LEU B CA  
3054 C C   . LEU B 69  ? 0.3869 0.4147 0.4911 0.1109  0.1028  0.1500  69  LEU B C   
3055 O O   . LEU B 69  ? 0.3205 0.3513 0.4417 0.1152  0.1132  0.1660  69  LEU B O   
3056 C CB  . LEU B 69  ? 0.4181 0.4146 0.4815 0.1294  0.1138  0.1224  69  LEU B CB  
3057 C CG  . LEU B 69  ? 0.4299 0.4235 0.4752 0.1303  0.1080  0.1188  69  LEU B CG  
3058 C CD1 . LEU B 69  ? 0.4931 0.4899 0.5251 0.1233  0.0933  0.1043  69  LEU B CD1 
3059 C CD2 . LEU B 69  ? 0.4612 0.4376 0.4844 0.1439  0.1183  0.1120  69  LEU B CD2 
3060 N N   . GLY B 70  ? 0.3085 0.3454 0.4101 0.0997  0.0888  0.1479  70  GLY B N   
3061 C CA  . GLY B 70  ? 0.3159 0.3665 0.4322 0.0905  0.0840  0.1629  70  GLY B CA  
3062 C C   . GLY B 70  ? 0.3519 0.4219 0.4937 0.0806  0.0787  0.1770  70  GLY B C   
3063 O O   . GLY B 70  ? 0.3397 0.4236 0.4932 0.0703  0.0717  0.1881  70  GLY B O   
3064 N N   . GLN B 71  ? 0.3670 0.4383 0.5175 0.0834  0.0820  0.1768  71  GLN B N   
3065 C CA  . GLN B 71  ? 0.3404 0.4306 0.5152 0.0758  0.0780  0.1916  71  GLN B CA  
3066 C C   . GLN B 71  ? 0.3278 0.4260 0.4953 0.0623  0.0621  0.1861  71  GLN B C   
3067 O O   . GLN B 71  ? 0.3017 0.3887 0.4468 0.0607  0.0563  0.1686  71  GLN B O   
3068 C CB  . GLN B 71  ? 0.3926 0.4788 0.5766 0.0834  0.0877  0.1916  71  GLN B CB  
3069 C CG  . GLN B 71  ? 0.3402 0.4456 0.5507 0.0785  0.0863  0.2095  71  GLN B CG  
3070 C CD  . GLN B 71  ? 0.3946 0.4927 0.6144 0.0877  0.0996  0.2102  71  GLN B CD  
3071 O OE1 . GLN B 71  ? 0.4130 0.4913 0.6194 0.0968  0.1101  0.1969  71  GLN B OE1 
3072 N NE2 . GLN B 71  ? 0.4322 0.5459 0.6746 0.0853  0.0999  0.2261  71  GLN B NE2 
3073 N N   . ARG B 72  ? 0.3048 0.4229 0.4910 0.0525  0.0550  0.2016  72  ARG B N   
3074 C CA  . ARG B 72  ? 0.3240 0.4496 0.5034 0.0396  0.0409  0.1978  72  ARG B CA  
3075 C C   . ARG B 72  ? 0.3442 0.4853 0.5444 0.0381  0.0406  0.2114  72  ARG B C   
3076 O O   . ARG B 72  ? 0.3329 0.4875 0.5576 0.0417  0.0466  0.2299  72  ARG B O   
3077 C CB  . ARG B 72  ? 0.3648 0.5001 0.5431 0.0269  0.0309  0.2034  72  ARG B CB  
3078 C CG  . ARG B 72  ? 0.3759 0.5174 0.5445 0.0123  0.0167  0.1994  72  ARG B CG  
3079 C CD  . ARG B 72  ? 0.3842 0.5346 0.5524 -0.0011 0.0080  0.2052  72  ARG B CD  
3080 N NE  . ARG B 72  ? 0.4728 0.6275 0.6292 -0.0159 -0.0049 0.2013  72  ARG B NE  
3081 C CZ  . ARG B 72  ? 0.6173 0.7836 0.7747 -0.0315 -0.0149 0.2076  72  ARG B CZ  
3082 N NH1 . ARG B 72  ? 0.7840 0.9598 0.9560 -0.0346 -0.0134 0.2183  72  ARG B NH1 
3083 N NH2 . ARG B 72  ? 0.5799 0.7476 0.7232 -0.0445 -0.0258 0.2028  72  ARG B NH2 
3084 N N   . ALA B 73  ? 0.3206 0.4592 0.5118 0.0340  0.0349  0.2028  73  ALA B N   
3085 C CA  . ALA B 73  ? 0.3456 0.4957 0.5542 0.0347  0.0367  0.2145  73  ALA B CA  
3086 C C   . ALA B 73  ? 0.3031 0.4542 0.4997 0.0253  0.0261  0.2074  73  ALA B C   
3087 O O   . ALA B 73  ? 0.2886 0.4264 0.4624 0.0213  0.0208  0.1895  73  ALA B O   
3088 C CB  . ALA B 73  ? 0.3512 0.4886 0.5660 0.0487  0.0525  0.2109  73  ALA B CB  
3089 N N   . LYS B 74  ? 0.3541 0.5213 0.5668 0.0226  0.0240  0.2227  74  LYS B N   
3090 C CA  . LYS B 74  ? 0.3791 0.5480 0.5828 0.0151  0.0161  0.2193  74  LYS B CA  
3091 C C   . LYS B 74  ? 0.4110 0.5679 0.6181 0.0251  0.0278  0.2130  74  LYS B C   
3092 O O   . LYS B 74  ? 0.4078 0.5696 0.6356 0.0341  0.0390  0.2258  74  LYS B O   
3093 C CB  . LYS B 74  ? 0.4681 0.6627 0.6869 0.0068  0.0070  0.2410  74  LYS B CB  
3094 C CG  . LYS B 74  ? 0.6147 0.8125 0.8199 -0.0033 -0.0036 0.2389  74  LYS B CG  
3095 C CD  . LYS B 74  ? 0.7682 0.9922 0.9815 -0.0152 -0.0170 0.2578  74  LYS B CD  
3096 C CE  . LYS B 74  ? 0.7874 1.0331 1.0291 -0.0085 -0.0126 0.2821  74  LYS B CE  
3097 N NZ  . LYS B 74  ? 0.8541 1.1019 1.0923 -0.0086 -0.0137 0.2860  74  LYS B NZ  
3098 N N   . LEU B 75  ? 0.3944 0.5348 0.5822 0.0237  0.0266  0.1932  75  LEU B N   
3099 C CA  . LEU B 75  ? 0.3570 0.4858 0.5474 0.0307  0.0367  0.1852  75  LEU B CA  
3100 C C   . LEU B 75  ? 0.3734 0.5066 0.5600 0.0236  0.0306  0.1876  75  LEU B C   
3101 O O   . LEU B 75  ? 0.4033 0.5326 0.5710 0.0147  0.0204  0.1776  75  LEU B O   
3102 C CB  . LEU B 75  ? 0.3328 0.4407 0.5060 0.0344  0.0401  0.1608  75  LEU B CB  
3103 C CG  . LEU B 75  ? 0.3940 0.4945 0.5613 0.0400  0.0433  0.1540  75  LEU B CG  
3104 C CD1 . LEU B 75  ? 0.3733 0.4560 0.5235 0.0433  0.0452  0.1303  75  LEU B CD1 
3105 C CD2 . LEU B 75  ? 0.4036 0.5065 0.5899 0.0497  0.0561  0.1665  75  LEU B CD2 
3106 N N   . THR B 76  ? 0.3705 0.5101 0.5744 0.0284  0.0383  0.2008  76  THR B N   
3107 C CA  . THR B 76  ? 0.3974 0.5394 0.5982 0.0238  0.0352  0.2038  76  THR B CA  
3108 C C   . THR B 76  ? 0.4168 0.5403 0.6181 0.0306  0.0480  0.1895  76  THR B C   
3109 O O   . THR B 76  ? 0.4209 0.5393 0.6378 0.0404  0.0622  0.1921  76  THR B O   
3110 C CB  . THR B 76  ? 0.4464 0.6099 0.6665 0.0246  0.0350  0.2304  76  THR B CB  
3111 O OG1 . THR B 76  ? 0.4040 0.5867 0.6259 0.0173  0.0226  0.2431  76  THR B OG1 
3112 C CG2 . THR B 76  ? 0.4505 0.6161 0.6647 0.0203  0.0317  0.2341  76  THR B CG2 
3113 N N   . CYS B 77  ? 0.3780 0.4906 0.5625 0.0251  0.0435  0.1737  77  CYS B N   
3114 C CA  . CYS B 77  ? 0.4062 0.5014 0.5903 0.0295  0.0539  0.1570  77  CYS B CA  
3115 C C   . CYS B 77  ? 0.4238 0.5183 0.6077 0.0266  0.0552  0.1609  77  CYS B C   
3116 O O   . CYS B 77  ? 0.4079 0.5044 0.5762 0.0181  0.0444  0.1594  77  CYS B O   
3117 C CB  . CYS B 77  ? 0.4106 0.4927 0.5761 0.0266  0.0487  0.1333  77  CYS B CB  
3118 S SG  . CYS B 77  ? 0.4464 0.5262 0.6084 0.0313  0.0482  0.1267  77  CYS B SG  
3119 N N   . THR B 78  ? 0.3819 0.4721 0.5823 0.0338  0.0696  0.1659  78  THR B N   
3120 C CA  . THR B 78  ? 0.4181 0.5053 0.6195 0.0326  0.0738  0.1692  78  THR B CA  
3121 C C   . THR B 78  ? 0.4196 0.4901 0.6087 0.0291  0.0741  0.1456  78  THR B C   
3122 O O   . THR B 78  ? 0.4516 0.5129 0.6371 0.0301  0.0749  0.1276  78  THR B O   
3123 C CB  . THR B 78  ? 0.3874 0.4720 0.6113 0.0423  0.0920  0.1805  78  THR B CB  
3124 O OG1 . THR B 78  ? 0.3865 0.4558 0.6178 0.0480  0.1046  0.1648  78  THR B OG1 
3125 C CG2 . THR B 78  ? 0.3243 0.4272 0.5632 0.0469  0.0927  0.2066  78  THR B CG2 
3126 N N   . PRO B 79  ? 0.4295 0.4965 0.6127 0.0254  0.0740  0.1459  79  PRO B N   
3127 C CA  . PRO B 79  ? 0.3880 0.4409 0.5605 0.0215  0.0737  0.1247  79  PRO B CA  
3128 C C   . PRO B 79  ? 0.3948 0.4344 0.5793 0.0265  0.0863  0.1075  79  PRO B C   
3129 O O   . PRO B 79  ? 0.4391 0.4703 0.6162 0.0237  0.0836  0.0879  79  PRO B O   
3130 C CB  . PRO B 79  ? 0.4032 0.4543 0.5716 0.0187  0.0757  0.1324  79  PRO B CB  
3131 C CG  . PRO B 79  ? 0.4172 0.4820 0.5939 0.0216  0.0768  0.1575  79  PRO B CG  
3132 C CD  . PRO B 79  ? 0.3855 0.4630 0.5694 0.0241  0.0724  0.1667  79  PRO B CD  
3133 N N   . ASP B 80  ? 0.3880 0.4256 0.5912 0.0336  0.1004  0.1146  80  ASP B N   
3134 C CA  . ASP B 80  ? 0.3984 0.4220 0.6127 0.0370  0.1134  0.0974  80  ASP B CA  
3135 C C   . ASP B 80  ? 0.4223 0.4437 0.6315 0.0379  0.1093  0.0825  80  ASP B C   
3136 O O   . ASP B 80  ? 0.3604 0.3711 0.5728 0.0382  0.1153  0.0635  80  ASP B O   
3137 C CB  . ASP B 80  ? 0.5535 0.5725 0.7885 0.0442  0.1321  0.1092  80  ASP B CB  
3138 C CG  . ASP B 80  ? 0.6948 0.7208 0.9384 0.0507  0.1360  0.1238  80  ASP B CG  
3139 O OD1 . ASP B 80  ? 0.8339 0.8752 1.0721 0.0499  0.1246  0.1395  80  ASP B OD1 
3140 O OD2 . ASP B 80  ? 1.0275 1.0433 1.2835 0.0563  0.1509  0.1193  80  ASP B OD2 
3141 N N   . VAL B 81  ? 0.3702 0.4018 0.5713 0.0382  0.0991  0.0908  81  VAL B N   
3142 C CA  . VAL B 81  ? 0.3510 0.3806 0.5426 0.0387  0.0931  0.0766  81  VAL B CA  
3143 C C   . VAL B 81  ? 0.3564 0.3918 0.5285 0.0328  0.0763  0.0723  81  VAL B C   
3144 O O   . VAL B 81  ? 0.3411 0.3782 0.5044 0.0340  0.0701  0.0674  81  VAL B O   
3145 C CB  . VAL B 81  ? 0.3320 0.3646 0.5306 0.0453  0.0986  0.0868  81  VAL B CB  
3146 C CG1 . VAL B 81  ? 0.3595 0.3814 0.5750 0.0515  0.1174  0.0862  81  VAL B CG1 
3147 C CG2 . VAL B 81  ? 0.2925 0.3405 0.4935 0.0451  0.0926  0.1109  81  VAL B CG2 
3148 N N   . ALA B 82  ? 0.3059 0.3429 0.4707 0.0268  0.0703  0.0744  82  ALA B N   
3149 C CA  . ALA B 82  ? 0.3096 0.3485 0.4555 0.0208  0.0569  0.0690  82  ALA B CA  
3150 C C   . ALA B 82  ? 0.2948 0.3255 0.4359 0.0169  0.0571  0.0558  82  ALA B C   
3151 O O   . ALA B 82  ? 0.3257 0.3496 0.4728 0.0190  0.0622  0.0399  82  ALA B O   
3152 C CB  . ALA B 82  ? 0.3287 0.3785 0.4671 0.0162  0.0480  0.0873  82  ALA B CB  
3153 N N   . TYR B 83  ? 0.3317 0.3629 0.4625 0.0111  0.0521  0.0621  83  TYR B N   
3154 C CA  . TYR B 83  ? 0.3469 0.3693 0.4721 0.0077  0.0529  0.0499  83  TYR B CA  
3155 C C   . TYR B 83  ? 0.3884 0.4057 0.5240 0.0077  0.0634  0.0550  83  TYR B C   
3156 O O   . TYR B 83  ? 0.3933 0.4033 0.5245 0.0047  0.0651  0.0481  83  TYR B O   
3157 C CB  . TYR B 83  ? 0.3664 0.3883 0.4695 0.0011  0.0417  0.0497  83  TYR B CB  
3158 C CG  . TYR B 83  ? 0.3846 0.4080 0.4787 0.0021  0.0342  0.0408  83  TYR B CG  
3159 C CD1 . TYR B 83  ? 0.3688 0.3998 0.4583 0.0022  0.0282  0.0500  83  TYR B CD1 
3160 C CD2 . TYR B 83  ? 0.3901 0.4082 0.4818 0.0037  0.0337  0.0238  83  TYR B CD2 
3161 C CE1 . TYR B 83  ? 0.3649 0.3961 0.4459 0.0040  0.0227  0.0423  83  TYR B CE1 
3162 C CE2 . TYR B 83  ? 0.3987 0.4186 0.4819 0.0059  0.0275  0.0167  83  TYR B CE2 
3163 C CZ  . TYR B 83  ? 0.4183 0.4437 0.4954 0.0063  0.0224  0.0259  83  TYR B CZ  
3164 O OH  . TYR B 83  ? 0.4117 0.4375 0.4798 0.0094  0.0175  0.0193  83  TYR B OH  
3165 N N   . GLY B 84  ? 0.4014 0.4219 0.5513 0.0119  0.0718  0.0677  84  GLY B N   
3166 C CA  . GLY B 84  ? 0.3729 0.3869 0.5357 0.0138  0.0848  0.0713  84  GLY B CA  
3167 C C   . GLY B 84  ? 0.4193 0.4311 0.5706 0.0095  0.0834  0.0801  84  GLY B C   
3168 O O   . GLY B 84  ? 0.4661 0.4845 0.6008 0.0051  0.0728  0.0910  84  GLY B O   
3169 N N   . ALA B 85  ? 0.4840 0.4858 0.6438 0.0103  0.0947  0.0753  85  ALA B N   
3170 C CA  . ALA B 85  ? 0.4669 0.4641 0.6157 0.0073  0.0961  0.0840  85  ALA B CA  
3171 C C   . ALA B 85  ? 0.4585 0.4500 0.5872 0.0008  0.0874  0.0733  85  ALA B C   
3172 O O   . ALA B 85  ? 0.5441 0.5341 0.6541 -0.0034 0.0827  0.0822  85  ALA B O   
3173 C CB  . ALA B 85  ? 0.5179 0.5048 0.6838 0.0112  0.1133  0.0830  85  ALA B CB  
3174 N N   . THR B 86  ? 0.4613 0.4492 0.5933 0.0003  0.0859  0.0547  86  THR B N   
3175 C CA  . THR B 86  ? 0.5167 0.4993 0.6311 -0.0045 0.0787  0.0453  86  THR B CA  
3176 C C   . THR B 86  ? 0.5749 0.5633 0.6669 -0.0091 0.0645  0.0513  86  THR B C   
3177 O O   . THR B 86  ? 0.5646 0.5471 0.6358 -0.0146 0.0600  0.0530  86  THR B O   
3178 C CB  . THR B 86  ? 0.5060 0.4868 0.6310 -0.0030 0.0793  0.0253  86  THR B CB  
3179 O OG1 . THR B 86  ? 0.5416 0.5167 0.6875 -0.0008 0.0922  0.0180  86  THR B OG1 
3180 C CG2 . THR B 86  ? 0.5694 0.5453 0.6773 -0.0068 0.0728  0.0170  86  THR B CG2 
3181 N N   . GLY B 87  ? 0.4813 0.4799 0.5773 -0.0070 0.0586  0.0542  87  GLY B N   
3182 C CA  . GLY B 87  ? 0.5031 0.5069 0.5813 -0.0112 0.0460  0.0571  87  GLY B CA  
3183 C C   . GLY B 87  ? 0.4857 0.4846 0.5571 -0.0115 0.0421  0.0407  87  GLY B C   
3184 O O   . GLY B 87  ? 0.4722 0.4690 0.5571 -0.0072 0.0471  0.0275  87  GLY B O   
3185 N N   . HIS B 88  ? 0.4043 0.4022 0.4552 -0.0167 0.0332  0.0420  88  HIS B N   
3186 C CA  . HIS B 88  ? 0.4170 0.4089 0.4587 -0.0167 0.0304  0.0288  88  HIS B CA  
3187 C C   . HIS B 88  ? 0.3856 0.3667 0.4035 -0.0243 0.0285  0.0308  88  HIS B C   
3188 O O   . HIS B 88  ? 0.3712 0.3534 0.3726 -0.0307 0.0217  0.0397  88  HIS B O   
3189 C CB  . HIS B 88  ? 0.4577 0.4567 0.4972 -0.0146 0.0233  0.0272  88  HIS B CB  
3190 C CG  . HIS B 88  ? 0.5655 0.5604 0.6007 -0.0116 0.0220  0.0136  88  HIS B CG  
3191 N ND1 . HIS B 88  ? 0.4977 0.4922 0.5469 -0.0063 0.0268  0.0010  88  HIS B ND1 
3192 C CD2 . HIS B 88  ? 0.6253 0.6168 0.6441 -0.0131 0.0168  0.0111  88  HIS B CD2 
3193 C CE1 . HIS B 88  ? 0.5320 0.5249 0.5741 -0.0039 0.0238  -0.0076 88  HIS B CE1 
3194 N NE2 . HIS B 88  ? 0.5875 0.5775 0.6109 -0.0075 0.0185  -0.0015 88  HIS B NE2 
3195 N N   . PRO B 89  ? 0.3680 0.3381 0.3844 -0.0240 0.0350  0.0224  89  PRO B N   
3196 C CA  . PRO B 89  ? 0.4072 0.3642 0.4003 -0.0312 0.0359  0.0256  89  PRO B CA  
3197 C C   . PRO B 89  ? 0.4502 0.4027 0.4199 -0.0372 0.0285  0.0261  89  PRO B C   
3198 O O   . PRO B 89  ? 0.4428 0.3959 0.4131 -0.0339 0.0265  0.0182  89  PRO B O   
3199 C CB  . PRO B 89  ? 0.4301 0.3770 0.4294 -0.0279 0.0449  0.0145  89  PRO B CB  
3200 C CG  . PRO B 89  ? 0.3939 0.3497 0.4223 -0.0209 0.0499  0.0096  89  PRO B CG  
3201 C CD  . PRO B 89  ? 0.3513 0.3208 0.3884 -0.0179 0.0428  0.0111  89  PRO B CD  
3202 N N   . GLY B 90  ? 0.4557 0.4039 0.4046 -0.0461 0.0249  0.0356  90  GLY B N   
3203 C CA  . GLY B 90  ? 0.4878 0.4304 0.4127 -0.0543 0.0184  0.0367  90  GLY B CA  
3204 C C   . GLY B 90  ? 0.5385 0.4955 0.4666 -0.0561 0.0088  0.0432  90  GLY B C   
3205 O O   . GLY B 90  ? 0.6087 0.5615 0.5191 -0.0632 0.0037  0.0435  90  GLY B O   
3206 N N   . VAL B 91  ? 0.4863 0.4589 0.4377 -0.0494 0.0077  0.0479  91  VAL B N   
3207 C CA  . VAL B 91  ? 0.4984 0.4847 0.4562 -0.0494 0.0003  0.0541  91  VAL B CA  
3208 C C   . VAL B 91  ? 0.4759 0.4780 0.4500 -0.0478 -0.0013 0.0678  91  VAL B C   
3209 O O   . VAL B 91  ? 0.4395 0.4513 0.4088 -0.0543 -0.0087 0.0795  91  VAL B O   
3210 C CB  . VAL B 91  ? 0.4891 0.4780 0.4599 -0.0401 0.0019  0.0444  91  VAL B CB  
3211 C CG1 . VAL B 91  ? 0.4537 0.4540 0.4282 -0.0403 -0.0044 0.0511  91  VAL B CG1 
3212 C CG2 . VAL B 91  ? 0.5679 0.5428 0.5255 -0.0396 0.0047  0.0323  91  VAL B CG2 
3213 N N   . ILE B 92  ? 0.4036 0.4085 0.3982 -0.0392 0.0060  0.0663  92  ILE B N   
3214 C CA  . ILE B 92  ? 0.3901 0.4079 0.4024 -0.0356 0.0074  0.0788  92  ILE B CA  
3215 C C   . ILE B 92  ? 0.3815 0.3942 0.3961 -0.0349 0.0147  0.0824  92  ILE B C   
3216 O O   . ILE B 92  ? 0.3981 0.4010 0.4189 -0.0306 0.0230  0.0717  92  ILE B O   
3217 C CB  . ILE B 92  ? 0.4032 0.4267 0.4393 -0.0252 0.0127  0.0739  92  ILE B CB  
3218 C CG1 . ILE B 92  ? 0.4155 0.4423 0.4494 -0.0237 0.0073  0.0689  92  ILE B CG1 
3219 C CG2 . ILE B 92  ? 0.3779 0.4130 0.4326 -0.0209 0.0164  0.0882  92  ILE B CG2 
3220 C CD1 . ILE B 92  ? 0.4018 0.4383 0.4286 -0.0299 -0.0012 0.0815  92  ILE B CD1 
3221 N N   . PRO B 93  ? 0.4572 0.4775 0.4677 -0.0389 0.0117  0.0982  93  PRO B N   
3222 C CA  . PRO B 93  ? 0.4828 0.4980 0.4958 -0.0369 0.0199  0.1032  93  PRO B CA  
3223 C C   . PRO B 93  ? 0.4651 0.4844 0.5064 -0.0264 0.0308  0.1051  93  PRO B C   
3224 O O   . PRO B 93  ? 0.4340 0.4621 0.4923 -0.0211 0.0310  0.1052  93  PRO B O   
3225 C CB  . PRO B 93  ? 0.5177 0.5429 0.5175 -0.0438 0.0121  0.1213  93  PRO B CB  
3226 C CG  . PRO B 93  ? 0.5676 0.6047 0.5617 -0.0500 -0.0001 0.1257  93  PRO B CG  
3227 C CD  . PRO B 93  ? 0.4651 0.4984 0.4663 -0.0464 0.0004  0.1116  93  PRO B CD  
3228 N N   . PRO B 94  ? 0.4379 0.4497 0.4835 -0.0236 0.0409  0.1071  94  PRO B N   
3229 C CA  . PRO B 94  ? 0.4315 0.4451 0.5029 -0.0146 0.0532  0.1105  94  PRO B CA  
3230 C C   . PRO B 94  ? 0.4032 0.4333 0.4872 -0.0110 0.0514  0.1282  94  PRO B C   
3231 O O   . PRO B 94  ? 0.4295 0.4703 0.5015 -0.0158 0.0420  0.1429  94  PRO B O   
3232 C CB  . PRO B 94  ? 0.5497 0.5535 0.6157 -0.0146 0.0619  0.1155  94  PRO B CB  
3233 C CG  . PRO B 94  ? 0.4985 0.4897 0.5397 -0.0220 0.0575  0.1055  94  PRO B CG  
3234 C CD  . PRO B 94  ? 0.5688 0.5680 0.5933 -0.0290 0.0424  0.1066  94  PRO B CD  
3235 N N   . ASN B 95  ? 0.4219 0.4541 0.5300 -0.0028 0.0606  0.1268  95  ASN B N   
3236 C CA  . ASN B 95  ? 0.5015 0.5480 0.6256 0.0025  0.0624  0.1445  95  ASN B CA  
3237 C C   . ASN B 95  ? 0.5174 0.5801 0.6340 -0.0018 0.0482  0.1554  95  ASN B C   
3238 O O   . ASN B 95  ? 0.4147 0.4926 0.5378 -0.0002 0.0462  0.1759  95  ASN B O   
3239 C CB  . ASN B 95  ? 0.5987 0.6473 0.7284 0.0062  0.0708  0.1619  95  ASN B CB  
3240 C CG  . ASN B 95  ? 0.7036 0.7357 0.8441 0.0109  0.0871  0.1520  95  ASN B CG  
3241 O OD1 . ASN B 95  ? 0.8698 0.8966 1.0305 0.0168  0.0982  0.1435  95  ASN B OD1 
3242 N ND2 . ASN B 95  ? 0.6845 0.7075 0.8112 0.0076  0.0888  0.1515  95  ASN B ND2 
3243 N N   . ALA B 96  ? 0.4286 0.4890 0.5334 -0.0068 0.0390  0.1425  96  ALA B N   
3244 C CA  . ALA B 96  ? 0.4123 0.4867 0.5109 -0.0117 0.0264  0.1513  96  ALA B CA  
3245 C C   . ALA B 96  ? 0.4410 0.5238 0.5602 -0.0042 0.0301  0.1548  96  ALA B C   
3246 O O   . ALA B 96  ? 0.4397 0.5132 0.5673 0.0013  0.0373  0.1405  96  ALA B O   
3247 C CB  . ALA B 96  ? 0.4998 0.5670 0.5759 -0.0203 0.0163  0.1379  96  ALA B CB  
3248 N N   . THR B 97  ? 0.3778 0.4786 0.5051 -0.0042 0.0254  0.1745  97  THR B N   
3249 C CA  . THR B 97  ? 0.3965 0.5068 0.5389 0.0005  0.0260  0.1797  97  THR B CA  
3250 C C   . THR B 97  ? 0.3701 0.4833 0.4965 -0.0080 0.0126  0.1738  97  THR B C   
3251 O O   . THR B 97  ? 0.4448 0.5643 0.5554 -0.0181 0.0010  0.1790  97  THR B O   
3252 C CB  . THR B 97  ? 0.3902 0.5205 0.5508 0.0044  0.0272  0.2054  97  THR B CB  
3253 O OG1 . THR B 97  ? 0.4054 0.5307 0.5816 0.0136  0.0422  0.2110  97  THR B OG1 
3254 C CG2 . THR B 97  ? 0.4230 0.5643 0.5988 0.0086  0.0272  0.2128  97  THR B CG2 
3255 N N   . LEU B 98  ? 0.3350 0.4428 0.4647 -0.0039 0.0149  0.1629  98  LEU B N   
3256 C CA  . LEU B 98  ? 0.3788 0.4858 0.4937 -0.0104 0.0050  0.1552  98  LEU B CA  
3257 C C   . LEU B 98  ? 0.3350 0.4546 0.4636 -0.0072 0.0042  0.1661  98  LEU B C   
3258 O O   . LEU B 98  ? 0.3608 0.4815 0.5077 0.0026  0.0143  0.1700  98  LEU B O   
3259 C CB  . LEU B 98  ? 0.3540 0.4433 0.4599 -0.0072 0.0088  0.1326  98  LEU B CB  
3260 C CG  . LEU B 98  ? 0.3747 0.4505 0.4726 -0.0079 0.0127  0.1202  98  LEU B CG  
3261 C CD1 . LEU B 98  ? 0.4433 0.5059 0.5359 -0.0041 0.0156  0.0994  98  LEU B CD1 
3262 C CD2 . LEU B 98  ? 0.3769 0.4515 0.4548 -0.0187 0.0041  0.1225  98  LEU B CD2 
3263 N N   . ILE B 99  ? 0.4312 0.5590 0.5507 -0.0159 -0.0067 0.1705  99  ILE B N   
3264 C CA  . ILE B 99  ? 0.4128 0.5519 0.5443 -0.0141 -0.0079 0.1799  99  ILE B CA  
3265 C C   . ILE B 99  ? 0.3989 0.5256 0.5156 -0.0154 -0.0099 0.1638  99  ILE B C   
3266 O O   . ILE B 99  ? 0.3925 0.5125 0.4890 -0.0247 -0.0175 0.1553  99  ILE B O   
3267 C CB  . ILE B 99  ? 0.4563 0.6162 0.5897 -0.0247 -0.0198 0.1978  99  ILE B CB  
3268 C CG1 . ILE B 99  ? 0.5138 0.6865 0.6534 -0.0266 -0.0219 0.2130  99  ILE B CG1 
3269 C CG2 . ILE B 99  ? 0.4742 0.6483 0.6272 -0.0210 -0.0185 0.2105  99  ILE B CG2 
3270 C CD1 . ILE B 99  ? 0.5850 0.7619 0.7488 -0.0133 -0.0089 0.2237  99  ILE B CD1 
3271 N N   . PHE B 100 ? 0.4021 0.5248 0.5278 -0.0058 -0.0023 0.1604  100 PHE B N   
3272 C CA  . PHE B 100 ? 0.3892 0.5019 0.5022 -0.0053 -0.0034 0.1480  100 PHE B CA  
3273 C C   . PHE B 100 ? 0.3817 0.5054 0.5069 -0.0039 -0.0031 0.1606  100 PHE B C   
3274 O O   . PHE B 100 ? 0.4645 0.5950 0.6093 0.0044  0.0047  0.1711  100 PHE B O   
3275 C CB  . PHE B 100 ? 0.3142 0.4114 0.4246 0.0056  0.0056  0.1315  100 PHE B CB  
3276 C CG  . PHE B 100 ? 0.3184 0.4042 0.4186 0.0049  0.0062  0.1171  100 PHE B CG  
3277 C CD1 . PHE B 100 ? 0.3167 0.3924 0.3971 0.0003  0.0010  0.1035  100 PHE B CD1 
3278 C CD2 . PHE B 100 ? 0.3419 0.4266 0.4537 0.0094  0.0134  0.1175  100 PHE B CD2 
3279 C CE1 . PHE B 100 ? 0.3539 0.4200 0.4272 0.0000  0.0023  0.0911  100 PHE B CE1 
3280 C CE2 . PHE B 100 ? 0.3433 0.4181 0.4480 0.0084  0.0147  0.1045  100 PHE B CE2 
3281 C CZ  . PHE B 100 ? 0.3694 0.4354 0.4553 0.0038  0.0088  0.0914  100 PHE B CZ  
3282 N N   . ASP B 101 ? 0.3625 0.4870 0.4769 -0.0121 -0.0105 0.1599  101 ASP B N   
3283 C CA  . ASP B 101 ? 0.3235 0.4557 0.4483 -0.0107 -0.0091 0.1693  101 ASP B CA  
3284 C C   . ASP B 101 ? 0.3009 0.4156 0.4145 -0.0015 -0.0023 0.1542  101 ASP B C   
3285 O O   . ASP B 101 ? 0.2770 0.3801 0.3708 -0.0054 -0.0059 0.1415  101 ASP B O   
3286 C CB  . ASP B 101 ? 0.3722 0.5132 0.4905 -0.0256 -0.0202 0.1753  101 ASP B CB  
3287 C CG  . ASP B 101 ? 0.4027 0.5502 0.5315 -0.0251 -0.0183 0.1835  101 ASP B CG  
3288 O OD1 . ASP B 101 ? 0.4114 0.5492 0.5418 -0.0137 -0.0089 0.1788  101 ASP B OD1 
3289 O OD2 . ASP B 101 ? 0.4930 0.6556 0.6282 -0.0366 -0.0263 0.1951  101 ASP B OD2 
3290 N N   . VAL B 102 ? 0.3163 0.4287 0.4414 0.0109  0.0080  0.1558  102 VAL B N   
3291 C CA  . VAL B 102 ? 0.2698 0.3654 0.3821 0.0206  0.0144  0.1403  102 VAL B CA  
3292 C C   . VAL B 102 ? 0.3158 0.4116 0.4337 0.0269  0.0205  0.1468  102 VAL B C   
3293 O O   . VAL B 102 ? 0.2842 0.3905 0.4218 0.0298  0.0255  0.1621  102 VAL B O   
3294 C CB  . VAL B 102 ? 0.2911 0.3787 0.4069 0.0308  0.0229  0.1318  102 VAL B CB  
3295 C CG1 . VAL B 102 ? 0.2736 0.3457 0.3740 0.0399  0.0275  0.1150  102 VAL B CG1 
3296 C CG2 . VAL B 102 ? 0.2938 0.3816 0.4080 0.0255  0.0190  0.1272  102 VAL B CG2 
3297 N N   . GLU B 103 ? 0.2765 0.3600 0.3771 0.0301  0.0212  0.1359  103 GLU B N   
3298 C CA  . GLU B 103 ? 0.2870 0.3674 0.3903 0.0381  0.0289  0.1405  103 GLU B CA  
3299 C C   . GLU B 103 ? 0.2478 0.3123 0.3360 0.0503  0.0353  0.1251  103 GLU B C   
3300 O O   . GLU B 103 ? 0.2585 0.3143 0.3284 0.0498  0.0309  0.1108  103 GLU B O   
3301 C CB  . GLU B 103 ? 0.3440 0.4247 0.4395 0.0303  0.0240  0.1431  103 GLU B CB  
3302 C CG  . GLU B 103 ? 0.4373 0.5160 0.5378 0.0372  0.0322  0.1505  103 GLU B CG  
3303 C CD  . GLU B 103 ? 0.6806 0.7561 0.7714 0.0295  0.0288  0.1507  103 GLU B CD  
3304 O OE1 . GLU B 103 ? 0.5218 0.5929 0.5973 0.0198  0.0208  0.1423  103 GLU B OE1 
3305 O OE2 . GLU B 103 ? 0.4971 0.5726 0.5953 0.0339  0.0360  0.1592  103 GLU B OE2 
3306 N N   . LEU B 104 ? 0.2911 0.3519 0.3864 0.0613  0.0461  0.1280  104 LEU B N   
3307 C CA  . LEU B 104 ? 0.2998 0.3458 0.3788 0.0727  0.0520  0.1130  104 LEU B CA  
3308 C C   . LEU B 104 ? 0.3191 0.3576 0.3851 0.0784  0.0551  0.1128  104 LEU B C   
3309 O O   . LEU B 104 ? 0.2910 0.3288 0.3648 0.0843  0.0639  0.1231  104 LEU B O   
3310 C CB  . LEU B 104 ? 0.2949 0.3374 0.3844 0.0813  0.0632  0.1144  104 LEU B CB  
3311 C CG  . LEU B 104 ? 0.3204 0.3475 0.3927 0.0923  0.0697  0.0986  104 LEU B CG  
3312 C CD1 . LEU B 104 ? 0.2944 0.3174 0.3513 0.0901  0.0616  0.0798  104 LEU B CD1 
3313 C CD2 . LEU B 104 ? 0.3747 0.3974 0.4594 0.0989  0.0826  0.1023  104 LEU B CD2 
3314 N N   . LEU B 105 ? 0.3540 0.3863 0.4006 0.0771  0.0488  0.1018  105 LEU B N   
3315 C CA  . LEU B 105 ? 0.3820 0.4074 0.4162 0.0815  0.0515  0.1030  105 LEU B CA  
3316 C C   . LEU B 105 ? 0.3417 0.3554 0.3616 0.0959  0.0596  0.0958  105 LEU B C   
3317 O O   . LEU B 105 ? 0.3326 0.3411 0.3489 0.1020  0.0666  0.1023  105 LEU B O   
3318 C CB  . LEU B 105 ? 0.4262 0.4477 0.4437 0.0763  0.0435  0.0942  105 LEU B CB  
3319 C CG  . LEU B 105 ? 0.4779 0.5077 0.5030 0.0610  0.0355  0.1002  105 LEU B CG  
3320 C CD1 . LEU B 105 ? 0.5326 0.5548 0.5386 0.0580  0.0297  0.0884  105 LEU B CD1 
3321 C CD2 . LEU B 105 ? 0.5238 0.5583 0.5595 0.0554  0.0382  0.1151  105 LEU B CD2 
3322 N N   . ASN B 106 ? 0.3318 0.3411 0.3423 0.1009  0.0585  0.0818  106 ASN B N   
3323 C CA  . ASN B 106 ? 0.3323 0.3308 0.3261 0.1138  0.0647  0.0730  106 ASN B CA  
3324 C C   . ASN B 106 ? 0.3445 0.3408 0.3347 0.1161  0.0636  0.0585  106 ASN B C   
3325 O O   . ASN B 106 ? 0.3277 0.3304 0.3260 0.1081  0.0569  0.0536  106 ASN B O   
3326 C CB  . ASN B 106 ? 0.3544 0.3468 0.3256 0.1190  0.0612  0.0664  106 ASN B CB  
3327 C CG  . ASN B 106 ? 0.3690 0.3506 0.3238 0.1330  0.0702  0.0654  106 ASN B CG  
3328 O OD1 . ASN B 106 ? 0.4526 0.4298 0.4126 0.1384  0.0799  0.0702  106 ASN B OD1 
3329 N ND2 . ASN B 106 ? 0.4303 0.4070 0.3649 0.1395  0.0679  0.0595  106 ASN B ND2 
3330 N N   . LEU B 107 ? 0.3781 0.3647 0.3549 0.1269  0.0706  0.0515  107 LEU B N   
3331 C CA  . LEU B 107 ? 0.4258 0.4083 0.3938 0.1296  0.0697  0.0350  107 LEU B CA  
3332 C C   . LEU B 107 ? 0.4284 0.4042 0.3694 0.1395  0.0678  0.0232  107 LEU B C   
3333 O O   . LEU B 107 ? 0.5376 0.5050 0.4677 0.1485  0.0759  0.0284  107 LEU B O   
3334 C CB  . LEU B 107 ? 0.4125 0.3886 0.3911 0.1322  0.0820  0.0382  107 LEU B CB  
3335 C CG  . LEU B 107 ? 0.4304 0.4145 0.4357 0.1232  0.0831  0.0471  107 LEU B CG  
3336 C CD1 . LEU B 107 ? 0.4299 0.4074 0.4480 0.1277  0.0984  0.0564  107 LEU B CD1 
3337 C CD2 . LEU B 107 ? 0.3865 0.3740 0.3936 0.1167  0.0759  0.0328  107 LEU B CD2 
3338 N N   . GLU B 108 ? 0.4512 0.4313 0.3819 0.1383  0.0576  0.0084  108 GLU B N   
3339 C CA  . GLU B 108 ? 0.5969 0.5747 0.5020 0.1477  0.0531  -0.0019 108 GLU B CA  
3340 C C   . GLU B 108 ? 0.6686 0.6458 0.5639 0.1492  0.0500  -0.0201 108 GLU B C   
3341 O O   . GLU B 108 ? 0.6746 0.6575 0.5832 0.1408  0.0457  -0.0282 108 GLU B O   
3342 C CB  . GLU B 108 ? 0.6032 0.5893 0.5049 0.1453  0.0426  -0.0027 108 GLU B CB  
3343 C CG  . GLU B 108 ? 0.6790 0.6652 0.5905 0.1409  0.0451  0.0131  108 GLU B CG  
3344 C CD  . GLU B 108 ? 0.6008 0.5917 0.5090 0.1376  0.0374  0.0135  108 GLU B CD  
3345 O OE1 . GLU B 108 ? 0.5287 0.5260 0.4356 0.1349  0.0289  0.0032  108 GLU B OE1 
3346 O OE2 . GLU B 108 ? 0.7430 0.7303 0.6515 0.1371  0.0414  0.0252  108 GLU B OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   170 ?   ?   ?   A . n 
A 1 2   MET 2   171 ?   ?   ?   A . n 
A 1 3   THR 3   172 ?   ?   ?   A . n 
A 1 4   THR 4   173 ?   ?   ?   A . n 
A 1 5   ASN 5   174 ?   ?   ?   A . n 
A 1 6   VAL 6   175 ?   ?   ?   A . n 
A 1 7   GLY 7   176 ?   ?   ?   A . n 
A 1 8   ASP 8   177 ?   ?   ?   A . n 
A 1 9   SER 9   178 178 SER SER A . n 
A 1 10  THR 10  179 179 THR THR A . n 
A 1 11  LEU 11  180 180 LEU LEU A . n 
A 1 12  ALA 12  181 181 ALA ALA A . n 
A 1 13  ASP 13  182 182 ASP ASP A . n 
A 1 14  LEU 14  183 183 LEU LEU A . n 
A 1 15  LEU 15  184 184 LEU LEU A . n 
A 1 16  ASP 16  185 185 ASP ASP A . n 
A 1 17  HIS 17  186 ?   ?   ?   A . n 
A 1 18  SER 18  187 ?   ?   ?   A . n 
A 1 19  CYS 19  188 ?   ?   ?   A . n 
A 1 20  THR 20  189 ?   ?   ?   A . n 
A 1 21  SER 21  190 190 SER SER A . n 
A 1 22  GLY 22  191 191 GLY GLY A . n 
A 1 23  SER 23  192 192 SER SER A . n 
A 1 24  GLY 24  193 193 GLY GLY A . n 
A 1 25  SER 25  194 194 SER SER A . n 
A 1 26  GLY 26  195 195 GLY GLY A . n 
A 1 27  LEU 27  196 196 LEU LEU A . n 
A 1 28  PRO 28  197 197 PRO PRO A . n 
A 1 29  PHE 29  198 198 PHE PHE A . n 
A 1 30  LEU 30  199 199 LEU LEU A . n 
A 1 31  VAL 31  200 200 VAL VAL A . n 
A 1 32  GLN 32  201 201 GLN GLN A . n 
A 1 33  ARG 33  202 202 ARG ARG A . n 
A 1 34  THR 34  203 203 THR THR A . n 
A 1 35  VAL 35  204 204 VAL VAL A . n 
A 1 36  ALA 36  205 205 ALA ALA A . n 
A 1 37  ARG 37  206 206 ARG ARG A . n 
A 1 38  GLN 38  207 207 GLN GLN A . n 
A 1 39  ILE 39  208 208 ILE ILE A . n 
A 1 40  THR 40  209 209 THR THR A . n 
A 1 41  LEU 41  210 210 LEU LEU A . n 
A 1 42  LEU 42  211 211 LEU LEU A . n 
A 1 43  GLU 43  212 212 GLU GLU A . n 
A 1 44  CYS 44  213 213 CYS CYS A . n 
A 1 45  VAL 45  214 214 VAL VAL A . n 
A 1 46  GLY 46  215 215 GLY GLY A . n 
A 1 47  LYS 47  216 216 LYS LYS A . n 
A 1 48  GLY 48  217 217 GLY GLY A . n 
A 1 49  ARG 49  218 218 ARG ARG A . n 
A 1 50  TYR 50  219 219 TYR TYR A . n 
A 1 51  GLY 51  220 220 GLY GLY A . n 
A 1 52  GLU 52  221 221 GLU GLU A . n 
A 1 53  VAL 53  222 222 VAL VAL A . n 
A 1 54  TRP 54  223 223 TRP TRP A . n 
A 1 55  ARG 55  224 224 ARG ARG A . n 
A 1 56  GLY 56  225 225 GLY GLY A . n 
A 1 57  SER 57  226 226 SER SER A . n 
A 1 58  TRP 58  227 227 TRP TRP A . n 
A 1 59  GLN 59  228 228 GLN GLN A . n 
A 1 60  GLY 60  229 229 GLY GLY A . n 
A 1 61  GLU 61  230 230 GLU GLU A . n 
A 1 62  ASN 62  231 231 ASN ASN A . n 
A 1 63  VAL 63  232 232 VAL VAL A . n 
A 1 64  ALA 64  233 233 ALA ALA A . n 
A 1 65  VAL 65  234 234 VAL VAL A . n 
A 1 66  LYS 66  235 235 LYS LYS A . n 
A 1 67  ILE 67  236 236 ILE ILE A . n 
A 1 68  PHE 68  237 237 PHE PHE A . n 
A 1 69  SER 69  238 238 SER SER A . n 
A 1 70  SER 70  239 239 SER SER A . n 
A 1 71  ARG 71  240 240 ARG ARG A . n 
A 1 72  ASP 72  241 241 ASP ASP A . n 
A 1 73  GLU 73  242 242 GLU GLU A . n 
A 1 74  LYS 74  243 243 LYS LYS A . n 
A 1 75  SER 75  244 244 SER SER A . n 
A 1 76  TRP 76  245 245 TRP TRP A . n 
A 1 77  PHE 77  246 246 PHE PHE A . n 
A 1 78  ARG 78  247 247 ARG ARG A . n 
A 1 79  GLU 79  248 248 GLU GLU A . n 
A 1 80  THR 80  249 249 THR THR A . n 
A 1 81  GLU 81  250 250 GLU GLU A . n 
A 1 82  LEU 82  251 251 LEU LEU A . n 
A 1 83  TYR 83  252 252 TYR TYR A . n 
A 1 84  ASN 84  253 253 ASN ASN A . n 
A 1 85  THR 85  254 254 THR THR A . n 
A 1 86  VAL 86  255 255 VAL VAL A . n 
A 1 87  MET 87  256 256 MET MET A . n 
A 1 88  LEU 88  257 257 LEU LEU A . n 
A 1 89  ARG 89  258 258 ARG ARG A . n 
A 1 90  HIS 90  259 259 HIS HIS A . n 
A 1 91  GLU 91  260 260 GLU GLU A . n 
A 1 92  ASN 92  261 261 ASN ASN A . n 
A 1 93  ILE 93  262 262 ILE ILE A . n 
A 1 94  LEU 94  263 263 LEU LEU A . n 
A 1 95  GLY 95  264 264 GLY GLY A . n 
A 1 96  PHE 96  265 265 PHE PHE A . n 
A 1 97  ILE 97  266 266 ILE ILE A . n 
A 1 98  ALA 98  267 267 ALA ALA A . n 
A 1 99  SER 99  268 268 SER SER A . n 
A 1 100 ASP 100 269 269 ASP ASP A . n 
A 1 101 MET 101 270 270 MET MET A . n 
A 1 102 THR 102 271 271 THR THR A . n 
A 1 103 SER 103 272 272 SER SER A . n 
A 1 104 ARG 104 273 273 ARG ARG A . n 
A 1 105 HIS 105 274 ?   ?   ?   A . n 
A 1 106 SER 106 275 ?   ?   ?   A . n 
A 1 107 SER 107 276 276 SER SER A . n 
A 1 108 THR 108 277 277 THR THR A . n 
A 1 109 GLN 109 278 278 GLN GLN A . n 
A 1 110 LEU 110 279 279 LEU LEU A . n 
A 1 111 TRP 111 280 280 TRP TRP A . n 
A 1 112 LEU 112 281 281 LEU LEU A . n 
A 1 113 ILE 113 282 282 ILE ILE A . n 
A 1 114 THR 114 283 283 THR THR A . n 
A 1 115 HIS 115 284 284 HIS HIS A . n 
A 1 116 TYR 116 285 285 TYR TYR A . n 
A 1 117 HIS 117 286 286 HIS HIS A . n 
A 1 118 GLU 118 287 287 GLU GLU A . n 
A 1 119 MET 119 288 288 MET MET A . n 
A 1 120 GLY 120 289 289 GLY GLY A . n 
A 1 121 SER 121 290 290 SER SER A . n 
A 1 122 LEU 122 291 291 LEU LEU A . n 
A 1 123 TYR 123 292 292 TYR TYR A . n 
A 1 124 ASP 124 293 293 ASP ASP A . n 
A 1 125 TYR 125 294 294 TYR TYR A . n 
A 1 126 LEU 126 295 295 LEU LEU A . n 
A 1 127 GLN 127 296 296 GLN GLN A . n 
A 1 128 LEU 128 297 297 LEU LEU A . n 
A 1 129 THR 129 298 298 THR THR A . n 
A 1 130 THR 130 299 299 THR THR A . n 
A 1 131 LEU 131 300 300 LEU LEU A . n 
A 1 132 ASP 132 301 301 ASP ASP A . n 
A 1 133 THR 133 302 302 THR THR A . n 
A 1 134 VAL 134 303 303 VAL VAL A . n 
A 1 135 SER 135 304 304 SER SER A . n 
A 1 136 CYS 136 305 305 CYS CYS A . n 
A 1 137 LEU 137 306 306 LEU LEU A . n 
A 1 138 ARG 138 307 307 ARG ARG A . n 
A 1 139 ILE 139 308 308 ILE ILE A . n 
A 1 140 VAL 140 309 309 VAL VAL A . n 
A 1 141 LEU 141 310 310 LEU LEU A . n 
A 1 142 SER 142 311 311 SER SER A . n 
A 1 143 ILE 143 312 312 ILE ILE A . n 
A 1 144 ALA 144 313 313 ALA ALA A . n 
A 1 145 SER 145 314 314 SER SER A . n 
A 1 146 GLY 146 315 315 GLY GLY A . n 
A 1 147 LEU 147 316 316 LEU LEU A . n 
A 1 148 ALA 148 317 317 ALA ALA A . n 
A 1 149 HIS 149 318 318 HIS HIS A . n 
A 1 150 LEU 150 319 319 LEU LEU A . n 
A 1 151 HIS 151 320 320 HIS HIS A . n 
A 1 152 ILE 152 321 321 ILE ILE A . n 
A 1 153 GLU 153 322 322 GLU GLU A . n 
A 1 154 ILE 154 323 323 ILE ILE A . n 
A 1 155 PHE 155 324 324 PHE PHE A . n 
A 1 156 GLY 156 325 325 GLY GLY A . n 
A 1 157 THR 157 326 326 THR THR A . n 
A 1 158 GLN 158 327 327 GLN GLN A . n 
A 1 159 GLY 159 328 328 GLY GLY A . n 
A 1 160 LYS 160 329 329 LYS LYS A . n 
A 1 161 PRO 161 330 330 PRO PRO A . n 
A 1 162 ALA 162 331 331 ALA ALA A . n 
A 1 163 ILE 163 332 332 ILE ILE A . n 
A 1 164 ALA 164 333 333 ALA ALA A . n 
A 1 165 HIS 165 334 334 HIS HIS A . n 
A 1 166 ARG 166 335 335 ARG ARG A . n 
A 1 167 ASP 167 336 336 ASP ASP A . n 
A 1 168 LEU 168 337 337 LEU LEU A . n 
A 1 169 LYS 169 338 338 LYS LYS A . n 
A 1 170 SER 170 339 339 SER SER A . n 
A 1 171 LYS 171 340 340 LYS LYS A . n 
A 1 172 ASN 172 341 341 ASN ASN A . n 
A 1 173 ILE 173 342 342 ILE ILE A . n 
A 1 174 LEU 174 343 343 LEU LEU A . n 
A 1 175 VAL 175 344 344 VAL VAL A . n 
A 1 176 LYS 176 345 345 LYS LYS A . n 
A 1 177 LYS 177 346 346 LYS LYS A . n 
A 1 178 ASN 178 347 347 ASN ASN A . n 
A 1 179 GLY 179 348 348 GLY GLY A . n 
A 1 180 GLN 180 349 349 GLN GLN A . n 
A 1 181 CYS 181 350 350 CYS CYS A . n 
A 1 182 CYS 182 351 351 CYS CYS A . n 
A 1 183 ILE 183 352 352 ILE ILE A . n 
A 1 184 ALA 184 353 353 ALA ALA A . n 
A 1 185 ASP 185 354 354 ASP ASP A . n 
A 1 186 LEU 186 355 355 LEU LEU A . n 
A 1 187 GLY 187 356 356 GLY GLY A . n 
A 1 188 LEU 188 357 357 LEU LEU A . n 
A 1 189 ALA 189 358 358 ALA ALA A . n 
A 1 190 VAL 190 359 359 VAL VAL A . n 
A 1 191 MET 191 360 360 MET MET A . n 
A 1 192 HIS 192 361 361 HIS HIS A . n 
A 1 193 SER 193 362 362 SER SER A . n 
A 1 194 GLN 194 363 363 GLN GLN A . n 
A 1 195 SER 195 364 364 SER SER A . n 
A 1 196 THR 196 365 365 THR THR A . n 
A 1 197 ASN 197 366 366 ASN ASN A . n 
A 1 198 GLN 198 367 367 GLN GLN A . n 
A 1 199 LEU 199 368 368 LEU LEU A . n 
A 1 200 ASP 200 369 369 ASP ASP A . n 
A 1 201 VAL 201 370 370 VAL VAL A . n 
A 1 202 GLY 202 371 ?   ?   ?   A . n 
A 1 203 ASN 203 372 ?   ?   ?   A . n 
A 1 204 ASN 204 373 ?   ?   ?   A . n 
A 1 205 PRO 205 374 374 PRO PRO A . n 
A 1 206 ARG 206 375 375 ARG ARG A . n 
A 1 207 VAL 207 376 376 VAL VAL A . n 
A 1 208 GLY 208 377 377 GLY GLY A . n 
A 1 209 THR 209 378 378 THR THR A . n 
A 1 210 LYS 210 379 379 LYS LYS A . n 
A 1 211 ARG 211 380 380 ARG ARG A . n 
A 1 212 TYR 212 381 381 TYR TYR A . n 
A 1 213 MET 213 382 382 MET MET A . n 
A 1 214 ALA 214 383 383 ALA ALA A . n 
A 1 215 PRO 215 384 384 PRO PRO A . n 
A 1 216 GLU 216 385 385 GLU GLU A . n 
A 1 217 VAL 217 386 386 VAL VAL A . n 
A 1 218 LEU 218 387 387 LEU LEU A . n 
A 1 219 ASP 219 388 388 ASP ASP A . n 
A 1 220 GLU 220 389 389 GLU GLU A . n 
A 1 221 THR 221 390 390 THR THR A . n 
A 1 222 ILE 222 391 391 ILE ILE A . n 
A 1 223 GLN 223 392 392 GLN GLN A . n 
A 1 224 VAL 224 393 393 VAL VAL A . n 
A 1 225 ASP 225 394 394 ASP ASP A . n 
A 1 226 CYS 226 395 395 CYS CYS A . n 
A 1 227 PHE 227 396 396 PHE PHE A . n 
A 1 228 ASP 228 397 397 ASP ASP A . n 
A 1 229 SER 229 398 398 SER SER A . n 
A 1 230 TYR 230 399 399 TYR TYR A . n 
A 1 231 LYS 231 400 400 LYS LYS A . n 
A 1 232 ARG 232 401 401 ARG ARG A . n 
A 1 233 VAL 233 402 402 VAL VAL A . n 
A 1 234 ASP 234 403 403 ASP ASP A . n 
A 1 235 ILE 235 404 404 ILE ILE A . n 
A 1 236 TRP 236 405 405 TRP TRP A . n 
A 1 237 ALA 237 406 406 ALA ALA A . n 
A 1 238 PHE 238 407 407 PHE PHE A . n 
A 1 239 GLY 239 408 408 GLY GLY A . n 
A 1 240 LEU 240 409 409 LEU LEU A . n 
A 1 241 VAL 241 410 410 VAL VAL A . n 
A 1 242 LEU 242 411 411 LEU LEU A . n 
A 1 243 TRP 243 412 412 TRP TRP A . n 
A 1 244 GLU 244 413 413 GLU GLU A . n 
A 1 245 VAL 245 414 414 VAL VAL A . n 
A 1 246 ALA 246 415 415 ALA ALA A . n 
A 1 247 ARG 247 416 416 ARG ARG A . n 
A 1 248 ARG 248 417 417 ARG ARG A . n 
A 1 249 MET 249 418 418 MET MET A . n 
A 1 250 VAL 250 419 419 VAL VAL A . n 
A 1 251 SER 251 420 420 SER SER A . n 
A 1 252 ASN 252 421 421 ASN ASN A . n 
A 1 253 GLY 253 422 422 GLY GLY A . n 
A 1 254 ILE 254 423 423 ILE ILE A . n 
A 1 255 VAL 255 424 424 VAL VAL A . n 
A 1 256 GLU 256 425 425 GLU GLU A . n 
A 1 257 ASP 257 426 426 ASP ASP A . n 
A 1 258 TYR 258 427 427 TYR TYR A . n 
A 1 259 LYS 259 428 428 LYS LYS A . n 
A 1 260 PRO 260 429 429 PRO PRO A . n 
A 1 261 PRO 261 430 430 PRO PRO A . n 
A 1 262 PHE 262 431 431 PHE PHE A . n 
A 1 263 TYR 263 432 432 TYR TYR A . n 
A 1 264 ASP 264 433 433 ASP ASP A . n 
A 1 265 VAL 265 434 434 VAL VAL A . n 
A 1 266 VAL 266 435 435 VAL VAL A . n 
A 1 267 PRO 267 436 436 PRO PRO A . n 
A 1 268 ASN 268 437 437 ASN ASN A . n 
A 1 269 ASP 269 438 438 ASP ASP A . n 
A 1 270 PRO 270 439 439 PRO PRO A . n 
A 1 271 SER 271 440 440 SER SER A . n 
A 1 272 PHE 272 441 441 PHE PHE A . n 
A 1 273 GLU 273 442 442 GLU GLU A . n 
A 1 274 ASP 274 443 443 ASP ASP A . n 
A 1 275 MET 275 444 444 MET MET A . n 
A 1 276 ARG 276 445 445 ARG ARG A . n 
A 1 277 LYS 277 446 446 LYS LYS A . n 
A 1 278 VAL 278 447 447 VAL VAL A . n 
A 1 279 VAL 279 448 448 VAL VAL A . n 
A 1 280 CYS 280 449 449 CYS CYS A . n 
A 1 281 VAL 281 450 450 VAL VAL A . n 
A 1 282 ASP 282 451 451 ASP ASP A . n 
A 1 283 GLN 283 452 452 GLN GLN A . n 
A 1 284 GLN 284 453 453 GLN GLN A . n 
A 1 285 ARG 285 454 454 ARG ARG A . n 
A 1 286 PRO 286 455 455 PRO PRO A . n 
A 1 287 ASN 287 456 456 ASN ASN A . n 
A 1 288 ILE 288 457 457 ILE ILE A . n 
A 1 289 PRO 289 458 458 PRO PRO A . n 
A 1 290 ASN 290 459 459 ASN ASN A . n 
A 1 291 ARG 291 460 460 ARG ARG A . n 
A 1 292 TRP 292 461 461 TRP TRP A . n 
A 1 293 PHE 293 462 462 PHE PHE A . n 
A 1 294 SER 294 463 463 SER SER A . n 
A 1 295 ASP 295 464 464 ASP ASP A . n 
A 1 296 PRO 296 465 465 PRO PRO A . n 
A 1 297 THR 297 466 466 THR THR A . n 
A 1 298 LEU 298 467 467 LEU LEU A . n 
A 1 299 THR 299 468 468 THR THR A . n 
A 1 300 SER 300 469 469 SER SER A . n 
A 1 301 LEU 301 470 470 LEU LEU A . n 
A 1 302 ALA 302 471 471 ALA ALA A . n 
A 1 303 LYS 303 472 472 LYS LYS A . n 
A 1 304 LEU 304 473 473 LEU LEU A . n 
A 1 305 MET 305 474 474 MET MET A . n 
A 1 306 LYS 306 475 475 LYS LYS A . n 
A 1 307 GLU 307 476 476 GLU GLU A . n 
A 1 308 CYS 308 477 477 CYS CYS A . n 
A 1 309 TRP 309 478 478 TRP TRP A . n 
A 1 310 TYR 310 479 479 TYR TYR A . n 
A 1 311 GLN 311 480 480 GLN GLN A . n 
A 1 312 ASN 312 481 481 ASN ASN A . n 
A 1 313 PRO 313 482 482 PRO PRO A . n 
A 1 314 SER 314 483 483 SER SER A . n 
A 1 315 ALA 315 484 484 ALA ALA A . n 
A 1 316 ARG 316 485 485 ARG ARG A . n 
A 1 317 LEU 317 486 486 LEU LEU A . n 
A 1 318 THR 318 487 487 THR THR A . n 
A 1 319 ALA 319 488 488 ALA ALA A . n 
A 1 320 LEU 320 489 489 LEU LEU A . n 
A 1 321 ARG 321 490 490 ARG ARG A . n 
A 1 322 ILE 322 491 491 ILE ILE A . n 
A 1 323 LYS 323 492 492 LYS LYS A . n 
A 1 324 LYS 324 493 493 LYS LYS A . n 
A 1 325 THR 325 494 494 THR THR A . n 
A 1 326 LEU 326 495 495 LEU LEU A . n 
A 1 327 THR 327 496 496 THR THR A . n 
A 1 328 LYS 328 497 497 LYS LYS A . n 
A 1 329 ILE 329 498 498 ILE ILE A . n 
A 1 330 ASP 330 499 499 ASP ASP A . n 
B 2 1   MET 1   1   0   MET MET B . n 
B 2 2   GLY 2   2   1   GLY GLY B . n 
B 2 3   VAL 3   3   2   VAL VAL B . n 
B 2 4   GLU 4   4   3   GLU GLU B . n 
B 2 5   ILE 5   5   4   ILE ILE B . n 
B 2 6   GLU 6   6   5   GLU GLU B . n 
B 2 7   THR 7   7   6   THR THR B . n 
B 2 8   ILE 8   8   7   ILE ILE B . n 
B 2 9   SER 9   9   8   SER SER B . n 
B 2 10  PRO 10  10  9   PRO PRO B . n 
B 2 11  GLY 11  11  10  GLY GLY B . n 
B 2 12  ASP 12  12  11  ASP ASP B . n 
B 2 13  GLY 13  13  12  GLY GLY B . n 
B 2 14  ARG 14  14  13  ARG ARG B . n 
B 2 15  THR 15  15  14  THR THR B . n 
B 2 16  PHE 16  16  15  PHE PHE B . n 
B 2 17  PRO 17  17  16  PRO PRO B . n 
B 2 18  LYS 18  18  17  LYS LYS B . n 
B 2 19  LYS 19  19  18  LYS LYS B . n 
B 2 20  GLY 20  20  19  GLY GLY B . n 
B 2 21  GLN 21  21  20  GLN GLN B . n 
B 2 22  THR 22  22  21  THR THR B . n 
B 2 23  CYS 23  23  22  CYS CYS B . n 
B 2 24  VAL 24  24  23  VAL VAL B . n 
B 2 25  VAL 25  25  24  VAL VAL B . n 
B 2 26  HIS 26  26  25  HIS HIS B . n 
B 2 27  TYR 27  27  26  TYR TYR B . n 
B 2 28  THR 28  28  27  THR THR B . n 
B 2 29  GLY 29  29  28  GLY GLY B . n 
B 2 30  MET 30  30  29  MET MET B . n 
B 2 31  LEU 31  31  30  LEU LEU B . n 
B 2 32  GLN 32  32  31  GLN GLN B . n 
B 2 33  ASN 33  33  32  ASN ASN B . n 
B 2 34  GLY 34  34  33  GLY GLY B . n 
B 2 35  LYS 35  35  34  LYS LYS B . n 
B 2 36  LYS 36  36  35  LYS LYS B . n 
B 2 37  PHE 37  37  36  PHE PHE B . n 
B 2 38  ASP 38  38  37  ASP ASP B . n 
B 2 39  SER 39  39  38  SER SER B . n 
B 2 40  SER 40  40  39  SER SER B . n 
B 2 41  ARG 41  41  40  ARG ARG B . n 
B 2 42  ASP 42  42  41  ASP ASP B . n 
B 2 43  ARG 43  43  42  ARG ARG B . n 
B 2 44  ASN 44  44  43  ASN ASN B . n 
B 2 45  LYS 45  45  44  LYS LYS B . n 
B 2 46  PRO 46  46  45  PRO PRO B . n 
B 2 47  PHE 47  47  46  PHE PHE B . n 
B 2 48  LYS 48  48  47  LYS LYS B . n 
B 2 49  PHE 49  49  48  PHE PHE B . n 
B 2 50  ARG 50  50  49  ARG ARG B . n 
B 2 51  ILE 51  51  50  ILE ILE B . n 
B 2 52  GLY 52  52  51  GLY GLY B . n 
B 2 53  LYS 53  53  52  LYS LYS B . n 
B 2 54  GLN 54  54  53  GLN GLN B . n 
B 2 55  GLU 55  55  54  GLU GLU B . n 
B 2 56  VAL 56  56  55  VAL VAL B . n 
B 2 57  ILE 57  57  56  ILE ILE B . n 
B 2 58  LYS 58  58  57  LYS LYS B . n 
B 2 59  GLY 59  59  58  GLY GLY B . n 
B 2 60  PHE 60  60  59  PHE PHE B . n 
B 2 61  GLU 61  61  60  GLU GLU B . n 
B 2 62  GLU 62  62  61  GLU GLU B . n 
B 2 63  GLY 63  63  62  GLY GLY B . n 
B 2 64  ALA 64  64  63  ALA ALA B . n 
B 2 65  ALA 65  65  64  ALA ALA B . n 
B 2 66  GLN 66  66  65  GLN GLN B . n 
B 2 67  MET 67  67  66  MET MET B . n 
B 2 68  SER 68  68  67  SER SER B . n 
B 2 69  LEU 69  69  68  LEU LEU B . n 
B 2 70  GLY 70  70  69  GLY GLY B . n 
B 2 71  GLN 71  71  70  GLN GLN B . n 
B 2 72  ARG 72  72  71  ARG ARG B . n 
B 2 73  ALA 73  73  72  ALA ALA B . n 
B 2 74  LYS 74  74  73  LYS LYS B . n 
B 2 75  LEU 75  75  74  LEU LEU B . n 
B 2 76  THR 76  76  75  THR THR B . n 
B 2 77  CYS 77  77  76  CYS CYS B . n 
B 2 78  THR 78  78  77  THR THR B . n 
B 2 79  PRO 79  79  78  PRO PRO B . n 
B 2 80  ASP 80  80  79  ASP ASP B . n 
B 2 81  VAL 81  81  80  VAL VAL B . n 
B 2 82  ALA 82  82  81  ALA ALA B . n 
B 2 83  TYR 83  83  82  TYR TYR B . n 
B 2 84  GLY 84  84  83  GLY GLY B . n 
B 2 85  ALA 85  85  84  ALA ALA B . n 
B 2 86  THR 86  86  85  THR THR B . n 
B 2 87  GLY 87  87  86  GLY GLY B . n 
B 2 88  HIS 88  88  87  HIS HIS B . n 
B 2 89  PRO 89  89  88  PRO PRO B . n 
B 2 90  GLY 90  90  89  GLY GLY B . n 
B 2 91  VAL 91  91  90  VAL VAL B . n 
B 2 92  ILE 92  92  91  ILE ILE B . n 
B 2 93  PRO 93  93  92  PRO PRO B . n 
B 2 94  PRO 94  94  93  PRO PRO B . n 
B 2 95  ASN 95  95  94  ASN ASN B . n 
B 2 96  ALA 96  96  95  ALA ALA B . n 
B 2 97  THR 97  97  96  THR THR B . n 
B 2 98  LEU 98  98  97  LEU LEU B . n 
B 2 99  ILE 99  99  98  ILE ILE B . n 
B 2 100 PHE 100 100 99  PHE PHE B . n 
B 2 101 ASP 101 101 100 ASP ASP B . n 
B 2 102 VAL 102 102 101 VAL VAL B . n 
B 2 103 GLU 103 103 102 GLU GLU B . n 
B 2 104 LEU 104 104 103 LEU LEU B . n 
B 2 105 LEU 105 105 104 LEU LEU B . n 
B 2 106 ASN 106 106 105 ASN ASN B . n 
B 2 107 LEU 107 107 106 LEU LEU B . n 
B 2 108 GLU 108 108 107 GLU GLU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 FLC 1   1500 1500 FLC FLC A . 
D 3 FLC 1   1501 1501 FLC FLC A . 
E 3 FLC 1   1502 1502 FLC FLC A . 
F 3 FLC 1   1503 1503 FLC FLC A . 
G 3 FLC 1   1504 1504 FLC FLC A . 
H 3 FLC 1   1505 1505 FLC FLC A . 
I 3 FLC 1   1506 1506 FLC FLC A . 
J 4 TAK 1   1507 1507 TAK TAK A . 
K 5 EDO 1   1508 1508 EDO EDO A . 
L 5 EDO 1   1509 1509 EDO EDO A . 
M 5 EDO 1   1510 1510 EDO EDO A . 
N 5 EDO 1   1511 1511 EDO EDO A . 
O 5 EDO 1   1512 1512 EDO EDO A . 
P 5 EDO 1   1513 1513 EDO EDO A . 
Q 5 EDO 1   1514 1514 EDO EDO A . 
R 5 EDO 1   1515 1515 EDO EDO A . 
S 5 EDO 1   1516 1516 EDO EDO A . 
T 3 FLC 1   1108 1108 FLC FLC B . 
U 5 EDO 1   1109 1109 EDO EDO B . 
V 5 EDO 1   1110 1110 EDO EDO B . 
W 5 EDO 1   1111 1111 EDO EDO B . 
X 5 EDO 1   1112 1112 EDO EDO B . 
Y 6 HOH 1   2001 2001 HOH HOH A . 
Y 6 HOH 2   2002 2002 HOH HOH A . 
Y 6 HOH 3   2003 2003 HOH HOH A . 
Y 6 HOH 4   2004 2004 HOH HOH A . 
Y 6 HOH 5   2005 2005 HOH HOH A . 
Y 6 HOH 6   2006 2006 HOH HOH A . 
Y 6 HOH 7   2007 2007 HOH HOH A . 
Y 6 HOH 8   2008 2008 HOH HOH A . 
Y 6 HOH 9   2009 2009 HOH HOH A . 
Y 6 HOH 10  2010 2010 HOH HOH A . 
Y 6 HOH 11  2011 2011 HOH HOH A . 
Y 6 HOH 12  2012 2012 HOH HOH A . 
Y 6 HOH 13  2013 2013 HOH HOH A . 
Y 6 HOH 14  2014 2014 HOH HOH A . 
Y 6 HOH 15  2015 2015 HOH HOH A . 
Y 6 HOH 16  2016 2016 HOH HOH A . 
Y 6 HOH 17  2017 2017 HOH HOH A . 
Y 6 HOH 18  2018 2018 HOH HOH A . 
Y 6 HOH 19  2019 2019 HOH HOH A . 
Y 6 HOH 20  2020 2020 HOH HOH A . 
Y 6 HOH 21  2021 2021 HOH HOH A . 
Y 6 HOH 22  2022 2022 HOH HOH A . 
Y 6 HOH 23  2023 2023 HOH HOH A . 
Y 6 HOH 24  2024 2024 HOH HOH A . 
Y 6 HOH 25  2025 2025 HOH HOH A . 
Y 6 HOH 26  2026 2026 HOH HOH A . 
Y 6 HOH 27  2027 2027 HOH HOH A . 
Y 6 HOH 28  2028 2028 HOH HOH A . 
Y 6 HOH 29  2029 2029 HOH HOH A . 
Y 6 HOH 30  2030 2030 HOH HOH A . 
Y 6 HOH 31  2031 2031 HOH HOH A . 
Y 6 HOH 32  2032 2032 HOH HOH A . 
Y 6 HOH 33  2033 2033 HOH HOH A . 
Y 6 HOH 34  2034 2034 HOH HOH A . 
Y 6 HOH 35  2035 2035 HOH HOH A . 
Y 6 HOH 36  2036 2036 HOH HOH A . 
Y 6 HOH 37  2037 2037 HOH HOH A . 
Y 6 HOH 38  2038 2038 HOH HOH A . 
Y 6 HOH 39  2039 2039 HOH HOH A . 
Y 6 HOH 40  2040 2040 HOH HOH A . 
Y 6 HOH 41  2041 2041 HOH HOH A . 
Y 6 HOH 42  2042 2042 HOH HOH A . 
Y 6 HOH 43  2043 2043 HOH HOH A . 
Y 6 HOH 44  2044 2044 HOH HOH A . 
Y 6 HOH 45  2045 2045 HOH HOH A . 
Y 6 HOH 46  2046 2046 HOH HOH A . 
Y 6 HOH 47  2047 2047 HOH HOH A . 
Y 6 HOH 48  2048 2048 HOH HOH A . 
Y 6 HOH 49  2049 2049 HOH HOH A . 
Y 6 HOH 50  2050 2050 HOH HOH A . 
Y 6 HOH 51  2051 2051 HOH HOH A . 
Y 6 HOH 52  2052 2052 HOH HOH A . 
Y 6 HOH 53  2053 2053 HOH HOH A . 
Y 6 HOH 54  2054 2054 HOH HOH A . 
Y 6 HOH 55  2055 2055 HOH HOH A . 
Y 6 HOH 56  2056 2056 HOH HOH A . 
Y 6 HOH 57  2057 2057 HOH HOH A . 
Y 6 HOH 58  2058 2058 HOH HOH A . 
Y 6 HOH 59  2059 2059 HOH HOH A . 
Y 6 HOH 60  2060 2060 HOH HOH A . 
Y 6 HOH 61  2061 2061 HOH HOH A . 
Y 6 HOH 62  2062 2062 HOH HOH A . 
Y 6 HOH 63  2063 2063 HOH HOH A . 
Y 6 HOH 64  2064 2064 HOH HOH A . 
Y 6 HOH 65  2065 2065 HOH HOH A . 
Y 6 HOH 66  2066 2066 HOH HOH A . 
Y 6 HOH 67  2067 2067 HOH HOH A . 
Y 6 HOH 68  2068 2068 HOH HOH A . 
Y 6 HOH 69  2069 2069 HOH HOH A . 
Y 6 HOH 70  2070 2070 HOH HOH A . 
Y 6 HOH 71  2071 2071 HOH HOH A . 
Y 6 HOH 72  2072 2072 HOH HOH A . 
Y 6 HOH 73  2073 2073 HOH HOH A . 
Y 6 HOH 74  2074 2074 HOH HOH A . 
Y 6 HOH 75  2075 2075 HOH HOH A . 
Y 6 HOH 76  2076 2076 HOH HOH A . 
Y 6 HOH 77  2077 2077 HOH HOH A . 
Y 6 HOH 78  2078 2078 HOH HOH A . 
Y 6 HOH 79  2079 2079 HOH HOH A . 
Y 6 HOH 80  2080 2080 HOH HOH A . 
Y 6 HOH 81  2081 2081 HOH HOH A . 
Y 6 HOH 82  2082 2082 HOH HOH A . 
Y 6 HOH 83  2083 2083 HOH HOH A . 
Y 6 HOH 84  2084 2084 HOH HOH A . 
Y 6 HOH 85  2085 2085 HOH HOH A . 
Y 6 HOH 86  2086 2086 HOH HOH A . 
Y 6 HOH 87  2087 2087 HOH HOH A . 
Y 6 HOH 88  2088 2088 HOH HOH A . 
Y 6 HOH 89  2089 2089 HOH HOH A . 
Y 6 HOH 90  2090 2090 HOH HOH A . 
Y 6 HOH 91  2091 2091 HOH HOH A . 
Y 6 HOH 92  2092 2092 HOH HOH A . 
Y 6 HOH 93  2093 2093 HOH HOH A . 
Y 6 HOH 94  2094 2094 HOH HOH A . 
Y 6 HOH 95  2095 2095 HOH HOH A . 
Y 6 HOH 96  2096 2096 HOH HOH A . 
Y 6 HOH 97  2097 2097 HOH HOH A . 
Y 6 HOH 98  2098 2098 HOH HOH A . 
Y 6 HOH 99  2099 2099 HOH HOH A . 
Y 6 HOH 100 2100 2100 HOH HOH A . 
Y 6 HOH 101 2101 2101 HOH HOH A . 
Y 6 HOH 102 2102 2102 HOH HOH A . 
Y 6 HOH 103 2103 2103 HOH HOH A . 
Y 6 HOH 104 2104 2104 HOH HOH A . 
Y 6 HOH 105 2105 2105 HOH HOH A . 
Y 6 HOH 106 2106 2106 HOH HOH A . 
Y 6 HOH 107 2107 2107 HOH HOH A . 
Y 6 HOH 108 2108 2108 HOH HOH A . 
Y 6 HOH 109 2109 2109 HOH HOH A . 
Y 6 HOH 110 2110 2110 HOH HOH A . 
Y 6 HOH 111 2111 2111 HOH HOH A . 
Y 6 HOH 112 2112 2112 HOH HOH A . 
Y 6 HOH 113 2113 2113 HOH HOH A . 
Y 6 HOH 114 2114 2114 HOH HOH A . 
Y 6 HOH 115 2115 2115 HOH HOH A . 
Y 6 HOH 116 2116 2116 HOH HOH A . 
Y 6 HOH 117 2117 2117 HOH HOH A . 
Y 6 HOH 118 2118 2118 HOH HOH A . 
Y 6 HOH 119 2119 2119 HOH HOH A . 
Y 6 HOH 120 2120 2120 HOH HOH A . 
Y 6 HOH 121 2121 2121 HOH HOH A . 
Y 6 HOH 122 2122 2122 HOH HOH A . 
Y 6 HOH 123 2123 2123 HOH HOH A . 
Y 6 HOH 124 2124 2124 HOH HOH A . 
Y 6 HOH 125 2125 2125 HOH HOH A . 
Y 6 HOH 126 2126 2126 HOH HOH A . 
Y 6 HOH 127 2127 2127 HOH HOH A . 
Y 6 HOH 128 2128 2128 HOH HOH A . 
Y 6 HOH 129 2129 2129 HOH HOH A . 
Y 6 HOH 130 2130 2130 HOH HOH A . 
Y 6 HOH 131 2131 2131 HOH HOH A . 
Y 6 HOH 132 2132 2132 HOH HOH A . 
Y 6 HOH 133 2133 2133 HOH HOH A . 
Y 6 HOH 134 2134 2134 HOH HOH A . 
Y 6 HOH 135 2135 2135 HOH HOH A . 
Y 6 HOH 136 2136 2136 HOH HOH A . 
Y 6 HOH 137 2137 2137 HOH HOH A . 
Y 6 HOH 138 2138 2138 HOH HOH A . 
Y 6 HOH 139 2139 2139 HOH HOH A . 
Y 6 HOH 140 2140 2140 HOH HOH A . 
Y 6 HOH 141 2141 2141 HOH HOH A . 
Y 6 HOH 142 2142 2142 HOH HOH A . 
Y 6 HOH 143 2143 2143 HOH HOH A . 
Y 6 HOH 144 2144 2144 HOH HOH A . 
Y 6 HOH 145 2145 2145 HOH HOH A . 
Y 6 HOH 146 2146 2146 HOH HOH A . 
Y 6 HOH 147 2147 2147 HOH HOH A . 
Y 6 HOH 148 2148 2148 HOH HOH A . 
Y 6 HOH 149 2149 2149 HOH HOH A . 
Y 6 HOH 150 2150 2150 HOH HOH A . 
Y 6 HOH 151 2151 2151 HOH HOH A . 
Y 6 HOH 152 2152 2152 HOH HOH A . 
Y 6 HOH 153 2153 2153 HOH HOH A . 
Y 6 HOH 154 2154 2154 HOH HOH A . 
Y 6 HOH 155 2155 2155 HOH HOH A . 
Y 6 HOH 156 2156 2156 HOH HOH A . 
Y 6 HOH 157 2157 2157 HOH HOH A . 
Y 6 HOH 158 2158 2158 HOH HOH A . 
Y 6 HOH 159 2159 2159 HOH HOH A . 
Y 6 HOH 160 2160 2160 HOH HOH A . 
Y 6 HOH 161 2161 2161 HOH HOH A . 
Y 6 HOH 162 2162 2162 HOH HOH A . 
Y 6 HOH 163 2163 2163 HOH HOH A . 
Y 6 HOH 164 2164 2164 HOH HOH A . 
Y 6 HOH 165 2165 2165 HOH HOH A . 
Y 6 HOH 166 2166 2166 HOH HOH A . 
Y 6 HOH 167 2167 2167 HOH HOH A . 
Y 6 HOH 168 2168 2168 HOH HOH A . 
Y 6 HOH 169 2169 2169 HOH HOH A . 
Y 6 HOH 170 2170 2170 HOH HOH A . 
Y 6 HOH 171 2171 2171 HOH HOH A . 
Y 6 HOH 172 2172 2172 HOH HOH A . 
Y 6 HOH 173 2173 2173 HOH HOH A . 
Y 6 HOH 174 2174 2174 HOH HOH A . 
Y 6 HOH 175 2175 2175 HOH HOH A . 
Y 6 HOH 176 2176 2176 HOH HOH A . 
Y 6 HOH 177 2177 2177 HOH HOH A . 
Y 6 HOH 178 2178 2178 HOH HOH A . 
Y 6 HOH 179 2179 2179 HOH HOH A . 
Y 6 HOH 180 2180 2180 HOH HOH A . 
Y 6 HOH 181 2181 2181 HOH HOH A . 
Y 6 HOH 182 2182 2182 HOH HOH A . 
Y 6 HOH 183 2183 2183 HOH HOH A . 
Y 6 HOH 184 2184 2184 HOH HOH A . 
Y 6 HOH 185 2185 2185 HOH HOH A . 
Y 6 HOH 186 2186 2186 HOH HOH A . 
Y 6 HOH 187 2187 2187 HOH HOH A . 
Y 6 HOH 188 2188 2188 HOH HOH A . 
Y 6 HOH 189 2189 2189 HOH HOH A . 
Z 6 HOH 1   2001 2001 HOH HOH B . 
Z 6 HOH 2   2002 2002 HOH HOH B . 
Z 6 HOH 3   2003 2003 HOH HOH B . 
Z 6 HOH 4   2004 2004 HOH HOH B . 
Z 6 HOH 5   2005 2005 HOH HOH B . 
Z 6 HOH 6   2006 2006 HOH HOH B . 
Z 6 HOH 7   2007 2007 HOH HOH B . 
Z 6 HOH 8   2008 2008 HOH HOH B . 
Z 6 HOH 9   2009 2009 HOH HOH B . 
Z 6 HOH 10  2010 2010 HOH HOH B . 
Z 6 HOH 11  2011 2011 HOH HOH B . 
Z 6 HOH 12  2012 2012 HOH HOH B . 
Z 6 HOH 13  2013 2013 HOH HOH B . 
Z 6 HOH 14  2014 2014 HOH HOH B . 
Z 6 HOH 15  2015 2015 HOH HOH B . 
Z 6 HOH 16  2016 2016 HOH HOH B . 
Z 6 HOH 17  2017 2017 HOH HOH B . 
Z 6 HOH 18  2018 2018 HOH HOH B . 
Z 6 HOH 19  2019 2019 HOH HOH B . 
Z 6 HOH 20  2020 2020 HOH HOH B . 
Z 6 HOH 21  2021 2021 HOH HOH B . 
Z 6 HOH 22  2022 2022 HOH HOH B . 
Z 6 HOH 23  2023 2023 HOH HOH B . 
Z 6 HOH 24  2024 2024 HOH HOH B . 
Z 6 HOH 25  2025 2025 HOH HOH B . 
Z 6 HOH 26  2026 2026 HOH HOH B . 
Z 6 HOH 27  2027 2027 HOH HOH B . 
Z 6 HOH 28  2028 2028 HOH HOH B . 
Z 6 HOH 29  2029 2029 HOH HOH B . 
Z 6 HOH 30  2030 2030 HOH HOH B . 
Z 6 HOH 31  2031 2031 HOH HOH B . 
Z 6 HOH 32  2032 2032 HOH HOH B . 
Z 6 HOH 33  2033 2033 HOH HOH B . 
Z 6 HOH 34  2034 2034 HOH HOH B . 
Z 6 HOH 35  2035 2035 HOH HOH B . 
Z 6 HOH 36  2036 2036 HOH HOH B . 
Z 6 HOH 37  2037 2037 HOH HOH B . 
Z 6 HOH 38  2038 2038 HOH HOH B . 
Z 6 HOH 39  2039 2039 HOH HOH B . 
Z 6 HOH 40  2040 2040 HOH HOH B . 
Z 6 HOH 41  2041 2041 HOH HOH B . 
Z 6 HOH 42  2042 2042 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7250  ? 
1 MORE         23.4  ? 
1 'SSA (A^2)'  18780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-08-07 
2 'Structure model' 1 1 2018-01-24 
3 'Structure model' 2 0 2021-02-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' Advisory               
3 3 'Structure model' 'Atomic model'         
4 3 'Structure model' 'Data collection'      
5 3 'Structure model' 'Database references'  
6 3 'Structure model' 'Derived calculations' 
7 3 'Structure model' Other                  
8 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' citation_author              
2  3 'Structure model' atom_site                    
3  3 'Structure model' atom_site_anisotrop          
4  3 'Structure model' pdbx_database_status         
5  3 'Structure model' pdbx_poly_seq_scheme         
6  3 'Structure model' pdbx_struct_sheet_hbond      
7  3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
8  3 'Structure model' pdbx_validate_torsion        
9  3 'Structure model' struct_conf                  
10 3 'Structure model' struct_ref_seq               
11 3 'Structure model' struct_sheet_range           
12 3 'Structure model' struct_site                  
13 3 'Structure model' struct_site_gen              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation_author.name'                        
2  3 'Structure model' '_atom_site.auth_seq_id'                       
3  3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id'        
4  3 'Structure model' '_pdbx_database_status.status_code_sf'         
5  3 'Structure model' '_pdbx_poly_seq_scheme.pdb_seq_num'            
6  3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_auth_seq_id' 
7  3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_auth_seq_id' 
8  3 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.auth_seq_id'    
9  3 'Structure model' '_pdbx_validate_torsion.auth_seq_id'           
10 3 'Structure model' '_struct_conf.beg_auth_seq_id'                 
11 3 'Structure model' '_struct_conf.end_auth_seq_id'                 
12 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg'      
13 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_end'      
14 3 'Structure model' '_struct_sheet_range.beg_auth_seq_id'          
15 3 'Structure model' '_struct_sheet_range.end_auth_seq_id'          
16 3 'Structure model' '_struct_site.pdbx_auth_asym_id'               
17 3 'Structure model' '_struct_site.pdbx_auth_comp_id'               
18 3 'Structure model' '_struct_site.pdbx_auth_seq_id'                
19 3 'Structure model' '_struct_site_gen.auth_seq_id'                 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -50.9931 6.1060  5.1011  0.0972 0.0796 0.0353 -0.0132 -0.0091 0.0149 0.3214 0.1672 0.5855 -0.0833 
-0.2006 0.0591  -0.0707 0.0034 0.0361 -0.0144 0.0224 0.0410 0.0106 0.0873  0.0483  
'X-RAY DIFFRACTION' 2 ? refined -82.6812 18.8453 21.2804 0.0415 0.1043 0.1408 0.0350  0.0263  0.0897 1.1255 1.4998 1.1139 -0.0583 
-1.0188 -0.4763 -0.0093 0.0759 0.3058 0.0669  0.3648 0.2314 0.0013 -0.1909 -0.3555 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1 A 178 ? ? A 192 ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 A 193 ? ? A 257 ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 A 258 ? ? A 296 ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 A 297 ? ? A 333 ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 A 334 ? ? A 381 ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 A 384 ? ? A 499 ? ? ? ? 
'X-RAY DIFFRACTION' 7  2 B 1   ? ? B 6   ? ? ? ? 
'X-RAY DIFFRACTION' 8  2 B 7   ? ? B 33  ? ? ? ? 
'X-RAY DIFFRACTION' 9  2 B 34  ? ? B 47  ? ? ? ? 
'X-RAY DIFFRACTION' 10 2 B 48  ? ? B 54  ? ? ? ? 
'X-RAY DIFFRACTION' 11 2 B 55  ? ? B 107 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.7.0032 ? 1 
MOSFLM  'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id                 4C02 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;N TERMINAL METHIONINE (RESIDUE 0) SEEN PRIOR TO RESIDUE 1
(GLY).
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 2177 ? ? O A HOH 2178 ? ? 1.88 
2 1 OD2 A ASP 293  ? ? O A HOH 2047 ? ? 2.16 
3 1 OG  A SER 483  ? A O A HOH 2178 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2176 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2037 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_445 
_pdbx_validate_symm_contact.dist              1.79 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 259 ? ? -172.13 141.75  
2 1 ASP A 336 ? ? -152.89 45.14   
3 1 ASP A 354 ? ? 69.71   70.69   
4 1 SER A 364 ? ? -66.33  53.96   
5 1 ASN A 366 ? ? -84.37  -143.88 
6 1 ARG B 14  ? ? -141.94 -40.44  
7 1 ALA B 82  ? ? -130.68 -117.29 
8 1 VAL B 91  ? ? -137.12 -56.96  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 178  ? OG  ? A SER 9   OG  
2  1 Y 1 A SER 190  ? OG  ? A SER 21  OG  
3  1 Y 1 A LYS 216  ? CE  ? A LYS 47  CE  
4  1 Y 1 A LYS 216  ? NZ  ? A LYS 47  NZ  
5  1 Y 1 A ARG 218  ? CG  ? A ARG 49  CG  
6  1 Y 1 A ARG 218  ? CD  ? A ARG 49  CD  
7  1 Y 1 A ARG 218  ? NE  ? A ARG 49  NE  
8  1 Y 1 A ARG 218  ? CZ  ? A ARG 49  CZ  
9  1 Y 1 A ARG 218  ? NH1 ? A ARG 49  NH1 
10 1 Y 1 A ARG 218  ? NH2 ? A ARG 49  NH2 
11 1 Y 1 A ARG 240  ? CG  ? A ARG 71  CG  
12 1 Y 1 A ARG 240  ? CD  ? A ARG 71  CD  
13 1 Y 1 A ARG 240  ? NE  ? A ARG 71  NE  
14 1 Y 1 A ARG 240  ? CZ  ? A ARG 71  CZ  
15 1 Y 1 A ARG 240  ? NH1 ? A ARG 71  NH1 
16 1 Y 1 A ARG 240  ? NH2 ? A ARG 71  NH2 
17 1 Y 1 A GLU 242  ? CG  ? A GLU 73  CG  
18 1 Y 1 A GLU 242  ? CD  ? A GLU 73  CD  
19 1 Y 1 A GLU 242  ? OE1 ? A GLU 73  OE1 
20 1 Y 1 A GLU 242  ? OE2 ? A GLU 73  OE2 
21 1 Y 1 A LYS 243  ? CD  ? A LYS 74  CD  
22 1 Y 1 A LYS 243  ? CE  ? A LYS 74  CE  
23 1 Y 1 A LYS 243  ? NZ  ? A LYS 74  NZ  
24 1 Y 1 A SER 272  ? OG  ? A SER 103 OG  
25 1 Y 1 A ARG 273  ? CG  ? A ARG 104 CG  
26 1 Y 1 A ARG 273  ? CD  ? A ARG 104 CD  
27 1 Y 1 A ARG 273  ? NE  ? A ARG 104 NE  
28 1 Y 1 A ARG 273  ? CZ  ? A ARG 104 CZ  
29 1 Y 1 A ARG 273  ? NH1 ? A ARG 104 NH1 
30 1 Y 1 A ARG 273  ? NH2 ? A ARG 104 NH2 
31 1 Y 1 A SER 276  ? OG  ? A SER 107 OG  
32 1 Y 1 A THR 277  ? OG1 ? A THR 108 OG1 
33 1 Y 1 A THR 277  ? CG2 ? A THR 108 CG2 
34 1 Y 1 A GLN 327  ? CG  ? A GLN 158 CG  
35 1 Y 1 A GLN 327  ? CD  ? A GLN 158 CD  
36 1 Y 1 A GLN 327  ? OE1 ? A GLN 158 OE1 
37 1 Y 1 A GLN 327  ? NE2 ? A GLN 158 NE2 
38 1 Y 1 A SER 364  ? OG  ? A SER 195 OG  
39 1 Y 1 A THR 365  ? OG1 ? A THR 196 OG1 
40 1 Y 1 A THR 365  ? CG2 ? A THR 196 CG2 
41 1 Y 1 A GLN 367  ? CG  ? A GLN 198 CG  
42 1 Y 1 A GLN 367  ? CD  ? A GLN 198 CD  
43 1 Y 1 A GLN 367  ? OE1 ? A GLN 198 OE1 
44 1 Y 1 A GLN 367  ? NE2 ? A GLN 198 NE2 
45 1 Y 1 A LYS 497  ? CE  ? A LYS 328 CE  
46 1 Y 1 A LYS 497  ? NZ  ? A LYS 328 NZ  
47 1 Y 1 A ASP 499  ? CG  ? A ASP 330 CG  
48 1 Y 1 A ASP 499  ? OD1 ? A ASP 330 OD1 
49 1 Y 1 A ASP 499  ? OD2 ? A ASP 330 OD2 
50 1 Y 1 B LYS 35   ? CD  ? B LYS 35  CD  
51 1 Y 1 B LYS 35   ? CE  ? B LYS 35  CE  
52 1 Y 1 B LYS 35   ? NZ  ? B LYS 35  NZ  
53 1 Y 1 B LYS 45   ? CE  ? B LYS 45  CE  
54 1 Y 1 B LYS 45   ? NZ  ? B LYS 45  NZ  
55 1 Y 1 B LYS 58   ? CD  ? B LYS 58  CD  
56 1 Y 1 B LYS 58   ? CE  ? B LYS 58  CE  
57 1 Y 1 B LYS 58   ? NZ  ? B LYS 58  NZ  
58 1 N 1 A TAK 1507 ? C1  ? J TAK 1   C1  
59 1 N 1 A TAK 1507 ? C2  ? J TAK 1   C2  
60 1 N 1 A TAK 1507 ? C3  ? J TAK 1   C3  
61 1 N 1 A TAK 1507 ? C4  ? J TAK 1   C4  
62 1 N 1 A TAK 1507 ? C5  ? J TAK 1   C5  
63 1 N 1 A TAK 1507 ? N1  ? J TAK 1   N1  
64 1 N 1 A TAK 1507 ? C6  ? J TAK 1   C6  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 170 ? A SER 1   
2  1 Y 1 A MET 171 ? A MET 2   
3  1 Y 1 A THR 172 ? A THR 3   
4  1 Y 1 A THR 173 ? A THR 4   
5  1 Y 1 A ASN 174 ? A ASN 5   
6  1 Y 1 A VAL 175 ? A VAL 6   
7  1 Y 1 A GLY 176 ? A GLY 7   
8  1 Y 1 A ASP 177 ? A ASP 8   
9  1 Y 1 A HIS 186 ? A HIS 17  
10 1 Y 1 A SER 187 ? A SER 18  
11 1 Y 1 A CYS 188 ? A CYS 19  
12 1 Y 1 A THR 189 ? A THR 20  
13 1 Y 1 A HIS 274 ? A HIS 105 
14 1 Y 1 A SER 275 ? A SER 106 
15 1 Y 1 A GLY 371 ? A GLY 202 
16 1 Y 1 A ASN 372 ? A ASN 203 
17 1 Y 1 A ASN 373 ? A ASN 204 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CITRATE ANION'                                                                FLC 
4 '6-[4-(2-piperidin-1-ylethoxy)phenyl]-3-pyridin-4-ylpyrazolo[1,5-a]pyrimidine' TAK 
5 1,2-ETHANEDIOL                                                                 EDO 
6 water                                                                          HOH 
#