data_4C2M
# 
_entry.id   4C2M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4C2M         
PDBE  EBI-58079    
WWPDB D_1290058079 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4C2M 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Engel, C.'     1 
'Sainsbury, S.' 2 
'Cheung, A.C.'  3 
'Kostrewa, D.'  4 
'Cramer, P.'    5 
# 
_citation.id                        primary 
_citation.title                     'RNA Polymerase I Structure and Transcription Regulation.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            502 
_citation.page_first                502 
_citation.page_last                 ? 
_citation.year                      2013 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24153182 
_citation.pdbx_database_id_DOI      10.1038/NATURE12712 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Engel, C.'     1 
primary 'Sainsbury, S.' 2 
primary 'Cheung, A.C.'  3 
primary 'Kostrewa, D.'  4 
primary 'Cramer, P.'    5 
# 
_cell.entry_id           4C2M 
_cell.length_a           122.740 
_cell.length_b           139.020 
_cell.length_c           209.550 
_cell.angle_alpha        108.06 
_cell.angle_beta         95.40 
_cell.angle_gamma        93.85 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4C2M 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4' 7729.969   2   ?       ? ? ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA49'                 46721.707  2   ?       ? ? ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA34'                 26933.518  2   ?       ? ? ? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA43'                 36264.852  4   ?       ? ? ? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190'                186676.969 2   2.7.7.6 ? ? ? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA135'                135910.328 2   2.7.7.6 ? ? ? 
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC1'        37732.613  2   ?       ? ? ? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA14'                 14599.128  2   ?       ? ? ? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1' 25117.094  2   ?       ? ? ? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2' 17931.834  2   ?       ? ? ? 
11 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3' 16525.363  2   ?       ? ? ? 
12 polymer     nat 'DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA12'                 13676.566  2   ?       ? ? ? 
13 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5' 8290.732   2   ?       ? ? ? 
14 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC2'        16167.860  2   ?       ? ? ? 
15 non-polymer syn 'ZINC ION'                                                    65.409     14  ?       ? ? ? 
16 non-polymer syn 'SULFATE ION'                                                 96.063     2   ?       ? ? ? 
17 water       nat water                                                         18.015     262 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'RNA POLYMERASES I\,II\,AND III SUBUNIT ABC4, ABC10-ALPHA, RPB12' 
2  'A49, DNA-DIRECTED RNA POLYMERASE I 49 KDA POLYPEPTIDE' 
3  'A34, DNA-DIRECTED DNA-DEPENDENT RNA POLYMERASE 34.5 KDA POLYPEPTIDE, A34.5, A34.5' 
4  'A43, DNA-DIRECTED DNA-DEPENDENT RNA POLYMERASE 36 KDA POLYPEPTIDE, A43' 
5  'A190, DNA-DIRECTED RNA POLYMERASE I 190 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE I LARGEST SUBUNIT' 
6  
;DNA-DIRECTED RNA POLYMERASE I 135 KDA POLYPEPTIDE, A135, DNA-DIRECTED RNA POLYMERASE I POLYPEPTIDE 2, RNA POLYMERASE I SUBUNIT 2, A135
;
7  'RNA POLYMERASES I AND III SUBUNIT AC1, C37, DNA-DIRECTED RN A POLYMERASES I AND III 40 KDA POLYPEPTIDE, AC40, C40, AC40' 
8  'A14, DNA-DIRECTED RNA POLYMERASE I 14 KDA POLYPEPTIDE, A14' 
9  'RNA POLYMERASES I, II, AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 27 KDA POLYPEPTIDE, RPB5' 
10 'RNA POLYMERASES I\,II\,AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 23 KDA POLYPEPTIDE, RPB6' 
11 
;RNA POLYMERASES I\,II\,AND III SUBUNIT ABC3, ABC14.4, ABC14.5, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 14.5 KDA POLYPEPTIDE, RPB8
;
12 'A12, A12.2, DNA-DIRECTED RNA POLYMERASE I 13.7 KDA POLYPEPTIDE, A12.2' 
13 
;RNA POLYMERASES I\,II\,AND III SUBUNIT ABC5, ABC10-BETA, ABC8, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 8.3 KDA POLYPEPTIDE, RPB10
;
14 'RNA POLYMERASES I AND III SUBUNIT AC2, DNA-DIRECTED R NA POLYMERASES I AND III 16 KDA POLYPEPTIDE, RPA19, AC19' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1,L     ? 
2  'polypeptide(L)' no no 
;MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGL
FNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAID
IVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNS
KYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFI
DPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVP
FKLPEMTRRGRGPRR
;
;MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGL
FNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAID
IVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNS
KYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFI
DPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVP
FKLPEMTRRGRGPRR
;
2,M     ? 
3  'polypeptide(L)' no no 
;MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTM
TIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDV
PKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
;
;MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTM
TIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDV
PKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
;
3,N     ? 
4  'polypeptide(L)' no no 
;MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGV
VLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKN
NIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDG
ESSDSD
;
;MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGV
VLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKN
NIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDG
ESSDSD
;
4,G,O,V ? 
5  'polypeptide(L)' no no 
;MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNED
EMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFS
PKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEV
KNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLN
DDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAA
RSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQ
LLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN
ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIF
KPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEV
YGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQ
EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVM
VSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRD
ADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
TLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSN
TAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSS
NSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMN
KVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLV
TEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNR
QGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA
;
;MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNED
EMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFS
PKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEV
KNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLN
DDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAA
RSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQ
LLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN
ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIF
KPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEV
YGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQ
EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVM
VSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRD
ADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
TLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSN
TAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSS
NSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMN
KVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLV
TEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNR
QGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA
;
A,P     ? 
6  'polypeptide(L)' no no 
;MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLN
SEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGG
LPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHL
QNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQ
EVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSR
IPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGL
YLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGY
GTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPA
YIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV
NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRI
GSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV
EPK
;
;MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLN
SEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGG
LPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHL
QNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQ
EVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSR
IPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGL
YLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGY
GTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPA
YIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV
NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRI
GSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV
EPK
;
B,Q     ? 
7  'polypeptide(L)' no no 
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
C,R     ? 
8  'polypeptide(L)' no no 
;MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDT
NLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE
;
;MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDT
NLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE
;
D,S     ? 
9  'polypeptide(L)' no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E,T     ? 
10 'polypeptide(L)' no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F,U     ? 
11 'polypeptide(L)' no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H,W     ? 
12 'polypeptide(L)' no no 
;MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGA
TIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
;
;MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGA
TIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
;
I,X     ? 
13 'polypeptide(L)' no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J,Y     ? 
14 'polypeptide(L)' no no 
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
K,Z     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    SER n 
1  3    ARG n 
1  4    GLU n 
1  5    GLY n 
1  6    PHE n 
1  7    GLN n 
1  8    ILE n 
1  9    PRO n 
1  10   THR n 
1  11   ASN n 
1  12   LEU n 
1  13   ASP n 
1  14   ALA n 
1  15   ALA n 
1  16   ALA n 
1  17   ALA n 
1  18   GLY n 
1  19   THR n 
1  20   SER n 
1  21   GLN n 
1  22   ALA n 
1  23   ARG n 
1  24   THR n 
1  25   ALA n 
1  26   THR n 
1  27   LEU n 
1  28   LYS n 
1  29   TYR n 
1  30   ILE n 
1  31   CYS n 
1  32   ALA n 
1  33   GLU n 
1  34   CYS n 
1  35   SER n 
1  36   SER n 
1  37   LYS n 
1  38   LEU n 
1  39   SER n 
1  40   LEU n 
1  41   SER n 
1  42   ARG n 
1  43   THR n 
1  44   ASP n 
1  45   ALA n 
1  46   VAL n 
1  47   ARG n 
1  48   CYS n 
1  49   LYS n 
1  50   ASP n 
1  51   CYS n 
1  52   GLY n 
1  53   HIS n 
1  54   ARG n 
1  55   ILE n 
1  56   LEU n 
1  57   LEU n 
1  58   LYS n 
1  59   ALA n 
1  60   ARG n 
1  61   THR n 
1  62   LYS n 
1  63   ARG n 
1  64   LEU n 
1  65   VAL n 
1  66   GLN n 
1  67   PHE n 
1  68   GLU n 
1  69   ALA n 
1  70   ARG n 
2  1    MET n 
2  2    SER n 
2  3    VAL n 
2  4    LYS n 
2  5    ARG n 
2  6    SER n 
2  7    VAL n 
2  8    SER n 
2  9    GLU n 
2  10   ILE n 
2  11   GLU n 
2  12   ILE n 
2  13   GLU n 
2  14   SER n 
2  15   VAL n 
2  16   GLN n 
2  17   ASP n 
2  18   GLN n 
2  19   PRO n 
2  20   SER n 
2  21   VAL n 
2  22   ALA n 
2  23   VAL n 
2  24   GLY n 
2  25   SER n 
2  26   PHE n 
2  27   PHE n 
2  28   LYS n 
2  29   GLY n 
2  30   PHE n 
2  31   ARG n 
2  32   ALA n 
2  33   PRO n 
2  34   SER n 
2  35   ASP n 
2  36   THR n 
2  37   THR n 
2  38   PHE n 
2  39   ASP n 
2  40   LEU n 
2  41   TYR n 
2  42   LYS n 
2  43   LYS n 
2  44   LYS n 
2  45   LYS n 
2  46   SER n 
2  47   GLU n 
2  48   LYS n 
2  49   ASP n 
2  50   GLU n 
2  51   PHE n 
2  52   VAL n 
2  53   LEU n 
2  54   HIS n 
2  55   GLY n 
2  56   GLU n 
2  57   ASN n 
2  58   GLU n 
2  59   ARG n 
2  60   LEU n 
2  61   GLU n 
2  62   TYR n 
2  63   GLU n 
2  64   GLY n 
2  65   TYR n 
2  66   THR n 
2  67   ASP n 
2  68   SER n 
2  69   SER n 
2  70   SER n 
2  71   GLN n 
2  72   ALA n 
2  73   SER n 
2  74   ASN n 
2  75   GLN n 
2  76   TYR n 
2  77   VAL n 
2  78   VAL n 
2  79   GLY n 
2  80   LEU n 
2  81   PHE n 
2  82   ASN n 
2  83   PRO n 
2  84   GLU n 
2  85   LYS n 
2  86   LYS n 
2  87   SER n 
2  88   ILE n 
2  89   GLN n 
2  90   LEU n 
2  91   TYR n 
2  92   LYS n 
2  93   ALA n 
2  94   PRO n 
2  95   VAL n 
2  96   LEU n 
2  97   VAL n 
2  98   SER n 
2  99   LYS n 
2  100  VAL n 
2  101  VAL n 
2  102  SER n 
2  103  LYS n 
2  104  SER n 
2  105  SER n 
2  106  LYS n 
2  107  ASN n 
2  108  LEU n 
2  109  ARG n 
2  110  GLY n 
2  111  PRO n 
2  112  LYS n 
2  113  ILE n 
2  114  LYS n 
2  115  SER n 
2  116  LYS n 
2  117  SER n 
2  118  ASP n 
2  119  THR n 
2  120  ARG n 
2  121  PRO n 
2  122  SER n 
2  123  ALA n 
2  124  LEU n 
2  125  ARG n 
2  126  ASN n 
2  127  ALA n 
2  128  LEU n 
2  129  GLY n 
2  130  GLU n 
2  131  ALA n 
2  132  PHE n 
2  133  GLY n 
2  134  THR n 
2  135  LYS n 
2  136  LYS n 
2  137  ALA n 
2  138  LYS n 
2  139  LYS n 
2  140  ALA n 
2  141  ILE n 
2  142  ALA n 
2  143  ASP n 
2  144  LEU n 
2  145  GLU n 
2  146  ARG n 
2  147  ASN n 
2  148  ARG n 
2  149  ILE n 
2  150  ASP n 
2  151  SER n 
2  152  ASP n 
2  153  LYS n 
2  154  LEU n 
2  155  THR n 
2  156  ASP n 
2  157  SER n 
2  158  ALA n 
2  159  ILE n 
2  160  ASP n 
2  161  ILE n 
2  162  VAL n 
2  163  ASP n 
2  164  SER n 
2  165  VAL n 
2  166  ARG n 
2  167  THR n 
2  168  ALA n 
2  169  SER n 
2  170  LYS n 
2  171  ASP n 
2  172  LEU n 
2  173  PRO n 
2  174  THR n 
2  175  ARG n 
2  176  ALA n 
2  177  GLN n 
2  178  LEU n 
2  179  ASP n 
2  180  GLU n 
2  181  ILE n 
2  182  THR n 
2  183  SER n 
2  184  ASN n 
2  185  ASP n 
2  186  ARG n 
2  187  PRO n 
2  188  THR n 
2  189  PRO n 
2  190  LEU n 
2  191  ALA n 
2  192  ASN n 
2  193  ILE n 
2  194  ASP n 
2  195  ALA n 
2  196  THR n 
2  197  ASP n 
2  198  VAL n 
2  199  GLU n 
2  200  GLN n 
2  201  ILE n 
2  202  TYR n 
2  203  PRO n 
2  204  ILE n 
2  205  GLU n 
2  206  SER n 
2  207  ILE n 
2  208  ILE n 
2  209  PRO n 
2  210  LYS n 
2  211  LYS n 
2  212  GLU n 
2  213  LEU n 
2  214  GLN n 
2  215  PHE n 
2  216  ILE n 
2  217  ARG n 
2  218  VAL n 
2  219  SER n 
2  220  SER n 
2  221  ILE n 
2  222  LEU n 
2  223  LYS n 
2  224  GLU n 
2  225  ALA n 
2  226  ASP n 
2  227  LYS n 
2  228  GLU n 
2  229  LYS n 
2  230  LYS n 
2  231  LEU n 
2  232  GLU n 
2  233  LEU n 
2  234  PHE n 
2  235  PRO n 
2  236  TYR n 
2  237  GLN n 
2  238  ASN n 
2  239  ASN n 
2  240  SER n 
2  241  LYS n 
2  242  TYR n 
2  243  VAL n 
2  244  ALA n 
2  245  LYS n 
2  246  LYS n 
2  247  LEU n 
2  248  ASP n 
2  249  SER n 
2  250  LEU n 
2  251  THR n 
2  252  GLN n 
2  253  PRO n 
2  254  SER n 
2  255  GLN n 
2  256  MET n 
2  257  THR n 
2  258  LYS n 
2  259  LEU n 
2  260  GLN n 
2  261  LEU n 
2  262  LEU n 
2  263  TYR n 
2  264  TYR n 
2  265  LEU n 
2  266  SER n 
2  267  LEU n 
2  268  LEU n 
2  269  LEU n 
2  270  GLY n 
2  271  VAL n 
2  272  TYR n 
2  273  GLU n 
2  274  ASN n 
2  275  ARG n 
2  276  ARG n 
2  277  VAL n 
2  278  ASN n 
2  279  ASN n 
2  280  LYS n 
2  281  THR n 
2  282  LYS n 
2  283  LEU n 
2  284  LEU n 
2  285  GLU n 
2  286  ARG n 
2  287  LEU n 
2  288  ASN n 
2  289  SER n 
2  290  PRO n 
2  291  PRO n 
2  292  GLU n 
2  293  ILE n 
2  294  LEU n 
2  295  VAL n 
2  296  ASP n 
2  297  GLY n 
2  298  ILE n 
2  299  LEU n 
2  300  SER n 
2  301  ARG n 
2  302  PHE n 
2  303  THR n 
2  304  VAL n 
2  305  ILE n 
2  306  LYS n 
2  307  PRO n 
2  308  GLY n 
2  309  GLN n 
2  310  PHE n 
2  311  GLY n 
2  312  ARG n 
2  313  SER n 
2  314  LYS n 
2  315  ASP n 
2  316  ARG n 
2  317  SER n 
2  318  TYR n 
2  319  PHE n 
2  320  ILE n 
2  321  ASP n 
2  322  PRO n 
2  323  GLN n 
2  324  ASN n 
2  325  GLU n 
2  326  ASP n 
2  327  LYS n 
2  328  ILE n 
2  329  LEU n 
2  330  CYS n 
2  331  TYR n 
2  332  ILE n 
2  333  LEU n 
2  334  ALA n 
2  335  ILE n 
2  336  ILE n 
2  337  MET n 
2  338  HIS n 
2  339  LEU n 
2  340  ASP n 
2  341  ASN n 
2  342  PHE n 
2  343  ILE n 
2  344  VAL n 
2  345  GLU n 
2  346  ILE n 
2  347  THR n 
2  348  PRO n 
2  349  LEU n 
2  350  ALA n 
2  351  HIS n 
2  352  GLU n 
2  353  LEU n 
2  354  ASN n 
2  355  LEU n 
2  356  LYS n 
2  357  PRO n 
2  358  SER n 
2  359  LYS n 
2  360  VAL n 
2  361  VAL n 
2  362  SER n 
2  363  LEU n 
2  364  PHE n 
2  365  ARG n 
2  366  VAL n 
2  367  LEU n 
2  368  GLY n 
2  369  ALA n 
2  370  ILE n 
2  371  VAL n 
2  372  LYS n 
2  373  GLY n 
2  374  ALA n 
2  375  THR n 
2  376  VAL n 
2  377  ALA n 
2  378  GLN n 
2  379  ALA n 
2  380  GLU n 
2  381  ALA n 
2  382  PHE n 
2  383  GLY n 
2  384  ILE n 
2  385  PRO n 
2  386  LYS n 
2  387  SER n 
2  388  THR n 
2  389  ALA n 
2  390  ALA n 
2  391  SER n 
2  392  TYR n 
2  393  LYS n 
2  394  ILE n 
2  395  ALA n 
2  396  THR n 
2  397  MET n 
2  398  LYS n 
2  399  VAL n 
2  400  PRO n 
2  401  PHE n 
2  402  LYS n 
2  403  LEU n 
2  404  PRO n 
2  405  GLU n 
2  406  MET n 
2  407  THR n 
2  408  ARG n 
2  409  ARG n 
2  410  GLY n 
2  411  ARG n 
2  412  GLY n 
2  413  PRO n 
2  414  ARG n 
2  415  ARG n 
3  1    MET n 
3  2    SER n 
3  3    LYS n 
3  4    LEU n 
3  5    SER n 
3  6    LYS n 
3  7    ASP n 
3  8    TYR n 
3  9    VAL n 
3  10   SER n 
3  11   ASP n 
3  12   SER n 
3  13   ASP n 
3  14   SER n 
3  15   ASP n 
3  16   ASP n 
3  17   GLU n 
3  18   VAL n 
3  19   ILE n 
3  20   SER n 
3  21   ASN n 
3  22   GLU n 
3  23   PHE n 
3  24   SER n 
3  25   ILE n 
3  26   PRO n 
3  27   ASP n 
3  28   GLY n 
3  29   PHE n 
3  30   LYS n 
3  31   LYS n 
3  32   CYS n 
3  33   LYS n 
3  34   HIS n 
3  35   LEU n 
3  36   LYS n 
3  37   ASN n 
3  38   PHE n 
3  39   PRO n 
3  40   LEU n 
3  41   ASN n 
3  42   GLY n 
3  43   ASP n 
3  44   ASN n 
3  45   LYS n 
3  46   LYS n 
3  47   LYS n 
3  48   ALA n 
3  49   LYS n 
3  50   GLN n 
3  51   GLN n 
3  52   GLN n 
3  53   VAL n 
3  54   TRP n 
3  55   LEU n 
3  56   ILE n 
3  57   LYS n 
3  58   PHE n 
3  59   PRO n 
3  60   SER n 
3  61   ASN n 
3  62   VAL n 
3  63   ASP n 
3  64   ILE n 
3  65   SER n 
3  66   LYS n 
3  67   LEU n 
3  68   LYS n 
3  69   SER n 
3  70   LEU n 
3  71   PRO n 
3  72   VAL n 
3  73   ASP n 
3  74   PHE n 
3  75   GLU n 
3  76   SER n 
3  77   SER n 
3  78   THR n 
3  79   THR n 
3  80   MET n 
3  81   THR n 
3  82   ILE n 
3  83   ASP n 
3  84   LYS n 
3  85   HIS n 
3  86   ASP n 
3  87   TYR n 
3  88   LYS n 
3  89   ILE n 
3  90   MET n 
3  91   ASP n 
3  92   ASP n 
3  93   THR n 
3  94   ASP n 
3  95   ILE n 
3  96   GLU n 
3  97   SER n 
3  98   SER n 
3  99   LEU n 
3  100  THR n 
3  101  GLN n 
3  102  ASP n 
3  103  ASN n 
3  104  LEU n 
3  105  SER n 
3  106  ASN n 
3  107  MET n 
3  108  THR n 
3  109  LEU n 
3  110  LEU n 
3  111  VAL n 
3  112  PRO n 
3  113  SER n 
3  114  GLU n 
3  115  SER n 
3  116  LYS n 
3  117  GLU n 
3  118  SER n 
3  119  LEU n 
3  120  LYS n 
3  121  ILE n 
3  122  ALA n 
3  123  SER n 
3  124  THR n 
3  125  ALA n 
3  126  LYS n 
3  127  ASP n 
3  128  ASN n 
3  129  ALA n 
3  130  PRO n 
3  131  LEU n 
3  132  GLN n 
3  133  PHE n 
3  134  ASP n 
3  135  LYS n 
3  136  VAL n 
3  137  PHE n 
3  138  SER n 
3  139  VAL n 
3  140  SER n 
3  141  GLU n 
3  142  THR n 
3  143  ALA n 
3  144  LYS n 
3  145  ILE n 
3  146  PRO n 
3  147  ALA n 
3  148  ILE n 
3  149  ASP n 
3  150  TYR n 
3  151  SER n 
3  152  LYS n 
3  153  VAL n 
3  154  ARG n 
3  155  VAL n 
3  156  PRO n 
3  157  ARG n 
3  158  LYS n 
3  159  ASP n 
3  160  VAL n 
3  161  PRO n 
3  162  LYS n 
3  163  VAL n 
3  164  GLU n 
3  165  GLY n 
3  166  LEU n 
3  167  LYS n 
3  168  LEU n 
3  169  GLU n 
3  170  HIS n 
3  171  PHE n 
3  172  ALA n 
3  173  THR n 
3  174  GLY n 
3  175  TYR n 
3  176  ASP n 
3  177  ALA n 
3  178  GLU n 
3  179  ASP n 
3  180  PHE n 
3  181  HIS n 
3  182  VAL n 
3  183  ALA n 
3  184  GLU n 
3  185  GLU n 
3  186  VAL n 
3  187  LYS n 
3  188  GLU n 
3  189  ASN n 
3  190  LYS n 
3  191  LYS n 
3  192  GLU n 
3  193  PRO n 
3  194  LYS n 
3  195  LYS n 
3  196  ARG n 
3  197  SER n 
3  198  HIS n 
3  199  HIS n 
3  200  ASP n 
3  201  ASP n 
3  202  GLU n 
3  203  GLU n 
3  204  GLU n 
3  205  SER n 
3  206  SER n 
3  207  GLU n 
3  208  LYS n 
3  209  LYS n 
3  210  LYS n 
3  211  LYS n 
3  212  LYS n 
3  213  LYS n 
3  214  GLU n 
3  215  LYS n 
3  216  ARG n 
3  217  GLU n 
3  218  LYS n 
3  219  ARG n 
3  220  GLU n 
3  221  LYS n 
3  222  LYS n 
3  223  ASP n 
3  224  LYS n 
3  225  LYS n 
3  226  ASP n 
3  227  LYS n 
3  228  LYS n 
3  229  LYS n 
3  230  LYS n 
3  231  HIS n 
3  232  ARG n 
3  233  ASP n 
4  1    MET n 
4  2    SER n 
4  3    GLN n 
4  4    VAL n 
4  5    LYS n 
4  6    ARG n 
4  7    ALA n 
4  8    ASN n 
4  9    GLU n 
4  10   ASN n 
4  11   ARG n 
4  12   GLU n 
4  13   THR n 
4  14   ALA n 
4  15   ARG n 
4  16   PHE n 
4  17   ILE n 
4  18   LYS n 
4  19   LYS n 
4  20   HIS n 
4  21   LYS n 
4  22   LYS n 
4  23   GLN n 
4  24   VAL n 
4  25   THR n 
4  26   ASN n 
4  27   PRO n 
4  28   ILE n 
4  29   ASP n 
4  30   GLU n 
4  31   LYS n 
4  32   ASN n 
4  33   GLY n 
4  34   THR n 
4  35   SER n 
4  36   ASN n 
4  37   CYS n 
4  38   ILE n 
4  39   VAL n 
4  40   ARG n 
4  41   VAL n 
4  42   PRO n 
4  43   ILE n 
4  44   ALA n 
4  45   LEU n 
4  46   TYR n 
4  47   VAL n 
4  48   SER n 
4  49   LEU n 
4  50   ALA n 
4  51   PRO n 
4  52   MET n 
4  53   TYR n 
4  54   LEU n 
4  55   GLU n 
4  56   ASN n 
4  57   PRO n 
4  58   LEU n 
4  59   GLN n 
4  60   GLY n 
4  61   VAL n 
4  62   MET n 
4  63   LYS n 
4  64   GLN n 
4  65   HIS n 
4  66   LEU n 
4  67   ASN n 
4  68   PRO n 
4  69   LEU n 
4  70   VAL n 
4  71   MET n 
4  72   LYS n 
4  73   TYR n 
4  74   ASN n 
4  75   ASN n 
4  76   LYS n 
4  77   VAL n 
4  78   GLY n 
4  79   GLY n 
4  80   VAL n 
4  81   VAL n 
4  82   LEU n 
4  83   GLY n 
4  84   TYR n 
4  85   GLU n 
4  86   GLY n 
4  87   LEU n 
4  88   LYS n 
4  89   ILE n 
4  90   LEU n 
4  91   ASP n 
4  92   ALA n 
4  93   ASP n 
4  94   PRO n 
4  95   LEU n 
4  96   SER n 
4  97   LYS n 
4  98   GLU n 
4  99   ASP n 
4  100  THR n 
4  101  SER n 
4  102  GLU n 
4  103  LYS n 
4  104  LEU n 
4  105  ILE n 
4  106  LYS n 
4  107  ILE n 
4  108  THR n 
4  109  PRO n 
4  110  ASP n 
4  111  THR n 
4  112  PRO n 
4  113  PHE n 
4  114  GLY n 
4  115  PHE n 
4  116  THR n 
4  117  TRP n 
4  118  CYS n 
4  119  HIS n 
4  120  VAL n 
4  121  ASN n 
4  122  LEU n 
4  123  TYR n 
4  124  VAL n 
4  125  TRP n 
4  126  GLN n 
4  127  PRO n 
4  128  GLN n 
4  129  VAL n 
4  130  GLY n 
4  131  ASP n 
4  132  VAL n 
4  133  LEU n 
4  134  GLU n 
4  135  GLY n 
4  136  TYR n 
4  137  ILE n 
4  138  PHE n 
4  139  ILE n 
4  140  GLN n 
4  141  SER n 
4  142  ALA n 
4  143  SER n 
4  144  HIS n 
4  145  ILE n 
4  146  GLY n 
4  147  LEU n 
4  148  LEU n 
4  149  ILE n 
4  150  HIS n 
4  151  ASP n 
4  152  ALA n 
4  153  PHE n 
4  154  ASN n 
4  155  ALA n 
4  156  SER n 
4  157  ILE n 
4  158  LYS n 
4  159  LYS n 
4  160  ASN n 
4  161  ASN n 
4  162  ILE n 
4  163  PRO n 
4  164  VAL n 
4  165  ASP n 
4  166  TRP n 
4  167  THR n 
4  168  PHE n 
4  169  VAL n 
4  170  HIS n 
4  171  ASN n 
4  172  ASP n 
4  173  VAL n 
4  174  GLU n 
4  175  GLU n 
4  176  ASP n 
4  177  ALA n 
4  178  ASP n 
4  179  VAL n 
4  180  ILE n 
4  181  ASN n 
4  182  THR n 
4  183  ASP n 
4  184  GLU n 
4  185  ASN n 
4  186  ASN n 
4  187  GLY n 
4  188  ASN n 
4  189  ASN n 
4  190  ASN n 
4  191  ASN n 
4  192  GLU n 
4  193  ASP n 
4  194  ASN n 
4  195  LYS n 
4  196  ASP n 
4  197  SER n 
4  198  ASN n 
4  199  GLY n 
4  200  GLY n 
4  201  SER n 
4  202  ASN n 
4  203  SER n 
4  204  LEU n 
4  205  GLY n 
4  206  LYS n 
4  207  PHE n 
4  208  SER n 
4  209  PHE n 
4  210  GLY n 
4  211  ASN n 
4  212  ARG n 
4  213  SER n 
4  214  LEU n 
4  215  GLY n 
4  216  HIS n 
4  217  TRP n 
4  218  VAL n 
4  219  ASP n 
4  220  SER n 
4  221  ASN n 
4  222  GLY n 
4  223  GLU n 
4  224  PRO n 
4  225  ILE n 
4  226  ASP n 
4  227  GLY n 
4  228  LYS n 
4  229  LEU n 
4  230  ARG n 
4  231  PHE n 
4  232  THR n 
4  233  VAL n 
4  234  ARG n 
4  235  ASN n 
4  236  VAL n 
4  237  HIS n 
4  238  THR n 
4  239  THR n 
4  240  GLY n 
4  241  ARG n 
4  242  VAL n 
4  243  VAL n 
4  244  SER n 
4  245  VAL n 
4  246  ASP n 
4  247  GLY n 
4  248  THR n 
4  249  LEU n 
4  250  ILE n 
4  251  SER n 
4  252  ASP n 
4  253  ALA n 
4  254  ASP n 
4  255  GLU n 
4  256  GLU n 
4  257  GLY n 
4  258  ASN n 
4  259  GLY n 
4  260  TYR n 
4  261  ASN n 
4  262  SER n 
4  263  SER n 
4  264  ARG n 
4  265  SER n 
4  266  GLN n 
4  267  ALA n 
4  268  GLU n 
4  269  SER n 
4  270  LEU n 
4  271  PRO n 
4  272  ILE n 
4  273  VAL n 
4  274  SER n 
4  275  ASN n 
4  276  LYS n 
4  277  LYS n 
4  278  ILE n 
4  279  VAL n 
4  280  PHE n 
4  281  ASP n 
4  282  ASP n 
4  283  GLU n 
4  284  VAL n 
4  285  SER n 
4  286  ILE n 
4  287  GLU n 
4  288  ASN n 
4  289  LYS n 
4  290  GLU n 
4  291  SER n 
4  292  HIS n 
4  293  LYS n 
4  294  GLU n 
4  295  LEU n 
4  296  ASP n 
4  297  LEU n 
4  298  PRO n 
4  299  GLU n 
4  300  VAL n 
4  301  LYS n 
4  302  GLU n 
4  303  ASP n 
4  304  ASN n 
4  305  GLY n 
4  306  SER n 
4  307  GLU n 
4  308  ILE n 
4  309  VAL n 
4  310  TYR n 
4  311  GLU n 
4  312  GLU n 
4  313  ASN n 
4  314  THR n 
4  315  SER n 
4  316  GLU n 
4  317  SER n 
4  318  ASN n 
4  319  ASP n 
4  320  GLY n 
4  321  GLU n 
4  322  SER n 
4  323  SER n 
4  324  ASP n 
4  325  SER n 
4  326  ASP n 
5  1    MET n 
5  2    ASP n 
5  3    ILE n 
5  4    SER n 
5  5    LYS n 
5  6    PRO n 
5  7    VAL n 
5  8    GLY n 
5  9    SER n 
5  10   GLU n 
5  11   ILE n 
5  12   THR n 
5  13   SER n 
5  14   VAL n 
5  15   ASP n 
5  16   PHE n 
5  17   GLY n 
5  18   ILE n 
5  19   LEU n 
5  20   THR n 
5  21   ALA n 
5  22   LYS n 
5  23   GLU n 
5  24   ILE n 
5  25   ARG n 
5  26   ASN n 
5  27   LEU n 
5  28   SER n 
5  29   ALA n 
5  30   LYS n 
5  31   GLN n 
5  32   ILE n 
5  33   THR n 
5  34   ASN n 
5  35   PRO n 
5  36   THR n 
5  37   VAL n 
5  38   LEU n 
5  39   ASP n 
5  40   ASN n 
5  41   LEU n 
5  42   GLY n 
5  43   HIS n 
5  44   PRO n 
5  45   VAL n 
5  46   SER n 
5  47   GLY n 
5  48   GLY n 
5  49   LEU n 
5  50   TYR n 
5  51   ASP n 
5  52   LEU n 
5  53   ALA n 
5  54   LEU n 
5  55   GLY n 
5  56   ALA n 
5  57   PHE n 
5  58   LEU n 
5  59   ARG n 
5  60   ASN n 
5  61   LEU n 
5  62   CYS n 
5  63   SER n 
5  64   THR n 
5  65   CYS n 
5  66   GLY n 
5  67   LEU n 
5  68   ASP n 
5  69   GLU n 
5  70   LYS n 
5  71   PHE n 
5  72   CYS n 
5  73   PRO n 
5  74   GLY n 
5  75   HIS n 
5  76   GLN n 
5  77   GLY n 
5  78   HIS n 
5  79   ILE n 
5  80   GLU n 
5  81   LEU n 
5  82   PRO n 
5  83   VAL n 
5  84   PRO n 
5  85   CYS n 
5  86   TYR n 
5  87   ASN n 
5  88   PRO n 
5  89   LEU n 
5  90   PHE n 
5  91   PHE n 
5  92   ASN n 
5  93   GLN n 
5  94   LEU n 
5  95   TYR n 
5  96   ILE n 
5  97   TYR n 
5  98   LEU n 
5  99   ARG n 
5  100  ALA n 
5  101  SER n 
5  102  CYS n 
5  103  LEU n 
5  104  PHE n 
5  105  CYS n 
5  106  HIS n 
5  107  HIS n 
5  108  PHE n 
5  109  ARG n 
5  110  LEU n 
5  111  LYS n 
5  112  SER n 
5  113  VAL n 
5  114  GLU n 
5  115  VAL n 
5  116  HIS n 
5  117  ARG n 
5  118  TYR n 
5  119  ALA n 
5  120  CYS n 
5  121  LYS n 
5  122  LEU n 
5  123  ARG n 
5  124  LEU n 
5  125  LEU n 
5  126  GLN n 
5  127  TYR n 
5  128  GLY n 
5  129  LEU n 
5  130  ILE n 
5  131  ASP n 
5  132  GLU n 
5  133  SER n 
5  134  TYR n 
5  135  LYS n 
5  136  LEU n 
5  137  ASP n 
5  138  GLU n 
5  139  ILE n 
5  140  THR n 
5  141  LEU n 
5  142  GLY n 
5  143  SER n 
5  144  LEU n 
5  145  ASN n 
5  146  SER n 
5  147  SER n 
5  148  MET n 
5  149  TYR n 
5  150  THR n 
5  151  ASP n 
5  152  ASP n 
5  153  GLU n 
5  154  ALA n 
5  155  ILE n 
5  156  GLU n 
5  157  ASP n 
5  158  ASN n 
5  159  GLU n 
5  160  ASP n 
5  161  GLU n 
5  162  MET n 
5  163  ASP n 
5  164  GLY n 
5  165  GLU n 
5  166  GLY n 
5  167  SER n 
5  168  LYS n 
5  169  GLN n 
5  170  SER n 
5  171  LYS n 
5  172  ASP n 
5  173  ILE n 
5  174  SER n 
5  175  SER n 
5  176  THR n 
5  177  LEU n 
5  178  LEU n 
5  179  ASN n 
5  180  GLU n 
5  181  LEU n 
5  182  LYS n 
5  183  SER n 
5  184  LYS n 
5  185  ARG n 
5  186  SER n 
5  187  GLU n 
5  188  TYR n 
5  189  VAL n 
5  190  ASP n 
5  191  MET n 
5  192  ALA n 
5  193  ILE n 
5  194  ALA n 
5  195  LYS n 
5  196  ALA n 
5  197  LEU n 
5  198  SER n 
5  199  ASP n 
5  200  GLY n 
5  201  ARG n 
5  202  THR n 
5  203  THR n 
5  204  GLU n 
5  205  ARG n 
5  206  GLY n 
5  207  SER n 
5  208  PHE n 
5  209  THR n 
5  210  ALA n 
5  211  THR n 
5  212  VAL n 
5  213  ASN n 
5  214  ASP n 
5  215  GLU n 
5  216  ARG n 
5  217  LYS n 
5  218  LYS n 
5  219  LEU n 
5  220  VAL n 
5  221  HIS n 
5  222  GLU n 
5  223  PHE n 
5  224  HIS n 
5  225  LYS n 
5  226  LYS n 
5  227  LEU n 
5  228  LEU n 
5  229  SER n 
5  230  ARG n 
5  231  GLY n 
5  232  LYS n 
5  233  CYS n 
5  234  ASP n 
5  235  ASN n 
5  236  CYS n 
5  237  GLY n 
5  238  MET n 
5  239  PHE n 
5  240  SER n 
5  241  PRO n 
5  242  LYS n 
5  243  PHE n 
5  244  ARG n 
5  245  LYS n 
5  246  ASP n 
5  247  GLY n 
5  248  PHE n 
5  249  THR n 
5  250  LYS n 
5  251  ILE n 
5  252  PHE n 
5  253  GLU n 
5  254  THR n 
5  255  ALA n 
5  256  LEU n 
5  257  ASN n 
5  258  GLU n 
5  259  LYS n 
5  260  GLN n 
5  261  ILE n 
5  262  THR n 
5  263  ASN n 
5  264  ASN n 
5  265  ARG n 
5  266  VAL n 
5  267  LYS n 
5  268  GLY n 
5  269  PHE n 
5  270  ILE n 
5  271  ARG n 
5  272  GLN n 
5  273  ASP n 
5  274  MET n 
5  275  ILE n 
5  276  LYS n 
5  277  LYS n 
5  278  GLN n 
5  279  LYS n 
5  280  GLN n 
5  281  ALA n 
5  282  LYS n 
5  283  LYS n 
5  284  LEU n 
5  285  ASP n 
5  286  GLY n 
5  287  SER n 
5  288  ASN n 
5  289  GLU n 
5  290  ALA n 
5  291  SER n 
5  292  ALA n 
5  293  ASN n 
5  294  ASP n 
5  295  GLU n 
5  296  GLU n 
5  297  SER n 
5  298  PHE n 
5  299  ASP n 
5  300  VAL n 
5  301  GLY n 
5  302  ARG n 
5  303  ASN n 
5  304  PRO n 
5  305  THR n 
5  306  THR n 
5  307  ARG n 
5  308  PRO n 
5  309  LYS n 
5  310  THR n 
5  311  GLY n 
5  312  SER n 
5  313  THR n 
5  314  TYR n 
5  315  ILE n 
5  316  LEU n 
5  317  SER n 
5  318  THR n 
5  319  GLU n 
5  320  VAL n 
5  321  LYS n 
5  322  ASN n 
5  323  ILE n 
5  324  LEU n 
5  325  ASP n 
5  326  THR n 
5  327  VAL n 
5  328  PHE n 
5  329  ARG n 
5  330  LYS n 
5  331  GLU n 
5  332  GLN n 
5  333  CYS n 
5  334  VAL n 
5  335  LEU n 
5  336  GLN n 
5  337  TYR n 
5  338  VAL n 
5  339  PHE n 
5  340  HIS n 
5  341  SER n 
5  342  ARG n 
5  343  PRO n 
5  344  ASN n 
5  345  LEU n 
5  346  SER n 
5  347  ARG n 
5  348  LYS n 
5  349  LEU n 
5  350  VAL n 
5  351  LYS n 
5  352  ALA n 
5  353  ASP n 
5  354  SER n 
5  355  PHE n 
5  356  PHE n 
5  357  MET n 
5  358  ASP n 
5  359  VAL n 
5  360  LEU n 
5  361  VAL n 
5  362  VAL n 
5  363  PRO n 
5  364  PRO n 
5  365  THR n 
5  366  ARG n 
5  367  PHE n 
5  368  ARG n 
5  369  LEU n 
5  370  PRO n 
5  371  SER n 
5  372  LYS n 
5  373  LEU n 
5  374  GLY n 
5  375  GLU n 
5  376  GLU n 
5  377  VAL n 
5  378  HIS n 
5  379  GLU n 
5  380  ASN n 
5  381  SER n 
5  382  GLN n 
5  383  ASN n 
5  384  GLN n 
5  385  LEU n 
5  386  LEU n 
5  387  SER n 
5  388  LYS n 
5  389  VAL n 
5  390  LEU n 
5  391  THR n 
5  392  THR n 
5  393  SER n 
5  394  LEU n 
5  395  LEU n 
5  396  ILE n 
5  397  ARG n 
5  398  ASP n 
5  399  LEU n 
5  400  ASN n 
5  401  ASP n 
5  402  ASP n 
5  403  LEU n 
5  404  SER n 
5  405  LYS n 
5  406  LEU n 
5  407  GLN n 
5  408  LYS n 
5  409  ASP n 
5  410  LYS n 
5  411  VAL n 
5  412  SER n 
5  413  LEU n 
5  414  GLU n 
5  415  ASP n 
5  416  ARG n 
5  417  ARG n 
5  418  VAL n 
5  419  ILE n 
5  420  PHE n 
5  421  SER n 
5  422  ARG n 
5  423  LEU n 
5  424  MET n 
5  425  ASN n 
5  426  ALA n 
5  427  PHE n 
5  428  VAL n 
5  429  THR n 
5  430  ILE n 
5  431  GLN n 
5  432  ASN n 
5  433  ASP n 
5  434  VAL n 
5  435  ASN n 
5  436  ALA n 
5  437  PHE n 
5  438  ILE n 
5  439  ASP n 
5  440  SER n 
5  441  THR n 
5  442  LYS n 
5  443  ALA n 
5  444  GLN n 
5  445  GLY n 
5  446  ARG n 
5  447  THR n 
5  448  SER n 
5  449  GLY n 
5  450  LYS n 
5  451  VAL n 
5  452  PRO n 
5  453  ILE n 
5  454  PRO n 
5  455  GLY n 
5  456  VAL n 
5  457  LYS n 
5  458  GLN n 
5  459  ALA n 
5  460  LEU n 
5  461  GLU n 
5  462  LYS n 
5  463  LYS n 
5  464  GLU n 
5  465  GLY n 
5  466  LEU n 
5  467  PHE n 
5  468  ARG n 
5  469  LYS n 
5  470  HIS n 
5  471  MET n 
5  472  MET n 
5  473  GLY n 
5  474  LYS n 
5  475  ARG n 
5  476  VAL n 
5  477  ASN n 
5  478  TYR n 
5  479  ALA n 
5  480  ALA n 
5  481  ARG n 
5  482  SER n 
5  483  VAL n 
5  484  ILE n 
5  485  SER n 
5  486  PRO n 
5  487  ASP n 
5  488  PRO n 
5  489  ASN n 
5  490  ILE n 
5  491  GLU n 
5  492  THR n 
5  493  ASN n 
5  494  GLU n 
5  495  ILE n 
5  496  GLY n 
5  497  VAL n 
5  498  PRO n 
5  499  PRO n 
5  500  VAL n 
5  501  PHE n 
5  502  ALA n 
5  503  VAL n 
5  504  LYS n 
5  505  LEU n 
5  506  THR n 
5  507  TYR n 
5  508  PRO n 
5  509  GLU n 
5  510  PRO n 
5  511  VAL n 
5  512  THR n 
5  513  ALA n 
5  514  TYR n 
5  515  ASN n 
5  516  ILE n 
5  517  ALA n 
5  518  GLU n 
5  519  LEU n 
5  520  ARG n 
5  521  GLN n 
5  522  ALA n 
5  523  VAL n 
5  524  ILE n 
5  525  ASN n 
5  526  GLY n 
5  527  PRO n 
5  528  ASP n 
5  529  LYS n 
5  530  TRP n 
5  531  PRO n 
5  532  GLY n 
5  533  ALA n 
5  534  THR n 
5  535  GLN n 
5  536  ILE n 
5  537  GLN n 
5  538  ASN n 
5  539  GLU n 
5  540  ASP n 
5  541  GLY n 
5  542  SER n 
5  543  LEU n 
5  544  VAL n 
5  545  SER n 
5  546  LEU n 
5  547  ILE n 
5  548  GLY n 
5  549  MET n 
5  550  SER n 
5  551  VAL n 
5  552  GLU n 
5  553  GLN n 
5  554  ARG n 
5  555  LYS n 
5  556  ALA n 
5  557  LEU n 
5  558  ALA n 
5  559  ASN n 
5  560  GLN n 
5  561  LEU n 
5  562  LEU n 
5  563  THR n 
5  564  PRO n 
5  565  SER n 
5  566  SER n 
5  567  ASN n 
5  568  VAL n 
5  569  SER n 
5  570  THR n 
5  571  HIS n 
5  572  THR n 
5  573  LEU n 
5  574  ASN n 
5  575  LYS n 
5  576  LYS n 
5  577  VAL n 
5  578  TYR n 
5  579  ARG n 
5  580  HIS n 
5  581  ILE n 
5  582  LYS n 
5  583  ASN n 
5  584  ARG n 
5  585  ASP n 
5  586  VAL n 
5  587  VAL n 
5  588  LEU n 
5  589  MET n 
5  590  ASN n 
5  591  ARG n 
5  592  GLN n 
5  593  PRO n 
5  594  THR n 
5  595  LEU n 
5  596  HIS n 
5  597  LYS n 
5  598  ALA n 
5  599  SER n 
5  600  MET n 
5  601  MET n 
5  602  GLY n 
5  603  HIS n 
5  604  LYS n 
5  605  VAL n 
5  606  ARG n 
5  607  VAL n 
5  608  LEU n 
5  609  PRO n 
5  610  ASN n 
5  611  GLU n 
5  612  LYS n 
5  613  THR n 
5  614  LEU n 
5  615  ARG n 
5  616  LEU n 
5  617  HIS n 
5  618  TYR n 
5  619  ALA n 
5  620  ASN n 
5  621  THR n 
5  622  GLY n 
5  623  ALA n 
5  624  TYR n 
5  625  ASN n 
5  626  ALA n 
5  627  ASP n 
5  628  PHE n 
5  629  ASP n 
5  630  GLY n 
5  631  ASP n 
5  632  GLU n 
5  633  MET n 
5  634  ASN n 
5  635  MET n 
5  636  HIS n 
5  637  PHE n 
5  638  PRO n 
5  639  GLN n 
5  640  ASN n 
5  641  GLU n 
5  642  ASN n 
5  643  ALA n 
5  644  ARG n 
5  645  ALA n 
5  646  GLU n 
5  647  ALA n 
5  648  LEU n 
5  649  ASN n 
5  650  LEU n 
5  651  ALA n 
5  652  ASN n 
5  653  THR n 
5  654  ASP n 
5  655  SER n 
5  656  GLN n 
5  657  TYR n 
5  658  LEU n 
5  659  THR n 
5  660  PRO n 
5  661  THR n 
5  662  SER n 
5  663  GLY n 
5  664  SER n 
5  665  PRO n 
5  666  VAL n 
5  667  ARG n 
5  668  GLY n 
5  669  LEU n 
5  670  ILE n 
5  671  GLN n 
5  672  ASP n 
5  673  HIS n 
5  674  ILE n 
5  675  SER n 
5  676  ALA n 
5  677  GLY n 
5  678  VAL n 
5  679  TRP n 
5  680  LEU n 
5  681  THR n 
5  682  SER n 
5  683  LYS n 
5  684  ASP n 
5  685  SER n 
5  686  PHE n 
5  687  PHE n 
5  688  THR n 
5  689  ARG n 
5  690  GLU n 
5  691  GLN n 
5  692  TYR n 
5  693  GLN n 
5  694  GLN n 
5  695  TYR n 
5  696  ILE n 
5  697  TYR n 
5  698  GLY n 
5  699  CYS n 
5  700  ILE n 
5  701  ARG n 
5  702  PRO n 
5  703  GLU n 
5  704  ASP n 
5  705  GLY n 
5  706  HIS n 
5  707  THR n 
5  708  THR n 
5  709  ARG n 
5  710  SER n 
5  711  LYS n 
5  712  ILE n 
5  713  VAL n 
5  714  THR n 
5  715  LEU n 
5  716  PRO n 
5  717  PRO n 
5  718  THR n 
5  719  ILE n 
5  720  PHE n 
5  721  LYS n 
5  722  PRO n 
5  723  TYR n 
5  724  PRO n 
5  725  LEU n 
5  726  TRP n 
5  727  THR n 
5  728  GLY n 
5  729  LYS n 
5  730  GLN n 
5  731  ILE n 
5  732  ILE n 
5  733  THR n 
5  734  THR n 
5  735  VAL n 
5  736  LEU n 
5  737  LEU n 
5  738  ASN n 
5  739  VAL n 
5  740  THR n 
5  741  PRO n 
5  742  PRO n 
5  743  ASP n 
5  744  MET n 
5  745  PRO n 
5  746  GLY n 
5  747  ILE n 
5  748  ASN n 
5  749  LEU n 
5  750  ILE n 
5  751  SER n 
5  752  LYS n 
5  753  ASN n 
5  754  LYS n 
5  755  ILE n 
5  756  LYS n 
5  757  ASN n 
5  758  GLU n 
5  759  TYR n 
5  760  TRP n 
5  761  GLY n 
5  762  LYS n 
5  763  GLY n 
5  764  SER n 
5  765  LEU n 
5  766  GLU n 
5  767  ASN n 
5  768  GLU n 
5  769  VAL n 
5  770  LEU n 
5  771  PHE n 
5  772  LYS n 
5  773  ASP n 
5  774  GLY n 
5  775  ALA n 
5  776  LEU n 
5  777  LEU n 
5  778  CYS n 
5  779  GLY n 
5  780  ILE n 
5  781  LEU n 
5  782  ASP n 
5  783  LYS n 
5  784  SER n 
5  785  GLN n 
5  786  TYR n 
5  787  GLY n 
5  788  ALA n 
5  789  SER n 
5  790  LYS n 
5  791  TYR n 
5  792  GLY n 
5  793  ILE n 
5  794  VAL n 
5  795  HIS n 
5  796  SER n 
5  797  LEU n 
5  798  HIS n 
5  799  GLU n 
5  800  VAL n 
5  801  TYR n 
5  802  GLY n 
5  803  PRO n 
5  804  GLU n 
5  805  VAL n 
5  806  ALA n 
5  807  ALA n 
5  808  LYS n 
5  809  VAL n 
5  810  LEU n 
5  811  SER n 
5  812  VAL n 
5  813  LEU n 
5  814  GLY n 
5  815  ARG n 
5  816  LEU n 
5  817  PHE n 
5  818  THR n 
5  819  ASN n 
5  820  TYR n 
5  821  ILE n 
5  822  THR n 
5  823  ALA n 
5  824  THR n 
5  825  ALA n 
5  826  PHE n 
5  827  THR n 
5  828  CYS n 
5  829  GLY n 
5  830  MET n 
5  831  ASP n 
5  832  ASP n 
5  833  LEU n 
5  834  ARG n 
5  835  LEU n 
5  836  THR n 
5  837  ALA n 
5  838  GLU n 
5  839  GLY n 
5  840  ASN n 
5  841  LYS n 
5  842  TRP n 
5  843  ARG n 
5  844  THR n 
5  845  ASP n 
5  846  ILE n 
5  847  LEU n 
5  848  LYS n 
5  849  THR n 
5  850  SER n 
5  851  VAL n 
5  852  ASP n 
5  853  THR n 
5  854  GLY n 
5  855  ARG n 
5  856  GLU n 
5  857  ALA n 
5  858  ALA n 
5  859  ALA n 
5  860  GLU n 
5  861  VAL n 
5  862  THR n 
5  863  ASN n 
5  864  LEU n 
5  865  ASP n 
5  866  LYS n 
5  867  ASP n 
5  868  THR n 
5  869  PRO n 
5  870  ALA n 
5  871  ASP n 
5  872  ASP n 
5  873  PRO n 
5  874  GLU n 
5  875  LEU n 
5  876  LEU n 
5  877  LYS n 
5  878  ARG n 
5  879  LEU n 
5  880  GLN n 
5  881  GLU n 
5  882  ILE n 
5  883  LEU n 
5  884  ARG n 
5  885  ASP n 
5  886  ASN n 
5  887  ASN n 
5  888  LYS n 
5  889  SER n 
5  890  GLY n 
5  891  ILE n 
5  892  LEU n 
5  893  ASP n 
5  894  ALA n 
5  895  VAL n 
5  896  THR n 
5  897  SER n 
5  898  SER n 
5  899  LYS n 
5  900  VAL n 
5  901  ASN n 
5  902  ALA n 
5  903  ILE n 
5  904  THR n 
5  905  SER n 
5  906  GLN n 
5  907  VAL n 
5  908  VAL n 
5  909  SER n 
5  910  LYS n 
5  911  CYS n 
5  912  VAL n 
5  913  PRO n 
5  914  ASP n 
5  915  GLY n 
5  916  THR n 
5  917  MET n 
5  918  LYS n 
5  919  LYS n 
5  920  PHE n 
5  921  PRO n 
5  922  CYS n 
5  923  ASN n 
5  924  SER n 
5  925  MET n 
5  926  GLN n 
5  927  ALA n 
5  928  MET n 
5  929  ALA n 
5  930  LEU n 
5  931  SER n 
5  932  GLY n 
5  933  ALA n 
5  934  LYS n 
5  935  GLY n 
5  936  SER n 
5  937  ASN n 
5  938  VAL n 
5  939  ASN n 
5  940  VAL n 
5  941  SER n 
5  942  GLN n 
5  943  ILE n 
5  944  MET n 
5  945  CYS n 
5  946  LEU n 
5  947  LEU n 
5  948  GLY n 
5  949  GLN n 
5  950  GLN n 
5  951  ALA n 
5  952  LEU n 
5  953  GLU n 
5  954  GLY n 
5  955  ARG n 
5  956  ARG n 
5  957  VAL n 
5  958  PRO n 
5  959  VAL n 
5  960  MET n 
5  961  VAL n 
5  962  SER n 
5  963  GLY n 
5  964  LYS n 
5  965  THR n 
5  966  LEU n 
5  967  PRO n 
5  968  SER n 
5  969  PHE n 
5  970  LYS n 
5  971  PRO n 
5  972  TYR n 
5  973  GLU n 
5  974  THR n 
5  975  ASP n 
5  976  ALA n 
5  977  MET n 
5  978  ALA n 
5  979  GLY n 
5  980  GLY n 
5  981  TYR n 
5  982  VAL n 
5  983  LYS n 
5  984  GLY n 
5  985  ARG n 
5  986  PHE n 
5  987  TYR n 
5  988  SER n 
5  989  GLY n 
5  990  ILE n 
5  991  LYS n 
5  992  PRO n 
5  993  GLN n 
5  994  GLU n 
5  995  TYR n 
5  996  TYR n 
5  997  PHE n 
5  998  HIS n 
5  999  CYS n 
5  1000 MET n 
5  1001 ALA n 
5  1002 GLY n 
5  1003 ARG n 
5  1004 GLU n 
5  1005 GLY n 
5  1006 LEU n 
5  1007 ILE n 
5  1008 ASP n 
5  1009 THR n 
5  1010 ALA n 
5  1011 VAL n 
5  1012 LYS n 
5  1013 THR n 
5  1014 SER n 
5  1015 ARG n 
5  1016 SER n 
5  1017 GLY n 
5  1018 TYR n 
5  1019 LEU n 
5  1020 GLN n 
5  1021 ARG n 
5  1022 CYS n 
5  1023 LEU n 
5  1024 THR n 
5  1025 LYS n 
5  1026 GLN n 
5  1027 LEU n 
5  1028 GLU n 
5  1029 GLY n 
5  1030 VAL n 
5  1031 HIS n 
5  1032 VAL n 
5  1033 SER n 
5  1034 TYR n 
5  1035 ASP n 
5  1036 ASN n 
5  1037 SER n 
5  1038 ILE n 
5  1039 ARG n 
5  1040 ASP n 
5  1041 ALA n 
5  1042 ASP n 
5  1043 GLY n 
5  1044 THR n 
5  1045 LEU n 
5  1046 VAL n 
5  1047 GLN n 
5  1048 PHE n 
5  1049 MET n 
5  1050 TYR n 
5  1051 GLY n 
5  1052 GLY n 
5  1053 ASP n 
5  1054 ALA n 
5  1055 ILE n 
5  1056 ASP n 
5  1057 ILE n 
5  1058 THR n 
5  1059 LYS n 
5  1060 GLU n 
5  1061 SER n 
5  1062 HIS n 
5  1063 MET n 
5  1064 THR n 
5  1065 GLN n 
5  1066 PHE n 
5  1067 GLU n 
5  1068 PHE n 
5  1069 CYS n 
5  1070 LEU n 
5  1071 ASP n 
5  1072 ASN n 
5  1073 TYR n 
5  1074 TYR n 
5  1075 ALA n 
5  1076 LEU n 
5  1077 LEU n 
5  1078 LYS n 
5  1079 LYS n 
5  1080 TYR n 
5  1081 ASN n 
5  1082 PRO n 
5  1083 SER n 
5  1084 ALA n 
5  1085 LEU n 
5  1086 ILE n 
5  1087 GLU n 
5  1088 HIS n 
5  1089 LEU n 
5  1090 ASP n 
5  1091 VAL n 
5  1092 GLU n 
5  1093 SER n 
5  1094 ALA n 
5  1095 LEU n 
5  1096 LYS n 
5  1097 TYR n 
5  1098 SER n 
5  1099 LYS n 
5  1100 LYS n 
5  1101 THR n 
5  1102 LEU n 
5  1103 LYS n 
5  1104 TYR n 
5  1105 ARG n 
5  1106 LYS n 
5  1107 LYS n 
5  1108 HIS n 
5  1109 SER n 
5  1110 LYS n 
5  1111 GLU n 
5  1112 PRO n 
5  1113 HIS n 
5  1114 TYR n 
5  1115 LYS n 
5  1116 GLN n 
5  1117 SER n 
5  1118 VAL n 
5  1119 LYS n 
5  1120 TYR n 
5  1121 ASP n 
5  1122 PRO n 
5  1123 VAL n 
5  1124 LEU n 
5  1125 ALA n 
5  1126 LYS n 
5  1127 TYR n 
5  1128 ASN n 
5  1129 PRO n 
5  1130 ALA n 
5  1131 LYS n 
5  1132 TYR n 
5  1133 LEU n 
5  1134 GLY n 
5  1135 SER n 
5  1136 VAL n 
5  1137 SER n 
5  1138 GLU n 
5  1139 ASN n 
5  1140 PHE n 
5  1141 GLN n 
5  1142 ASP n 
5  1143 LYS n 
5  1144 LEU n 
5  1145 GLU n 
5  1146 SER n 
5  1147 PHE n 
5  1148 LEU n 
5  1149 ASP n 
5  1150 LYS n 
5  1151 ASN n 
5  1152 SER n 
5  1153 LYS n 
5  1154 LEU n 
5  1155 PHE n 
5  1156 LYS n 
5  1157 SER n 
5  1158 SER n 
5  1159 ASP n 
5  1160 GLY n 
5  1161 VAL n 
5  1162 ASN n 
5  1163 GLU n 
5  1164 LYS n 
5  1165 LYS n 
5  1166 PHE n 
5  1167 ARG n 
5  1168 ALA n 
5  1169 LEU n 
5  1170 MET n 
5  1171 GLN n 
5  1172 LEU n 
5  1173 LYS n 
5  1174 TYR n 
5  1175 MET n 
5  1176 ARG n 
5  1177 SER n 
5  1178 LEU n 
5  1179 ILE n 
5  1180 ASN n 
5  1181 PRO n 
5  1182 GLY n 
5  1183 GLU n 
5  1184 ALA n 
5  1185 VAL n 
5  1186 GLY n 
5  1187 ILE n 
5  1188 ILE n 
5  1189 ALA n 
5  1190 SER n 
5  1191 GLN n 
5  1192 SER n 
5  1193 VAL n 
5  1194 GLY n 
5  1195 GLU n 
5  1196 PRO n 
5  1197 SER n 
5  1198 THR n 
5  1199 GLN n 
5  1200 MET n 
5  1201 THR n 
5  1202 LEU n 
5  1203 ASN n 
5  1204 THR n 
5  1205 PHE n 
5  1206 HIS n 
5  1207 PHE n 
5  1208 ALA n 
5  1209 GLY n 
5  1210 HIS n 
5  1211 GLY n 
5  1212 ALA n 
5  1213 ALA n 
5  1214 ASN n 
5  1215 VAL n 
5  1216 THR n 
5  1217 LEU n 
5  1218 GLY n 
5  1219 ILE n 
5  1220 PRO n 
5  1221 ARG n 
5  1222 LEU n 
5  1223 ARG n 
5  1224 GLU n 
5  1225 ILE n 
5  1226 VAL n 
5  1227 MET n 
5  1228 THR n 
5  1229 ALA n 
5  1230 SER n 
5  1231 ALA n 
5  1232 ALA n 
5  1233 ILE n 
5  1234 LYS n 
5  1235 THR n 
5  1236 PRO n 
5  1237 GLN n 
5  1238 MET n 
5  1239 THR n 
5  1240 LEU n 
5  1241 PRO n 
5  1242 ILE n 
5  1243 TRP n 
5  1244 ASN n 
5  1245 ASP n 
5  1246 VAL n 
5  1247 SER n 
5  1248 ASP n 
5  1249 GLU n 
5  1250 GLN n 
5  1251 ALA n 
5  1252 ASP n 
5  1253 THR n 
5  1254 PHE n 
5  1255 CYS n 
5  1256 LYS n 
5  1257 SER n 
5  1258 ILE n 
5  1259 SER n 
5  1260 LYS n 
5  1261 VAL n 
5  1262 LEU n 
5  1263 LEU n 
5  1264 SER n 
5  1265 GLU n 
5  1266 VAL n 
5  1267 ILE n 
5  1268 ASP n 
5  1269 LYS n 
5  1270 VAL n 
5  1271 ILE n 
5  1272 VAL n 
5  1273 THR n 
5  1274 GLU n 
5  1275 THR n 
5  1276 THR n 
5  1277 GLY n 
5  1278 THR n 
5  1279 SER n 
5  1280 ASN n 
5  1281 THR n 
5  1282 ALA n 
5  1283 GLY n 
5  1284 GLY n 
5  1285 ASN n 
5  1286 ALA n 
5  1287 ALA n 
5  1288 ARG n 
5  1289 SER n 
5  1290 TYR n 
5  1291 VAL n 
5  1292 ILE n 
5  1293 HIS n 
5  1294 MET n 
5  1295 ARG n 
5  1296 PHE n 
5  1297 PHE n 
5  1298 ASP n 
5  1299 ASN n 
5  1300 ASN n 
5  1301 GLU n 
5  1302 TYR n 
5  1303 SER n 
5  1304 GLU n 
5  1305 GLU n 
5  1306 TYR n 
5  1307 ASP n 
5  1308 VAL n 
5  1309 SER n 
5  1310 LYS n 
5  1311 GLU n 
5  1312 GLU n 
5  1313 LEU n 
5  1314 GLN n 
5  1315 ASN n 
5  1316 VAL n 
5  1317 ILE n 
5  1318 SER n 
5  1319 ASN n 
5  1320 GLN n 
5  1321 PHE n 
5  1322 ILE n 
5  1323 HIS n 
5  1324 LEU n 
5  1325 LEU n 
5  1326 GLU n 
5  1327 ALA n 
5  1328 ALA n 
5  1329 ILE n 
5  1330 VAL n 
5  1331 LYS n 
5  1332 GLU n 
5  1333 ILE n 
5  1334 LYS n 
5  1335 LYS n 
5  1336 GLN n 
5  1337 LYS n 
5  1338 ARG n 
5  1339 THR n 
5  1340 THR n 
5  1341 GLY n 
5  1342 PRO n 
5  1343 ASP n 
5  1344 ILE n 
5  1345 GLY n 
5  1346 VAL n 
5  1347 ALA n 
5  1348 VAL n 
5  1349 PRO n 
5  1350 ARG n 
5  1351 LEU n 
5  1352 GLN n 
5  1353 THR n 
5  1354 ASP n 
5  1355 VAL n 
5  1356 ALA n 
5  1357 ASN n 
5  1358 SER n 
5  1359 SER n 
5  1360 SER n 
5  1361 ASN n 
5  1362 SER n 
5  1363 LYS n 
5  1364 ARG n 
5  1365 LEU n 
5  1366 GLU n 
5  1367 GLU n 
5  1368 ASP n 
5  1369 ASN n 
5  1370 ASP n 
5  1371 GLU n 
5  1372 GLU n 
5  1373 GLN n 
5  1374 SER n 
5  1375 HIS n 
5  1376 LYS n 
5  1377 LYS n 
5  1378 THR n 
5  1379 LYS n 
5  1380 GLN n 
5  1381 ALA n 
5  1382 VAL n 
5  1383 SER n 
5  1384 TYR n 
5  1385 ASP n 
5  1386 GLU n 
5  1387 PRO n 
5  1388 ASP n 
5  1389 GLU n 
5  1390 ASP n 
5  1391 GLU n 
5  1392 ILE n 
5  1393 GLU n 
5  1394 THR n 
5  1395 MET n 
5  1396 ARG n 
5  1397 GLU n 
5  1398 ALA n 
5  1399 GLU n 
5  1400 LYS n 
5  1401 SER n 
5  1402 SER n 
5  1403 ASP n 
5  1404 GLU n 
5  1405 GLU n 
5  1406 GLY n 
5  1407 ILE n 
5  1408 ASP n 
5  1409 SER n 
5  1410 ASP n 
5  1411 LYS n 
5  1412 GLU n 
5  1413 SER n 
5  1414 ASP n 
5  1415 SER n 
5  1416 ASP n 
5  1417 SER n 
5  1418 GLU n 
5  1419 ASP n 
5  1420 GLU n 
5  1421 ASP n 
5  1422 VAL n 
5  1423 ASP n 
5  1424 MET n 
5  1425 ASN n 
5  1426 GLU n 
5  1427 GLN n 
5  1428 ILE n 
5  1429 ASN n 
5  1430 LYS n 
5  1431 SER n 
5  1432 ILE n 
5  1433 VAL n 
5  1434 GLU n 
5  1435 ALA n 
5  1436 ASN n 
5  1437 ASN n 
5  1438 ASN n 
5  1439 MET n 
5  1440 ASN n 
5  1441 LYS n 
5  1442 VAL n 
5  1443 GLN n 
5  1444 ARG n 
5  1445 ASP n 
5  1446 ARG n 
5  1447 GLN n 
5  1448 SER n 
5  1449 ALA n 
5  1450 ILE n 
5  1451 ILE n 
5  1452 SER n 
5  1453 HIS n 
5  1454 HIS n 
5  1455 ARG n 
5  1456 PHE n 
5  1457 ILE n 
5  1458 THR n 
5  1459 LYS n 
5  1460 TYR n 
5  1461 ASN n 
5  1462 PHE n 
5  1463 ASP n 
5  1464 ASP n 
5  1465 GLU n 
5  1466 SER n 
5  1467 GLY n 
5  1468 LYS n 
5  1469 TRP n 
5  1470 CYS n 
5  1471 GLU n 
5  1472 PHE n 
5  1473 LYS n 
5  1474 LEU n 
5  1475 GLU n 
5  1476 LEU n 
5  1477 ALA n 
5  1478 ALA n 
5  1479 ASP n 
5  1480 THR n 
5  1481 GLU n 
5  1482 LYS n 
5  1483 LEU n 
5  1484 LEU n 
5  1485 MET n 
5  1486 VAL n 
5  1487 ASN n 
5  1488 ILE n 
5  1489 VAL n 
5  1490 GLU n 
5  1491 GLU n 
5  1492 ILE n 
5  1493 CYS n 
5  1494 ARG n 
5  1495 LYS n 
5  1496 SER n 
5  1497 ILE n 
5  1498 ILE n 
5  1499 ARG n 
5  1500 GLN n 
5  1501 ILE n 
5  1502 PRO n 
5  1503 HIS n 
5  1504 ILE n 
5  1505 ASP n 
5  1506 ARG n 
5  1507 CYS n 
5  1508 VAL n 
5  1509 HIS n 
5  1510 PRO n 
5  1511 GLU n 
5  1512 PRO n 
5  1513 GLU n 
5  1514 ASN n 
5  1515 GLY n 
5  1516 LYS n 
5  1517 ARG n 
5  1518 VAL n 
5  1519 LEU n 
5  1520 VAL n 
5  1521 THR n 
5  1522 GLU n 
5  1523 GLY n 
5  1524 VAL n 
5  1525 ASN n 
5  1526 PHE n 
5  1527 GLN n 
5  1528 ALA n 
5  1529 MET n 
5  1530 TRP n 
5  1531 ASP n 
5  1532 GLN n 
5  1533 GLU n 
5  1534 ALA n 
5  1535 PHE n 
5  1536 ILE n 
5  1537 ASP n 
5  1538 VAL n 
5  1539 ASP n 
5  1540 GLY n 
5  1541 ILE n 
5  1542 THR n 
5  1543 SER n 
5  1544 ASN n 
5  1545 ASP n 
5  1546 VAL n 
5  1547 ALA n 
5  1548 ALA n 
5  1549 VAL n 
5  1550 LEU n 
5  1551 LYS n 
5  1552 THR n 
5  1553 TYR n 
5  1554 GLY n 
5  1555 VAL n 
5  1556 GLU n 
5  1557 ALA n 
5  1558 ALA n 
5  1559 ARG n 
5  1560 ASN n 
5  1561 THR n 
5  1562 ILE n 
5  1563 VAL n 
5  1564 ASN n 
5  1565 GLU n 
5  1566 ILE n 
5  1567 ASN n 
5  1568 ASN n 
5  1569 VAL n 
5  1570 PHE n 
5  1571 SER n 
5  1572 ARG n 
5  1573 TYR n 
5  1574 ALA n 
5  1575 ILE n 
5  1576 SER n 
5  1577 VAL n 
5  1578 SER n 
5  1579 PHE n 
5  1580 ARG n 
5  1581 HIS n 
5  1582 LEU n 
5  1583 ASP n 
5  1584 LEU n 
5  1585 ILE n 
5  1586 ALA n 
5  1587 ASP n 
5  1588 MET n 
5  1589 MET n 
5  1590 THR n 
5  1591 ARG n 
5  1592 GLN n 
5  1593 GLY n 
5  1594 THR n 
5  1595 TYR n 
5  1596 LEU n 
5  1597 ALA n 
5  1598 PHE n 
5  1599 ASN n 
5  1600 ARG n 
5  1601 GLN n 
5  1602 GLY n 
5  1603 MET n 
5  1604 GLU n 
5  1605 THR n 
5  1606 SER n 
5  1607 THR n 
5  1608 SER n 
5  1609 SER n 
5  1610 PHE n 
5  1611 MET n 
5  1612 LYS n 
5  1613 MET n 
5  1614 SER n 
5  1615 TYR n 
5  1616 GLU n 
5  1617 THR n 
5  1618 THR n 
5  1619 CYS n 
5  1620 GLN n 
5  1621 PHE n 
5  1622 LEU n 
5  1623 THR n 
5  1624 LYS n 
5  1625 ALA n 
5  1626 VAL n 
5  1627 LEU n 
5  1628 ASP n 
5  1629 ASN n 
5  1630 GLU n 
5  1631 ARG n 
5  1632 GLU n 
5  1633 GLN n 
5  1634 LEU n 
5  1635 ASP n 
5  1636 SER n 
5  1637 PRO n 
5  1638 SER n 
5  1639 ALA n 
5  1640 ARG n 
5  1641 ILE n 
5  1642 VAL n 
5  1643 VAL n 
5  1644 GLY n 
5  1645 LYS n 
5  1646 LEU n 
5  1647 ASN n 
5  1648 ASN n 
5  1649 VAL n 
5  1650 GLY n 
5  1651 THR n 
5  1652 GLY n 
5  1653 SER n 
5  1654 PHE n 
5  1655 ASP n 
5  1656 VAL n 
5  1657 LEU n 
5  1658 ALA n 
5  1659 LYS n 
5  1660 VAL n 
5  1661 PRO n 
5  1662 ASN n 
5  1663 ALA n 
5  1664 ALA n 
6  1    MET n 
6  2    SER n 
6  3    LYS n 
6  4    VAL n 
6  5    ILE n 
6  6    LYS n 
6  7    PRO n 
6  8    PRO n 
6  9    GLY n 
6  10   GLN n 
6  11   ALA n 
6  12   ARG n 
6  13   THR n 
6  14   ALA n 
6  15   ASP n 
6  16   PHE n 
6  17   ARG n 
6  18   THR n 
6  19   LEU n 
6  20   GLU n 
6  21   ARG n 
6  22   GLU n 
6  23   SER n 
6  24   ARG n 
6  25   PHE n 
6  26   ILE n 
6  27   ASN n 
6  28   PRO n 
6  29   PRO n 
6  30   LYS n 
6  31   ASP n 
6  32   LYS n 
6  33   SER n 
6  34   ALA n 
6  35   PHE n 
6  36   PRO n 
6  37   LEU n 
6  38   LEU n 
6  39   GLN n 
6  40   GLU n 
6  41   ALA n 
6  42   VAL n 
6  43   GLN n 
6  44   PRO n 
6  45   HIS n 
6  46   ILE n 
6  47   GLY n 
6  48   SER n 
6  49   PHE n 
6  50   ASN n 
6  51   ALA n 
6  52   LEU n 
6  53   THR n 
6  54   GLU n 
6  55   GLY n 
6  56   PRO n 
6  57   ASP n 
6  58   GLY n 
6  59   GLY n 
6  60   LEU n 
6  61   LEU n 
6  62   ASN n 
6  63   LEU n 
6  64   GLY n 
6  65   VAL n 
6  66   LYS n 
6  67   ASP n 
6  68   ILE n 
6  69   GLY n 
6  70   GLU n 
6  71   LYS n 
6  72   VAL n 
6  73   ILE n 
6  74   PHE n 
6  75   ASP n 
6  76   GLY n 
6  77   LYS n 
6  78   PRO n 
6  79   LEU n 
6  80   ASN n 
6  81   SER n 
6  82   GLU n 
6  83   ASP n 
6  84   GLU n 
6  85   ILE n 
6  86   SER n 
6  87   ASN n 
6  88   SER n 
6  89   GLY n 
6  90   TYR n 
6  91   LEU n 
6  92   GLY n 
6  93   ASN n 
6  94   LYS n 
6  95   LEU n 
6  96   SER n 
6  97   VAL n 
6  98   SER n 
6  99   VAL n 
6  100  GLU n 
6  101  GLN n 
6  102  VAL n 
6  103  SER n 
6  104  ILE n 
6  105  ALA n 
6  106  LYS n 
6  107  PRO n 
6  108  MET n 
6  109  SER n 
6  110  ASN n 
6  111  ASP n 
6  112  GLY n 
6  113  VAL n 
6  114  SER n 
6  115  SER n 
6  116  ALA n 
6  117  VAL n 
6  118  GLU n 
6  119  ARG n 
6  120  LYS n 
6  121  VAL n 
6  122  TYR n 
6  123  PRO n 
6  124  SER n 
6  125  GLU n 
6  126  SER n 
6  127  ARG n 
6  128  GLN n 
6  129  ARG n 
6  130  LEU n 
6  131  THR n 
6  132  SER n 
6  133  TYR n 
6  134  ARG n 
6  135  GLY n 
6  136  LYS n 
6  137  LEU n 
6  138  LEU n 
6  139  LEU n 
6  140  LYS n 
6  141  LEU n 
6  142  LYS n 
6  143  TRP n 
6  144  SER n 
6  145  VAL n 
6  146  ASN n 
6  147  ASN n 
6  148  GLY n 
6  149  GLU n 
6  150  GLU n 
6  151  ASN n 
6  152  LEU n 
6  153  PHE n 
6  154  GLU n 
6  155  VAL n 
6  156  ARG n 
6  157  ASP n 
6  158  CYS n 
6  159  GLY n 
6  160  GLY n 
6  161  LEU n 
6  162  PRO n 
6  163  VAL n 
6  164  MET n 
6  165  LEU n 
6  166  GLN n 
6  167  SER n 
6  168  ASN n 
6  169  ARG n 
6  170  CYS n 
6  171  HIS n 
6  172  LEU n 
6  173  ASN n 
6  174  LYS n 
6  175  MET n 
6  176  SER n 
6  177  PRO n 
6  178  TYR n 
6  179  GLU n 
6  180  LEU n 
6  181  VAL n 
6  182  GLN n 
6  183  HIS n 
6  184  LYS n 
6  185  GLU n 
6  186  GLU n 
6  187  SER n 
6  188  ASP n 
6  189  GLU n 
6  190  ILE n 
6  191  GLY n 
6  192  GLY n 
6  193  TYR n 
6  194  PHE n 
6  195  ILE n 
6  196  VAL n 
6  197  ASN n 
6  198  GLY n 
6  199  ILE n 
6  200  GLU n 
6  201  LYS n 
6  202  LEU n 
6  203  ILE n 
6  204  ARG n 
6  205  MET n 
6  206  LEU n 
6  207  ILE n 
6  208  VAL n 
6  209  GLN n 
6  210  ARG n 
6  211  ARG n 
6  212  ASN n 
6  213  HIS n 
6  214  PRO n 
6  215  MET n 
6  216  ALA n 
6  217  ILE n 
6  218  ILE n 
6  219  ARG n 
6  220  PRO n 
6  221  SER n 
6  222  PHE n 
6  223  ALA n 
6  224  ASN n 
6  225  ARG n 
6  226  GLY n 
6  227  ALA n 
6  228  SER n 
6  229  TYR n 
6  230  SER n 
6  231  HIS n 
6  232  TYR n 
6  233  GLY n 
6  234  ILE n 
6  235  GLN n 
6  236  ILE n 
6  237  ARG n 
6  238  SER n 
6  239  VAL n 
6  240  ARG n 
6  241  PRO n 
6  242  ASP n 
6  243  GLN n 
6  244  THR n 
6  245  SER n 
6  246  GLN n 
6  247  THR n 
6  248  ASN n 
6  249  VAL n 
6  250  LEU n 
6  251  HIS n 
6  252  TYR n 
6  253  LEU n 
6  254  ASN n 
6  255  ASP n 
6  256  GLY n 
6  257  GLN n 
6  258  VAL n 
6  259  THR n 
6  260  PHE n 
6  261  ARG n 
6  262  PHE n 
6  263  SER n 
6  264  TRP n 
6  265  ARG n 
6  266  LYS n 
6  267  ASN n 
6  268  GLU n 
6  269  TYR n 
6  270  LEU n 
6  271  VAL n 
6  272  PRO n 
6  273  VAL n 
6  274  VAL n 
6  275  MET n 
6  276  ILE n 
6  277  LEU n 
6  278  LYS n 
6  279  ALA n 
6  280  LEU n 
6  281  CYS n 
6  282  HIS n 
6  283  THR n 
6  284  SER n 
6  285  ASP n 
6  286  ARG n 
6  287  GLU n 
6  288  ILE n 
6  289  PHE n 
6  290  ASP n 
6  291  GLY n 
6  292  ILE n 
6  293  ILE n 
6  294  GLY n 
6  295  ASN n 
6  296  ASP n 
6  297  VAL n 
6  298  LYS n 
6  299  ASP n 
6  300  SER n 
6  301  PHE n 
6  302  LEU n 
6  303  THR n 
6  304  ASP n 
6  305  ARG n 
6  306  LEU n 
6  307  GLU n 
6  308  LEU n 
6  309  LEU n 
6  310  LEU n 
6  311  ARG n 
6  312  GLY n 
6  313  PHE n 
6  314  LYS n 
6  315  LYS n 
6  316  ARG n 
6  317  TYR n 
6  318  PRO n 
6  319  HIS n 
6  320  LEU n 
6  321  GLN n 
6  322  ASN n 
6  323  ARG n 
6  324  THR n 
6  325  GLN n 
6  326  VAL n 
6  327  LEU n 
6  328  GLN n 
6  329  TYR n 
6  330  LEU n 
6  331  GLY n 
6  332  ASP n 
6  333  LYS n 
6  334  PHE n 
6  335  ARG n 
6  336  VAL n 
6  337  VAL n 
6  338  PHE n 
6  339  GLN n 
6  340  ALA n 
6  341  SER n 
6  342  PRO n 
6  343  ASP n 
6  344  GLN n 
6  345  SER n 
6  346  ASP n 
6  347  LEU n 
6  348  GLU n 
6  349  VAL n 
6  350  GLY n 
6  351  GLN n 
6  352  GLU n 
6  353  VAL n 
6  354  LEU n 
6  355  ASP n 
6  356  ARG n 
6  357  ILE n 
6  358  VAL n 
6  359  LEU n 
6  360  VAL n 
6  361  HIS n 
6  362  LEU n 
6  363  GLY n 
6  364  LYS n 
6  365  ASP n 
6  366  GLY n 
6  367  SER n 
6  368  GLN n 
6  369  ASP n 
6  370  LYS n 
6  371  PHE n 
6  372  ARG n 
6  373  MET n 
6  374  LEU n 
6  375  LEU n 
6  376  PHE n 
6  377  MET n 
6  378  ILE n 
6  379  ARG n 
6  380  LYS n 
6  381  LEU n 
6  382  TYR n 
6  383  SER n 
6  384  LEU n 
6  385  VAL n 
6  386  ALA n 
6  387  GLY n 
6  388  GLU n 
6  389  CYS n 
6  390  SER n 
6  391  PRO n 
6  392  ASP n 
6  393  ASN n 
6  394  PRO n 
6  395  ASP n 
6  396  ALA n 
6  397  THR n 
6  398  GLN n 
6  399  HIS n 
6  400  GLN n 
6  401  GLU n 
6  402  VAL n 
6  403  LEU n 
6  404  LEU n 
6  405  GLY n 
6  406  GLY n 
6  407  PHE n 
6  408  LEU n 
6  409  TYR n 
6  410  GLY n 
6  411  MET n 
6  412  ILE n 
6  413  LEU n 
6  414  LYS n 
6  415  GLU n 
6  416  LYS n 
6  417  ILE n 
6  418  ASP n 
6  419  GLU n 
6  420  TYR n 
6  421  LEU n 
6  422  GLN n 
6  423  ASN n 
6  424  ILE n 
6  425  ILE n 
6  426  ALA n 
6  427  GLN n 
6  428  VAL n 
6  429  ARG n 
6  430  MET n 
6  431  ASP n 
6  432  ILE n 
6  433  ASN n 
6  434  ARG n 
6  435  GLY n 
6  436  MET n 
6  437  ALA n 
6  438  ILE n 
6  439  ASN n 
6  440  PHE n 
6  441  LYS n 
6  442  ASP n 
6  443  LYS n 
6  444  ARG n 
6  445  TYR n 
6  446  MET n 
6  447  SER n 
6  448  ARG n 
6  449  VAL n 
6  450  LEU n 
6  451  MET n 
6  452  ARG n 
6  453  VAL n 
6  454  ASN n 
6  455  GLU n 
6  456  ASN n 
6  457  ILE n 
6  458  GLY n 
6  459  SER n 
6  460  LYS n 
6  461  MET n 
6  462  GLN n 
6  463  TYR n 
6  464  PHE n 
6  465  LEU n 
6  466  SER n 
6  467  THR n 
6  468  GLY n 
6  469  ASN n 
6  470  LEU n 
6  471  VAL n 
6  472  SER n 
6  473  GLN n 
6  474  SER n 
6  475  GLY n 
6  476  LEU n 
6  477  ASP n 
6  478  LEU n 
6  479  GLN n 
6  480  GLN n 
6  481  VAL n 
6  482  SER n 
6  483  GLY n 
6  484  TYR n 
6  485  THR n 
6  486  VAL n 
6  487  VAL n 
6  488  ALA n 
6  489  GLU n 
6  490  LYS n 
6  491  ILE n 
6  492  ASN n 
6  493  PHE n 
6  494  TYR n 
6  495  ARG n 
6  496  PHE n 
6  497  ILE n 
6  498  SER n 
6  499  HIS n 
6  500  PHE n 
6  501  ARG n 
6  502  MET n 
6  503  VAL n 
6  504  HIS n 
6  505  ARG n 
6  506  GLY n 
6  507  SER n 
6  508  PHE n 
6  509  PHE n 
6  510  ALA n 
6  511  GLN n 
6  512  LEU n 
6  513  LYS n 
6  514  THR n 
6  515  THR n 
6  516  THR n 
6  517  VAL n 
6  518  ARG n 
6  519  LYS n 
6  520  LEU n 
6  521  LEU n 
6  522  PRO n 
6  523  GLU n 
6  524  SER n 
6  525  TRP n 
6  526  GLY n 
6  527  PHE n 
6  528  LEU n 
6  529  CYS n 
6  530  PRO n 
6  531  VAL n 
6  532  HIS n 
6  533  THR n 
6  534  PRO n 
6  535  ASP n 
6  536  GLY n 
6  537  SER n 
6  538  PRO n 
6  539  CYS n 
6  540  GLY n 
6  541  LEU n 
6  542  LEU n 
6  543  ASN n 
6  544  HIS n 
6  545  PHE n 
6  546  ALA n 
6  547  HIS n 
6  548  LYS n 
6  549  CYS n 
6  550  ARG n 
6  551  ILE n 
6  552  SER n 
6  553  THR n 
6  554  GLN n 
6  555  GLN n 
6  556  SER n 
6  557  ASP n 
6  558  VAL n 
6  559  SER n 
6  560  ARG n 
6  561  ILE n 
6  562  PRO n 
6  563  SER n 
6  564  ILE n 
6  565  LEU n 
6  566  TYR n 
6  567  SER n 
6  568  LEU n 
6  569  GLY n 
6  570  VAL n 
6  571  ALA n 
6  572  PRO n 
6  573  ALA n 
6  574  SER n 
6  575  HIS n 
6  576  THR n 
6  577  PHE n 
6  578  ALA n 
6  579  ALA n 
6  580  GLY n 
6  581  PRO n 
6  582  SER n 
6  583  LEU n 
6  584  CYS n 
6  585  CYS n 
6  586  VAL n 
6  587  GLN n 
6  588  ILE n 
6  589  ASP n 
6  590  GLY n 
6  591  LYS n 
6  592  ILE n 
6  593  ILE n 
6  594  GLY n 
6  595  TRP n 
6  596  VAL n 
6  597  SER n 
6  598  HIS n 
6  599  GLU n 
6  600  GLN n 
6  601  GLY n 
6  602  LYS n 
6  603  ILE n 
6  604  ILE n 
6  605  ALA n 
6  606  ASP n 
6  607  THR n 
6  608  LEU n 
6  609  ARG n 
6  610  TYR n 
6  611  TRP n 
6  612  LYS n 
6  613  VAL n 
6  614  GLU n 
6  615  GLY n 
6  616  LYS n 
6  617  THR n 
6  618  PRO n 
6  619  GLY n 
6  620  LEU n 
6  621  PRO n 
6  622  ILE n 
6  623  ASP n 
6  624  LEU n 
6  625  GLU n 
6  626  ILE n 
6  627  GLY n 
6  628  TYR n 
6  629  VAL n 
6  630  PRO n 
6  631  PRO n 
6  632  SER n 
6  633  THR n 
6  634  ARG n 
6  635  GLY n 
6  636  GLN n 
6  637  TYR n 
6  638  PRO n 
6  639  GLY n 
6  640  LEU n 
6  641  TYR n 
6  642  LEU n 
6  643  PHE n 
6  644  GLY n 
6  645  GLY n 
6  646  HIS n 
6  647  SER n 
6  648  ARG n 
6  649  MET n 
6  650  LEU n 
6  651  ARG n 
6  652  PRO n 
6  653  VAL n 
6  654  ARG n 
6  655  TYR n 
6  656  LEU n 
6  657  PRO n 
6  658  LEU n 
6  659  ASP n 
6  660  LYS n 
6  661  GLU n 
6  662  ASP n 
6  663  ILE n 
6  664  VAL n 
6  665  GLY n 
6  666  PRO n 
6  667  PHE n 
6  668  GLU n 
6  669  GLN n 
6  670  VAL n 
6  671  TYR n 
6  672  MET n 
6  673  ASN n 
6  674  ILE n 
6  675  ALA n 
6  676  VAL n 
6  677  THR n 
6  678  PRO n 
6  679  GLN n 
6  680  GLU n 
6  681  ILE n 
6  682  GLN n 
6  683  ASN n 
6  684  ASN n 
6  685  VAL n 
6  686  HIS n 
6  687  THR n 
6  688  HIS n 
6  689  VAL n 
6  690  GLU n 
6  691  PHE n 
6  692  THR n 
6  693  PRO n 
6  694  THR n 
6  695  ASN n 
6  696  ILE n 
6  697  LEU n 
6  698  SER n 
6  699  ILE n 
6  700  LEU n 
6  701  ALA n 
6  702  ASN n 
6  703  LEU n 
6  704  THR n 
6  705  PRO n 
6  706  PHE n 
6  707  SER n 
6  708  ASP n 
6  709  PHE n 
6  710  ASN n 
6  711  GLN n 
6  712  SER n 
6  713  PRO n 
6  714  ARG n 
6  715  ASN n 
6  716  MET n 
6  717  TYR n 
6  718  GLN n 
6  719  CYS n 
6  720  GLN n 
6  721  MET n 
6  722  GLY n 
6  723  LYS n 
6  724  GLN n 
6  725  THR n 
6  726  MET n 
6  727  GLY n 
6  728  THR n 
6  729  PRO n 
6  730  GLY n 
6  731  VAL n 
6  732  ALA n 
6  733  LEU n 
6  734  CYS n 
6  735  HIS n 
6  736  ARG n 
6  737  SER n 
6  738  ASP n 
6  739  ASN n 
6  740  LYS n 
6  741  LEU n 
6  742  TYR n 
6  743  ARG n 
6  744  LEU n 
6  745  GLN n 
6  746  THR n 
6  747  GLY n 
6  748  GLN n 
6  749  THR n 
6  750  PRO n 
6  751  ILE n 
6  752  VAL n 
6  753  LYS n 
6  754  ALA n 
6  755  ASN n 
6  756  LEU n 
6  757  TYR n 
6  758  ASP n 
6  759  ASP n 
6  760  TYR n 
6  761  GLY n 
6  762  MET n 
6  763  ASP n 
6  764  ASN n 
6  765  PHE n 
6  766  PRO n 
6  767  ASN n 
6  768  GLY n 
6  769  PHE n 
6  770  ASN n 
6  771  ALA n 
6  772  VAL n 
6  773  VAL n 
6  774  ALA n 
6  775  VAL n 
6  776  ILE n 
6  777  SER n 
6  778  TYR n 
6  779  THR n 
6  780  GLY n 
6  781  TYR n 
6  782  ASP n 
6  783  MET n 
6  784  ASP n 
6  785  ASP n 
6  786  ALA n 
6  787  MET n 
6  788  ILE n 
6  789  ILE n 
6  790  ASN n 
6  791  LYS n 
6  792  SER n 
6  793  ALA n 
6  794  ASP n 
6  795  GLU n 
6  796  ARG n 
6  797  GLY n 
6  798  PHE n 
6  799  GLY n 
6  800  TYR n 
6  801  GLY n 
6  802  THR n 
6  803  MET n 
6  804  TYR n 
6  805  LYS n 
6  806  THR n 
6  807  GLU n 
6  808  LYS n 
6  809  VAL n 
6  810  ASP n 
6  811  LEU n 
6  812  ALA n 
6  813  LEU n 
6  814  ASN n 
6  815  ARG n 
6  816  ASN n 
6  817  ARG n 
6  818  GLY n 
6  819  ASP n 
6  820  PRO n 
6  821  ILE n 
6  822  THR n 
6  823  GLN n 
6  824  HIS n 
6  825  PHE n 
6  826  GLY n 
6  827  PHE n 
6  828  GLY n 
6  829  ASN n 
6  830  ASP n 
6  831  GLU n 
6  832  TRP n 
6  833  PRO n 
6  834  LYS n 
6  835  GLU n 
6  836  TRP n 
6  837  LEU n 
6  838  GLU n 
6  839  LYS n 
6  840  LEU n 
6  841  ASP n 
6  842  GLU n 
6  843  ASP n 
6  844  GLY n 
6  845  LEU n 
6  846  PRO n 
6  847  TYR n 
6  848  ILE n 
6  849  GLY n 
6  850  THR n 
6  851  TYR n 
6  852  VAL n 
6  853  GLU n 
6  854  GLU n 
6  855  GLY n 
6  856  ASP n 
6  857  PRO n 
6  858  ILE n 
6  859  CYS n 
6  860  ALA n 
6  861  TYR n 
6  862  PHE n 
6  863  ASP n 
6  864  ASP n 
6  865  THR n 
6  866  LEU n 
6  867  ASN n 
6  868  LYS n 
6  869  THR n 
6  870  LYS n 
6  871  ILE n 
6  872  LYS n 
6  873  THR n 
6  874  TYR n 
6  875  HIS n 
6  876  SER n 
6  877  SER n 
6  878  GLU n 
6  879  PRO n 
6  880  ALA n 
6  881  TYR n 
6  882  ILE n 
6  883  GLU n 
6  884  GLU n 
6  885  VAL n 
6  886  ASN n 
6  887  LEU n 
6  888  ILE n 
6  889  GLY n 
6  890  ASP n 
6  891  GLU n 
6  892  SER n 
6  893  ASN n 
6  894  LYS n 
6  895  PHE n 
6  896  GLN n 
6  897  GLU n 
6  898  LEU n 
6  899  GLN n 
6  900  THR n 
6  901  VAL n 
6  902  SER n 
6  903  ILE n 
6  904  LYS n 
6  905  TYR n 
6  906  ARG n 
6  907  ILE n 
6  908  ARG n 
6  909  ARG n 
6  910  THR n 
6  911  PRO n 
6  912  GLN n 
6  913  ILE n 
6  914  GLY n 
6  915  ASP n 
6  916  LYS n 
6  917  PHE n 
6  918  SER n 
6  919  SER n 
6  920  ARG n 
6  921  HIS n 
6  922  GLY n 
6  923  GLN n 
6  924  LYS n 
6  925  GLY n 
6  926  VAL n 
6  927  CYS n 
6  928  SER n 
6  929  ARG n 
6  930  LYS n 
6  931  TRP n 
6  932  PRO n 
6  933  THR n 
6  934  ILE n 
6  935  ASP n 
6  936  MET n 
6  937  PRO n 
6  938  PHE n 
6  939  SER n 
6  940  GLU n 
6  941  THR n 
6  942  GLY n 
6  943  ILE n 
6  944  GLN n 
6  945  PRO n 
6  946  ASP n 
6  947  ILE n 
6  948  ILE n 
6  949  ILE n 
6  950  ASN n 
6  951  PRO n 
6  952  HIS n 
6  953  ALA n 
6  954  PHE n 
6  955  PRO n 
6  956  SER n 
6  957  ARG n 
6  958  MET n 
6  959  THR n 
6  960  ILE n 
6  961  GLY n 
6  962  MET n 
6  963  PHE n 
6  964  VAL n 
6  965  GLU n 
6  966  SER n 
6  967  LEU n 
6  968  ALA n 
6  969  GLY n 
6  970  LYS n 
6  971  ALA n 
6  972  GLY n 
6  973  ALA n 
6  974  LEU n 
6  975  HIS n 
6  976  GLY n 
6  977  ILE n 
6  978  ALA n 
6  979  GLN n 
6  980  ASP n 
6  981  SER n 
6  982  THR n 
6  983  PRO n 
6  984  TRP n 
6  985  ILE n 
6  986  PHE n 
6  987  ASN n 
6  988  GLU n 
6  989  ASP n 
6  990  ASP n 
6  991  THR n 
6  992  PRO n 
6  993  ALA n 
6  994  ASP n 
6  995  TYR n 
6  996  PHE n 
6  997  GLY n 
6  998  GLU n 
6  999  GLN n 
6  1000 LEU n 
6  1001 ALA n 
6  1002 LYS n 
6  1003 ALA n 
6  1004 GLY n 
6  1005 TYR n 
6  1006 ASN n 
6  1007 TYR n 
6  1008 HIS n 
6  1009 GLY n 
6  1010 ASN n 
6  1011 GLU n 
6  1012 PRO n 
6  1013 MET n 
6  1014 TYR n 
6  1015 SER n 
6  1016 GLY n 
6  1017 ALA n 
6  1018 THR n 
6  1019 GLY n 
6  1020 GLU n 
6  1021 GLU n 
6  1022 LEU n 
6  1023 ARG n 
6  1024 ALA n 
6  1025 ASP n 
6  1026 ILE n 
6  1027 TYR n 
6  1028 VAL n 
6  1029 GLY n 
6  1030 VAL n 
6  1031 VAL n 
6  1032 TYR n 
6  1033 TYR n 
6  1034 GLN n 
6  1035 ARG n 
6  1036 LEU n 
6  1037 ARG n 
6  1038 HIS n 
6  1039 MET n 
6  1040 VAL n 
6  1041 ASN n 
6  1042 ASP n 
6  1043 LYS n 
6  1044 PHE n 
6  1045 GLN n 
6  1046 VAL n 
6  1047 ARG n 
6  1048 SER n 
6  1049 THR n 
6  1050 GLY n 
6  1051 PRO n 
6  1052 VAL n 
6  1053 ASN n 
6  1054 SER n 
6  1055 LEU n 
6  1056 THR n 
6  1057 MET n 
6  1058 GLN n 
6  1059 PRO n 
6  1060 VAL n 
6  1061 LYS n 
6  1062 GLY n 
6  1063 ARG n 
6  1064 LYS n 
6  1065 ARG n 
6  1066 HIS n 
6  1067 GLY n 
6  1068 GLY n 
6  1069 ILE n 
6  1070 ARG n 
6  1071 VAL n 
6  1072 GLY n 
6  1073 GLU n 
6  1074 MET n 
6  1075 GLU n 
6  1076 ARG n 
6  1077 ASP n 
6  1078 ALA n 
6  1079 LEU n 
6  1080 ILE n 
6  1081 GLY n 
6  1082 HIS n 
6  1083 GLY n 
6  1084 THR n 
6  1085 SER n 
6  1086 PHE n 
6  1087 LEU n 
6  1088 LEU n 
6  1089 GLN n 
6  1090 ASP n 
6  1091 ARG n 
6  1092 LEU n 
6  1093 LEU n 
6  1094 ASN n 
6  1095 SER n 
6  1096 SER n 
6  1097 ASP n 
6  1098 TYR n 
6  1099 THR n 
6  1100 GLN n 
6  1101 ALA n 
6  1102 SER n 
6  1103 VAL n 
6  1104 CYS n 
6  1105 ARG n 
6  1106 GLU n 
6  1107 CYS n 
6  1108 GLY n 
6  1109 SER n 
6  1110 ILE n 
6  1111 LEU n 
6  1112 THR n 
6  1113 THR n 
6  1114 GLN n 
6  1115 GLN n 
6  1116 SER n 
6  1117 VAL n 
6  1118 PRO n 
6  1119 ARG n 
6  1120 ILE n 
6  1121 GLY n 
6  1122 SER n 
6  1123 ILE n 
6  1124 SER n 
6  1125 THR n 
6  1126 VAL n 
6  1127 CYS n 
6  1128 CYS n 
6  1129 ARG n 
6  1130 ARG n 
6  1131 CYS n 
6  1132 SER n 
6  1133 MET n 
6  1134 ARG n 
6  1135 PHE n 
6  1136 GLU n 
6  1137 ASP n 
6  1138 ALA n 
6  1139 LYS n 
6  1140 LYS n 
6  1141 LEU n 
6  1142 LEU n 
6  1143 THR n 
6  1144 LYS n 
6  1145 SER n 
6  1146 GLU n 
6  1147 ASP n 
6  1148 GLY n 
6  1149 GLU n 
6  1150 LYS n 
6  1151 ILE n 
6  1152 PHE n 
6  1153 ILE n 
6  1154 ASP n 
6  1155 ASP n 
6  1156 SER n 
6  1157 GLN n 
6  1158 ILE n 
6  1159 TRP n 
6  1160 GLU n 
6  1161 ASP n 
6  1162 GLY n 
6  1163 GLN n 
6  1164 GLY n 
6  1165 ASN n 
6  1166 LYS n 
6  1167 PHE n 
6  1168 VAL n 
6  1169 GLY n 
6  1170 GLY n 
6  1171 ASN n 
6  1172 GLU n 
6  1173 THR n 
6  1174 THR n 
6  1175 THR n 
6  1176 VAL n 
6  1177 ALA n 
6  1178 ILE n 
6  1179 PRO n 
6  1180 PHE n 
6  1181 VAL n 
6  1182 LEU n 
6  1183 LYS n 
6  1184 TYR n 
6  1185 LEU n 
6  1186 ASP n 
6  1187 SER n 
6  1188 GLU n 
6  1189 LEU n 
6  1190 SER n 
6  1191 ALA n 
6  1192 MET n 
6  1193 GLY n 
6  1194 ILE n 
6  1195 ARG n 
6  1196 LEU n 
6  1197 ARG n 
6  1198 TYR n 
6  1199 ASN n 
6  1200 VAL n 
6  1201 GLU n 
6  1202 PRO n 
6  1203 LYS n 
7  1    MET n 
7  2    SER n 
7  3    ASN n 
7  4    ILE n 
7  5    VAL n 
7  6    GLY n 
7  7    ILE n 
7  8    GLU n 
7  9    TYR n 
7  10   ASN n 
7  11   ARG n 
7  12   VAL n 
7  13   THR n 
7  14   ASN n 
7  15   THR n 
7  16   THR n 
7  17   SER n 
7  18   THR n 
7  19   ASP n 
7  20   PHE n 
7  21   PRO n 
7  22   GLY n 
7  23   PHE n 
7  24   SER n 
7  25   LYS n 
7  26   ASP n 
7  27   ALA n 
7  28   GLU n 
7  29   ASN n 
7  30   GLU n 
7  31   TRP n 
7  32   ASN n 
7  33   VAL n 
7  34   GLU n 
7  35   LYS n 
7  36   PHE n 
7  37   LYS n 
7  38   LYS n 
7  39   ASP n 
7  40   PHE n 
7  41   GLU n 
7  42   VAL n 
7  43   ASN n 
7  44   ILE n 
7  45   SER n 
7  46   SER n 
7  47   LEU n 
7  48   ASP n 
7  49   ALA n 
7  50   ARG n 
7  51   GLU n 
7  52   ALA n 
7  53   ASN n 
7  54   PHE n 
7  55   ASP n 
7  56   LEU n 
7  57   ILE n 
7  58   ASN n 
7  59   ILE n 
7  60   ASP n 
7  61   THR n 
7  62   SER n 
7  63   ILE n 
7  64   ALA n 
7  65   ASN n 
7  66   ALA n 
7  67   PHE n 
7  68   ARG n 
7  69   ARG n 
7  70   ILE n 
7  71   MET n 
7  72   ILE n 
7  73   SER n 
7  74   GLU n 
7  75   VAL n 
7  76   PRO n 
7  77   SER n 
7  78   VAL n 
7  79   ALA n 
7  80   ALA n 
7  81   GLU n 
7  82   TYR n 
7  83   VAL n 
7  84   TYR n 
7  85   PHE n 
7  86   PHE n 
7  87   ASN n 
7  88   ASN n 
7  89   THR n 
7  90   SER n 
7  91   VAL n 
7  92   ILE n 
7  93   GLN n 
7  94   ASP n 
7  95   GLU n 
7  96   VAL n 
7  97   LEU n 
7  98   ALA n 
7  99   HIS n 
7  100  ARG n 
7  101  ILE n 
7  102  GLY n 
7  103  LEU n 
7  104  VAL n 
7  105  PRO n 
7  106  LEU n 
7  107  LYS n 
7  108  VAL n 
7  109  ASP n 
7  110  PRO n 
7  111  ASP n 
7  112  MET n 
7  113  LEU n 
7  114  THR n 
7  115  TRP n 
7  116  VAL n 
7  117  ASP n 
7  118  SER n 
7  119  ASN n 
7  120  LEU n 
7  121  PRO n 
7  122  ASP n 
7  123  ASP n 
7  124  GLU n 
7  125  LYS n 
7  126  PHE n 
7  127  THR n 
7  128  ASP n 
7  129  GLU n 
7  130  ASN n 
7  131  THR n 
7  132  ILE n 
7  133  VAL n 
7  134  LEU n 
7  135  SER n 
7  136  LEU n 
7  137  ASN n 
7  138  VAL n 
7  139  LYS n 
7  140  CYS n 
7  141  THR n 
7  142  ARG n 
7  143  ASN n 
7  144  PRO n 
7  145  ASP n 
7  146  ALA n 
7  147  PRO n 
7  148  LYS n 
7  149  GLY n 
7  150  SER n 
7  151  THR n 
7  152  ASP n 
7  153  PRO n 
7  154  LYS n 
7  155  GLU n 
7  156  LEU n 
7  157  TYR n 
7  158  ASN n 
7  159  ASN n 
7  160  ALA n 
7  161  HIS n 
7  162  VAL n 
7  163  TYR n 
7  164  ALA n 
7  165  ARG n 
7  166  ASP n 
7  167  LEU n 
7  168  LYS n 
7  169  PHE n 
7  170  GLU n 
7  171  PRO n 
7  172  GLN n 
7  173  GLY n 
7  174  ARG n 
7  175  GLN n 
7  176  SER n 
7  177  THR n 
7  178  THR n 
7  179  PHE n 
7  180  ALA n 
7  181  ASP n 
7  182  CYS n 
7  183  PRO n 
7  184  VAL n 
7  185  VAL n 
7  186  PRO n 
7  187  ALA n 
7  188  ASP n 
7  189  PRO n 
7  190  ASP n 
7  191  ILE n 
7  192  LEU n 
7  193  LEU n 
7  194  ALA n 
7  195  LYS n 
7  196  LEU n 
7  197  ARG n 
7  198  PRO n 
7  199  GLY n 
7  200  GLN n 
7  201  GLU n 
7  202  ILE n 
7  203  SER n 
7  204  LEU n 
7  205  LYS n 
7  206  ALA n 
7  207  HIS n 
7  208  CYS n 
7  209  ILE n 
7  210  LEU n 
7  211  GLY n 
7  212  ILE n 
7  213  GLY n 
7  214  GLY n 
7  215  ASP n 
7  216  HIS n 
7  217  ALA n 
7  218  LYS n 
7  219  PHE n 
7  220  SER n 
7  221  PRO n 
7  222  VAL n 
7  223  SER n 
7  224  THR n 
7  225  ALA n 
7  226  SER n 
7  227  TYR n 
7  228  ARG n 
7  229  LEU n 
7  230  LEU n 
7  231  PRO n 
7  232  GLN n 
7  233  ILE n 
7  234  ASN n 
7  235  ILE n 
7  236  LEU n 
7  237  GLN n 
7  238  PRO n 
7  239  ILE n 
7  240  LYS n 
7  241  GLY n 
7  242  GLU n 
7  243  SER n 
7  244  ALA n 
7  245  ARG n 
7  246  ARG n 
7  247  PHE n 
7  248  GLN n 
7  249  LYS n 
7  250  CYS n 
7  251  PHE n 
7  252  PRO n 
7  253  PRO n 
7  254  GLY n 
7  255  VAL n 
7  256  ILE n 
7  257  GLY n 
7  258  ILE n 
7  259  ASP n 
7  260  GLU n 
7  261  GLY n 
7  262  SER n 
7  263  ASP n 
7  264  GLU n 
7  265  ALA n 
7  266  TYR n 
7  267  VAL n 
7  268  LYS n 
7  269  ASP n 
7  270  ALA n 
7  271  ARG n 
7  272  LYS n 
7  273  ASP n 
7  274  THR n 
7  275  VAL n 
7  276  SER n 
7  277  ARG n 
7  278  GLU n 
7  279  VAL n 
7  280  LEU n 
7  281  ARG n 
7  282  TYR n 
7  283  GLU n 
7  284  GLU n 
7  285  PHE n 
7  286  ALA n 
7  287  ASP n 
7  288  LYS n 
7  289  VAL n 
7  290  LYS n 
7  291  LEU n 
7  292  GLY n 
7  293  ARG n 
7  294  VAL n 
7  295  ARG n 
7  296  ASN n 
7  297  HIS n 
7  298  PHE n 
7  299  ILE n 
7  300  PHE n 
7  301  ASN n 
7  302  VAL n 
7  303  GLU n 
7  304  SER n 
7  305  ALA n 
7  306  GLY n 
7  307  ALA n 
7  308  MET n 
7  309  THR n 
7  310  PRO n 
7  311  GLU n 
7  312  GLU n 
7  313  ILE n 
7  314  PHE n 
7  315  PHE n 
7  316  LYS n 
7  317  SER n 
7  318  VAL n 
7  319  ARG n 
7  320  ILE n 
7  321  LEU n 
7  322  LYS n 
7  323  ASN n 
7  324  LYS n 
7  325  ALA n 
7  326  GLU n 
7  327  TYR n 
7  328  LEU n 
7  329  LYS n 
7  330  ASN n 
7  331  CYS n 
7  332  PRO n 
7  333  ILE n 
7  334  THR n 
7  335  GLN n 
8  1    MET n 
8  2    MET n 
8  3    LYS n 
8  4    GLY n 
8  5    SER n 
8  6    ARG n 
8  7    ARG n 
8  8    THR n 
8  9    GLY n 
8  10   ASN n 
8  11   ASN n 
8  12   THR n 
8  13   ALA n 
8  14   THR n 
8  15   THR n 
8  16   LEU n 
8  17   ASN n 
8  18   THR n 
8  19   PRO n 
8  20   VAL n 
8  21   VAL n 
8  22   ILE n 
8  23   HIS n 
8  24   ALA n 
8  25   THR n 
8  26   GLN n 
8  27   LEU n 
8  28   PRO n 
8  29   GLN n 
8  30   HIS n 
8  31   VAL n 
8  32   SER n 
8  33   THR n 
8  34   ASP n 
8  35   GLU n 
8  36   VAL n 
8  37   LEU n 
8  38   GLN n 
8  39   PHE n 
8  40   LEU n 
8  41   GLU n 
8  42   SER n 
8  43   PHE n 
8  44   ILE n 
8  45   ASP n 
8  46   GLU n 
8  47   LYS n 
8  48   GLU n 
8  49   ASN n 
8  50   ILE n 
8  51   ILE n 
8  52   ASP n 
8  53   SER n 
8  54   THR n 
8  55   THR n 
8  56   MET n 
8  57   ASN n 
8  58   THR n 
8  59   ILE n 
8  60   SER n 
8  61   GLY n 
8  62   ASN n 
8  63   ALA n 
8  64   ALA n 
8  65   ASP n 
8  66   ALA n 
8  67   ASP n 
8  68   ALA n 
8  69   ALA n 
8  70   ALA n 
8  71   VAL n 
8  72   ALA n 
8  73   ASN n 
8  74   THR n 
8  75   SER n 
8  76   LEU n 
8  77   ASN n 
8  78   ILE n 
8  79   ASP n 
8  80   THR n 
8  81   ASN n 
8  82   LEU n 
8  83   SER n 
8  84   SER n 
8  85   SER n 
8  86   ILE n 
8  87   SER n 
8  88   GLN n 
8  89   LEU n 
8  90   LYS n 
8  91   ARG n 
8  92   ILE n 
8  93   GLN n 
8  94   ARG n 
8  95   ASP n 
8  96   PHE n 
8  97   LYS n 
8  98   GLY n 
8  99   LEU n 
8  100  PRO n 
8  101  PRO n 
8  102  ALA n 
8  103  GLN n 
8  104  ASP n 
8  105  PHE n 
8  106  SER n 
8  107  ALA n 
8  108  ALA n 
8  109  PRO n 
8  110  ILE n 
8  111  GLN n 
8  112  VAL n 
8  113  SER n 
8  114  THR n 
8  115  THR n 
8  116  GLU n 
8  117  LYS n 
8  118  LYS n 
8  119  GLU n 
8  120  THR n 
8  121  SER n 
8  122  ILE n 
8  123  GLY n 
8  124  VAL n 
8  125  SER n 
8  126  ALA n 
8  127  THR n 
8  128  GLY n 
8  129  GLY n 
8  130  LYS n 
8  131  LYS n 
8  132  THR n 
8  133  THR n 
8  134  PHE n 
8  135  ALA n 
8  136  ASP n 
8  137  GLU n 
9  1    MET n 
9  2    ASP n 
9  3    GLN n 
9  4    GLU n 
9  5    ASN n 
9  6    GLU n 
9  7    ARG n 
9  8    ASN n 
9  9    ILE n 
9  10   SER n 
9  11   ARG n 
9  12   LEU n 
9  13   TRP n 
9  14   ARG n 
9  15   ALA n 
9  16   PHE n 
9  17   ARG n 
9  18   THR n 
9  19   VAL n 
9  20   LYS n 
9  21   GLU n 
9  22   MET n 
9  23   VAL n 
9  24   LYS n 
9  25   ASP n 
9  26   ARG n 
9  27   GLY n 
9  28   TYR n 
9  29   PHE n 
9  30   ILE n 
9  31   THR n 
9  32   GLN n 
9  33   GLU n 
9  34   GLU n 
9  35   VAL n 
9  36   GLU n 
9  37   LEU n 
9  38   PRO n 
9  39   LEU n 
9  40   GLU n 
9  41   ASP n 
9  42   PHE n 
9  43   LYS n 
9  44   ALA n 
9  45   LYS n 
9  46   TYR n 
9  47   CYS n 
9  48   ASP n 
9  49   SER n 
9  50   MET n 
9  51   GLY n 
9  52   ARG n 
9  53   PRO n 
9  54   GLN n 
9  55   ARG n 
9  56   LYS n 
9  57   MET n 
9  58   MET n 
9  59   SER n 
9  60   PHE n 
9  61   GLN n 
9  62   ALA n 
9  63   ASN n 
9  64   PRO n 
9  65   THR n 
9  66   GLU n 
9  67   GLU n 
9  68   SER n 
9  69   ILE n 
9  70   SER n 
9  71   LYS n 
9  72   PHE n 
9  73   PRO n 
9  74   ASP n 
9  75   MET n 
9  76   GLY n 
9  77   SER n 
9  78   LEU n 
9  79   TRP n 
9  80   VAL n 
9  81   GLU n 
9  82   PHE n 
9  83   CYS n 
9  84   ASP n 
9  85   GLU n 
9  86   PRO n 
9  87   SER n 
9  88   VAL n 
9  89   GLY n 
9  90   VAL n 
9  91   LYS n 
9  92   THR n 
9  93   MET n 
9  94   LYS n 
9  95   THR n 
9  96   PHE n 
9  97   VAL n 
9  98   ILE n 
9  99   HIS n 
9  100  ILE n 
9  101  GLN n 
9  102  GLU n 
9  103  LYS n 
9  104  ASN n 
9  105  PHE n 
9  106  GLN n 
9  107  THR n 
9  108  GLY n 
9  109  ILE n 
9  110  PHE n 
9  111  VAL n 
9  112  TYR n 
9  113  GLN n 
9  114  ASN n 
9  115  ASN n 
9  116  ILE n 
9  117  THR n 
9  118  PRO n 
9  119  SER n 
9  120  ALA n 
9  121  MET n 
9  122  LYS n 
9  123  LEU n 
9  124  VAL n 
9  125  PRO n 
9  126  SER n 
9  127  ILE n 
9  128  PRO n 
9  129  PRO n 
9  130  ALA n 
9  131  THR n 
9  132  ILE n 
9  133  GLU n 
9  134  THR n 
9  135  PHE n 
9  136  ASN n 
9  137  GLU n 
9  138  ALA n 
9  139  ALA n 
9  140  LEU n 
9  141  VAL n 
9  142  VAL n 
9  143  ASN n 
9  144  ILE n 
9  145  THR n 
9  146  HIS n 
9  147  HIS n 
9  148  GLU n 
9  149  LEU n 
9  150  VAL n 
9  151  PRO n 
9  152  LYS n 
9  153  HIS n 
9  154  ILE n 
9  155  ARG n 
9  156  LEU n 
9  157  SER n 
9  158  SER n 
9  159  ASP n 
9  160  GLU n 
9  161  LYS n 
9  162  ARG n 
9  163  GLU n 
9  164  LEU n 
9  165  LEU n 
9  166  LYS n 
9  167  ARG n 
9  168  TYR n 
9  169  ARG n 
9  170  LEU n 
9  171  LYS n 
9  172  GLU n 
9  173  SER n 
9  174  GLN n 
9  175  LEU n 
9  176  PRO n 
9  177  ARG n 
9  178  ILE n 
9  179  GLN n 
9  180  ARG n 
9  181  ALA n 
9  182  ASP n 
9  183  PRO n 
9  184  VAL n 
9  185  ALA n 
9  186  LEU n 
9  187  TYR n 
9  188  LEU n 
9  189  GLY n 
9  190  LEU n 
9  191  LYS n 
9  192  ARG n 
9  193  GLY n 
9  194  GLU n 
9  195  VAL n 
9  196  VAL n 
9  197  LYS n 
9  198  ILE n 
9  199  ILE n 
9  200  ARG n 
9  201  LYS n 
9  202  SER n 
9  203  GLU n 
9  204  THR n 
9  205  SER n 
9  206  GLY n 
9  207  ARG n 
9  208  TYR n 
9  209  ALA n 
9  210  SER n 
9  211  TYR n 
9  212  ARG n 
9  213  ILE n 
9  214  CYS n 
9  215  MET n 
10 1    MET n 
10 2    SER n 
10 3    ASP n 
10 4    TYR n 
10 5    GLU n 
10 6    GLU n 
10 7    ALA n 
10 8    PHE n 
10 9    ASN n 
10 10   ASP n 
10 11   GLY n 
10 12   ASN n 
10 13   GLU n 
10 14   ASN n 
10 15   PHE n 
10 16   GLU n 
10 17   ASP n 
10 18   PHE n 
10 19   ASP n 
10 20   VAL n 
10 21   GLU n 
10 22   HIS n 
10 23   PHE n 
10 24   SER n 
10 25   ASP n 
10 26   GLU n 
10 27   GLU n 
10 28   THR n 
10 29   TYR n 
10 30   GLU n 
10 31   GLU n 
10 32   LYS n 
10 33   PRO n 
10 34   GLN n 
10 35   PHE n 
10 36   LYS n 
10 37   ASP n 
10 38   GLY n 
10 39   GLU n 
10 40   THR n 
10 41   THR n 
10 42   ASP n 
10 43   ALA n 
10 44   ASN n 
10 45   GLY n 
10 46   LYS n 
10 47   THR n 
10 48   ILE n 
10 49   VAL n 
10 50   THR n 
10 51   GLY n 
10 52   GLY n 
10 53   ASN n 
10 54   GLY n 
10 55   PRO n 
10 56   GLU n 
10 57   ASP n 
10 58   PHE n 
10 59   GLN n 
10 60   GLN n 
10 61   HIS n 
10 62   GLU n 
10 63   GLN n 
10 64   ILE n 
10 65   ARG n 
10 66   ARG n 
10 67   LYS n 
10 68   THR n 
10 69   LEU n 
10 70   LYS n 
10 71   GLU n 
10 72   LYS n 
10 73   ALA n 
10 74   ILE n 
10 75   PRO n 
10 76   LYS n 
10 77   ASP n 
10 78   GLN n 
10 79   ARG n 
10 80   ALA n 
10 81   THR n 
10 82   THR n 
10 83   PRO n 
10 84   TYR n 
10 85   MET n 
10 86   THR n 
10 87   LYS n 
10 88   TYR n 
10 89   GLU n 
10 90   ARG n 
10 91   ALA n 
10 92   ARG n 
10 93   ILE n 
10 94   LEU n 
10 95   GLY n 
10 96   THR n 
10 97   ARG n 
10 98   ALA n 
10 99   LEU n 
10 100  GLN n 
10 101  ILE n 
10 102  SER n 
10 103  MET n 
10 104  ASN n 
10 105  ALA n 
10 106  PRO n 
10 107  VAL n 
10 108  PHE n 
10 109  VAL n 
10 110  ASP n 
10 111  LEU n 
10 112  GLU n 
10 113  GLY n 
10 114  GLU n 
10 115  THR n 
10 116  ASP n 
10 117  PRO n 
10 118  LEU n 
10 119  ARG n 
10 120  ILE n 
10 121  ALA n 
10 122  MET n 
10 123  LYS n 
10 124  GLU n 
10 125  LEU n 
10 126  ALA n 
10 127  GLU n 
10 128  LYS n 
10 129  LYS n 
10 130  ILE n 
10 131  PRO n 
10 132  LEU n 
10 133  VAL n 
10 134  ILE n 
10 135  ARG n 
10 136  ARG n 
10 137  TYR n 
10 138  LEU n 
10 139  PRO n 
10 140  ASP n 
10 141  GLY n 
10 142  SER n 
10 143  PHE n 
10 144  GLU n 
10 145  ASP n 
10 146  TRP n 
10 147  SER n 
10 148  VAL n 
10 149  GLU n 
10 150  GLU n 
10 151  LEU n 
10 152  ILE n 
10 153  VAL n 
10 154  ASP n 
10 155  LEU n 
11 1    MET n 
11 2    SER n 
11 3    ASN n 
11 4    THR n 
11 5    LEU n 
11 6    PHE n 
11 7    ASP n 
11 8    ASP n 
11 9    ILE n 
11 10   PHE n 
11 11   GLN n 
11 12   VAL n 
11 13   SER n 
11 14   GLU n 
11 15   VAL n 
11 16   ASP n 
11 17   PRO n 
11 18   GLY n 
11 19   ARG n 
11 20   TYR n 
11 21   ASN n 
11 22   LYS n 
11 23   VAL n 
11 24   CYS n 
11 25   ARG n 
11 26   ILE n 
11 27   GLU n 
11 28   ALA n 
11 29   ALA n 
11 30   SER n 
11 31   THR n 
11 32   THR n 
11 33   GLN n 
11 34   ASP n 
11 35   GLN n 
11 36   CYS n 
11 37   LYS n 
11 38   LEU n 
11 39   THR n 
11 40   LEU n 
11 41   ASP n 
11 42   ILE n 
11 43   ASN n 
11 44   VAL n 
11 45   GLU n 
11 46   LEU n 
11 47   PHE n 
11 48   PRO n 
11 49   VAL n 
11 50   ALA n 
11 51   ALA n 
11 52   GLN n 
11 53   ASP n 
11 54   SER n 
11 55   LEU n 
11 56   THR n 
11 57   VAL n 
11 58   THR n 
11 59   ILE n 
11 60   ALA n 
11 61   SER n 
11 62   SER n 
11 63   LEU n 
11 64   ASN n 
11 65   LEU n 
11 66   GLU n 
11 67   ASP n 
11 68   THR n 
11 69   PRO n 
11 70   ALA n 
11 71   ASN n 
11 72   ASP n 
11 73   SER n 
11 74   SER n 
11 75   ALA n 
11 76   THR n 
11 77   ARG n 
11 78   SER n 
11 79   TRP n 
11 80   ARG n 
11 81   PRO n 
11 82   PRO n 
11 83   GLN n 
11 84   ALA n 
11 85   GLY n 
11 86   ASP n 
11 87   ARG n 
11 88   SER n 
11 89   LEU n 
11 90   ALA n 
11 91   ASP n 
11 92   ASP n 
11 93   TYR n 
11 94   ASP n 
11 95   TYR n 
11 96   VAL n 
11 97   MET n 
11 98   TYR n 
11 99   GLY n 
11 100  THR n 
11 101  ALA n 
11 102  TYR n 
11 103  LYS n 
11 104  PHE n 
11 105  GLU n 
11 106  GLU n 
11 107  VAL n 
11 108  SER n 
11 109  LYS n 
11 110  ASP n 
11 111  LEU n 
11 112  ILE n 
11 113  ALA n 
11 114  VAL n 
11 115  TYR n 
11 116  TYR n 
11 117  SER n 
11 118  PHE n 
11 119  GLY n 
11 120  GLY n 
11 121  LEU n 
11 122  LEU n 
11 123  MET n 
11 124  ARG n 
11 125  LEU n 
11 126  GLU n 
11 127  GLY n 
11 128  ASN n 
11 129  TYR n 
11 130  ARG n 
11 131  ASN n 
11 132  LEU n 
11 133  ASN n 
11 134  ASN n 
11 135  LEU n 
11 136  LYS n 
11 137  GLN n 
11 138  GLU n 
11 139  ASN n 
11 140  ALA n 
11 141  TYR n 
11 142  LEU n 
11 143  LEU n 
11 144  ILE n 
11 145  ARG n 
11 146  ARG n 
12 1    MET n 
12 2    SER n 
12 3    VAL n 
12 4    VAL n 
12 5    GLY n 
12 6    SER n 
12 7    LEU n 
12 8    ILE n 
12 9    PHE n 
12 10   CYS n 
12 11   LEU n 
12 12   ASP n 
12 13   CYS n 
12 14   GLY n 
12 15   ASP n 
12 16   LEU n 
12 17   LEU n 
12 18   GLU n 
12 19   ASN n 
12 20   PRO n 
12 21   ASN n 
12 22   ALA n 
12 23   VAL n 
12 24   LEU n 
12 25   GLY n 
12 26   SER n 
12 27   ASN n 
12 28   VAL n 
12 29   GLU n 
12 30   CYS n 
12 31   SER n 
12 32   GLN n 
12 33   CYS n 
12 34   LYS n 
12 35   ALA n 
12 36   ILE n 
12 37   TYR n 
12 38   PRO n 
12 39   LYS n 
12 40   SER n 
12 41   GLN n 
12 42   PHE n 
12 43   SER n 
12 44   ASN n 
12 45   LEU n 
12 46   LYS n 
12 47   VAL n 
12 48   VAL n 
12 49   THR n 
12 50   THR n 
12 51   THR n 
12 52   ALA n 
12 53   ASP n 
12 54   ASP n 
12 55   ALA n 
12 56   PHE n 
12 57   PRO n 
12 58   SER n 
12 59   SER n 
12 60   LEU n 
12 61   ARG n 
12 62   ALA n 
12 63   LYS n 
12 64   LYS n 
12 65   SER n 
12 66   VAL n 
12 67   VAL n 
12 68   LYS n 
12 69   THR n 
12 70   SER n 
12 71   LEU n 
12 72   LYS n 
12 73   LYS n 
12 74   ASN n 
12 75   GLU n 
12 76   LEU n 
12 77   LYS n 
12 78   ASP n 
12 79   GLY n 
12 80   ALA n 
12 81   THR n 
12 82   ILE n 
12 83   LYS n 
12 84   GLU n 
12 85   LYS n 
12 86   CYS n 
12 87   PRO n 
12 88   GLN n 
12 89   CYS n 
12 90   GLY n 
12 91   ASN n 
12 92   GLU n 
12 93   GLU n 
12 94   MET n 
12 95   ASN n 
12 96   TYR n 
12 97   HIS n 
12 98   THR n 
12 99   LEU n 
12 100  GLN n 
12 101  LEU n 
12 102  ARG n 
12 103  SER n 
12 104  ALA n 
12 105  ASP n 
12 106  GLU n 
12 107  GLY n 
12 108  ALA n 
12 109  THR n 
12 110  VAL n 
12 111  PHE n 
12 112  TYR n 
12 113  THR n 
12 114  CYS n 
12 115  THR n 
12 116  SER n 
12 117  CYS n 
12 118  GLY n 
12 119  TYR n 
12 120  LYS n 
12 121  PHE n 
12 122  ARG n 
12 123  THR n 
12 124  ASN n 
12 125  ASN n 
13 1    MET n 
13 2    ILE n 
13 3    VAL n 
13 4    PRO n 
13 5    VAL n 
13 6    ARG n 
13 7    CYS n 
13 8    PHE n 
13 9    SER n 
13 10   CYS n 
13 11   GLY n 
13 12   LYS n 
13 13   VAL n 
13 14   VAL n 
13 15   GLY n 
13 16   ASP n 
13 17   LYS n 
13 18   TRP n 
13 19   GLU n 
13 20   SER n 
13 21   TYR n 
13 22   LEU n 
13 23   ASN n 
13 24   LEU n 
13 25   LEU n 
13 26   GLN n 
13 27   GLU n 
13 28   ASP n 
13 29   GLU n 
13 30   LEU n 
13 31   ASP n 
13 32   GLU n 
13 33   GLY n 
13 34   THR n 
13 35   ALA n 
13 36   LEU n 
13 37   SER n 
13 38   ARG n 
13 39   LEU n 
13 40   GLY n 
13 41   LEU n 
13 42   LYS n 
13 43   ARG n 
13 44   TYR n 
13 45   CYS n 
13 46   CYS n 
13 47   ARG n 
13 48   ARG n 
13 49   MET n 
13 50   ILE n 
13 51   LEU n 
13 52   THR n 
13 53   HIS n 
13 54   VAL n 
13 55   ASP n 
13 56   LEU n 
13 57   ILE n 
13 58   GLU n 
13 59   LYS n 
13 60   PHE n 
13 61   LEU n 
13 62   ARG n 
13 63   TYR n 
13 64   ASN n 
13 65   PRO n 
13 66   LEU n 
13 67   GLU n 
13 68   LYS n 
13 69   ARG n 
13 70   ASP n 
14 1    MET n 
14 2    THR n 
14 3    GLU n 
14 4    ASP n 
14 5    ILE n 
14 6    GLU n 
14 7    GLN n 
14 8    LYS n 
14 9    LYS n 
14 10   THR n 
14 11   ALA n 
14 12   THR n 
14 13   GLU n 
14 14   VAL n 
14 15   THR n 
14 16   PRO n 
14 17   GLN n 
14 18   GLU n 
14 19   PRO n 
14 20   LYS n 
14 21   HIS n 
14 22   ILE n 
14 23   GLN n 
14 24   GLU n 
14 25   GLU n 
14 26   GLU n 
14 27   GLU n 
14 28   GLN n 
14 29   ASP n 
14 30   VAL n 
14 31   ASP n 
14 32   MET n 
14 33   THR n 
14 34   GLY n 
14 35   ASP n 
14 36   GLU n 
14 37   GLU n 
14 38   GLN n 
14 39   GLU n 
14 40   GLU n 
14 41   GLU n 
14 42   PRO n 
14 43   ASP n 
14 44   ARG n 
14 45   GLU n 
14 46   LYS n 
14 47   ILE n 
14 48   LYS n 
14 49   LEU n 
14 50   LEU n 
14 51   THR n 
14 52   GLN n 
14 53   ALA n 
14 54   THR n 
14 55   SER n 
14 56   GLU n 
14 57   ASP n 
14 58   GLY n 
14 59   THR n 
14 60   SER n 
14 61   ALA n 
14 62   SER n 
14 63   PHE n 
14 64   GLN n 
14 65   ILE n 
14 66   VAL n 
14 67   GLU n 
14 68   GLU n 
14 69   ASP n 
14 70   HIS n 
14 71   THR n 
14 72   LEU n 
14 73   GLY n 
14 74   ASN n 
14 75   ALA n 
14 76   LEU n 
14 77   ARG n 
14 78   TYR n 
14 79   VAL n 
14 80   ILE n 
14 81   MET n 
14 82   LYS n 
14 83   ASN n 
14 84   PRO n 
14 85   ASP n 
14 86   VAL n 
14 87   GLU n 
14 88   PHE n 
14 89   CYS n 
14 90   GLY n 
14 91   TYR n 
14 92   SER n 
14 93   ILE n 
14 94   PRO n 
14 95   HIS n 
14 96   PRO n 
14 97   SER n 
14 98   GLU n 
14 99   ASN n 
14 100  LEU n 
14 101  LEU n 
14 102  ASN n 
14 103  ILE n 
14 104  ARG n 
14 105  ILE n 
14 106  GLN n 
14 107  THR n 
14 108  TYR n 
14 109  GLY n 
14 110  GLU n 
14 111  THR n 
14 112  THR n 
14 113  ALA n 
14 114  VAL n 
14 115  ASP n 
14 116  ALA n 
14 117  LEU n 
14 118  GLN n 
14 119  LYS n 
14 120  GLY n 
14 121  LEU n 
14 122  LYS n 
14 123  ASP n 
14 124  LEU n 
14 125  MET n 
14 126  ASP n 
14 127  LEU n 
14 128  CYS n 
14 129  ASP n 
14 130  VAL n 
14 131  VAL n 
14 132  GLU n 
14 133  SER n 
14 134  LYS n 
14 135  PHE n 
14 136  THR n 
14 137  GLU n 
14 138  LYS n 
14 139  ILE n 
14 140  LYS n 
14 141  SER n 
14 142  MET n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPAB4_YEAST 1  ? ? P40422 ? 
2  UNP RPA49_YEAST 2  ? ? Q01080 ? 
3  UNP RPA34_YEAST 3  ? ? P47006 ? 
4  UNP RPA43_YEAST 4  ? ? P46669 ? 
5  UNP RPA1_YEAST  5  ? ? P10964 ? 
6  UNP RPA2_YEAST  6  ? ? P22138 ? 
7  UNP RPAC1_YEAST 7  ? ? P07703 ? 
8  UNP RPA14_YEAST 8  ? ? P50106 ? 
9  UNP RPAB1_YEAST 9  ? ? P20434 ? 
10 UNP RPAB2_YEAST 10 ? ? P20435 ? 
11 UNP RPAB3_YEAST 11 ? ? P20436 ? 
12 UNP RPA12_YEAST 12 ? ? P32529 ? 
13 UNP RPAB5_YEAST 13 ? ? P22139 ? 
14 UNP RPAC2_YEAST 14 ? ? P28000 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4C2M 1 1 ? 70   ? P40422 1 ? 70   ? 1 70   
2  2  4C2M 2 1 ? 415  ? Q01080 1 ? 415  ? 1 415  
3  3  4C2M 3 1 ? 233  ? P47006 1 ? 233  ? 1 233  
4  4  4C2M 4 1 ? 326  ? P46669 1 ? 326  ? 1 326  
5  5  4C2M A 1 ? 1664 ? P10964 1 ? 1664 ? 1 1664 
6  6  4C2M B 1 ? 1203 ? P22138 1 ? 1203 ? 1 1203 
7  7  4C2M C 1 ? 335  ? P07703 1 ? 335  ? 1 335  
8  8  4C2M D 1 ? 137  ? P50106 1 ? 137  ? 1 137  
9  9  4C2M E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
10 10 4C2M F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
11 4  4C2M G 1 ? 326  ? P46669 1 ? 326  ? 1 326  
12 11 4C2M H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
13 12 4C2M I 1 ? 125  ? P32529 1 ? 125  ? 1 125  
14 13 4C2M J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
15 14 4C2M K 1 ? 142  ? P28000 1 ? 142  ? 1 142  
16 1  4C2M L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
17 2  4C2M M 1 ? 415  ? Q01080 1 ? 415  ? 1 415  
18 3  4C2M N 1 ? 233  ? P47006 1 ? 233  ? 1 233  
19 4  4C2M O 1 ? 326  ? P46669 1 ? 326  ? 1 326  
20 5  4C2M P 1 ? 1664 ? P10964 1 ? 1664 ? 1 1664 
21 6  4C2M Q 1 ? 1203 ? P22138 1 ? 1203 ? 1 1203 
22 7  4C2M R 1 ? 335  ? P07703 1 ? 335  ? 1 335  
23 8  4C2M S 1 ? 137  ? P50106 1 ? 137  ? 1 137  
24 9  4C2M T 1 ? 215  ? P20434 1 ? 215  ? 1 215  
25 10 4C2M U 1 ? 155  ? P20435 1 ? 155  ? 1 155  
26 4  4C2M V 1 ? 326  ? P46669 1 ? 326  ? 1 326  
27 11 4C2M W 1 ? 146  ? P20436 1 ? 146  ? 1 146  
28 12 4C2M X 1 ? 125  ? P32529 1 ? 125  ? 1 125  
29 13 4C2M Y 1 ? 70   ? P22139 1 ? 70   ? 1 70   
30 14 4C2M Z 1 ? 142  ? P28000 1 ? 142  ? 1 142  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          4C2M 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   4 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.85 
_exptl_crystal.density_percent_sol   56.9 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10% PEG4000, 300MM AMMONIUM ACETATE, 50MM HEPES PH 7.5, 5MM TCEP' 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 PIXEL 'DECTRIS PILATUS 6M' ? ? 
2 PIXEL 'DECTRIS PILATUS 6M' ? ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.pdbx_scattering_type 
1 1 M ? 'SINGLE WAVELENGTH' x-ray 
2 1 M ? 'SINGLE WAVELENGTH' x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0     1.0 
2 1.28288 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'SLS BEAMLINE X10SA' SLS X10SA 1.0     ? 
2 SYNCHROTRON 'SLS BEAMLINE X06SA' SLS X06SA 1.28288 ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4C2M 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.00 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   320814 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.24 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.61 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.1 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.87 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.52 
_reflns_shell.pdbx_redundancy        11.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4C2M 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     320815 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.292 
_refine.ls_d_res_high                            2.800 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.1697 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1689 
_refine.ls_R_factor_R_free                       0.2099 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  6493 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.pdbx_overall_phase_error                 23.43 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        68821 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             262 
_refine_hist.number_atoms_total               69107 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        39.292 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 70209 'X-RAY DIFFRACTION' ? 
f_angle_d          1.241  ? ? 94762 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.318 ? ? 26576 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.084  ? ? 10577 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 12274 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 625  ?     ? POSITIONAL 1  1  'X-RAY DIFFRACTION' ? ? ? 
2 P 625  0.075 ? POSITIONAL 1  2  'X-RAY DIFFRACTION' ? ? ? 
1 A 475  ?     ? POSITIONAL 2  3  'X-RAY DIFFRACTION' ? ? ? 
2 P 475  0.037 ? POSITIONAL 2  4  'X-RAY DIFFRACTION' ? ? ? 
1 A 783  ?     ? POSITIONAL 3  5  'X-RAY DIFFRACTION' ? ? ? 
2 P 783  0.055 ? POSITIONAL 3  6  'X-RAY DIFFRACTION' ? ? ? 
1 A 427  ?     ? POSITIONAL 4  7  'X-RAY DIFFRACTION' ? ? ? 
2 P 427  0.092 ? POSITIONAL 4  8  'X-RAY DIFFRACTION' ? ? ? 
1 A 141  ?     ? POSITIONAL 5  9  'X-RAY DIFFRACTION' ? ? ? 
2 P 141  0.035 ? POSITIONAL 5  10 'X-RAY DIFFRACTION' ? ? ? 
1 A 489  ?     ? POSITIONAL 6  11 'X-RAY DIFFRACTION' ? ? ? 
2 P 489  0.101 ? POSITIONAL 6  12 'X-RAY DIFFRACTION' ? ? ? 
1 A 279  ?     ? POSITIONAL 7  13 'X-RAY DIFFRACTION' ? ? ? 
2 P 279  0.042 ? POSITIONAL 7  14 'X-RAY DIFFRACTION' ? ? ? 
1 A 1367 ?     ? POSITIONAL 8  15 'X-RAY DIFFRACTION' ? ? ? 
2 P 1367 0.041 ? POSITIONAL 8  16 'X-RAY DIFFRACTION' ? ? ? 
1 A 1368 ?     ? POSITIONAL 9  17 'X-RAY DIFFRACTION' ? ? ? 
2 P 1368 0.042 ? POSITIONAL 9  18 'X-RAY DIFFRACTION' ? ? ? 
1 A 1220 ?     ? POSITIONAL 10 19 'X-RAY DIFFRACTION' ? ? ? 
2 P 1220 0.042 ? POSITIONAL 10 20 'X-RAY DIFFRACTION' ? ? ? 
1 A 316  ?     ? POSITIONAL 11 21 'X-RAY DIFFRACTION' ? ? ? 
2 P 316  0.054 ? POSITIONAL 11 22 'X-RAY DIFFRACTION' ? ? ? 
1 A 1012 ?     ? POSITIONAL 12 23 'X-RAY DIFFRACTION' ? ? ? 
2 P 1012 0.041 ? POSITIONAL 12 24 'X-RAY DIFFRACTION' ? ? ? 
1 A 341  ?     ? POSITIONAL 13 25 'X-RAY DIFFRACTION' ? ? ? 
2 P 341  0.041 ? POSITIONAL 13 26 'X-RAY DIFFRACTION' ? ? ? 
1 A 921  ?     ? POSITIONAL 14 27 'X-RAY DIFFRACTION' ? ? ? 
2 P 921  0.043 ? POSITIONAL 14 28 'X-RAY DIFFRACTION' ? ? ? 
1 A 290  ?     ? POSITIONAL 15 29 'X-RAY DIFFRACTION' ? ? ? 
2 P 290  0.083 ? POSITIONAL 15 30 'X-RAY DIFFRACTION' ? ? ? 
1 A 524  ?     ? POSITIONAL 16 31 'X-RAY DIFFRACTION' ? ? ? 
2 P 524  0.048 ? POSITIONAL 16 32 'X-RAY DIFFRACTION' ? ? ? 
1 B 544  ?     ? POSITIONAL 17 33 'X-RAY DIFFRACTION' ? ? ? 
2 Q 544  0.038 ? POSITIONAL 17 34 'X-RAY DIFFRACTION' ? ? ? 
1 B 885  ?     ? POSITIONAL 18 35 'X-RAY DIFFRACTION' ? ? ? 
2 Q 885  0.039 ? POSITIONAL 18 36 'X-RAY DIFFRACTION' ? ? ? 
1 B 1632 ?     ? POSITIONAL 19 37 'X-RAY DIFFRACTION' ? ? ? 
2 Q 1632 0.050 ? POSITIONAL 19 38 'X-RAY DIFFRACTION' ? ? ? 
1 B 677  ?     ? POSITIONAL 20 39 'X-RAY DIFFRACTION' ? ? ? 
2 Q 677  0.092 ? POSITIONAL 20 40 'X-RAY DIFFRACTION' ? ? ? 
1 B 1651 ?     ? POSITIONAL 21 41 'X-RAY DIFFRACTION' ? ? ? 
2 Q 1651 0.068 ? POSITIONAL 21 42 'X-RAY DIFFRACTION' ? ? ? 
1 B 787  ?     ? POSITIONAL 22 43 'X-RAY DIFFRACTION' ? ? ? 
2 Q 787  0.045 ? POSITIONAL 22 44 'X-RAY DIFFRACTION' ? ? ? 
1 B 865  ?     ? POSITIONAL 23 45 'X-RAY DIFFRACTION' ? ? ? 
2 Q 865  0.030 ? POSITIONAL 23 46 'X-RAY DIFFRACTION' ? ? ? 
1 B 1004 ?     ? POSITIONAL 24 47 'X-RAY DIFFRACTION' ? ? ? 
2 Q 1004 0.055 ? POSITIONAL 24 48 'X-RAY DIFFRACTION' ? ? ? 
1 B 1216 ?     ? POSITIONAL 25 49 'X-RAY DIFFRACTION' ? ? ? 
2 Q 1216 0.047 ? POSITIONAL 25 50 'X-RAY DIFFRACTION' ? ? ? 
1 C 377  ?     ? POSITIONAL 26 51 'X-RAY DIFFRACTION' ? ? ? 
2 R 377  0.145 ? POSITIONAL 26 52 'X-RAY DIFFRACTION' ? ? ? 
1 C 1121 ?     ? POSITIONAL 27 53 'X-RAY DIFFRACTION' ? ? ? 
2 R 1121 0.048 ? POSITIONAL 27 54 'X-RAY DIFFRACTION' ? ? ? 
1 C 915  ?     ? POSITIONAL 28 55 'X-RAY DIFFRACTION' ? ? ? 
2 R 915  0.032 ? POSITIONAL 28 56 'X-RAY DIFFRACTION' ? ? ? 
1 D 459  ?     ? POSITIONAL 29 57 'X-RAY DIFFRACTION' ? ? ? 
2 S 459  0.029 ? POSITIONAL 29 58 'X-RAY DIFFRACTION' ? ? ? 
1 G 890  ?     ? POSITIONAL 30 59 'X-RAY DIFFRACTION' ? ? ? 
2 V 890  0.036 ? POSITIONAL 30 60 'X-RAY DIFFRACTION' ? ? ? 
1 G 618  ?     ? POSITIONAL 31 61 'X-RAY DIFFRACTION' ? ? ? 
2 V 618  0.058 ? POSITIONAL 31 62 'X-RAY DIFFRACTION' ? ? ? 
1 O 404  ?     ? POSITIONAL 32 63 'X-RAY DIFFRACTION' ? ? ? 
2 4 404  0.033 ? POSITIONAL 32 64 'X-RAY DIFFRACTION' ? ? ? 
1 E 1161 ?     ? POSITIONAL 33 65 'X-RAY DIFFRACTION' ? ? ? 
2 T 1161 0.027 ? POSITIONAL 33 66 'X-RAY DIFFRACTION' ? ? ? 
1 E 565  ?     ? POSITIONAL 34 67 'X-RAY DIFFRACTION' ? ? ? 
2 T 565  0.065 ? POSITIONAL 34 68 'X-RAY DIFFRACTION' ? ? ? 
1 F 823  ?     ? POSITIONAL 35 69 'X-RAY DIFFRACTION' ? ? ? 
2 U 823  0.037 ? POSITIONAL 35 70 'X-RAY DIFFRACTION' ? ? ? 
1 H 1052 ?     ? POSITIONAL 36 71 'X-RAY DIFFRACTION' ? ? ? 
2 W 1052 0.032 ? POSITIONAL 36 72 'X-RAY DIFFRACTION' ? ? ? 
1 I 516  ?     ? POSITIONAL 37 73 'X-RAY DIFFRACTION' ? ? ? 
2 X 516  0.043 ? POSITIONAL 37 74 'X-RAY DIFFRACTION' ? ? ? 
1 I 384  ?     ? POSITIONAL 38 75 'X-RAY DIFFRACTION' ? ? ? 
2 X 384  0.032 ? POSITIONAL 38 76 'X-RAY DIFFRACTION' ? ? ? 
1 J 570  ?     ? POSITIONAL 39 77 'X-RAY DIFFRACTION' ? ? ? 
2 Y 570  0.036 ? POSITIONAL 39 78 'X-RAY DIFFRACTION' ? ? ? 
1 K 786  ?     ? POSITIONAL 40 79 'X-RAY DIFFRACTION' ? ? ? 
2 Z 786  0.055 ? POSITIONAL 40 80 'X-RAY DIFFRACTION' ? ? ? 
1 L 353  ?     ? POSITIONAL 41 81 'X-RAY DIFFRACTION' ? ? ? 
2 1 353  0.029 ? POSITIONAL 41 82 'X-RAY DIFFRACTION' ? ? ? 
1 M 814  ?     ? POSITIONAL 42 83 'X-RAY DIFFRACTION' ? ? ? 
2 2 814  0.031 ? POSITIONAL 42 84 'X-RAY DIFFRACTION' ? ? ? 
1 N 816  ?     ? POSITIONAL 43 85 'X-RAY DIFFRACTION' ? ? ? 
2 3 816  0.031 ? POSITIONAL 43 86 'X-RAY DIFFRACTION' ? ? ? 
1 N 320  ?     ? POSITIONAL 44 87 'X-RAY DIFFRACTION' ? ? ? 
2 3 320  0.032 ? POSITIONAL 44 88 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.8000 2.8318  10451 0.3180 100.00 0.3485 . . 212 . . 
'X-RAY DIFFRACTION' . 2.8318 2.8651  10460 0.3000 100.00 0.3397 . . 218 . . 
'X-RAY DIFFRACTION' . 2.8651 2.9000  10483 0.2858 100.00 0.3225 . . 236 . . 
'X-RAY DIFFRACTION' . 2.9000 2.9367  10465 0.2654 100.00 0.3065 . . 236 . . 
'X-RAY DIFFRACTION' . 2.9367 2.9754  10453 0.2539 100.00 0.3011 . . 211 . . 
'X-RAY DIFFRACTION' . 2.9754 3.0161  10481 0.2549 100.00 0.3146 . . 223 . . 
'X-RAY DIFFRACTION' . 3.0161 3.0592  10455 0.2476 100.00 0.2703 . . 230 . . 
'X-RAY DIFFRACTION' . 3.0592 3.1048  10423 0.2469 100.00 0.3174 . . 236 . . 
'X-RAY DIFFRACTION' . 3.1048 3.1533  10561 0.2459 100.00 0.3304 . . 208 . . 
'X-RAY DIFFRACTION' . 3.1533 3.2050  10452 0.2431 100.00 0.2817 . . 210 . . 
'X-RAY DIFFRACTION' . 3.2050 3.2602  10466 0.2255 100.00 0.2706 . . 248 . . 
'X-RAY DIFFRACTION' . 3.2602 3.3195  10572 0.2204 100.00 0.2945 . . 198 . . 
'X-RAY DIFFRACTION' . 3.3195 3.3833  10465 0.2109 100.00 0.2587 . . 201 . . 
'X-RAY DIFFRACTION' . 3.3833 3.4523  10411 0.1994 100.00 0.2478 . . 217 . . 
'X-RAY DIFFRACTION' . 3.4523 3.5274  10479 0.1893 100.00 0.2260 . . 227 . . 
'X-RAY DIFFRACTION' . 3.5274 3.6094  10565 0.1858 100.00 0.2381 . . 206 . . 
'X-RAY DIFFRACTION' . 3.6094 3.6995  10428 0.1693 100.00 0.2190 . . 197 . . 
'X-RAY DIFFRACTION' . 3.6995 3.7995  10469 0.1627 100.00 0.2167 . . 215 . . 
'X-RAY DIFFRACTION' . 3.7995 3.9112  10507 0.1592 100.00 0.2062 . . 209 . . 
'X-RAY DIFFRACTION' . 3.9112 4.0373  10449 0.1526 100.00 0.2166 . . 217 . . 
'X-RAY DIFFRACTION' . 4.0373 4.1815  10538 0.1478 100.00 0.2015 . . 210 . . 
'X-RAY DIFFRACTION' . 4.1815 4.3487  10527 0.1336 100.00 0.1735 . . 215 . . 
'X-RAY DIFFRACTION' . 4.3487 4.5463  10456 0.1298 100.00 0.1591 . . 206 . . 
'X-RAY DIFFRACTION' . 4.5463 4.7856  10513 0.1255 100.00 0.1665 . . 220 . . 
'X-RAY DIFFRACTION' . 4.7856 5.0849  10452 0.1269 100.00 0.1688 . . 227 . . 
'X-RAY DIFFRACTION' . 5.0849 5.4765  10483 0.1338 100.00 0.1555 . . 223 . . 
'X-RAY DIFFRACTION' . 5.4765 6.0259  10500 0.1437 100.00 0.1850 . . 200 . . 
'X-RAY DIFFRACTION' . 6.0259 6.8938  10504 0.1491 100.00 0.1960 . . 204 . . 
'X-RAY DIFFRACTION' . 6.8938 8.6700  10477 0.1382 100.00 0.1711 . . 222 . . 
'X-RAY DIFFRACTION' . 8.6700 39.2963 10377 0.1464 99.00  0.1554 . . 211 . . 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.992300 
_struct_ncs_oper.matrix[1][2]   -0.121700 
_struct_ncs_oper.matrix[1][3]   -0.022810 
_struct_ncs_oper.matrix[2][1]   -0.122100 
_struct_ncs_oper.matrix[2][2]   0.992300 
_struct_ncs_oper.matrix[2][3]   0.021180 
_struct_ncs_oper.matrix[3][1]   0.020060 
_struct_ncs_oper.matrix[3][2]   0.023800 
_struct_ncs_oper.matrix[3][3]   -0.999500 
_struct_ncs_oper.vector[1]      106.60000 
_struct_ncs_oper.vector[2]      7.92700 
_struct_ncs_oper.vector[3]      212.80000 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1  
2 ? 1  
1 ? 2  
2 ? 2  
1 ? 3  
2 ? 3  
1 ? 4  
2 ? 4  
1 ? 5  
2 ? 5  
1 ? 6  
2 ? 6  
1 ? 7  
2 ? 7  
1 ? 8  
2 ? 8  
1 ? 9  
2 ? 9  
1 ? 10 
2 ? 10 
1 ? 11 
2 ? 11 
1 ? 12 
2 ? 12 
1 ? 13 
2 ? 13 
1 ? 14 
2 ? 14 
1 ? 15 
2 ? 15 
1 ? 16 
2 ? 16 
1 ? 17 
2 ? 17 
1 ? 18 
2 ? 18 
1 ? 19 
2 ? 19 
1 ? 20 
2 ? 20 
1 ? 21 
2 ? 21 
1 ? 22 
2 ? 22 
1 ? 23 
2 ? 23 
1 ? 24 
2 ? 24 
1 ? 25 
2 ? 25 
1 ? 26 
2 ? 26 
1 ? 27 
2 ? 27 
1 ? 28 
2 ? 28 
1 ? 29 
2 ? 29 
1 ? 30 
2 ? 30 
1 ? 31 
2 ? 31 
1 ? 32 
2 ? 32 
1 ? 33 
2 ? 33 
1 ? 34 
2 ? 34 
1 ? 35 
2 ? 35 
1 ? 36 
2 ? 36 
1 ? 37 
2 ? 37 
1 ? 38 
2 ? 38 
1 ? 39 
2 ? 39 
1 ? 40 
2 ? 40 
1 ? 41 
2 ? 41 
1 ? 42 
2 ? 42 
1 ? 43 
2 ? 43 
1 ? 44 
2 ? 44 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'CHAIN A AND RESSEQ 1:84'      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1  'CHAIN P AND RESSEQ 1:84'      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'CHAIN A AND RESSEQ 85:139'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2  'CHAIN P AND RESSEQ 85:139'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'CHAIN A AND RESSEQ 176:272'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3  'CHAIN P AND RESSEQ 176:272'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'CHAIN A AND RESSEQ 296:363'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4  'CHAIN P AND RESSEQ 296:363'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'CHAIN A AND RESSEQ 364:380'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 5  'CHAIN P AND RESSEQ 364:380'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'CHAIN A AND RESSEQ 381:441'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 6  'CHAIN P AND RESSEQ 381:441'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'CHAIN A AND RESSEQ 442:477'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 7  'CHAIN P AND RESSEQ 442:477'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'CHAIN A AND RESSEQ 478:652'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 8  'CHAIN P AND RESSEQ 478:652'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'CHAIN A AND RESSEQ 653:826'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 9  'CHAIN P AND RESSEQ 653:826'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'CHAIN A AND RESSEQ 827:989'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 10 'CHAIN P AND RESSEQ 827:989'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'CHAIN A AND RESSEQ 990:1028'  
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 11 'CHAIN P AND RESSEQ 990:1028'  
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'CHAIN A AND RESSEQ 1029:1152' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 12 'CHAIN P AND RESSEQ 1029:1152' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'CHAIN A AND RESSEQ 1160:1204' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 13 'CHAIN P AND RESSEQ 1160:1204' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'CHAIN A AND RESSEQ 1213:1337' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 14 'CHAIN P AND RESSEQ 1213:1337' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'CHAIN A AND RESSEQ 1361:1395' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 15 'CHAIN P AND RESSEQ 1361:1395' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 16 'CHAIN A AND RESSEQ 1596:1664' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 16 'CHAIN P AND RESSEQ 1596:1664' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 17 'CHAIN B AND RESSEQ 8:79'      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 17 'CHAIN Q AND RESSEQ 8:79'      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 18 'CHAIN B AND RESSEQ 88:204'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 18 'CHAIN Q AND RESSEQ 88:204'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 19 'CHAIN B AND RESSEQ 205:404'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 19 'CHAIN Q AND RESSEQ 205:404'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 20 'CHAIN B AND RESSEQ 405:489'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 20 'CHAIN Q AND RESSEQ 405:489'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 21 'CHAIN B AND RESSEQ 490:697'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 21 'CHAIN Q AND RESSEQ 490:697'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 22 'CHAIN B AND RESSEQ 698:798'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 22 'CHAIN Q AND RESSEQ 698:798'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 23 'CHAIN B AND RESSEQ 799:910'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 23 'CHAIN Q AND RESSEQ 799:910'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 24 'CHAIN B AND RESSEQ 911:1038'  
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 24 'CHAIN Q AND RESSEQ 911:1038'  
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 25 'CHAIN B AND RESSEQ 1039:1203' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 25 'CHAIN Q AND RESSEQ 1039:1203' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 26 'CHAIN C AND RESSEQ 31:76'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 26 'CHAIN R AND RESSEQ 31:76'     
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 27 'CHAIN C AND RESSEQ 77:220'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 27 'CHAIN R AND RESSEQ 77:220'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 28 'CHAIN C AND RESSEQ 221:334'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 28 'CHAIN R AND RESSEQ 221:334'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 29 'CHAIN D'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 29 'CHAIN S'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 30 'CHAIN G AND RESSEQ 14:127'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 30 'CHAIN V AND RESSEQ 14:127'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 31 'CHAIN G AND RESSEQ 128:250'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 31 'CHAIN V AND RESSEQ 128:250'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 32 'CHAIN O AND RESSEQ 265:315'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 32 'CHAIN 4 AND RESSEQ 265:315'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 33 'CHAIN E AND RESSEQ 5:147'     
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 33 'CHAIN T AND RESSEQ 5:147'     
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 34 'CHAIN E AND RESSEQ 148:215'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 34 'CHAIN T AND RESSEQ 148:215'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 35 'CHAIN F'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 35 'CHAIN U'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 36 'CHAIN H'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 36 'CHAIN W'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 37 'CHAIN I AND RESSEQ 2:74'      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 37 'CHAIN X AND RESSEQ 2:74'      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 38 'CHAIN I AND RESSEQ 75:125'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 38 'CHAIN X AND RESSEQ 75:125'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 39 'CHAIN J'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 39 'CHAIN Y'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 40 'CHAIN K'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 40 'CHAIN Z'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 41 'CHAIN L'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 41 'CHAIN 1'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 42 'CHAIN M'                      
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 42 'CHAIN 2'                      
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 43 'CHAIN N AND RESSEQ 22:140'    
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 43 'CHAIN 3 AND RESSEQ 22:140'    
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 44 'CHAIN N AND RESSEQ 141:180'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 44 'CHAIN 3 AND RESSEQ 141:180'   
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
19 ? 
20 ? 
21 ? 
22 ? 
23 ? 
24 ? 
25 ? 
26 ? 
27 ? 
28 ? 
29 ? 
30 ? 
31 ? 
32 ? 
33 ? 
34 ? 
35 ? 
36 ? 
37 ? 
38 ? 
39 ? 
40 ? 
41 ? 
42 ? 
43 ? 
44 ? 
# 
_struct.entry_id                  4C2M 
_struct.title                     'Structure of RNA polymerase I at 2.8 A resolution' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA49, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA34, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA43, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA135 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC1, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA14, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA12, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC2
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4C2M 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, RIBOSOME BIOGENESIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 4  ? 
L  N N 11 ? 
M  N N 12 ? 
N  N N 13 ? 
O  N N 14 ? 
P  N N 1  ? 
Q  N N 2  ? 
R  N N 3  ? 
S  N N 4  ? 
T  N N 5  ? 
U  N N 6  ? 
V  N N 7  ? 
W  N N 8  ? 
X  N N 9  ? 
Y  N N 10 ? 
Z  N N 4  ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 15 ? 
GA N N 15 ? 
HA N N 16 ? 
IA N N 15 ? 
JA N N 15 ? 
KA N N 15 ? 
LA N N 15 ? 
MA N N 15 ? 
NA N N 15 ? 
OA N N 15 ? 
PA N N 16 ? 
QA N N 15 ? 
RA N N 15 ? 
SA N N 15 ? 
TA N N 15 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 17 ? 
YA N N 17 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
CB N N 17 ? 
DB N N 17 ? 
EB N N 17 ? 
FB N N 17 ? 
GB N N 17 ? 
HB N N 17 ? 
IB N N 17 ? 
JB N N 17 ? 
KB N N 17 ? 
LB N N 17 ? 
MB N N 17 ? 
NB N N 17 ? 
OB N N 17 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER B  69   ? ALA B  72   ? SER 2 69   ALA 2 72   5 ? 4  
HELX_P HELX_P2   2   LYS B  103  ? ASN B  107  ? LYS 2 103  ASN 2 107  1 ? 5  
HELX_P HELX_P3   3   ASP C  92   ? SER C  97   ? ASP 3 92   SER 3 97   1 ? 6  
HELX_P HELX_P4   4   ASP C  149  ? ARG C  154  ? ASP 3 149  ARG 3 154  1 ? 6  
HELX_P HELX_P5   5   ASP C  176  ? PHE C  180  ? ASP 3 176  PHE 3 180  5 ? 5  
HELX_P HELX_P6   6   ILE D  272  ? GLU D  294  ? ILE 4 272  GLU 4 294  1 ? 23 
HELX_P HELX_P7   7   THR E  20   ? SER E  28   ? THR A 20   SER A 28   1 ? 9  
HELX_P HELX_P8   8   ASP E  51   ? GLY E  55   ? ASP A 51   GLY A 55   5 ? 5  
HELX_P HELX_P9   9   PHE E  90   ? SER E  101  ? PHE A 90   SER A 101  1 ? 12 
HELX_P HELX_P10  10  LYS E  111  ? TYR E  127  ? LYS A 111  TYR A 127  1 ? 17 
HELX_P HELX_P11  11  LEU E  129  ? LEU E  136  ? LEU A 129  LEU A 136  1 ? 8  
HELX_P HELX_P12  12  ASP E  137  ? ILE E  139  ? ASP A 137  ILE A 139  5 ? 3  
HELX_P HELX_P13  13  SER E  174  ? ASP E  199  ? SER A 174  ASP A 199  1 ? 26 
HELX_P HELX_P14  14  THR E  209  ? SER E  229  ? THR A 209  SER A 229  1 ? 21 
HELX_P HELX_P15  15  ASN E  257  ? LYS E  267  ? ASN A 257  LYS A 267  1 ? 11 
HELX_P HELX_P16  16  LEU E  316  ? GLU E  331  ? LEU A 316  GLU A 331  1 ? 16 
HELX_P HELX_P17  17  GLU E  331  ? PHE E  339  ? GLU A 331  PHE A 339  1 ? 9  
HELX_P HELX_P18  18  LYS E  351  ? SER E  354  ? LYS A 351  SER A 354  5 ? 4  
HELX_P HELX_P19  19  PRO E  364  ? ARG E  368  ? PRO A 364  ARG A 368  5 ? 5  
HELX_P HELX_P20  20  ASN E  380  ? LYS E  405  ? ASN A 380  LYS A 405  1 ? 26 
HELX_P HELX_P21  21  GLU E  414  ? ASP E  439  ? GLU A 414  ASP A 439  1 ? 26 
HELX_P HELX_P22  22  SER E  440  ? ALA E  443  ? SER A 440  ALA A 443  5 ? 4  
HELX_P HELX_P23  23  GLY E  455  ? LYS E  462  ? GLY A 455  LYS A 462  1 ? 8  
HELX_P HELX_P24  24  GLY E  465  ? MET E  471  ? GLY A 465  MET A 471  1 ? 7  
HELX_P HELX_P25  25  PRO E  498  ? VAL E  503  ? PRO A 498  VAL A 503  1 ? 6  
HELX_P HELX_P26  26  ASN E  515  ? GLY E  526  ? ASN A 515  GLY A 526  1 ? 12 
HELX_P HELX_P27  27  SER E  550  ? ASN E  559  ? SER A 550  ASN A 559  1 ? 10 
HELX_P HELX_P28  28  ASN E  567  ? HIS E  571  ? ASN A 567  HIS A 571  5 ? 5  
HELX_P HELX_P29  29  HIS E  596  ? ALA E  598  ? HIS A 596  ALA A 598  5 ? 3  
HELX_P HELX_P30  30  HIS E  617  ? ALA E  619  ? HIS A 617  ALA A 619  5 ? 3  
HELX_P HELX_P31  31  ASN E  620  ? ASN E  625  ? ASN A 620  ASN A 625  1 ? 6  
HELX_P HELX_P32  32  ASN E  640  ? LEU E  650  ? ASN A 640  LEU A 650  1 ? 11 
HELX_P HELX_P33  33  THR E  653  ? TYR E  657  ? THR A 653  TYR A 657  5 ? 5  
HELX_P HELX_P34  34  GLN E  671  ? THR E  681  ? GLN A 671  THR A 681  1 ? 11 
HELX_P HELX_P35  35  ARG E  689  ? ARG E  701  ? ARG A 689  ARG A 701  1 ? 13 
HELX_P HELX_P36  36  GLY E  728  ? THR E  740  ? GLY A 728  THR A 740  1 ? 13 
HELX_P HELX_P37  37  LYS E  756  ? TRP E  760  ? LYS A 756  TRP A 760  5 ? 5  
HELX_P HELX_P38  38  ASP E  782  ? GLY E  787  ? ASP A 782  GLY A 787  1 ? 6  
HELX_P HELX_P39  39  GLY E  792  ? ALA E  825  ? GLY A 792  ALA A 825  1 ? 34 
HELX_P HELX_P40  40  GLY E  829  ? ARG E  834  ? GLY A 829  ARG A 834  5 ? 6  
HELX_P HELX_P41  41  THR E  836  ? LYS E  848  ? THR A 836  LYS A 848  1 ? 13 
HELX_P HELX_P42  42  THR E  849  ? VAL E  851  ? THR A 849  VAL A 851  5 ? 3  
HELX_P HELX_P43  43  ASP E  852  ? THR E  862  ? ASP A 852  THR A 862  1 ? 11 
HELX_P HELX_P44  44  ASP E  872  ? ASP E  885  ? ASP A 872  ASP A 885  1 ? 14 
HELX_P HELX_P45  45  ASP E  885  ? VAL E  912  ? ASP A 885  VAL A 912  1 ? 28 
HELX_P HELX_P46  46  ASN E  923  ? SER E  931  ? ASN A 923  SER A 931  1 ? 9  
HELX_P HELX_P47  47  SER E  936  ? CYS E  945  ? SER A 936  CYS A 945  1 ? 10 
HELX_P HELX_P48  48  ASP E  975  ? GLY E  979  ? ASP A 975  GLY A 979  5 ? 5  
HELX_P HELX_P49  49  LYS E  991  ? LYS E  1012 ? LYS A 991  LYS A 1012 1 ? 22 
HELX_P HELX_P50  50  SER E  1016 ? GLU E  1028 ? SER A 1016 GLU A 1028 1 ? 13 
HELX_P HELX_P51  51  ASP E  1056 ? GLU E  1060 ? ASP A 1056 GLU A 1060 5 ? 5  
HELX_P HELX_P52  52  GLN E  1065 ? ASP E  1071 ? GLN A 1065 ASP A 1071 1 ? 7  
HELX_P HELX_P53  53  ASN E  1072 ? ASN E  1081 ? ASN A 1072 ASN A 1081 1 ? 10 
HELX_P HELX_P54  54  PRO E  1082 ? LEU E  1089 ? PRO A 1082 LEU A 1089 5 ? 8  
HELX_P HELX_P55  55  GLU E  1092 ? HIS E  1108 ? GLU A 1092 HIS A 1108 1 ? 17 
HELX_P HELX_P56  56  PRO E  1112 ? GLN E  1116 ? PRO A 1112 GLN A 1116 5 ? 5  
HELX_P HELX_P57  57  PRO E  1122 ? TYR E  1127 ? PRO A 1122 TYR A 1127 1 ? 6  
HELX_P HELX_P58  58  SER E  1137 ? ASN E  1151 ? SER A 1137 ASN A 1151 1 ? 15 
HELX_P HELX_P59  59  SER E  1152 ? LYS E  1156 ? SER A 1152 LYS A 1156 5 ? 5  
HELX_P HELX_P60  60  ASN E  1162 ? ARG E  1176 ? ASN A 1162 ARG A 1176 1 ? 15 
HELX_P HELX_P61  61  ALA E  1184 ? GLU E  1195 ? ALA A 1184 GLU A 1195 1 ? 12 
HELX_P HELX_P62  62  PRO E  1196 ? THR E  1201 ? PRO A 1196 THR A 1201 5 ? 6  
HELX_P HELX_P63  63  LEU E  1217 ? MET E  1227 ? LEU A 1217 MET A 1227 1 ? 11 
HELX_P HELX_P64  64  SER E  1247 ? SER E  1259 ? SER A 1247 SER A 1259 1 ? 13 
HELX_P HELX_P65  65  LEU E  1263 ? VAL E  1266 ? LEU A 1263 VAL A 1266 1 ? 4  
HELX_P HELX_P66  66  ASP E  1298 ? ASP E  1307 ? ASP A 1298 ASP A 1307 1 ? 10 
HELX_P HELX_P67  67  SER E  1309 ? ASN E  1319 ? SER A 1309 ASN A 1319 1 ? 11 
HELX_P HELX_P68  68  ASN E  1319 ? GLN E  1336 ? ASN A 1319 GLN A 1336 1 ? 18 
HELX_P HELX_P69  69  LYS E  1363 ? GLU E  1367 ? LYS A 1363 GLU A 1367 5 ? 5  
HELX_P HELX_P70  70  ASP E  1368 ? LYS E  1379 ? ASP A 1368 LYS A 1379 1 ? 12 
HELX_P HELX_P71  71  ASP E  1388 ? MET E  1395 ? ASP A 1388 MET A 1395 1 ? 8  
HELX_P HELX_P72  72  LYS E  1441 ? HIS E  1453 ? LYS A 1441 HIS A 1453 1 ? 13 
HELX_P HELX_P73  73  LEU E  1484 ? ARG E  1494 ? LEU A 1484 ARG A 1494 1 ? 11 
HELX_P HELX_P74  74  ASN E  1525 ? TRP E  1530 ? ASN A 1525 TRP A 1530 1 ? 6  
HELX_P HELX_P75  75  ASP E  1531 ? GLU E  1533 ? ASP A 1531 GLU A 1533 5 ? 3  
HELX_P HELX_P76  76  ASP E  1537 ? ILE E  1541 ? ASP A 1537 ILE A 1541 5 ? 5  
HELX_P HELX_P77  77  ASP E  1545 ? GLY E  1554 ? ASP A 1545 GLY A 1554 1 ? 10 
HELX_P HELX_P78  78  GLY E  1554 ? TYR E  1573 ? GLY A 1554 TYR A 1573 1 ? 20 
HELX_P HELX_P79  79  SER E  1578 ? THR E  1590 ? SER A 1578 THR A 1590 1 ? 13 
HELX_P HELX_P80  80  ASN E  1599 ? GLU E  1604 ? ASN A 1599 GLU A 1604 1 ? 6  
HELX_P HELX_P81  81  SER E  1608 ? SER E  1614 ? SER A 1608 SER A 1614 1 ? 7  
HELX_P HELX_P82  82  THR E  1617 ? ASP E  1628 ? THR A 1617 ASP A 1628 1 ? 12 
HELX_P HELX_P83  83  SER E  1636 ? GLY E  1644 ? SER A 1636 GLY A 1644 1 ? 9  
HELX_P HELX_P84  84  VAL E  1649 ? GLY E  1652 ? VAL A 1649 GLY A 1652 5 ? 4  
HELX_P HELX_P85  85  ARG F  17   ? ASN F  27   ? ARG B 17   ASN B 27   1 ? 11 
HELX_P HELX_P86  86  PHE F  35   ? ALA F  51   ? PHE B 35   ALA B 51   1 ? 17 
HELX_P HELX_P87  87  GLY F  59   ? GLY F  69   ? GLY B 59   GLY B 69   1 ? 11 
HELX_P HELX_P88  88  TYR F  122  ? LEU F  130  ? TYR B 122  LEU B 130  1 ? 9  
HELX_P HELX_P89  89  SER F  176  ? HIS F  183  ? SER B 176  HIS B 183  1 ? 8  
HELX_P HELX_P90  90  PRO F  220  ? GLY F  226  ? PRO B 220  GLY B 226  5 ? 7  
HELX_P HELX_P91  91  VAL F  273  ? CYS F  281  ? VAL B 273  CYS B 281  1 ? 9  
HELX_P HELX_P92  92  SER F  284  ? GLY F  294  ? SER B 284  GLY B 294  1 ? 11 
HELX_P HELX_P93  93  ASP F  299  ? LYS F  314  ? ASP B 299  LYS B 314  1 ? 16 
HELX_P HELX_P94  94  ASN F  322  ? ARG F  335  ? ASN B 322  ARG B 335  1 ? 14 
HELX_P HELX_P95  95  SER F  345  ? VAL F  358  ? SER B 345  VAL B 358  1 ? 14 
HELX_P HELX_P96  96  LEU F  359  ? GLY F  363  ? LEU B 359  GLY B 363  5 ? 5  
HELX_P HELX_P97  97  GLY F  366  ? ALA F  386  ? GLY B 366  ALA B 386  1 ? 21 
HELX_P HELX_P98  98  ALA F  396  ? GLN F  398  ? ALA B 396  GLN B 398  5 ? 3  
HELX_P HELX_P99  99  LEU F  404  ? GLY F  435  ? LEU B 404  GLY B 435  1 ? 32 
HELX_P HELX_P100 100 ASP F  442  ? ARG F  452  ? ASP B 442  ARG B 452  1 ? 11 
HELX_P HELX_P101 101 ASN F  456  ? GLY F  468  ? ASN B 456  GLY B 468  1 ? 13 
HELX_P HELX_P102 102 ASN F  492  ? PHE F  500  ? ASN B 492  PHE B 500  1 ? 9  
HELX_P HELX_P103 103 GLY F  506  ? GLN F  511  ? GLY B 506  GLN B 511  5 ? 6  
HELX_P HELX_P104 104 LEU F  521  ? TRP F  525  ? LEU B 521  TRP B 525  5 ? 5  
HELX_P HELX_P105 105 ARG F  560  ? LEU F  568  ? ARG B 560  LEU B 568  1 ? 9  
HELX_P HELX_P106 106 SER F  574  ? THR F  576  ? SER B 574  THR B 576  5 ? 3  
HELX_P HELX_P107 107 SER F  597  ? GLY F  615  ? SER B 597  GLY B 615  1 ? 19 
HELX_P HELX_P108 108 GLY F  665  ? VAL F  670  ? GLY B 665  VAL B 670  1 ? 6  
HELX_P HELX_P109 109 THR F  677  ? ILE F  681  ? THR B 677  ILE B 681  5 ? 5  
HELX_P HELX_P110 110 THR F  692  ? LEU F  697  ? THR B 692  LEU B 697  5 ? 6  
HELX_P HELX_P111 111 SER F  698  ? THR F  704  ? SER B 698  THR B 704  1 ? 7  
HELX_P HELX_P112 112 PHE F  706  ? PHE F  709  ? PHE B 706  PHE B 709  5 ? 4  
HELX_P HELX_P113 113 GLN F  711  ? LYS F  723  ? GLN B 711  LYS B 723  1 ? 13 
HELX_P HELX_P114 114 ALA F  732  ? ARG F  736  ? ALA B 732  ARG B 736  5 ? 5  
HELX_P HELX_P115 115 ALA F  754  ? TYR F  760  ? ALA B 754  TYR B 760  1 ? 7  
HELX_P HELX_P116 116 GLY F  761  ? PHE F  765  ? GLY B 761  PHE B 765  5 ? 5  
HELX_P HELX_P117 117 LYS F  791  ? ARG F  796  ? LYS B 791  ARG B 796  1 ? 6  
HELX_P HELX_P118 118 LYS F  834  ? LYS F  839  ? LYS B 834  LYS B 839  5 ? 6  
HELX_P HELX_P119 119 ASN F  950  ? PHE F  954  ? ASN B 950  PHE B 954  5 ? 5  
HELX_P HELX_P120 120 THR F  959  ? GLY F  976  ? THR B 959  GLY B 976  1 ? 18 
HELX_P HELX_P121 121 THR F  991  ? GLY F  1004 ? THR B 991  GLY B 1004 1 ? 14 
HELX_P HELX_P122 122 GLY F  1072 ? GLY F  1083 ? GLY B 1072 GLY B 1083 1 ? 12 
HELX_P HELX_P123 123 THR F  1084 ? LEU F  1093 ? THR B 1084 LEU B 1093 1 ? 10 
HELX_P HELX_P124 124 PHE F  1135 ? LYS F  1140 ? PHE B 1135 LYS B 1140 1 ? 6  
HELX_P HELX_P125 125 ASP F  1154 ? SER F  1156 ? ASP B 1154 SER B 1156 5 ? 3  
HELX_P HELX_P126 126 PHE F  1180 ? MET F  1192 ? PHE B 1180 MET B 1192 1 ? 13 
HELX_P HELX_P127 127 ASN G  32   ? PHE G  40   ? ASN C 32   PHE C 40   1 ? 9  
HELX_P HELX_P128 128 ASP G  60   ? GLU G  74   ? ASP C 60   GLU C 74   1 ? 15 
HELX_P HELX_P129 129 GLN G  93   ? VAL G  104  ? GLN C 93   VAL C 104  1 ? 12 
HELX_P HELX_P130 130 ASP G  109  ? LEU G  113  ? ASP C 109  LEU C 113  5 ? 5  
HELX_P HELX_P131 131 PRO G  121  ? PHE G  126  ? PRO C 121  PHE C 126  1 ? 6  
HELX_P HELX_P132 132 ASP G  152  ? LEU G  156  ? ASP C 152  LEU C 156  1 ? 5  
HELX_P HELX_P133 133 ARG G  165  ? LEU G  167  ? ARG C 165  LEU C 167  5 ? 3  
HELX_P HELX_P134 134 ARG G  174  ? PHE G  179  ? ARG C 174  PHE C 179  1 ? 6  
HELX_P HELX_P135 135 HIS G  216  ? SER G  220  ? HIS C 216  SER C 220  5 ? 5  
HELX_P HELX_P136 136 GLY G  241  ? LYS G  249  ? GLY C 241  LYS C 249  1 ? 9  
HELX_P HELX_P137 137 ASP G  269  ? ASP G  273  ? ASP C 269  ASP C 273  5 ? 5  
HELX_P HELX_P138 138 ARG G  277  ? ARG G  281  ? ARG C 277  ARG C 281  5 ? 5  
HELX_P HELX_P139 139 TYR G  282  ? ASP G  287  ? TYR C 282  ASP C 287  1 ? 6  
HELX_P HELX_P140 140 THR G  309  ? ASN G  330  ? THR C 309  ASN C 330  1 ? 22 
HELX_P HELX_P141 141 SER H  32   ? LYS H  47   ? SER D 32   LYS D 47   1 ? 16 
HELX_P HELX_P142 142 THR H  80   ? PHE H  96   ? THR D 80   PHE D 96   1 ? 17 
HELX_P HELX_P143 143 ASN I  5    ? ARG I  26   ? ASN E 5    ARG E 26   1 ? 22 
HELX_P HELX_P144 144 THR I  31   ? GLU I  36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P145 145 PRO I  38   ? CYS I  47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P146 146 GLN I  54   ? SER I  59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P147 147 THR I  65   ? PHE I  72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P148 148 GLY I  89   ? LYS I  103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P149 149 THR I  117  ? LYS I  122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P150 150 ALA I  138  ? LEU I  140  ? ALA E 138  LEU E 140  5 ? 3  
HELX_P HELX_P151 151 ASN I  143  ? HIS I  147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P152 152 SER I  157  ? TYR I  168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P153 153 LYS I  171  ? LEU I  175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P154 154 ASP I  182  ? GLY I  189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P155 155 PRO J  55   ? ALA J  73   ? PRO F 55   ALA F 73   1 ? 19 
HELX_P HELX_P156 156 PRO J  75   ? ARG J  79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P157 157 THR J  86   ? MET J  103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P158 158 ASP J  116  ? GLU J  127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P159 159 ALA K  50   ? LEU K  54   ? ALA G 50   LEU G 54   5 ? 5  
HELX_P HELX_P160 160 ASN K  56   ? HIS K  65   ? ASN G 56   HIS G 65   1 ? 10 
HELX_P HELX_P161 161 LEU K  66   ? VAL K  70   ? LEU G 66   VAL G 70   5 ? 5  
HELX_P HELX_P162 162 SER L  88   ? TYR L  93   ? SER H 88   TYR H 93   5 ? 6  
HELX_P HELX_P163 163 ASN M  19   ? VAL M  23   ? ASN I 19   VAL I 23   5 ? 5  
HELX_P HELX_P164 164 ALA M  52   ? PHE M  56   ? ALA I 52   PHE I 56   5 ? 5  
HELX_P HELX_P165 165 SER M  58   ? LYS M  64   ? SER I 58   LYS I 64   1 ? 7  
HELX_P HELX_P166 166 LYS N  17   ? GLU N  27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P167 167 ASP N  31   ? LEU N  39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P168 168 ARG N  43   ? THR N  52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P169 169 LEU N  56   ? LEU N  61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P170 170 ASP O  69   ? MET O  81   ? ASP K 69   MET K 81   1 ? 13 
HELX_P HELX_P171 171 THR O  112  ? MET O  142  ? THR K 112  MET K 142  1 ? 31 
HELX_P HELX_P172 172 SER Q  69   ? ALA Q  72   ? SER M 69   ALA M 72   5 ? 4  
HELX_P HELX_P173 173 LYS Q  103  ? ASN Q  107  ? LYS M 103  ASN M 107  1 ? 5  
HELX_P HELX_P174 174 ASP R  92   ? SER R  97   ? ASP N 92   SER N 97   1 ? 6  
HELX_P HELX_P175 175 ASP R  149  ? ARG R  154  ? ASP N 149  ARG N 154  1 ? 6  
HELX_P HELX_P176 176 ASP R  176  ? PHE R  180  ? ASP N 176  PHE N 180  5 ? 5  
HELX_P HELX_P177 177 ILE S  272  ? GLU S  294  ? ILE O 272  GLU O 294  1 ? 23 
HELX_P HELX_P178 178 THR T  20   ? SER T  28   ? THR P 20   SER P 28   1 ? 9  
HELX_P HELX_P179 179 PHE T  90   ? SER T  101  ? PHE P 90   SER P 101  1 ? 12 
HELX_P HELX_P180 180 LYS T  111  ? TYR T  127  ? LYS P 111  TYR P 127  1 ? 17 
HELX_P HELX_P181 181 LEU T  129  ? GLU T  138  ? LEU P 129  GLU P 138  1 ? 10 
HELX_P HELX_P182 182 SER T  174  ? ASP T  199  ? SER P 174  ASP P 199  1 ? 26 
HELX_P HELX_P183 183 THR T  209  ? SER T  229  ? THR P 209  SER P 229  1 ? 21 
HELX_P HELX_P184 184 ASN T  257  ? LYS T  267  ? ASN P 257  LYS P 267  1 ? 11 
HELX_P HELX_P185 185 LEU T  316  ? GLU T  331  ? LEU P 316  GLU P 331  1 ? 16 
HELX_P HELX_P186 186 GLU T  331  ? PHE T  339  ? GLU P 331  PHE P 339  1 ? 9  
HELX_P HELX_P187 187 LYS T  351  ? SER T  354  ? LYS P 351  SER P 354  5 ? 4  
HELX_P HELX_P188 188 PRO T  364  ? ARG T  368  ? PRO P 364  ARG P 368  5 ? 5  
HELX_P HELX_P189 189 ASN T  380  ? LYS T  405  ? ASN P 380  LYS P 405  1 ? 26 
HELX_P HELX_P190 190 GLU T  414  ? ASP T  439  ? GLU P 414  ASP P 439  1 ? 26 
HELX_P HELX_P191 191 SER T  440  ? ALA T  443  ? SER P 440  ALA P 443  5 ? 4  
HELX_P HELX_P192 192 GLY T  455  ? LYS T  462  ? GLY P 455  LYS P 462  1 ? 8  
HELX_P HELX_P193 193 GLY T  465  ? MET T  471  ? GLY P 465  MET P 471  1 ? 7  
HELX_P HELX_P194 194 PRO T  498  ? VAL T  503  ? PRO P 498  VAL P 503  1 ? 6  
HELX_P HELX_P195 195 ASN T  515  ? GLY T  526  ? ASN P 515  GLY P 526  1 ? 12 
HELX_P HELX_P196 196 SER T  550  ? ASN T  559  ? SER P 550  ASN P 559  1 ? 10 
HELX_P HELX_P197 197 ASN T  567  ? HIS T  571  ? ASN P 567  HIS P 571  5 ? 5  
HELX_P HELX_P198 198 HIS T  596  ? ALA T  598  ? HIS P 596  ALA P 598  5 ? 3  
HELX_P HELX_P199 199 HIS T  617  ? ALA T  619  ? HIS P 617  ALA P 619  5 ? 3  
HELX_P HELX_P200 200 ASN T  620  ? ASN T  625  ? ASN P 620  ASN P 625  1 ? 6  
HELX_P HELX_P201 201 ASN T  640  ? LEU T  650  ? ASN P 640  LEU P 650  1 ? 11 
HELX_P HELX_P202 202 THR T  653  ? TYR T  657  ? THR P 653  TYR P 657  5 ? 5  
HELX_P HELX_P203 203 ILE T  670  ? THR T  681  ? ILE P 670  THR P 681  1 ? 12 
HELX_P HELX_P204 204 ARG T  689  ? ARG T  701  ? ARG P 689  ARG P 701  1 ? 13 
HELX_P HELX_P205 205 GLY T  728  ? THR T  740  ? GLY P 728  THR P 740  1 ? 13 
HELX_P HELX_P206 206 LYS T  756  ? TRP T  760  ? LYS P 756  TRP P 760  5 ? 5  
HELX_P HELX_P207 207 ASP T  782  ? GLY T  787  ? ASP P 782  GLY P 787  1 ? 6  
HELX_P HELX_P208 208 GLY T  792  ? ALA T  825  ? GLY P 792  ALA P 825  1 ? 34 
HELX_P HELX_P209 209 GLY T  829  ? ARG T  834  ? GLY P 829  ARG P 834  5 ? 6  
HELX_P HELX_P210 210 THR T  836  ? LYS T  848  ? THR P 836  LYS P 848  1 ? 13 
HELX_P HELX_P211 211 THR T  849  ? VAL T  851  ? THR P 849  VAL P 851  5 ? 3  
HELX_P HELX_P212 212 ASP T  852  ? THR T  862  ? ASP P 852  THR P 862  1 ? 11 
HELX_P HELX_P213 213 ASP T  872  ? ASP T  885  ? ASP P 872  ASP P 885  1 ? 14 
HELX_P HELX_P214 214 ASP T  885  ? VAL T  912  ? ASP P 885  VAL P 912  1 ? 28 
HELX_P HELX_P215 215 ASN T  923  ? SER T  931  ? ASN P 923  SER P 931  1 ? 9  
HELX_P HELX_P216 216 SER T  936  ? CYS T  945  ? SER P 936  CYS P 945  1 ? 10 
HELX_P HELX_P217 217 ASP T  975  ? GLY T  979  ? ASP P 975  GLY P 979  5 ? 5  
HELX_P HELX_P218 218 LYS T  991  ? LYS T  1012 ? LYS P 991  LYS P 1012 1 ? 22 
HELX_P HELX_P219 219 SER T  1016 ? GLU T  1028 ? SER P 1016 GLU P 1028 1 ? 13 
HELX_P HELX_P220 220 ASP T  1056 ? GLU T  1060 ? ASP P 1056 GLU P 1060 5 ? 5  
HELX_P HELX_P221 221 GLN T  1065 ? ASP T  1071 ? GLN P 1065 ASP P 1071 1 ? 7  
HELX_P HELX_P222 222 ASN T  1072 ? ASN T  1081 ? ASN P 1072 ASN P 1081 1 ? 10 
HELX_P HELX_P223 223 PRO T  1082 ? LEU T  1089 ? PRO P 1082 LEU P 1089 5 ? 8  
HELX_P HELX_P224 224 GLU T  1092 ? HIS T  1108 ? GLU P 1092 HIS P 1108 1 ? 17 
HELX_P HELX_P225 225 PRO T  1112 ? GLN T  1116 ? PRO P 1112 GLN P 1116 5 ? 5  
HELX_P HELX_P226 226 PRO T  1122 ? TYR T  1127 ? PRO P 1122 TYR P 1127 1 ? 6  
HELX_P HELX_P227 227 SER T  1137 ? ASN T  1151 ? SER P 1137 ASN P 1151 1 ? 15 
HELX_P HELX_P228 228 LYS T  1153 ? SER T  1158 ? LYS P 1153 SER P 1158 1 ? 6  
HELX_P HELX_P229 229 ASN T  1162 ? ARG T  1176 ? ASN P 1162 ARG P 1176 1 ? 15 
HELX_P HELX_P230 230 ALA T  1184 ? GLU T  1195 ? ALA P 1184 GLU P 1195 1 ? 12 
HELX_P HELX_P231 231 PRO T  1196 ? THR T  1201 ? PRO P 1196 THR P 1201 5 ? 6  
HELX_P HELX_P232 232 LEU T  1217 ? MET T  1227 ? LEU P 1217 MET P 1227 1 ? 11 
HELX_P HELX_P233 233 SER T  1247 ? SER T  1259 ? SER P 1247 SER P 1259 1 ? 13 
HELX_P HELX_P234 234 ASP T  1298 ? ASP T  1307 ? ASP P 1298 ASP P 1307 1 ? 10 
HELX_P HELX_P235 235 SER T  1309 ? ASN T  1319 ? SER P 1309 ASN P 1319 1 ? 11 
HELX_P HELX_P236 236 ASN T  1319 ? GLN T  1336 ? ASN P 1319 GLN P 1336 1 ? 18 
HELX_P HELX_P237 237 LYS T  1363 ? GLU T  1367 ? LYS P 1363 GLU P 1367 5 ? 5  
HELX_P HELX_P238 238 ASP T  1368 ? LYS T  1379 ? ASP P 1368 LYS P 1379 1 ? 12 
HELX_P HELX_P239 239 ASP T  1388 ? MET T  1395 ? ASP P 1388 MET P 1395 1 ? 8  
HELX_P HELX_P240 240 LYS T  1441 ? HIS T  1453 ? LYS P 1441 HIS P 1453 1 ? 13 
HELX_P HELX_P241 241 LEU T  1484 ? ARG T  1494 ? LEU P 1484 ARG P 1494 1 ? 11 
HELX_P HELX_P242 242 PRO T  1512 ? LYS T  1516 ? PRO P 1512 LYS P 1516 5 ? 5  
HELX_P HELX_P243 243 ASN T  1525 ? ASP T  1531 ? ASN P 1525 ASP P 1531 1 ? 7  
HELX_P HELX_P244 244 ASP T  1537 ? ILE T  1541 ? ASP P 1537 ILE P 1541 5 ? 5  
HELX_P HELX_P245 245 ASP T  1545 ? GLY T  1554 ? ASP P 1545 GLY P 1554 1 ? 10 
HELX_P HELX_P246 246 GLY T  1554 ? ARG T  1572 ? GLY P 1554 ARG P 1572 1 ? 19 
HELX_P HELX_P247 247 SER T  1578 ? ARG T  1591 ? SER P 1578 ARG P 1591 1 ? 14 
HELX_P HELX_P248 248 ASN T  1599 ? GLU T  1604 ? ASN P 1599 GLU P 1604 1 ? 6  
HELX_P HELX_P249 249 SER T  1608 ? SER T  1614 ? SER P 1608 SER P 1614 1 ? 7  
HELX_P HELX_P250 250 THR T  1617 ? ASP T  1628 ? THR P 1617 ASP P 1628 1 ? 12 
HELX_P HELX_P251 251 SER T  1636 ? GLY T  1644 ? SER P 1636 GLY P 1644 1 ? 9  
HELX_P HELX_P252 252 VAL T  1649 ? GLY T  1652 ? VAL P 1649 GLY P 1652 5 ? 4  
HELX_P HELX_P253 253 ARG U  17   ? ASN U  27   ? ARG Q 17   ASN Q 27   1 ? 11 
HELX_P HELX_P254 254 PHE U  35   ? ALA U  51   ? PHE Q 35   ALA Q 51   1 ? 17 
HELX_P HELX_P255 255 GLY U  58   ? GLY U  69   ? GLY Q 58   GLY Q 69   1 ? 12 
HELX_P HELX_P256 256 TYR U  122  ? LEU U  130  ? TYR Q 122  LEU Q 130  1 ? 9  
HELX_P HELX_P257 257 SER U  176  ? HIS U  183  ? SER Q 176  HIS Q 183  1 ? 8  
HELX_P HELX_P258 258 PRO U  220  ? GLY U  226  ? PRO Q 220  GLY Q 226  5 ? 7  
HELX_P HELX_P259 259 VAL U  273  ? CYS U  281  ? VAL Q 273  CYS Q 281  1 ? 9  
HELX_P HELX_P260 260 SER U  284  ? GLY U  294  ? SER Q 284  GLY Q 294  1 ? 11 
HELX_P HELX_P261 261 ASP U  299  ? LYS U  314  ? ASP Q 299  LYS Q 314  1 ? 16 
HELX_P HELX_P262 262 ASN U  322  ? ARG U  335  ? ASN Q 322  ARG Q 335  1 ? 14 
HELX_P HELX_P263 263 SER U  345  ? VAL U  358  ? SER Q 345  VAL Q 358  1 ? 14 
HELX_P HELX_P264 264 LEU U  359  ? GLY U  363  ? LEU Q 359  GLY Q 363  5 ? 5  
HELX_P HELX_P265 265 GLY U  366  ? ALA U  386  ? GLY Q 366  ALA Q 386  1 ? 21 
HELX_P HELX_P266 266 ALA U  396  ? GLN U  398  ? ALA Q 396  GLN Q 398  5 ? 3  
HELX_P HELX_P267 267 LEU U  404  ? GLY U  435  ? LEU Q 404  GLY Q 435  1 ? 32 
HELX_P HELX_P268 268 ASP U  442  ? ARG U  452  ? ASP Q 442  ARG Q 452  1 ? 11 
HELX_P HELX_P269 269 ASN U  456  ? GLY U  468  ? ASN Q 456  GLY Q 468  1 ? 13 
HELX_P HELX_P270 270 ASN U  492  ? PHE U  500  ? ASN Q 492  PHE Q 500  1 ? 9  
HELX_P HELX_P271 271 GLY U  506  ? GLN U  511  ? GLY Q 506  GLN Q 511  5 ? 6  
HELX_P HELX_P272 272 LEU U  521  ? TRP U  525  ? LEU Q 521  TRP Q 525  5 ? 5  
HELX_P HELX_P273 273 ARG U  560  ? LEU U  568  ? ARG Q 560  LEU Q 568  1 ? 9  
HELX_P HELX_P274 274 SER U  574  ? THR U  576  ? SER Q 574  THR Q 576  5 ? 3  
HELX_P HELX_P275 275 SER U  597  ? GLY U  615  ? SER Q 597  GLY Q 615  1 ? 19 
HELX_P HELX_P276 276 GLY U  665  ? VAL U  670  ? GLY Q 665  VAL Q 670  1 ? 6  
HELX_P HELX_P277 277 THR U  677  ? ILE U  681  ? THR Q 677  ILE Q 681  5 ? 5  
HELX_P HELX_P278 278 THR U  692  ? LEU U  697  ? THR Q 692  LEU Q 697  5 ? 6  
HELX_P HELX_P279 279 SER U  698  ? THR U  704  ? SER Q 698  THR Q 704  1 ? 7  
HELX_P HELX_P280 280 PHE U  706  ? PHE U  709  ? PHE Q 706  PHE Q 709  5 ? 4  
HELX_P HELX_P281 281 GLN U  711  ? LYS U  723  ? GLN Q 711  LYS Q 723  1 ? 13 
HELX_P HELX_P282 282 ALA U  732  ? ARG U  736  ? ALA Q 732  ARG Q 736  5 ? 5  
HELX_P HELX_P283 283 ALA U  754  ? TYR U  760  ? ALA Q 754  TYR Q 760  1 ? 7  
HELX_P HELX_P284 284 GLY U  761  ? PHE U  765  ? GLY Q 761  PHE Q 765  5 ? 5  
HELX_P HELX_P285 285 LYS U  791  ? ARG U  796  ? LYS Q 791  ARG Q 796  1 ? 6  
HELX_P HELX_P286 286 LYS U  834  ? LYS U  839  ? LYS Q 834  LYS Q 839  5 ? 6  
HELX_P HELX_P287 287 ASN U  950  ? PHE U  954  ? ASN Q 950  PHE Q 954  5 ? 5  
HELX_P HELX_P288 288 THR U  959  ? GLY U  976  ? THR Q 959  GLY Q 976  1 ? 18 
HELX_P HELX_P289 289 THR U  991  ? GLY U  1004 ? THR Q 991  GLY Q 1004 1 ? 14 
HELX_P HELX_P290 290 GLY U  1072 ? GLY U  1083 ? GLY Q 1072 GLY Q 1083 1 ? 12 
HELX_P HELX_P291 291 THR U  1084 ? LEU U  1093 ? THR Q 1084 LEU Q 1093 1 ? 10 
HELX_P HELX_P292 292 PHE U  1135 ? LYS U  1140 ? PHE Q 1135 LYS Q 1140 1 ? 6  
HELX_P HELX_P293 293 ASP U  1154 ? SER U  1156 ? ASP Q 1154 SER Q 1156 5 ? 3  
HELX_P HELX_P294 294 PHE U  1180 ? MET U  1192 ? PHE Q 1180 MET Q 1192 1 ? 13 
HELX_P HELX_P295 295 ASN V  32   ? PHE V  40   ? ASN R 32   PHE R 40   1 ? 9  
HELX_P HELX_P296 296 ASP V  60   ? GLU V  74   ? ASP R 60   GLU R 74   1 ? 15 
HELX_P HELX_P297 297 GLN V  93   ? VAL V  104  ? GLN R 93   VAL R 104  1 ? 12 
HELX_P HELX_P298 298 ASP V  109  ? LEU V  113  ? ASP R 109  LEU R 113  5 ? 5  
HELX_P HELX_P299 299 PRO V  121  ? PHE V  126  ? PRO R 121  PHE R 126  1 ? 6  
HELX_P HELX_P300 300 ASP V  152  ? LEU V  156  ? ASP R 152  LEU R 156  1 ? 5  
HELX_P HELX_P301 301 ARG V  165  ? LEU V  167  ? ARG R 165  LEU R 167  5 ? 3  
HELX_P HELX_P302 302 ARG V  174  ? PHE V  179  ? ARG R 174  PHE R 179  1 ? 6  
HELX_P HELX_P303 303 HIS V  216  ? SER V  220  ? HIS R 216  SER R 220  5 ? 5  
HELX_P HELX_P304 304 GLY V  241  ? LYS V  249  ? GLY R 241  LYS R 249  1 ? 9  
HELX_P HELX_P305 305 ASP V  269  ? ASP V  273  ? ASP R 269  ASP R 273  5 ? 5  
HELX_P HELX_P306 306 ARG V  277  ? ARG V  281  ? ARG R 277  ARG R 281  5 ? 5  
HELX_P HELX_P307 307 TYR V  282  ? ASP V  287  ? TYR R 282  ASP R 287  1 ? 6  
HELX_P HELX_P308 308 THR V  309  ? ASN V  330  ? THR R 309  ASN R 330  1 ? 22 
HELX_P HELX_P309 309 SER W  32   ? LYS W  47   ? SER S 32   LYS S 47   1 ? 16 
HELX_P HELX_P310 310 ASP W  79   ? PHE W  96   ? ASP S 79   PHE S 96   1 ? 18 
HELX_P HELX_P311 311 ASN X  5    ? ARG X  26   ? ASN T 5    ARG T 26   1 ? 22 
HELX_P HELX_P312 312 THR X  31   ? GLU X  36   ? THR T 31   GLU T 36   1 ? 6  
HELX_P HELX_P313 313 PRO X  38   ? CYS X  47   ? PRO T 38   CYS T 47   1 ? 10 
HELX_P HELX_P314 314 GLN X  54   ? SER X  59   ? GLN T 54   SER T 59   1 ? 6  
HELX_P HELX_P315 315 THR X  65   ? PHE X  72   ? THR T 65   PHE T 72   1 ? 8  
HELX_P HELX_P316 316 GLY X  89   ? LYS X  103  ? GLY T 89   LYS T 103  1 ? 15 
HELX_P HELX_P317 317 ALA X  120  ? VAL X  124  ? ALA T 120  VAL T 124  5 ? 5  
HELX_P HELX_P318 318 ALA X  138  ? LEU X  140  ? ALA T 138  LEU T 140  5 ? 3  
HELX_P HELX_P319 319 ASN X  143  ? HIS X  147  ? ASN T 143  HIS T 147  5 ? 5  
HELX_P HELX_P320 320 SER X  157  ? TYR X  168  ? SER T 157  TYR T 168  1 ? 12 
HELX_P HELX_P321 321 LYS X  171  ? LEU X  175  ? LYS T 171  LEU T 175  5 ? 5  
HELX_P HELX_P322 322 ASP X  182  ? GLY X  189  ? ASP T 182  GLY T 189  1 ? 8  
HELX_P HELX_P323 323 PRO Y  55   ? ALA Y  73   ? PRO U 55   ALA U 73   1 ? 19 
HELX_P HELX_P324 324 PRO Y  75   ? ARG Y  79   ? PRO U 75   ARG U 79   5 ? 5  
HELX_P HELX_P325 325 THR Y  86   ? MET Y  103  ? THR U 86   MET U 103  1 ? 18 
HELX_P HELX_P326 326 ASP Y  116  ? GLU Y  127  ? ASP U 116  GLU U 127  1 ? 12 
HELX_P HELX_P327 327 ALA Z  50   ? LEU Z  54   ? ALA V 50   LEU V 54   5 ? 5  
HELX_P HELX_P328 328 ASN Z  56   ? HIS Z  65   ? ASN V 56   HIS V 65   1 ? 10 
HELX_P HELX_P329 329 LEU Z  66   ? VAL Z  70   ? LEU V 66   VAL V 70   5 ? 5  
HELX_P HELX_P330 330 SER AA 88   ? TYR AA 93   ? SER W 88   TYR W 93   5 ? 6  
HELX_P HELX_P331 331 ASN BA 19   ? VAL BA 23   ? ASN X 19   VAL X 23   5 ? 5  
HELX_P HELX_P332 332 ALA BA 52   ? PHE BA 56   ? ALA X 52   PHE X 56   5 ? 5  
HELX_P HELX_P333 333 SER BA 58   ? LYS BA 64   ? SER X 58   LYS X 64   1 ? 7  
HELX_P HELX_P334 334 LYS CA 17   ? GLU CA 27   ? LYS Y 17   GLU Y 27   1 ? 11 
HELX_P HELX_P335 335 ASP CA 31   ? LEU CA 39   ? ASP Y 31   LEU Y 39   1 ? 9  
HELX_P HELX_P336 336 ARG CA 43   ? THR CA 52   ? ARG Y 43   THR Y 52   1 ? 10 
HELX_P HELX_P337 337 LEU CA 56   ? LEU CA 61   ? LEU Y 56   LEU Y 61   1 ? 6  
HELX_P HELX_P338 338 ASP DA 69   ? MET DA 81   ? ASP Z 69   MET Z 81   1 ? 13 
HELX_P HELX_P339 339 THR DA 112  ? MET DA 142  ? THR Z 112  MET Z 142  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? E  CYS 62 SG ? ? ? 1_555 E  CYS 65   SG  ? ? A CYS 62   A CYS 65   1_555 ? ? ? ? ? ? ? 2.875 ? 
disulf2  disulf ? ? N  CYS 7  SG ? ? ? 1_555 N  CYS 10   SG  ? ? J CYS 7    J CYS 10   1_555 ? ? ? ? ? ? ? 2.258 ? 
disulf3  disulf ? ? N  CYS 7  SG ? ? ? 1_555 N  CYS 45   SG  ? ? J CYS 7    J CYS 45   1_555 ? ? ? ? ? ? ? 2.577 ? 
disulf4  disulf ? ? N  CYS 10 SG ? ? ? 1_555 N  CYS 46   SG  ? ? J CYS 10   J CYS 46   1_555 ? ? ? ? ? ? ? 2.129 ? 
disulf5  disulf ? ? N  CYS 45 SG ? ? ? 1_555 N  CYS 46   SG  ? ? J CYS 45   J CYS 46   1_555 ? ? ? ? ? ? ? 2.680 ? 
disulf6  disulf ? ? CA CYS 7  SG ? ? ? 1_555 CA CYS 10   SG  ? ? Y CYS 7    Y CYS 10   1_555 ? ? ? ? ? ? ? 2.341 ? 
disulf7  disulf ? ? CA CYS 7  SG ? ? ? 1_555 CA CYS 45   SG  ? ? Y CYS 7    Y CYS 45   1_555 ? ? ? ? ? ? ? 2.634 ? 
disulf8  disulf ? ? CA CYS 10 SG ? ? ? 1_555 CA CYS 46   SG  ? ? Y CYS 10   Y CYS 46   1_555 ? ? ? ? ? ? ? 2.109 ? 
disulf9  disulf ? ? CA CYS 45 SG ? ? ? 1_555 CA CYS 46   SG  ? ? Y CYS 45   Y CYS 46   1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc1  metalc ? ? EA ZN  .  ZN ? ? ? 1_555 A  CYS 51   SG  ? ? 1 ZN  3001 1 CYS 51   1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc2  metalc ? ? EA ZN  .  ZN ? ? ? 1_555 A  CYS 31   SG  ? ? 1 ZN  3001 1 CYS 31   1_555 ? ? ? ? ? ? ? 2.345 ? 
metalc3  metalc ? ? EA ZN  .  ZN ? ? ? 1_555 A  CYS 34   SG  ? ? 1 ZN  3001 1 CYS 34   1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc4  metalc ? ? EA ZN  .  ZN ? ? ? 1_555 A  CYS 48   SG  ? ? 1 ZN  3001 1 CYS 48   1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc5  metalc ? ? FA ZN  .  ZN ? ? ? 1_555 E  CYS 65   SG  ? ? A ZN  3001 A CYS 65   1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc6  metalc ? ? FA ZN  .  ZN ? ? ? 1_555 E  HIS 75   NE2 ? ? A ZN  3001 A HIS 75   1_555 ? ? ? ? ? ? ? 1.972 ? 
metalc7  metalc ? ? FA ZN  .  ZN ? ? ? 1_555 E  CYS 62   SG  ? ? A ZN  3001 A CYS 62   1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc8  metalc ? ? FA ZN  .  ZN ? ? ? 1_555 E  CYS 72   SG  ? ? A ZN  3001 A CYS 72   1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc9  metalc ? ? GA ZN  .  ZN ? ? ? 1_555 E  CYS 236  SG  ? ? A ZN  3002 A CYS 236  1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc10 metalc ? ? GA ZN  .  ZN ? ? ? 1_555 E  CYS 102  SG  ? ? A ZN  3002 A CYS 102  1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc11 metalc ? ? GA ZN  .  ZN ? ? ? 1_555 E  CYS 105  SG  ? ? A ZN  3002 A CYS 105  1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc12 metalc ? ? GA ZN  .  ZN ? ? ? 1_555 E  CYS 233  SG  ? ? A ZN  3002 A CYS 233  1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc13 metalc ? ? IA ZN  .  ZN ? ? ? 1_555 F  CYS 1104 SG  ? ? B ZN  3001 B CYS 1104 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc14 metalc ? ? IA ZN  .  ZN ? ? ? 1_555 F  CYS 1128 SG  ? ? B ZN  3001 B CYS 1128 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc15 metalc ? ? IA ZN  .  ZN ? ? ? 1_555 F  CYS 1107 SG  ? ? B ZN  3001 B CYS 1107 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc16 metalc ? ? IA ZN  .  ZN ? ? ? 1_555 F  CYS 1131 SG  ? ? B ZN  3001 B CYS 1131 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc17 metalc ? ? JA ZN  .  ZN ? ? ? 1_555 M  CYS 30   SG  ? ? I ZN  3001 I CYS 30   1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc18 metalc ? ? JA ZN  .  ZN ? ? ? 1_555 M  CYS 13   SG  ? ? I ZN  3001 I CYS 13   1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc19 metalc ? ? JA ZN  .  ZN ? ? ? 1_555 M  CYS 10   SG  ? ? I ZN  3001 I CYS 10   1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc20 metalc ? ? JA ZN  .  ZN ? ? ? 1_555 M  CYS 33   SG  ? ? I ZN  3001 I CYS 33   1_555 ? ? ? ? ? ? ? 2.265 ? 
metalc21 metalc ? ? KA ZN  .  ZN ? ? ? 1_555 M  CYS 117  SG  ? ? I ZN  3002 I CYS 117  1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc22 metalc ? ? KA ZN  .  ZN ? ? ? 1_555 M  CYS 114  SG  ? ? I ZN  3002 I CYS 114  1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc23 metalc ? ? KA ZN  .  ZN ? ? ? 1_555 M  CYS 86   SG  ? ? I ZN  3002 I CYS 86   1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc24 metalc ? ? KA ZN  .  ZN ? ? ? 1_555 M  CYS 89   SG  ? ? I ZN  3002 I CYS 89   1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc25 metalc ? ? LA ZN  .  ZN ? ? ? 1_555 N  CYS 10   SG  ? ? J ZN  3001 J CYS 10   1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc26 metalc ? ? LA ZN  .  ZN ? ? ? 1_555 N  CYS 45   SG  ? ? J ZN  3001 J CYS 45   1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc27 metalc ? ? LA ZN  .  ZN ? ? ? 1_555 N  CYS 46   SG  ? ? J ZN  3001 J CYS 46   1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc28 metalc ? ? LA ZN  .  ZN ? ? ? 1_555 N  CYS 7    SG  ? ? J ZN  3001 J CYS 7    1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc29 metalc ? ? MA ZN  .  ZN ? ? ? 1_555 P  CYS 34   SG  ? ? L ZN  3001 L CYS 34   1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc30 metalc ? ? MA ZN  .  ZN ? ? ? 1_555 P  CYS 51   SG  ? ? L ZN  3001 L CYS 51   1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc31 metalc ? ? MA ZN  .  ZN ? ? ? 1_555 P  CYS 31   SG  ? ? L ZN  3001 L CYS 31   1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc32 metalc ? ? MA ZN  .  ZN ? ? ? 1_555 P  CYS 48   SG  ? ? L ZN  3001 L CYS 48   1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc33 metalc ? ? NA ZN  .  ZN ? ? ? 1_555 T  CYS 65   SG  ? ? P ZN  3001 P CYS 65   1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc34 metalc ? ? NA ZN  .  ZN ? ? ? 1_555 T  CYS 72   SG  ? ? P ZN  3001 P CYS 72   1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc35 metalc ? ? NA ZN  .  ZN ? ? ? 1_555 T  CYS 62   SG  ? ? P ZN  3001 P CYS 62   1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc36 metalc ? ? NA ZN  .  ZN ? ? ? 1_555 T  HIS 75   NE2 ? ? P ZN  3001 P HIS 75   1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc37 metalc ? ? OA ZN  .  ZN ? ? ? 1_555 T  CYS 105  SG  ? ? P ZN  3002 P CYS 105  1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc38 metalc ? ? OA ZN  .  ZN ? ? ? 1_555 T  CYS 233  SG  ? ? P ZN  3002 P CYS 233  1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc39 metalc ? ? OA ZN  .  ZN ? ? ? 1_555 T  CYS 102  SG  ? ? P ZN  3002 P CYS 102  1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc40 metalc ? ? OA ZN  .  ZN ? ? ? 1_555 T  CYS 236  SG  ? ? P ZN  3002 P CYS 236  1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc41 metalc ? ? QA ZN  .  ZN ? ? ? 1_555 U  CYS 1131 SG  ? ? Q ZN  3001 Q CYS 1131 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc42 metalc ? ? QA ZN  .  ZN ? ? ? 1_555 U  CYS 1104 SG  ? ? Q ZN  3001 Q CYS 1104 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc43 metalc ? ? QA ZN  .  ZN ? ? ? 1_555 U  CYS 1128 SG  ? ? Q ZN  3001 Q CYS 1128 1_555 ? ? ? ? ? ? ? 2.271 ? 
metalc44 metalc ? ? QA ZN  .  ZN ? ? ? 1_555 U  CYS 1107 SG  ? ? Q ZN  3001 Q CYS 1107 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc45 metalc ? ? RA ZN  .  ZN ? ? ? 1_555 BA CYS 30   SG  ? ? X ZN  3001 X CYS 30   1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc46 metalc ? ? RA ZN  .  ZN ? ? ? 1_555 BA CYS 33   SG  ? ? X ZN  3001 X CYS 33   1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc47 metalc ? ? RA ZN  .  ZN ? ? ? 1_555 BA CYS 13   SG  ? ? X ZN  3001 X CYS 13   1_555 ? ? ? ? ? ? ? 2.262 ? 
metalc48 metalc ? ? RA ZN  .  ZN ? ? ? 1_555 BA CYS 10   SG  ? ? X ZN  3001 X CYS 10   1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc49 metalc ? ? SA ZN  .  ZN ? ? ? 1_555 BA CYS 117  SG  ? ? X ZN  3002 X CYS 117  1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc50 metalc ? ? SA ZN  .  ZN ? ? ? 1_555 BA CYS 89   SG  ? ? X ZN  3002 X CYS 89   1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc51 metalc ? ? SA ZN  .  ZN ? ? ? 1_555 BA CYS 114  SG  ? ? X ZN  3002 X CYS 114  1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc52 metalc ? ? SA ZN  .  ZN ? ? ? 1_555 BA CYS 86   SG  ? ? X ZN  3002 X CYS 86   1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc53 metalc ? ? TA ZN  .  ZN ? ? ? 1_555 CA CYS 10   SG  ? ? Y ZN  3001 Y CYS 10   1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc54 metalc ? ? TA ZN  .  ZN ? ? ? 1_555 CA CYS 45   SG  ? ? Y ZN  3001 Y CYS 45   1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc55 metalc ? ? TA ZN  .  ZN ? ? ? 1_555 CA CYS 46   SG  ? ? Y ZN  3001 Y CYS 46   1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc56 metalc ? ? TA ZN  .  ZN ? ? ? 1_555 CA CYS 7    SG  ? ? Y ZN  3001 Y CYS 7    1_555 ? ? ? ? ? ? ? 2.212 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TRP 530  E . ? TRP 530  A PRO 531  E ? PRO 531  A 1 -3.80 
2  GLN 592  E . ? GLN 592  A PRO 593  E ? PRO 593  A 1 -4.34 
3  LYS 721  E . ? LYS 721  A PRO 722  E ? PRO 722  A 1 11.22 
4  VAL 912  E . ? VAL 912  A PRO 913  E ? PRO 913  A 1 10.29 
5  PHE 920  E . ? PHE 920  A PRO 921  E ? PRO 921  A 1 3.30  
6  GLU 1201 F . ? GLU 1201 B PRO 1202 F ? PRO 1202 B 1 4.66  
7  PRO 128  I . ? PRO 128  E PRO 129  I ? PRO 129  E 1 2.14  
8  GLU 30   K . ? GLU 30   G LYS 31   K ? LYS 31   G 1 -1.95 
9  TRP 530  T . ? TRP 530  P PRO 531  T ? PRO 531  P 1 -1.00 
10 GLN 592  T . ? GLN 592  P PRO 593  T ? PRO 593  P 1 -1.91 
11 LYS 721  T . ? LYS 721  P PRO 722  T ? PRO 722  P 1 10.05 
12 VAL 912  T . ? VAL 912  P PRO 913  T ? PRO 913  P 1 9.66  
13 PHE 920  T . ? PHE 920  P PRO 921  T ? PRO 921  P 1 4.38  
14 GLU 1201 U . ? GLU 1201 Q PRO 1202 U ? PRO 1202 Q 1 2.97  
15 PRO 128  X . ? PRO 128  T PRO 129  X ? PRO 129  T 1 2.51  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
1A ? 7  ? 
1B ? 5  ? 
1C ? 5  ? 
2A ? 7  ? 
2B ? 9  ? 
4A ? 2  ? 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 2  ? 
AE ? 2  ? 
AF ? 14 ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 18 ? 
AJ ? 3  ? 
AK ? 2  ? 
BA ? 2  ? 
AL ? 2  ? 
AM ? 3  ? 
AN ? 4  ? 
AO ? 2  ? 
AP ? 5  ? 
FA ? 4  ? 
BB ? 4  ? 
BC ? 2  ? 
BD ? 3  ? 
BE ? 4  ? 
BF ? 5  ? 
BG ? 2  ? 
BH ? 2  ? 
BI ? 4  ? 
BJ ? 4  ? 
BK ? 5  ? 
BL ? 7  ? 
BM ? 5  ? 
BN ? 2  ? 
BO ? 3  ? 
BP ? 2  ? 
BQ ? 2  ? 
BR ? 2  ? 
BS ? 2  ? 
BT ? 3  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
CD ? 2  ? 
CE ? 2  ? 
CF ? 2  ? 
DA ? 2  ? 
DB ? 2  ? 
GA ? 5  ? 
GB ? 5  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
GC ? 10 ? 
GD ? 2  ? 
IA ? 2  ? 
IB ? 2  ? 
IC ? 4  ? 
KA ? 4  ? 
MA ? 7  ? 
MB ? 16 ? 
PA ? 3  ? 
PB ? 2  ? 
PC ? 2  ? 
PD ? 2  ? 
PE ? 2  ? 
PF ? 14 ? 
PG ? 4  ? 
PH ? 2  ? 
PI ? 18 ? 
PJ ? 3  ? 
PK ? 2  ? 
QA ? 2  ? 
PL ? 2  ? 
PM ? 3  ? 
PN ? 4  ? 
PO ? 2  ? 
PP ? 5  ? 
UA ? 4  ? 
QB ? 4  ? 
QC ? 2  ? 
QD ? 3  ? 
QE ? 4  ? 
QF ? 5  ? 
QG ? 2  ? 
QH ? 2  ? 
QI ? 4  ? 
QJ ? 4  ? 
QK ? 5  ? 
QL ? 2  ? 
QM ? 3  ? 
QN ? 2  ? 
QO ? 2  ? 
QP ? 2  ? 
QQ ? 3  ? 
RA ? 4  ? 
RB ? 2  ? 
RC ? 2  ? 
RD ? 2  ? 
RE ? 2  ? 
SA ? 2  ? 
SB ? 2  ? 
VA ? 5  ? 
VB ? 5  ? 
TA ? 4  ? 
TB ? 2  ? 
TC ? 4  ? 
VC ? 10 ? 
VD ? 2  ? 
XA ? 2  ? 
XB ? 2  ? 
XC ? 4  ? 
ZA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
1A 1 2  ? anti-parallel 
1A 2 3  ? anti-parallel 
1A 3 4  ? anti-parallel 
1A 4 5  ? anti-parallel 
1A 5 6  ? anti-parallel 
1A 6 7  ? anti-parallel 
1B 1 2  ? anti-parallel 
1B 2 3  ? anti-parallel 
1B 3 4  ? anti-parallel 
1B 4 5  ? parallel      
1C 1 2  ? anti-parallel 
1C 2 3  ? anti-parallel 
1C 3 4  ? anti-parallel 
1C 4 5  ? anti-parallel 
2A 1 2  ? parallel      
2A 2 3  ? anti-parallel 
2A 3 4  ? anti-parallel 
2A 4 5  ? parallel      
2A 5 6  ? anti-parallel 
2A 6 7  ? anti-parallel 
2B 1 2  ? anti-parallel 
2B 2 3  ? anti-parallel 
2B 3 4  ? anti-parallel 
2B 4 5  ? anti-parallel 
2B 5 6  ? anti-parallel 
2B 6 7  ? anti-parallel 
4A 1 2  ? parallel      
AA 1 2  ? anti-parallel 
AA 2 3  ? anti-parallel 
AB 1 2  ? anti-parallel 
AC 1 2  ? anti-parallel 
AD 1 2  ? anti-parallel 
AE 1 2  ? anti-parallel 
AF 1 2  ? anti-parallel 
AF 3 4  ? parallel      
AF 4 5  ? anti-parallel 
AF 5 6  ? anti-parallel 
AF 6 7  ? anti-parallel 
AF 7 8  ? anti-parallel 
AG 1 2  ? anti-parallel 
AG 2 3  ? anti-parallel 
AG 3 4  ? anti-parallel 
AH 1 2  ? anti-parallel 
AI 1 2  ? anti-parallel 
AI 3 4  ? anti-parallel 
AI 9 10 ? anti-parallel 
AJ 1 2  ? anti-parallel 
AJ 2 3  ? anti-parallel 
AK 1 2  ? anti-parallel 
BA 1 2  ? parallel      
AL 1 2  ? anti-parallel 
AM 1 2  ? anti-parallel 
AM 2 3  ? anti-parallel 
AN 1 2  ? anti-parallel 
AN 2 3  ? anti-parallel 
AN 3 4  ? anti-parallel 
AO 1 2  ? anti-parallel 
AP 1 2  ? anti-parallel 
AP 2 3  ? anti-parallel 
AP 3 4  ? anti-parallel 
AP 4 5  ? anti-parallel 
FA 1 2  ? anti-parallel 
FA 2 3  ? anti-parallel 
FA 3 4  ? anti-parallel 
BB 1 2  ? anti-parallel 
BB 2 3  ? anti-parallel 
BB 3 4  ? anti-parallel 
BC 1 2  ? anti-parallel 
BD 1 2  ? anti-parallel 
BD 2 3  ? anti-parallel 
BE 1 2  ? anti-parallel 
BE 2 3  ? parallel      
BE 3 4  ? anti-parallel 
BF 1 2  ? anti-parallel 
BF 2 3  ? anti-parallel 
BF 3 4  ? anti-parallel 
BF 4 5  ? anti-parallel 
BG 1 2  ? anti-parallel 
BH 1 2  ? anti-parallel 
BI 1 2  ? parallel      
BI 2 3  ? anti-parallel 
BI 3 4  ? anti-parallel 
BJ 1 2  ? parallel      
BJ 2 3  ? anti-parallel 
BJ 3 4  ? anti-parallel 
BK 1 2  ? anti-parallel 
BK 2 3  ? anti-parallel 
BK 3 4  ? parallel      
BK 4 5  ? anti-parallel 
BL 1 2  ? anti-parallel 
BL 2 3  ? anti-parallel 
BL 3 4  ? anti-parallel 
BL 4 5  ? anti-parallel 
BL 5 6  ? anti-parallel 
BL 6 7  ? anti-parallel 
BM 1 2  ? anti-parallel 
BM 2 3  ? anti-parallel 
BM 3 4  ? anti-parallel 
BM 4 5  ? anti-parallel 
BN 1 2  ? parallel      
BO 1 2  ? anti-parallel 
BO 2 3  ? anti-parallel 
BP 1 2  ? anti-parallel 
BQ 1 2  ? parallel      
BR 1 2  ? anti-parallel 
BS 1 2  ? anti-parallel 
BT 1 2  ? anti-parallel 
BT 2 3  ? anti-parallel 
CA 1 2  ? anti-parallel 
CA 2 3  ? anti-parallel 
CA 3 4  ? anti-parallel 
CB 1 2  ? anti-parallel 
CB 2 3  ? anti-parallel 
CB 3 4  ? anti-parallel 
CB 4 5  ? anti-parallel 
CC 1 2  ? anti-parallel 
CD 1 2  ? anti-parallel 
CE 1 2  ? anti-parallel 
CF 1 2  ? anti-parallel 
DA 1 2  ? anti-parallel 
DB 1 2  ? anti-parallel 
GA 1 2  ? anti-parallel 
GA 2 3  ? anti-parallel 
GA 3 4  ? anti-parallel 
GA 4 5  ? anti-parallel 
GB 1 2  ? anti-parallel 
GB 2 3  ? anti-parallel 
GB 3 4  ? anti-parallel 
GB 4 5  ? anti-parallel 
EA 1 2  ? anti-parallel 
EA 2 3  ? parallel      
EA 3 4  ? parallel      
EB 1 2  ? parallel      
EC 1 2  ? anti-parallel 
EC 2 3  ? anti-parallel 
EC 3 4  ? parallel      
GC 1 2  ? anti-parallel 
GC 5 6  ? parallel      
GD 1 2  ? anti-parallel 
IA 1 2  ? anti-parallel 
IB 1 2  ? anti-parallel 
IC 1 2  ? anti-parallel 
IC 2 3  ? anti-parallel 
IC 3 4  ? anti-parallel 
KA 1 2  ? anti-parallel 
KA 2 3  ? anti-parallel 
KA 3 4  ? anti-parallel 
MA 1 2  ? parallel      
MA 2 3  ? anti-parallel 
MA 3 4  ? anti-parallel 
MA 4 5  ? parallel      
MA 5 6  ? anti-parallel 
MA 6 7  ? anti-parallel 
MB 1 2  ? anti-parallel 
MB 3 4  ? anti-parallel 
MB 8 9  ? anti-parallel 
PA 1 2  ? anti-parallel 
PA 2 3  ? anti-parallel 
PB 1 2  ? anti-parallel 
PC 1 2  ? anti-parallel 
PD 1 2  ? anti-parallel 
PE 1 2  ? anti-parallel 
PF 1 2  ? anti-parallel 
PF 3 4  ? parallel      
PF 4 5  ? anti-parallel 
PF 5 6  ? anti-parallel 
PF 6 7  ? anti-parallel 
PF 7 8  ? anti-parallel 
PG 1 2  ? anti-parallel 
PG 2 3  ? anti-parallel 
PG 3 4  ? anti-parallel 
PH 1 2  ? anti-parallel 
PI 1 2  ? anti-parallel 
PI 3 4  ? anti-parallel 
PI 9 10 ? anti-parallel 
PJ 1 2  ? anti-parallel 
PJ 2 3  ? anti-parallel 
PK 1 2  ? anti-parallel 
QA 1 2  ? parallel      
PL 1 2  ? anti-parallel 
PM 1 2  ? anti-parallel 
PM 2 3  ? anti-parallel 
PN 1 2  ? anti-parallel 
PN 2 3  ? anti-parallel 
PN 3 4  ? anti-parallel 
PO 1 2  ? anti-parallel 
PP 1 2  ? anti-parallel 
PP 2 3  ? anti-parallel 
PP 3 4  ? anti-parallel 
PP 4 5  ? anti-parallel 
UA 1 2  ? anti-parallel 
UA 2 3  ? anti-parallel 
UA 3 4  ? anti-parallel 
QB 1 2  ? anti-parallel 
QB 2 3  ? anti-parallel 
QB 3 4  ? anti-parallel 
QC 1 2  ? anti-parallel 
QD 1 2  ? anti-parallel 
QD 2 3  ? anti-parallel 
QE 1 2  ? anti-parallel 
QE 2 3  ? parallel      
QE 3 4  ? anti-parallel 
QF 1 2  ? anti-parallel 
QF 2 3  ? anti-parallel 
QF 3 4  ? anti-parallel 
QF 4 5  ? anti-parallel 
QG 1 2  ? anti-parallel 
QH 1 2  ? anti-parallel 
QI 1 2  ? parallel      
QI 2 3  ? anti-parallel 
QI 3 4  ? anti-parallel 
QJ 1 2  ? parallel      
QJ 2 3  ? anti-parallel 
QJ 3 4  ? anti-parallel 
QK 1 2  ? anti-parallel 
QK 2 3  ? anti-parallel 
QK 3 4  ? parallel      
QK 4 5  ? anti-parallel 
QL 1 2  ? parallel      
QM 1 2  ? anti-parallel 
QM 2 3  ? anti-parallel 
QN 1 2  ? anti-parallel 
QO 1 2  ? anti-parallel 
QP 1 2  ? anti-parallel 
QQ 1 2  ? anti-parallel 
QQ 2 3  ? anti-parallel 
RA 1 2  ? anti-parallel 
RA 2 3  ? anti-parallel 
RA 3 4  ? anti-parallel 
RB 1 2  ? anti-parallel 
RC 1 2  ? anti-parallel 
RD 1 2  ? anti-parallel 
RE 1 2  ? anti-parallel 
SA 1 2  ? anti-parallel 
SB 1 2  ? anti-parallel 
VA 1 2  ? anti-parallel 
VA 2 3  ? anti-parallel 
VA 3 4  ? anti-parallel 
VA 4 5  ? anti-parallel 
VB 1 2  ? anti-parallel 
VB 2 3  ? anti-parallel 
VB 3 4  ? anti-parallel 
VB 4 5  ? anti-parallel 
TA 1 2  ? anti-parallel 
TA 2 3  ? parallel      
TA 3 4  ? parallel      
TB 1 2  ? parallel      
TC 1 2  ? anti-parallel 
TC 2 3  ? anti-parallel 
TC 3 4  ? parallel      
VC 1 2  ? anti-parallel 
VC 5 6  ? parallel      
VD 1 2  ? anti-parallel 
XA 1 2  ? anti-parallel 
XB 1 2  ? anti-parallel 
XC 1 2  ? anti-parallel 
XC 2 3  ? anti-parallel 
XC 3 4  ? anti-parallel 
ZA 1 2  ? anti-parallel 
ZA 2 3  ? anti-parallel 
ZA 3 4  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
1A 1  LYS A  37   ? LEU A  38   ? LYS 1 37   LEU 1 38   
1A 2  TYR A  29   ? CYS A  31   ? TYR 1 29   CYS 1 31   
1A 3  ILE A  55   ? LYS A  58   ? ILE 1 55   LYS 1 58   
1A 4  ALA U  880  ? ILE U  888  ? ALA Q 880  ILE Q 888  
1A 5  THR U  900  ? ARG U  909  ? THR Q 900  ARG Q 909  
1A 6  GLY U  801  ? ASP U  810  ? GLY Q 801  ASP Q 810  
1A 7  LYS U  740  ? LEU U  744  ? LYS Q 740  LEU Q 744  
1B 1  LYS A  37   ? LEU A  38   ? LYS 1 37   LEU 1 38   
1B 2  TYR A  29   ? CYS A  31   ? TYR 1 29   CYS 1 31   
1B 3  ILE A  55   ? LYS A  58   ? ILE 1 55   LYS 1 58   
1B 4  ALA U  880  ? ILE U  888  ? ALA Q 880  ILE Q 888  
1B 5  TYR U  851  ? VAL U  852  ? TYR Q 851  VAL Q 852  
1C 1  VAL A  65   ? GLU A  68   ? VAL 1 65   GLU 1 68   
1C 2  SER V  77   ? ASN V  88   ? SER R 77   ASN R 88   
1C 3  GLU V  201  ? GLY V  211  ? GLU R 201  GLY R 211  
1C 4  ILE V  132  ? LYS V  139  ? ILE R 132  LYS R 139  
1C 5  LYS V  168  ? GLU V  170  ? LYS R 168  GLU R 170  
2A 1  GLU B  11   ? GLN B  16   ? GLU 2 11   GLN 2 16   
2A 2  SER B  87   ? LYS B  92   ? SER 2 87   LYS 2 92   
2A 3  ASN B  74   ? ASN B  82   ? ASN 2 74   ASN 2 82   
2A 4  GLN C  52   ? PRO C  59   ? GLN 3 52   PRO 3 59   
2A 5  LYS C  135  ? GLU C  141  ? LYS 3 135  GLU 3 141  
2A 6  HIS C  85   ? ASP C  91   ? HIS 3 85   ASP 3 91   
2A 7  THR C  79   ? ILE C  82   ? THR 3 79   ILE 3 82   
2B 1  ALA B  22   ? SER B  25   ? ALA 2 22   SER 2 25   
2B 2  MET C  107  ? PRO C  112  ? MET 3 107  PRO 3 112  
2B 3  LEU C  119  ? ILE C  121  ? LEU 3 119  ILE 3 121  
2B 4  THR B  37   ? LYS B  42   ? THR 2 37   LYS 2 42   
2B 5  PHE B  51   ? GLU B  56   ? PHE 2 51   GLU 2 56   
2B 6  LEU B  60   ? TYR B  65   ? LEU 2 60   TYR 2 65   
2B 7  VAL B  95   ? SER B  102  ? VAL 2 95   SER 2 102  
2B 8  ALA B  22   ? SER B  25   ? ALA 2 22   SER 2 25   
4A 1  ILE D  308  ? VAL D  309  ? ILE 4 308  VAL 4 309  
4A 2  VAL U  1052 ? ASN U  1053 ? VAL Q 1052 ASN Q 1053 
AA 1  ARG E  1631 ? GLU E  1632 ? ARG A 1631 GLU A 1632 
AA 2  GLU E  10   ? ILE E  18   ? GLU A 10   ILE A 18   
AA 3  ILE F  1194 ? GLU F  1201 ? ILE B 1194 GLU B 1201 
AB 1  GLY E  77   ? TYR E  86   ? GLY A 77   TYR A 86   
AB 2  PHE E  356  ? VAL E  362  ? PHE A 356  VAL A 362  
AC 1  LYS E  242  ? LYS E  245  ? LYS A 242  LYS A 245  
AC 2  ILE E  251  ? THR E  254  ? ILE A 251  THR A 254  
AD 1  SER E  371  ? LEU E  373  ? SER A 371  LEU A 373  
AD 2  GLU E  376  ? HIS E  378  ? GLU A 376  HIS A 378  
AE 1  LYS E  474  ? VAL E  476  ? LYS A 474  VAL A 476  
AE 2  ILE F  1069 ? VAL F  1071 ? ILE B 1069 VAL B 1071 
AF 1  ALA E  479  ? PRO E  486  ? ALA A 479  PRO A 486  
AF 2  GLN F  1045 ? ARG F  1047 ? GLN B 1045 ARG B 1047 
AF 3  GLU E  494  ? VAL E  497  ? GLU A 494  VAL A 497  
AF 4  MET E  600  ? VAL E  607  ? MET A 600  VAL A 607  
AF 5  VAL E  586  ? ASN E  590  ? VAL A 586  ASN A 590  
AF 6  LEU E  614  ? LEU E  616  ? LEU A 614  LEU A 616  
AF 7  GLU E  632  ? HIS E  636  ? GLU A 632  HIS A 636  
AF 8  ALA E  479  ? PRO E  486  ? ALA A 479  PRO A 486  
AG 1  THR E  506  ? PRO E  510  ? THR A 506  PRO A 510  
AG 2  LYS E  576  ? HIS E  580  ? LYS A 576  HIS A 580  
AG 3  ALA E  533  ? GLN E  537  ? ALA A 533  GLN A 537  
AG 4  LEU E  543  ? SER E  545  ? LEU A 543  SER A 545  
AH 1  PHE E  686  ? THR E  688  ? PHE A 686  THR A 688  
AH 2  LEU E  725  ? THR E  727  ? LEU A 725  THR A 727  
AI 1  ILE E  719  ? LYS E  721  ? ILE A 719  LYS A 721  
AI 2  TYR L  95   ? GLU L  106  ? TYR H 95   GLU H 106  
AI 3  THR L  4    ? ASP L  16   ? THR H 4    ASP H 16   
AI 4  SER L  54   ? ALA L  60   ? SER H 54   ALA H 60   
AI 5  VAL L  23   ? SER L  30   ? VAL H 23   SER H 30   
AI 6  LYS L  37   ? ASN L  43   ? LYS H 37   ASN H 43   
AI 7  LEU L  111  ? PHE L  118  ? LEU H 111  PHE H 118  
AI 8  LEU L  121  ? ASN L  128  ? LEU H 121  ASN H 128  
AI 9  ASN L  139  ? ARG L  145  ? ASN H 139  ARG H 145  
AI 10 SER L  54   ? ALA L  60   ? SER H 54   ALA H 60   
AJ 1  LEU E  749  ? LYS E  752  ? LEU A 749  LYS A 752  
AJ 2  GLU E  768  ? LYS E  772  ? GLU A 768  LYS A 772  
AJ 3  ALA E  775  ? CYS E  778  ? ALA A 775  CYS A 778  
AK 1  PHE E  826  ? THR E  827  ? PHE A 826  THR A 827  
AK 2  PHE F  769  ? SER F  777  ? PHE B 769  SER B 777  
BA 1  ASN F  1010 ? GLU F  1011 ? ASN B 1010 GLU B 1011 
BA 2  ILE F  1026 ? LEU F  1036 ? ILE B 1026 LEU B 1036 
AL 1  GLY E  948  ? GLN E  949  ? GLY A 948  GLN A 949  
AL 2  TYR E  981  ? VAL E  982  ? TYR A 981  VAL A 982  
AM 1  HIS E  1031 ? VAL E  1032 ? HIS A 1031 VAL A 1032 
AM 2  ILE E  1038 ? ARG E  1039 ? ILE A 1038 ARG A 1039 
AM 3  LEU E  1045 ? GLN E  1047 ? LEU A 1045 GLN A 1047 
AN 1  CYS E  1507 ? VAL E  1508 ? CYS A 1507 VAL A 1508 
AN 2  VAL E  1518 ? GLU E  1522 ? VAL A 1518 GLU A 1522 
AN 3  GLN E  1237 ? PRO E  1241 ? GLN A 1237 PRO A 1241 
AN 4  THR E  1542 ? SER E  1543 ? THR A 1542 SER A 1543 
AO 1  VAL E  1261 ? LEU E  1262 ? VAL A 1261 LEU A 1262 
AO 2  ILE E  1497 ? ARG E  1499 ? ILE A 1497 ARG A 1499 
AP 1  ILE E  1457 ? PHE E  1462 ? ILE A 1457 PHE A 1462 
AP 2  TRP E  1469 ? LEU E  1476 ? TRP A 1469 LEU A 1476 
AP 3  ARG E  1288 ? PHE E  1296 ? ARG A 1288 PHE A 1296 
AP 4  ILE E  1267 ? THR E  1275 ? ILE A 1267 THR A 1275 
AP 5  VAL M  47   ? THR M  50   ? VAL I 47   THR I 50   
FA 1  PHE J  143  ? SER J  147  ? PHE F 143  SER F 147  
FA 2  LEU J  132  ? TYR J  137  ? LEU F 132  TYR F 137  
FA 3  PHE E  1654 ? VAL E  1660 ? PHE A 1654 VAL A 1660 
FA 4  LYS K  103  ? LYS K  106  ? LYS G 103  LYS G 106  
BB 1  LYS F  71   ? PHE F  74   ? LYS B 71   PHE B 74   
BB 2  LYS F  94   ? ILE F  104  ? LYS B 94   ILE B 104  
BB 3  ARG F  134  ? VAL F  145  ? ARG B 134  VAL B 145  
BB 4  GLU F  150  ? PRO F  162  ? GLU B 150  PRO B 162  
BC 1  MET F  108  ? SER F  109  ? MET B 108  SER B 109  
BC 2  ARG F  119  ? LYS F  120  ? ARG B 119  LYS B 120  
BD 1  PHE F  194  ? VAL F  196  ? PHE B 194  VAL B 196  
BD 2  ILE F  199  ? ILE F  203  ? ILE B 199  ILE B 203  
BD 3  THR F  485  ? VAL F  487  ? THR B 485  VAL B 487  
BE 1  GLN F  400  ? LEU F  403  ? GLN B 400  LEU B 403  
BE 2  MET F  205  ? GLN F  209  ? MET B 205  GLN B 209  
BE 3  MET F  502  ? HIS F  504  ? MET B 502  HIS B 504  
BE 4  ASN F  543  ? HIS F  544  ? ASN B 543  HIS B 544  
BF 1  PRO F  214  ? ILE F  218  ? PRO B 214  ILE B 218  
BF 2  TYR F  229  ? VAL F  239  ? TYR B 229  VAL B 239  
BF 3  SER F  245  ? LEU F  253  ? SER B 245  LEU B 253  
BF 4  VAL F  258  ? TRP F  264  ? VAL B 258  TRP B 264  
BF 5  ASN F  267  ? PRO F  272  ? ASN B 267  PRO B 272  
BG 1  ARG F  550  ? ILE F  551  ? ARG B 550  ILE B 551  
BG 2  MET F  649  ? TYR F  655  ? MET B 649  TYR B 655  
BH 1  LYS F  660  ? VAL F  664  ? LYS B 660  VAL B 664  
BH 2  MET F  649  ? TYR F  655  ? MET B 649  TYR B 655  
BI 1  ILE F  674  ? ALA F  675  ? ILE B 674  ALA B 675  
BI 2  HIS F  688  ? VAL F  689  ? HIS B 688  VAL B 689  
BI 3  MET F  649  ? TYR F  655  ? MET B 649  TYR B 655  
BI 4  LYS F  660  ? VAL F  664  ? LYS B 660  VAL B 664  
BJ 1  ILE F  674  ? ALA F  675  ? ILE B 674  ALA B 675  
BJ 2  HIS F  688  ? VAL F  689  ? HIS B 688  VAL B 689  
BJ 3  MET F  649  ? TYR F  655  ? MET B 649  TYR B 655  
BJ 4  ARG F  550  ? ILE F  551  ? ARG B 550  ILE B 551  
BK 1  ALA F  571  ? PRO F  572  ? ALA B 571  PRO B 572  
BK 2  LYS F  591  ? VAL F  596  ? LYS B 591  VAL B 596  
BK 3  CYS F  584  ? ILE F  588  ? CYS B 584  ILE B 588  
BK 4  GLY F  639  ? PHE F  643  ? GLY B 639  PHE B 643  
BK 5  GLU F  625  ? VAL F  629  ? GLU B 625  VAL B 629  
BL 1  LYS F  740  ? LEU F  744  ? LYS B 740  LEU B 744  
BL 2  GLY F  801  ? ASP F  810  ? GLY B 801  ASP B 810  
BL 3  THR F  900  ? ARG F  909  ? THR B 900  ARG B 909  
BL 4  ALA F  880  ? ILE F  888  ? ALA B 880  ILE B 888  
BL 5  ILE P  55   ? LYS P  58   ? ILE L 55   LYS L 58   
BL 6  TYR P  29   ? CYS P  31   ? TYR L 29   CYS L 31   
BL 7  LYS P  37   ? LEU P  38   ? LYS L 37   LEU L 38   
BM 1  LYS F  740  ? LEU F  744  ? LYS B 740  LEU B 744  
BM 2  GLY F  801  ? ASP F  810  ? GLY B 801  ASP B 810  
BM 3  THR F  900  ? ARG F  909  ? THR B 900  ARG B 909  
BM 4  ALA F  880  ? ILE F  888  ? ALA B 880  ILE B 888  
BM 5  TYR F  851  ? VAL F  852  ? TYR B 851  VAL B 852  
BN 1  VAL F  752  ? LYS F  753  ? VAL B 752  LYS B 753  
BN 2  GLN F  979  ? ASP F  980  ? GLN B 979  ASP B 980  
BO 1  GLN F  823  ? PHE F  825  ? GLN B 823  PHE B 825  
BO 2  PRO F  857  ? ASP F  863  ? PRO B 857  ASP B 863  
BO 3  LYS F  868  ? THR F  873  ? LYS B 868  THR B 873  
BP 1  PHE F  938  ? SER F  939  ? PHE B 938  SER B 939  
BP 2  MET F  1013 ? TYR F  1014 ? MET B 1013 TYR B 1014 
BQ 1  VAL F  1052 ? ASN F  1053 ? VAL B 1052 ASN B 1053 
BQ 2  ILE S  308  ? VAL S  309  ? ILE O 308  VAL O 309  
BR 1  TYR F  1098 ? CYS F  1104 ? TYR B 1098 CYS B 1104 
BR 2  THR F  1173 ? PRO F  1179 ? THR B 1173 PRO B 1179 
BS 1  THR F  1113 ? GLN F  1115 ? THR B 1113 GLN B 1115 
BS 2  VAL F  1126 ? CYS F  1128 ? VAL B 1126 CYS B 1128 
BT 1  MET F  1133 ? ARG F  1134 ? MET B 1133 ARG B 1134 
BT 2  LYS F  1166 ? VAL F  1168 ? LYS B 1166 VAL B 1168 
BT 3  ILE F  1158 ? GLU F  1160 ? ILE B 1158 GLU B 1160 
CA 1  GLU G  41   ? SER G  46   ? GLU C 41   SER C 46   
CA 2  GLU G  51   ? ILE G  57   ? GLU C 51   ILE C 57   
CA 3  VAL G  289  ? SER G  304  ? VAL C 289  SER C 304  
CA 4  VAL G  222  ? ILE G  235  ? VAL C 222  ILE C 235  
CB 1  LYS G  168  ? GLU G  170  ? LYS C 168  GLU C 170  
CB 2  ILE G  132  ? LYS G  139  ? ILE C 132  LYS C 139  
CB 3  GLU G  201  ? GLY G  211  ? GLU C 201  GLY C 211  
CB 4  SER G  77   ? ASN G  88   ? SER C 77   ASN C 88   
CB 5  VAL P  65   ? GLU P  68   ? VAL L 65   GLU L 68   
CC 1  LEU G  106  ? LYS G  107  ? LEU C 106  LYS C 107  
CC 2  VAL G  185  ? PRO G  186  ? VAL C 185  PRO C 186  
CD 1  THR G  141  ? ARG G  142  ? THR C 141  ARG C 142  
CD 2  TYR G  157  ? ASN G  158  ? TYR C 157  ASN C 158  
CE 1  HIS G  161  ? TYR G  163  ? HIS C 161  TYR C 163  
CE 2  LEU G  192  ? LYS G  195  ? LEU C 192  LYS C 195  
CF 1  ILE G  256  ? ILE G  258  ? ILE C 256  ILE C 258  
CF 2  ALA G  265  ? VAL G  267  ? ALA C 265  VAL C 267  
DA 1  VAL H  21   ? ALA H  24   ? VAL D 21   ALA D 24   
DA 2  ILE K  38   ? LEU K  49   ? ILE G 38   LEU G 49   
DB 1  GLN H  29   ? HIS H  30   ? GLN D 29   HIS D 30   
DB 2  ILE K  38   ? LEU K  49   ? ILE G 38   LEU G 49   
GA 1  TYR K  73   ? ASN K  74   ? TYR G 73   ASN G 74   
GA 2  GLY K  79   ? ILE K  89   ? GLY G 79   ILE G 89   
GA 3  GLY K  114  ? TRP K  125  ? GLY G 114  TRP G 125  
GA 4  ILE K  38   ? LEU K  49   ? ILE G 38   LEU G 49   
GA 5  GLN H  29   ? HIS H  30   ? GLN D 29   HIS D 30   
GB 1  TYR K  73   ? ASN K  74   ? TYR G 73   ASN G 74   
GB 2  GLY K  79   ? ILE K  89   ? GLY G 79   ILE G 89   
GB 3  GLY K  114  ? TRP K  125  ? GLY G 114  TRP G 125  
GB 4  ILE K  38   ? LEU K  49   ? ILE G 38   LEU G 49   
GB 5  VAL H  21   ? ALA H  24   ? VAL D 21   ALA D 24   
EA 1  PHE I  60   ? ALA I  62   ? PHE E 60   ALA E 62   
EA 2  LEU I  78   ? PHE I  82   ? LEU E 78   PHE E 82   
EA 3  THR I  107  ? TYR I  112  ? THR E 107  TYR E 112  
EA 4  THR I  131  ? ASN I  136  ? THR E 131  ASN E 136  
EB 1  SER I  87   ? VAL I  88   ? SER E 87   VAL E 88   
EB 2  ASN I  115  ? ILE I  116  ? ASN E 115  ILE E 116  
EC 1  LYS I  152  ? ARG I  155  ? LYS E 152  ARG E 155  
EC 2  VAL I  195  ? LYS I  201  ? VAL E 195  LYS E 201  
EC 3  ARG I  207  ? CYS I  214  ? ARG E 207  CYS E 214  
EC 4  ARG I  177  ? ILE I  178  ? ARG E 177  ILE E 178  
GC 1  VAL K  132  ? GLN K  140  ? VAL G 132  GLN G 140  
GC 2  LYS K  228  ? HIS K  237  ? LYS G 228  HIS G 237  
GC 3  HIS K  144  ? ILE K  149  ? HIS G 144  ILE G 149  
GC 4  PHE K  153  ? LYS K  158  ? PHE G 153  LYS G 158  
GC 5  SER K  244  ? THR K  248  ? SER G 244  THR G 248  
GC 6  PHE K  153  ? LYS K  158  ? PHE G 153  LYS G 158  
GD 1  THR K  167  ? VAL K  169  ? THR G 167  VAL G 169  
GD 2  HIS K  216  ? VAL K  218  ? HIS G 216  VAL G 218  
IA 1  VAL M  3    ? VAL M  4    ? VAL I 3    VAL I 4    
IA 2  LEU M  7    ? ILE M  8    ? LEU I 7    ILE I 8    
IB 1  ASN M  27   ? GLU M  29   ? ASN I 27   GLU I 29   
IB 2  ILE M  36   ? PRO M  38   ? ILE I 36   PRO I 38   
IC 1  ALA M  80   ? LYS M  83   ? ALA I 80   LYS I 83   
IC 2  GLU M  93   ? LEU M  99   ? GLU I 93   LEU I 99   
IC 3  THR M  109  ? CYS M  114  ? THR I 109  CYS I 114  
IC 4  LYS M  120  ? THR M  123  ? LYS I 120  THR I 123  
KA 1  ILE O  47   ? LEU O  49   ? ILE K 47   LEU K 49   
KA 2  SER O  60   ? VAL O  66   ? SER K 60   VAL K 66   
KA 3  LEU O  100  ? THR O  107  ? LEU K 100  THR K 107  
KA 4  VAL O  86   ? SER O  92   ? VAL K 86   SER K 92   
MA 1  GLU Q  11   ? GLN Q  16   ? GLU M 11   GLN M 16   
MA 2  SER Q  87   ? LYS Q  92   ? SER M 87   LYS M 92   
MA 3  ASN Q  74   ? ASN Q  82   ? ASN M 74   ASN M 82   
MA 4  GLN R  52   ? PRO R  59   ? GLN N 52   PRO N 59   
MA 5  LYS R  135  ? GLU R  141  ? LYS N 135  GLU N 141  
MA 6  HIS R  85   ? ASP R  91   ? HIS N 85   ASP N 91   
MA 7  THR R  79   ? ILE R  82   ? THR N 79   ILE N 82   
MB 1  ALA Q  22   ? SER Q  25   ? ALA M 22   SER M 25   
MB 2  MET R  107  ? PRO R  112  ? MET N 107  PRO N 112  
MB 3  THR Q  37   ? LYS Q  45   ? THR M 37   LYS M 45   
MB 4  LYS Q  48   ? GLU Q  56   ? LYS M 48   GLU M 56   
MB 5  LEU Q  60   ? TYR Q  65   ? LEU M 60   TYR M 65   
MB 6  VAL Q  95   ? SER Q  102  ? VAL M 95   SER M 102  
MB 7  LYS R  30   ? LYS R  31   ? LYS N 30   LYS N 31   
MB 8  LEU R  119  ? ILE R  121  ? LEU N 119  ILE N 121  
MB 9  THR Q  37   ? LYS Q  45   ? THR M 37   LYS M 45   
PA 1  ARG T  1631 ? GLU T  1632 ? ARG P 1631 GLU P 1632 
PA 2  GLU T  10   ? ILE T  18   ? GLU P 10   ILE P 18   
PA 3  ILE U  1194 ? GLU U  1201 ? ILE Q 1194 GLU Q 1201 
PB 1  GLY T  77   ? TYR T  86   ? GLY P 77   TYR P 86   
PB 2  PHE T  356  ? VAL T  362  ? PHE P 356  VAL P 362  
PC 1  LYS T  242  ? ARG T  244  ? LYS P 242  ARG P 244  
PC 2  PHE T  252  ? THR T  254  ? PHE P 252  THR P 254  
PD 1  SER T  371  ? LEU T  373  ? SER P 371  LEU P 373  
PD 2  GLU T  376  ? HIS T  378  ? GLU P 376  HIS P 378  
PE 1  LYS T  474  ? VAL T  476  ? LYS P 474  VAL P 476  
PE 2  ILE U  1069 ? VAL U  1071 ? ILE Q 1069 VAL Q 1071 
PF 1  ALA T  479  ? PRO T  486  ? ALA P 479  PRO P 486  
PF 2  GLN U  1045 ? ARG U  1047 ? GLN Q 1045 ARG Q 1047 
PF 3  GLU T  494  ? VAL T  497  ? GLU P 494  VAL P 497  
PF 4  MET T  600  ? VAL T  607  ? MET P 600  VAL P 607  
PF 5  VAL T  586  ? ASN T  590  ? VAL P 586  ASN P 590  
PF 6  LEU T  614  ? LEU T  616  ? LEU P 614  LEU P 616  
PF 7  GLU T  632  ? HIS T  636  ? GLU P 632  HIS P 636  
PF 8  ALA T  479  ? PRO T  486  ? ALA P 479  PRO P 486  
PG 1  THR T  506  ? PRO T  510  ? THR P 506  PRO P 510  
PG 2  LYS T  576  ? HIS T  580  ? LYS P 576  HIS P 580  
PG 3  ALA T  533  ? GLN T  537  ? ALA P 533  GLN P 537  
PG 4  LEU T  543  ? SER T  545  ? LEU P 543  SER P 545  
PH 1  PHE T  686  ? THR T  688  ? PHE P 686  THR P 688  
PH 2  LEU T  725  ? THR T  727  ? LEU P 725  THR P 727  
PI 1  ILE T  719  ? LYS T  721  ? ILE P 719  LYS P 721  
PI 2  TYR AA 95   ? GLU AA 106  ? TYR W 95   GLU W 106  
PI 3  THR AA 4    ? ASP AA 16   ? THR W 4    ASP W 16   
PI 4  SER AA 54   ? ALA AA 60   ? SER W 54   ALA W 60   
PI 5  VAL AA 23   ? SER AA 30   ? VAL W 23   SER W 30   
PI 6  LYS AA 37   ? ASN AA 43   ? LYS W 37   ASN W 43   
PI 7  LEU AA 111  ? PHE AA 118  ? LEU W 111  PHE W 118  
PI 8  LEU AA 121  ? ASN AA 128  ? LEU W 121  ASN W 128  
PI 9  ASN AA 139  ? ARG AA 145  ? ASN W 139  ARG W 145  
PI 10 SER AA 54   ? ALA AA 60   ? SER W 54   ALA W 60   
PJ 1  LEU T  749  ? LYS T  752  ? LEU P 749  LYS P 752  
PJ 2  GLU T  768  ? LYS T  772  ? GLU P 768  LYS P 772  
PJ 3  ALA T  775  ? CYS T  778  ? ALA P 775  CYS P 778  
PK 1  PHE T  826  ? THR T  827  ? PHE P 826  THR P 827  
PK 2  PHE U  769  ? SER U  777  ? PHE Q 769  SER Q 777  
QA 1  ASN U  1010 ? GLU U  1011 ? ASN Q 1010 GLU Q 1011 
QA 2  ILE U  1026 ? LEU U  1036 ? ILE Q 1026 LEU Q 1036 
PL 1  GLY T  948  ? GLN T  949  ? GLY P 948  GLN P 949  
PL 2  TYR T  981  ? VAL T  982  ? TYR P 981  VAL P 982  
PM 1  HIS T  1031 ? VAL T  1032 ? HIS P 1031 VAL P 1032 
PM 2  ILE T  1038 ? ARG T  1039 ? ILE P 1038 ARG P 1039 
PM 3  LEU T  1045 ? GLN T  1047 ? LEU P 1045 GLN P 1047 
PN 1  CYS T  1507 ? VAL T  1508 ? CYS P 1507 VAL P 1508 
PN 2  VAL T  1518 ? GLU T  1522 ? VAL P 1518 GLU P 1522 
PN 3  GLN T  1237 ? PRO T  1241 ? GLN P 1237 PRO P 1241 
PN 4  THR T  1542 ? SER T  1543 ? THR P 1542 SER P 1543 
PO 1  VAL T  1261 ? LEU T  1262 ? VAL P 1261 LEU P 1262 
PO 2  ILE T  1497 ? ARG T  1499 ? ILE P 1497 ARG P 1499 
PP 1  ILE T  1457 ? PHE T  1462 ? ILE P 1457 PHE P 1462 
PP 2  TRP T  1469 ? LEU T  1476 ? TRP P 1469 LEU P 1476 
PP 3  ARG T  1288 ? PHE T  1296 ? ARG P 1288 PHE P 1296 
PP 4  ILE T  1267 ? THR T  1275 ? ILE P 1267 THR P 1275 
PP 5  VAL BA 47   ? THR BA 50   ? VAL X 47   THR X 50   
UA 1  PHE Y  143  ? SER Y  147  ? PHE U 143  SER U 147  
UA 2  LEU Y  132  ? TYR Y  137  ? LEU U 132  TYR U 137  
UA 3  PHE T  1654 ? VAL T  1660 ? PHE P 1654 VAL P 1660 
UA 4  LYS Z  103  ? LYS Z  106  ? LYS V 103  LYS V 106  
QB 1  LYS U  71   ? PHE U  74   ? LYS Q 71   PHE Q 74   
QB 2  LYS U  94   ? ILE U  104  ? LYS Q 94   ILE Q 104  
QB 3  ARG U  134  ? VAL U  145  ? ARG Q 134  VAL Q 145  
QB 4  GLU U  150  ? PRO U  162  ? GLU Q 150  PRO Q 162  
QC 1  MET U  108  ? SER U  109  ? MET Q 108  SER Q 109  
QC 2  ARG U  119  ? LYS U  120  ? ARG Q 119  LYS Q 120  
QD 1  PHE U  194  ? VAL U  196  ? PHE Q 194  VAL Q 196  
QD 2  ILE U  199  ? ILE U  203  ? ILE Q 199  ILE Q 203  
QD 3  THR U  485  ? VAL U  487  ? THR Q 485  VAL Q 487  
QE 1  GLN U  400  ? LEU U  403  ? GLN Q 400  LEU Q 403  
QE 2  MET U  205  ? GLN U  209  ? MET Q 205  GLN Q 209  
QE 3  MET U  502  ? HIS U  504  ? MET Q 502  HIS Q 504  
QE 4  ASN U  543  ? HIS U  544  ? ASN Q 543  HIS Q 544  
QF 1  PRO U  214  ? ILE U  218  ? PRO Q 214  ILE Q 218  
QF 2  TYR U  229  ? VAL U  239  ? TYR Q 229  VAL Q 239  
QF 3  SER U  245  ? LEU U  253  ? SER Q 245  LEU Q 253  
QF 4  VAL U  258  ? TRP U  264  ? VAL Q 258  TRP Q 264  
QF 5  ASN U  267  ? PRO U  272  ? ASN Q 267  PRO Q 272  
QG 1  ARG U  550  ? ILE U  551  ? ARG Q 550  ILE Q 551  
QG 2  MET U  649  ? TYR U  655  ? MET Q 649  TYR Q 655  
QH 1  LYS U  660  ? VAL U  664  ? LYS Q 660  VAL Q 664  
QH 2  MET U  649  ? TYR U  655  ? MET Q 649  TYR Q 655  
QI 1  ILE U  674  ? ALA U  675  ? ILE Q 674  ALA Q 675  
QI 2  HIS U  688  ? VAL U  689  ? HIS Q 688  VAL Q 689  
QI 3  MET U  649  ? TYR U  655  ? MET Q 649  TYR Q 655  
QI 4  LYS U  660  ? VAL U  664  ? LYS Q 660  VAL Q 664  
QJ 1  ILE U  674  ? ALA U  675  ? ILE Q 674  ALA Q 675  
QJ 2  HIS U  688  ? VAL U  689  ? HIS Q 688  VAL Q 689  
QJ 3  MET U  649  ? TYR U  655  ? MET Q 649  TYR Q 655  
QJ 4  ARG U  550  ? ILE U  551  ? ARG Q 550  ILE Q 551  
QK 1  ALA U  571  ? PRO U  572  ? ALA Q 571  PRO Q 572  
QK 2  LYS U  591  ? VAL U  596  ? LYS Q 591  VAL Q 596  
QK 3  CYS U  584  ? ILE U  588  ? CYS Q 584  ILE Q 588  
QK 4  GLY U  639  ? PHE U  643  ? GLY Q 639  PHE Q 643  
QK 5  GLU U  625  ? VAL U  629  ? GLU Q 625  VAL Q 629  
QL 1  VAL U  752  ? LYS U  753  ? VAL Q 752  LYS Q 753  
QL 2  GLN U  979  ? ASP U  980  ? GLN Q 979  ASP Q 980  
QM 1  GLN U  823  ? PHE U  825  ? GLN Q 823  PHE Q 825  
QM 2  PRO U  857  ? ASP U  863  ? PRO Q 857  ASP Q 863  
QM 3  LYS U  868  ? THR U  873  ? LYS Q 868  THR Q 873  
QN 1  PHE U  938  ? SER U  939  ? PHE Q 938  SER Q 939  
QN 2  MET U  1013 ? TYR U  1014 ? MET Q 1013 TYR Q 1014 
QO 1  TYR U  1098 ? CYS U  1104 ? TYR Q 1098 CYS Q 1104 
QO 2  THR U  1173 ? PRO U  1179 ? THR Q 1173 PRO Q 1179 
QP 1  THR U  1113 ? GLN U  1115 ? THR Q 1113 GLN Q 1115 
QP 2  VAL U  1126 ? CYS U  1128 ? VAL Q 1126 CYS Q 1128 
QQ 1  MET U  1133 ? ARG U  1134 ? MET Q 1133 ARG Q 1134 
QQ 2  LYS U  1166 ? VAL U  1168 ? LYS Q 1166 VAL Q 1168 
QQ 3  ILE U  1158 ? GLU U  1160 ? ILE Q 1158 GLU Q 1160 
RA 1  GLU V  41   ? SER V  46   ? GLU R 41   SER R 46   
RA 2  GLU V  51   ? ILE V  57   ? GLU R 51   ILE R 57   
RA 3  VAL V  289  ? SER V  304  ? VAL R 289  SER R 304  
RA 4  VAL V  222  ? ILE V  235  ? VAL R 222  ILE R 235  
RB 1  LEU V  106  ? LYS V  107  ? LEU R 106  LYS R 107  
RB 2  VAL V  185  ? PRO V  186  ? VAL R 185  PRO R 186  
RC 1  THR V  141  ? ARG V  142  ? THR R 141  ARG R 142  
RC 2  TYR V  157  ? ASN V  158  ? TYR R 157  ASN R 158  
RD 1  HIS V  161  ? TYR V  163  ? HIS R 161  TYR R 163  
RD 2  LEU V  192  ? LYS V  195  ? LEU R 192  LYS R 195  
RE 1  ILE V  256  ? ILE V  258  ? ILE R 256  ILE R 258  
RE 2  ALA V  265  ? VAL V  267  ? ALA R 265  VAL R 267  
SA 1  VAL W  21   ? ALA W  24   ? VAL S 21   ALA S 24   
SA 2  ILE Z  38   ? LEU Z  49   ? ILE V 38   LEU V 49   
SB 1  GLN W  29   ? HIS W  30   ? GLN S 29   HIS S 30   
SB 2  ILE Z  38   ? LEU Z  49   ? ILE V 38   LEU V 49   
VA 1  TYR Z  73   ? ASN Z  74   ? TYR V 73   ASN V 74   
VA 2  GLY Z  79   ? ILE Z  89   ? GLY V 79   ILE V 89   
VA 3  GLY Z  114  ? TRP Z  125  ? GLY V 114  TRP V 125  
VA 4  ILE Z  38   ? LEU Z  49   ? ILE V 38   LEU V 49   
VA 5  GLN W  29   ? HIS W  30   ? GLN S 29   HIS S 30   
VB 1  TYR Z  73   ? ASN Z  74   ? TYR V 73   ASN V 74   
VB 2  GLY Z  79   ? ILE Z  89   ? GLY V 79   ILE V 89   
VB 3  GLY Z  114  ? TRP Z  125  ? GLY V 114  TRP V 125  
VB 4  ILE Z  38   ? LEU Z  49   ? ILE V 38   LEU V 49   
VB 5  VAL W  21   ? ALA W  24   ? VAL S 21   ALA S 24   
TA 1  PHE X  60   ? ALA X  62   ? PHE T 60   ALA T 62   
TA 2  LEU X  78   ? PHE X  82   ? LEU T 78   PHE T 82   
TA 3  THR X  107  ? TYR X  112  ? THR T 107  TYR T 112  
TA 4  THR X  131  ? ASN X  136  ? THR T 131  ASN T 136  
TB 1  SER X  87   ? VAL X  88   ? SER T 87   VAL T 88   
TB 2  ASN X  115  ? ILE X  116  ? ASN T 115  ILE T 116  
TC 1  LYS X  152  ? ARG X  155  ? LYS T 152  ARG T 155  
TC 2  VAL X  195  ? LYS X  201  ? VAL T 195  LYS T 201  
TC 3  ARG X  207  ? CYS X  214  ? ARG T 207  CYS T 214  
TC 4  ARG X  177  ? ILE X  178  ? ARG T 177  ILE T 178  
VC 1  VAL Z  132  ? GLN Z  140  ? VAL V 132  GLN V 140  
VC 2  LYS Z  228  ? HIS Z  237  ? LYS V 228  HIS V 237  
VC 3  HIS Z  144  ? ILE Z  149  ? HIS V 144  ILE V 149  
VC 4  PHE Z  153  ? LYS Z  158  ? PHE V 153  LYS V 158  
VC 5  SER Z  244  ? THR Z  248  ? SER V 244  THR V 248  
VC 6  PHE Z  153  ? LYS Z  158  ? PHE V 153  LYS V 158  
VD 1  THR Z  167  ? VAL Z  169  ? THR V 167  VAL V 169  
VD 2  HIS Z  216  ? VAL Z  218  ? HIS V 216  VAL V 218  
XA 1  VAL BA 3    ? VAL BA 4    ? VAL X 3    VAL X 4    
XA 2  LEU BA 7    ? ILE BA 8    ? LEU X 7    ILE X 8    
XB 1  ASN BA 27   ? GLU BA 29   ? ASN X 27   GLU X 29   
XB 2  ILE BA 36   ? PRO BA 38   ? ILE X 36   PRO X 38   
XC 1  ALA BA 80   ? LYS BA 83   ? ALA X 80   LYS X 83   
XC 2  GLU BA 93   ? LEU BA 99   ? GLU X 93   LEU X 99   
XC 3  THR BA 109  ? CYS BA 114  ? THR X 109  CYS X 114  
XC 4  LYS BA 120  ? THR BA 123  ? LYS X 120  THR X 123  
ZA 1  ILE DA 47   ? LEU DA 49   ? ILE Z 47   LEU Z 49   
ZA 2  SER DA 60   ? VAL DA 66   ? SER Z 60   VAL Z 66   
ZA 3  LEU DA 100  ? THR DA 107  ? LEU Z 100  THR Z 107  
ZA 4  VAL DA 86   ? SER DA 92   ? VAL Z 86   SER Z 92   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
1A 1 2  N LEU A  38   ? N LEU 1 38   O TYR A  29   ? O TYR 1 29   
1A 2 3  N ILE A  30   ? N ILE 1 30   O LEU A  57   ? O LEU 1 57   
1A 3 4  N LYS A  58   ? N LYS 1 58   O VAL U  885  ? O VAL Q 885  
1A 4 5  N ILE U  888  ? N ILE Q 888  O THR U  900  ? O THR Q 900  
1A 5 6  N ARG U  909  ? N ARG Q 909  O GLY U  801  ? O GLY Q 801  
1A 6 7  N TYR U  804  ? N TYR Q 804  O LEU U  741  ? O LEU Q 741  
1B 1 2  N LEU A  38   ? N LEU 1 38   O TYR A  29   ? O TYR 1 29   
1B 2 3  N ILE A  30   ? N ILE 1 30   O LEU A  57   ? O LEU 1 57   
1B 3 4  N LYS A  58   ? N LYS 1 58   O VAL U  885  ? O VAL Q 885  
1B 4 5  N ALA U  880  ? N ALA Q 880  O VAL U  852  ? O VAL Q 852  
1C 1 2  N PHE A  67   ? N PHE 1 67   O VAL V  83   ? O VAL R 83   
1C 2 3  N PHE V  86   ? N PHE R 86   O SER V  203  ? O SER R 203  
1C 3 4  N CYS V  208  ? N CYS R 208  O ILE V  132  ? O ILE R 132  
1C 4 5  N SER V  135  ? N SER R 135  O LYS V  168  ? O LYS R 168  
2A 1 2  N GLU B  13   ? N GLU 2 13   O ILE B  88   ? O ILE 2 88   
2A 2 3  N TYR B  91   ? N TYR 2 91   O VAL B  78   ? O VAL 2 78   
2A 3 4  N PHE B  81   ? N PHE 2 81   O GLN C  52   ? O GLN 3 52   
2A 4 5  N LEU C  55   ? N LEU 3 55   O LYS C  135  ? O LYS 3 135  
2A 5 6  N SER C  140  ? N SER 3 140  O LYS C  88   ? O LYS 3 88   
2A 6 7  N TYR C  87   ? N TYR 3 87   O MET C  80   ? O MET 3 80   
2B 1 2  N GLY B  24   ? N GLY 2 24   O THR C  108  ? O THR 3 108  
2B 2 3  N VAL C  111  ? N VAL 3 111  O LYS C  120  ? O LYS 3 120  
2B 3 4  N LEU C  119  ? N LEU 3 119  O PHE B  38   ? O PHE 2 38   
2B 4 5  N TYR B  41   ? N TYR 2 41   O VAL B  52   ? O VAL 2 52   
2B 5 6  N GLY B  55   ? N GLY 2 55   O TYR B  62   ? O TYR 2 62   
2B 6 7  N TYR B  65   ? N TYR 2 65   O VAL B  97   ? O VAL 2 97   
4A 1 2  N VAL D  309  ? N VAL 4 309  O VAL U  1052 ? O VAL Q 1052 
AA 1 2  N GLU E  1632 ? N GLU A 1632 O VAL E  14   ? O VAL A 14   
AA 2 3  N GLY E  17   ? N GLY A 17   O ARG F  1195 ? O ARG B 1195 
AB 1 2  N CYS E  85   ? N CYS A 85   O MET E  357  ? O MET A 357  
AC 1 2  N ARG E  244  ? N ARG A 244  O PHE E  252  ? O PHE A 252  
AD 1 2  N LEU E  373  ? N LEU A 373  O GLU E  376  ? O GLU A 376  
AE 1 2  N VAL E  476  ? N VAL A 476  O ILE F  1069 ? O ILE B 1069 
AF 1 2  N ARG E  481  ? N ARG A 481  O GLN F  1045 ? O GLN B 1045 
AF 3 4  N ILE E  495  ? N ILE A 495  O LYS E  604  ? O LYS A 604  
AF 4 5  N HIS E  603  ? N HIS A 603  O VAL E  587  ? O VAL A 587  
AF 5 6  N GLY E  496  ? N GLY A 496  O ARG E  615  ? O ARG A 615  
AF 6 7  N SER E  482  ? N SER A 482  O MET E  633  ? O MET A 633  
AF 7 8  N ARG F  1047 ? N ARG B 1047 O ALA E  479  ? O ALA A 479  
AG 1 2  N GLU E  509  ? N GLU A 509  O VAL E  577  ? O VAL A 577  
AG 2 3  O TYR E  578  ? O TYR A 578  N THR E  534  ? N THR A 534  
AG 3 4  N ILE E  536  ? N ILE A 536  O VAL E  544  ? O VAL A 544  
AH 1 2  N PHE E  687  ? N PHE A 687  O TRP E  726  ? O TRP A 726  
AI 1 2  N PHE E  720  ? N PHE A 720  O VAL L  96   ? O VAL H 96   
AI 3 4  N PHE L  10   ? N PHE H 10   O LEU L  55   ? O LEU H 55   
AI 9 10 N ARG L  145  ? N ARG H 145  O THR L  56   ? O THR H 56   
AJ 1 2  N SER E  751  ? N SER A 751  O VAL E  769  ? O VAL A 769  
AJ 2 3  N LYS E  772  ? N LYS A 772  O ALA E  775  ? O ALA A 775  
AK 1 2  N PHE E  826  ? N PHE A 826  O SER F  777  ? O SER B 777  
BA 1 2  N GLU F  1011 ? N GLU B 1011 O ILE F  1026 ? O ILE B 1026 
AL 1 2  N GLY E  948  ? N GLY A 948  O VAL E  982  ? O VAL A 982  
AM 1 2  N HIS E  1031 ? N HIS A 1031 O ARG E  1039 ? O ARG A 1039 
AM 2 3  O ILE E  1038 ? O ILE A 1038 N VAL E  1046 ? N VAL A 1046 
AN 1 2  N VAL E  1508 ? N VAL A 1508 O VAL E  1520 ? O VAL A 1520 
AN 2 3  N THR E  1521 ? N THR A 1521 O MET E  1238 ? O MET A 1238 
AN 3 4  N THR E  1239 ? N THR A 1239 O THR E  1542 ? O THR A 1542 
AO 1 2  O VAL E  1261 ? O VAL A 1261 N ILE E  1498 ? N ILE A 1498 
AP 1 2  N ASN E  1461 ? N ASN A 1461 O GLU E  1471 ? O GLU A 1471 
AP 2 3  N LEU E  1476 ? N LEU A 1476 O ARG E  1288 ? O ARG A 1288 
AP 3 4  O ARG E  1295 ? O ARG A 1295 N ASP E  1268 ? N ASP A 1268 
AP 4 5  N GLU E  1274 ? N GLU A 1274 O VAL M  47   ? O VAL I 47   
FA 1 2  N TRP J  146  ? N TRP F 146  O ILE J  134  ? O ILE F 134  
FA 2 3  N ARG J  135  ? N ARG F 135  O ASP E  1655 ? O ASP A 1655 
FA 3 4  N VAL E  1660 ? N VAL A 1660 O LYS K  103  ? O LYS G 103  
BB 1 2  N ILE F  73   ? N ILE B 73   O LEU F  95   ? O LEU B 95   
BB 2 3  N SER F  103  ? N SER B 103  O LEU F  138  ? O LEU B 138  
BB 3 4  N VAL F  145  ? N VAL B 145  O GLU F  150  ? O GLU B 150  
BC 1 2  N SER F  109  ? N SER B 109  O ARG F  119  ? O ARG B 119  
BD 1 2  N VAL F  196  ? N VAL B 196  O ILE F  199  ? O ILE B 199  
BD 2 3  N LEU F  202  ? N LEU B 202  O VAL F  486  ? O VAL B 486  
BE 1 2  N LEU F  403  ? N LEU B 403  O LEU F  206  ? O LEU B 206  
BE 2 3  N MET F  205  ? N MET B 205  O MET F  502  ? O MET B 502  
BE 3 4  N VAL F  503  ? N VAL B 503  O ASN F  543  ? O ASN B 543  
BF 1 2  N ILE F  217  ? N ILE B 217  O GLY F  233  ? O GLY B 233  
BF 2 3  N SER F  238  ? N SER B 238  O GLN F  246  ? O GLN B 246  
BF 3 4  N HIS F  251  ? N HIS B 251  O THR F  259  ? O THR B 259  
BF 4 5  N TRP F  264  ? N TRP B 264  O ASN F  267  ? O ASN B 267  
BG 1 2  N ARG F  550  ? N ARG B 550  O LEU F  650  ? O LEU B 650  
BH 1 2  N VAL F  664  ? N VAL B 664  O ARG F  651  ? O ARG B 651  
BI 1 2  N ALA F  675  ? N ALA B 675  O HIS F  688  ? O HIS B 688  
BI 2 3  N VAL F  689  ? N VAL B 689  O ARG F  654  ? O ARG B 654  
BI 3 4  N TYR F  655  ? N TYR B 655  O LYS F  660  ? O LYS B 660  
BJ 1 2  N ALA F  675  ? N ALA B 675  O HIS F  688  ? O HIS B 688  
BJ 2 3  N VAL F  689  ? N VAL B 689  O ARG F  654  ? O ARG B 654  
BJ 3 4  N LEU F  650  ? N LEU B 650  O ARG F  550  ? O ARG B 550  
BK 1 2  N ALA F  571  ? N ALA B 571  O TRP F  595  ? O TRP B 595  
BK 2 3  N VAL F  596  ? N VAL B 596  O CYS F  584  ? O CYS B 584  
BK 3 4  N GLN F  587  ? N GLN B 587  O LEU F  640  ? O LEU B 640  
BK 4 5  N PHE F  643  ? N PHE B 643  O GLU F  625  ? O GLU B 625  
BL 1 2  N ARG F  743  ? N ARG B 743  O THR F  802  ? O THR B 802  
BL 2 3  N VAL F  809  ? N VAL B 809  O VAL F  901  ? O VAL B 901  
BL 3 4  N ARG F  906  ? N ARG B 906  O TYR F  881  ? O TYR B 881  
BL 4 5  N LEU F  887  ? N LEU B 887  O LEU P  56   ? O LEU L 56   
BL 5 6  N LEU P  57   ? N LEU L 57   O ILE P  30   ? O ILE L 30   
BL 6 7  N TYR P  29   ? N TYR L 29   O LEU P  38   ? O LEU L 38   
BM 1 2  N ARG F  743  ? N ARG B 743  O THR F  802  ? O THR B 802  
BM 2 3  N VAL F  809  ? N VAL B 809  O VAL F  901  ? O VAL B 901  
BM 3 4  N ARG F  906  ? N ARG B 906  O TYR F  881  ? O TYR B 881  
BM 4 5  N ALA F  880  ? N ALA B 880  O VAL F  852  ? O VAL B 852  
BN 1 2  N LYS F  753  ? N LYS B 753  O GLN F  979  ? O GLN B 979  
BO 1 2  N HIS F  824  ? N HIS B 824  O PHE F  862  ? O PHE B 862  
BO 2 3  N ASP F  863  ? N ASP B 863  O LYS F  868  ? O LYS B 868  
BP 1 2  N PHE F  938  ? N PHE B 938  O TYR F  1014 ? O TYR B 1014 
BQ 1 2  O VAL F  1052 ? O VAL B 1052 N VAL S  309  ? N VAL O 309  
BR 1 2  N VAL F  1103 ? N VAL B 1103 O THR F  1174 ? O THR B 1174 
BS 1 2  N GLN F  1114 ? N GLN B 1114 O CYS F  1127 ? O CYS B 1127 
BT 1 2  N MET F  1133 ? N MET B 1133 O VAL F  1168 ? O VAL B 1168 
BT 2 3  N PHE F  1167 ? N PHE B 1167 O TRP F  1159 ? O TRP B 1159 
CA 1 2  N SER G  46   ? N SER C 46   O ASN G  53   ? O ASN C 53   
CA 2 3  N LEU G  56   ? N LEU C 56   O PHE G  298  ? O PHE C 298  
CA 3 4  O GLU G  303  ? O GLU C 303  N SER G  223  ? N SER C 223  
CB 1 2  N GLU G  170  ? N GLU C 170  O VAL G  133  ? O VAL C 133  
CB 2 3  N VAL G  138  ? N VAL C 138  O ILE G  202  ? O ILE C 202  
CB 3 4  N GLY G  211  ? N GLY C 211  O SER G  77   ? O SER C 77   
CB 4 5  N PHE G  85   ? N PHE C 85   O VAL P  65   ? O VAL L 65   
CC 1 2  N LYS G  107  ? N LYS C 107  O VAL G  185  ? O VAL C 185  
CD 1 2  N THR G  141  ? N THR C 141  O ASN G  158  ? O ASN C 158  
CE 1 2  O VAL G  162  ? O VAL C 162  N LEU G  193  ? N LEU C 193  
CF 1 2  N GLY G  257  ? N GLY C 257  O TYR G  266  ? O TYR C 266  
DA 1 2  N HIS H  23   ? N HIS D 23   O ALA K  44   ? O ALA G 44   
DB 1 2  N GLN H  29   ? N GLN D 29   O ARG K  40   ? O ARG G 40   
GA 1 2  N ASN K  74   ? N ASN G 74   O GLY K  79   ? O GLY G 79   
GA 2 3  N LYS K  88   ? N LYS G 88   O HIS K  119  ? O HIS G 119  
GA 3 4  N VAL K  124  ? N VAL G 124  O VAL K  39   ? O VAL G 39   
GA 4 5  N ARG K  40   ? N ARG G 40   O GLN H  29   ? O GLN D 29   
GB 1 2  N ASN K  74   ? N ASN G 74   O GLY K  79   ? O GLY G 79   
GB 2 3  N LYS K  88   ? N LYS G 88   O HIS K  119  ? O HIS G 119  
GB 3 4  N VAL K  124  ? N VAL G 124  O VAL K  39   ? O VAL G 39   
GB 4 5  N TYR K  46   ? N TYR G 46   O VAL H  21   ? O VAL D 21   
EA 1 2  N ALA I  62   ? N ALA E 62   O LEU I  78   ? O LEU E 78   
EA 2 3  N TRP I  79   ? N TRP E 79   O THR I  107  ? O THR E 107  
EA 3 4  N GLY I  108  ? N GLY E 108  O THR I  131  ? O THR E 131  
EB 1 2  N VAL I  88   ? N VAL E 88   O ASN I  115  ? O ASN E 115  
EC 1 2  N ILE I  154  ? N ILE E 154  O LYS I  197  ? O LYS E 197  
EC 2 3  N ARG I  200  ? N ARG E 200  O TYR I  208  ? O TYR E 208  
EC 3 4  O ILE I  213  ? O ILE E 213  N ILE I  178  ? N ILE E 178  
GC 1 2  N GLY K  135  ? N GLY G 135  O LEU K  229  ? O LEU G 229  
GC 5 6  N VAL K  245  ? N VAL G 245  O ASN K  154  ? O ASN G 154  
GD 1 2  N VAL K  169  ? N VAL G 169  O HIS K  216  ? O HIS G 216  
IA 1 2  N VAL M  4    ? N VAL I 4    O LEU M  7    ? O LEU I 7    
IB 1 2  N VAL M  28   ? N VAL I 28   O TYR M  37   ? O TYR I 37   
IC 1 2  N ILE M  82   ? N ILE I 82   O MET M  94   ? O MET I 94   
IC 2 3  N LEU M  99   ? N LEU I 99   O THR M  109  ? O THR I 109  
IC 3 4  N TYR M  112  ? N TYR I 112  O PHE M  121  ? O PHE I 121  
KA 1 2  N LYS O  48   ? N LYS K 48   O GLN O  64   ? O GLN K 64   
KA 2 3  N ILE O  65   ? N ILE K 65   O LEU O  101  ? O LEU K 101  
KA 3 4  O GLN O  106  ? O GLN K 106  N GLU O  87   ? N GLU K 87   
MA 1 2  N GLU Q  13   ? N GLU M 13   O ILE Q  88   ? O ILE M 88   
MA 2 3  N TYR Q  91   ? N TYR M 91   O VAL Q  78   ? O VAL M 78   
MA 3 4  N PHE Q  81   ? N PHE M 81   O GLN R  52   ? O GLN N 52   
MA 4 5  N LEU R  55   ? N LEU N 55   O LYS R  135  ? O LYS N 135  
MA 5 6  N SER R  140  ? N SER N 140  O LYS R  88   ? O LYS N 88   
MA 6 7  N TYR R  87   ? N TYR N 87   O MET R  80   ? O MET N 80   
MB 1 2  N GLY Q  24   ? N GLY M 24   O THR R  108  ? O THR N 108  
MB 3 4  N LYS Q  45   ? N LYS M 45   O LYS Q  48   ? O LYS M 48   
MB 8 9  N LEU R  119  ? N LEU N 119  O PHE Q  38   ? O PHE M 38   
PA 1 2  N GLU T  1632 ? N GLU P 1632 O VAL T  14   ? O VAL P 14   
PA 2 3  N GLY T  17   ? N GLY P 17   O ARG U  1195 ? O ARG Q 1195 
PB 1 2  N CYS T  85   ? N CYS P 85   O MET T  357  ? O MET P 357  
PC 1 2  N ARG T  244  ? N ARG P 244  O PHE T  252  ? O PHE P 252  
PD 1 2  N LEU T  373  ? N LEU P 373  O GLU T  376  ? O GLU P 376  
PE 1 2  N VAL T  476  ? N VAL P 476  O ILE U  1069 ? O ILE Q 1069 
PF 1 2  N ARG T  481  ? N ARG P 481  O GLN U  1045 ? O GLN Q 1045 
PF 3 4  N ILE T  495  ? N ILE P 495  O LYS T  604  ? O LYS P 604  
PF 4 5  N HIS T  603  ? N HIS P 603  O VAL T  587  ? O VAL P 587  
PF 5 6  N GLY T  496  ? N GLY P 496  O ARG T  615  ? O ARG P 615  
PF 6 7  N SER T  482  ? N SER P 482  O MET T  633  ? O MET P 633  
PF 7 8  N ARG U  1047 ? N ARG Q 1047 O ALA T  479  ? O ALA P 479  
PG 1 2  N GLU T  509  ? N GLU P 509  O VAL T  577  ? O VAL P 577  
PG 2 3  O TYR T  578  ? O TYR P 578  N THR T  534  ? N THR P 534  
PG 3 4  N ILE T  536  ? N ILE P 536  O VAL T  544  ? O VAL P 544  
PH 1 2  N PHE T  687  ? N PHE P 687  O TRP T  726  ? O TRP P 726  
PI 1 2  N PHE T  720  ? N PHE P 720  O VAL AA 96   ? O VAL W 96   
PI 3 4  N PHE AA 10   ? N PHE W 10   O LEU AA 55   ? O LEU W 55   
PI 9 10 N ARG AA 145  ? N ARG W 145  O THR AA 56   ? O THR W 56   
PJ 1 2  N SER T  751  ? N SER P 751  O VAL T  769  ? O VAL P 769  
PJ 2 3  N LYS T  772  ? N LYS P 772  O ALA T  775  ? O ALA P 775  
PK 1 2  N PHE T  826  ? N PHE P 826  O SER U  777  ? O SER Q 777  
QA 1 2  N GLU U  1011 ? N GLU Q 1011 O ILE U  1026 ? O ILE Q 1026 
PL 1 2  N GLY T  948  ? N GLY P 948  O VAL T  982  ? O VAL P 982  
PM 1 2  N HIS T  1031 ? N HIS P 1031 O ARG T  1039 ? O ARG P 1039 
PM 2 3  O ILE T  1038 ? O ILE P 1038 N VAL T  1046 ? N VAL P 1046 
PN 1 2  N VAL T  1508 ? N VAL P 1508 O VAL T  1520 ? O VAL P 1520 
PN 2 3  N THR T  1521 ? N THR P 1521 O MET T  1238 ? O MET P 1238 
PN 3 4  N THR T  1239 ? N THR P 1239 O THR T  1542 ? O THR P 1542 
PO 1 2  O VAL T  1261 ? O VAL P 1261 N ILE T  1498 ? N ILE P 1498 
PP 1 2  N ASN T  1461 ? N ASN P 1461 O GLU T  1471 ? O GLU P 1471 
PP 2 3  N LEU T  1476 ? N LEU P 1476 O ARG T  1288 ? O ARG P 1288 
PP 3 4  O ARG T  1295 ? O ARG P 1295 N ASP T  1268 ? N ASP P 1268 
PP 4 5  N GLU T  1274 ? N GLU P 1274 O VAL BA 47   ? O VAL X 47   
UA 1 2  N TRP Y  146  ? N TRP U 146  O ILE Y  134  ? O ILE U 134  
UA 2 3  N ARG Y  135  ? N ARG U 135  O ASP T  1655 ? O ASP P 1655 
UA 3 4  N VAL T  1660 ? N VAL P 1660 O LYS Z  103  ? O LYS V 103  
QB 1 2  N ILE U  73   ? N ILE Q 73   O LEU U  95   ? O LEU Q 95   
QB 2 3  N SER U  103  ? N SER Q 103  O LEU U  138  ? O LEU Q 138  
QB 3 4  N VAL U  145  ? N VAL Q 145  O GLU U  150  ? O GLU Q 150  
QC 1 2  N SER U  109  ? N SER Q 109  O ARG U  119  ? O ARG Q 119  
QD 1 2  N VAL U  196  ? N VAL Q 196  O ILE U  199  ? O ILE Q 199  
QD 2 3  N LEU U  202  ? N LEU Q 202  O VAL U  486  ? O VAL Q 486  
QE 1 2  N LEU U  403  ? N LEU Q 403  O LEU U  206  ? O LEU Q 206  
QE 2 3  N MET U  205  ? N MET Q 205  O MET U  502  ? O MET Q 502  
QE 3 4  N VAL U  503  ? N VAL Q 503  O ASN U  543  ? O ASN Q 543  
QF 1 2  N ILE U  217  ? N ILE Q 217  O GLY U  233  ? O GLY Q 233  
QF 2 3  N SER U  238  ? N SER Q 238  O GLN U  246  ? O GLN Q 246  
QF 3 4  N HIS U  251  ? N HIS Q 251  O THR U  259  ? O THR Q 259  
QF 4 5  N TRP U  264  ? N TRP Q 264  O ASN U  267  ? O ASN Q 267  
QG 1 2  N ARG U  550  ? N ARG Q 550  O LEU U  650  ? O LEU Q 650  
QH 1 2  N VAL U  664  ? N VAL Q 664  O ARG U  651  ? O ARG Q 651  
QI 1 2  N ALA U  675  ? N ALA Q 675  O HIS U  688  ? O HIS Q 688  
QI 2 3  N VAL U  689  ? N VAL Q 689  O ARG U  654  ? O ARG Q 654  
QI 3 4  N TYR U  655  ? N TYR Q 655  O LYS U  660  ? O LYS Q 660  
QJ 1 2  N ALA U  675  ? N ALA Q 675  O HIS U  688  ? O HIS Q 688  
QJ 2 3  N VAL U  689  ? N VAL Q 689  O ARG U  654  ? O ARG Q 654  
QJ 3 4  N LEU U  650  ? N LEU Q 650  O ARG U  550  ? O ARG Q 550  
QK 1 2  N ALA U  571  ? N ALA Q 571  O TRP U  595  ? O TRP Q 595  
QK 2 3  N VAL U  596  ? N VAL Q 596  O CYS U  584  ? O CYS Q 584  
QK 3 4  N GLN U  587  ? N GLN Q 587  O LEU U  640  ? O LEU Q 640  
QK 4 5  N PHE U  643  ? N PHE Q 643  O GLU U  625  ? O GLU Q 625  
QL 1 2  N LYS U  753  ? N LYS Q 753  O GLN U  979  ? O GLN Q 979  
QM 1 2  N HIS U  824  ? N HIS Q 824  O PHE U  862  ? O PHE Q 862  
QM 2 3  N ASP U  863  ? N ASP Q 863  O LYS U  868  ? O LYS Q 868  
QN 1 2  N PHE U  938  ? N PHE Q 938  O TYR U  1014 ? O TYR Q 1014 
QO 1 2  N VAL U  1103 ? N VAL Q 1103 O THR U  1174 ? O THR Q 1174 
QP 1 2  N GLN U  1114 ? N GLN Q 1114 O CYS U  1127 ? O CYS Q 1127 
QQ 1 2  N MET U  1133 ? N MET Q 1133 O VAL U  1168 ? O VAL Q 1168 
QQ 2 3  N PHE U  1167 ? N PHE Q 1167 O TRP U  1159 ? O TRP Q 1159 
RA 1 2  N SER V  46   ? N SER R 46   O ASN V  53   ? O ASN R 53   
RA 2 3  N LEU V  56   ? N LEU R 56   O PHE V  298  ? O PHE R 298  
RA 3 4  O GLU V  303  ? O GLU R 303  N SER V  223  ? N SER R 223  
RB 1 2  N LYS V  107  ? N LYS R 107  O VAL V  185  ? O VAL R 185  
RC 1 2  N THR V  141  ? N THR R 141  O ASN V  158  ? O ASN R 158  
RD 1 2  O VAL V  162  ? O VAL R 162  N LEU V  193  ? N LEU R 193  
RE 1 2  N GLY V  257  ? N GLY R 257  O TYR V  266  ? O TYR R 266  
SA 1 2  N HIS W  23   ? N HIS S 23   O ALA Z  44   ? O ALA V 44   
SB 1 2  N GLN W  29   ? N GLN S 29   O ARG Z  40   ? O ARG V 40   
VA 1 2  N ASN Z  74   ? N ASN V 74   O GLY Z  79   ? O GLY V 79   
VA 2 3  N LYS Z  88   ? N LYS V 88   O HIS Z  119  ? O HIS V 119  
VA 3 4  N VAL Z  124  ? N VAL V 124  O VAL Z  39   ? O VAL V 39   
VA 4 5  N ARG Z  40   ? N ARG V 40   O GLN W  29   ? O GLN S 29   
VB 1 2  N ASN Z  74   ? N ASN V 74   O GLY Z  79   ? O GLY V 79   
VB 2 3  N LYS Z  88   ? N LYS V 88   O HIS Z  119  ? O HIS V 119  
VB 3 4  N VAL Z  124  ? N VAL V 124  O VAL Z  39   ? O VAL V 39   
VB 4 5  N TYR Z  46   ? N TYR V 46   O VAL W  21   ? O VAL S 21   
TA 1 2  N ALA X  62   ? N ALA T 62   O LEU X  78   ? O LEU T 78   
TA 2 3  N TRP X  79   ? N TRP T 79   O THR X  107  ? O THR T 107  
TA 3 4  N GLY X  108  ? N GLY T 108  O THR X  131  ? O THR T 131  
TB 1 2  N VAL X  88   ? N VAL T 88   O ASN X  115  ? O ASN T 115  
TC 1 2  N ILE X  154  ? N ILE T 154  O LYS X  197  ? O LYS T 197  
TC 2 3  N ARG X  200  ? N ARG T 200  O TYR X  208  ? O TYR T 208  
TC 3 4  O ILE X  213  ? O ILE T 213  N ILE X  178  ? N ILE T 178  
VC 1 2  N GLY Z  135  ? N GLY V 135  O LEU Z  229  ? O LEU V 229  
VC 5 6  N VAL Z  245  ? N VAL V 245  O ASN Z  154  ? O ASN V 154  
VD 1 2  N VAL Z  169  ? N VAL V 169  O HIS Z  216  ? O HIS V 216  
XA 1 2  N VAL BA 4    ? N VAL X 4    O LEU BA 7    ? O LEU X 7    
XB 1 2  N VAL BA 28   ? N VAL X 28   O TYR BA 37   ? O TYR X 37   
XC 1 2  N ILE BA 82   ? N ILE X 82   O MET BA 94   ? O MET X 94   
XC 2 3  N LEU BA 99   ? N LEU X 99   O THR BA 109  ? O THR X 109  
XC 3 4  N TYR BA 112  ? N TYR X 112  O PHE BA 121  ? O PHE X 121  
ZA 1 2  N LYS DA 48   ? N LYS Z 48   O GLN DA 64   ? O GLN Z 64   
ZA 2 3  N ILE DA 65   ? N ILE Z 65   O LEU DA 101  ? O LEU Z 101  
ZA 3 4  O GLN DA 106  ? O GLN Z 106  N GLU DA 87   ? N GLU Z 87   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN 1 3001'  
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3001'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 3002'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 3001'  
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 3001'  
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 3002'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 3001'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 3001'  
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN P 3001'  
BC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN P 3002'  
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN Q 3001'  
BC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 2204' 
BC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 Q 2204' 
BC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN X 3001'  
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN X 3002'  
BC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN Y 3001'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A  31   ? CYS 1 31   . ? 1_555 ? 
2  AC1 4 CYS A  34   ? CYS 1 34   . ? 1_555 ? 
3  AC1 4 CYS A  48   ? CYS 1 48   . ? 1_555 ? 
4  AC1 4 CYS A  51   ? CYS 1 51   . ? 1_555 ? 
5  AC2 4 CYS E  62   ? CYS A 62   . ? 1_555 ? 
6  AC2 4 CYS E  65   ? CYS A 65   . ? 1_555 ? 
7  AC2 4 CYS E  72   ? CYS A 72   . ? 1_555 ? 
8  AC2 4 HIS E  75   ? HIS A 75   . ? 1_555 ? 
9  AC3 4 CYS E  102  ? CYS A 102  . ? 1_555 ? 
10 AC3 4 CYS E  105  ? CYS A 105  . ? 1_555 ? 
11 AC3 4 CYS E  233  ? CYS A 233  . ? 1_555 ? 
12 AC3 4 CYS E  236  ? CYS A 236  . ? 1_555 ? 
13 AC4 4 CYS F  1104 ? CYS B 1104 . ? 1_555 ? 
14 AC4 4 CYS F  1107 ? CYS B 1107 . ? 1_555 ? 
15 AC4 4 CYS F  1128 ? CYS B 1128 . ? 1_555 ? 
16 AC4 4 CYS F  1131 ? CYS B 1131 . ? 1_555 ? 
17 AC5 4 CYS M  10   ? CYS I 10   . ? 1_555 ? 
18 AC5 4 CYS M  13   ? CYS I 13   . ? 1_555 ? 
19 AC5 4 CYS M  30   ? CYS I 30   . ? 1_555 ? 
20 AC5 4 CYS M  33   ? CYS I 33   . ? 1_555 ? 
21 AC6 4 CYS M  86   ? CYS I 86   . ? 1_555 ? 
22 AC6 4 CYS M  89   ? CYS I 89   . ? 1_555 ? 
23 AC6 4 CYS M  114  ? CYS I 114  . ? 1_555 ? 
24 AC6 4 CYS M  117  ? CYS I 117  . ? 1_555 ? 
25 AC7 4 CYS N  7    ? CYS J 7    . ? 1_555 ? 
26 AC7 4 CYS N  10   ? CYS J 10   . ? 1_555 ? 
27 AC7 4 CYS N  45   ? CYS J 45   . ? 1_555 ? 
28 AC7 4 CYS N  46   ? CYS J 46   . ? 1_555 ? 
29 AC8 4 CYS P  31   ? CYS L 31   . ? 1_555 ? 
30 AC8 4 CYS P  34   ? CYS L 34   . ? 1_555 ? 
31 AC8 4 CYS P  48   ? CYS L 48   . ? 1_555 ? 
32 AC8 4 CYS P  51   ? CYS L 51   . ? 1_555 ? 
33 AC9 4 CYS T  62   ? CYS P 62   . ? 1_555 ? 
34 AC9 4 CYS T  65   ? CYS P 65   . ? 1_555 ? 
35 AC9 4 CYS T  72   ? CYS P 72   . ? 1_555 ? 
36 AC9 4 HIS T  75   ? HIS P 75   . ? 1_555 ? 
37 BC1 4 CYS T  102  ? CYS P 102  . ? 1_555 ? 
38 BC1 4 CYS T  105  ? CYS P 105  . ? 1_555 ? 
39 BC1 4 CYS T  233  ? CYS P 233  . ? 1_555 ? 
40 BC1 4 CYS T  236  ? CYS P 236  . ? 1_555 ? 
41 BC2 4 CYS U  1104 ? CYS Q 1104 . ? 1_555 ? 
42 BC2 4 CYS U  1107 ? CYS Q 1107 . ? 1_555 ? 
43 BC2 4 CYS U  1128 ? CYS Q 1128 . ? 1_555 ? 
44 BC2 4 CYS U  1131 ? CYS Q 1131 . ? 1_555 ? 
45 BC3 7 SER F  498  ? SER B 498  . ? 1_555 ? 
46 BC3 7 ARG F  501  ? ARG B 501  . ? 1_555 ? 
47 BC3 7 HIS F  532  ? HIS B 532  . ? 1_555 ? 
48 BC3 7 HIS F  544  ? HIS B 544  . ? 1_555 ? 
49 BC3 7 SER F  698  ? SER B 698  . ? 1_555 ? 
50 BC3 7 ILE F  699  ? ILE B 699  . ? 1_555 ? 
51 BC3 7 LEU F  700  ? LEU B 700  . ? 1_555 ? 
52 BC4 5 HIS U  532  ? HIS Q 532  . ? 1_555 ? 
53 BC4 5 HIS U  544  ? HIS Q 544  . ? 1_555 ? 
54 BC4 5 SER U  698  ? SER Q 698  . ? 1_555 ? 
55 BC4 5 ILE U  699  ? ILE Q 699  . ? 1_555 ? 
56 BC4 5 LEU U  700  ? LEU Q 700  . ? 1_555 ? 
57 BC5 4 CYS BA 10   ? CYS X 10   . ? 1_555 ? 
58 BC5 4 CYS BA 13   ? CYS X 13   . ? 1_555 ? 
59 BC5 4 CYS BA 30   ? CYS X 30   . ? 1_555 ? 
60 BC5 4 CYS BA 33   ? CYS X 33   . ? 1_555 ? 
61 BC6 4 CYS BA 86   ? CYS X 86   . ? 1_555 ? 
62 BC6 4 CYS BA 89   ? CYS X 89   . ? 1_555 ? 
63 BC6 4 CYS BA 114  ? CYS X 114  . ? 1_555 ? 
64 BC6 4 CYS BA 117  ? CYS X 117  . ? 1_555 ? 
65 BC7 4 CYS CA 7    ? CYS Y 7    . ? 1_555 ? 
66 BC7 4 CYS CA 10   ? CYS Y 10   . ? 1_555 ? 
67 BC7 4 CYS CA 45   ? CYS Y 45   . ? 1_555 ? 
68 BC7 4 CYS CA 46   ? CYS Y 46   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4C2M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4C2M 
_atom_sites.fract_transf_matrix[1][1]   0.008147 
_atom_sites.fract_transf_matrix[1][2]   0.000548 
_atom_sites.fract_transf_matrix[1][3]   0.000997 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007209 
_atom_sites.fract_transf_matrix[2][3]   0.002422 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005057 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A  1  27   ? 14.429  128.612 90.437  1.00 102.95 ? 27   LEU 1 N   1 
ATOM   2     C  CA  . LEU A  1  27   ? 13.799  127.924 89.307  1.00 113.82 ? 27   LEU 1 CA  1 
ATOM   3     C  C   . LEU A  1  27   ? 14.817  127.272 88.369  1.00 114.51 ? 27   LEU 1 C   1 
ATOM   4     O  O   . LEU A  1  27   ? 15.067  127.772 87.268  1.00 112.22 ? 27   LEU 1 O   1 
ATOM   5     C  CB  . LEU A  1  27   ? 12.934  128.896 88.509  1.00 119.29 ? 27   LEU 1 CB  1 
ATOM   6     C  CG  . LEU A  1  27   ? 11.578  129.277 89.101  1.00 122.87 ? 27   LEU 1 CG  1 
ATOM   7     C  CD1 . LEU A  1  27   ? 10.881  130.298 88.209  1.00 123.21 ? 27   LEU 1 CD1 1 
ATOM   8     C  CD2 . LEU A  1  27   ? 10.701  128.041 89.301  1.00 123.04 ? 27   LEU 1 CD2 1 
ATOM   9     N  N   . LYS A  1  28   ? 15.369  126.140 88.800  1.00 115.96 ? 28   LYS 1 N   1 
ATOM   10    C  CA  . LYS A  1  28   ? 16.532  125.517 88.152  1.00 113.28 ? 28   LYS 1 CA  1 
ATOM   11    C  C   . LYS A  1  28   ? 16.372  125.044 86.689  1.00 106.46 ? 28   LYS 1 C   1 
ATOM   12    O  O   . LYS A  1  28   ? 17.350  125.024 85.935  1.00 103.82 ? 28   LYS 1 O   1 
ATOM   13    C  CB  . LYS A  1  28   ? 17.055  124.357 89.016  1.00 112.14 ? 28   LYS 1 CB  1 
ATOM   14    C  CG  . LYS A  1  28   ? 17.515  124.757 90.415  1.00 106.63 ? 28   LYS 1 CG  1 
ATOM   15    C  CD  . LYS A  1  28   ? 17.949  123.539 91.222  1.00 104.28 ? 28   LYS 1 CD  1 
ATOM   16    C  CE  . LYS A  1  28   ? 18.502  123.940 92.574  1.00 105.88 ? 28   LYS 1 CE  1 
ATOM   17    N  NZ  . LYS A  1  28   ? 17.487  124.684 93.389  1.00 109.24 ? 28   LYS 1 NZ  1 
ATOM   18    N  N   . TYR A  1  29   ? 15.161  124.666 86.289  1.00 101.99 ? 29   TYR 1 N   1 
ATOM   19    C  CA  . TYR A  1  29   ? 14.968  124.050 84.981  1.00 102.38 ? 29   TYR 1 CA  1 
ATOM   20    C  C   . TYR A  1  29   ? 14.034  124.804 84.047  1.00 104.48 ? 29   TYR 1 C   1 
ATOM   21    O  O   . TYR A  1  29   ? 13.322  125.723 84.452  1.00 105.52 ? 29   TYR 1 O   1 
ATOM   22    C  CB  . TYR A  1  29   ? 14.490  122.610 85.145  1.00 103.14 ? 29   TYR 1 CB  1 
ATOM   23    C  CG  . TYR A  1  29   ? 15.261  121.885 86.205  1.00 101.71 ? 29   TYR 1 CG  1 
ATOM   24    C  CD1 . TYR A  1  29   ? 16.585  121.541 86.006  1.00 105.31 ? 29   TYR 1 CD1 1 
ATOM   25    C  CD2 . TYR A  1  29   ? 14.678  121.573 87.418  1.00 101.99 ? 29   TYR 1 CD2 1 
ATOM   26    C  CE1 . TYR A  1  29   ? 17.308  120.891 86.981  1.00 108.24 ? 29   TYR 1 CE1 1 
ATOM   27    C  CE2 . TYR A  1  29   ? 15.388  120.924 88.402  1.00 106.61 ? 29   TYR 1 CE2 1 
ATOM   28    C  CZ  . TYR A  1  29   ? 16.703  120.585 88.180  1.00 109.26 ? 29   TYR 1 CZ  1 
ATOM   29    O  OH  . TYR A  1  29   ? 17.416  119.937 89.159  1.00 109.01 ? 29   TYR 1 OH  1 
ATOM   30    N  N   . ILE A  1  30   ? 14.058  124.392 82.785  1.00 100.29 ? 30   ILE 1 N   1 
ATOM   31    C  CA  . ILE A  1  30   ? 13.241  124.986 81.741  1.00 104.47 ? 30   ILE 1 CA  1 
ATOM   32    C  C   . ILE A  1  30   ? 12.640  123.871 80.902  1.00 105.31 ? 30   ILE 1 C   1 
ATOM   33    O  O   . ILE A  1  30   ? 13.304  122.872 80.607  1.00 105.42 ? 30   ILE 1 O   1 
ATOM   34    C  CB  . ILE A  1  30   ? 14.100  125.843 80.797  1.00 104.67 ? 30   ILE 1 CB  1 
ATOM   35    C  CG1 . ILE A  1  30   ? 14.780  126.974 81.555  1.00 98.91  ? 30   ILE 1 CG1 1 
ATOM   36    C  CG2 . ILE A  1  30   ? 13.271  126.399 79.646  1.00 105.81 ? 30   ILE 1 CG2 1 
ATOM   37    C  CD1 . ILE A  1  30   ? 15.897  127.591 80.772  1.00 92.66  ? 30   ILE 1 CD1 1 
ATOM   38    N  N   . CYS A  1  31   ? 11.386  124.036 80.508  1.00 105.49 ? 31   CYS 1 N   1 
ATOM   39    C  CA  . CYS A  1  31   ? 10.774  123.085 79.603  1.00 106.84 ? 31   CYS 1 CA  1 
ATOM   40    C  C   . CYS A  1  31   ? 11.357  123.263 78.202  1.00 108.99 ? 31   CYS 1 C   1 
ATOM   41    O  O   . CYS A  1  31   ? 11.528  124.391 77.735  1.00 105.03 ? 31   CYS 1 O   1 
ATOM   42    C  CB  . CYS A  1  31   ? 9.259   123.266 79.584  1.00 108.71 ? 31   CYS 1 CB  1 
ATOM   43    S  SG  . CYS A  1  31   ? 8.415   122.135 78.471  1.00 129.96 ? 31   CYS 1 SG  1 
ATOM   44    N  N   . ALA A  1  32   ? 11.670  122.151 77.539  1.00 114.15 ? 32   ALA 1 N   1 
ATOM   45    C  CA  . ALA A  1  32   ? 12.255  122.196 76.203  1.00 115.14 ? 32   ALA 1 CA  1 
ATOM   46    C  C   . ALA A  1  32   ? 11.222  122.474 75.115  1.00 120.98 ? 32   ALA 1 C   1 
ATOM   47    O  O   . ALA A  1  32   ? 11.578  122.873 74.007  1.00 123.99 ? 32   ALA 1 O   1 
ATOM   48    C  CB  . ALA A  1  32   ? 12.992  120.908 75.904  1.00 110.51 ? 32   ALA 1 CB  1 
ATOM   49    N  N   . GLU A  1  33   ? 9.947   122.267 75.432  1.00 121.78 ? 33   GLU 1 N   1 
ATOM   50    C  CA  . GLU A  1  33   ? 8.877   122.450 74.451  1.00 120.66 ? 33   GLU 1 CA  1 
ATOM   51    C  C   . GLU A  1  33   ? 8.114   123.770 74.565  1.00 123.19 ? 33   GLU 1 C   1 
ATOM   52    O  O   . GLU A  1  33   ? 7.923   124.461 73.565  1.00 126.48 ? 33   GLU 1 O   1 
ATOM   53    C  CB  . GLU A  1  33   ? 7.899   121.278 74.498  1.00 122.12 ? 33   GLU 1 CB  1 
ATOM   54    C  CG  . GLU A  1  33   ? 8.113   120.279 73.384  1.00 124.73 ? 33   GLU 1 CG  1 
ATOM   55    C  CD  . GLU A  1  33   ? 7.405   120.677 72.105  1.00 122.27 ? 33   GLU 1 CD  1 
ATOM   56    O  OE1 . GLU A  1  33   ? 6.223   121.090 72.185  1.00 120.01 ? 33   GLU 1 OE1 1 
ATOM   57    O  OE2 . GLU A  1  33   ? 8.032   120.567 71.025  1.00 116.55 ? 33   GLU 1 OE2 1 
ATOM   58    N  N   . CYS A  1  34   ? 7.675   124.114 75.775  1.00 121.11 ? 34   CYS 1 N   1 
ATOM   59    C  CA  . CYS A  1  34   ? 6.839   125.298 75.977  1.00 116.18 ? 34   CYS 1 CA  1 
ATOM   60    C  C   . CYS A  1  34   ? 7.596   126.452 76.619  1.00 117.12 ? 34   CYS 1 C   1 
ATOM   61    O  O   . CYS A  1  34   ? 7.106   127.582 76.628  1.00 122.20 ? 34   CYS 1 O   1 
ATOM   62    C  CB  . CYS A  1  34   ? 5.616   124.957 76.824  1.00 117.19 ? 34   CYS 1 CB  1 
ATOM   63    S  SG  . CYS A  1  34   ? 5.978   124.629 78.559  1.00 113.66 ? 34   CYS 1 SG  1 
ATOM   64    N  N   . SER A  1  35   ? 8.770   126.145 77.171  1.00 116.61 ? 35   SER 1 N   1 
ATOM   65    C  CA  . SER A  1  35   ? 9.713   127.134 77.710  1.00 117.42 ? 35   SER 1 CA  1 
ATOM   66    C  C   . SER A  1  35   ? 9.369   127.659 79.112  1.00 118.15 ? 35   SER 1 C   1 
ATOM   67    O  O   . SER A  1  35   ? 10.037  128.560 79.634  1.00 116.79 ? 35   SER 1 O   1 
ATOM   68    C  CB  . SER A  1  35   ? 9.927   128.292 76.726  1.00 119.42 ? 35   SER 1 CB  1 
ATOM   69    O  OG  . SER A  1  35   ? 11.000  129.115 77.135  1.00 124.74 ? 35   SER 1 OG  1 
ATOM   70    N  N   . SER A  1  36   ? 8.340   127.090 79.726  1.00 121.44 ? 36   SER 1 N   1 
ATOM   71    C  CA  . SER A  1  36   ? 7.957   127.523 81.060  1.00 128.23 ? 36   SER 1 CA  1 
ATOM   72    C  C   . SER A  1  36   ? 9.092   127.219 82.035  1.00 130.52 ? 36   SER 1 C   1 
ATOM   73    O  O   . SER A  1  36   ? 9.622   126.107 82.056  1.00 129.50 ? 36   SER 1 O   1 
ATOM   74    C  CB  . SER A  1  36   ? 6.639   126.874 81.508  1.00 128.06 ? 36   SER 1 CB  1 
ATOM   75    O  OG  . SER A  1  36   ? 6.857   125.667 82.219  1.00 126.86 ? 36   SER 1 OG  1 
ATOM   76    N  N   . LYS A  1  37   ? 9.486   128.229 82.806  1.00 129.82 ? 37   LYS 1 N   1 
ATOM   77    C  CA  . LYS A  1  37   ? 10.499  128.055 83.834  1.00 122.25 ? 37   LYS 1 CA  1 
ATOM   78    C  C   . LYS A  1  37   ? 9.861   127.364 85.024  1.00 119.62 ? 37   LYS 1 C   1 
ATOM   79    O  O   . LYS A  1  37   ? 8.762   127.724 85.432  1.00 120.20 ? 37   LYS 1 O   1 
ATOM   80    C  CB  . LYS A  1  37   ? 11.095  129.403 84.245  1.00 118.57 ? 37   LYS 1 CB  1 
ATOM   81    C  CG  . LYS A  1  37   ? 11.912  130.060 83.146  1.00 118.38 ? 37   LYS 1 CG  1 
ATOM   82    C  CD  . LYS A  1  37   ? 13.200  130.653 83.697  1.00 120.94 ? 37   LYS 1 CD  1 
ATOM   83    C  CE  . LYS A  1  37   ? 14.179  130.986 82.577  1.00 118.53 ? 37   LYS 1 CE  1 
ATOM   84    N  NZ  . LYS A  1  37   ? 15.328  131.792 83.072  1.00 117.61 ? 37   LYS 1 NZ  1 
ATOM   85    N  N   . LEU A  1  38   ? 10.540  126.360 85.570  1.00 120.56 ? 38   LEU 1 N   1 
ATOM   86    C  CA  . LEU A  1  38   ? 9.976   125.591 86.674  1.00 123.39 ? 38   LEU 1 CA  1 
ATOM   87    C  C   . LEU A  1  38   ? 11.033  124.838 87.473  1.00 128.51 ? 38   LEU 1 C   1 
ATOM   88    O  O   . LEU A  1  38   ? 12.152  124.636 87.001  1.00 130.43 ? 38   LEU 1 O   1 
ATOM   89    C  CB  . LEU A  1  38   ? 8.891   124.633 86.168  1.00 118.71 ? 38   LEU 1 CB  1 
ATOM   90    C  CG  . LEU A  1  38   ? 9.207   123.254 85.587  1.00 116.44 ? 38   LEU 1 CG  1 
ATOM   91    C  CD1 . LEU A  1  38   ? 7.921   122.662 85.023  1.00 118.93 ? 38   LEU 1 CD1 1 
ATOM   92    C  CD2 . LEU A  1  38   ? 10.303  123.274 84.521  1.00 110.51 ? 38   LEU 1 CD2 1 
ATOM   93    N  N   . SER A  1  39   ? 10.668  124.426 88.684  1.00 130.28 ? 39   SER 1 N   1 
ATOM   94    C  CA  . SER A  1  39   ? 11.599  123.729 89.561  1.00 128.84 ? 39   SER 1 CA  1 
ATOM   95    C  C   . SER A  1  39   ? 11.096  122.352 89.991  1.00 128.48 ? 39   SER 1 C   1 
ATOM   96    O  O   . SER A  1  39   ? 9.904   122.054 89.896  1.00 131.00 ? 39   SER 1 O   1 
ATOM   97    C  CB  . SER A  1  39   ? 11.909  124.578 90.788  1.00 131.96 ? 39   SER 1 CB  1 
ATOM   98    O  OG  . SER A  1  39   ? 13.197  124.258 91.282  1.00 135.82 ? 39   SER 1 OG  1 
ATOM   99    N  N   . LEU A  1  40   ? 12.016  121.516 90.463  1.00 126.66 ? 40   LEU 1 N   1 
ATOM   100   C  CA  . LEU A  1  40   ? 11.672  120.171 90.906  1.00 130.16 ? 40   LEU 1 CA  1 
ATOM   101   C  C   . LEU A  1  40   ? 11.905  119.997 92.393  1.00 140.25 ? 40   LEU 1 C   1 
ATOM   102   O  O   . LEU A  1  40   ? 12.379  120.908 93.067  1.00 140.54 ? 40   LEU 1 O   1 
ATOM   103   C  CB  . LEU A  1  40   ? 12.506  119.130 90.169  1.00 123.91 ? 40   LEU 1 CB  1 
ATOM   104   C  CG  . LEU A  1  40   ? 12.099  118.773 88.745  1.00 124.16 ? 40   LEU 1 CG  1 
ATOM   105   C  CD1 . LEU A  1  40   ? 13.040  117.706 88.189  1.00 121.62 ? 40   LEU 1 CD1 1 
ATOM   106   C  CD2 . LEU A  1  40   ? 10.657  118.303 88.722  1.00 126.09 ? 40   LEU 1 CD2 1 
ATOM   107   N  N   . SER A  1  41   ? 11.573  118.810 92.893  1.00 148.02 ? 41   SER 1 N   1 
ATOM   108   C  CA  . SER A  1  41   ? 11.841  118.445 94.281  1.00 153.15 ? 41   SER 1 CA  1 
ATOM   109   C  C   . SER A  1  41   ? 12.259  116.975 94.399  1.00 160.40 ? 41   SER 1 C   1 
ATOM   110   O  O   . SER A  1  41   ? 12.547  116.320 93.393  1.00 152.78 ? 41   SER 1 O   1 
ATOM   111   C  CB  . SER A  1  41   ? 10.632  118.748 95.173  1.00 146.46 ? 41   SER 1 CB  1 
ATOM   112   O  OG  . SER A  1  41   ? 9.423   118.588 94.458  1.00 142.76 ? 41   SER 1 OG  1 
ATOM   113   N  N   . ARG A  1  42   ? 12.310  116.469 95.629  1.00 170.83 ? 42   ARG 1 N   1 
ATOM   114   C  CA  . ARG A  1  42   ? 12.690  115.079 95.865  1.00 174.65 ? 42   ARG 1 CA  1 
ATOM   115   C  C   . ARG A  1  42   ? 11.556  114.141 95.454  1.00 180.88 ? 42   ARG 1 C   1 
ATOM   116   O  O   . ARG A  1  42   ? 10.436  114.249 95.965  1.00 181.15 ? 42   ARG 1 O   1 
ATOM   117   C  CB  . ARG A  1  42   ? 13.105  114.855 97.326  1.00 172.80 ? 42   ARG 1 CB  1 
ATOM   118   C  CG  . ARG A  1  42   ? 14.545  115.266 97.627  1.00 167.53 ? 42   ARG 1 CG  1 
ATOM   119   C  CD  . ARG A  1  42   ? 14.903  115.032 99.084  1.00 165.95 ? 42   ARG 1 CD  1 
ATOM   120   N  NE  . ARG A  1  42   ? 16.261  115.476 99.387  1.00 162.22 ? 42   ARG 1 NE  1 
ATOM   121   C  CZ  . ARG A  1  42   ? 16.743  115.619 100.617 1.00 161.28 ? 42   ARG 1 CZ  1 
ATOM   122   N  NH1 . ARG A  1  42   ? 15.976  115.357 101.671 1.00 162.26 ? 42   ARG 1 NH1 1 
ATOM   123   N  NH2 . ARG A  1  42   ? 17.991  116.032 100.795 1.00 158.38 ? 42   ARG 1 NH2 1 
ATOM   124   N  N   . THR A  1  43   ? 11.873  113.225 94.536  1.00 184.76 ? 43   THR 1 N   1 
ATOM   125   C  CA  . THR A  1  43   ? 10.885  112.395 93.834  1.00 187.33 ? 43   THR 1 CA  1 
ATOM   126   C  C   . THR A  1  43   ? 9.695   113.240 93.367  1.00 187.24 ? 43   THR 1 C   1 
ATOM   127   O  O   . THR A  1  43   ? 8.651   113.318 94.030  1.00 192.86 ? 43   THR 1 O   1 
ATOM   128   C  CB  . THR A  1  43   ? 10.433  111.151 94.654  1.00 200.91 ? 43   THR 1 CB  1 
ATOM   129   O  OG1 . THR A  1  43   ? 11.580  110.377 95.024  1.00 200.72 ? 43   THR 1 OG1 1 
ATOM   130   C  CG2 . THR A  1  43   ? 9.497   110.268 93.831  1.00 198.71 ? 43   THR 1 CG2 1 
ATOM   131   N  N   . ASP A  1  44   ? 9.885   113.893 92.225  1.00 175.81 ? 44   ASP 1 N   1 
ATOM   132   C  CA  . ASP A  1  44   ? 8.878   114.768 91.651  1.00 165.22 ? 44   ASP 1 CA  1 
ATOM   133   C  C   . ASP A  1  44   ? 8.705   114.373 90.198  1.00 155.89 ? 44   ASP 1 C   1 
ATOM   134   O  O   . ASP A  1  44   ? 9.551   113.672 89.636  1.00 151.16 ? 44   ASP 1 O   1 
ATOM   135   C  CB  . ASP A  1  44   ? 9.324   116.227 91.753  1.00 161.11 ? 44   ASP 1 CB  1 
ATOM   136   C  CG  . ASP A  1  44   ? 8.188   117.161 92.104  1.00 158.44 ? 44   ASP 1 CG  1 
ATOM   137   O  OD1 . ASP A  1  44   ? 7.235   116.708 92.772  1.00 157.04 ? 44   ASP 1 OD1 1 
ATOM   138   O  OD2 . ASP A  1  44   ? 8.257   118.349 91.720  1.00 157.68 ? 44   ASP 1 OD2 1 
ATOM   139   N  N   . ALA A  1  45   ? 7.612   114.821 89.593  1.00 154.74 ? 45   ALA 1 N   1 
ATOM   140   C  CA  . ALA A  1  45   ? 7.305   114.463 88.212  1.00 154.34 ? 45   ALA 1 CA  1 
ATOM   141   C  C   . ALA A  1  45   ? 8.301   115.063 87.210  1.00 151.87 ? 45   ALA 1 C   1 
ATOM   142   O  O   . ALA A  1  45   ? 8.165   116.222 86.815  1.00 156.15 ? 45   ALA 1 O   1 
ATOM   143   C  CB  . ALA A  1  45   ? 5.872   114.880 87.866  1.00 154.16 ? 45   ALA 1 CB  1 
ATOM   144   N  N   . VAL A  1  46   ? 9.296   114.279 86.798  1.00 144.16 ? 46   VAL 1 N   1 
ATOM   145   C  CA  . VAL A  1  46   ? 10.269  114.747 85.807  1.00 137.69 ? 46   VAL 1 CA  1 
ATOM   146   C  C   . VAL A  1  46   ? 9.573   115.042 84.472  1.00 133.48 ? 46   VAL 1 C   1 
ATOM   147   O  O   . VAL A  1  46   ? 9.659   114.262 83.516  1.00 130.60 ? 46   VAL 1 O   1 
ATOM   148   C  CB  . VAL A  1  46   ? 11.422  113.734 85.609  1.00 130.77 ? 46   VAL 1 CB  1 
ATOM   149   C  CG1 . VAL A  1  46   ? 12.606  114.394 84.909  1.00 117.18 ? 46   VAL 1 CG1 1 
ATOM   150   C  CG2 . VAL A  1  46   ? 11.850  113.165 86.955  1.00 135.63 ? 46   VAL 1 CG2 1 
ATOM   151   N  N   . ARG A  1  47   ? 8.877   116.180 84.438  1.00 130.65 ? 47   ARG 1 N   1 
ATOM   152   C  CA  . ARG A  1  47   ? 8.063   116.606 83.302  1.00 127.19 ? 47   ARG 1 CA  1 
ATOM   153   C  C   . ARG A  1  47   ? 7.590   118.047 83.509  1.00 125.56 ? 47   ARG 1 C   1 
ATOM   154   O  O   . ARG A  1  47   ? 7.571   118.553 84.637  1.00 123.99 ? 47   ARG 1 O   1 
ATOM   155   C  CB  . ARG A  1  47   ? 6.841   115.700 83.150  1.00 129.17 ? 47   ARG 1 CB  1 
ATOM   156   C  CG  . ARG A  1  47   ? 5.811   115.880 84.261  1.00 132.01 ? 47   ARG 1 CG  1 
ATOM   157   C  CD  . ARG A  1  47   ? 4.794   114.752 84.285  1.00 136.46 ? 47   ARG 1 CD  1 
ATOM   158   N  NE  . ARG A  1  47   ? 3.657   114.994 83.404  1.00 141.13 ? 47   ARG 1 NE  1 
ATOM   159   C  CZ  . ARG A  1  47   ? 2.597   115.716 83.748  1.00 149.54 ? 47   ARG 1 CZ  1 
ATOM   160   N  NH1 . ARG A  1  47   ? 2.536   116.280 84.949  1.00 151.81 ? 47   ARG 1 NH1 1 
ATOM   161   N  NH2 . ARG A  1  47   ? 1.600   115.880 82.890  1.00 152.35 ? 47   ARG 1 NH2 1 
ATOM   162   N  N   . CYS A  1  48   ? 7.199   118.704 82.423  1.00 122.37 ? 48   CYS 1 N   1 
ATOM   163   C  CA  . CYS A  1  48   ? 6.675   120.059 82.526  1.00 121.83 ? 48   CYS 1 CA  1 
ATOM   164   C  C   . CYS A  1  48   ? 5.291   120.058 83.171  1.00 122.34 ? 48   CYS 1 C   1 
ATOM   165   O  O   . CYS A  1  48   ? 4.406   119.302 82.775  1.00 120.45 ? 48   CYS 1 O   1 
ATOM   166   C  CB  . CYS A  1  48   ? 6.620   120.726 81.152  1.00 119.48 ? 48   CYS 1 CB  1 
ATOM   167   S  SG  . CYS A  1  48   ? 6.026   122.430 81.203  1.00 120.09 ? 48   CYS 1 SG  1 
ATOM   168   N  N   . LYS A  1  49   ? 5.105   120.916 84.165  1.00 123.58 ? 49   LYS 1 N   1 
ATOM   169   C  CA  . LYS A  1  49   ? 3.832   120.988 84.861  1.00 126.93 ? 49   LYS 1 CA  1 
ATOM   170   C  C   . LYS A  1  49   ? 2.745   121.637 84.000  1.00 128.48 ? 49   LYS 1 C   1 
ATOM   171   O  O   . LYS A  1  49   ? 1.567   121.615 84.360  1.00 129.97 ? 49   LYS 1 O   1 
ATOM   172   C  CB  . LYS A  1  49   ? 4.003   121.719 86.189  1.00 128.11 ? 49   LYS 1 CB  1 
ATOM   173   C  CG  . LYS A  1  49   ? 5.208   121.235 86.978  1.00 129.06 ? 49   LYS 1 CG  1 
ATOM   174   C  CD  . LYS A  1  49   ? 5.278   121.872 88.362  1.00 131.37 ? 49   LYS 1 CD  1 
ATOM   175   C  CE  . LYS A  1  49   ? 6.589   121.520 89.062  1.00 129.15 ? 49   LYS 1 CE  1 
ATOM   176   N  NZ  . LYS A  1  49   ? 6.613   122.015 90.468  1.00 126.98 ? 49   LYS 1 NZ  1 
ATOM   177   N  N   . ASP A  1  50   ? 3.146   122.203 82.862  1.00 125.76 ? 50   ASP 1 N   1 
ATOM   178   C  CA  . ASP A  1  50   ? 2.199   122.766 81.896  1.00 121.68 ? 50   ASP 1 CA  1 
ATOM   179   C  C   . ASP A  1  50   ? 1.965   121.817 80.715  1.00 119.22 ? 50   ASP 1 C   1 
ATOM   180   O  O   . ASP A  1  50   ? 0.833   121.422 80.439  1.00 119.15 ? 50   ASP 1 O   1 
ATOM   181   C  CB  . ASP A  1  50   ? 2.676   124.133 81.380  1.00 117.84 ? 50   ASP 1 CB  1 
ATOM   182   C  CG  . ASP A  1  50   ? 2.793   125.177 82.485  1.00 120.70 ? 50   ASP 1 CG  1 
ATOM   183   O  OD1 . ASP A  1  50   ? 1.752   125.608 83.026  1.00 127.32 ? 50   ASP 1 OD1 1 
ATOM   184   O  OD2 . ASP A  1  50   ? 3.929   125.585 82.800  1.00 118.22 ? 50   ASP 1 OD2 1 
ATOM   185   N  N   . CYS A  1  51   ? 3.047   121.459 80.026  1.00 119.99 ? 51   CYS 1 N   1 
ATOM   186   C  CA  . CYS A  1  51   ? 2.996   120.624 78.817  1.00 122.05 ? 51   CYS 1 CA  1 
ATOM   187   C  C   . CYS A  1  51   ? 2.731   119.154 79.099  1.00 122.85 ? 51   CYS 1 C   1 
ATOM   188   O  O   . CYS A  1  51   ? 1.843   118.536 78.506  1.00 116.92 ? 51   CYS 1 O   1 
ATOM   189   C  CB  . CYS A  1  51   ? 4.329   120.691 78.066  1.00 116.90 ? 51   CYS 1 CB  1 
ATOM   190   S  SG  . CYS A  1  51   ? 4.619   122.201 77.161  1.00 181.74 ? 51   CYS 1 SG  1 
ATOM   191   N  N   . GLY A  1  52   ? 3.541   118.599 79.993  1.00 124.65 ? 52   GLY 1 N   1 
ATOM   192   C  CA  . GLY A  1  52   ? 3.585   117.170 80.204  1.00 120.56 ? 52   GLY 1 CA  1 
ATOM   193   C  C   . GLY A  1  52   ? 4.708   116.614 79.352  1.00 119.22 ? 52   GLY 1 C   1 
ATOM   194   O  O   . GLY A  1  52   ? 4.846   115.401 79.205  1.00 115.68 ? 52   GLY 1 O   1 
ATOM   195   N  N   . HIS A  1  53   ? 5.508   117.503 78.771  1.00 117.62 ? 53   HIS 1 N   1 
ATOM   196   C  CA  . HIS A  1  53   ? 6.683   117.051 78.058  1.00 118.49 ? 53   HIS 1 CA  1 
ATOM   197   C  C   . HIS A  1  53   ? 7.738   116.630 79.049  1.00 115.42 ? 53   HIS 1 C   1 
ATOM   198   O  O   . HIS A  1  53   ? 7.901   117.254 80.089  1.00 121.48 ? 53   HIS 1 O   1 
ATOM   199   C  CB  . HIS A  1  53   ? 7.198   118.105 77.092  1.00 135.79 ? 53   HIS 1 CB  1 
ATOM   200   C  CG  . HIS A  1  53   ? 6.766   117.862 75.683  1.00 151.67 ? 53   HIS 1 CG  1 
ATOM   201   N  ND1 . HIS A  1  53   ? 7.603   117.322 74.728  1.00 154.70 ? 53   HIS 1 ND1 1 
ATOM   202   C  CD2 . HIS A  1  53   ? 5.565   118.037 75.081  1.00 157.27 ? 53   HIS 1 CD2 1 
ATOM   203   C  CE1 . HIS A  1  53   ? 6.940   117.194 73.591  1.00 157.72 ? 53   HIS 1 CE1 1 
ATOM   204   N  NE2 . HIS A  1  53   ? 5.704   117.624 73.778  1.00 159.54 ? 53   HIS 1 NE2 1 
ATOM   205   N  N   . ARG A  1  54   ? 8.439   115.551 78.735  1.00 111.66 ? 54   ARG 1 N   1 
ATOM   206   C  CA  . ARG A  1  54   ? 9.291   114.907 79.718  1.00 113.18 ? 54   ARG 1 CA  1 
ATOM   207   C  C   . ARG A  1  54   ? 10.752  115.216 79.466  1.00 110.86 ? 54   ARG 1 C   1 
ATOM   208   O  O   . ARG A  1  54   ? 11.632  114.400 79.742  1.00 113.45 ? 54   ARG 1 O   1 
ATOM   209   C  CB  . ARG A  1  54   ? 9.049   113.397 79.719  1.00 119.20 ? 54   ARG 1 CB  1 
ATOM   210   C  CG  . ARG A  1  54   ? 7.891   112.963 80.599  1.00 130.25 ? 54   ARG 1 CG  1 
ATOM   211   C  CD  . ARG A  1  54   ? 7.171   111.752 80.018  1.00 137.69 ? 54   ARG 1 CD  1 
ATOM   212   N  NE  . ARG A  1  54   ? 6.238   111.159 80.977  1.00 145.29 ? 54   ARG 1 NE  1 
ATOM   213   C  CZ  . ARG A  1  54   ? 4.984   111.566 81.160  1.00 148.81 ? 54   ARG 1 CZ  1 
ATOM   214   N  NH1 . ARG A  1  54   ? 4.500   112.574 80.447  1.00 150.38 ? 54   ARG 1 NH1 1 
ATOM   215   N  NH2 . ARG A  1  54   ? 4.213   110.967 82.058  1.00 149.14 ? 54   ARG 1 NH2 1 
ATOM   216   N  N   . ILE A  1  55   ? 11.017  116.407 78.953  1.00 107.46 ? 55   ILE 1 N   1 
ATOM   217   C  CA  . ILE A  1  55   ? 12.387  116.760 78.622  1.00 106.85 ? 55   ILE 1 CA  1 
ATOM   218   C  C   . ILE A  1  55   ? 12.711  118.197 79.096  1.00 102.09 ? 55   ILE 1 C   1 
ATOM   219   O  O   . ILE A  1  55   ? 12.112  119.174 78.635  1.00 99.32  ? 55   ILE 1 O   1 
ATOM   220   C  CB  . ILE A  1  55   ? 12.654  116.464 77.111  1.00 89.53  ? 55   ILE 1 CB  1 
ATOM   221   C  CG1 . ILE A  1  55   ? 14.143  116.528 76.781  1.00 88.65  ? 55   ILE 1 CG1 1 
ATOM   222   C  CG2 . ILE A  1  55   ? 11.761  117.327 76.199  1.00 92.70  ? 55   ILE 1 CG2 1 
ATOM   223   C  CD1 . ILE A  1  55   ? 14.652  117.914 76.550  1.00 86.86  ? 55   ILE 1 CD1 1 
ATOM   224   N  N   . LEU A  1  56   ? 13.650  118.311 80.035  1.00 96.92  ? 56   LEU 1 N   1 
ATOM   225   C  CA  . LEU A  1  56   ? 13.895  119.578 80.722  1.00 98.93  ? 56   LEU 1 CA  1 
ATOM   226   C  C   . LEU A  1  56   ? 15.335  120.067 80.620  1.00 100.70 ? 56   LEU 1 C   1 
ATOM   227   O  O   . LEU A  1  56   ? 16.271  119.298 80.820  1.00 105.53 ? 56   LEU 1 O   1 
ATOM   228   C  CB  . LEU A  1  56   ? 13.534  119.440 82.199  1.00 101.82 ? 56   LEU 1 CB  1 
ATOM   229   C  CG  . LEU A  1  56   ? 12.124  118.939 82.513  1.00 101.81 ? 56   LEU 1 CG  1 
ATOM   230   C  CD1 . LEU A  1  56   ? 11.923  118.858 84.008  1.00 100.14 ? 56   LEU 1 CD1 1 
ATOM   231   C  CD2 . LEU A  1  56   ? 11.074  119.838 81.882  1.00 103.90 ? 56   LEU 1 CD2 1 
ATOM   232   N  N   . LEU A  1  57   ? 15.511  121.353 80.333  1.00 96.80  ? 57   LEU 1 N   1 
ATOM   233   C  CA  . LEU A  1  57   ? 16.848  121.930 80.236  1.00 95.49  ? 57   LEU 1 CA  1 
ATOM   234   C  C   . LEU A  1  57   ? 17.220  122.616 81.540  1.00 100.89 ? 57   LEU 1 C   1 
ATOM   235   O  O   . LEU A  1  57   ? 16.410  123.360 82.107  1.00 109.21 ? 57   LEU 1 O   1 
ATOM   236   C  CB  . LEU A  1  57   ? 16.905  122.959 79.109  1.00 91.53  ? 57   LEU 1 CB  1 
ATOM   237   C  CG  . LEU A  1  57   ? 15.997  122.707 77.909  1.00 89.65  ? 57   LEU 1 CG  1 
ATOM   238   C  CD1 . LEU A  1  57   ? 15.821  123.979 77.121  1.00 86.82  ? 57   LEU 1 CD1 1 
ATOM   239   C  CD2 . LEU A  1  57   ? 16.566  121.622 77.025  1.00 89.12  ? 57   LEU 1 CD2 1 
ATOM   240   N  N   . LYS A  1  58   ? 18.439  122.379 82.015  1.00 95.09  ? 58   LYS 1 N   1 
ATOM   241   C  CA  . LYS A  1  58   ? 18.915  123.054 83.220  1.00 95.09  ? 58   LYS 1 CA  1 
ATOM   242   C  C   . LYS A  1  58   ? 19.248  124.503 82.891  1.00 97.62  ? 58   LYS 1 C   1 
ATOM   243   O  O   . LYS A  1  58   ? 19.984  124.769 81.950  1.00 91.92  ? 58   LYS 1 O   1 
ATOM   244   C  CB  . LYS A  1  58   ? 20.142  122.350 83.801  1.00 90.33  ? 58   LYS 1 CB  1 
ATOM   245   C  CG  . LYS A  1  58   ? 20.681  123.016 85.049  1.00 92.81  ? 58   LYS 1 CG  1 
ATOM   246   C  CD  . LYS A  1  58   ? 21.633  122.119 85.808  1.00 88.12  ? 58   LYS 1 CD  1 
ATOM   247   C  CE  . LYS A  1  58   ? 22.077  122.789 87.101  1.00 89.55  ? 58   LYS 1 CE  1 
ATOM   248   N  NZ  . LYS A  1  58   ? 20.916  123.220 87.950  1.00 91.57  ? 58   LYS 1 NZ  1 
ATOM   249   N  N   . ALA A  1  59   ? 18.704  125.440 83.662  1.00 103.79 ? 59   ALA 1 N   1 
ATOM   250   C  CA  . ALA A  1  59   ? 18.889  126.857 83.360  1.00 100.89 ? 59   ALA 1 CA  1 
ATOM   251   C  C   . ALA A  1  59   ? 20.233  127.369 83.834  1.00 104.79 ? 59   ALA 1 C   1 
ATOM   252   O  O   . ALA A  1  59   ? 20.764  126.901 84.846  1.00 105.75 ? 59   ALA 1 O   1 
ATOM   253   C  CB  . ALA A  1  59   ? 17.772  127.677 83.971  1.00 92.07  ? 59   ALA 1 CB  1 
ATOM   254   N  N   . ARG A  1  60   ? 20.782  128.330 83.099  1.00 87.53  ? 60   ARG 1 N   1 
ATOM   255   C  CA  . ARG A  1  60   ? 21.966  129.024 83.577  1.00 109.54 ? 60   ARG 1 CA  1 
ATOM   256   C  C   . ARG A  1  60   ? 21.584  130.062 84.641  1.00 110.69 ? 60   ARG 1 C   1 
ATOM   257   O  O   . ARG A  1  60   ? 20.773  130.976 84.405  1.00 103.32 ? 60   ARG 1 O   1 
ATOM   258   C  CB  . ARG A  1  60   ? 22.746  129.681 82.437  1.00 104.64 ? 60   ARG 1 CB  1 
ATOM   259   C  CG  . ARG A  1  60   ? 24.144  130.137 82.866  1.00 107.18 ? 60   ARG 1 CG  1 
ATOM   260   C  CD  . ARG A  1  60   ? 24.981  130.697 81.719  1.00 105.63 ? 60   ARG 1 CD  1 
ATOM   261   N  NE  . ARG A  1  60   ? 26.322  131.064 82.164  1.00 102.79 ? 60   ARG 1 NE  1 
ATOM   262   C  CZ  . ARG A  1  60   ? 27.330  131.365 81.351  1.00 104.76 ? 60   ARG 1 CZ  1 
ATOM   263   N  NH1 . ARG A  1  60   ? 27.167  131.348 80.037  1.00 80.19  ? 60   ARG 1 NH1 1 
ATOM   264   N  NH2 . ARG A  1  60   ? 28.509  131.683 81.857  1.00 108.20 ? 60   ARG 1 NH2 1 
ATOM   265   N  N   . THR A  1  61   ? 22.165  129.911 85.823  1.00 112.34 ? 61   THR 1 N   1 
ATOM   266   C  CA  . THR A  1  61   ? 21.870  130.817 86.917  1.00 113.72 ? 61   THR 1 CA  1 
ATOM   267   C  C   . THR A  1  61   ? 23.093  131.693 87.219  1.00 114.00 ? 61   THR 1 C   1 
ATOM   268   O  O   . THR A  1  61   ? 24.207  131.370 86.797  1.00 116.30 ? 61   THR 1 O   1 
ATOM   269   C  CB  . THR A  1  61   ? 21.383  130.042 88.170  1.00 104.19 ? 61   THR 1 CB  1 
ATOM   270   O  OG1 . THR A  1  61   ? 22.422  129.176 88.643  1.00 108.31 ? 61   THR 1 OG1 1 
ATOM   271   C  CG2 . THR A  1  61   ? 20.143  129.205 87.835  1.00 100.44 ? 61   THR 1 CG2 1 
ATOM   272   N  N   . LYS A  1  62   ? 22.875  132.804 87.923  1.00 109.22 ? 62   LYS 1 N   1 
ATOM   273   C  CA  . LYS A  1  62   ? 23.940  133.761 88.218  1.00 104.98 ? 62   LYS 1 CA  1 
ATOM   274   C  C   . LYS A  1  62   ? 25.121  133.107 88.930  1.00 99.80  ? 62   LYS 1 C   1 
ATOM   275   O  O   . LYS A  1  62   ? 25.007  132.686 90.080  1.00 102.42 ? 62   LYS 1 O   1 
ATOM   276   C  CB  . LYS A  1  62   ? 23.399  134.934 89.049  1.00 112.66 ? 62   LYS 1 CB  1 
ATOM   277   C  CG  . LYS A  1  62   ? 24.456  135.960 89.461  1.00 113.64 ? 62   LYS 1 CG  1 
ATOM   278   C  CD  . LYS A  1  62   ? 23.835  137.223 90.033  1.00 118.50 ? 62   LYS 1 CD  1 
ATOM   279   C  CE  . LYS A  1  62   ? 24.893  138.297 90.305  1.00 122.20 ? 62   LYS 1 CE  1 
ATOM   280   N  NZ  . LYS A  1  62   ? 24.305  139.480 91.008  1.00 128.50 ? 62   LYS 1 NZ  1 
ATOM   281   N  N   . ARG A  1  63   ? 26.258  133.036 88.243  1.00 94.71  ? 63   ARG 1 N   1 
ATOM   282   C  CA  . ARG A  1  63   ? 27.444  132.388 88.798  1.00 99.20  ? 63   ARG 1 CA  1 
ATOM   283   C  C   . ARG A  1  63   ? 28.746  132.822 88.103  1.00 104.86 ? 63   ARG 1 C   1 
ATOM   284   O  O   . ARG A  1  63   ? 28.760  133.091 86.901  1.00 111.74 ? 63   ARG 1 O   1 
ATOM   285   C  CB  . ARG A  1  63   ? 27.278  130.874 88.734  1.00 94.90  ? 63   ARG 1 CB  1 
ATOM   286   C  CG  . ARG A  1  63   ? 28.331  130.112 89.474  1.00 92.24  ? 63   ARG 1 CG  1 
ATOM   287   C  CD  . ARG A  1  63   ? 27.980  128.655 89.483  1.00 101.15 ? 63   ARG 1 CD  1 
ATOM   288   N  NE  . ARG A  1  63   ? 28.893  127.903 90.331  1.00 109.65 ? 63   ARG 1 NE  1 
ATOM   289   C  CZ  . ARG A  1  63   ? 28.803  127.847 91.656  1.00 113.84 ? 63   ARG 1 CZ  1 
ATOM   290   N  NH1 . ARG A  1  63   ? 27.831  128.496 92.293  1.00 109.92 ? 63   ARG 1 NH1 1 
ATOM   291   N  NH2 . ARG A  1  63   ? 29.685  127.133 92.343  1.00 119.07 ? 63   ARG 1 NH2 1 
ATOM   292   N  N   . LEU A  1  64   ? 29.839  132.881 88.859  1.00 100.17 ? 64   LEU 1 N   1 
ATOM   293   C  CA  . LEU A  1  64   ? 31.076  133.447 88.340  1.00 93.67  ? 64   LEU 1 CA  1 
ATOM   294   C  C   . LEU A  1  64   ? 31.928  132.477 87.543  1.00 96.95  ? 64   LEU 1 C   1 
ATOM   295   O  O   . LEU A  1  64   ? 32.505  131.544 88.103  1.00 99.83  ? 64   LEU 1 O   1 
ATOM   296   C  CB  . LEU A  1  64   ? 31.931  133.997 89.467  1.00 89.30  ? 64   LEU 1 CB  1 
ATOM   297   C  CG  . LEU A  1  64   ? 33.229  134.587 88.921  1.00 92.65  ? 64   LEU 1 CG  1 
ATOM   298   C  CD1 . LEU A  1  64   ? 32.931  135.910 88.239  1.00 97.98  ? 64   LEU 1 CD1 1 
ATOM   299   C  CD2 . LEU A  1  64   ? 34.271  134.765 90.009  1.00 95.54  ? 64   LEU 1 CD2 1 
ATOM   300   N  N   . VAL A  1  65   ? 32.016  132.711 86.237  1.00 94.94  ? 65   VAL 1 N   1 
ATOM   301   C  CA  . VAL A  1  65   ? 33.008  132.039 85.404  1.00 89.51  ? 65   VAL 1 CA  1 
ATOM   302   C  C   . VAL A  1  65   ? 33.993  133.091 84.906  1.00 86.00  ? 65   VAL 1 C   1 
ATOM   303   O  O   . VAL A  1  65   ? 33.588  134.147 84.418  1.00 85.01  ? 65   VAL 1 O   1 
ATOM   304   C  CB  . VAL A  1  65   ? 32.380  131.321 84.182  1.00 83.74  ? 65   VAL 1 CB  1 
ATOM   305   C  CG1 . VAL A  1  65   ? 33.446  130.551 83.437  1.00 77.59  ? 65   VAL 1 CG1 1 
ATOM   306   C  CG2 . VAL A  1  65   ? 31.255  130.385 84.618  1.00 82.15  ? 65   VAL 1 CG2 1 
ATOM   307   N  N   . GLN A  1  66   ? 35.284  132.815 85.030  1.00 83.73  ? 66   GLN 1 N   1 
ATOM   308   C  CA  . GLN A  1  66   ? 36.275  133.810 84.645  1.00 88.09  ? 66   GLN 1 CA  1 
ATOM   309   C  C   . GLN A  1  66   ? 37.052  133.444 83.362  1.00 86.81  ? 66   GLN 1 C   1 
ATOM   310   O  O   . GLN A  1  66   ? 37.491  132.300 83.182  1.00 80.15  ? 66   GLN 1 O   1 
ATOM   311   C  CB  . GLN A  1  66   ? 37.200  134.137 85.830  1.00 93.68  ? 66   GLN 1 CB  1 
ATOM   312   C  CG  . GLN A  1  66   ? 38.585  133.516 85.773  1.00 105.58 ? 66   GLN 1 CG  1 
ATOM   313   C  CD  . GLN A  1  66   ? 39.694  134.539 85.982  1.00 113.10 ? 66   GLN 1 CD  1 
ATOM   314   O  OE1 . GLN A  1  66   ? 39.691  135.281 86.971  1.00 116.05 ? 66   GLN 1 OE1 1 
ATOM   315   N  NE2 . GLN A  1  66   ? 40.648  134.589 85.043  1.00 111.29 ? 66   GLN 1 NE2 1 
ATOM   316   N  N   . PHE A  1  67   ? 37.201  134.426 82.472  1.00 83.97  ? 67   PHE 1 N   1 
ATOM   317   C  CA  . PHE A  1  67   ? 37.853  134.223 81.183  1.00 81.27  ? 67   PHE 1 CA  1 
ATOM   318   C  C   . PHE A  1  67   ? 38.978  135.197 80.898  1.00 81.55  ? 67   PHE 1 C   1 
ATOM   319   O  O   . PHE A  1  67   ? 38.974  136.324 81.372  1.00 83.89  ? 67   PHE 1 O   1 
ATOM   320   C  CB  . PHE A  1  67   ? 36.837  134.337 80.051  1.00 83.19  ? 67   PHE 1 CB  1 
ATOM   321   C  CG  . PHE A  1  67   ? 36.036  133.102 79.846  1.00 89.01  ? 67   PHE 1 CG  1 
ATOM   322   C  CD1 . PHE A  1  67   ? 36.505  132.088 79.028  1.00 93.48  ? 67   PHE 1 CD1 1 
ATOM   323   C  CD2 . PHE A  1  67   ? 34.829  132.940 80.485  1.00 94.06  ? 67   PHE 1 CD2 1 
ATOM   324   C  CE1 . PHE A  1  67   ? 35.780  130.942 78.843  1.00 93.20  ? 67   PHE 1 CE1 1 
ATOM   325   C  CE2 . PHE A  1  67   ? 34.097  131.797 80.305  1.00 97.73  ? 67   PHE 1 CE2 1 
ATOM   326   C  CZ  . PHE A  1  67   ? 34.571  130.794 79.481  1.00 97.12  ? 67   PHE 1 CZ  1 
ATOM   327   N  N   . GLU A  1  68   ? 39.931  134.758 80.088  1.00 81.76  ? 68   GLU 1 N   1 
ATOM   328   C  CA  . GLU A  1  68   ? 40.970  135.646 79.609  1.00 80.91  ? 68   GLU 1 CA  1 
ATOM   329   C  C   . GLU A  1  68   ? 40.668  135.983 78.150  1.00 85.05  ? 68   GLU 1 C   1 
ATOM   330   O  O   . GLU A  1  68   ? 40.426  135.086 77.338  1.00 92.94  ? 68   GLU 1 O   1 
ATOM   331   C  CB  . GLU A  1  68   ? 42.322  134.979 79.776  1.00 74.92  ? 68   GLU 1 CB  1 
ATOM   332   C  CG  . GLU A  1  68   ? 43.520  135.884 79.591  1.00 88.51  ? 68   GLU 1 CG  1 
ATOM   333   C  CD  . GLU A  1  68   ? 44.815  135.193 80.017  1.00 104.82 ? 68   GLU 1 CD  1 
ATOM   334   O  OE1 . GLU A  1  68   ? 44.984  134.966 81.238  1.00 106.05 ? 68   GLU 1 OE1 1 
ATOM   335   O  OE2 . GLU A  1  68   ? 45.651  134.860 79.137  1.00 111.73 ? 68   GLU 1 OE2 1 
ATOM   336   N  N   . ALA A  1  69   ? 40.673  137.275 77.824  1.00 79.70  ? 69   ALA 1 N   1 
ATOM   337   C  CA  . ALA A  1  69   ? 40.142  137.760 76.544  1.00 80.05  ? 69   ALA 1 CA  1 
ATOM   338   C  C   . ALA A  1  69   ? 41.017  137.458 75.332  1.00 79.00  ? 69   ALA 1 C   1 
ATOM   339   O  O   . ALA A  1  69   ? 41.245  138.331 74.485  1.00 78.99  ? 69   ALA 1 O   1 
ATOM   340   C  CB  . ALA A  1  69   ? 39.887  139.253 76.624  1.00 76.81  ? 69   ALA 1 CB  1 
ATOM   341   N  N   . ARG A  1  70   ? 41.502  136.228 75.243  1.00 79.14  ? 70   ARG 1 N   1 
ATOM   342   C  CA  . ARG A  1  70   ? 42.476  135.888 74.221  1.00 81.35  ? 70   ARG 1 CA  1 
ATOM   343   C  C   . ARG A  1  70   ? 42.109  134.580 73.561  1.00 88.66  ? 70   ARG 1 C   1 
ATOM   344   O  O   . ARG A  1  70   ? 42.397  134.382 72.371  1.00 96.87  ? 70   ARG 1 O   1 
ATOM   345   C  CB  . ARG A  1  70   ? 43.877  135.799 74.825  1.00 74.34  ? 70   ARG 1 CB  1 
ATOM   346   C  CG  . ARG A  1  70   ? 44.328  137.090 75.463  1.00 78.16  ? 70   ARG 1 CG  1 
ATOM   347   C  CD  . ARG A  1  70   ? 45.335  136.843 76.549  1.00 76.82  ? 70   ARG 1 CD  1 
ATOM   348   N  NE  . ARG A  1  70   ? 46.686  136.835 76.025  1.00 76.68  ? 70   ARG 1 NE  1 
ATOM   349   C  CZ  . ARG A  1  70   ? 47.623  137.704 76.374  1.00 75.74  ? 70   ARG 1 CZ  1 
ATOM   350   N  NH1 . ARG A  1  70   ? 47.357  138.650 77.261  1.00 73.18  ? 70   ARG 1 NH1 1 
ATOM   351   N  NH2 . ARG A  1  70   ? 48.828  137.617 75.840  1.00 77.07  ? 70   ARG 1 NH2 1 
ATOM   352   O  OXT . ARG A  1  70   ? 41.517  133.729 74.232  1.00 85.24  ? 70   ARG 1 OXT 1 
ATOM   353   N  N   . SER B  2  8    ? 4.941   98.832  -7.664  1.00 137.13 ? 8    SER 2 N   1 
ATOM   354   C  CA  . SER B  2  8    ? 4.313   100.017 -8.245  1.00 143.46 ? 8    SER 2 CA  1 
ATOM   355   C  C   . SER B  2  8    ? 2.800   100.116 -7.968  1.00 148.55 ? 8    SER 2 C   1 
ATOM   356   O  O   . SER B  2  8    ? 2.388   100.535 -6.884  1.00 147.95 ? 8    SER 2 O   1 
ATOM   357   C  CB  . SER B  2  8    ? 4.599   100.092 -9.748  1.00 144.30 ? 8    SER 2 CB  1 
ATOM   358   O  OG  . SER B  2  8    ? 4.280   98.870  -10.393 1.00 144.37 ? 8    SER 2 OG  1 
ATOM   359   N  N   . GLU B  2  9    ? 1.977   99.742  -8.943  1.00 154.51 ? 9    GLU 2 N   1 
ATOM   360   C  CA  . GLU B  2  9    ? 0.522   99.829  -8.774  1.00 161.96 ? 9    GLU 2 CA  1 
ATOM   361   C  C   . GLU B  2  9    ? -0.210  98.478  -8.870  1.00 161.40 ? 9    GLU 2 C   1 
ATOM   362   O  O   . GLU B  2  9    ? 0.068   97.665  -9.760  1.00 162.67 ? 9    GLU 2 O   1 
ATOM   363   C  CB  . GLU B  2  9    ? -0.092  100.843 -9.756  1.00 167.80 ? 9    GLU 2 CB  1 
ATOM   364   C  CG  . GLU B  2  9    ? -0.209  100.364 -11.204 1.00 167.52 ? 9    GLU 2 CG  1 
ATOM   365   C  CD  . GLU B  2  9    ? -1.131  101.241 -12.038 1.00 167.72 ? 9    GLU 2 CD  1 
ATOM   366   O  OE1 . GLU B  2  9    ? -1.672  102.231 -11.492 1.00 164.94 ? 9    GLU 2 OE1 1 
ATOM   367   O  OE2 . GLU B  2  9    ? -1.316  100.937 -13.238 1.00 169.52 ? 9    GLU 2 OE2 1 
ATOM   368   N  N   . ILE B  2  10   ? -1.145  98.256  -7.945  1.00 153.70 ? 10   ILE 2 N   1 
ATOM   369   C  CA  . ILE B  2  10   ? -1.939  97.027  -7.904  1.00 145.00 ? 10   ILE 2 CA  1 
ATOM   370   C  C   . ILE B  2  10   ? -3.411  97.325  -7.627  1.00 143.94 ? 10   ILE 2 C   1 
ATOM   371   O  O   . ILE B  2  10   ? -3.740  97.983  -6.637  1.00 142.22 ? 10   ILE 2 O   1 
ATOM   372   C  CB  . ILE B  2  10   ? -1.414  96.040  -6.833  1.00 136.39 ? 10   ILE 2 CB  1 
ATOM   373   C  CG1 . ILE B  2  10   ? -0.074  95.440  -7.264  1.00 130.74 ? 10   ILE 2 CG1 1 
ATOM   374   C  CG2 . ILE B  2  10   ? -2.418  94.925  -6.587  1.00 132.85 ? 10   ILE 2 CG2 1 
ATOM   375   C  CD1 . ILE B  2  10   ? -0.143  94.679  -8.571  1.00 130.66 ? 10   ILE 2 CD1 1 
ATOM   376   N  N   . GLU B  2  11   ? -4.288  96.836  -8.505  1.00 145.35 ? 11   GLU 2 N   1 
ATOM   377   C  CA  . GLU B  2  11   ? -5.735  97.050  -8.396  1.00 145.91 ? 11   GLU 2 CA  1 
ATOM   378   C  C   . GLU B  2  11   ? -6.392  95.999  -7.492  1.00 144.53 ? 11   GLU 2 C   1 
ATOM   379   O  O   . GLU B  2  11   ? -5.992  94.839  -7.484  1.00 143.54 ? 11   GLU 2 O   1 
ATOM   380   C  CB  . GLU B  2  11   ? -6.373  97.040  -9.795  1.00 148.71 ? 11   GLU 2 CB  1 
ATOM   381   C  CG  . GLU B  2  11   ? -7.868  97.384  -9.850  1.00 151.48 ? 11   GLU 2 CG  1 
ATOM   382   C  CD  . GLU B  2  11   ? -8.434  97.343  -11.273 1.00 153.18 ? 11   GLU 2 CD  1 
ATOM   383   O  OE1 . GLU B  2  11   ? -7.804  97.928  -12.179 1.00 156.38 ? 11   GLU 2 OE1 1 
ATOM   384   O  OE2 . GLU B  2  11   ? -9.509  96.732  -11.488 1.00 149.57 ? 11   GLU 2 OE2 1 
ATOM   385   N  N   . ILE B  2  12   ? -7.397  96.409  -6.728  1.00 146.57 ? 12   ILE 2 N   1 
ATOM   386   C  CA  . ILE B  2  12   ? -8.062  95.507  -5.793  1.00 149.53 ? 12   ILE 2 CA  1 
ATOM   387   C  C   . ILE B  2  12   ? -9.414  95.030  -6.323  1.00 153.35 ? 12   ILE 2 C   1 
ATOM   388   O  O   . ILE B  2  12   ? -10.397 95.766  -6.268  1.00 152.94 ? 12   ILE 2 O   1 
ATOM   389   C  CB  . ILE B  2  12   ? -8.265  96.189  -4.425  1.00 153.39 ? 12   ILE 2 CB  1 
ATOM   390   C  CG1 . ILE B  2  12   ? -6.910  96.575  -3.830  1.00 157.69 ? 12   ILE 2 CG1 1 
ATOM   391   C  CG2 . ILE B  2  12   ? -9.024  95.279  -3.475  1.00 151.90 ? 12   ILE 2 CG2 1 
ATOM   392   C  CD1 . ILE B  2  12   ? -6.994  97.241  -2.471  1.00 159.63 ? 12   ILE 2 CD1 1 
ATOM   393   N  N   . GLU B  2  13   ? -9.460  93.800  -6.834  1.00 158.51 ? 13   GLU 2 N   1 
ATOM   394   C  CA  . GLU B  2  13   ? -10.697 93.246  -7.404  1.00 160.71 ? 13   GLU 2 CA  1 
ATOM   395   C  C   . GLU B  2  13   ? -11.845 93.183  -6.385  1.00 155.01 ? 13   GLU 2 C   1 
ATOM   396   O  O   . GLU B  2  13   ? -12.883 93.821  -6.566  1.00 149.80 ? 13   GLU 2 O   1 
ATOM   397   C  CB  . GLU B  2  13   ? -10.463 91.861  -8.040  1.00 160.79 ? 13   GLU 2 CB  1 
ATOM   398   C  CG  . GLU B  2  13   ? -10.110 91.890  -9.533  1.00 162.33 ? 13   GLU 2 CG  1 
ATOM   399   C  CD  . GLU B  2  13   ? -10.487 90.603  -10.261 1.00 165.07 ? 13   GLU 2 CD  1 
ATOM   400   O  OE1 . GLU B  2  13   ? -10.842 89.616  -9.584  1.00 168.64 ? 13   GLU 2 OE1 1 
ATOM   401   O  OE2 . GLU B  2  13   ? -10.433 90.579  -11.511 1.00 162.31 ? 13   GLU 2 OE2 1 
ATOM   402   N  N   . SER B  2  14   ? -11.646 92.419  -5.316  1.00 151.81 ? 14   SER 2 N   1 
ATOM   403   C  CA  . SER B  2  14   ? -12.684 92.230  -4.312  1.00 147.03 ? 14   SER 2 CA  1 
ATOM   404   C  C   . SER B  2  14   ? -12.103 92.252  -2.909  1.00 146.11 ? 14   SER 2 C   1 
ATOM   405   O  O   . SER B  2  14   ? -10.922 91.966  -2.713  1.00 148.56 ? 14   SER 2 O   1 
ATOM   406   C  CB  . SER B  2  14   ? -13.406 90.904  -4.545  1.00 145.95 ? 14   SER 2 CB  1 
ATOM   407   O  OG  . SER B  2  14   ? -12.489 89.837  -4.745  1.00 144.44 ? 14   SER 2 OG  1 
ATOM   408   N  N   . VAL B  2  15   ? -12.935 92.602  -1.935  1.00 143.61 ? 15   VAL 2 N   1 
ATOM   409   C  CA  . VAL B  2  15   ? -12.544 92.514  -0.532  1.00 138.70 ? 15   VAL 2 CA  1 
ATOM   410   C  C   . VAL B  2  15   ? -13.650 91.886  0.306   1.00 137.07 ? 15   VAL 2 C   1 
ATOM   411   O  O   . VAL B  2  15   ? -14.731 92.458  0.465   1.00 141.10 ? 15   VAL 2 O   1 
ATOM   412   C  CB  . VAL B  2  15   ? -12.130 93.882  0.055   1.00 139.58 ? 15   VAL 2 CB  1 
ATOM   413   C  CG1 . VAL B  2  15   ? -12.186 93.855  1.578   1.00 127.14 ? 15   VAL 2 CG1 1 
ATOM   414   C  CG2 . VAL B  2  15   ? -10.736 94.258  -0.417  1.00 136.50 ? 15   VAL 2 CG2 1 
ATOM   415   N  N   . GLN B  2  16   ? -13.367 90.696  0.826   1.00 133.46 ? 16   GLN 2 N   1 
ATOM   416   C  CA  . GLN B  2  16   ? -14.319 89.950  1.637   1.00 138.51 ? 16   GLN 2 CA  1 
ATOM   417   C  C   . GLN B  2  16   ? -14.281 90.383  3.102   1.00 147.30 ? 16   GLN 2 C   1 
ATOM   418   O  O   . GLN B  2  16   ? -13.215 90.514  3.695   1.00 147.36 ? 16   GLN 2 O   1 
ATOM   419   C  CB  . GLN B  2  16   ? -14.041 88.453  1.532   1.00 134.90 ? 16   GLN 2 CB  1 
ATOM   420   C  CG  . GLN B  2  16   ? -14.993 87.601  2.343   1.00 138.94 ? 16   GLN 2 CG  1 
ATOM   421   C  CD  . GLN B  2  16   ? -16.427 87.721  1.867   1.00 147.71 ? 16   GLN 2 CD  1 
ATOM   422   O  OE1 . GLN B  2  16   ? -17.238 88.421  2.475   1.00 151.07 ? 16   GLN 2 OE1 1 
ATOM   423   N  NE2 . GLN B  2  16   ? -16.749 87.032  0.775   1.00 150.47 ? 16   GLN 2 NE2 1 
ATOM   424   N  N   . ASP B  2  17   ? -15.457 90.589  3.681   1.00 156.19 ? 17   ASP 2 N   1 
ATOM   425   C  CA  . ASP B  2  17   ? -15.577 91.118  5.032   1.00 159.58 ? 17   ASP 2 CA  1 
ATOM   426   C  C   . ASP B  2  17   ? -15.973 90.021  6.005   1.00 150.43 ? 17   ASP 2 C   1 
ATOM   427   O  O   . ASP B  2  17   ? -15.916 90.193  7.221   1.00 144.35 ? 17   ASP 2 O   1 
ATOM   428   C  CB  . ASP B  2  17   ? -16.646 92.208  5.048   1.00 176.24 ? 17   ASP 2 CB  1 
ATOM   429   C  CG  . ASP B  2  17   ? -16.075 93.578  5.339   1.00 189.80 ? 17   ASP 2 CG  1 
ATOM   430   O  OD1 . ASP B  2  17   ? -15.430 93.745  6.401   1.00 191.74 ? 17   ASP 2 OD1 1 
ATOM   431   O  OD2 . ASP B  2  17   ? -16.269 94.485  4.502   1.00 196.43 ? 17   ASP 2 OD2 1 
ATOM   432   N  N   . GLN B  2  18   ? -16.373 88.889  5.447   1.00 151.68 ? 18   GLN 2 N   1 
ATOM   433   C  CA  . GLN B  2  18   ? -16.986 87.819  6.213   1.00 156.62 ? 18   GLN 2 CA  1 
ATOM   434   C  C   . GLN B  2  18   ? -15.989 86.694  6.441   1.00 152.87 ? 18   GLN 2 C   1 
ATOM   435   O  O   . GLN B  2  18   ? -15.034 86.554  5.676   1.00 155.28 ? 18   GLN 2 O   1 
ATOM   436   C  CB  . GLN B  2  18   ? -18.212 87.300  5.448   1.00 165.22 ? 18   GLN 2 CB  1 
ATOM   437   C  CG  . GLN B  2  18   ? -19.502 87.267  6.253   1.00 166.58 ? 18   GLN 2 CG  1 
ATOM   438   C  CD  . GLN B  2  18   ? -19.603 88.423  7.216   1.00 165.25 ? 18   GLN 2 CD  1 
ATOM   439   O  OE1 . GLN B  2  18   ? -19.702 88.227  8.427   1.00 164.05 ? 18   GLN 2 OE1 1 
ATOM   440   N  NE2 . GLN B  2  18   ? -19.571 89.640  6.685   1.00 166.27 ? 18   GLN 2 NE2 1 
ATOM   441   N  N   . PRO B  2  19   ? -16.193 85.896  7.505   1.00 146.63 ? 19   PRO 2 N   1 
ATOM   442   C  CA  . PRO B  2  19   ? -15.370 84.700  7.709   1.00 140.23 ? 19   PRO 2 CA  1 
ATOM   443   C  C   . PRO B  2  19   ? -15.300 83.817  6.466   1.00 146.82 ? 19   PRO 2 C   1 
ATOM   444   O  O   . PRO B  2  19   ? -16.316 83.290  6.003   1.00 149.93 ? 19   PRO 2 O   1 
ATOM   445   C  CB  . PRO B  2  19   ? -16.094 83.975  8.841   1.00 135.74 ? 19   PRO 2 CB  1 
ATOM   446   C  CG  . PRO B  2  19   ? -16.680 85.075  9.641   1.00 138.61 ? 19   PRO 2 CG  1 
ATOM   447   C  CD  . PRO B  2  19   ? -17.088 86.141  8.650   1.00 144.77 ? 19   PRO 2 CD  1 
ATOM   448   N  N   . SER B  2  20   ? -14.089 83.693  5.930   1.00 150.55 ? 20   SER 2 N   1 
ATOM   449   C  CA  . SER B  2  20   ? -13.809 82.856  4.765   1.00 154.51 ? 20   SER 2 CA  1 
ATOM   450   C  C   . SER B  2  20   ? -12.704 81.859  5.091   1.00 146.25 ? 20   SER 2 C   1 
ATOM   451   O  O   . SER B  2  20   ? -12.957 80.671  5.287   1.00 143.99 ? 20   SER 2 O   1 
ATOM   452   C  CB  . SER B  2  20   ? -13.387 83.720  3.571   1.00 161.70 ? 20   SER 2 CB  1 
ATOM   453   O  OG  . SER B  2  20   ? -12.363 84.639  3.925   1.00 163.03 ? 20   SER 2 OG  1 
ATOM   454   N  N   . VAL B  2  21   ? -11.473 82.353  5.155   1.00 140.75 ? 21   VAL 2 N   1 
ATOM   455   C  CA  . VAL B  2  21   ? -10.348 81.522  5.551   1.00 135.66 ? 21   VAL 2 CA  1 
ATOM   456   C  C   . VAL B  2  21   ? -9.783  81.933  6.913   1.00 128.68 ? 21   VAL 2 C   1 
ATOM   457   O  O   . VAL B  2  21   ? -10.140 82.976  7.465   1.00 132.80 ? 21   VAL 2 O   1 
ATOM   458   C  CB  . VAL B  2  21   ? -9.237  81.569  4.501   1.00 136.19 ? 21   VAL 2 CB  1 
ATOM   459   C  CG1 . VAL B  2  21   ? -9.791  81.162  3.146   1.00 135.54 ? 21   VAL 2 CG1 1 
ATOM   460   C  CG2 . VAL B  2  21   ? -8.621  82.962  4.447   1.00 135.66 ? 21   VAL 2 CG2 1 
ATOM   461   N  N   . ALA B  2  22   ? -8.908  81.095  7.454   1.00 119.96 ? 22   ALA 2 N   1 
ATOM   462   C  CA  . ALA B  2  22   ? -8.258  81.373  8.724   1.00 122.09 ? 22   ALA 2 CA  1 
ATOM   463   C  C   . ALA B  2  22   ? -6.762  81.049  8.629   1.00 122.23 ? 22   ALA 2 C   1 
ATOM   464   O  O   . ALA B  2  22   ? -6.330  80.326  7.728   1.00 131.57 ? 22   ALA 2 O   1 
ATOM   465   C  CB  . ALA B  2  22   ? -8.914  80.567  9.832   1.00 112.51 ? 22   ALA 2 CB  1 
ATOM   466   N  N   . VAL B  2  23   ? -5.973  81.584  9.554   1.00 110.33 ? 23   VAL 2 N   1 
ATOM   467   C  CA  . VAL B  2  23   ? -4.533  81.352  9.559   1.00 110.89 ? 23   VAL 2 CA  1 
ATOM   468   C  C   . VAL B  2  23   ? -4.066  80.842  10.918  1.00 109.51 ? 23   VAL 2 C   1 
ATOM   469   O  O   . VAL B  2  23   ? -4.385  81.410  11.956  1.00 108.72 ? 23   VAL 2 O   1 
ATOM   470   C  CB  . VAL B  2  23   ? -3.745  82.627  9.183   1.00 114.16 ? 23   VAL 2 CB  1 
ATOM   471   C  CG1 . VAL B  2  23   ? -2.262  82.413  9.388   1.00 113.16 ? 23   VAL 2 CG1 1 
ATOM   472   C  CG2 . VAL B  2  23   ? -4.037  83.028  7.743   1.00 116.24 ? 23   VAL 2 CG2 1 
ATOM   473   N  N   . GLY B  2  24   ? -3.309  79.756  10.909  1.00 103.93 ? 24   GLY 2 N   1 
ATOM   474   C  CA  . GLY B  2  24   ? -2.857  79.168  12.149  1.00 102.58 ? 24   GLY 2 CA  1 
ATOM   475   C  C   . GLY B  2  24   ? -1.353  79.077  12.161  1.00 105.37 ? 24   GLY 2 C   1 
ATOM   476   O  O   . GLY B  2  24   ? -0.739  78.664  11.180  1.00 102.45 ? 24   GLY 2 O   1 
ATOM   477   N  N   . SER B  2  25   ? -0.746  79.495  13.260  1.00 103.24 ? 25   SER 2 N   1 
ATOM   478   C  CA  . SER B  2  25   ? 0.675   79.284  13.430  1.00 102.64 ? 25   SER 2 CA  1 
ATOM   479   C  C   . SER B  2  25   ? 0.844   78.148  14.421  1.00 105.97 ? 25   SER 2 C   1 
ATOM   480   O  O   . SER B  2  25   ? 0.470   78.255  15.588  1.00 106.72 ? 25   SER 2 O   1 
ATOM   481   C  CB  . SER B  2  25   ? 1.409   80.564  13.870  1.00 100.88 ? 25   SER 2 CB  1 
ATOM   482   O  OG  . SER B  2  25   ? 0.868   81.125  15.049  1.00 96.10  ? 25   SER 2 OG  1 
ATOM   483   N  N   . PHE B  2  26   ? 1.369   77.036  13.929  1.00 106.91 ? 26   PHE 2 N   1 
ATOM   484   C  CA  . PHE B  2  26   ? 1.608   75.877  14.769  1.00 109.66 ? 26   PHE 2 CA  1 
ATOM   485   C  C   . PHE B  2  26   ? 3.090   75.767  15.072  1.00 111.70 ? 26   PHE 2 C   1 
ATOM   486   O  O   . PHE B  2  26   ? 3.529   76.023  16.193  1.00 117.93 ? 26   PHE 2 O   1 
ATOM   487   C  CB  . PHE B  2  26   ? 1.126   74.611  14.069  1.00 109.35 ? 26   PHE 2 CB  1 
ATOM   488   C  CG  . PHE B  2  26   ? -0.363  74.485  14.008  1.00 107.25 ? 26   PHE 2 CG  1 
ATOM   489   C  CD1 . PHE B  2  26   ? -1.064  73.927  15.057  1.00 99.29  ? 26   PHE 2 CD1 1 
ATOM   490   C  CD2 . PHE B  2  26   ? -1.055  74.923  12.906  1.00 105.03 ? 26   PHE 2 CD2 1 
ATOM   491   C  CE1 . PHE B  2  26   ? -2.412  73.807  15.005  1.00 101.05 ? 26   PHE 2 CE1 1 
ATOM   492   C  CE2 . PHE B  2  26   ? -2.407  74.804  12.850  1.00 102.01 ? 26   PHE 2 CE2 1 
ATOM   493   C  CZ  . PHE B  2  26   ? -3.089  74.250  13.904  1.00 111.29 ? 26   PHE 2 CZ  1 
ATOM   494   N  N   . PHE B  2  27   ? 3.845   75.370  14.055  1.00 107.43 ? 27   PHE 2 N   1 
ATOM   495   C  CA  . PHE B  2  27   ? 5.299   75.402  14.083  1.00 104.43 ? 27   PHE 2 CA  1 
ATOM   496   C  C   . PHE B  2  27   ? 5.793   75.187  12.665  1.00 102.18 ? 27   PHE 2 C   1 
ATOM   497   O  O   . PHE B  2  27   ? 4.989   75.030  11.751  1.00 108.94 ? 27   PHE 2 O   1 
ATOM   498   C  CB  . PHE B  2  27   ? 5.871   74.354  15.039  1.00 102.89 ? 27   PHE 2 CB  1 
ATOM   499   C  CG  . PHE B  2  27   ? 5.221   73.002  14.934  1.00 102.37 ? 27   PHE 2 CG  1 
ATOM   500   C  CD1 . PHE B  2  27   ? 5.531   72.139  13.884  1.00 101.94 ? 27   PHE 2 CD1 1 
ATOM   501   C  CD2 . PHE B  2  27   ? 4.332   72.571  15.907  1.00 103.13 ? 27   PHE 2 CD2 1 
ATOM   502   C  CE1 . PHE B  2  27   ? 4.949   70.881  13.791  1.00 93.69  ? 27   PHE 2 CE1 1 
ATOM   503   C  CE2 . PHE B  2  27   ? 3.750   71.301  15.819  1.00 107.02 ? 27   PHE 2 CE2 1 
ATOM   504   C  CZ  . PHE B  2  27   ? 4.061   70.460  14.757  1.00 102.62 ? 27   PHE 2 CZ  1 
ATOM   505   N  N   . LYS B  2  28   ? 7.105   75.180  12.470  1.00 96.10  ? 28   LYS 2 N   1 
ATOM   506   C  CA  . LYS B  2  28   ? 7.656   75.012  11.124  1.00 97.23  ? 28   LYS 2 CA  1 
ATOM   507   C  C   . LYS B  2  28   ? 7.517   73.576  10.599  1.00 99.29  ? 28   LYS 2 C   1 
ATOM   508   O  O   . LYS B  2  28   ? 7.745   72.603  11.323  1.00 98.21  ? 28   LYS 2 O   1 
ATOM   509   C  CB  . LYS B  2  28   ? 9.118   75.476  11.057  1.00 89.94  ? 28   LYS 2 CB  1 
ATOM   510   C  CG  . LYS B  2  28   ? 9.316   76.971  11.301  1.00 94.31  ? 28   LYS 2 CG  1 
ATOM   511   C  CD  . LYS B  2  28   ? 10.787  77.354  11.356  1.00 89.52  ? 28   LYS 2 CD  1 
ATOM   512   C  CE  . LYS B  2  28   ? 10.996  78.761  11.903  1.00 96.27  ? 28   LYS 2 CE  1 
ATOM   513   N  NZ  . LYS B  2  28   ? 10.598  79.824  10.939  1.00 102.72 ? 28   LYS 2 NZ  1 
ATOM   514   N  N   . GLY B  2  29   ? 7.136   73.461  9.331   1.00 93.51  ? 29   GLY 2 N   1 
ATOM   515   C  CA  . GLY B  2  29   ? 6.976   72.175  8.691   1.00 99.84  ? 29   GLY 2 CA  1 
ATOM   516   C  C   . GLY B  2  29   ? 5.747   71.437  9.173   1.00 104.50 ? 29   GLY 2 C   1 
ATOM   517   O  O   . GLY B  2  29   ? 5.607   70.231  8.944   1.00 109.84 ? 29   GLY 2 O   1 
ATOM   518   N  N   . PHE B  2  30   ? 4.857   72.163  9.841   1.00 105.10 ? 30   PHE 2 N   1 
ATOM   519   C  CA  . PHE B  2  30   ? 3.617   71.588  10.345  1.00 108.35 ? 30   PHE 2 CA  1 
ATOM   520   C  C   . PHE B  2  30   ? 2.738   71.055  9.216   1.00 112.57 ? 30   PHE 2 C   1 
ATOM   521   O  O   . PHE B  2  30   ? 2.558   71.717  8.194   1.00 117.66 ? 30   PHE 2 O   1 
ATOM   522   C  CB  . PHE B  2  30   ? 2.829   72.619  11.165  1.00 101.17 ? 30   PHE 2 CB  1 
ATOM   523   C  CG  . PHE B  2  30   ? 1.418   72.197  11.457  1.00 102.19 ? 30   PHE 2 CG  1 
ATOM   524   C  CD1 . PHE B  2  30   ? 1.143   71.321  12.493  1.00 102.03 ? 30   PHE 2 CD1 1 
ATOM   525   C  CD2 . PHE B  2  30   ? 0.366   72.660  10.685  1.00 105.48 ? 30   PHE 2 CD2 1 
ATOM   526   C  CE1 . PHE B  2  30   ? -0.158  70.914  12.755  1.00 103.29 ? 30   PHE 2 CE1 1 
ATOM   527   C  CE2 . PHE B  2  30   ? -0.937  72.255  10.942  1.00 106.80 ? 30   PHE 2 CE2 1 
ATOM   528   C  CZ  . PHE B  2  30   ? -1.198  71.384  11.981  1.00 105.72 ? 30   PHE 2 CZ  1 
ATOM   529   N  N   . ARG B  2  31   ? 2.206   69.851  9.409   1.00 110.36 ? 31   ARG 2 N   1 
ATOM   530   C  CA  . ARG B  2  31   ? 1.118   69.345  8.575   1.00 117.87 ? 31   ARG 2 CA  1 
ATOM   531   C  C   . ARG B  2  31   ? 0.200   68.436  9.376   1.00 122.45 ? 31   ARG 2 C   1 
ATOM   532   O  O   . ARG B  2  31   ? 0.512   68.026  10.498  1.00 124.35 ? 31   ARG 2 O   1 
ATOM   533   C  CB  . ARG B  2  31   ? 1.624   68.628  7.322   1.00 117.96 ? 31   ARG 2 CB  1 
ATOM   534   C  CG  . ARG B  2  31   ? 2.973   67.991  7.489   1.00 122.56 ? 31   ARG 2 CG  1 
ATOM   535   C  CD  . ARG B  2  31   ? 3.957   68.552  6.472   1.00 131.11 ? 31   ARG 2 CD  1 
ATOM   536   N  NE  . ARG B  2  31   ? 3.807   67.924  5.161   1.00 139.59 ? 31   ARG 2 NE  1 
ATOM   537   C  CZ  . ARG B  2  31   ? 4.623   68.131  4.129   1.00 137.26 ? 31   ARG 2 CZ  1 
ATOM   538   N  NH1 . ARG B  2  31   ? 5.655   68.965  4.242   1.00 130.82 ? 31   ARG 2 NH1 1 
ATOM   539   N  NH2 . ARG B  2  31   ? 4.399   67.504  2.980   1.00 137.57 ? 31   ARG 2 NH2 1 
ATOM   540   N  N   . ALA B  2  32   ? -0.955  68.151  8.800   1.00 120.79 ? 32   ALA 2 N   1 
ATOM   541   C  CA  . ALA B  2  32   ? -1.913  67.292  9.451   1.00 120.63 ? 32   ALA 2 CA  1 
ATOM   542   C  C   . ALA B  2  32   ? -2.327  66.299  8.408   1.00 123.86 ? 32   ALA 2 C   1 
ATOM   543   O  O   . ALA B  2  32   ? -2.297  66.610  7.217   1.00 122.66 ? 32   ALA 2 O   1 
ATOM   544   C  CB  . ALA B  2  32   ? -3.108  68.085  9.929   1.00 120.68 ? 32   ALA 2 CB  1 
ATOM   545   N  N   . PRO B  2  33   ? -2.685  65.089  8.851   1.00 127.04 ? 33   PRO 2 N   1 
ATOM   546   C  CA  . PRO B  2  33   ? -3.210  64.015  8.004   1.00 130.35 ? 33   PRO 2 CA  1 
ATOM   547   C  C   . PRO B  2  33   ? -4.299  64.509  7.040   1.00 135.56 ? 33   PRO 2 C   1 
ATOM   548   O  O   . PRO B  2  33   ? -4.958  65.512  7.323   1.00 133.03 ? 33   PRO 2 O   1 
ATOM   549   C  CB  . PRO B  2  33   ? -3.798  63.024  9.022   1.00 129.46 ? 33   PRO 2 CB  1 
ATOM   550   C  CG  . PRO B  2  33   ? -3.480  63.587  10.405  1.00 125.82 ? 33   PRO 2 CG  1 
ATOM   551   C  CD  . PRO B  2  33   ? -2.448  64.633  10.229  1.00 123.78 ? 33   PRO 2 CD  1 
ATOM   552   N  N   . SER B  2  34   ? -4.472  63.802  5.923   1.00 140.28 ? 34   SER 2 N   1 
ATOM   553   C  CA  . SER B  2  34   ? -5.386  64.199  4.844   1.00 138.20 ? 34   SER 2 CA  1 
ATOM   554   C  C   . SER B  2  34   ? -6.789  64.562  5.323   1.00 138.39 ? 34   SER 2 C   1 
ATOM   555   O  O   . SER B  2  34   ? -7.317  65.625  4.985   1.00 133.95 ? 34   SER 2 O   1 
ATOM   556   C  CB  . SER B  2  34   ? -5.488  63.079  3.799   1.00 137.11 ? 34   SER 2 CB  1 
ATOM   557   O  OG  . SER B  2  34   ? -4.209  62.718  3.294   1.00 138.48 ? 34   SER 2 OG  1 
ATOM   558   N  N   . ASP B  2  35   ? -7.379  63.666  6.110   1.00 143.99 ? 35   ASP 2 N   1 
ATOM   559   C  CA  . ASP B  2  35   ? -8.756  63.807  6.590   1.00 141.88 ? 35   ASP 2 CA  1 
ATOM   560   C  C   . ASP B  2  35   ? -9.013  65.070  7.429   1.00 132.86 ? 35   ASP 2 C   1 
ATOM   561   O  O   . ASP B  2  35   ? -9.997  65.773  7.201   1.00 130.91 ? 35   ASP 2 O   1 
ATOM   562   C  CB  . ASP B  2  35   ? -9.181  62.542  7.358   1.00 142.06 ? 35   ASP 2 CB  1 
ATOM   563   C  CG  . ASP B  2  35   ? -8.121  62.070  8.358   1.00 139.98 ? 35   ASP 2 CG  1 
ATOM   564   O  OD1 . ASP B  2  35   ? -7.059  61.565  7.916   1.00 134.57 ? 35   ASP 2 OD1 1 
ATOM   565   O  OD2 . ASP B  2  35   ? -8.354  62.191  9.583   1.00 138.46 ? 35   ASP 2 OD2 1 
ATOM   566   N  N   . THR B  2  36   ? -8.112  65.344  8.375   1.00 129.24 ? 36   THR 2 N   1 
ATOM   567   C  CA  . THR B  2  36   ? -8.232  66.430  9.365   1.00 127.69 ? 36   THR 2 CA  1 
ATOM   568   C  C   . THR B  2  36   ? -9.042  67.660  8.945   1.00 129.23 ? 36   THR 2 C   1 
ATOM   569   O  O   . THR B  2  36   ? -8.850  68.214  7.862   1.00 130.46 ? 36   THR 2 O   1 
ATOM   570   C  CB  . THR B  2  36   ? -6.844  66.911  9.849   1.00 120.16 ? 36   THR 2 CB  1 
ATOM   571   O  OG1 . THR B  2  36   ? -5.973  65.789  10.020  1.00 123.16 ? 36   THR 2 OG1 1 
ATOM   572   C  CG2 . THR B  2  36   ? -6.971  67.627  11.167  1.00 115.69 ? 36   THR 2 CG2 1 
ATOM   573   N  N   . THR B  2  37   ? -9.943  68.080  9.826   1.00 126.94 ? 37   THR 2 N   1 
ATOM   574   C  CA  . THR B  2  37   ? -10.868 69.158  9.523   1.00 128.20 ? 37   THR 2 CA  1 
ATOM   575   C  C   . THR B  2  37   ? -11.095 70.060  10.743  1.00 129.25 ? 37   THR 2 C   1 
ATOM   576   O  O   . THR B  2  37   ? -11.195 69.579  11.872  1.00 129.75 ? 37   THR 2 O   1 
ATOM   577   C  CB  . THR B  2  37   ? -12.199 68.592  9.019   1.00 131.50 ? 37   THR 2 CB  1 
ATOM   578   O  OG1 . THR B  2  37   ? -13.185 69.626  9.044   1.00 141.85 ? 37   THR 2 OG1 1 
ATOM   579   C  CG2 . THR B  2  37   ? -12.656 67.436  9.898   1.00 126.02 ? 37   THR 2 CG2 1 
ATOM   580   N  N   . PHE B  2  38   ? -11.183 71.367  10.504  1.00 129.35 ? 38   PHE 2 N   1 
ATOM   581   C  CA  . PHE B  2  38   ? -11.108 72.357  11.579  1.00 129.34 ? 38   PHE 2 CA  1 
ATOM   582   C  C   . PHE B  2  38   ? -12.366 73.192  11.709  1.00 135.82 ? 38   PHE 2 C   1 
ATOM   583   O  O   . PHE B  2  38   ? -12.786 73.832  10.749  1.00 136.57 ? 38   PHE 2 O   1 
ATOM   584   C  CB  . PHE B  2  38   ? -9.926  73.299  11.340  1.00 125.73 ? 38   PHE 2 CB  1 
ATOM   585   C  CG  . PHE B  2  38   ? -8.597  72.608  11.333  1.00 125.96 ? 38   PHE 2 CG  1 
ATOM   586   C  CD1 . PHE B  2  38   ? -7.894  72.421  12.511  1.00 120.97 ? 38   PHE 2 CD1 1 
ATOM   587   C  CD2 . PHE B  2  38   ? -8.052  72.137  10.148  1.00 125.94 ? 38   PHE 2 CD2 1 
ATOM   588   C  CE1 . PHE B  2  38   ? -6.683  71.777  12.506  1.00 117.08 ? 38   PHE 2 CE1 1 
ATOM   589   C  CE2 . PHE B  2  38   ? -6.829  71.493  10.138  1.00 120.26 ? 38   PHE 2 CE2 1 
ATOM   590   C  CZ  . PHE B  2  38   ? -6.148  71.310  11.317  1.00 116.05 ? 38   PHE 2 CZ  1 
ATOM   591   N  N   . ASP B  2  39   ? -12.947 73.203  12.906  1.00 141.80 ? 39   ASP 2 N   1 
ATOM   592   C  CA  . ASP B  2  39   ? -14.147 73.999  13.187  1.00 145.46 ? 39   ASP 2 CA  1 
ATOM   593   C  C   . ASP B  2  39   ? -13.782 75.363  13.768  1.00 144.65 ? 39   ASP 2 C   1 
ATOM   594   O  O   . ASP B  2  39   ? -13.112 75.451  14.797  1.00 147.85 ? 39   ASP 2 O   1 
ATOM   595   C  CB  . ASP B  2  39   ? -15.081 73.264  14.156  1.00 150.89 ? 39   ASP 2 CB  1 
ATOM   596   C  CG  . ASP B  2  39   ? -15.623 71.964  13.583  1.00 160.77 ? 39   ASP 2 CG  1 
ATOM   597   O  OD1 . ASP B  2  39   ? -16.123 71.967  12.435  1.00 167.18 ? 39   ASP 2 OD1 1 
ATOM   598   O  OD2 . ASP B  2  39   ? -15.548 70.934  14.286  1.00 161.87 ? 39   ASP 2 OD2 1 
ATOM   599   N  N   . LEU B  2  40   ? -14.238 76.423  13.106  1.00 141.11 ? 40   LEU 2 N   1 
ATOM   600   C  CA  . LEU B  2  40   ? -13.940 77.796  13.514  1.00 136.67 ? 40   LEU 2 CA  1 
ATOM   601   C  C   . LEU B  2  40   ? -15.105 78.410  14.298  1.00 140.02 ? 40   LEU 2 C   1 
ATOM   602   O  O   . LEU B  2  40   ? -16.267 78.139  14.001  1.00 144.35 ? 40   LEU 2 O   1 
ATOM   603   C  CB  . LEU B  2  40   ? -13.629 78.641  12.277  1.00 131.14 ? 40   LEU 2 CB  1 
ATOM   604   C  CG  . LEU B  2  40   ? -13.156 80.081  12.475  1.00 125.85 ? 40   LEU 2 CG  1 
ATOM   605   C  CD1 . LEU B  2  40   ? -11.823 80.109  13.205  1.00 124.19 ? 40   LEU 2 CD1 1 
ATOM   606   C  CD2 . LEU B  2  40   ? -13.051 80.784  11.135  1.00 124.06 ? 40   LEU 2 CD2 1 
ATOM   607   N  N   . TYR B  2  41   ? -14.794 79.235  15.295  1.00 138.78 ? 41   TYR 2 N   1 
ATOM   608   C  CA  . TYR B  2  41   ? -15.819 79.816  16.159  1.00 142.53 ? 41   TYR 2 CA  1 
ATOM   609   C  C   . TYR B  2  41   ? -15.584 81.315  16.341  1.00 145.95 ? 41   TYR 2 C   1 
ATOM   610   O  O   . TYR B  2  41   ? -14.435 81.756  16.371  1.00 145.57 ? 41   TYR 2 O   1 
ATOM   611   C  CB  . TYR B  2  41   ? -15.823 79.109  17.515  1.00 144.05 ? 41   TYR 2 CB  1 
ATOM   612   C  CG  . TYR B  2  41   ? -16.136 77.630  17.434  1.00 149.33 ? 41   TYR 2 CG  1 
ATOM   613   C  CD1 . TYR B  2  41   ? -15.139 76.700  17.178  1.00 151.76 ? 41   TYR 2 CD1 1 
ATOM   614   C  CD2 . TYR B  2  41   ? -17.428 77.165  17.618  1.00 155.91 ? 41   TYR 2 CD2 1 
ATOM   615   C  CE1 . TYR B  2  41   ? -15.423 75.346  17.102  1.00 156.11 ? 41   TYR 2 CE1 1 
ATOM   616   C  CE2 . TYR B  2  41   ? -17.722 75.815  17.545  1.00 161.19 ? 41   TYR 2 CE2 1 
ATOM   617   C  CZ  . TYR B  2  41   ? -16.719 74.911  17.289  1.00 161.83 ? 41   TYR 2 CZ  1 
ATOM   618   O  OH  . TYR B  2  41   ? -17.021 73.569  17.214  1.00 167.51 ? 41   TYR 2 OH  1 
ATOM   619   N  N   . LYS B  2  42   ? -16.665 82.090  16.478  1.00 149.12 ? 42   LYS 2 N   1 
ATOM   620   C  CA  . LYS B  2  42   ? -16.573 83.559  16.485  1.00 145.57 ? 42   LYS 2 CA  1 
ATOM   621   C  C   . LYS B  2  42   ? -17.487 84.269  17.492  1.00 147.40 ? 42   LYS 2 C   1 
ATOM   622   O  O   . LYS B  2  42   ? -18.678 83.973  17.583  1.00 153.29 ? 42   LYS 2 O   1 
ATOM   623   C  CB  . LYS B  2  42   ? -16.835 84.104  15.076  1.00 143.52 ? 42   LYS 2 CB  1 
ATOM   624   C  CG  . LYS B  2  42   ? -16.883 85.621  14.976  1.00 141.73 ? 42   LYS 2 CG  1 
ATOM   625   C  CD  . LYS B  2  42   ? -17.095 86.066  13.535  1.00 144.65 ? 42   LYS 2 CD  1 
ATOM   626   C  CE  . LYS B  2  42   ? -17.046 87.580  13.413  1.00 148.29 ? 42   LYS 2 CE  1 
ATOM   627   N  NZ  . LYS B  2  42   ? -16.985 88.033  11.993  1.00 150.98 ? 42   LYS 2 NZ  1 
ATOM   628   N  N   . LYS B  2  43   ? -16.916 85.224  18.225  1.00 145.97 ? 43   LYS 2 N   1 
ATOM   629   C  CA  . LYS B  2  43   ? -17.643 86.013  19.222  1.00 144.82 ? 43   LYS 2 CA  1 
ATOM   630   C  C   . LYS B  2  43   ? -17.603 87.500  18.887  1.00 139.88 ? 43   LYS 2 C   1 
ATOM   631   O  O   . LYS B  2  43   ? -16.553 88.031  18.529  1.00 137.00 ? 43   LYS 2 O   1 
ATOM   632   C  CB  . LYS B  2  43   ? -17.035 85.793  20.606  1.00 147.02 ? 43   LYS 2 CB  1 
ATOM   633   C  CG  . LYS B  2  43   ? -17.658 86.630  21.702  1.00 152.78 ? 43   LYS 2 CG  1 
ATOM   634   C  CD  . LYS B  2  43   ? -16.910 86.446  23.010  1.00 155.34 ? 43   LYS 2 CD  1 
ATOM   635   C  CE  . LYS B  2  43   ? -17.719 86.973  24.181  1.00 162.68 ? 43   LYS 2 CE  1 
ATOM   636   N  NZ  . LYS B  2  43   ? -16.959 86.864  25.457  1.00 166.87 ? 43   LYS 2 NZ  1 
ATOM   637   N  N   . ASP B  2  49   ? -13.381 91.425  16.635  1.00 148.96 ? 49   ASP 2 N   1 
ATOM   638   C  CA  . ASP B  2  49   ? -13.834 90.052  16.425  1.00 154.50 ? 49   ASP 2 CA  1 
ATOM   639   C  C   . ASP B  2  49   ? -12.837 89.022  16.951  1.00 150.51 ? 49   ASP 2 C   1 
ATOM   640   O  O   . ASP B  2  49   ? -11.706 88.942  16.472  1.00 146.31 ? 49   ASP 2 O   1 
ATOM   641   C  CB  . ASP B  2  49   ? -14.113 89.791  14.942  1.00 162.30 ? 49   ASP 2 CB  1 
ATOM   642   C  CG  . ASP B  2  49   ? -15.436 90.375  14.486  1.00 172.87 ? 49   ASP 2 CG  1 
ATOM   643   O  OD1 . ASP B  2  49   ? -16.333 90.559  15.339  1.00 181.67 ? 49   ASP 2 OD1 1 
ATOM   644   O  OD2 . ASP B  2  49   ? -15.586 90.641  13.275  1.00 172.69 ? 49   ASP 2 OD2 1 
ATOM   645   N  N   . GLU B  2  50   ? -13.269 88.233  17.931  1.00 149.90 ? 50   GLU 2 N   1 
ATOM   646   C  CA  . GLU B  2  50   ? -12.446 87.159  18.487  1.00 144.79 ? 50   GLU 2 CA  1 
ATOM   647   C  C   . GLU B  2  50   ? -12.753 85.823  17.812  1.00 140.03 ? 50   GLU 2 C   1 
ATOM   648   O  O   . GLU B  2  50   ? -13.889 85.560  17.427  1.00 143.46 ? 50   GLU 2 O   1 
ATOM   649   C  CB  . GLU B  2  50   ? -12.654 87.047  20.001  1.00 146.60 ? 50   GLU 2 CB  1 
ATOM   650   C  CG  . GLU B  2  50   ? -12.269 88.301  20.781  1.00 148.22 ? 50   GLU 2 CG  1 
ATOM   651   C  CD  . GLU B  2  50   ? -11.830 87.998  22.204  1.00 148.01 ? 50   GLU 2 CD  1 
ATOM   652   O  OE1 . GLU B  2  50   ? -12.625 87.411  22.967  1.00 146.46 ? 50   GLU 2 OE1 1 
ATOM   653   O  OE2 . GLU B  2  50   ? -10.685 88.350  22.559  1.00 150.16 ? 50   GLU 2 OE2 1 
ATOM   654   N  N   . PHE B  2  51   ? -11.738 84.979  17.667  1.00 133.39 ? 51   PHE 2 N   1 
ATOM   655   C  CA  . PHE B  2  51   ? -11.921 83.673  17.035  1.00 130.88 ? 51   PHE 2 CA  1 
ATOM   656   C  C   . PHE B  2  51   ? -11.312 82.544  17.857  1.00 127.19 ? 51   PHE 2 C   1 
ATOM   657   O  O   . PHE B  2  51   ? -10.292 82.718  18.524  1.00 120.75 ? 51   PHE 2 O   1 
ATOM   658   C  CB  . PHE B  2  51   ? -11.304 83.649  15.633  1.00 130.73 ? 51   PHE 2 CB  1 
ATOM   659   C  CG  . PHE B  2  51   ? -12.106 84.376  14.597  1.00 135.28 ? 51   PHE 2 CG  1 
ATOM   660   C  CD1 . PHE B  2  51   ? -11.950 85.741  14.406  1.00 140.77 ? 51   PHE 2 CD1 1 
ATOM   661   C  CD2 . PHE B  2  51   ? -13.009 83.692  13.801  1.00 136.95 ? 51   PHE 2 CD2 1 
ATOM   662   C  CE1 . PHE B  2  51   ? -12.689 86.408  13.442  1.00 144.12 ? 51   PHE 2 CE1 1 
ATOM   663   C  CE2 . PHE B  2  51   ? -13.753 84.355  12.838  1.00 139.45 ? 51   PHE 2 CE2 1 
ATOM   664   C  CZ  . PHE B  2  51   ? -13.593 85.712  12.658  1.00 142.00 ? 51   PHE 2 CZ  1 
ATOM   665   N  N   . VAL B  2  52   ? -11.937 81.377  17.796  1.00 129.69 ? 52   VAL 2 N   1 
ATOM   666   C  CA  . VAL B  2  52   ? -11.376 80.188  18.425  1.00 129.04 ? 52   VAL 2 CA  1 
ATOM   667   C  C   . VAL B  2  52   ? -11.410 79.014  17.448  1.00 134.84 ? 52   VAL 2 C   1 
ATOM   668   O  O   . VAL B  2  52   ? -12.386 78.828  16.719  1.00 142.24 ? 52   VAL 2 O   1 
ATOM   669   C  CB  . VAL B  2  52   ? -12.094 79.852  19.755  1.00 120.36 ? 52   VAL 2 CB  1 
ATOM   670   C  CG1 . VAL B  2  52   ? -12.171 78.357  19.981  1.00 118.97 ? 52   VAL 2 CG1 1 
ATOM   671   C  CG2 . VAL B  2  52   ? -11.381 80.520  20.906  1.00 112.32 ? 52   VAL 2 CG2 1 
ATOM   672   N  N   . LEU B  2  53   ? -10.327 78.244  17.425  1.00 130.42 ? 53   LEU 2 N   1 
ATOM   673   C  CA  . LEU B  2  53   ? -10.191 77.122  16.504  1.00 130.67 ? 53   LEU 2 CA  1 
ATOM   674   C  C   . LEU B  2  53   ? -10.183 75.785  17.234  1.00 129.70 ? 53   LEU 2 C   1 
ATOM   675   O  O   . LEU B  2  53   ? -9.510  75.621  18.257  1.00 128.78 ? 53   LEU 2 O   1 
ATOM   676   C  CB  . LEU B  2  53   ? -8.897  77.252  15.694  1.00 127.55 ? 53   LEU 2 CB  1 
ATOM   677   C  CG  . LEU B  2  53   ? -8.621  76.071  14.770  1.00 119.75 ? 53   LEU 2 CG  1 
ATOM   678   C  CD1 . LEU B  2  53   ? -9.719  76.013  13.735  1.00 127.98 ? 53   LEU 2 CD1 1 
ATOM   679   C  CD2 . LEU B  2  53   ? -7.272  76.173  14.114  1.00 110.16 ? 53   LEU 2 CD2 1 
ATOM   680   N  N   . HIS B  2  54   ? -10.927 74.827  16.697  1.00 129.74 ? 54   HIS 2 N   1 
ATOM   681   C  CA  . HIS B  2  54   ? -10.907 73.468  17.225  1.00 130.51 ? 54   HIS 2 CA  1 
ATOM   682   C  C   . HIS B  2  54   ? -10.960 72.443  16.094  1.00 127.07 ? 54   HIS 2 C   1 
ATOM   683   O  O   . HIS B  2  54   ? -11.916 72.376  15.323  1.00 119.93 ? 54   HIS 2 O   1 
ATOM   684   C  CB  . HIS B  2  54   ? -12.046 73.246  18.224  1.00 137.18 ? 54   HIS 2 CB  1 
ATOM   685   C  CG  . HIS B  2  54   ? -11.868 72.034  19.085  1.00 134.74 ? 54   HIS 2 CG  1 
ATOM   686   N  ND1 . HIS B  2  54   ? -11.416 70.828  18.590  1.00 125.54 ? 54   HIS 2 ND1 1 
ATOM   687   C  CD2 . HIS B  2  54   ? -12.084 71.841  20.408  1.00 137.56 ? 54   HIS 2 CD2 1 
ATOM   688   C  CE1 . HIS B  2  54   ? -11.359 69.946  19.571  1.00 127.39 ? 54   HIS 2 CE1 1 
ATOM   689   N  NE2 . HIS B  2  54   ? -11.757 70.536  20.684  1.00 136.60 ? 54   HIS 2 NE2 1 
ATOM   690   N  N   . GLY B  2  55   ? -9.899  71.654  16.003  1.00 134.57 ? 55   GLY 2 N   1 
ATOM   691   C  CA  . GLY B  2  55   ? -9.787  70.626  14.991  1.00 139.25 ? 55   GLY 2 CA  1 
ATOM   692   C  C   . GLY B  2  55   ? -9.690  69.262  15.636  1.00 140.99 ? 55   GLY 2 C   1 
ATOM   693   O  O   . GLY B  2  55   ? -9.309  69.125  16.798  1.00 142.51 ? 55   GLY 2 O   1 
ATOM   694   N  N   . GLU B  2  56   ? -10.031 68.241  14.870  1.00 143.26 ? 56   GLU 2 N   1 
ATOM   695   C  CA  . GLU B  2  56   ? -10.137 66.911  15.419  1.00 147.92 ? 56   GLU 2 CA  1 
ATOM   696   C  C   . GLU B  2  56   ? -9.788  65.903  14.348  1.00 143.91 ? 56   GLU 2 C   1 
ATOM   697   O  O   . GLU B  2  56   ? -10.335 65.948  13.248  1.00 147.95 ? 56   GLU 2 O   1 
ATOM   698   C  CB  . GLU B  2  56   ? -11.574 66.680  15.897  1.00 160.07 ? 56   GLU 2 CB  1 
ATOM   699   C  CG  . GLU B  2  56   ? -11.841 65.308  16.487  1.00 169.59 ? 56   GLU 2 CG  1 
ATOM   700   C  CD  . GLU B  2  56   ? -11.443 65.210  17.946  1.00 174.02 ? 56   GLU 2 CD  1 
ATOM   701   O  OE1 . GLU B  2  56   ? -10.677 66.077  18.416  1.00 175.91 ? 56   GLU 2 OE1 1 
ATOM   702   O  OE2 . GLU B  2  56   ? -11.900 64.266  18.624  1.00 175.09 ? 56   GLU 2 OE2 1 
ATOM   703   N  N   . ASN B  2  57   ? -8.853  65.012  14.654  1.00 135.76 ? 57   ASN 2 N   1 
ATOM   704   C  CA  . ASN B  2  57   ? -8.730  63.786  13.878  1.00 128.25 ? 57   ASN 2 CA  1 
ATOM   705   C  C   . ASN B  2  57   ? -8.621  62.572  14.798  1.00 127.91 ? 57   ASN 2 C   1 
ATOM   706   O  O   . ASN B  2  57   ? -8.849  62.683  16.003  1.00 127.64 ? 57   ASN 2 O   1 
ATOM   707   C  CB  . ASN B  2  57   ? -7.643  63.860  12.792  1.00 125.80 ? 57   ASN 2 CB  1 
ATOM   708   C  CG  . ASN B  2  57   ? -6.227  63.846  13.348  1.00 129.22 ? 57   ASN 2 CG  1 
ATOM   709   O  OD1 . ASN B  2  57   ? -5.884  63.032  14.207  1.00 131.29 ? 57   ASN 2 OD1 1 
ATOM   710   N  ND2 . ASN B  2  57   ? -5.386  64.743  12.836  1.00 125.95 ? 57   ASN 2 ND2 1 
ATOM   711   N  N   . GLU B  2  58   ? -8.297  61.419  14.232  1.00 134.42 ? 58   GLU 2 N   1 
ATOM   712   C  CA  . GLU B  2  58   ? -8.411  60.161  14.963  1.00 140.70 ? 58   GLU 2 CA  1 
ATOM   713   C  C   . GLU B  2  58   ? -7.573  60.098  16.251  1.00 142.37 ? 58   GLU 2 C   1 
ATOM   714   O  O   . GLU B  2  58   ? -8.045  59.609  17.277  1.00 147.18 ? 58   GLU 2 O   1 
ATOM   715   C  CB  . GLU B  2  58   ? -8.077  58.995  14.041  1.00 144.51 ? 58   GLU 2 CB  1 
ATOM   716   C  CG  . GLU B  2  58   ? -8.413  57.636  14.611  1.00 152.83 ? 58   GLU 2 CG  1 
ATOM   717   C  CD  . GLU B  2  58   ? -7.388  56.578  14.227  1.00 158.46 ? 58   GLU 2 CD  1 
ATOM   718   O  OE1 . GLU B  2  58   ? -6.295  56.943  13.730  1.00 159.08 ? 58   GLU 2 OE1 1 
ATOM   719   O  OE2 . GLU B  2  58   ? -7.674  55.379  14.429  1.00 159.22 ? 58   GLU 2 OE2 1 
ATOM   720   N  N   . ARG B  2  59   ? -6.344  60.603  16.211  1.00 137.63 ? 59   ARG 2 N   1 
ATOM   721   C  CA  . ARG B  2  59   ? -5.479  60.542  17.390  1.00 131.72 ? 59   ARG 2 CA  1 
ATOM   722   C  C   . ARG B  2  59   ? -4.751  61.852  17.715  1.00 127.16 ? 59   ARG 2 C   1 
ATOM   723   O  O   . ARG B  2  59   ? -3.727  61.842  18.400  1.00 121.15 ? 59   ARG 2 O   1 
ATOM   724   C  CB  . ARG B  2  59   ? -4.479  59.395  17.255  1.00 126.19 ? 59   ARG 2 CB  1 
ATOM   725   C  CG  . ARG B  2  59   ? -3.892  59.301  15.870  1.00 123.20 ? 59   ARG 2 CG  1 
ATOM   726   C  CD  . ARG B  2  59   ? -2.851  58.200  15.731  1.00 119.80 ? 59   ARG 2 CD  1 
ATOM   727   N  NE  . ARG B  2  59   ? -2.262  58.270  14.400  1.00 115.46 ? 59   ARG 2 NE  1 
ATOM   728   C  CZ  . ARG B  2  59   ? -1.294  59.118  14.064  1.00 118.38 ? 59   ARG 2 CZ  1 
ATOM   729   N  NH1 . ARG B  2  59   ? -0.787  59.953  14.967  1.00 124.76 ? 59   ARG 2 NH1 1 
ATOM   730   N  NH2 . ARG B  2  59   ? -0.831  59.134  12.825  1.00 115.05 ? 59   ARG 2 NH2 1 
ATOM   731   N  N   . LEU B  2  60   ? -5.287  62.968  17.227  1.00 128.51 ? 60   LEU 2 N   1 
ATOM   732   C  CA  . LEU B  2  60   ? -4.765  64.297  17.550  1.00 128.68 ? 60   LEU 2 CA  1 
ATOM   733   C  C   . LEU B  2  60   ? -5.887  65.318  17.711  1.00 135.55 ? 60   LEU 2 C   1 
ATOM   734   O  O   . LEU B  2  60   ? -6.903  65.258  17.015  1.00 142.90 ? 60   LEU 2 O   1 
ATOM   735   C  CB  . LEU B  2  60   ? -3.831  64.789  16.453  1.00 122.05 ? 60   LEU 2 CB  1 
ATOM   736   C  CG  . LEU B  2  60   ? -2.535  64.021  16.262  1.00 122.24 ? 60   LEU 2 CG  1 
ATOM   737   C  CD1 . LEU B  2  60   ? -1.878  64.488  14.994  1.00 124.96 ? 60   LEU 2 CD1 1 
ATOM   738   C  CD2 . LEU B  2  60   ? -1.623  64.241  17.448  1.00 118.66 ? 60   LEU 2 CD2 1 
ATOM   739   N  N   . GLU B  2  61   ? -5.702  66.256  18.632  1.00 129.63 ? 61   GLU 2 N   1 
ATOM   740   C  CA  . GLU B  2  61   ? -6.591  67.403  18.721  1.00 127.10 ? 61   GLU 2 CA  1 
ATOM   741   C  C   . GLU B  2  61   ? -5.821  68.630  18.278  1.00 120.70 ? 61   GLU 2 C   1 
ATOM   742   O  O   . GLU B  2  61   ? -4.596  68.656  18.342  1.00 118.44 ? 61   GLU 2 O   1 
ATOM   743   C  CB  . GLU B  2  61   ? -7.108  67.603  20.144  1.00 131.60 ? 61   GLU 2 CB  1 
ATOM   744   C  CG  . GLU B  2  61   ? -8.007  66.493  20.654  1.00 137.88 ? 61   GLU 2 CG  1 
ATOM   745   C  CD  . GLU B  2  61   ? -8.627  66.836  21.996  1.00 145.42 ? 61   GLU 2 CD  1 
ATOM   746   O  OE1 . GLU B  2  61   ? -9.332  67.866  22.082  1.00 147.52 ? 61   GLU 2 OE1 1 
ATOM   747   O  OE2 . GLU B  2  61   ? -8.411  66.080  22.967  1.00 147.99 ? 61   GLU 2 OE2 1 
ATOM   748   N  N   . TYR B  2  62   ? -6.543  69.641  17.820  1.00 121.23 ? 62   TYR 2 N   1 
ATOM   749   C  CA  . TYR B  2  62   ? -5.929  70.883  17.389  1.00 123.95 ? 62   TYR 2 CA  1 
ATOM   750   C  C   . TYR B  2  62   ? -6.733  72.035  17.973  1.00 129.29 ? 62   TYR 2 C   1 
ATOM   751   O  O   . TYR B  2  62   ? -7.945  72.085  17.804  1.00 137.68 ? 62   TYR 2 O   1 
ATOM   752   C  CB  . TYR B  2  62   ? -5.920  70.964  15.859  1.00 126.62 ? 62   TYR 2 CB  1 
ATOM   753   C  CG  . TYR B  2  62   ? -5.114  69.872  15.161  1.00 129.37 ? 62   TYR 2 CG  1 
ATOM   754   C  CD1 . TYR B  2  62   ? -5.673  68.627  14.885  1.00 131.66 ? 62   TYR 2 CD1 1 
ATOM   755   C  CD2 . TYR B  2  62   ? -3.804  70.099  14.759  1.00 130.25 ? 62   TYR 2 CD2 1 
ATOM   756   C  CE1 . TYR B  2  62   ? -4.949  67.636  14.246  1.00 132.01 ? 62   TYR 2 CE1 1 
ATOM   757   C  CE2 . TYR B  2  62   ? -3.073  69.117  14.120  1.00 134.61 ? 62   TYR 2 CE2 1 
ATOM   758   C  CZ  . TYR B  2  62   ? -3.650  67.885  13.866  1.00 137.82 ? 62   TYR 2 CZ  1 
ATOM   759   O  OH  . TYR B  2  62   ? -2.917  66.907  13.225  1.00 145.79 ? 62   TYR 2 OH  1 
ATOM   760   N  N   . GLU B  2  63   ? -6.078  72.950  18.679  1.00 127.19 ? 63   GLU 2 N   1 
ATOM   761   C  CA  . GLU B  2  63   ? -6.775  74.124  19.200  1.00 128.46 ? 63   GLU 2 CA  1 
ATOM   762   C  C   . GLU B  2  63   ? -6.041  75.410  18.879  1.00 116.67 ? 63   GLU 2 C   1 
ATOM   763   O  O   . GLU B  2  63   ? -4.830  75.398  18.675  1.00 110.77 ? 63   GLU 2 O   1 
ATOM   764   C  CB  . GLU B  2  63   ? -6.992  74.011  20.704  1.00 138.60 ? 63   GLU 2 CB  1 
ATOM   765   C  CG  . GLU B  2  63   ? -8.235  73.235  21.069  1.00 148.85 ? 63   GLU 2 CG  1 
ATOM   766   C  CD  . GLU B  2  63   ? -7.913  72.018  21.899  1.00 156.50 ? 63   GLU 2 CD  1 
ATOM   767   O  OE1 . GLU B  2  63   ? -6.808  71.985  22.488  1.00 155.99 ? 63   GLU 2 OE1 1 
ATOM   768   O  OE2 . GLU B  2  63   ? -8.758  71.098  21.958  1.00 161.70 ? 63   GLU 2 OE2 1 
ATOM   769   N  N   . GLY B  2  64   ? -6.780  76.517  18.841  1.00 110.54 ? 64   GLY 2 N   1 
ATOM   770   C  CA  . GLY B  2  64   ? -6.204  77.803  18.498  1.00 106.57 ? 64   GLY 2 CA  1 
ATOM   771   C  C   . GLY B  2  64   ? -7.031  78.988  18.947  1.00 107.96 ? 64   GLY 2 C   1 
ATOM   772   O  O   . GLY B  2  64   ? -8.260  78.948  18.907  1.00 108.74 ? 64   GLY 2 O   1 
ATOM   773   N  N   . TYR B  2  65   ? -6.354  80.048  19.381  1.00 109.54 ? 65   TYR 2 N   1 
ATOM   774   C  CA  . TYR B  2  65   ? -7.037  81.277  19.780  1.00 118.90 ? 65   TYR 2 CA  1 
ATOM   775   C  C   . TYR B  2  65   ? -6.447  82.538  19.134  1.00 120.19 ? 65   TYR 2 C   1 
ATOM   776   O  O   . TYR B  2  65   ? -5.313  82.533  18.667  1.00 118.41 ? 65   TYR 2 O   1 
ATOM   777   C  CB  . TYR B  2  65   ? -7.118  81.403  21.310  1.00 123.88 ? 65   TYR 2 CB  1 
ATOM   778   C  CG  . TYR B  2  65   ? -5.800  81.424  22.059  1.00 128.99 ? 65   TYR 2 CG  1 
ATOM   779   C  CD1 . TYR B  2  65   ? -4.592  81.507  21.391  1.00 132.94 ? 65   TYR 2 CD1 1 
ATOM   780   C  CD2 . TYR B  2  65   ? -5.769  81.354  23.447  1.00 132.68 ? 65   TYR 2 CD2 1 
ATOM   781   C  CE1 . TYR B  2  65   ? -3.396  81.528  22.071  1.00 134.48 ? 65   TYR 2 CE1 1 
ATOM   782   C  CE2 . TYR B  2  65   ? -4.565  81.368  24.140  1.00 134.51 ? 65   TYR 2 CE2 1 
ATOM   783   C  CZ  . TYR B  2  65   ? -3.378  81.455  23.436  1.00 136.41 ? 65   TYR 2 CZ  1 
ATOM   784   O  OH  . TYR B  2  65   ? -2.154  81.472  24.072  1.00 139.30 ? 65   TYR 2 OH  1 
ATOM   785   N  N   . THR B  2  66   ? -7.227  83.612  19.087  1.00 122.11 ? 66   THR 2 N   1 
ATOM   786   C  CA  . THR B  2  66   ? -6.707  84.871  18.581  1.00 120.72 ? 66   THR 2 CA  1 
ATOM   787   C  C   . THR B  2  66   ? -6.081  85.610  19.745  1.00 123.34 ? 66   THR 2 C   1 
ATOM   788   O  O   . THR B  2  66   ? -6.644  85.634  20.839  1.00 125.24 ? 66   THR 2 O   1 
ATOM   789   C  CB  . THR B  2  66   ? -7.808  85.740  17.952  1.00 116.84 ? 66   THR 2 CB  1 
ATOM   790   O  OG1 . THR B  2  66   ? -8.986  85.680  18.767  1.00 119.83 ? 66   THR 2 OG1 1 
ATOM   791   C  CG2 . THR B  2  66   ? -8.143  85.255  16.551  1.00 112.42 ? 66   THR 2 CG2 1 
ATOM   792   N  N   . ASP B  2  67   ? -4.913  86.201  19.521  1.00 125.65 ? 67   ASP 2 N   1 
ATOM   793   C  CA  . ASP B  2  67   ? -4.234  86.943  20.584  1.00 132.05 ? 67   ASP 2 CA  1 
ATOM   794   C  C   . ASP B  2  67   ? -4.996  88.213  20.946  1.00 132.52 ? 67   ASP 2 C   1 
ATOM   795   O  O   . ASP B  2  67   ? -5.135  89.120  20.124  1.00 132.22 ? 67   ASP 2 O   1 
ATOM   796   C  CB  . ASP B  2  67   ? -2.796  87.283  20.184  1.00 135.08 ? 67   ASP 2 CB  1 
ATOM   797   C  CG  . ASP B  2  67   ? -2.009  87.914  21.319  1.00 131.99 ? 67   ASP 2 CG  1 
ATOM   798   O  OD1 . ASP B  2  67   ? -2.450  87.791  22.484  1.00 132.43 ? 67   ASP 2 OD1 1 
ATOM   799   O  OD2 . ASP B  2  67   ? -0.949  88.522  21.043  1.00 128.05 ? 67   ASP 2 OD2 1 
ATOM   800   N  N   . SER B  2  68   ? -5.482  88.266  22.181  1.00 133.81 ? 68   SER 2 N   1 
ATOM   801   C  CA  . SER B  2  68   ? -6.292  89.386  22.648  1.00 138.42 ? 68   SER 2 CA  1 
ATOM   802   C  C   . SER B  2  68   ? -5.566  90.727  22.517  1.00 131.60 ? 68   SER 2 C   1 
ATOM   803   O  O   . SER B  2  68   ? -6.195  91.760  22.259  1.00 129.23 ? 68   SER 2 O   1 
ATOM   804   C  CB  . SER B  2  68   ? -6.713  89.163  24.106  1.00 143.20 ? 68   SER 2 CB  1 
ATOM   805   O  OG  . SER B  2  68   ? -5.579  89.031  24.953  1.00 142.55 ? 68   SER 2 OG  1 
ATOM   806   N  N   . SER B  2  69   ? -4.244  90.702  22.680  1.00 121.23 ? 69   SER 2 N   1 
ATOM   807   C  CA  . SER B  2  69   ? -3.458  91.929  22.706  1.00 113.42 ? 69   SER 2 CA  1 
ATOM   808   C  C   . SER B  2  69   ? -3.138  92.491  21.321  1.00 117.99 ? 69   SER 2 C   1 
ATOM   809   O  O   . SER B  2  69   ? -3.195  93.705  21.110  1.00 124.71 ? 69   SER 2 O   1 
ATOM   810   C  CB  . SER B  2  69   ? -2.170  91.717  23.496  1.00 109.57 ? 69   SER 2 CB  1 
ATOM   811   O  OG  . SER B  2  69   ? -1.224  90.978  22.740  1.00 111.32 ? 69   SER 2 OG  1 
ATOM   812   N  N   . SER B  2  70   ? -2.794  91.619  20.379  1.00 119.71 ? 70   SER 2 N   1 
ATOM   813   C  CA  . SER B  2  70   ? -2.392  92.085  19.055  1.00 121.09 ? 70   SER 2 CA  1 
ATOM   814   C  C   . SER B  2  70   ? -3.600  92.518  18.231  1.00 124.36 ? 70   SER 2 C   1 
ATOM   815   O  O   . SER B  2  70   ? -3.524  93.472  17.456  1.00 123.12 ? 70   SER 2 O   1 
ATOM   816   C  CB  . SER B  2  70   ? -1.551  91.031  18.307  1.00 118.23 ? 70   SER 2 CB  1 
ATOM   817   O  OG  . SER B  2  70   ? -2.356  90.053  17.673  1.00 113.17 ? 70   SER 2 OG  1 
ATOM   818   N  N   . GLN B  2  71   ? -4.725  91.834  18.422  1.00 130.71 ? 71   GLN 2 N   1 
ATOM   819   C  CA  . GLN B  2  71   ? -5.930  92.109  17.642  1.00 133.68 ? 71   GLN 2 CA  1 
ATOM   820   C  C   . GLN B  2  71   ? -6.521  93.471  17.956  1.00 129.43 ? 71   GLN 2 C   1 
ATOM   821   O  O   . GLN B  2  71   ? -7.398  93.957  17.242  1.00 130.25 ? 71   GLN 2 O   1 
ATOM   822   C  CB  . GLN B  2  71   ? -6.964  91.001  17.834  1.00 141.52 ? 71   GLN 2 CB  1 
ATOM   823   C  CG  . GLN B  2  71   ? -6.530  89.680  17.211  1.00 150.16 ? 71   GLN 2 CG  1 
ATOM   824   C  CD  . GLN B  2  71   ? -7.594  89.083  16.312  1.00 158.41 ? 71   GLN 2 CD  1 
ATOM   825   O  OE1 . GLN B  2  71   ? -8.788  89.311  16.514  1.00 162.40 ? 71   GLN 2 OE1 1 
ATOM   826   N  NE2 . GLN B  2  71   ? -7.166  88.318  15.307  1.00 159.00 ? 71   GLN 2 NE2 1 
ATOM   827   N  N   . ALA B  2  72   ? -6.019  94.083  19.024  1.00 127.40 ? 72   ALA 2 N   1 
ATOM   828   C  CA  . ALA B  2  72   ? -6.370  95.451  19.373  1.00 126.51 ? 72   ALA 2 CA  1 
ATOM   829   C  C   . ALA B  2  72   ? -5.731  96.463  18.413  1.00 129.52 ? 72   ALA 2 C   1 
ATOM   830   O  O   . ALA B  2  72   ? -6.220  97.587  18.280  1.00 130.26 ? 72   ALA 2 O   1 
ATOM   831   C  CB  . ALA B  2  72   ? -5.961  95.746  20.806  1.00 121.20 ? 72   ALA 2 CB  1 
ATOM   832   N  N   . SER B  2  73   ? -4.646  96.071  17.742  1.00 125.81 ? 73   SER 2 N   1 
ATOM   833   C  CA  . SER B  2  73   ? -3.952  96.995  16.836  1.00 121.47 ? 73   SER 2 CA  1 
ATOM   834   C  C   . SER B  2  73   ? -3.491  96.404  15.494  1.00 118.22 ? 73   SER 2 C   1 
ATOM   835   O  O   . SER B  2  73   ? -2.984  97.128  14.629  1.00 109.99 ? 73   SER 2 O   1 
ATOM   836   C  CB  . SER B  2  73   ? -2.783  97.669  17.556  1.00 119.33 ? 73   SER 2 CB  1 
ATOM   837   O  OG  . SER B  2  73   ? -2.044  96.721  18.300  1.00 116.91 ? 73   SER 2 OG  1 
ATOM   838   N  N   . ASN B  2  74   ? -3.671  95.096  15.320  1.00 125.84 ? 74   ASN 2 N   1 
ATOM   839   C  CA  . ASN B  2  74   ? -3.358  94.441  14.049  1.00 127.31 ? 74   ASN 2 CA  1 
ATOM   840   C  C   . ASN B  2  74   ? -4.573  93.767  13.413  1.00 130.65 ? 74   ASN 2 C   1 
ATOM   841   O  O   . ASN B  2  74   ? -5.294  93.017  14.069  1.00 134.88 ? 74   ASN 2 O   1 
ATOM   842   C  CB  . ASN B  2  74   ? -2.227  93.422  14.211  1.00 124.22 ? 74   ASN 2 CB  1 
ATOM   843   C  CG  . ASN B  2  74   ? -0.860  94.070  14.254  1.00 127.26 ? 74   ASN 2 CG  1 
ATOM   844   O  OD1 . ASN B  2  74   ? -0.736  95.256  14.558  1.00 130.80 ? 74   ASN 2 OD1 1 
ATOM   845   N  ND2 . ASN B  2  74   ? 0.177   93.297  13.947  1.00 127.58 ? 74   ASN 2 ND2 1 
ATOM   846   N  N   . GLN B  2  75   ? -4.792  94.047  12.132  1.00 127.60 ? 75   GLN 2 N   1 
ATOM   847   C  CA  . GLN B  2  75   ? -5.842  93.394  11.359  1.00 125.01 ? 75   GLN 2 CA  1 
ATOM   848   C  C   . GLN B  2  75   ? -5.159  92.569  10.284  1.00 121.54 ? 75   GLN 2 C   1 
ATOM   849   O  O   . GLN B  2  75   ? -4.223  93.044  9.647   1.00 125.94 ? 75   GLN 2 O   1 
ATOM   850   C  CB  . GLN B  2  75   ? -6.747  94.440  10.714  1.00 123.96 ? 75   GLN 2 CB  1 
ATOM   851   C  CG  . GLN B  2  75   ? -8.027  93.890  10.123  1.00 125.55 ? 75   GLN 2 CG  1 
ATOM   852   C  CD  . GLN B  2  75   ? -8.925  94.991  9.596   1.00 131.56 ? 75   GLN 2 CD  1 
ATOM   853   O  OE1 . GLN B  2  75   ? -8.493  96.136  9.459   1.00 135.37 ? 75   GLN 2 OE1 1 
ATOM   854   N  NE2 . GLN B  2  75   ? -10.177 94.652  9.285   1.00 131.72 ? 75   GLN 2 NE2 1 
ATOM   855   N  N   . TYR B  2  76   ? -5.598  91.334  10.081  1.00 115.01 ? 76   TYR 2 N   1 
ATOM   856   C  CA  . TYR B  2  76   ? -4.914  90.488  9.114   1.00 115.90 ? 76   TYR 2 CA  1 
ATOM   857   C  C   . TYR B  2  76   ? -5.784  90.088  7.913   1.00 124.16 ? 76   TYR 2 C   1 
ATOM   858   O  O   . TYR B  2  76   ? -6.995  89.891  8.037   1.00 127.47 ? 76   TYR 2 O   1 
ATOM   859   C  CB  . TYR B  2  76   ? -4.268  89.287  9.809   1.00 112.82 ? 76   TYR 2 CB  1 
ATOM   860   C  CG  . TYR B  2  76   ? -2.951  89.618  10.496  1.00 113.64 ? 76   TYR 2 CG  1 
ATOM   861   C  CD1 . TYR B  2  76   ? -1.755  89.595  9.794   1.00 103.53 ? 76   TYR 2 CD1 1 
ATOM   862   C  CD2 . TYR B  2  76   ? -2.905  89.958  11.849  1.00 112.99 ? 76   TYR 2 CD2 1 
ATOM   863   C  CE1 . TYR B  2  76   ? -0.552  89.900  10.417  1.00 101.55 ? 76   TYR 2 CE1 1 
ATOM   864   C  CE2 . TYR B  2  76   ? -1.693  90.265  12.486  1.00 106.51 ? 76   TYR 2 CE2 1 
ATOM   865   C  CZ  . TYR B  2  76   ? -0.522  90.236  11.762  1.00 105.37 ? 76   TYR 2 CZ  1 
ATOM   866   O  OH  . TYR B  2  76   ? 0.682   90.533  12.370  1.00 102.37 ? 76   TYR 2 OH  1 
ATOM   867   N  N   . VAL B  2  77   ? -5.148  89.993  6.748   1.00 124.32 ? 77   VAL 2 N   1 
ATOM   868   C  CA  . VAL B  2  77   ? -5.855  89.798  5.485   1.00 125.08 ? 77   VAL 2 CA  1 
ATOM   869   C  C   . VAL B  2  77   ? -5.045  88.924  4.531   1.00 125.41 ? 77   VAL 2 C   1 
ATOM   870   O  O   . VAL B  2  77   ? -3.862  89.184  4.289   1.00 129.79 ? 77   VAL 2 O   1 
ATOM   871   C  CB  . VAL B  2  77   ? -6.180  91.164  4.825   1.00 115.61 ? 77   VAL 2 CB  1 
ATOM   872   C  CG1 . VAL B  2  77   ? -5.933  91.150  3.323   1.00 115.00 ? 77   VAL 2 CG1 1 
ATOM   873   C  CG2 . VAL B  2  77   ? -7.604  91.571  5.135   1.00 116.18 ? 77   VAL 2 CG2 1 
ATOM   874   N  N   . VAL B  2  78   ? -5.676  87.871  4.015   1.00 121.61 ? 78   VAL 2 N   1 
ATOM   875   C  CA  . VAL B  2  78   ? -5.040  86.989  3.035   1.00 118.51 ? 78   VAL 2 CA  1 
ATOM   876   C  C   . VAL B  2  78   ? -5.328  87.489  1.623   1.00 117.91 ? 78   VAL 2 C   1 
ATOM   877   O  O   . VAL B  2  78   ? -6.444  87.899  1.325   1.00 116.73 ? 78   VAL 2 O   1 
ATOM   878   C  CB  . VAL B  2  78   ? -5.534  85.535  3.178   1.00 118.61 ? 78   VAL 2 CB  1 
ATOM   879   C  CG1 . VAL B  2  78   ? -4.860  84.631  2.156   1.00 113.82 ? 78   VAL 2 CG1 1 
ATOM   880   C  CG2 . VAL B  2  78   ? -5.272  85.026  4.582   1.00 117.56 ? 78   VAL 2 CG2 1 
ATOM   881   N  N   . GLY B  2  79   ? -4.320  87.468  0.758   1.00 114.21 ? 79   GLY 2 N   1 
ATOM   882   C  CA  . GLY B  2  79   ? -4.466  88.004  -0.582  1.00 126.35 ? 79   GLY 2 CA  1 
ATOM   883   C  C   . GLY B  2  79   ? -4.160  87.016  -1.693  1.00 130.97 ? 79   GLY 2 C   1 
ATOM   884   O  O   . GLY B  2  79   ? -3.185  86.264  -1.629  1.00 131.09 ? 79   GLY 2 O   1 
ATOM   885   N  N   . LEU B  2  80   ? -5.010  87.011  -2.717  1.00 134.26 ? 80   LEU 2 N   1 
ATOM   886   C  CA  . LEU B  2  80   ? -4.783  86.200  -3.909  1.00 134.54 ? 80   LEU 2 CA  1 
ATOM   887   C  C   . LEU B  2  80   ? -4.344  87.119  -5.034  1.00 133.79 ? 80   LEU 2 C   1 
ATOM   888   O  O   . LEU B  2  80   ? -5.027  88.093  -5.360  1.00 132.71 ? 80   LEU 2 O   1 
ATOM   889   C  CB  . LEU B  2  80   ? -6.042  85.419  -4.290  1.00 135.63 ? 80   LEU 2 CB  1 
ATOM   890   C  CG  . LEU B  2  80   ? -6.474  84.396  -3.232  1.00 120.69 ? 80   LEU 2 CG  1 
ATOM   891   C  CD1 . LEU B  2  80   ? -7.837  83.836  -3.534  1.00 122.84 ? 80   LEU 2 CD1 1 
ATOM   892   C  CD2 . LEU B  2  80   ? -5.461  83.273  -3.132  1.00 126.44 ? 80   LEU 2 CD2 1 
ATOM   893   N  N   . PHE B  2  81   ? -3.190  86.808  -5.613  1.00 132.24 ? 81   PHE 2 N   1 
ATOM   894   C  CA  . PHE B  2  81   ? -2.529  87.718  -6.536  1.00 134.76 ? 81   PHE 2 CA  1 
ATOM   895   C  C   . PHE B  2  81   ? -2.531  87.206  -7.978  1.00 140.69 ? 81   PHE 2 C   1 
ATOM   896   O  O   . PHE B  2  81   ? -2.165  86.061  -8.253  1.00 140.36 ? 81   PHE 2 O   1 
ATOM   897   C  CB  . PHE B  2  81   ? -1.099  87.987  -6.053  1.00 130.24 ? 81   PHE 2 CB  1 
ATOM   898   C  CG  . PHE B  2  81   ? -0.354  89.000  -6.876  1.00 128.61 ? 81   PHE 2 CG  1 
ATOM   899   C  CD1 . PHE B  2  81   ? -0.864  90.274  -7.059  1.00 127.32 ? 81   PHE 2 CD1 1 
ATOM   900   C  CD2 . PHE B  2  81   ? 0.870   88.685  -7.445  1.00 127.12 ? 81   PHE 2 CD2 1 
ATOM   901   C  CE1 . PHE B  2  81   ? -0.178  91.207  -7.811  1.00 125.75 ? 81   PHE 2 CE1 1 
ATOM   902   C  CE2 . PHE B  2  81   ? 1.562   89.618  -8.194  1.00 125.03 ? 81   PHE 2 CE2 1 
ATOM   903   C  CZ  . PHE B  2  81   ? 1.037   90.878  -8.377  1.00 123.99 ? 81   PHE 2 CZ  1 
ATOM   904   N  N   . ASN B  2  82   ? -2.964  88.067  -8.892  1.00 145.17 ? 82   ASN 2 N   1 
ATOM   905   C  CA  . ASN B  2  82   ? -2.931  87.769  -10.313 1.00 145.36 ? 82   ASN 2 CA  1 
ATOM   906   C  C   . ASN B  2  82   ? -1.872  88.645  -10.992 1.00 149.29 ? 82   ASN 2 C   1 
ATOM   907   O  O   . ASN B  2  82   ? -2.121  89.824  -11.249 1.00 154.89 ? 82   ASN 2 O   1 
ATOM   908   C  CB  . ASN B  2  82   ? -4.315  88.007  -10.924 1.00 141.29 ? 82   ASN 2 CB  1 
ATOM   909   C  CG  . ASN B  2  82   ? -4.496  87.299  -12.247 1.00 142.43 ? 82   ASN 2 CG  1 
ATOM   910   O  OD1 . ASN B  2  82   ? -3.548  87.151  -13.016 1.00 143.84 ? 82   ASN 2 OD1 1 
ATOM   911   N  ND2 . ASN B  2  82   ? -5.719  86.849  -12.519 1.00 142.49 ? 82   ASN 2 ND2 1 
ATOM   912   N  N   . PRO B  2  83   ? -0.676  88.078  -11.256 1.00 143.49 ? 83   PRO 2 N   1 
ATOM   913   C  CA  . PRO B  2  83   ? 0.431   88.813  -11.889 1.00 137.69 ? 83   PRO 2 CA  1 
ATOM   914   C  C   . PRO B  2  83   ? 0.242   89.030  -13.396 1.00 142.03 ? 83   PRO 2 C   1 
ATOM   915   O  O   . PRO B  2  83   ? 0.912   89.894  -13.964 1.00 140.36 ? 83   PRO 2 O   1 
ATOM   916   C  CB  . PRO B  2  83   ? 1.645   87.922  -11.619 1.00 133.60 ? 83   PRO 2 CB  1 
ATOM   917   C  CG  . PRO B  2  83   ? 1.081   86.552  -11.499 1.00 136.93 ? 83   PRO 2 CG  1 
ATOM   918   C  CD  . PRO B  2  83   ? -0.281  86.709  -10.874 1.00 140.71 ? 83   PRO 2 CD  1 
ATOM   919   N  N   . GLU B  2  84   ? -0.641  88.254  -14.027 1.00 146.74 ? 84   GLU 2 N   1 
ATOM   920   C  CA  . GLU B  2  84   ? -1.049  88.511  -15.407 1.00 155.16 ? 84   GLU 2 CA  1 
ATOM   921   C  C   . GLU B  2  84   ? -2.262  89.439  -15.340 1.00 162.86 ? 84   GLU 2 C   1 
ATOM   922   O  O   . GLU B  2  84   ? -3.331  89.142  -15.879 1.00 168.48 ? 84   GLU 2 O   1 
ATOM   923   C  CB  . GLU B  2  84   ? -1.391  87.203  -16.135 1.00 158.74 ? 84   GLU 2 CB  1 
ATOM   924   C  CG  . GLU B  2  84   ? -1.056  87.182  -17.638 1.00 162.99 ? 84   GLU 2 CG  1 
ATOM   925   C  CD  . GLU B  2  84   ? -2.216  87.609  -18.539 1.00 168.75 ? 84   GLU 2 CD  1 
ATOM   926   O  OE1 . GLU B  2  84   ? -2.538  88.813  -18.598 1.00 173.00 ? 84   GLU 2 OE1 1 
ATOM   927   O  OE2 . GLU B  2  84   ? -2.803  86.739  -19.211 1.00 170.29 ? 84   GLU 2 OE2 1 
ATOM   928   N  N   . LYS B  2  85   ? -2.053  90.565  -14.662 1.00 161.49 ? 85   LYS 2 N   1 
ATOM   929   C  CA  . LYS B  2  85   ? -3.069  91.540  -14.273 1.00 160.37 ? 85   LYS 2 CA  1 
ATOM   930   C  C   . LYS B  2  85   ? -2.351  92.398  -13.239 1.00 166.05 ? 85   LYS 2 C   1 
ATOM   931   O  O   . LYS B  2  85   ? -1.280  92.027  -12.751 1.00 164.97 ? 85   LYS 2 O   1 
ATOM   932   C  CB  . LYS B  2  85   ? -4.275  90.869  -13.604 1.00 150.42 ? 85   LYS 2 CB  1 
ATOM   933   C  CG  . LYS B  2  85   ? -5.534  90.782  -14.454 1.00 147.07 ? 85   LYS 2 CG  1 
ATOM   934   C  CD  . LYS B  2  85   ? -6.480  89.704  -13.923 1.00 143.37 ? 85   LYS 2 CD  1 
ATOM   935   C  CE  . LYS B  2  85   ? -7.586  89.377  -14.923 1.00 143.04 ? 85   LYS 2 CE  1 
ATOM   936   N  NZ  . LYS B  2  85   ? -8.339  88.135  -14.575 1.00 138.98 ? 85   LYS 2 NZ  1 
ATOM   937   N  N   . LYS B  2  86   ? -2.921  93.541  -12.894 1.00 170.15 ? 86   LYS 2 N   1 
ATOM   938   C  CA  . LYS B  2  86   ? -2.385  94.305  -11.779 1.00 170.10 ? 86   LYS 2 CA  1 
ATOM   939   C  C   . LYS B  2  86   ? -3.329  94.134  -10.593 1.00 171.61 ? 86   LYS 2 C   1 
ATOM   940   O  O   . LYS B  2  86   ? -3.499  95.048  -9.789  1.00 173.70 ? 86   LYS 2 O   1 
ATOM   941   C  CB  . LYS B  2  86   ? -2.246  95.785  -12.150 1.00 171.16 ? 86   LYS 2 CB  1 
ATOM   942   C  CG  . LYS B  2  86   ? -1.204  96.089  -13.231 1.00 170.17 ? 86   LYS 2 CG  1 
ATOM   943   C  CD  . LYS B  2  86   ? 0.216   96.118  -12.674 1.00 166.04 ? 86   LYS 2 CD  1 
ATOM   944   C  CE  . LYS B  2  86   ? 1.143   96.938  -13.565 1.00 165.05 ? 86   LYS 2 CE  1 
ATOM   945   N  NZ  . LYS B  2  86   ? 0.687   98.354  -13.692 1.00 167.13 ? 86   LYS 2 NZ  1 
ATOM   946   N  N   . SER B  2  87   ? -3.938  92.953  -10.488 1.00 169.19 ? 87   SER 2 N   1 
ATOM   947   C  CA  . SER B  2  87   ? -5.046  92.739  -9.552  1.00 163.54 ? 87   SER 2 CA  1 
ATOM   948   C  C   . SER B  2  87   ? -4.733  91.821  -8.363  1.00 150.88 ? 87   SER 2 C   1 
ATOM   949   O  O   . SER B  2  87   ? -3.858  90.961  -8.436  1.00 146.74 ? 87   SER 2 O   1 
ATOM   950   C  CB  . SER B  2  87   ? -6.296  92.239  -10.298 1.00 166.81 ? 87   SER 2 CB  1 
ATOM   951   O  OG  . SER B  2  87   ? -6.069  90.984  -10.921 1.00 166.48 ? 87   SER 2 OG  1 
ATOM   952   N  N   . ILE B  2  88   ? -5.467  92.021  -7.271  1.00 142.75 ? 88   ILE 2 N   1 
ATOM   953   C  CA  . ILE B  2  88   ? -5.344  91.183  -6.083  1.00 137.52 ? 88   ILE 2 CA  1 
ATOM   954   C  C   . ILE B  2  88   ? -6.700  91.040  -5.393  1.00 138.05 ? 88   ILE 2 C   1 
ATOM   955   O  O   . ILE B  2  88   ? -7.523  91.954  -5.439  1.00 141.09 ? 88   ILE 2 O   1 
ATOM   956   C  CB  . ILE B  2  88   ? -4.303  91.758  -5.096  1.00 137.32 ? 88   ILE 2 CB  1 
ATOM   957   C  CG1 . ILE B  2  88   ? -4.028  90.774  -3.955  1.00 137.29 ? 88   ILE 2 CG1 1 
ATOM   958   C  CG2 . ILE B  2  88   ? -4.754  93.102  -4.560  1.00 135.79 ? 88   ILE 2 CG2 1 
ATOM   959   C  CD1 . ILE B  2  88   ? -2.924  91.216  -3.022  1.00 134.47 ? 88   ILE 2 CD1 1 
ATOM   960   N  N   . GLN B  2  89   ? -6.941  89.887  -4.773  1.00 136.26 ? 89   GLN 2 N   1 
ATOM   961   C  CA  . GLN B  2  89   ? -8.212  89.631  -4.098  1.00 136.62 ? 89   GLN 2 CA  1 
ATOM   962   C  C   . GLN B  2  89   ? -8.001  89.420  -2.608  1.00 134.74 ? 89   GLN 2 C   1 
ATOM   963   O  O   . GLN B  2  89   ? -7.391  88.436  -2.200  1.00 121.77 ? 89   GLN 2 O   1 
ATOM   964   C  CB  . GLN B  2  89   ? -8.901  88.401  -4.686  1.00 138.90 ? 89   GLN 2 CB  1 
ATOM   965   C  CG  . GLN B  2  89   ? -9.039  88.419  -6.192  1.00 139.86 ? 89   GLN 2 CG  1 
ATOM   966   C  CD  . GLN B  2  89   ? -9.869  87.266  -6.695  1.00 138.93 ? 89   GLN 2 CD  1 
ATOM   967   O  OE1 . GLN B  2  89   ? -9.342  86.197  -6.999  1.00 140.35 ? 89   GLN 2 OE1 1 
ATOM   968   N  NE2 . GLN B  2  89   ? -11.182 87.471  -6.777  1.00 137.97 ? 89   GLN 2 NE2 1 
ATOM   969   N  N   . LEU B  2  90   ? -8.527  90.338  -1.800  1.00 134.16 ? 90   LEU 2 N   1 
ATOM   970   C  CA  . LEU B  2  90   ? -8.297  90.321  -0.357  1.00 129.26 ? 90   LEU 2 CA  1 
ATOM   971   C  C   . LEU B  2  90   ? -9.448  89.700  0.416   1.00 125.36 ? 90   LEU 2 C   1 
ATOM   972   O  O   . LEU B  2  90   ? -10.612 90.017  0.178   1.00 124.62 ? 90   LEU 2 O   1 
ATOM   973   C  CB  . LEU B  2  90   ? -8.065  91.737  0.167   1.00 128.01 ? 90   LEU 2 CB  1 
ATOM   974   C  CG  . LEU B  2  90   ? -7.162  92.644  -0.665  1.00 128.59 ? 90   LEU 2 CG  1 
ATOM   975   C  CD1 . LEU B  2  90   ? -7.077  94.023  -0.021  1.00 120.87 ? 90   LEU 2 CD1 1 
ATOM   976   C  CD2 . LEU B  2  90   ? -5.783  92.013  -0.847  1.00 119.11 ? 90   LEU 2 CD2 1 
ATOM   977   N  N   . TYR B  2  91   ? -9.100  88.829  1.357   1.00 122.49 ? 91   TYR 2 N   1 
ATOM   978   C  CA  . TYR B  2  91   ? -10.063 88.197  2.246   1.00 127.94 ? 91   TYR 2 CA  1 
ATOM   979   C  C   . TYR B  2  91   ? -9.602  88.421  3.689   1.00 130.15 ? 91   TYR 2 C   1 
ATOM   980   O  O   . TYR B  2  91   ? -8.414  88.287  3.991   1.00 127.60 ? 91   TYR 2 O   1 
ATOM   981   C  CB  . TYR B  2  91   ? -10.164 86.699  1.923   1.00 130.36 ? 91   TYR 2 CB  1 
ATOM   982   C  CG  . TYR B  2  91   ? -10.540 86.419  0.479   1.00 134.44 ? 91   TYR 2 CG  1 
ATOM   983   C  CD1 . TYR B  2  91   ? -9.575  86.398  -0.524  1.00 130.73 ? 91   TYR 2 CD1 1 
ATOM   984   C  CD2 . TYR B  2  91   ? -11.868 86.192  0.116   1.00 138.44 ? 91   TYR 2 CD2 1 
ATOM   985   C  CE1 . TYR B  2  91   ? -9.925  86.161  -1.841  1.00 133.47 ? 91   TYR 2 CE1 1 
ATOM   986   C  CE2 . TYR B  2  91   ? -12.223 85.953  -1.198  1.00 138.98 ? 91   TYR 2 CE2 1 
ATOM   987   C  CZ  . TYR B  2  91   ? -11.249 85.937  -2.170  1.00 138.56 ? 91   TYR 2 CZ  1 
ATOM   988   O  OH  . TYR B  2  91   ? -11.604 85.700  -3.475  1.00 144.52 ? 91   TYR 2 OH  1 
ATOM   989   N  N   . LYS B  2  92   ? -10.521 88.789  4.578   1.00 132.92 ? 92   LYS 2 N   1 
ATOM   990   C  CA  . LYS B  2  92   ? -10.142 88.975  5.978   1.00 128.19 ? 92   LYS 2 CA  1 
ATOM   991   C  C   . LYS B  2  92   ? -10.034 87.630  6.664   1.00 131.63 ? 92   LYS 2 C   1 
ATOM   992   O  O   . LYS B  2  92   ? -10.843 86.723  6.434   1.00 118.63 ? 92   LYS 2 O   1 
ATOM   993   C  CB  . LYS B  2  92   ? -11.106 89.891  6.735   1.00 122.28 ? 92   LYS 2 CB  1 
ATOM   994   C  CG  . LYS B  2  92   ? -11.097 91.323  6.247   1.00 121.72 ? 92   LYS 2 CG  1 
ATOM   995   C  CD  . LYS B  2  92   ? -11.459 92.304  7.351   1.00 124.34 ? 92   LYS 2 CD  1 
ATOM   996   C  CE  . LYS B  2  92   ? -12.870 92.105  7.850   1.00 124.81 ? 92   LYS 2 CE  1 
ATOM   997   N  NZ  . LYS B  2  92   ? -13.264 93.205  8.760   1.00 127.13 ? 92   LYS 2 NZ  1 
ATOM   998   N  N   . ALA B  2  93   ? -9.016  87.513  7.506   1.00 131.19 ? 93   ALA 2 N   1 
ATOM   999   C  CA  . ALA B  2  93   ? -8.690  86.254  8.146   1.00 129.37 ? 93   ALA 2 CA  1 
ATOM   1000  C  C   . ALA B  2  93   ? -8.162  86.525  9.533   1.00 123.71 ? 93   ALA 2 C   1 
ATOM   1001  O  O   . ALA B  2  93   ? -7.408  87.475  9.732   1.00 127.43 ? 93   ALA 2 O   1 
ATOM   1002  C  CB  . ALA B  2  93   ? -7.647  85.512  7.331   1.00 128.52 ? 93   ALA 2 CB  1 
ATOM   1003  N  N   . PRO B  2  94   ? -8.564  85.702  10.507  1.00 120.24 ? 94   PRO 2 N   1 
ATOM   1004  C  CA  . PRO B  2  94   ? -7.961  85.828  11.831  1.00 123.49 ? 94   PRO 2 CA  1 
ATOM   1005  C  C   . PRO B  2  94   ? -6.660  85.043  11.861  1.00 128.83 ? 94   PRO 2 C   1 
ATOM   1006  O  O   . PRO B  2  94   ? -6.562  84.048  11.150  1.00 137.80 ? 94   PRO 2 O   1 
ATOM   1007  C  CB  . PRO B  2  94   ? -8.994  85.162  12.735  1.00 126.36 ? 94   PRO 2 CB  1 
ATOM   1008  C  CG  . PRO B  2  94   ? -9.629  84.130  11.875  1.00 112.58 ? 94   PRO 2 CG  1 
ATOM   1009  C  CD  . PRO B  2  94   ? -9.619  84.676  10.470  1.00 113.52 ? 94   PRO 2 CD  1 
ATOM   1010  N  N   . VAL B  2  95   ? -5.672  85.485  12.634  1.00 124.22 ? 95   VAL 2 N   1 
ATOM   1011  C  CA  . VAL B  2  95   ? -4.479  84.678  12.863  1.00 112.97 ? 95   VAL 2 CA  1 
ATOM   1012  C  C   . VAL B  2  95   ? -4.590  84.054  14.241  1.00 110.57 ? 95   VAL 2 C   1 
ATOM   1013  O  O   . VAL B  2  95   ? -4.704  84.764  15.237  1.00 111.90 ? 95   VAL 2 O   1 
ATOM   1014  C  CB  . VAL B  2  95   ? -3.200  85.509  12.814  1.00 102.85 ? 95   VAL 2 CB  1 
ATOM   1015  C  CG1 . VAL B  2  95   ? -2.002  84.636  13.145  1.00 100.95 ? 95   VAL 2 CG1 1 
ATOM   1016  C  CG2 . VAL B  2  95   ? -3.041  86.157  11.459  1.00 103.56 ? 95   VAL 2 CG2 1 
ATOM   1017  N  N   . LEU B  2  96   ? -4.571  82.728  14.303  1.00 112.67 ? 96   LEU 2 N   1 
ATOM   1018  C  CA  . LEU B  2  96   ? -4.766  82.035  15.571  1.00 113.24 ? 96   LEU 2 CA  1 
ATOM   1019  C  C   . LEU B  2  96   ? -3.492  81.379  16.062  1.00 118.97 ? 96   LEU 2 C   1 
ATOM   1020  O  O   . LEU B  2  96   ? -2.780  80.738  15.289  1.00 127.93 ? 96   LEU 2 O   1 
ATOM   1021  C  CB  . LEU B  2  96   ? -5.859  80.979  15.446  1.00 110.22 ? 96   LEU 2 CB  1 
ATOM   1022  C  CG  . LEU B  2  96   ? -7.147  81.512  14.830  1.00 114.89 ? 96   LEU 2 CG  1 
ATOM   1023  C  CD1 . LEU B  2  96   ? -7.322  80.912  13.453  1.00 116.72 ? 96   LEU 2 CD1 1 
ATOM   1024  C  CD2 . LEU B  2  96   ? -8.351  81.219  15.720  1.00 119.59 ? 96   LEU 2 CD2 1 
ATOM   1025  N  N   . VAL B  2  97   ? -3.213  81.551  17.352  1.00 114.99 ? 97   VAL 2 N   1 
ATOM   1026  C  CA  . VAL B  2  97   ? -2.092  80.885  18.007  1.00 113.48 ? 97   VAL 2 CA  1 
ATOM   1027  C  C   . VAL B  2  97   ? -2.540  79.486  18.391  1.00 116.96 ? 97   VAL 2 C   1 
ATOM   1028  O  O   . VAL B  2  97   ? -3.431  79.317  19.224  1.00 99.88  ? 97   VAL 2 O   1 
ATOM   1029  C  CB  . VAL B  2  97   ? -1.618  81.646  19.269  1.00 112.83 ? 97   VAL 2 CB  1 
ATOM   1030  C  CG1 . VAL B  2  97   ? -0.675  80.783  20.101  1.00 109.36 ? 97   VAL 2 CG1 1 
ATOM   1031  C  CG2 . VAL B  2  97   ? -0.972  82.976  18.898  1.00 96.61  ? 97   VAL 2 CG2 1 
ATOM   1032  N  N   . SER B  2  98   ? -1.919  78.486  17.773  1.00 117.66 ? 98   SER 2 N   1 
ATOM   1033  C  CA  . SER B  2  98   ? -2.453  77.131  17.816  1.00 114.28 ? 98   SER 2 CA  1 
ATOM   1034  C  C   . SER B  2  98   ? -1.443  76.078  18.246  1.00 109.60 ? 98   SER 2 C   1 
ATOM   1035  O  O   . SER B  2  98   ? -0.238  76.222  18.025  1.00 105.18 ? 98   SER 2 O   1 
ATOM   1036  C  CB  . SER B  2  98   ? -3.032  76.748  16.452  1.00 110.11 ? 98   SER 2 CB  1 
ATOM   1037  O  OG  . SER B  2  98   ? -3.168  77.870  15.602  1.00 107.00 ? 98   SER 2 OG  1 
ATOM   1038  N  N   . LYS B  2  99   ? -1.959  75.013  18.852  1.00 106.55 ? 99   LYS 2 N   1 
ATOM   1039  C  CA  . LYS B  2  99   ? -1.137  73.890  19.263  1.00 103.88 ? 99   LYS 2 CA  1 
ATOM   1040  C  C   . LYS B  2  99   ? -1.708  72.580  18.742  1.00 105.31 ? 99   LYS 2 C   1 
ATOM   1041  O  O   . LYS B  2  99   ? -2.864  72.516  18.343  1.00 100.45 ? 99   LYS 2 O   1 
ATOM   1042  C  CB  . LYS B  2  99   ? -1.032  73.841  20.782  1.00 103.06 ? 99   LYS 2 CB  1 
ATOM   1043  C  CG  . LYS B  2  99   ? -2.356  73.681  21.483  1.00 112.69 ? 99   LYS 2 CG  1 
ATOM   1044  C  CD  . LYS B  2  99   ? -2.177  73.889  22.979  1.00 124.30 ? 99   LYS 2 CD  1 
ATOM   1045  C  CE  . LYS B  2  99   ? -3.438  73.569  23.764  1.00 130.53 ? 99   LYS 2 CE  1 
ATOM   1046  N  NZ  . LYS B  2  99   ? -3.189  73.717  25.226  1.00 129.57 ? 99   LYS 2 NZ  1 
ATOM   1047  N  N   . VAL B  2  100  ? -0.875  71.546  18.737  1.00 105.73 ? 100  VAL 2 N   1 
ATOM   1048  C  CA  . VAL B  2  100  ? -1.298  70.192  18.401  1.00 113.75 ? 100  VAL 2 CA  1 
ATOM   1049  C  C   . VAL B  2  100  ? -1.164  69.331  19.644  1.00 118.83 ? 100  VAL 2 C   1 
ATOM   1050  O  O   . VAL B  2  100  ? -0.076  69.218  20.205  1.00 120.06 ? 100  VAL 2 O   1 
ATOM   1051  C  CB  . VAL B  2  100  ? -0.395  69.561  17.321  1.00 114.69 ? 100  VAL 2 CB  1 
ATOM   1052  C  CG1 . VAL B  2  100  ? -0.929  68.203  16.907  1.00 112.45 ? 100  VAL 2 CG1 1 
ATOM   1053  C  CG2 . VAL B  2  100  ? -0.277  70.469  16.121  1.00 115.94 ? 100  VAL 2 CG2 1 
ATOM   1054  N  N   . VAL B  2  101  ? -2.257  68.713  20.073  1.00 121.89 ? 101  VAL 2 N   1 
ATOM   1055  C  CA  . VAL B  2  101  ? -2.220  67.878  21.266  1.00 119.97 ? 101  VAL 2 CA  1 
ATOM   1056  C  C   . VAL B  2  101  ? -2.416  66.418  20.916  1.00 126.25 ? 101  VAL 2 C   1 
ATOM   1057  O  O   . VAL B  2  101  ? -3.289  66.067  20.122  1.00 134.01 ? 101  VAL 2 O   1 
ATOM   1058  C  CB  . VAL B  2  101  ? -3.298  68.287  22.266  1.00 113.79 ? 101  VAL 2 CB  1 
ATOM   1059  C  CG1 . VAL B  2  101  ? -3.136  67.501  23.561  1.00 105.82 ? 101  VAL 2 CG1 1 
ATOM   1060  C  CG2 . VAL B  2  101  ? -3.219  69.781  22.521  1.00 116.01 ? 101  VAL 2 CG2 1 
ATOM   1061  N  N   . SER B  2  102  ? -1.596  65.564  21.508  1.00 124.71 ? 102  SER 2 N   1 
ATOM   1062  C  CA  . SER B  2  102  ? -1.716  64.137  21.270  1.00 124.47 ? 102  SER 2 CA  1 
ATOM   1063  C  C   . SER B  2  102  ? -2.771  63.547  22.188  1.00 128.06 ? 102  SER 2 C   1 
ATOM   1064  O  O   . SER B  2  102  ? -2.652  63.646  23.410  1.00 131.67 ? 102  SER 2 O   1 
ATOM   1065  C  CB  . SER B  2  102  ? -0.381  63.446  21.516  1.00 120.65 ? 102  SER 2 CB  1 
ATOM   1066  O  OG  . SER B  2  102  ? -0.572  62.063  21.756  1.00 118.16 ? 102  SER 2 OG  1 
ATOM   1067  N  N   . LYS B  2  103  ? -3.801  62.941  21.600  1.00 125.59 ? 103  LYS 2 N   1 
ATOM   1068  C  CA  . LYS B  2  103  ? -4.850  62.290  22.375  1.00 121.25 ? 103  LYS 2 CA  1 
ATOM   1069  C  C   . LYS B  2  103  ? -4.259  61.168  23.208  1.00 121.26 ? 103  LYS 2 C   1 
ATOM   1070  O  O   . LYS B  2  103  ? -4.743  60.859  24.296  1.00 122.30 ? 103  LYS 2 O   1 
ATOM   1071  C  CB  . LYS B  2  103  ? -5.918  61.711  21.458  1.00 119.13 ? 103  LYS 2 CB  1 
ATOM   1072  C  CG  . LYS B  2  103  ? -6.806  62.732  20.796  1.00 122.53 ? 103  LYS 2 CG  1 
ATOM   1073  C  CD  . LYS B  2  103  ? -8.175  62.126  20.567  1.00 127.93 ? 103  LYS 2 CD  1 
ATOM   1074  C  CE  . LYS B  2  103  ? -8.969  62.866  19.509  1.00 127.55 ? 103  LYS 2 CE  1 
ATOM   1075  N  NZ  . LYS B  2  103  ? -10.095 62.005  19.038  1.00 123.37 ? 103  LYS 2 NZ  1 
ATOM   1076  N  N   . SER B  2  104  ? -3.207  60.562  22.676  1.00 120.93 ? 104  SER 2 N   1 
ATOM   1077  C  CA  . SER B  2  104  ? -2.512  59.468  23.337  1.00 121.59 ? 104  SER 2 CA  1 
ATOM   1078  C  C   . SER B  2  104  ? -2.014  59.844  24.741  1.00 123.18 ? 104  SER 2 C   1 
ATOM   1079  O  O   . SER B  2  104  ? -2.266  59.119  25.706  1.00 120.36 ? 104  SER 2 O   1 
ATOM   1080  C  CB  . SER B  2  104  ? -1.352  58.991  22.451  1.00 119.80 ? 104  SER 2 CB  1 
ATOM   1081  O  OG  . SER B  2  104  ? -0.502  58.082  23.130  1.00 116.68 ? 104  SER 2 OG  1 
ATOM   1082  N  N   . SER B  2  105  ? -1.335  60.983  24.857  1.00 122.34 ? 105  SER 2 N   1 
ATOM   1083  C  CA  . SER B  2  105  ? -0.669  61.339  26.104  1.00 118.75 ? 105  SER 2 CA  1 
ATOM   1084  C  C   . SER B  2  105  ? -1.317  62.506  26.853  1.00 117.79 ? 105  SER 2 C   1 
ATOM   1085  O  O   . SER B  2  105  ? -0.870  62.862  27.940  1.00 112.89 ? 105  SER 2 O   1 
ATOM   1086  C  CB  . SER B  2  105  ? 0.792   61.665  25.827  1.00 115.88 ? 105  SER 2 CB  1 
ATOM   1087  O  OG  . SER B  2  105  ? 0.878   62.823  25.017  1.00 118.74 ? 105  SER 2 OG  1 
ATOM   1088  N  N   . LYS B  2  106  ? -2.363  63.093  26.275  1.00 120.01 ? 106  LYS 2 N   1 
ATOM   1089  C  CA  . LYS B  2  106  ? -3.058  64.245  26.872  1.00 120.66 ? 106  LYS 2 CA  1 
ATOM   1090  C  C   . LYS B  2  106  ? -3.492  64.035  28.322  1.00 115.15 ? 106  LYS 2 C   1 
ATOM   1091  O  O   . LYS B  2  106  ? -3.308  64.906  29.171  1.00 107.96 ? 106  LYS 2 O   1 
ATOM   1092  C  CB  . LYS B  2  106  ? -4.288  64.615  26.036  1.00 126.75 ? 106  LYS 2 CB  1 
ATOM   1093  C  CG  . LYS B  2  106  ? -5.239  65.612  26.695  1.00 128.65 ? 106  LYS 2 CG  1 
ATOM   1094  C  CD  . LYS B  2  106  ? -6.531  65.792  25.879  1.00 129.85 ? 106  LYS 2 CD  1 
ATOM   1095  C  CE  . LYS B  2  106  ? -7.381  66.953  26.397  1.00 130.05 ? 106  LYS 2 CE  1 
ATOM   1096  N  NZ  . LYS B  2  106  ? -8.629  67.160  25.603  1.00 132.39 ? 106  LYS 2 NZ  1 
ATOM   1097  N  N   . ASN B  2  107  ? -4.063  62.874  28.605  1.00 117.89 ? 107  ASN 2 N   1 
ATOM   1098  C  CA  . ASN B  2  107  ? -4.618  62.633  29.926  1.00 119.76 ? 107  ASN 2 CA  1 
ATOM   1099  C  C   . ASN B  2  107  ? -3.730  61.808  30.847  1.00 119.87 ? 107  ASN 2 C   1 
ATOM   1100  O  O   . ASN B  2  107  ? -4.140  61.462  31.952  1.00 121.65 ? 107  ASN 2 O   1 
ATOM   1101  C  CB  . ASN B  2  107  ? -5.996  61.992  29.806  1.00 125.48 ? 107  ASN 2 CB  1 
ATOM   1102  C  CG  . ASN B  2  107  ? -6.958  62.845  29.010  1.00 129.88 ? 107  ASN 2 CG  1 
ATOM   1103  O  OD1 . ASN B  2  107  ? -6.941  64.077  29.111  1.00 127.38 ? 107  ASN 2 OD1 1 
ATOM   1104  N  ND2 . ASN B  2  107  ? -7.803  62.197  28.205  1.00 133.04 ? 107  ASN 2 ND2 1 
ATOM   1105  N  N   . LEU B  2  108  ? -2.521  61.484  30.399  1.00 116.18 ? 108  LEU 2 N   1 
ATOM   1106  C  CA  . LEU B  2  108  ? -1.581  60.806  31.279  1.00 116.20 ? 108  LEU 2 CA  1 
ATOM   1107  C  C   . LEU B  2  108  ? -1.356  61.706  32.491  1.00 121.74 ? 108  LEU 2 C   1 
ATOM   1108  O  O   . LEU B  2  108  ? -1.383  62.930  32.371  1.00 126.50 ? 108  LEU 2 O   1 
ATOM   1109  C  CB  . LEU B  2  108  ? -0.271  60.488  30.553  1.00 113.44 ? 108  LEU 2 CB  1 
ATOM   1110  C  CG  . LEU B  2  108  ? -0.332  59.495  29.385  1.00 100.53 ? 108  LEU 2 CG  1 
ATOM   1111  C  CD1 . LEU B  2  108  ? 1.047   59.245  28.832  1.00 99.05  ? 108  LEU 2 CD1 1 
ATOM   1112  C  CD2 . LEU B  2  108  ? -0.947  58.209  29.833  1.00 102.05 ? 108  LEU 2 CD2 1 
ATOM   1113  N  N   . ARG B  2  109  ? -1.169  61.099  33.658  1.00 122.35 ? 109  ARG 2 N   1 
ATOM   1114  C  CA  . ARG B  2  109  ? -1.151  61.840  34.913  1.00 120.56 ? 109  ARG 2 CA  1 
ATOM   1115  C  C   . ARG B  2  109  ? -0.629  60.959  36.029  1.00 119.63 ? 109  ARG 2 C   1 
ATOM   1116  O  O   . ARG B  2  109  ? -0.996  59.789  36.118  1.00 123.52 ? 109  ARG 2 O   1 
ATOM   1117  C  CB  . ARG B  2  109  ? -2.568  62.263  35.273  1.00 126.04 ? 109  ARG 2 CB  1 
ATOM   1118  C  CG  . ARG B  2  109  ? -2.721  63.715  35.647  1.00 131.63 ? 109  ARG 2 CG  1 
ATOM   1119  C  CD  . ARG B  2  109  ? -3.923  63.897  36.556  1.00 140.68 ? 109  ARG 2 CD  1 
ATOM   1120  N  NE  . ARG B  2  109  ? -3.524  64.076  37.951  1.00 144.60 ? 109  ARG 2 NE  1 
ATOM   1121  C  CZ  . ARG B  2  109  ? -4.349  63.987  38.993  1.00 149.64 ? 109  ARG 2 CZ  1 
ATOM   1122  N  NH1 . ARG B  2  109  ? -5.641  63.705  38.818  1.00 150.13 ? 109  ARG 2 NH1 1 
ATOM   1123  N  NH2 . ARG B  2  109  ? -3.873  64.172  40.219  1.00 151.29 ? 109  ARG 2 NH2 1 
ATOM   1124  N  N   . GLY B  2  110  ? 0.219   61.519  36.884  1.00 116.78 ? 110  GLY 2 N   1 
ATOM   1125  C  CA  . GLY B  2  110  ? 0.706   60.803  38.051  1.00 115.72 ? 110  GLY 2 CA  1 
ATOM   1126  C  C   . GLY B  2  110  ? -0.269  60.929  39.209  1.00 115.20 ? 110  GLY 2 C   1 
ATOM   1127  O  O   . GLY B  2  110  ? -1.279  61.624  39.092  1.00 112.96 ? 110  GLY 2 O   1 
ATOM   1128  N  N   . PRO B  2  111  ? 0.030   60.261  40.337  1.00 118.15 ? 111  PRO 2 N   1 
ATOM   1129  C  CA  . PRO B  2  111  ? -0.833  60.302  41.525  1.00 122.16 ? 111  PRO 2 CA  1 
ATOM   1130  C  C   . PRO B  2  111  ? -0.774  61.682  42.161  1.00 128.24 ? 111  PRO 2 C   1 
ATOM   1131  O  O   . PRO B  2  111  ? 0.178   62.411  41.877  1.00 137.53 ? 111  PRO 2 O   1 
ATOM   1132  C  CB  . PRO B  2  111  ? -0.199  59.261  42.449  1.00 122.85 ? 111  PRO 2 CB  1 
ATOM   1133  C  CG  . PRO B  2  111  ? 1.245   59.228  42.039  1.00 120.33 ? 111  PRO 2 CG  1 
ATOM   1134  C  CD  . PRO B  2  111  ? 1.256   59.470  40.561  1.00 118.44 ? 111  PRO 2 CD  1 
ATOM   1135  N  N   . LYS B  2  112  ? -1.754  62.036  42.994  1.00 127.44 ? 112  LYS 2 N   1 
ATOM   1136  C  CA  . LYS B  2  112  ? -1.812  63.381  43.579  1.00 125.16 ? 112  LYS 2 CA  1 
ATOM   1137  C  C   . LYS B  2  112  ? -0.541  63.761  44.328  1.00 121.14 ? 112  LYS 2 C   1 
ATOM   1138  O  O   . LYS B  2  112  ? -0.061  64.885  44.199  1.00 111.98 ? 112  LYS 2 O   1 
ATOM   1139  C  CB  . LYS B  2  112  ? -3.050  63.567  44.462  1.00 124.41 ? 112  LYS 2 CB  1 
ATOM   1140  C  CG  . LYS B  2  112  ? -4.173  64.314  43.749  1.00 125.94 ? 112  LYS 2 CG  1 
ATOM   1141  C  CD  . LYS B  2  112  ? -5.442  64.419  44.590  1.00 128.71 ? 112  LYS 2 CD  1 
ATOM   1142  C  CE  . LYS B  2  112  ? -6.610  64.969  43.770  1.00 128.72 ? 112  LYS 2 CE  1 
ATOM   1143  N  NZ  . LYS B  2  112  ? -7.927  64.870  44.481  1.00 129.94 ? 112  LYS 2 NZ  1 
ATOM   1144  N  N   . ILE B  2  113  ? -0.008  62.819  45.105  1.00 125.59 ? 113  ILE 2 N   1 
ATOM   1145  C  CA  . ILE B  2  113  ? 1.306   62.959  45.726  1.00 124.23 ? 113  ILE 2 CA  1 
ATOM   1146  C  C   . ILE B  2  113  ? 1.962   61.595  45.818  1.00 126.53 ? 113  ILE 2 C   1 
ATOM   1147  O  O   . ILE B  2  113  ? 1.305   60.621  46.188  1.00 127.75 ? 113  ILE 2 O   1 
ATOM   1148  C  CB  . ILE B  2  113  ? 1.226   63.489  47.178  1.00 120.21 ? 113  ILE 2 CB  1 
ATOM   1149  C  CG1 . ILE B  2  113  ? 0.376   64.756  47.271  1.00 117.13 ? 113  ILE 2 CG1 1 
ATOM   1150  C  CG2 . ILE B  2  113  ? 2.628   63.730  47.734  1.00 119.70 ? 113  ILE 2 CG2 1 
ATOM   1151  C  CD1 . ILE B  2  113  ? 0.162   65.225  48.685  1.00 117.67 ? 113  ILE 2 CD1 1 
ATOM   1152  N  N   . LYS B  2  114  ? 3.247   61.522  45.482  1.00 126.25 ? 114  LYS 2 N   1 
ATOM   1153  C  CA  . LYS B  2  114  ? 4.059   60.381  45.876  1.00 127.82 ? 114  LYS 2 CA  1 
ATOM   1154  C  C   . LYS B  2  114  ? 4.552   60.626  47.311  1.00 131.31 ? 114  LYS 2 C   1 
ATOM   1155  O  O   . LYS B  2  114  ? 5.659   61.133  47.543  1.00 131.58 ? 114  LYS 2 O   1 
ATOM   1156  C  CB  . LYS B  2  114  ? 5.209   60.179  44.896  1.00 125.65 ? 114  LYS 2 CB  1 
ATOM   1157  C  CG  . LYS B  2  114  ? 4.820   60.449  43.452  1.00 121.75 ? 114  LYS 2 CG  1 
ATOM   1158  C  CD  . LYS B  2  114  ? 5.632   59.596  42.504  1.00 118.34 ? 114  LYS 2 CD  1 
ATOM   1159  C  CE  . LYS B  2  114  ? 7.123   59.736  42.770  1.00 117.71 ? 114  LYS 2 CE  1 
ATOM   1160  N  NZ  . LYS B  2  114  ? 7.915   58.696  42.048  1.00 119.72 ? 114  LYS 2 NZ  1 
ATOM   1161  N  N   . SER B  2  115  ? 3.691   60.285  48.268  1.00 131.38 ? 115  SER 2 N   1 
ATOM   1162  C  CA  . SER B  2  115  ? 3.924   60.559  49.684  1.00 124.71 ? 115  SER 2 CA  1 
ATOM   1163  C  C   . SER B  2  115  ? 5.041   59.687  50.266  1.00 123.88 ? 115  SER 2 C   1 
ATOM   1164  O  O   . SER B  2  115  ? 6.223   60.043  50.194  1.00 116.01 ? 115  SER 2 O   1 
ATOM   1165  C  CB  . SER B  2  115  ? 2.618   60.393  50.480  1.00 118.52 ? 115  SER 2 CB  1 
ATOM   1166  O  OG  . SER B  2  115  ? 1.889   59.245  50.061  1.00 117.35 ? 115  SER 2 OG  1 
ATOM   1167  N  N   . ILE C  3  25   ? -16.356 74.329  23.427  1.00 131.57 ? 25   ILE 3 N   1 
ATOM   1168  C  CA  . ILE C  3  25   ? -16.802 75.682  23.106  1.00 141.35 ? 25   ILE 3 CA  1 
ATOM   1169  C  C   . ILE C  3  25   ? -16.912 76.569  24.344  1.00 155.15 ? 25   ILE 3 C   1 
ATOM   1170  O  O   . ILE C  3  25   ? -17.606 76.213  25.294  1.00 156.28 ? 25   ILE 3 O   1 
ATOM   1171  C  CB  . ILE C  3  25   ? -18.189 75.673  22.443  1.00 139.80 ? 25   ILE 3 CB  1 
ATOM   1172  C  CG1 . ILE C  3  25   ? -18.147 74.942  21.104  1.00 137.17 ? 25   ILE 3 CG1 1 
ATOM   1173  C  CG2 . ILE C  3  25   ? -18.711 77.101  22.265  1.00 141.49 ? 25   ILE 3 CG2 1 
ATOM   1174  C  CD1 . ILE C  3  25   ? -19.517 74.811  20.457  1.00 137.95 ? 25   ILE 3 CD1 1 
ATOM   1175  N  N   . PRO C  3  26   ? -16.233 77.735  24.329  1.00 164.61 ? 26   PRO 3 N   1 
ATOM   1176  C  CA  . PRO C  3  26   ? -16.304 78.746  25.398  1.00 165.98 ? 26   PRO 3 CA  1 
ATOM   1177  C  C   . PRO C  3  26   ? -17.525 79.653  25.266  1.00 167.07 ? 26   PRO 3 C   1 
ATOM   1178  O  O   . PRO C  3  26   ? -18.232 79.603  24.252  1.00 163.83 ? 26   PRO 3 O   1 
ATOM   1179  C  CB  . PRO C  3  26   ? -15.022 79.575  25.199  1.00 163.28 ? 26   PRO 3 CB  1 
ATOM   1180  C  CG  . PRO C  3  26   ? -14.190 78.809  24.209  1.00 164.57 ? 26   PRO 3 CG  1 
ATOM   1181  C  CD  . PRO C  3  26   ? -15.171 78.055  23.364  1.00 166.41 ? 26   PRO 3 CD  1 
ATOM   1182  N  N   . ASP C  3  27   ? -17.751 80.480  26.286  1.00 169.10 ? 27   ASP 3 N   1 
ATOM   1183  C  CA  . ASP C  3  27   ? -18.944 81.323  26.369  1.00 172.83 ? 27   ASP 3 CA  1 
ATOM   1184  C  C   . ASP C  3  27   ? -18.991 82.415  25.303  1.00 166.23 ? 27   ASP 3 C   1 
ATOM   1185  O  O   . ASP C  3  27   ? -18.106 83.274  25.245  1.00 164.42 ? 27   ASP 3 O   1 
ATOM   1186  C  CB  . ASP C  3  27   ? -19.040 81.988  27.747  1.00 179.95 ? 27   ASP 3 CB  1 
ATOM   1187  C  CG  . ASP C  3  27   ? -19.231 80.991  28.873  1.00 183.53 ? 27   ASP 3 CG  1 
ATOM   1188  O  OD1 . ASP C  3  27   ? -19.773 79.893  28.618  1.00 183.30 ? 27   ASP 3 OD1 1 
ATOM   1189  O  OD2 . ASP C  3  27   ? -18.845 81.319  30.017  1.00 184.08 ? 27   ASP 3 OD2 1 
ATOM   1190  N  N   . GLY C  3  28   ? -20.035 82.389  24.477  1.00 160.30 ? 28   GLY 3 N   1 
ATOM   1191  C  CA  . GLY C  3  28   ? -20.293 83.475  23.547  1.00 157.20 ? 28   GLY 3 CA  1 
ATOM   1192  C  C   . GLY C  3  28   ? -19.888 83.234  22.106  1.00 156.56 ? 28   GLY 3 C   1 
ATOM   1193  O  O   . GLY C  3  28   ? -20.161 84.070  21.242  1.00 157.52 ? 28   GLY 3 O   1 
ATOM   1194  N  N   . PHE C  3  29   ? -19.239 82.102  21.843  1.00 154.52 ? 29   PHE 3 N   1 
ATOM   1195  C  CA  . PHE C  3  29   ? -18.808 81.757  20.491  1.00 153.49 ? 29   PHE 3 CA  1 
ATOM   1196  C  C   . PHE C  3  29   ? -19.830 80.852  19.809  1.00 155.39 ? 29   PHE 3 C   1 
ATOM   1197  O  O   . PHE C  3  29   ? -20.295 79.882  20.406  1.00 157.46 ? 29   PHE 3 O   1 
ATOM   1198  C  CB  . PHE C  3  29   ? -17.455 81.041  20.523  1.00 151.70 ? 29   PHE 3 CB  1 
ATOM   1199  C  CG  . PHE C  3  29   ? -16.330 81.876  21.068  1.00 152.67 ? 29   PHE 3 CG  1 
ATOM   1200  C  CD1 . PHE C  3  29   ? -16.154 82.018  22.436  1.00 152.44 ? 29   PHE 3 CD1 1 
ATOM   1201  C  CD2 . PHE C  3  29   ? -15.430 82.500  20.214  1.00 154.39 ? 29   PHE 3 CD2 1 
ATOM   1202  C  CE1 . PHE C  3  29   ? -15.109 82.783  22.946  1.00 150.37 ? 29   PHE 3 CE1 1 
ATOM   1203  C  CE2 . PHE C  3  29   ? -14.380 83.267  20.718  1.00 152.80 ? 29   PHE 3 CE2 1 
ATOM   1204  C  CZ  . PHE C  3  29   ? -14.221 83.407  22.086  1.00 149.17 ? 29   PHE 3 CZ  1 
ATOM   1205  N  N   . LYS C  3  30   ? -20.175 81.169  18.563  1.00 154.59 ? 30   LYS 3 N   1 
ATOM   1206  C  CA  . LYS C  3  30   ? -21.025 80.296  17.755  1.00 155.71 ? 30   LYS 3 CA  1 
ATOM   1207  C  C   . LYS C  3  30   ? -20.277 79.816  16.514  1.00 152.16 ? 30   LYS 3 C   1 
ATOM   1208  O  O   . LYS C  3  30   ? -19.548 80.589  15.890  1.00 149.29 ? 30   LYS 3 O   1 
ATOM   1209  C  CB  . LYS C  3  30   ? -22.308 81.010  17.347  1.00 158.82 ? 30   LYS 3 CB  1 
ATOM   1210  C  CG  . LYS C  3  30   ? -23.277 81.264  18.487  1.00 161.80 ? 30   LYS 3 CG  1 
ATOM   1211  C  CD  . LYS C  3  30   ? -24.598 81.789  17.948  1.00 164.78 ? 30   LYS 3 CD  1 
ATOM   1212  C  CE  . LYS C  3  30   ? -25.642 81.912  19.037  1.00 165.21 ? 30   LYS 3 CE  1 
ATOM   1213  N  NZ  . LYS C  3  30   ? -26.965 82.292  18.463  1.00 167.42 ? 30   LYS 3 NZ  1 
ATOM   1214  N  N   . LYS C  3  31   ? -20.461 78.545  16.161  1.00 150.05 ? 31   LYS 3 N   1 
ATOM   1215  C  CA  . LYS C  3  31   ? -19.729 77.946  15.044  1.00 147.14 ? 31   LYS 3 CA  1 
ATOM   1216  C  C   . LYS C  3  31   ? -19.987 78.712  13.754  1.00 152.00 ? 31   LYS 3 C   1 
ATOM   1217  O  O   . LYS C  3  31   ? -21.129 79.023  13.425  1.00 155.22 ? 31   LYS 3 O   1 
ATOM   1218  C  CB  . LYS C  3  31   ? -20.081 76.460  14.873  1.00 141.91 ? 31   LYS 3 CB  1 
ATOM   1219  C  CG  . LYS C  3  31   ? -19.272 75.739  13.792  1.00 136.51 ? 31   LYS 3 CG  1 
ATOM   1220  C  CD  . LYS C  3  31   ? -19.680 74.268  13.658  1.00 139.42 ? 31   LYS 3 CD  1 
ATOM   1221  C  CE  . LYS C  3  31   ? -18.933 73.574  12.512  1.00 138.33 ? 31   LYS 3 CE  1 
ATOM   1222  N  NZ  . LYS C  3  31   ? -19.331 72.148  12.281  1.00 134.95 ? 31   LYS 3 NZ  1 
ATOM   1223  N  N   . CYS C  3  32   ? -18.913 79.035  13.043  1.00 154.76 ? 32   CYS 3 N   1 
ATOM   1224  C  CA  . CYS C  3  32   ? -19.023 79.770  11.793  1.00 160.04 ? 32   CYS 3 CA  1 
ATOM   1225  C  C   . CYS C  3  32   ? -19.697 78.894  10.750  1.00 164.73 ? 32   CYS 3 C   1 
ATOM   1226  O  O   . CYS C  3  32   ? -19.062 78.042  10.126  1.00 167.09 ? 32   CYS 3 O   1 
ATOM   1227  C  CB  . CYS C  3  32   ? -17.646 80.233  11.311  1.00 160.22 ? 32   CYS 3 CB  1 
ATOM   1228  S  SG  . CYS C  3  32   ? -16.930 81.573  12.299  1.00 151.48 ? 32   CYS 3 SG  1 
ATOM   1229  N  N   . LYS C  3  33   ? -20.996 79.112  10.574  1.00 163.25 ? 33   LYS 3 N   1 
ATOM   1230  C  CA  . LYS C  3  33   ? -21.814 78.237  9.752   1.00 159.08 ? 33   LYS 3 CA  1 
ATOM   1231  C  C   . LYS C  3  33   ? -21.459 78.306  8.267   1.00 153.93 ? 33   LYS 3 C   1 
ATOM   1232  O  O   . LYS C  3  33   ? -20.891 77.363  7.733   1.00 152.97 ? 33   LYS 3 O   1 
ATOM   1233  C  CB  . LYS C  3  33   ? -23.301 78.525  9.984   1.00 164.52 ? 33   LYS 3 CB  1 
ATOM   1234  C  CG  . LYS C  3  33   ? -24.123 77.299  10.386  1.00 166.46 ? 33   LYS 3 CG  1 
ATOM   1235  C  CD  . LYS C  3  33   ? -23.514 76.575  11.583  1.00 162.64 ? 33   LYS 3 CD  1 
ATOM   1236  C  CE  . LYS C  3  33   ? -24.379 75.399  12.020  1.00 161.37 ? 33   LYS 3 CE  1 
ATOM   1237  N  NZ  . LYS C  3  33   ? -23.706 74.587  13.075  1.00 156.23 ? 33   LYS 3 NZ  1 
ATOM   1238  N  N   . HIS C  3  34   ? -21.782 79.415  7.607   1.00 153.88 ? 34   HIS 3 N   1 
ATOM   1239  C  CA  . HIS C  3  34   ? -21.646 79.508  6.149   1.00 154.86 ? 34   HIS 3 CA  1 
ATOM   1240  C  C   . HIS C  3  34   ? -20.384 80.251  5.712   1.00 151.15 ? 34   HIS 3 C   1 
ATOM   1241  O  O   . HIS C  3  34   ? -20.372 81.477  5.607   1.00 148.99 ? 34   HIS 3 O   1 
ATOM   1242  C  CB  . HIS C  3  34   ? -22.898 80.148  5.517   1.00 157.79 ? 34   HIS 3 CB  1 
ATOM   1243  C  CG  . HIS C  3  34   ? -24.125 79.285  5.579   1.00 154.41 ? 34   HIS 3 CG  1 
ATOM   1244  N  ND1 . HIS C  3  34   ? -24.911 79.184  6.709   1.00 148.95 ? 34   HIS 3 ND1 1 
ATOM   1245  C  CD2 . HIS C  3  34   ? -24.700 78.481  4.651   1.00 152.73 ? 34   HIS 3 CD2 1 
ATOM   1246  C  CE1 . HIS C  3  34   ? -25.911 78.353  6.476   1.00 149.89 ? 34   HIS 3 CE1 1 
ATOM   1247  N  NE2 . HIS C  3  34   ? -25.807 77.914  5.233   1.00 151.76 ? 34   HIS 3 NE2 1 
ATOM   1248  N  N   . LEU C  3  35   ? -19.326 79.493  5.442   1.00 151.94 ? 35   LEU 3 N   1 
ATOM   1249  C  CA  . LEU C  3  35   ? -18.034 80.063  5.064   1.00 150.03 ? 35   LEU 3 CA  1 
ATOM   1250  C  C   . LEU C  3  35   ? -17.997 80.539  3.615   1.00 150.12 ? 35   LEU 3 C   1 
ATOM   1251  O  O   . LEU C  3  35   ? -18.330 79.783  2.695   1.00 155.71 ? 35   LEU 3 O   1 
ATOM   1252  C  CB  . LEU C  3  35   ? -16.923 79.040  5.295   1.00 147.12 ? 35   LEU 3 CB  1 
ATOM   1253  C  CG  . LEU C  3  35   ? -16.630 78.702  6.759   1.00 145.16 ? 35   LEU 3 CG  1 
ATOM   1254  C  CD1 . LEU C  3  35   ? -15.596 77.583  6.857   1.00 143.70 ? 35   LEU 3 CD1 1 
ATOM   1255  C  CD2 . LEU C  3  35   ? -16.173 79.951  7.523   1.00 141.13 ? 35   LEU 3 CD2 1 
ATOM   1256  N  N   . LYS C  3  36   ? -17.575 81.788  3.420   1.00 141.82 ? 36   LYS 3 N   1 
ATOM   1257  C  CA  . LYS C  3  36   ? -17.515 82.374  2.083   1.00 140.39 ? 36   LYS 3 CA  1 
ATOM   1258  C  C   . LYS C  3  36   ? -16.413 81.736  1.233   1.00 146.22 ? 36   LYS 3 C   1 
ATOM   1259  O  O   . LYS C  3  36   ? -15.588 80.975  1.742   1.00 145.65 ? 36   LYS 3 O   1 
ATOM   1260  C  CB  . LYS C  3  36   ? -17.357 83.894  2.149   1.00 134.65 ? 36   LYS 3 CB  1 
ATOM   1261  C  CG  . LYS C  3  36   ? -18.354 84.581  3.079   1.00 136.06 ? 36   LYS 3 CG  1 
ATOM   1262  C  CD  . LYS C  3  36   ? -19.796 84.329  2.662   1.00 136.98 ? 36   LYS 3 CD  1 
ATOM   1263  C  CE  . LYS C  3  36   ? -20.759 84.782  3.746   1.00 138.67 ? 36   LYS 3 CE  1 
ATOM   1264  N  NZ  . LYS C  3  36   ? -22.156 84.374  3.435   1.00 142.51 ? 36   LYS 3 NZ  1 
ATOM   1265  N  N   . ASN C  3  37   ? -16.407 82.057  -0.060  1.00 151.37 ? 37   ASN 3 N   1 
ATOM   1266  C  CA  . ASN C  3  37   ? -15.607 81.326  -1.048  1.00 145.97 ? 37   ASN 3 CA  1 
ATOM   1267  C  C   . ASN C  3  37   ? -14.172 81.830  -1.233  1.00 141.68 ? 37   ASN 3 C   1 
ATOM   1268  O  O   . ASN C  3  37   ? -13.896 83.022  -1.102  1.00 140.56 ? 37   ASN 3 O   1 
ATOM   1269  C  CB  . ASN C  3  37   ? -16.338 81.307  -2.393  1.00 145.77 ? 37   ASN 3 CB  1 
ATOM   1270  C  CG  . ASN C  3  37   ? -15.742 80.314  -3.361  1.00 150.86 ? 37   ASN 3 CG  1 
ATOM   1271  O  OD1 . ASN C  3  37   ? -16.045 79.123  -3.306  1.00 152.24 ? 37   ASN 3 OD1 1 
ATOM   1272  N  ND2 . ASN C  3  37   ? -14.883 80.795  -4.255  1.00 154.12 ? 37   ASN 3 ND2 1 
ATOM   1273  N  N   . PHE C  3  38   ? -13.266 80.913  -1.559  1.00 141.64 ? 38   PHE 3 N   1 
ATOM   1274  C  CA  . PHE C  3  38   ? -11.848 81.241  -1.664  1.00 143.49 ? 38   PHE 3 CA  1 
ATOM   1275  C  C   . PHE C  3  38   ? -11.186 80.614  -2.900  1.00 136.45 ? 38   PHE 3 C   1 
ATOM   1276  O  O   . PHE C  3  38   ? -10.597 79.539  -2.808  1.00 134.38 ? 38   PHE 3 O   1 
ATOM   1277  C  CB  . PHE C  3  38   ? -11.119 80.803  -0.382  1.00 149.54 ? 38   PHE 3 CB  1 
ATOM   1278  C  CG  . PHE C  3  38   ? -9.689  81.272  -0.299  1.00 148.86 ? 38   PHE 3 CG  1 
ATOM   1279  C  CD1 . PHE C  3  38   ? -9.397  82.574  0.070   1.00 149.12 ? 38   PHE 3 CD1 1 
ATOM   1280  C  CD2 . PHE C  3  38   ? -8.641  80.408  -0.584  1.00 147.36 ? 38   PHE 3 CD2 1 
ATOM   1281  C  CE1 . PHE C  3  38   ? -8.089  83.004  0.147   1.00 148.41 ? 38   PHE 3 CE1 1 
ATOM   1282  C  CE2 . PHE C  3  38   ? -7.334  80.835  -0.509  1.00 143.72 ? 38   PHE 3 CE2 1 
ATOM   1283  C  CZ  . PHE C  3  38   ? -7.057  82.133  -0.143  1.00 145.02 ? 38   PHE 3 CZ  1 
ATOM   1284  N  N   . PRO C  3  39   ? -11.258 81.306  -4.053  1.00 134.79 ? 39   PRO 3 N   1 
ATOM   1285  C  CA  . PRO C  3  39   ? -10.757 80.868  -5.368  1.00 135.55 ? 39   PRO 3 CA  1 
ATOM   1286  C  C   . PRO C  3  39   ? -9.244  80.621  -5.449  1.00 137.27 ? 39   PRO 3 C   1 
ATOM   1287  O  O   . PRO C  3  39   ? -8.483  81.541  -5.756  1.00 135.05 ? 39   PRO 3 O   1 
ATOM   1288  C  CB  . PRO C  3  39   ? -11.131 82.037  -6.285  1.00 136.80 ? 39   PRO 3 CB  1 
ATOM   1289  C  CG  . PRO C  3  39   ? -11.231 83.212  -5.378  1.00 136.53 ? 39   PRO 3 CG  1 
ATOM   1290  C  CD  . PRO C  3  39   ? -11.822 82.664  -4.114  1.00 135.87 ? 39   PRO 3 CD  1 
ATOM   1291  N  N   . LEU C  3  40   ? -8.825  79.379  -5.218  1.00 142.07 ? 40   LEU 3 N   1 
ATOM   1292  C  CA  . LEU C  3  40   ? -7.408  79.015  -5.237  1.00 139.63 ? 40   LEU 3 CA  1 
ATOM   1293  C  C   . LEU C  3  40   ? -6.954  78.510  -6.620  1.00 139.92 ? 40   LEU 3 C   1 
ATOM   1294  O  O   . LEU C  3  40   ? -7.560  78.850  -7.635  1.00 138.18 ? 40   LEU 3 O   1 
ATOM   1295  C  CB  . LEU C  3  40   ? -7.128  77.975  -4.149  1.00 133.85 ? 40   LEU 3 CB  1 
ATOM   1296  C  CG  . LEU C  3  40   ? -5.762  78.063  -3.477  1.00 126.38 ? 40   LEU 3 CG  1 
ATOM   1297  C  CD1 . LEU C  3  40   ? -5.405  79.512  -3.215  1.00 118.70 ? 40   LEU 3 CD1 1 
ATOM   1298  C  CD2 . LEU C  3  40   ? -5.776  77.259  -2.196  1.00 123.44 ? 40   LEU 3 CD2 1 
ATOM   1299  N  N   . ASN C  3  41   ? -5.886  77.715  -6.654  1.00 142.33 ? 41   ASN 3 N   1 
ATOM   1300  C  CA  . ASN C  3  41   ? -5.340  77.189  -7.908  1.00 145.10 ? 41   ASN 3 CA  1 
ATOM   1301  C  C   . ASN C  3  41   ? -4.445  75.958  -7.719  1.00 135.20 ? 41   ASN 3 C   1 
ATOM   1302  O  O   . ASN C  3  41   ? -3.758  75.520  -8.646  1.00 128.84 ? 41   ASN 3 O   1 
ATOM   1303  C  CB  . ASN C  3  41   ? -4.586  78.283  -8.676  1.00 152.59 ? 41   ASN 3 CB  1 
ATOM   1304  C  CG  . ASN C  3  41   ? -5.364  78.791  -9.884  1.00 162.52 ? 41   ASN 3 CG  1 
ATOM   1305  O  OD1 . ASN C  3  41   ? -5.485  78.092  -10.898 1.00 170.45 ? 41   ASN 3 OD1 1 
ATOM   1306  N  ND2 . ASN C  3  41   ? -5.895  80.008  -9.784  1.00 160.09 ? 41   ASN 3 ND2 1 
ATOM   1307  N  N   . GLN C  3  50   ? 2.396   81.932  -12.517 1.00 129.35 ? 50   GLN 3 N   1 
ATOM   1308  C  CA  . GLN C  3  50   ? 1.154   81.466  -11.905 1.00 136.98 ? 50   GLN 3 CA  1 
ATOM   1309  C  C   . GLN C  3  50   ? 0.726   82.435  -10.803 1.00 141.83 ? 50   GLN 3 C   1 
ATOM   1310  O  O   . GLN C  3  50   ? 1.365   83.470  -10.620 1.00 144.56 ? 50   GLN 3 O   1 
ATOM   1311  C  CB  . GLN C  3  50   ? 1.323   80.040  -11.358 1.00 138.25 ? 50   GLN 3 CB  1 
ATOM   1312  C  CG  . GLN C  3  50   ? 1.908   79.014  -12.364 1.00 151.63 ? 50   GLN 3 CG  1 
ATOM   1313  C  CD  . GLN C  3  50   ? 0.931   78.574  -13.466 1.00 153.41 ? 50   GLN 3 CD  1 
ATOM   1314  O  OE1 . GLN C  3  50   ? -0.257  78.910  -13.448 1.00 156.28 ? 50   GLN 3 OE1 1 
ATOM   1315  N  NE2 . GLN C  3  50   ? 1.440   77.815  -14.431 1.00 149.27 ? 50   GLN 3 NE2 1 
ATOM   1316  N  N   . GLN C  3  51   ? -0.344  82.112  -10.075 1.00 143.93 ? 51   GLN 3 N   1 
ATOM   1317  C  CA  . GLN C  3  51   ? -0.857  83.014  -9.034  1.00 146.46 ? 51   GLN 3 CA  1 
ATOM   1318  C  C   . GLN C  3  51   ? -0.158  82.831  -7.678  1.00 149.22 ? 51   GLN 3 C   1 
ATOM   1319  O  O   . GLN C  3  51   ? 0.422   81.779  -7.405  1.00 148.25 ? 51   GLN 3 O   1 
ATOM   1320  C  CB  . GLN C  3  51   ? -2.376  82.874  -8.869  1.00 143.30 ? 51   GLN 3 CB  1 
ATOM   1321  C  CG  . GLN C  3  51   ? -2.807  82.121  -7.612  1.00 140.56 ? 51   GLN 3 CG  1 
ATOM   1322  C  CD  . GLN C  3  51   ? -4.269  82.339  -7.268  1.00 141.55 ? 51   GLN 3 CD  1 
ATOM   1323  O  OE1 . GLN C  3  51   ? -4.917  83.236  -7.806  1.00 141.01 ? 51   GLN 3 OE1 1 
ATOM   1324  N  NE2 . GLN C  3  51   ? -4.796  81.514  -6.368  1.00 143.47 ? 51   GLN 3 NE2 1 
ATOM   1325  N  N   . GLN C  3  52   ? -0.227  83.861  -6.834  1.00 149.90 ? 52   GLN 3 N   1 
ATOM   1326  C  CA  . GLN C  3  52   ? 0.446   83.864  -5.534  1.00 145.59 ? 52   GLN 3 CA  1 
ATOM   1327  C  C   . GLN C  3  52   ? -0.508  84.156  -4.370  1.00 147.52 ? 52   GLN 3 C   1 
ATOM   1328  O  O   . GLN C  3  52   ? -1.501  84.870  -4.531  1.00 155.45 ? 52   GLN 3 O   1 
ATOM   1329  C  CB  . GLN C  3  52   ? 1.560   84.911  -5.520  1.00 139.90 ? 52   GLN 3 CB  1 
ATOM   1330  C  CG  . GLN C  3  52   ? 2.669   84.698  -6.528  1.00 137.08 ? 52   GLN 3 CG  1 
ATOM   1331  C  CD  . GLN C  3  52   ? 3.687   85.824  -6.489  1.00 134.14 ? 52   GLN 3 CD  1 
ATOM   1332  O  OE1 . GLN C  3  52   ? 3.520   86.842  -7.158  1.00 129.33 ? 52   GLN 3 OE1 1 
ATOM   1333  N  NE2 . GLN C  3  52   ? 4.741   85.652  -5.690  1.00 135.44 ? 52   GLN 3 NE2 1 
ATOM   1334  N  N   . VAL C  3  53   ? -0.191  83.621  -3.193  1.00 137.33 ? 53   VAL 3 N   1 
ATOM   1335  C  CA  . VAL C  3  53   ? -0.985  83.882  -1.993  1.00 129.03 ? 53   VAL 3 CA  1 
ATOM   1336  C  C   . VAL C  3  53   ? -0.186  84.699  -0.981  1.00 120.98 ? 53   VAL 3 C   1 
ATOM   1337  O  O   . VAL C  3  53   ? 0.906   84.307  -0.591  1.00 108.32 ? 53   VAL 3 O   1 
ATOM   1338  C  CB  . VAL C  3  53   ? -1.461  82.571  -1.336  1.00 127.80 ? 53   VAL 3 CB  1 
ATOM   1339  C  CG1 . VAL C  3  53   ? -2.466  82.863  -0.237  1.00 129.66 ? 53   VAL 3 CG1 1 
ATOM   1340  C  CG2 . VAL C  3  53   ? -2.075  81.667  -2.374  1.00 127.81 ? 53   VAL 3 CG2 1 
ATOM   1341  N  N   . TRP C  3  54   ? -0.740  85.834  -0.563  1.00 120.75 ? 54   TRP 3 N   1 
ATOM   1342  C  CA  . TRP C  3  54   ? -0.056  86.754  0.348   1.00 117.50 ? 54   TRP 3 CA  1 
ATOM   1343  C  C   . TRP C  3  54   ? -0.765  86.850  1.690   1.00 117.07 ? 54   TRP 3 C   1 
ATOM   1344  O  O   . TRP C  3  54   ? -1.974  86.640  1.777   1.00 121.92 ? 54   TRP 3 O   1 
ATOM   1345  C  CB  . TRP C  3  54   ? -0.021  88.165  -0.240  1.00 118.93 ? 54   TRP 3 CB  1 
ATOM   1346  C  CG  . TRP C  3  54   ? 0.807   88.351  -1.472  1.00 120.03 ? 54   TRP 3 CG  1 
ATOM   1347  C  CD1 . TRP C  3  54   ? 1.553   87.411  -2.125  1.00 116.78 ? 54   TRP 3 CD1 1 
ATOM   1348  C  CD2 . TRP C  3  54   ? 0.971   89.572  -2.204  1.00 120.28 ? 54   TRP 3 CD2 1 
ATOM   1349  N  NE1 . TRP C  3  54   ? 2.173   87.973  -3.217  1.00 115.27 ? 54   TRP 3 NE1 1 
ATOM   1350  C  CE2 . TRP C  3  54   ? 1.830   89.299  -3.288  1.00 118.19 ? 54   TRP 3 CE2 1 
ATOM   1351  C  CE3 . TRP C  3  54   ? 0.472   90.870  -2.046  1.00 119.42 ? 54   TRP 3 CE3 1 
ATOM   1352  C  CZ2 . TRP C  3  54   ? 2.205   90.276  -4.206  1.00 119.08 ? 54   TRP 3 CZ2 1 
ATOM   1353  C  CZ3 . TRP C  3  54   ? 0.841   91.835  -2.957  1.00 119.58 ? 54   TRP 3 CZ3 1 
ATOM   1354  C  CH2 . TRP C  3  54   ? 1.702   91.536  -4.023  1.00 120.94 ? 54   TRP 3 CH2 1 
ATOM   1355  N  N   . LEU C  3  55   ? -0.007  87.184  2.730   1.00 114.29 ? 55   LEU 3 N   1 
ATOM   1356  C  CA  . LEU C  3  55   ? -0.578  87.599  4.010   1.00 114.29 ? 55   LEU 3 CA  1 
ATOM   1357  C  C   . LEU C  3  55   ? -0.216  89.061  4.243   1.00 112.58 ? 55   LEU 3 C   1 
ATOM   1358  O  O   . LEU C  3  55   ? 0.938   89.451  4.054   1.00 113.51 ? 55   LEU 3 O   1 
ATOM   1359  C  CB  . LEU C  3  55   ? -0.039  86.750  5.163   1.00 113.07 ? 55   LEU 3 CB  1 
ATOM   1360  C  CG  . LEU C  3  55   ? -0.607  87.124  6.536   1.00 108.25 ? 55   LEU 3 CG  1 
ATOM   1361  C  CD1 . LEU C  3  55   ? -2.072  86.787  6.591   1.00 108.94 ? 55   LEU 3 CD1 1 
ATOM   1362  C  CD2 . LEU C  3  55   ? 0.127   86.427  7.655   1.00 102.13 ? 55   LEU 3 CD2 1 
ATOM   1363  N  N   . ILE C  3  56   ? -1.194  89.871  4.639   1.00 109.09 ? 56   ILE 3 N   1 
ATOM   1364  C  CA  . ILE C  3  56   ? -0.959  91.295  4.836   1.00 106.83 ? 56   ILE 3 CA  1 
ATOM   1365  C  C   . ILE C  3  56   ? -1.529  91.757  6.169   1.00 114.43 ? 56   ILE 3 C   1 
ATOM   1366  O  O   . ILE C  3  56   ? -2.687  91.454  6.492   1.00 110.04 ? 56   ILE 3 O   1 
ATOM   1367  C  CB  . ILE C  3  56   ? -1.582  92.139  3.705   1.00 109.97 ? 56   ILE 3 CB  1 
ATOM   1368  C  CG1 . ILE C  3  56   ? -1.108  91.650  2.336   1.00 109.42 ? 56   ILE 3 CG1 1 
ATOM   1369  C  CG2 . ILE C  3  56   ? -1.235  93.605  3.874   1.00 108.74 ? 56   ILE 3 CG2 1 
ATOM   1370  C  CD1 . ILE C  3  56   ? -1.866  92.245  1.172   1.00 111.73 ? 56   ILE 3 CD1 1 
ATOM   1371  N  N   . LYS C  3  57   ? -0.706  92.479  6.938   1.00 110.61 ? 57   LYS 3 N   1 
ATOM   1372  C  CA  . LYS C  3  57   ? -1.142  93.131  8.172   1.00 109.76 ? 57   LYS 3 CA  1 
ATOM   1373  C  C   . LYS C  3  57   ? -1.495  94.591  7.923   1.00 109.39 ? 57   LYS 3 C   1 
ATOM   1374  O  O   . LYS C  3  57   ? -0.705  95.334  7.351   1.00 105.60 ? 57   LYS 3 O   1 
ATOM   1375  C  CB  . LYS C  3  57   ? -0.059  93.048  9.251   1.00 112.77 ? 57   LYS 3 CB  1 
ATOM   1376  C  CG  . LYS C  3  57   ? -0.364  93.870  10.518  1.00 117.57 ? 57   LYS 3 CG  1 
ATOM   1377  C  CD  . LYS C  3  57   ? 0.409   95.206  10.566  1.00 117.84 ? 57   LYS 3 CD  1 
ATOM   1378  C  CE  . LYS C  3  57   ? -0.108  96.106  11.679  1.00 120.35 ? 57   LYS 3 CE  1 
ATOM   1379  N  NZ  . LYS C  3  57   ? 0.583   97.416  11.762  1.00 121.24 ? 57   LYS 3 NZ  1 
ATOM   1380  N  N   . PHE C  3  58   ? -2.690  94.981  8.356   1.00 113.13 ? 58   PHE 3 N   1 
ATOM   1381  C  CA  . PHE C  3  58   ? -3.149  96.367  8.335   1.00 116.82 ? 58   PHE 3 CA  1 
ATOM   1382  C  C   . PHE C  3  58   ? -3.411  96.756  9.778   1.00 120.94 ? 58   PHE 3 C   1 
ATOM   1383  O  O   . PHE C  3  58   ? -3.679  95.886  10.607  1.00 123.35 ? 58   PHE 3 O   1 
ATOM   1384  C  CB  . PHE C  3  58   ? -4.466  96.497  7.557   1.00 111.12 ? 58   PHE 3 CB  1 
ATOM   1385  C  CG  . PHE C  3  58   ? -4.309  96.439  6.063   1.00 115.75 ? 58   PHE 3 CG  1 
ATOM   1386  C  CD1 . PHE C  3  58   ? -4.034  97.581  5.334   1.00 115.81 ? 58   PHE 3 CD1 1 
ATOM   1387  C  CD2 . PHE C  3  58   ? -4.449  95.243  5.385   1.00 119.28 ? 58   PHE 3 CD2 1 
ATOM   1388  C  CE1 . PHE C  3  58   ? -3.891  97.527  3.961   1.00 115.82 ? 58   PHE 3 CE1 1 
ATOM   1389  C  CE2 . PHE C  3  58   ? -4.305  95.185  4.015   1.00 121.85 ? 58   PHE 3 CE2 1 
ATOM   1390  C  CZ  . PHE C  3  58   ? -4.027  96.328  3.303   1.00 119.99 ? 58   PHE 3 CZ  1 
ATOM   1391  N  N   . PRO C  3  59   ? -3.328  98.059  10.093  1.00 119.44 ? 59   PRO 3 N   1 
ATOM   1392  C  CA  . PRO C  3  59   ? -3.756  98.529  11.412  1.00 114.92 ? 59   PRO 3 CA  1 
ATOM   1393  C  C   . PRO C  3  59   ? -5.228  98.228  11.596  1.00 114.14 ? 59   PRO 3 C   1 
ATOM   1394  O  O   . PRO C  3  59   ? -5.986  98.390  10.649  1.00 111.81 ? 59   PRO 3 O   1 
ATOM   1395  C  CB  . PRO C  3  59   ? -3.543  100.034 11.320  1.00 118.10 ? 59   PRO 3 CB  1 
ATOM   1396  C  CG  . PRO C  3  59   ? -2.439  100.184 10.332  1.00 117.29 ? 59   PRO 3 CG  1 
ATOM   1397  C  CD  . PRO C  3  59   ? -2.693  99.129  9.307   1.00 118.67 ? 59   PRO 3 CD  1 
ATOM   1398  N  N   . SER C  3  60   ? -5.621  97.792  12.785  1.00 118.24 ? 60   SER 3 N   1 
ATOM   1399  C  CA  . SER C  3  60   ? -6.995  97.357  13.031  1.00 127.77 ? 60   SER 3 CA  1 
ATOM   1400  C  C   . SER C  3  60   ? -8.047  98.442  12.749  1.00 130.86 ? 60   SER 3 C   1 
ATOM   1401  O  O   . SER C  3  60   ? -9.196  98.129  12.424  1.00 126.79 ? 60   SER 3 O   1 
ATOM   1402  C  CB  . SER C  3  60   ? -7.138  96.819  14.462  1.00 132.62 ? 60   SER 3 CB  1 
ATOM   1403  O  OG  . SER C  3  60   ? -6.726  97.781  15.423  1.00 134.79 ? 60   SER 3 OG  1 
ATOM   1404  N  N   . ASN C  3  61   ? -7.637  99.707  12.865  1.00 134.61 ? 61   ASN 3 N   1 
ATOM   1405  C  CA  . ASN C  3  61   ? -8.514  100.862 12.655  1.00 131.32 ? 61   ASN 3 CA  1 
ATOM   1406  C  C   . ASN C  3  61   ? -8.767  101.208 11.188  1.00 130.33 ? 61   ASN 3 C   1 
ATOM   1407  O  O   . ASN C  3  61   ? -9.493  102.155 10.888  1.00 132.87 ? 61   ASN 3 O   1 
ATOM   1408  C  CB  . ASN C  3  61   ? -7.949  102.094 13.370  1.00 130.74 ? 61   ASN 3 CB  1 
ATOM   1409  C  CG  . ASN C  3  61   ? -6.466  102.298 13.100  1.00 133.89 ? 61   ASN 3 CG  1 
ATOM   1410  O  OD1 . ASN C  3  61   ? -6.054  102.558 11.969  1.00 137.37 ? 61   ASN 3 OD1 1 
ATOM   1411  N  ND2 . ASN C  3  61   ? -5.656  102.186 14.147  1.00 134.24 ? 61   ASN 3 ND2 1 
ATOM   1412  N  N   . VAL C  3  62   ? -8.168  100.446 10.278  1.00 129.06 ? 62   VAL 3 N   1 
ATOM   1413  C  CA  . VAL C  3  62   ? -8.303  100.716 8.849   1.00 130.79 ? 62   VAL 3 CA  1 
ATOM   1414  C  C   . VAL C  3  62   ? -9.422  99.909  8.200   1.00 132.38 ? 62   VAL 3 C   1 
ATOM   1415  O  O   . VAL C  3  62   ? -9.421  98.678  8.236   1.00 128.98 ? 62   VAL 3 O   1 
ATOM   1416  C  CB  . VAL C  3  62   ? -6.984  100.461 8.093   1.00 128.59 ? 62   VAL 3 CB  1 
ATOM   1417  C  CG1 . VAL C  3  62   ? -7.201  100.528 6.586   1.00 125.69 ? 62   VAL 3 CG1 1 
ATOM   1418  C  CG2 . VAL C  3  62   ? -5.932  101.467 8.526   1.00 128.42 ? 62   VAL 3 CG2 1 
ATOM   1419  N  N   . ASP C  3  63   ? -10.381 100.619 7.618   1.00 136.45 ? 63   ASP 3 N   1 
ATOM   1420  C  CA  . ASP C  3  63   ? -11.420 99.979  6.832   1.00 140.64 ? 63   ASP 3 CA  1 
ATOM   1421  C  C   . ASP C  3  63   ? -10.810 99.470  5.535   1.00 138.95 ? 63   ASP 3 C   1 
ATOM   1422  O  O   . ASP C  3  63   ? -10.530 100.249 4.618   1.00 134.72 ? 63   ASP 3 O   1 
ATOM   1423  C  CB  . ASP C  3  63   ? -12.536 100.968 6.522   1.00 144.51 ? 63   ASP 3 CB  1 
ATOM   1424  C  CG  . ASP C  3  63   ? -13.710 100.321 5.812   1.00 150.40 ? 63   ASP 3 CG  1 
ATOM   1425  O  OD1 . ASP C  3  63   ? -13.630 99.121  5.479   1.00 146.88 ? 63   ASP 3 OD1 1 
ATOM   1426  O  OD2 . ASP C  3  63   ? -14.720 101.022 5.580   1.00 159.44 ? 63   ASP 3 OD2 1 
ATOM   1427  N  N   . ILE C  3  64   ? -10.616 98.158  5.462   1.00 139.03 ? 64   ILE 3 N   1 
ATOM   1428  C  CA  . ILE C  3  64   ? -9.995  97.545  4.299   1.00 142.40 ? 64   ILE 3 CA  1 
ATOM   1429  C  C   . ILE C  3  64   ? -10.974 97.469  3.137   1.00 144.81 ? 64   ILE 3 C   1 
ATOM   1430  O  O   . ILE C  3  64   ? -10.575 97.436  1.971   1.00 147.66 ? 64   ILE 3 O   1 
ATOM   1431  C  CB  . ILE C  3  64   ? -9.513  96.132  4.628   1.00 146.54 ? 64   ILE 3 CB  1 
ATOM   1432  C  CG1 . ILE C  3  64   ? -8.928  96.102  6.038   1.00 149.90 ? 64   ILE 3 CG1 1 
ATOM   1433  C  CG2 . ILE C  3  64   ? -8.499  95.657  3.596   1.00 146.98 ? 64   ILE 3 CG2 1 
ATOM   1434  C  CD1 . ILE C  3  64   ? -8.296  94.787  6.393   1.00 152.18 ? 64   ILE 3 CD1 1 
ATOM   1435  N  N   . SER C  3  65   ? -12.261 97.457  3.464   1.00 141.77 ? 65   SER 3 N   1 
ATOM   1436  C  CA  . SER C  3  65   ? -13.305 97.269  2.466   1.00 142.22 ? 65   SER 3 CA  1 
ATOM   1437  C  C   . SER C  3  65   ? -13.354 98.385  1.424   1.00 138.91 ? 65   SER 3 C   1 
ATOM   1438  O  O   . SER C  3  65   ? -14.054 98.265  0.418   1.00 135.28 ? 65   SER 3 O   1 
ATOM   1439  C  CB  . SER C  3  65   ? -14.666 97.124  3.146   1.00 149.27 ? 65   SER 3 CB  1 
ATOM   1440  O  OG  . SER C  3  65   ? -15.059 98.334  3.774   1.00 154.93 ? 65   SER 3 OG  1 
ATOM   1441  N  N   . LYS C  3  66   ? -12.619 99.468  1.660   1.00 138.83 ? 66   LYS 3 N   1 
ATOM   1442  C  CA  . LYS C  3  66   ? -12.598 100.561 0.696   1.00 143.15 ? 66   LYS 3 CA  1 
ATOM   1443  C  C   . LYS C  3  66   ? -11.199 101.081 0.375   1.00 139.87 ? 66   LYS 3 C   1 
ATOM   1444  O  O   . LYS C  3  66   ? -10.786 102.136 0.851   1.00 139.23 ? 66   LYS 3 O   1 
ATOM   1445  C  CB  . LYS C  3  66   ? -13.560 101.694 1.101   1.00 149.37 ? 66   LYS 3 CB  1 
ATOM   1446  C  CG  . LYS C  3  66   ? -13.519 102.124 2.562   1.00 149.95 ? 66   LYS 3 CG  1 
ATOM   1447  C  CD  . LYS C  3  66   ? -14.700 103.047 2.870   1.00 152.38 ? 66   LYS 3 CD  1 
ATOM   1448  C  CE  . LYS C  3  66   ? -14.393 104.007 4.021   1.00 150.54 ? 66   LYS 3 CE  1 
ATOM   1449  N  NZ  . LYS C  3  66   ? -14.377 103.361 5.360   1.00 144.99 ? 66   LYS 3 NZ  1 
ATOM   1450  N  N   . LEU C  3  67   ? -10.481 100.321 -0.447  1.00 140.60 ? 67   LEU 3 N   1 
ATOM   1451  C  CA  . LEU C  3  67   ? -9.172  100.731 -0.938  1.00 142.53 ? 67   LEU 3 CA  1 
ATOM   1452  C  C   . LEU C  3  67   ? -9.108  100.538 -2.449  1.00 146.76 ? 67   LEU 3 C   1 
ATOM   1453  O  O   . LEU C  3  67   ? -10.073 100.086 -3.068  1.00 150.45 ? 67   LEU 3 O   1 
ATOM   1454  C  CB  . LEU C  3  67   ? -8.068  99.901  -0.291  1.00 140.02 ? 67   LEU 3 CB  1 
ATOM   1455  C  CG  . LEU C  3  67   ? -8.219  99.485  1.172   1.00 139.30 ? 67   LEU 3 CG  1 
ATOM   1456  C  CD1 . LEU C  3  67   ? -7.091  98.536  1.548   1.00 135.43 ? 67   LEU 3 CD1 1 
ATOM   1457  C  CD2 . LEU C  3  67   ? -8.246  100.700 2.090   1.00 139.21 ? 67   LEU 3 CD2 1 
ATOM   1458  N  N   . LYS C  3  68   ? -7.964  100.873 -3.036  1.00 143.85 ? 68   LYS 3 N   1 
ATOM   1459  C  CA  . LYS C  3  68   ? -7.765  100.695 -4.470  1.00 144.67 ? 68   LYS 3 CA  1 
ATOM   1460  C  C   . LYS C  3  68   ? -6.331  100.301 -4.799  1.00 150.16 ? 68   LYS 3 C   1 
ATOM   1461  O  O   . LYS C  3  68   ? -6.097  99.259  -5.406  1.00 154.92 ? 68   LYS 3 O   1 
ATOM   1462  C  CB  . LYS C  3  68   ? -8.153  101.959 -5.244  1.00 142.74 ? 68   LYS 3 CB  1 
ATOM   1463  C  CG  . LYS C  3  68   ? -9.610  101.988 -5.725  1.00 141.08 ? 68   LYS 3 CG  1 
ATOM   1464  C  CD  . LYS C  3  68   ? -9.902  103.241 -6.549  1.00 140.43 ? 68   LYS 3 CD  1 
ATOM   1465  C  CE  . LYS C  3  68   ? -11.355 103.293 -7.001  1.00 144.70 ? 68   LYS 3 CE  1 
ATOM   1466  N  NZ  . LYS C  3  68   ? -11.730 104.602 -7.627  1.00 146.41 ? 68   LYS 3 NZ  1 
ATOM   1467  N  N   . SER C  3  69   ? -5.375  101.133 -4.397  1.00 151.81 ? 69   SER 3 N   1 
ATOM   1468  C  CA  . SER C  3  69   ? -3.966  100.901 -4.723  1.00 156.30 ? 69   SER 3 CA  1 
ATOM   1469  C  C   . SER C  3  69   ? -3.250  99.916  -3.795  1.00 156.29 ? 69   SER 3 C   1 
ATOM   1470  O  O   . SER C  3  69   ? -3.849  99.364  -2.867  1.00 156.12 ? 69   SER 3 O   1 
ATOM   1471  C  CB  . SER C  3  69   ? -3.191  102.224 -4.760  1.00 159.32 ? 69   SER 3 CB  1 
ATOM   1472  O  OG  . SER C  3  69   ? -1.786  101.999 -4.679  1.00 159.08 ? 69   SER 3 OG  1 
ATOM   1473  N  N   . LEU C  3  70   ? -1.957  99.733  -4.065  1.00 154.40 ? 70   LEU 3 N   1 
ATOM   1474  C  CA  . LEU C  3  70   ? -1.094  98.801  -3.356  1.00 152.02 ? 70   LEU 3 CA  1 
ATOM   1475  C  C   . LEU C  3  70   ? 0.226   98.724  -4.123  1.00 157.72 ? 70   LEU 3 C   1 
ATOM   1476  O  O   . LEU C  3  70   ? 0.226   98.430  -5.317  1.00 160.02 ? 70   LEU 3 O   1 
ATOM   1477  C  CB  . LEU C  3  70   ? -1.733  97.413  -3.301  1.00 146.71 ? 70   LEU 3 CB  1 
ATOM   1478  C  CG  . LEU C  3  70   ? -1.593  96.660  -1.981  1.00 141.32 ? 70   LEU 3 CG  1 
ATOM   1479  C  CD1 . LEU C  3  70   ? -2.111  97.496  -0.816  1.00 137.19 ? 70   LEU 3 CD1 1 
ATOM   1480  C  CD2 . LEU C  3  70   ? -2.324  95.333  -2.063  1.00 139.59 ? 70   LEU 3 CD2 1 
ATOM   1481  N  N   . PRO C  3  71   ? 1.354   99.013  -3.449  1.00 156.44 ? 71   PRO 3 N   1 
ATOM   1482  C  CA  . PRO C  3  71   ? 2.684   99.013  -4.084  1.00 149.45 ? 71   PRO 3 CA  1 
ATOM   1483  C  C   . PRO C  3  71   ? 3.474   97.709  -3.955  1.00 140.24 ? 71   PRO 3 C   1 
ATOM   1484  O  O   . PRO C  3  71   ? 3.103   96.849  -3.161  1.00 111.71 ? 71   PRO 3 O   1 
ATOM   1485  C  CB  . PRO C  3  71   ? 3.427   100.136 -3.339  1.00 150.84 ? 71   PRO 3 CB  1 
ATOM   1486  C  CG  . PRO C  3  71   ? 2.374   100.828 -2.486  1.00 154.06 ? 71   PRO 3 CG  1 
ATOM   1487  C  CD  . PRO C  3  71   ? 1.360   99.776  -2.195  1.00 155.34 ? 71   PRO 3 CD  1 
ATOM   1488  N  N   . VAL C  3  72   ? 4.555   97.597  -4.732  1.00 135.79 ? 72   VAL 3 N   1 
ATOM   1489  C  CA  . VAL C  3  72   ? 5.459   96.437  -4.723  1.00 139.05 ? 72   VAL 3 CA  1 
ATOM   1490  C  C   . VAL C  3  72   ? 6.873   96.831  -4.255  1.00 139.05 ? 72   VAL 3 C   1 
ATOM   1491  O  O   . VAL C  3  72   ? 7.464   96.208  -3.360  1.00 135.70 ? 72   VAL 3 O   1 
ATOM   1492  C  CB  . VAL C  3  72   ? 5.553   95.750  -6.137  1.00 128.92 ? 72   VAL 3 CB  1 
ATOM   1493  C  CG1 . VAL C  3  72   ? 6.761   94.804  -6.226  1.00 124.34 ? 72   VAL 3 CG1 1 
ATOM   1494  C  CG2 . VAL C  3  72   ? 4.257   95.010  -6.490  1.00 127.46 ? 72   VAL 3 CG2 1 
ATOM   1495  N  N   . SER C  3  77   ? 9.436   97.582  -1.017  1.00 139.10 ? 77   SER 3 N   1 
ATOM   1496  C  CA  . SER C  3  77   ? 9.794   98.037  0.334   1.00 137.85 ? 77   SER 3 CA  1 
ATOM   1497  C  C   . SER C  3  77   ? 9.695   99.561  0.470   1.00 143.13 ? 77   SER 3 C   1 
ATOM   1498  O  O   . SER C  3  77   ? 10.701  100.233 0.714   1.00 141.75 ? 77   SER 3 O   1 
ATOM   1499  C  CB  . SER C  3  77   ? 11.213  97.582  0.706   1.00 128.18 ? 77   SER 3 CB  1 
ATOM   1500  O  OG  . SER C  3  77   ? 11.391  96.195  0.478   1.00 122.84 ? 77   SER 3 OG  1 
ATOM   1501  N  N   . THR C  3  78   ? 8.484   100.102 0.325   1.00 146.65 ? 78   THR 3 N   1 
ATOM   1502  C  CA  . THR C  3  78   ? 8.292   101.554 0.271   1.00 143.99 ? 78   THR 3 CA  1 
ATOM   1503  C  C   . THR C  3  78   ? 7.057   102.076 0.995   1.00 146.31 ? 78   THR 3 C   1 
ATOM   1504  O  O   . THR C  3  78   ? 6.680   101.590 2.060   1.00 148.26 ? 78   THR 3 O   1 
ATOM   1505  C  CB  . THR C  3  78   ? 8.178   102.070 -1.179  1.00 141.74 ? 78   THR 3 CB  1 
ATOM   1506  O  OG1 . THR C  3  78   ? 7.194   101.301 -1.887  1.00 142.15 ? 78   THR 3 OG1 1 
ATOM   1507  C  CG2 . THR C  3  78   ? 9.523   102.008 -1.894  1.00 139.28 ? 78   THR 3 CG2 1 
ATOM   1508  N  N   . THR C  3  79   ? 6.427   103.071 0.379   1.00 144.70 ? 79   THR 3 N   1 
ATOM   1509  C  CA  . THR C  3  79   ? 5.430   103.887 1.050   1.00 141.05 ? 79   THR 3 CA  1 
ATOM   1510  C  C   . THR C  3  79   ? 4.084   103.860 0.351   1.00 143.34 ? 79   THR 3 C   1 
ATOM   1511  O  O   . THR C  3  79   ? 4.008   103.698 -0.867  1.00 146.80 ? 79   THR 3 O   1 
ATOM   1512  C  CB  . THR C  3  79   ? 5.883   105.353 1.121   1.00 136.73 ? 79   THR 3 CB  1 
ATOM   1513  O  OG1 . THR C  3  79   ? 4.821   106.150 1.657   1.00 139.42 ? 79   THR 3 OG1 1 
ATOM   1514  C  CG2 . THR C  3  79   ? 6.239   105.865 -0.268  1.00 136.42 ? 79   THR 3 CG2 1 
ATOM   1515  N  N   . MET C  3  80   ? 3.026   104.026 1.140   1.00 140.19 ? 80   MET 3 N   1 
ATOM   1516  C  CA  . MET C  3  80   ? 1.670   104.160 0.620   1.00 136.15 ? 80   MET 3 CA  1 
ATOM   1517  C  C   . MET C  3  80   ? 0.826   104.986 1.575   1.00 138.60 ? 80   MET 3 C   1 
ATOM   1518  O  O   . MET C  3  80   ? 1.097   105.053 2.773   1.00 136.23 ? 80   MET 3 O   1 
ATOM   1519  C  CB  . MET C  3  80   ? 1.011   102.794 0.412   1.00 131.63 ? 80   MET 3 CB  1 
ATOM   1520  C  CG  . MET C  3  80   ? 0.621   102.067 1.695   1.00 127.32 ? 80   MET 3 CG  1 
ATOM   1521  S  SD  . MET C  3  80   ? -0.366  100.594 1.365   1.00 219.14 ? 80   MET 3 SD  1 
ATOM   1522  C  CE  . MET C  3  80   ? -1.602  101.271 0.268   1.00 117.02 ? 80   MET 3 CE  1 
ATOM   1523  N  N   . THR C  3  81   ? -0.199  105.628 1.037   1.00 147.54 ? 81   THR 3 N   1 
ATOM   1524  C  CA  . THR C  3  81   ? -1.157  106.329 1.877   1.00 156.13 ? 81   THR 3 CA  1 
ATOM   1525  C  C   . THR C  3  81   ? -2.531  105.668 1.755   1.00 161.55 ? 81   THR 3 C   1 
ATOM   1526  O  O   . THR C  3  81   ? -2.933  105.223 0.676   1.00 165.54 ? 81   THR 3 O   1 
ATOM   1527  C  CB  . THR C  3  81   ? -1.258  107.838 1.538   1.00 124.36 ? 81   THR 3 CB  1 
ATOM   1528  O  OG1 . THR C  3  81   ? -2.283  108.046 0.560   1.00 127.03 ? 81   THR 3 OG1 1 
ATOM   1529  C  CG2 . THR C  3  81   ? 0.082   108.386 1.027   1.00 117.21 ? 81   THR 3 CG2 1 
ATOM   1530  N  N   . ILE C  3  82   ? -3.234  105.584 2.878   1.00 159.10 ? 82   ILE 3 N   1 
ATOM   1531  C  CA  . ILE C  3  82   ? -4.582  105.041 2.907   1.00 158.33 ? 82   ILE 3 CA  1 
ATOM   1532  C  C   . ILE C  3  82   ? -5.429  106.047 3.661   1.00 156.13 ? 82   ILE 3 C   1 
ATOM   1533  O  O   . ILE C  3  82   ? -5.110  106.396 4.801   1.00 142.71 ? 82   ILE 3 O   1 
ATOM   1534  C  CB  . ILE C  3  82   ? -4.640  103.661 3.607   1.00 157.25 ? 82   ILE 3 CB  1 
ATOM   1535  C  CG1 . ILE C  3  82   ? -3.675  102.676 2.940   1.00 154.73 ? 82   ILE 3 CG1 1 
ATOM   1536  C  CG2 . ILE C  3  82   ? -6.056  103.106 3.593   1.00 158.69 ? 82   ILE 3 CG2 1 
ATOM   1537  C  CD1 . ILE C  3  82   ? -3.614  101.332 3.617   1.00 152.23 ? 82   ILE 3 CD1 1 
ATOM   1538  N  N   . ASP C  3  83   ? -6.493  106.517 3.009   1.00 168.47 ? 83   ASP 3 N   1 
ATOM   1539  C  CA  . ASP C  3  83   ? -7.333  107.603 3.523   1.00 179.18 ? 83   ASP 3 CA  1 
ATOM   1540  C  C   . ASP C  3  83   ? -6.529  108.859 3.891   1.00 183.34 ? 83   ASP 3 C   1 
ATOM   1541  O  O   . ASP C  3  83   ? -6.660  109.404 4.993   1.00 179.09 ? 83   ASP 3 O   1 
ATOM   1542  C  CB  . ASP C  3  83   ? -8.201  107.133 4.695   1.00 182.56 ? 83   ASP 3 CB  1 
ATOM   1543  C  CG  . ASP C  3  83   ? -9.491  106.472 4.236   1.00 187.93 ? 83   ASP 3 CG  1 
ATOM   1544  O  OD1 . ASP C  3  83   ? -10.113 106.979 3.274   1.00 191.83 ? 83   ASP 3 OD1 1 
ATOM   1545  O  OD2 . ASP C  3  83   ? -9.886  105.447 4.834   1.00 187.34 ? 83   ASP 3 OD2 1 
ATOM   1546  N  N   . LYS C  3  84   ? -5.704  109.306 2.943   1.00 188.82 ? 84   LYS 3 N   1 
ATOM   1547  C  CA  . LYS C  3  84   ? -4.861  110.509 3.068   1.00 187.70 ? 84   LYS 3 CA  1 
ATOM   1548  C  C   . LYS C  3  84   ? -3.808  110.467 4.192   1.00 186.06 ? 84   LYS 3 C   1 
ATOM   1549  O  O   . LYS C  3  84   ? -2.930  111.330 4.256   1.00 184.90 ? 84   LYS 3 O   1 
ATOM   1550  C  CB  . LYS C  3  84   ? -5.700  111.793 3.166   1.00 186.59 ? 84   LYS 3 CB  1 
ATOM   1551  C  CG  . LYS C  3  84   ? -7.097  111.741 2.529   1.00 190.10 ? 84   LYS 3 CG  1 
ATOM   1552  C  CD  . LYS C  3  84   ? -7.099  111.605 1.006   1.00 188.54 ? 84   LYS 3 CD  1 
ATOM   1553  C  CE  . LYS C  3  84   ? -8.536  111.569 0.485   1.00 186.47 ? 84   LYS 3 CE  1 
ATOM   1554  N  NZ  . LYS C  3  84   ? -8.628  111.491 -0.998  1.00 185.64 ? 84   LYS 3 NZ  1 
ATOM   1555  N  N   . HIS C  3  85   ? -3.898  109.475 5.072   1.00 182.15 ? 85   HIS 3 N   1 
ATOM   1556  C  CA  . HIS C  3  85   ? -2.865  109.253 6.071   1.00 171.71 ? 85   HIS 3 CA  1 
ATOM   1557  C  C   . HIS C  3  85   ? -1.825  108.319 5.459   1.00 165.04 ? 85   HIS 3 C   1 
ATOM   1558  O  O   . HIS C  3  85   ? -2.181  107.435 4.678   1.00 163.29 ? 85   HIS 3 O   1 
ATOM   1559  C  CB  . HIS C  3  85   ? -3.466  108.642 7.336   1.00 168.62 ? 85   HIS 3 CB  1 
ATOM   1560  C  CG  . HIS C  3  85   ? -2.519  108.612 8.494   1.00 167.04 ? 85   HIS 3 CG  1 
ATOM   1561  N  ND1 . HIS C  3  85   ? -2.421  107.537 9.351   1.00 165.37 ? 85   HIS 3 ND1 1 
ATOM   1562  C  CD2 . HIS C  3  85   ? -1.621  109.526 8.932   1.00 167.29 ? 85   HIS 3 CD2 1 
ATOM   1563  C  CE1 . HIS C  3  85   ? -1.504  107.790 10.269  1.00 164.16 ? 85   HIS 3 CE1 1 
ATOM   1564  N  NE2 . HIS C  3  85   ? -1.004  108.991 10.037  1.00 165.47 ? 85   HIS 3 NE2 1 
ATOM   1565  N  N   . ASP C  3  86   ? -0.549  108.515 5.797   1.00 160.43 ? 86   ASP 3 N   1 
ATOM   1566  C  CA  . ASP C  3  86   ? 0.526   107.720 5.183   1.00 155.74 ? 86   ASP 3 CA  1 
ATOM   1567  C  C   . ASP C  3  86   ? 1.189   106.628 6.044   1.00 142.62 ? 86   ASP 3 C   1 
ATOM   1568  O  O   . ASP C  3  86   ? 1.523   106.820 7.223   1.00 132.40 ? 86   ASP 3 O   1 
ATOM   1569  C  CB  . ASP C  3  86   ? 1.579   108.606 4.495   1.00 158.22 ? 86   ASP 3 CB  1 
ATOM   1570  C  CG  . ASP C  3  86   ? 1.919   109.844 5.292   1.00 158.14 ? 86   ASP 3 CG  1 
ATOM   1571  O  OD1 . ASP C  3  86   ? 1.930   109.765 6.538   1.00 158.51 ? 86   ASP 3 OD1 1 
ATOM   1572  O  OD2 . ASP C  3  86   ? 2.180   110.896 4.668   1.00 157.73 ? 86   ASP 3 OD2 1 
ATOM   1573  N  N   . TYR C  3  87   ? 1.372   105.478 5.400   1.00 137.78 ? 87   TYR 3 N   1 
ATOM   1574  C  CA  . TYR C  3  87   ? 1.887   104.281 6.033   1.00 130.91 ? 87   TYR 3 CA  1 
ATOM   1575  C  C   . TYR C  3  87   ? 3.117   103.787 5.282   1.00 128.81 ? 87   TYR 3 C   1 
ATOM   1576  O  O   . TYR C  3  87   ? 3.557   104.405 4.310   1.00 129.14 ? 87   TYR 3 O   1 
ATOM   1577  C  CB  . TYR C  3  87   ? 0.810   103.190 6.048   1.00 127.21 ? 87   TYR 3 CB  1 
ATOM   1578  C  CG  . TYR C  3  87   ? -0.384  103.533 6.904   1.00 125.50 ? 87   TYR 3 CG  1 
ATOM   1579  C  CD1 . TYR C  3  87   ? -1.458  104.231 6.380   1.00 131.99 ? 87   TYR 3 CD1 1 
ATOM   1580  C  CD2 . TYR C  3  87   ? -0.431  103.169 8.239   1.00 123.44 ? 87   TYR 3 CD2 1 
ATOM   1581  C  CE1 . TYR C  3  87   ? -2.556  104.560 7.171   1.00 135.74 ? 87   TYR 3 CE1 1 
ATOM   1582  C  CE2 . TYR C  3  87   ? -1.519  103.490 9.037   1.00 126.55 ? 87   TYR 3 CE2 1 
ATOM   1583  C  CZ  . TYR C  3  87   ? -2.579  104.184 8.501   1.00 130.52 ? 87   TYR 3 CZ  1 
ATOM   1584  O  OH  . TYR C  3  87   ? -3.661  104.497 9.294   1.00 129.85 ? 87   TYR 3 OH  1 
ATOM   1585  N  N   . LYS C  3  88   ? 3.658   102.663 5.739   1.00 124.13 ? 88   LYS 3 N   1 
ATOM   1586  C  CA  . LYS C  3  88   ? 4.853   102.072 5.160   1.00 120.00 ? 88   LYS 3 CA  1 
ATOM   1587  C  C   . LYS C  3  88   ? 4.607   100.571 4.958   1.00 125.96 ? 88   LYS 3 C   1 
ATOM   1588  O  O   . LYS C  3  88   ? 4.124   99.888  5.863   1.00 129.08 ? 88   LYS 3 O   1 
ATOM   1589  C  CB  . LYS C  3  88   ? 6.035   102.316 6.106   1.00 112.17 ? 88   LYS 3 CB  1 
ATOM   1590  C  CG  . LYS C  3  88   ? 7.385   101.786 5.657   1.00 107.59 ? 88   LYS 3 CG  1 
ATOM   1591  C  CD  . LYS C  3  88   ? 8.366   101.867 6.819   1.00 103.17 ? 88   LYS 3 CD  1 
ATOM   1592  C  CE  . LYS C  3  88   ? 9.813   101.735 6.378   1.00 103.87 ? 88   LYS 3 CE  1 
ATOM   1593  N  NZ  . LYS C  3  88   ? 10.749  101.997 7.511   1.00 100.45 ? 88   LYS 3 NZ  1 
ATOM   1594  N  N   . ILE C  3  89   ? 4.908   100.063 3.766   1.00 126.61 ? 89   ILE 3 N   1 
ATOM   1595  C  CA  . ILE C  3  89   ? 4.797   98.627  3.504   1.00 124.21 ? 89   ILE 3 CA  1 
ATOM   1596  C  C   . ILE C  3  89   ? 6.152   97.923  3.597   1.00 120.02 ? 89   ILE 3 C   1 
ATOM   1597  O  O   . ILE C  3  89   ? 7.096   98.267  2.882   1.00 123.06 ? 89   ILE 3 O   1 
ATOM   1598  C  CB  . ILE C  3  89   ? 4.184   98.343  2.124   1.00 126.84 ? 89   ILE 3 CB  1 
ATOM   1599  C  CG1 . ILE C  3  89   ? 2.701   98.702  2.119   1.00 130.79 ? 89   ILE 3 CG1 1 
ATOM   1600  C  CG2 . ILE C  3  89   ? 4.355   96.880  1.761   1.00 129.18 ? 89   ILE 3 CG2 1 
ATOM   1601  C  CD1 . ILE C  3  89   ? 1.881   97.904  1.112   1.00 136.91 ? 89   ILE 3 CD1 1 
ATOM   1602  N  N   . MET C  3  90   ? 6.250   96.937  4.481   1.00 111.78 ? 90   MET 3 N   1 
ATOM   1603  C  CA  . MET C  3  90   ? 7.507   96.228  4.658   1.00 106.35 ? 90   MET 3 CA  1 
ATOM   1604  C  C   . MET C  3  90   ? 7.350   94.773  4.247   1.00 111.68 ? 90   MET 3 C   1 
ATOM   1605  O  O   . MET C  3  90   ? 6.304   94.169  4.494   1.00 111.58 ? 90   MET 3 O   1 
ATOM   1606  C  CB  . MET C  3  90   ? 7.978   96.322  6.110   1.00 102.39 ? 90   MET 3 CB  1 
ATOM   1607  C  CG  . MET C  3  90   ? 8.472   97.702  6.529   1.00 97.62  ? 90   MET 3 CG  1 
ATOM   1608  S  SD  . MET C  3  90   ? 8.659   97.824  8.317   1.00 173.02 ? 90   MET 3 SD  1 
ATOM   1609  C  CE  . MET C  3  90   ? 7.115   97.098  8.866   1.00 129.46 ? 90   MET 3 CE  1 
ATOM   1610  N  N   . ASP C  3  91   ? 8.391   94.227  3.615   1.00 112.27 ? 91   ASP 3 N   1 
ATOM   1611  C  CA  . ASP C  3  91   ? 8.431   92.828  3.190   1.00 110.50 ? 91   ASP 3 CA  1 
ATOM   1612  C  C   . ASP C  3  91   ? 8.956   91.958  4.334   1.00 106.86 ? 91   ASP 3 C   1 
ATOM   1613  O  O   . ASP C  3  91   ? 10.139  91.627  4.388   1.00 109.50 ? 91   ASP 3 O   1 
ATOM   1614  C  CB  . ASP C  3  91   ? 9.317   92.679  1.939   1.00 113.98 ? 91   ASP 3 CB  1 
ATOM   1615  C  CG  . ASP C  3  91   ? 9.211   91.291  1.275   1.00 116.45 ? 91   ASP 3 CG  1 
ATOM   1616  O  OD1 . ASP C  3  91   ? 8.714   90.342  1.917   1.00 114.68 ? 91   ASP 3 OD1 1 
ATOM   1617  O  OD2 . ASP C  3  91   ? 9.644   91.148  0.106   1.00 99.00  ? 91   ASP 3 OD2 1 
ATOM   1618  N  N   . ASP C  3  92   ? 8.068   91.581  5.245   1.00 103.59 ? 92   ASP 3 N   1 
ATOM   1619  C  CA  . ASP C  3  92   ? 8.457   90.789  6.403   1.00 103.88 ? 92   ASP 3 CA  1 
ATOM   1620  C  C   . ASP C  3  92   ? 8.435   89.297  6.115   1.00 110.46 ? 92   ASP 3 C   1 
ATOM   1621  O  O   . ASP C  3  92   ? 8.206   88.499  7.023   1.00 109.84 ? 92   ASP 3 O   1 
ATOM   1622  C  CB  . ASP C  3  92   ? 7.552   91.095  7.594   1.00 105.28 ? 92   ASP 3 CB  1 
ATOM   1623  C  CG  . ASP C  3  92   ? 7.727   92.507  8.100   1.00 112.06 ? 92   ASP 3 CG  1 
ATOM   1624  O  OD1 . ASP C  3  92   ? 8.717   93.156  7.701   1.00 111.76 ? 92   ASP 3 OD1 1 
ATOM   1625  O  OD2 . ASP C  3  92   ? 6.889   92.969  8.902   1.00 118.98 ? 92   ASP 3 OD2 1 
ATOM   1626  N  N   . THR C  3  93   ? 8.682   88.919  4.861   1.00 115.19 ? 93   THR 3 N   1 
ATOM   1627  C  CA  . THR C  3  93   ? 8.660   87.511  4.474   1.00 114.97 ? 93   THR 3 CA  1 
ATOM   1628  C  C   . THR C  3  93   ? 9.748   86.702  5.184   1.00 115.01 ? 93   THR 3 C   1 
ATOM   1629  O  O   . THR C  3  93   ? 9.505   85.564  5.591   1.00 112.18 ? 93   THR 3 O   1 
ATOM   1630  C  CB  . THR C  3  93   ? 8.773   87.342  2.946   1.00 115.18 ? 93   THR 3 CB  1 
ATOM   1631  O  OG1 . THR C  3  93   ? 7.701   88.048  2.313   1.00 119.18 ? 93   THR 3 OG1 1 
ATOM   1632  C  CG2 . THR C  3  93   ? 8.694   85.876  2.552   1.00 111.02 ? 93   THR 3 CG2 1 
ATOM   1633  N  N   . ASP C  3  94   ? 10.932  87.291  5.357   1.00 117.35 ? 94   ASP 3 N   1 
ATOM   1634  C  CA  . ASP C  3  94   ? 12.044  86.586  6.018   1.00 118.33 ? 94   ASP 3 CA  1 
ATOM   1635  C  C   . ASP C  3  94   ? 11.869  86.389  7.534   1.00 112.84 ? 94   ASP 3 C   1 
ATOM   1636  O  O   . ASP C  3  94   ? 12.700  85.746  8.183   1.00 99.22  ? 94   ASP 3 O   1 
ATOM   1637  C  CB  . ASP C  3  94   ? 13.399  87.237  5.701   1.00 121.45 ? 94   ASP 3 CB  1 
ATOM   1638  C  CG  . ASP C  3  94   ? 13.389  88.740  5.890   1.00 129.14 ? 94   ASP 3 CG  1 
ATOM   1639  O  OD1 . ASP C  3  94   ? 12.742  89.223  6.847   1.00 132.29 ? 94   ASP 3 OD1 1 
ATOM   1640  O  OD2 . ASP C  3  94   ? 14.030  89.438  5.074   1.00 131.61 ? 94   ASP 3 OD2 1 
ATOM   1641  N  N   . ILE C  3  95   ? 10.786  86.940  8.082   1.00 118.20 ? 95   ILE 3 N   1 
ATOM   1642  C  CA  . ILE C  3  95   ? 10.426  86.753  9.490   1.00 118.25 ? 95   ILE 3 CA  1 
ATOM   1643  C  C   . ILE C  3  95   ? 9.420   85.607  9.646   1.00 119.76 ? 95   ILE 3 C   1 
ATOM   1644  O  O   . ILE C  3  95   ? 9.523   84.795  10.576  1.00 89.06  ? 95   ILE 3 O   1 
ATOM   1645  C  CB  . ILE C  3  95   ? 9.840   88.055  10.100  1.00 102.72 ? 95   ILE 3 CB  1 
ATOM   1646  C  CG1 . ILE C  3  95   ? 10.827  89.213  9.927   1.00 97.10  ? 95   ILE 3 CG1 1 
ATOM   1647  C  CG2 . ILE C  3  95   ? 9.490   87.862  11.568  1.00 88.57  ? 95   ILE 3 CG2 1 
ATOM   1648  C  CD1 . ILE C  3  95   ? 10.302  90.535  10.410  1.00 93.11  ? 95   ILE 3 CD1 1 
ATOM   1649  N  N   . GLU C  3  96   ? 8.456   85.551  8.724   1.00 118.35 ? 96   GLU 3 N   1 
ATOM   1650  C  CA  . GLU C  3  96   ? 7.457   84.485  8.690   1.00 113.89 ? 96   GLU 3 CA  1 
ATOM   1651  C  C   . GLU C  3  96   ? 8.046   83.190  8.130   1.00 112.67 ? 96   GLU 3 C   1 
ATOM   1652  O  O   . GLU C  3  96   ? 7.597   82.095  8.471   1.00 119.71 ? 96   GLU 3 O   1 
ATOM   1653  C  CB  . GLU C  3  96   ? 6.246   84.908  7.852   1.00 116.22 ? 96   GLU 3 CB  1 
ATOM   1654  C  CG  . GLU C  3  96   ? 5.007   84.012  8.010   1.00 122.62 ? 96   GLU 3 CG  1 
ATOM   1655  C  CD  . GLU C  3  96   ? 4.995   82.796  7.086   1.00 127.54 ? 96   GLU 3 CD  1 
ATOM   1656  O  OE1 . GLU C  3  96   ? 5.575   82.858  5.979   1.00 127.05 ? 96   GLU 3 OE1 1 
ATOM   1657  O  OE2 . GLU C  3  96   ? 4.396   81.769  7.471   1.00 133.34 ? 96   GLU 3 OE2 1 
ATOM   1658  N  N   . SER C  3  97   ? 9.054   83.310  7.273   1.00 104.80 ? 97   SER 3 N   1 
ATOM   1659  C  CA  . SER C  3  97   ? 9.656   82.133  6.664   1.00 104.15 ? 97   SER 3 CA  1 
ATOM   1660  C  C   . SER C  3  97   ? 11.105  82.386  6.282   1.00 105.54 ? 97   SER 3 C   1 
ATOM   1661  O  O   . SER C  3  97   ? 11.644  83.455  6.551   1.00 110.10 ? 97   SER 3 O   1 
ATOM   1662  C  CB  . SER C  3  97   ? 8.880   81.747  5.412   1.00 106.87 ? 97   SER 3 CB  1 
ATOM   1663  O  OG  . SER C  3  97   ? 9.248   82.592  4.334   1.00 106.99 ? 97   SER 3 OG  1 
ATOM   1664  N  N   . SER C  3  98   ? 11.734  81.402  5.648   1.00 104.52 ? 98   SER 3 N   1 
ATOM   1665  C  CA  . SER C  3  98   ? 13.090  81.576  5.136   1.00 102.66 ? 98   SER 3 CA  1 
ATOM   1666  C  C   . SER C  3  98   ? 13.080  81.929  3.662   1.00 108.66 ? 98   SER 3 C   1 
ATOM   1667  O  O   . SER C  3  98   ? 12.328  81.346  2.878   1.00 112.89 ? 98   SER 3 O   1 
ATOM   1668  C  CB  . SER C  3  98   ? 13.926  80.312  5.331   1.00 97.16  ? 98   SER 3 CB  1 
ATOM   1669  O  OG  . SER C  3  98   ? 15.210  80.454  4.734   1.00 89.04  ? 98   SER 3 OG  1 
ATOM   1670  N  N   . LEU C  3  99   ? 13.929  82.877  3.284   1.00 108.57 ? 99   LEU 3 N   1 
ATOM   1671  C  CA  . LEU C  3  99   ? 14.051  83.254  1.885   1.00 108.40 ? 99   LEU 3 CA  1 
ATOM   1672  C  C   . LEU C  3  99   ? 14.917  82.250  1.137   1.00 111.19 ? 99   LEU 3 C   1 
ATOM   1673  O  O   . LEU C  3  99   ? 14.677  81.980  -0.037  1.00 117.70 ? 99   LEU 3 O   1 
ATOM   1674  C  CB  . LEU C  3  99   ? 14.620  84.673  1.749   1.00 105.84 ? 99   LEU 3 CB  1 
ATOM   1675  C  CG  . LEU C  3  99   ? 13.800  85.814  2.365   1.00 105.22 ? 99   LEU 3 CG  1 
ATOM   1676  C  CD1 . LEU C  3  99   ? 14.381  87.181  2.016   1.00 91.93  ? 99   LEU 3 CD1 1 
ATOM   1677  C  CD2 . LEU C  3  99   ? 12.344  85.720  1.937   1.00 108.92 ? 99   LEU 3 CD2 1 
ATOM   1678  N  N   . THR C  3  100  ? 15.904  81.681  1.829   1.00 110.35 ? 100  THR 3 N   1 
ATOM   1679  C  CA  . THR C  3  100  ? 16.886  80.796  1.194   1.00 109.79 ? 100  THR 3 CA  1 
ATOM   1680  C  C   . THR C  3  100  ? 16.493  79.315  1.205   1.00 107.67 ? 100  THR 3 C   1 
ATOM   1681  O  O   . THR C  3  100  ? 16.965  78.532  0.375   1.00 108.58 ? 100  THR 3 O   1 
ATOM   1682  C  CB  . THR C  3  100  ? 18.307  80.946  1.821   1.00 90.77  ? 100  THR 3 CB  1 
ATOM   1683  O  OG1 . THR C  3  100  ? 18.409  80.166  3.025   1.00 87.93  ? 100  THR 3 OG1 1 
ATOM   1684  C  CG2 . THR C  3  100  ? 18.623  82.408  2.113   1.00 94.21  ? 100  THR 3 CG2 1 
ATOM   1685  N  N   . GLN C  3  101  ? 15.633  78.927  2.138   1.00 104.84 ? 101  GLN 3 N   1 
ATOM   1686  C  CA  . GLN C  3  101  ? 15.282  77.519  2.270   1.00 109.76 ? 101  GLN 3 CA  1 
ATOM   1687  C  C   . GLN C  3  101  ? 13.776  77.277  2.380   1.00 113.44 ? 101  GLN 3 C   1 
ATOM   1688  O  O   . GLN C  3  101  ? 13.058  78.043  3.023   1.00 116.74 ? 101  GLN 3 O   1 
ATOM   1689  C  CB  . GLN C  3  101  ? 16.023  76.899  3.457   1.00 114.17 ? 101  GLN 3 CB  1 
ATOM   1690  C  CG  . GLN C  3  101  ? 15.565  75.491  3.808   1.00 123.34 ? 101  GLN 3 CG  1 
ATOM   1691  C  CD  . GLN C  3  101  ? 16.560  74.733  4.668   1.00 125.92 ? 101  GLN 3 CD  1 
ATOM   1692  O  OE1 . GLN C  3  101  ? 17.751  75.053  4.695   1.00 127.65 ? 101  GLN 3 OE1 1 
ATOM   1693  N  NE2 . GLN C  3  101  ? 16.073  73.718  5.376   1.00 121.79 ? 101  GLN 3 NE2 1 
ATOM   1694  N  N   . ASP C  3  102  ? 13.309  76.206  1.742   1.00 114.54 ? 102  ASP 3 N   1 
ATOM   1695  C  CA  . ASP C  3  102  ? 11.894  75.828  1.755   1.00 114.97 ? 102  ASP 3 CA  1 
ATOM   1696  C  C   . ASP C  3  102  ? 11.445  75.185  3.073   1.00 116.22 ? 102  ASP 3 C   1 
ATOM   1697  O  O   . ASP C  3  102  ? 12.263  74.711  3.862   1.00 116.33 ? 102  ASP 3 O   1 
ATOM   1698  C  CB  . ASP C  3  102  ? 11.585  74.874  0.591   1.00 110.69 ? 102  ASP 3 CB  1 
ATOM   1699  C  CG  . ASP C  3  102  ? 10.092  74.726  0.329   1.00 109.93 ? 102  ASP 3 CG  1 
ATOM   1700  O  OD1 . ASP C  3  102  ? 9.391   75.759  0.319   1.00 109.25 ? 102  ASP 3 OD1 1 
ATOM   1701  O  OD2 . ASP C  3  102  ? 9.615   73.583  0.137   1.00 111.08 ? 102  ASP 3 OD2 1 
ATOM   1702  N  N   . ASN C  3  103  ? 10.132  75.187  3.291   1.00 116.75 ? 103  ASN 3 N   1 
ATOM   1703  C  CA  . ASN C  3  103  ? 9.491   74.513  4.417   1.00 113.47 ? 103  ASN 3 CA  1 
ATOM   1704  C  C   . ASN C  3  103  ? 9.836   75.095  5.789   1.00 112.65 ? 103  ASN 3 C   1 
ATOM   1705  O  O   . ASN C  3  103  ? 9.687   74.430  6.814   1.00 114.19 ? 103  ASN 3 O   1 
ATOM   1706  C  CB  . ASN C  3  103  ? 9.775   73.009  4.377   1.00 112.68 ? 103  ASN 3 CB  1 
ATOM   1707  C  CG  . ASN C  3  103  ? 8.727   72.199  5.117   1.00 117.80 ? 103  ASN 3 CG  1 
ATOM   1708  O  OD1 . ASN C  3  103  ? 7.524   72.454  5.002   1.00 126.30 ? 103  ASN 3 OD1 1 
ATOM   1709  N  ND2 . ASN C  3  103  ? 9.181   71.222  5.891   1.00 111.04 ? 103  ASN 3 ND2 1 
ATOM   1710  N  N   . LEU C  3  104  ? 10.284  76.344  5.811   1.00 108.75 ? 104  LEU 3 N   1 
ATOM   1711  C  CA  . LEU C  3  104  ? 10.550  77.013  7.076   1.00 105.91 ? 104  LEU 3 CA  1 
ATOM   1712  C  C   . LEU C  3  104  ? 9.506   78.082  7.410   1.00 109.97 ? 104  LEU 3 C   1 
ATOM   1713  O  O   . LEU C  3  104  ? 9.838   79.131  7.967   1.00 105.65 ? 104  LEU 3 O   1 
ATOM   1714  C  CB  . LEU C  3  104  ? 11.945  77.627  7.063   1.00 102.53 ? 104  LEU 3 CB  1 
ATOM   1715  C  CG  . LEU C  3  104  ? 13.078  76.611  7.181   1.00 98.53  ? 104  LEU 3 CG  1 
ATOM   1716  C  CD1 . LEU C  3  104  ? 14.415  77.326  7.303   1.00 91.73  ? 104  LEU 3 CD1 1 
ATOM   1717  C  CD2 . LEU C  3  104  ? 12.838  75.671  8.362   1.00 95.09  ? 104  LEU 3 CD2 1 
ATOM   1718  N  N   . SER C  3  105  ? 8.247   77.799  7.079   1.00 116.03 ? 105  SER 3 N   1 
ATOM   1719  C  CA  . SER C  3  105  ? 7.149   78.742  7.285   1.00 114.77 ? 105  SER 3 CA  1 
ATOM   1720  C  C   . SER C  3  105  ? 6.460   78.576  8.630   1.00 108.66 ? 105  SER 3 C   1 
ATOM   1721  O  O   . SER C  3  105  ? 6.109   77.464  9.029   1.00 106.41 ? 105  SER 3 O   1 
ATOM   1722  C  CB  . SER C  3  105  ? 6.109   78.598  6.176   1.00 123.27 ? 105  SER 3 CB  1 
ATOM   1723  O  OG  . SER C  3  105  ? 6.503   79.304  5.013   1.00 127.77 ? 105  SER 3 OG  1 
ATOM   1724  N  N   . ASN C  3  106  ? 6.255   79.700  9.309   1.00 108.80 ? 106  ASN 3 N   1 
ATOM   1725  C  CA  . ASN C  3  106  ? 5.544   79.740  10.586  1.00 109.99 ? 106  ASN 3 CA  1 
ATOM   1726  C  C   . ASN C  3  106  ? 4.051   79.442  10.457  1.00 111.59 ? 106  ASN 3 C   1 
ATOM   1727  O  O   . ASN C  3  106  ? 3.449   78.831  11.341  1.00 110.70 ? 106  ASN 3 O   1 
ATOM   1728  C  CB  . ASN C  3  106  ? 5.710   81.111  11.250  1.00 109.91 ? 106  ASN 3 CB  1 
ATOM   1729  C  CG  . ASN C  3  106  ? 7.148   81.400  11.671  1.00 110.60 ? 106  ASN 3 CG  1 
ATOM   1730  O  OD1 . ASN C  3  106  ? 7.983   80.491  11.770  1.00 103.45 ? 106  ASN 3 OD1 1 
ATOM   1731  N  ND2 . ASN C  3  106  ? 7.437   82.679  11.939  1.00 111.90 ? 106  ASN 3 ND2 1 
ATOM   1732  N  N   . MET C  3  107  ? 3.455   79.879  9.352   1.00 112.80 ? 107  MET 3 N   1 
ATOM   1733  C  CA  . MET C  3  107  ? 2.006   79.836  9.211   1.00 112.52 ? 107  MET 3 CA  1 
ATOM   1734  C  C   . MET C  3  107  ? 1.515   78.849  8.174   1.00 118.05 ? 107  MET 3 C   1 
ATOM   1735  O  O   . MET C  3  107  ? 2.160   78.613  7.145   1.00 117.98 ? 107  MET 3 O   1 
ATOM   1736  C  CB  . MET C  3  107  ? 1.466   81.220  8.881   1.00 110.12 ? 107  MET 3 CB  1 
ATOM   1737  C  CG  . MET C  3  107  ? 1.528   82.177  10.048  1.00 109.86 ? 107  MET 3 CG  1 
ATOM   1738  S  SD  . MET C  3  107  ? 1.594   83.887  9.499   1.00 122.50 ? 107  MET 3 SD  1 
ATOM   1739  C  CE  . MET C  3  107  ? 1.328   84.734  11.049  1.00 135.09 ? 107  MET 3 CE  1 
ATOM   1740  N  N   . THR C  3  108  ? 0.351   78.282  8.469   1.00 121.51 ? 108  THR 3 N   1 
ATOM   1741  C  CA  . THR C  3  108  ? -0.339  77.374  7.567   1.00 119.64 ? 108  THR 3 CA  1 
ATOM   1742  C  C   . THR C  3  108  ? -1.760  77.903  7.307   1.00 120.21 ? 108  THR 3 C   1 
ATOM   1743  O  O   . THR C  3  108  ? -2.462  78.327  8.228   1.00 116.90 ? 108  THR 3 O   1 
ATOM   1744  C  CB  . THR C  3  108  ? -0.343  75.932  8.118   1.00 112.55 ? 108  THR 3 CB  1 
ATOM   1745  O  OG1 . THR C  3  108  ? -0.529  75.964  9.538   1.00 101.53 ? 108  THR 3 OG1 1 
ATOM   1746  C  CG2 . THR C  3  108  ? 0.993   75.246  7.816   1.00 107.94 ? 108  THR 3 CG2 1 
ATOM   1747  N  N   . LEU C  3  109  ? -2.159  77.903  6.038   1.00 119.94 ? 109  LEU 3 N   1 
ATOM   1748  C  CA  . LEU C  3  109  ? -3.417  78.500  5.619   1.00 113.53 ? 109  LEU 3 CA  1 
ATOM   1749  C  C   . LEU C  3  109  ? -4.533  77.479  5.718   1.00 115.38 ? 109  LEU 3 C   1 
ATOM   1750  O  O   . LEU C  3  109  ? -4.349  76.312  5.353   1.00 113.91 ? 109  LEU 3 O   1 
ATOM   1751  C  CB  . LEU C  3  109  ? -3.296  79.007  4.183   1.00 112.45 ? 109  LEU 3 CB  1 
ATOM   1752  C  CG  . LEU C  3  109  ? -4.517  79.666  3.551   1.00 113.42 ? 109  LEU 3 CG  1 
ATOM   1753  C  CD1 . LEU C  3  109  ? -5.048  80.782  4.433   1.00 113.66 ? 109  LEU 3 CD1 1 
ATOM   1754  C  CD2 . LEU C  3  109  ? -4.144  80.204  2.187   1.00 111.75 ? 109  LEU 3 CD2 1 
ATOM   1755  N  N   . LEU C  3  110  ? -5.684  77.919  6.217   1.00 118.72 ? 110  LEU 3 N   1 
ATOM   1756  C  CA  . LEU C  3  110  ? -6.846  77.045  6.353   1.00 124.49 ? 110  LEU 3 CA  1 
ATOM   1757  C  C   . LEU C  3  110  ? -8.033  77.562  5.535   1.00 130.09 ? 110  LEU 3 C   1 
ATOM   1758  O  O   . LEU C  3  110  ? -8.560  78.643  5.803   1.00 128.87 ? 110  LEU 3 O   1 
ATOM   1759  C  CB  . LEU C  3  110  ? -7.238  76.886  7.825   1.00 120.60 ? 110  LEU 3 CB  1 
ATOM   1760  C  CG  . LEU C  3  110  ? -6.181  76.347  8.792   1.00 116.86 ? 110  LEU 3 CG  1 
ATOM   1761  C  CD1 . LEU C  3  110  ? -6.766  76.144  10.181  1.00 114.14 ? 110  LEU 3 CD1 1 
ATOM   1762  C  CD2 . LEU C  3  110  ? -5.593  75.050  8.275   1.00 120.23 ? 110  LEU 3 CD2 1 
ATOM   1763  N  N   . VAL C  3  111  ? -8.451  76.777  4.543   1.00 131.62 ? 111  VAL 3 N   1 
ATOM   1764  C  CA  . VAL C  3  111  ? -9.531  77.173  3.637   1.00 130.90 ? 111  VAL 3 CA  1 
ATOM   1765  C  C   . VAL C  3  111  ? -10.808 76.364  3.896   1.00 132.28 ? 111  VAL 3 C   1 
ATOM   1766  O  O   . VAL C  3  111  ? -10.745 75.279  4.479   1.00 129.98 ? 111  VAL 3 O   1 
ATOM   1767  C  CB  . VAL C  3  111  ? -9.098  77.012  2.163   1.00 123.21 ? 111  VAL 3 CB  1 
ATOM   1768  C  CG1 . VAL C  3  111  ? -7.964  77.962  1.842   1.00 117.25 ? 111  VAL 3 CG1 1 
ATOM   1769  C  CG2 . VAL C  3  111  ? -8.690  75.592  1.893   1.00 123.44 ? 111  VAL 3 CG2 1 
ATOM   1770  N  N   . PRO C  3  112  ? -11.975 76.898  3.485   1.00 131.65 ? 112  PRO 3 N   1 
ATOM   1771  C  CA  . PRO C  3  112  ? -13.226 76.160  3.679   1.00 129.43 ? 112  PRO 3 CA  1 
ATOM   1772  C  C   . PRO C  3  112  ? -13.225 74.828  2.940   1.00 133.26 ? 112  PRO 3 C   1 
ATOM   1773  O  O   . PRO C  3  112  ? -12.737 74.747  1.810   1.00 130.17 ? 112  PRO 3 O   1 
ATOM   1774  C  CB  . PRO C  3  112  ? -14.282 77.098  3.081   1.00 127.79 ? 112  PRO 3 CB  1 
ATOM   1775  C  CG  . PRO C  3  112  ? -13.524 78.033  2.199   1.00 125.19 ? 112  PRO 3 CG  1 
ATOM   1776  C  CD  . PRO C  3  112  ? -12.216 78.221  2.884   1.00 133.38 ? 112  PRO 3 CD  1 
ATOM   1777  N  N   . SER C  3  113  ? -13.758 73.794  3.584   1.00 140.55 ? 113  SER 3 N   1 
ATOM   1778  C  CA  . SER C  3  113  ? -13.828 72.463  2.982   1.00 145.39 ? 113  SER 3 CA  1 
ATOM   1779  C  C   . SER C  3  113  ? -15.121 72.258  2.184   1.00 150.85 ? 113  SER 3 C   1 
ATOM   1780  O  O   . SER C  3  113  ? -15.929 73.180  2.033   1.00 146.19 ? 113  SER 3 O   1 
ATOM   1781  C  CB  . SER C  3  113  ? -13.662 71.366  4.041   1.00 141.59 ? 113  SER 3 CB  1 
ATOM   1782  O  OG  . SER C  3  113  ? -14.647 71.470  5.054   1.00 141.87 ? 113  SER 3 OG  1 
ATOM   1783  N  N   . GLU C  3  114  ? -15.308 71.037  1.686   1.00 156.40 ? 114  GLU 3 N   1 
ATOM   1784  C  CA  . GLU C  3  114  ? -16.391 70.728  0.753   1.00 161.81 ? 114  GLU 3 CA  1 
ATOM   1785  C  C   . GLU C  3  114  ? -17.755 70.645  1.430   1.00 162.63 ? 114  GLU 3 C   1 
ATOM   1786  O  O   . GLU C  3  114  ? -18.500 69.687  1.227   1.00 168.24 ? 114  GLU 3 O   1 
ATOM   1787  C  CB  . GLU C  3  114  ? -16.096 69.420  0.017   1.00 167.79 ? 114  GLU 3 CB  1 
ATOM   1788  C  CG  . GLU C  3  114  ? -14.700 69.359  -0.595  1.00 171.25 ? 114  GLU 3 CG  1 
ATOM   1789  C  CD  . GLU C  3  114  ? -14.490 70.397  -1.684  1.00 171.34 ? 114  GLU 3 CD  1 
ATOM   1790  O  OE1 . GLU C  3  114  ? -15.473 70.724  -2.392  1.00 172.60 ? 114  GLU 3 OE1 1 
ATOM   1791  O  OE2 . GLU C  3  114  ? -13.342 70.886  -1.824  1.00 165.99 ? 114  GLU 3 OE2 1 
ATOM   1792  N  N   . SER C  3  115  ? -18.079 71.662  2.220   1.00 156.86 ? 115  SER 3 N   1 
ATOM   1793  C  CA  . SER C  3  115  ? -19.320 71.694  2.972   1.00 156.62 ? 115  SER 3 CA  1 
ATOM   1794  C  C   . SER C  3  115  ? -19.557 73.117  3.437   1.00 162.24 ? 115  SER 3 C   1 
ATOM   1795  O  O   . SER C  3  115  ? -20.653 73.463  3.872   1.00 164.69 ? 115  SER 3 O   1 
ATOM   1796  C  CB  . SER C  3  115  ? -19.227 70.772  4.190   1.00 151.08 ? 115  SER 3 CB  1 
ATOM   1797  O  OG  . SER C  3  115  ? -18.290 71.265  5.142   1.00 144.70 ? 115  SER 3 OG  1 
ATOM   1798  N  N   . LYS C  3  116  ? -18.507 73.930  3.344   1.00 162.13 ? 116  LYS 3 N   1 
ATOM   1799  C  CA  . LYS C  3  116  ? -18.518 75.308  3.831   1.00 159.50 ? 116  LYS 3 CA  1 
ATOM   1800  C  C   . LYS C  3  116  ? -18.899 75.392  5.308   1.00 159.02 ? 116  LYS 3 C   1 
ATOM   1801  O  O   . LYS C  3  116  ? -19.404 76.417  5.754   1.00 163.11 ? 116  LYS 3 O   1 
ATOM   1802  C  CB  . LYS C  3  116  ? -19.454 76.192  2.996   1.00 160.24 ? 116  LYS 3 CB  1 
ATOM   1803  C  CG  . LYS C  3  116  ? -19.098 76.302  1.520   1.00 161.96 ? 116  LYS 3 CG  1 
ATOM   1804  C  CD  . LYS C  3  116  ? -20.341 76.631  0.691   1.00 166.16 ? 116  LYS 3 CD  1 
ATOM   1805  C  CE  . LYS C  3  116  ? -20.011 76.872  -0.772  1.00 166.43 ? 116  LYS 3 CE  1 
ATOM   1806  N  NZ  . LYS C  3  116  ? -19.135 78.067  -0.939  1.00 166.10 ? 116  LYS 3 NZ  1 
ATOM   1807  N  N   . GLU C  3  117  ? -18.657 74.321  6.063   1.00 154.68 ? 117  GLU 3 N   1 
ATOM   1808  C  CA  . GLU C  3  117  ? -18.959 74.319  7.493   1.00 153.58 ? 117  GLU 3 CA  1 
ATOM   1809  C  C   . GLU C  3  117  ? -17.726 73.961  8.326   1.00 152.27 ? 117  GLU 3 C   1 
ATOM   1810  O  O   . GLU C  3  117  ? -17.819 73.753  9.538   1.00 151.70 ? 117  GLU 3 O   1 
ATOM   1811  C  CB  . GLU C  3  117  ? -20.109 73.360  7.799   1.00 156.42 ? 117  GLU 3 CB  1 
ATOM   1812  C  CG  . GLU C  3  117  ? -20.875 73.683  9.076   1.00 161.19 ? 117  GLU 3 CG  1 
ATOM   1813  C  CD  . GLU C  3  117  ? -22.215 72.967  9.147   1.00 171.25 ? 117  GLU 3 CD  1 
ATOM   1814  O  OE1 . GLU C  3  117  ? -22.340 71.867  8.562   1.00 173.47 ? 117  GLU 3 OE1 1 
ATOM   1815  O  OE2 . GLU C  3  117  ? -23.150 73.511  9.777   1.00 175.23 ? 117  GLU 3 OE2 1 
ATOM   1816  N  N   . SER C  3  118  ? -16.572 73.896  7.666   1.00 147.97 ? 118  SER 3 N   1 
ATOM   1817  C  CA  . SER C  3  118  ? -15.313 73.593  8.337   1.00 140.94 ? 118  SER 3 CA  1 
ATOM   1818  C  C   . SER C  3  118  ? -14.118 73.976  7.468   1.00 134.20 ? 118  SER 3 C   1 
ATOM   1819  O  O   . SER C  3  118  ? -14.282 74.465  6.350   1.00 131.44 ? 118  SER 3 O   1 
ATOM   1820  C  CB  . SER C  3  118  ? -15.239 72.112  8.710   1.00 143.40 ? 118  SER 3 CB  1 
ATOM   1821  O  OG  . SER C  3  118  ? -15.184 71.298  7.552   1.00 148.98 ? 118  SER 3 OG  1 
ATOM   1822  N  N   . LEU C  3  119  ? -12.917 73.740  7.985   1.00 129.73 ? 119  LEU 3 N   1 
ATOM   1823  C  CA  . LEU C  3  119  ? -11.703 74.186  7.318   1.00 125.50 ? 119  LEU 3 CA  1 
ATOM   1824  C  C   . LEU C  3  119  ? -10.728 73.041  7.078   1.00 126.67 ? 119  LEU 3 C   1 
ATOM   1825  O  O   . LEU C  3  119  ? -10.603 72.132  7.897   1.00 127.21 ? 119  LEU 3 O   1 
ATOM   1826  C  CB  . LEU C  3  119  ? -11.031 75.287  8.141   1.00 123.01 ? 119  LEU 3 CB  1 
ATOM   1827  C  CG  . LEU C  3  119  ? -11.846 76.572  8.321   1.00 122.05 ? 119  LEU 3 CG  1 
ATOM   1828  C  CD1 . LEU C  3  119  ? -11.291 77.435  9.443   1.00 116.31 ? 119  LEU 3 CD1 1 
ATOM   1829  C  CD2 . LEU C  3  119  ? -11.893 77.357  7.021   1.00 121.42 ? 119  LEU 3 CD2 1 
ATOM   1830  N  N   . LYS C  3  120  ? -10.050 73.091  5.937   1.00 129.30 ? 120  LYS 3 N   1 
ATOM   1831  C  CA  . LYS C  3  120  ? -9.010  72.126  5.603   1.00 132.66 ? 120  LYS 3 CA  1 
ATOM   1832  C  C   . LYS C  3  120  ? -7.708  72.887  5.422   1.00 135.04 ? 120  LYS 3 C   1 
ATOM   1833  O  O   . LYS C  3  120  ? -7.722  74.084  5.131   1.00 140.40 ? 120  LYS 3 O   1 
ATOM   1834  C  CB  . LYS C  3  120  ? -9.353  71.374  4.310   1.00 137.00 ? 120  LYS 3 CB  1 
ATOM   1835  C  CG  . LYS C  3  120  ? -10.154 70.095  4.517   1.00 142.27 ? 120  LYS 3 CG  1 
ATOM   1836  C  CD  . LYS C  3  120  ? -10.659 69.516  3.199   1.00 145.99 ? 120  LYS 3 CD  1 
ATOM   1837  C  CE  . LYS C  3  120  ? -11.556 68.299  3.434   1.00 148.33 ? 120  LYS 3 CE  1 
ATOM   1838  N  NZ  . LYS C  3  120  ? -12.626 68.148  2.398   1.00 149.22 ? 120  LYS 3 NZ  1 
ATOM   1839  N  N   . ILE C  3  121  ? -6.584  72.205  5.603   1.00 128.00 ? 121  ILE 3 N   1 
ATOM   1840  C  CA  . ILE C  3  121  ? -5.298  72.821  5.331   1.00 125.09 ? 121  ILE 3 CA  1 
ATOM   1841  C  C   . ILE C  3  121  ? -5.160  73.049  3.834   1.00 132.96 ? 121  ILE 3 C   1 
ATOM   1842  O  O   . ILE C  3  121  ? -5.254  72.106  3.046   1.00 138.86 ? 121  ILE 3 O   1 
ATOM   1843  C  CB  . ILE C  3  121  ? -4.146  71.944  5.813   1.00 118.94 ? 121  ILE 3 CB  1 
ATOM   1844  C  CG1 . ILE C  3  121  ? -4.137  71.887  7.337   1.00 115.71 ? 121  ILE 3 CG1 1 
ATOM   1845  C  CG2 . ILE C  3  121  ? -2.821  72.481  5.297   1.00 116.17 ? 121  ILE 3 CG2 1 
ATOM   1846  C  CD1 . ILE C  3  121  ? -3.076  70.990  7.893   1.00 106.67 ? 121  ILE 3 CD1 1 
ATOM   1847  N  N   . ALA C  3  122  ? -4.948  74.304  3.448   1.00 133.96 ? 122  ALA 3 N   1 
ATOM   1848  C  CA  . ALA C  3  122  ? -4.844  74.668  2.039   1.00 132.56 ? 122  ALA 3 CA  1 
ATOM   1849  C  C   . ALA C  3  122  ? -3.594  74.087  1.403   1.00 132.80 ? 122  ALA 3 C   1 
ATOM   1850  O  O   . ALA C  3  122  ? -2.482  74.296  1.892   1.00 131.94 ? 122  ALA 3 O   1 
ATOM   1851  C  CB  . ALA C  3  122  ? -4.856  76.175  1.874   1.00 132.04 ? 122  ALA 3 CB  1 
ATOM   1852  N  N   . SER C  3  123  ? -3.785  73.353  0.311   1.00 136.05 ? 123  SER 3 N   1 
ATOM   1853  C  CA  . SER C  3  123  ? -2.661  72.811  -0.437  1.00 132.72 ? 123  SER 3 CA  1 
ATOM   1854  C  C   . SER C  3  123  ? -2.793  73.069  -1.935  1.00 135.90 ? 123  SER 3 C   1 
ATOM   1855  O  O   . SER C  3  123  ? -3.879  73.384  -2.434  1.00 131.61 ? 123  SER 3 O   1 
ATOM   1856  C  CB  . SER C  3  123  ? -2.484  71.321  -0.159  1.00 125.74 ? 123  SER 3 CB  1 
ATOM   1857  O  OG  . SER C  3  123  ? -1.267  70.870  -0.721  1.00 123.86 ? 123  SER 3 OG  1 
ATOM   1858  N  N   . THR C  3  124  ? -1.673  72.928  -2.639  1.00 143.14 ? 124  THR 3 N   1 
ATOM   1859  C  CA  . THR C  3  124  ? -1.585  73.270  -4.052  1.00 150.96 ? 124  THR 3 CA  1 
ATOM   1860  C  C   . THR C  3  124  ? -0.725  72.238  -4.789  1.00 155.31 ? 124  THR 3 C   1 
ATOM   1861  O  O   . THR C  3  124  ? -0.783  72.117  -6.017  1.00 155.23 ? 124  THR 3 O   1 
ATOM   1862  C  CB  . THR C  3  124  ? -1.025  74.716  -4.218  1.00 135.94 ? 124  THR 3 CB  1 
ATOM   1863  O  OG1 . THR C  3  124  ? -2.020  75.552  -4.823  1.00 141.93 ? 124  THR 3 OG1 1 
ATOM   1864  C  CG2 . THR C  3  124  ? 0.262   74.753  -5.045  1.00 131.49 ? 124  THR 3 CG2 1 
ATOM   1865  N  N   . ALA C  3  125  ? 0.022   71.457  -4.010  1.00 159.17 ? 125  ALA 3 N   1 
ATOM   1866  C  CA  . ALA C  3  125  ? 1.096   70.605  -4.525  1.00 162.93 ? 125  ALA 3 CA  1 
ATOM   1867  C  C   . ALA C  3  125  ? 0.671   69.266  -5.133  1.00 163.35 ? 125  ALA 3 C   1 
ATOM   1868  O  O   . ALA C  3  125  ? 1.526   68.520  -5.632  1.00 160.08 ? 125  ALA 3 O   1 
ATOM   1869  C  CB  . ALA C  3  125  ? 2.143   70.365  -3.428  1.00 163.01 ? 125  ALA 3 CB  1 
ATOM   1870  N  N   . LYS C  3  126  ? -0.629  68.968  -5.099  1.00 166.23 ? 126  LYS 3 N   1 
ATOM   1871  C  CA  . LYS C  3  126  ? -1.145  67.647  -5.493  1.00 166.52 ? 126  LYS 3 CA  1 
ATOM   1872  C  C   . LYS C  3  126  ? -0.348  66.559  -4.763  1.00 162.52 ? 126  LYS 3 C   1 
ATOM   1873  O  O   . LYS C  3  126  ? 0.026   65.524  -5.330  1.00 158.41 ? 126  LYS 3 O   1 
ATOM   1874  C  CB  . LYS C  3  126  ? -1.125  67.452  -7.021  1.00 161.98 ? 126  LYS 3 CB  1 
ATOM   1875  C  CG  . LYS C  3  126  ? -2.295  66.621  -7.552  1.00 154.05 ? 126  LYS 3 CG  1 
ATOM   1876  C  CD  . LYS C  3  126  ? -2.593  66.873  -9.032  1.00 147.13 ? 126  LYS 3 CD  1 
ATOM   1877  C  CE  . LYS C  3  126  ? -3.931  66.240  -9.423  1.00 143.45 ? 126  LYS 3 CE  1 
ATOM   1878  N  NZ  . LYS C  3  126  ? -4.284  66.386  -10.862 1.00 141.82 ? 126  LYS 3 NZ  1 
ATOM   1879  N  N   . ASP C  3  127  ? -0.101  66.838  -3.487  1.00 158.59 ? 127  ASP 3 N   1 
ATOM   1880  C  CA  . ASP C  3  127  ? 0.764   66.049  -2.628  1.00 149.68 ? 127  ASP 3 CA  1 
ATOM   1881  C  C   . ASP C  3  127  ? 0.299   66.323  -1.195  1.00 146.43 ? 127  ASP 3 C   1 
ATOM   1882  O  O   . ASP C  3  127  ? 0.775   65.716  -0.230  1.00 142.73 ? 127  ASP 3 O   1 
ATOM   1883  C  CB  . ASP C  3  127  ? 2.222   66.479  -2.841  1.00 141.67 ? 127  ASP 3 CB  1 
ATOM   1884  C  CG  . ASP C  3  127  ? 3.140   66.023  -1.728  1.00 136.25 ? 127  ASP 3 CG  1 
ATOM   1885  O  OD1 . ASP C  3  127  ? 3.283   64.800  -1.542  1.00 137.49 ? 127  ASP 3 OD1 1 
ATOM   1886  O  OD2 . ASP C  3  127  ? 3.716   66.886  -1.035  1.00 131.79 ? 127  ASP 3 OD2 1 
ATOM   1887  N  N   . ASN C  3  128  ? -0.661  67.241  -1.086  1.00 145.06 ? 128  ASN 3 N   1 
ATOM   1888  C  CA  . ASN C  3  128  ? -1.192  67.712  0.193   1.00 146.77 ? 128  ASN 3 CA  1 
ATOM   1889  C  C   . ASN C  3  128  ? -0.160  68.466  1.036   1.00 146.21 ? 128  ASN 3 C   1 
ATOM   1890  O  O   . ASN C  3  128  ? -0.404  68.784  2.207   1.00 147.60 ? 128  ASN 3 O   1 
ATOM   1891  C  CB  . ASN C  3  128  ? -1.851  66.581  0.992   1.00 147.00 ? 128  ASN 3 CB  1 
ATOM   1892  C  CG  . ASN C  3  128  ? -3.337  66.807  1.198   1.00 148.98 ? 128  ASN 3 CG  1 
ATOM   1893  O  OD1 . ASN C  3  128  ? -3.816  67.942  1.158   1.00 151.75 ? 128  ASN 3 OD1 1 
ATOM   1894  N  ND2 . ASN C  3  128  ? -4.075  65.727  1.424   1.00 148.43 ? 128  ASN 3 ND2 1 
ATOM   1895  N  N   . ALA C  3  129  ? 0.988   68.751  0.423   1.00 139.74 ? 129  ALA 3 N   1 
ATOM   1896  C  CA  . ALA C  3  129  ? 1.992   69.626  1.014   1.00 128.66 ? 129  ALA 3 CA  1 
ATOM   1897  C  C   . ALA C  3  129  ? 1.369   70.989  1.260   1.00 126.49 ? 129  ALA 3 C   1 
ATOM   1898  O  O   . ALA C  3  129  ? 0.939   71.657  0.313   1.00 124.95 ? 129  ALA 3 O   1 
ATOM   1899  C  CB  . ALA C  3  129  ? 3.176   69.760  0.091   1.00 124.06 ? 129  ALA 3 CB  1 
ATOM   1900  N  N   . PRO C  3  130  ? 1.315   71.404  2.537   1.00 122.17 ? 130  PRO 3 N   1 
ATOM   1901  C  CA  . PRO C  3  130  ? 0.613   72.632  2.916   1.00 120.83 ? 130  PRO 3 CA  1 
ATOM   1902  C  C   . PRO C  3  130  ? 1.134   73.830  2.138   1.00 122.68 ? 130  PRO 3 C   1 
ATOM   1903  O  O   . PRO C  3  130  ? 2.340   73.917  1.865   1.00 119.28 ? 130  PRO 3 O   1 
ATOM   1904  C  CB  . PRO C  3  130  ? 0.946   72.779  4.403   1.00 115.64 ? 130  PRO 3 CB  1 
ATOM   1905  C  CG  . PRO C  3  130  ? 1.302   71.396  4.851   1.00 113.67 ? 130  PRO 3 CG  1 
ATOM   1906  C  CD  . PRO C  3  130  ? 1.982   70.770  3.687   1.00 113.61 ? 130  PRO 3 CD  1 
ATOM   1907  N  N   . LEU C  3  131  ? 0.224   74.722  1.758   1.00 123.89 ? 131  LEU 3 N   1 
ATOM   1908  C  CA  . LEU C  3  131  ? 0.604   75.955  1.091   1.00 124.47 ? 131  LEU 3 CA  1 
ATOM   1909  C  C   . LEU C  3  131  ? 1.485   76.785  2.019   1.00 119.23 ? 131  LEU 3 C   1 
ATOM   1910  O  O   . LEU C  3  131  ? 1.269   76.820  3.232   1.00 115.01 ? 131  LEU 3 O   1 
ATOM   1911  C  CB  . LEU C  3  131  ? -0.638  76.755  0.696   1.00 129.08 ? 131  LEU 3 CB  1 
ATOM   1912  C  CG  . LEU C  3  131  ? -0.349  78.065  -0.038  1.00 129.44 ? 131  LEU 3 CG  1 
ATOM   1913  C  CD1 . LEU C  3  131  ? 0.046   77.786  -1.482  1.00 129.53 ? 131  LEU 3 CD1 1 
ATOM   1914  C  CD2 . LEU C  3  131  ? -1.531  79.011  0.042   1.00 130.32 ? 131  LEU 3 CD2 1 
ATOM   1915  N  N   . GLN C  3  132  ? 2.499   77.422  1.445   1.00 118.06 ? 132  GLN 3 N   1 
ATOM   1916  C  CA  . GLN C  3  132  ? 3.310   78.399  2.160   1.00 115.74 ? 132  GLN 3 CA  1 
ATOM   1917  C  C   . GLN C  3  132  ? 3.035   79.773  1.572   1.00 117.41 ? 132  GLN 3 C   1 
ATOM   1918  O  O   . GLN C  3  132  ? 2.795   79.905  0.372   1.00 124.74 ? 132  GLN 3 O   1 
ATOM   1919  C  CB  . GLN C  3  132  ? 4.796   78.081  2.022   1.00 117.14 ? 132  GLN 3 CB  1 
ATOM   1920  C  CG  . GLN C  3  132  ? 5.263   76.909  2.862   1.00 120.84 ? 132  GLN 3 CG  1 
ATOM   1921  C  CD  . GLN C  3  132  ? 6.730   76.584  2.639   1.00 118.31 ? 132  GLN 3 CD  1 
ATOM   1922  O  OE1 . GLN C  3  132  ? 7.066   75.582  2.000   1.00 117.78 ? 132  GLN 3 OE1 1 
ATOM   1923  N  NE2 . GLN C  3  132  ? 7.612   77.434  3.163   1.00 111.40 ? 132  GLN 3 NE2 1 
ATOM   1924  N  N   . PHE C  3  133  ? 3.059   80.801  2.407   1.00 110.00 ? 133  PHE 3 N   1 
ATOM   1925  C  CA  . PHE C  3  133  ? 2.792   82.131  1.898   1.00 105.59 ? 133  PHE 3 CA  1 
ATOM   1926  C  C   . PHE C  3  133  ? 3.915   82.567  0.971   1.00 104.65 ? 133  PHE 3 C   1 
ATOM   1927  O  O   . PHE C  3  133  ? 5.093   82.430  1.304   1.00 101.49 ? 133  PHE 3 O   1 
ATOM   1928  C  CB  . PHE C  3  133  ? 2.629   83.121  3.042   1.00 105.73 ? 133  PHE 3 CB  1 
ATOM   1929  C  CG  . PHE C  3  133  ? 1.264   83.119  3.652   1.00 110.69 ? 133  PHE 3 CG  1 
ATOM   1930  C  CD1 . PHE C  3  133  ? 0.155   83.513  2.909   1.00 115.04 ? 133  PHE 3 CD1 1 
ATOM   1931  C  CD2 . PHE C  3  133  ? 1.084   82.746  4.976   1.00 108.95 ? 133  PHE 3 CD2 1 
ATOM   1932  C  CE1 . PHE C  3  133  ? -1.107  83.526  3.471   1.00 111.69 ? 133  PHE 3 CE1 1 
ATOM   1933  C  CE2 . PHE C  3  133  ? -0.173  82.756  5.550   1.00 107.43 ? 133  PHE 3 CE2 1 
ATOM   1934  C  CZ  . PHE C  3  133  ? -1.271  83.146  4.796   1.00 108.74 ? 133  PHE 3 CZ  1 
ATOM   1935  N  N   . ASP C  3  134  ? 3.541   83.083  -0.195  1.00 104.79 ? 134  ASP 3 N   1 
ATOM   1936  C  CA  . ASP C  3  134  ? 4.509   83.581  -1.166  1.00 111.46 ? 134  ASP 3 CA  1 
ATOM   1937  C  C   . ASP C  3  134  ? 5.150   84.870  -0.670  1.00 112.46 ? 134  ASP 3 C   1 
ATOM   1938  O  O   . ASP C  3  134  ? 6.330   85.119  -0.914  1.00 112.45 ? 134  ASP 3 O   1 
ATOM   1939  C  CB  . ASP C  3  134  ? 3.836   83.818  -2.523  1.00 121.90 ? 134  ASP 3 CB  1 
ATOM   1940  C  CG  . ASP C  3  134  ? 3.266   82.542  -3.125  1.00 129.49 ? 134  ASP 3 CG  1 
ATOM   1941  O  OD1 . ASP C  3  134  ? 2.117   82.173  -2.791  1.00 130.65 ? 134  ASP 3 OD1 1 
ATOM   1942  O  OD2 . ASP C  3  134  ? 3.970   81.909  -3.938  1.00 134.46 ? 134  ASP 3 OD2 1 
ATOM   1943  N  N   . LYS C  3  135  ? 4.358   85.682  0.028   1.00 112.92 ? 135  LYS 3 N   1 
ATOM   1944  C  CA  . LYS C  3  135  ? 4.837   86.931  0.614   1.00 110.33 ? 135  LYS 3 CA  1 
ATOM   1945  C  C   . LYS C  3  135  ? 4.034   87.323  1.857   1.00 112.57 ? 135  LYS 3 C   1 
ATOM   1946  O  O   . LYS C  3  135  ? 2.845   87.026  1.946   1.00 117.81 ? 135  LYS 3 O   1 
ATOM   1947  C  CB  . LYS C  3  135  ? 4.818   88.052  -0.429  1.00 108.83 ? 135  LYS 3 CB  1 
ATOM   1948  C  CG  . LYS C  3  135  ? 6.198   88.365  -0.984  1.00 111.09 ? 135  LYS 3 CG  1 
ATOM   1949  C  CD  . LYS C  3  135  ? 6.207   88.486  -2.498  1.00 114.35 ? 135  LYS 3 CD  1 
ATOM   1950  C  CE  . LYS C  3  135  ? 7.638   88.384  -3.028  1.00 112.23 ? 135  LYS 3 CE  1 
ATOM   1951  N  NZ  . LYS C  3  135  ? 8.589   89.206  -2.221  1.00 104.18 ? 135  LYS 3 NZ  1 
ATOM   1952  N  N   . VAL C  3  136  ? 4.700   87.957  2.823   1.00 110.92 ? 136  VAL 3 N   1 
ATOM   1953  C  CA  . VAL C  3  136  ? 4.029   88.527  3.993   1.00 109.20 ? 136  VAL 3 CA  1 
ATOM   1954  C  C   . VAL C  3  136  ? 4.336   90.017  4.068   1.00 110.63 ? 136  VAL 3 C   1 
ATOM   1955  O  O   . VAL C  3  136  ? 5.501   90.421  4.064   1.00 108.16 ? 136  VAL 3 O   1 
ATOM   1956  C  CB  . VAL C  3  136  ? 4.471   87.869  5.318   1.00 105.21 ? 136  VAL 3 CB  1 
ATOM   1957  C  CG1 . VAL C  3  136  ? 3.730   88.494  6.479   1.00 98.96  ? 136  VAL 3 CG1 1 
ATOM   1958  C  CG2 . VAL C  3  136  ? 4.208   86.397  5.289   1.00 99.12  ? 136  VAL 3 CG2 1 
ATOM   1959  N  N   . PHE C  3  137  ? 3.293   90.836  4.126   1.00 111.49 ? 137  PHE 3 N   1 
ATOM   1960  C  CA  . PHE C  3  137  ? 3.484   92.281  4.135   1.00 111.11 ? 137  PHE 3 CA  1 
ATOM   1961  C  C   . PHE C  3  137  ? 2.938   92.933  5.400   1.00 110.17 ? 137  PHE 3 C   1 
ATOM   1962  O  O   . PHE C  3  137  ? 1.877   92.561  5.900   1.00 110.20 ? 137  PHE 3 O   1 
ATOM   1963  C  CB  . PHE C  3  137  ? 2.864   92.923  2.891   1.00 116.14 ? 137  PHE 3 CB  1 
ATOM   1964  C  CG  . PHE C  3  137  ? 3.638   92.672  1.628   1.00 119.17 ? 137  PHE 3 CG  1 
ATOM   1965  C  CD1 . PHE C  3  137  ? 4.810   93.365  1.372   1.00 118.68 ? 137  PHE 3 CD1 1 
ATOM   1966  C  CD2 . PHE C  3  137  ? 3.187   91.750  0.692   1.00 122.79 ? 137  PHE 3 CD2 1 
ATOM   1967  C  CE1 . PHE C  3  137  ? 5.527   93.136  0.210   1.00 122.85 ? 137  PHE 3 CE1 1 
ATOM   1968  C  CE2 . PHE C  3  137  ? 3.898   91.516  -0.475  1.00 124.08 ? 137  PHE 3 CE2 1 
ATOM   1969  C  CZ  . PHE C  3  137  ? 5.071   92.209  -0.714  1.00 124.41 ? 137  PHE 3 CZ  1 
ATOM   1970  N  N   . SER C  3  138  ? 3.678   93.904  5.919   1.00 109.15 ? 138  SER 3 N   1 
ATOM   1971  C  CA  . SER C  3  138  ? 3.215   94.657  7.069   1.00 106.40 ? 138  SER 3 CA  1 
ATOM   1972  C  C   . SER C  3  138  ? 2.995   96.105  6.662   1.00 108.52 ? 138  SER 3 C   1 
ATOM   1973  O  O   . SER C  3  138  ? 3.946   96.820  6.340   1.00 101.00 ? 138  SER 3 O   1 
ATOM   1974  C  CB  . SER C  3  138  ? 4.229   94.572  8.210   1.00 102.64 ? 138  SER 3 CB  1 
ATOM   1975  O  OG  . SER C  3  138  ? 3.642   94.909  9.454   1.00 98.18  ? 138  SER 3 OG  1 
ATOM   1976  N  N   . VAL C  3  139  ? 1.729   96.512  6.646   1.00 113.51 ? 139  VAL 3 N   1 
ATOM   1977  C  CA  . VAL C  3  139  ? 1.350   97.917  6.483   1.00 113.95 ? 139  VAL 3 CA  1 
ATOM   1978  C  C   . VAL C  3  139  ? 1.290   98.546  7.863   1.00 109.95 ? 139  VAL 3 C   1 
ATOM   1979  O  O   . VAL C  3  139  ? 0.393   98.258  8.654   1.00 110.59 ? 139  VAL 3 O   1 
ATOM   1980  C  CB  . VAL C  3  139  ? -0.026  98.066  5.789   1.00 114.58 ? 139  VAL 3 CB  1 
ATOM   1981  C  CG1 . VAL C  3  139  ? -0.527  99.489  5.879   1.00 108.27 ? 139  VAL 3 CG1 1 
ATOM   1982  C  CG2 . VAL C  3  139  ? 0.064   97.628  4.338   1.00 114.45 ? 139  VAL 3 CG2 1 
ATOM   1983  N  N   . SER C  3  140  ? 2.264   99.393  8.156   1.00 106.75 ? 140  SER 3 N   1 
ATOM   1984  C  CA  . SER C  3  140  ? 2.397   99.939  9.489   1.00 106.41 ? 140  SER 3 CA  1 
ATOM   1985  C  C   . SER C  3  140  ? 2.679   101.422 9.422   1.00 110.32 ? 140  SER 3 C   1 
ATOM   1986  O  O   . SER C  3  140  ? 2.873   101.986 8.348   1.00 113.34 ? 140  SER 3 O   1 
ATOM   1987  C  CB  . SER C  3  140  ? 3.513   99.218  10.241  1.00 106.34 ? 140  SER 3 CB  1 
ATOM   1988  O  OG  . SER C  3  140  ? 3.198   97.845  10.405  1.00 105.29 ? 140  SER 3 OG  1 
ATOM   1989  N  N   . GLU C  3  141  ? 2.727   102.043 10.588  1.00 113.07 ? 141  GLU 3 N   1 
ATOM   1990  C  CA  . GLU C  3  141  ? 2.798   103.488 10.681  1.00 111.60 ? 141  GLU 3 CA  1 
ATOM   1991  C  C   . GLU C  3  141  ? 4.213   103.996 10.473  1.00 105.99 ? 141  GLU 3 C   1 
ATOM   1992  O  O   . GLU C  3  141  ? 5.186   103.307 10.777  1.00 100.80 ? 141  GLU 3 O   1 
ATOM   1993  C  CB  . GLU C  3  141  ? 2.272   103.930 12.036  1.00 115.67 ? 141  GLU 3 CB  1 
ATOM   1994  C  CG  . GLU C  3  141  ? 1.420   105.163 11.965  1.00 126.28 ? 141  GLU 3 CG  1 
ATOM   1995  C  CD  . GLU C  3  141  ? 0.179   105.029 12.805  1.00 136.03 ? 141  GLU 3 CD  1 
ATOM   1996  O  OE1 . GLU C  3  141  ? 0.228   105.382 14.003  1.00 141.16 ? 141  GLU 3 OE1 1 
ATOM   1997  O  OE2 . GLU C  3  141  ? -0.842  104.555 12.268  1.00 138.21 ? 141  GLU 3 OE2 1 
ATOM   1998  N  N   . THR C  3  142  ? 4.323   105.205 9.940   1.00 109.65 ? 142  THR 3 N   1 
ATOM   1999  C  CA  . THR C  3  142  ? 5.622   105.815 9.710   1.00 111.41 ? 142  THR 3 CA  1 
ATOM   2000  C  C   . THR C  3  142  ? 5.618   107.247 10.237  1.00 112.37 ? 142  THR 3 C   1 
ATOM   2001  O  O   . THR C  3  142  ? 4.577   107.909 10.259  1.00 117.28 ? 142  THR 3 O   1 
ATOM   2002  C  CB  . THR C  3  142  ? 6.008   105.779 8.209   1.00 113.18 ? 142  THR 3 CB  1 
ATOM   2003  O  OG1 . THR C  3  142  ? 7.433   105.812 8.070   1.00 116.22 ? 142  THR 3 OG1 1 
ATOM   2004  C  CG2 . THR C  3  142  ? 5.393   106.944 7.453   1.00 111.27 ? 142  THR 3 CG2 1 
ATOM   2005  N  N   . ALA C  3  143  ? 6.771   107.715 10.698  1.00 109.25 ? 143  ALA 3 N   1 
ATOM   2006  C  CA  . ALA C  3  143  ? 6.876   109.081 11.183  1.00 110.77 ? 143  ALA 3 CA  1 
ATOM   2007  C  C   . ALA C  3  143  ? 8.071   109.743 10.531  1.00 116.26 ? 143  ALA 3 C   1 
ATOM   2008  O  O   . ALA C  3  143  ? 9.104   109.107 10.333  1.00 121.96 ? 143  ALA 3 O   1 
ATOM   2009  C  CB  . ALA C  3  143  ? 7.006   109.107 12.693  1.00 105.86 ? 143  ALA 3 CB  1 
ATOM   2010  N  N   . LYS C  3  144  ? 7.916   111.012 10.171  1.00 115.10 ? 144  LYS 3 N   1 
ATOM   2011  C  CA  . LYS C  3  144  ? 9.004   111.780 9.584   1.00 115.16 ? 144  LYS 3 CA  1 
ATOM   2012  C  C   . LYS C  3  144  ? 9.655   112.617 10.672  1.00 115.67 ? 144  LYS 3 C   1 
ATOM   2013  O  O   . LYS C  3  144  ? 9.071   113.588 11.158  1.00 118.10 ? 144  LYS 3 O   1 
ATOM   2014  C  CB  . LYS C  3  144  ? 8.496   112.666 8.442   1.00 120.28 ? 144  LYS 3 CB  1 
ATOM   2015  C  CG  . LYS C  3  144  ? 8.049   111.880 7.208   1.00 128.59 ? 144  LYS 3 CG  1 
ATOM   2016  C  CD  . LYS C  3  144  ? 7.246   112.737 6.222   1.00 131.03 ? 144  LYS 3 CD  1 
ATOM   2017  C  CE  . LYS C  3  144  ? 6.669   111.883 5.088   1.00 130.71 ? 144  LYS 3 CE  1 
ATOM   2018  N  NZ  . LYS C  3  144  ? 5.723   112.649 4.222   1.00 132.05 ? 144  LYS 3 NZ  1 
ATOM   2019  N  N   . ILE C  3  145  ? 10.862  112.221 11.066  1.00 113.93 ? 145  ILE 3 N   1 
ATOM   2020  C  CA  . ILE C  3  145  ? 11.583  112.896 12.136  1.00 107.04 ? 145  ILE 3 CA  1 
ATOM   2021  C  C   . ILE C  3  145  ? 12.309  114.112 11.594  1.00 103.81 ? 145  ILE 3 C   1 
ATOM   2022  O  O   . ILE C  3  145  ? 13.106  113.991 10.665  1.00 105.53 ? 145  ILE 3 O   1 
ATOM   2023  C  CB  . ILE C  3  145  ? 12.597  111.958 12.795  1.00 99.94  ? 145  ILE 3 CB  1 
ATOM   2024  C  CG1 . ILE C  3  145  ? 11.870  110.849 13.548  1.00 93.23  ? 145  ILE 3 CG1 1 
ATOM   2025  C  CG2 . ILE C  3  145  ? 13.469  112.729 13.757  1.00 102.87 ? 145  ILE 3 CG2 1 
ATOM   2026  C  CD1 . ILE C  3  145  ? 12.732  109.677 13.867  1.00 90.79  ? 145  ILE 3 CD1 1 
ATOM   2027  N  N   . PRO C  3  146  ? 12.036  115.285 12.179  1.00 101.07 ? 146  PRO 3 N   1 
ATOM   2028  C  CA  . PRO C  3  146  ? 12.538  116.577 11.704  1.00 100.99 ? 146  PRO 3 CA  1 
ATOM   2029  C  C   . PRO C  3  146  ? 14.037  116.548 11.554  1.00 100.57 ? 146  PRO 3 C   1 
ATOM   2030  O  O   . PRO C  3  146  ? 14.712  115.819 12.274  1.00 98.88  ? 146  PRO 3 O   1 
ATOM   2031  C  CB  . PRO C  3  146  ? 12.162  117.536 12.830  1.00 103.63 ? 146  PRO 3 CB  1 
ATOM   2032  C  CG  . PRO C  3  146  ? 10.989  116.903 13.486  1.00 109.49 ? 146  PRO 3 CG  1 
ATOM   2033  C  CD  . PRO C  3  146  ? 11.234  115.423 13.403  1.00 106.18 ? 146  PRO 3 CD  1 
ATOM   2034  N  N   . ALA C  3  147  ? 14.554  117.314 10.606  1.00 96.51  ? 147  ALA 3 N   1 
ATOM   2035  C  CA  . ALA C  3  147  ? 15.990  117.467 10.507  1.00 97.75  ? 147  ALA 3 CA  1 
ATOM   2036  C  C   . ALA C  3  147  ? 16.440  118.447 11.592  1.00 100.72 ? 147  ALA 3 C   1 
ATOM   2037  O  O   . ALA C  3  147  ? 15.674  119.305 12.056  1.00 97.53  ? 147  ALA 3 O   1 
ATOM   2038  C  CB  . ALA C  3  147  ? 16.396  117.943 9.123   1.00 93.81  ? 147  ALA 3 CB  1 
ATOM   2039  N  N   . ILE C  3  148  ? 17.682  118.295 12.018  1.00 98.93  ? 148  ILE 3 N   1 
ATOM   2040  C  CA  . ILE C  3  148  ? 18.240  119.197 13.002  1.00 95.15  ? 148  ILE 3 CA  1 
ATOM   2041  C  C   . ILE C  3  148  ? 18.463  120.546 12.332  1.00 95.31  ? 148  ILE 3 C   1 
ATOM   2042  O  O   . ILE C  3  148  ? 18.874  120.608 11.167  1.00 95.53  ? 148  ILE 3 O   1 
ATOM   2043  C  CB  . ILE C  3  148  ? 19.560  118.632 13.554  1.00 93.00  ? 148  ILE 3 CB  1 
ATOM   2044  C  CG1 . ILE C  3  148  ? 19.291  117.361 14.361  1.00 93.40  ? 148  ILE 3 CG1 1 
ATOM   2045  C  CG2 . ILE C  3  148  ? 20.272  119.639 14.421  1.00 89.27  ? 148  ILE 3 CG2 1 
ATOM   2046  C  CD1 . ILE C  3  148  ? 20.546  116.580 14.690  1.00 89.03  ? 148  ILE 3 CD1 1 
ATOM   2047  N  N   . ASP C  3  149  ? 18.154  121.619 13.055  1.00 93.71  ? 149  ASP 3 N   1 
ATOM   2048  C  CA  . ASP C  3  149  ? 18.422  122.967 12.574  1.00 100.36 ? 149  ASP 3 CA  1 
ATOM   2049  C  C   . ASP C  3  149  ? 19.774  123.441 13.100  1.00 108.75 ? 149  ASP 3 C   1 
ATOM   2050  O  O   . ASP C  3  149  ? 19.859  124.021 14.185  1.00 115.13 ? 149  ASP 3 O   1 
ATOM   2051  C  CB  . ASP C  3  149  ? 17.323  123.920 13.031  1.00 106.20 ? 149  ASP 3 CB  1 
ATOM   2052  C  CG  . ASP C  3  149  ? 17.376  125.250 12.317  1.00 117.48 ? 149  ASP 3 CG  1 
ATOM   2053  O  OD1 . ASP C  3  149  ? 18.374  125.511 11.607  1.00 122.54 ? 149  ASP 3 OD1 1 
ATOM   2054  O  OD2 . ASP C  3  149  ? 16.415  126.035 12.468  1.00 119.60 ? 149  ASP 3 OD2 1 
ATOM   2055  N  N   . TYR C  3  150  ? 20.833  123.203 12.333  1.00 108.89 ? 150  TYR 3 N   1 
ATOM   2056  C  CA  . TYR C  3  150  ? 22.183  123.526 12.799  1.00 107.31 ? 150  TYR 3 CA  1 
ATOM   2057  C  C   . TYR C  3  150  ? 22.419  125.037 13.002  1.00 112.86 ? 150  TYR 3 C   1 
ATOM   2058  O  O   . TYR C  3  150  ? 23.315  125.437 13.747  1.00 113.27 ? 150  TYR 3 O   1 
ATOM   2059  C  CB  . TYR C  3  150  ? 23.239  122.883 11.889  1.00 99.67  ? 150  TYR 3 CB  1 
ATOM   2060  C  CG  . TYR C  3  150  ? 23.161  121.361 11.864  1.00 103.44 ? 150  TYR 3 CG  1 
ATOM   2061  C  CD1 . TYR C  3  150  ? 22.333  120.693 10.965  1.00 106.22 ? 150  TYR 3 CD1 1 
ATOM   2062  C  CD2 . TYR C  3  150  ? 23.900  120.591 12.753  1.00 102.90 ? 150  TYR 3 CD2 1 
ATOM   2063  C  CE1 . TYR C  3  150  ? 22.251  119.297 10.953  1.00 102.79 ? 150  TYR 3 CE1 1 
ATOM   2064  C  CE2 . TYR C  3  150  ? 23.823  119.199 12.744  1.00 103.65 ? 150  TYR 3 CE2 1 
ATOM   2065  C  CZ  . TYR C  3  150  ? 22.999  118.558 11.844  1.00 102.20 ? 150  TYR 3 CZ  1 
ATOM   2066  O  OH  . TYR C  3  150  ? 22.945  117.177 11.845  1.00 102.36 ? 150  TYR 3 OH  1 
ATOM   2067  N  N   . SER C  3  151  ? 21.601  125.867 12.357  1.00 113.90 ? 151  SER 3 N   1 
ATOM   2068  C  CA  . SER C  3  151  ? 21.670  127.315 12.540  1.00 113.34 ? 151  SER 3 CA  1 
ATOM   2069  C  C   . SER C  3  151  ? 21.273  127.699 13.956  1.00 109.24 ? 151  SER 3 C   1 
ATOM   2070  O  O   . SER C  3  151  ? 21.961  128.476 14.617  1.00 104.17 ? 151  SER 3 O   1 
ATOM   2071  C  CB  . SER C  3  151  ? 20.740  128.037 11.562  1.00 119.61 ? 151  SER 3 CB  1 
ATOM   2072  O  OG  . SER C  3  151  ? 21.007  127.658 10.225  1.00 129.13 ? 151  SER 3 OG  1 
ATOM   2073  N  N   . LYS C  3  152  ? 20.147  127.162 14.412  1.00 109.75 ? 152  LYS 3 N   1 
ATOM   2074  C  CA  . LYS C  3  152  ? 19.641  127.476 15.739  1.00 106.93 ? 152  LYS 3 CA  1 
ATOM   2075  C  C   . LYS C  3  152  ? 20.440  126.753 16.798  1.00 110.11 ? 152  LYS 3 C   1 
ATOM   2076  O  O   . LYS C  3  152  ? 20.520  127.200 17.944  1.00 116.10 ? 152  LYS 3 O   1 
ATOM   2077  C  CB  . LYS C  3  152  ? 18.162  127.099 15.863  1.00 105.51 ? 152  LYS 3 CB  1 
ATOM   2078  C  CG  . LYS C  3  152  ? 17.261  127.910 14.950  1.00 115.21 ? 152  LYS 3 CG  1 
ATOM   2079  C  CD  . LYS C  3  152  ? 15.779  127.722 15.247  1.00 114.78 ? 152  LYS 3 CD  1 
ATOM   2080  C  CE  . LYS C  3  152  ? 14.948  128.621 14.348  1.00 116.15 ? 152  LYS 3 CE  1 
ATOM   2081  N  NZ  . LYS C  3  152  ? 13.496  128.376 14.519  1.00 121.03 ? 152  LYS 3 NZ  1 
ATOM   2082  N  N   . VAL C  3  153  ? 21.048  125.639 16.413  1.00 105.34 ? 153  VAL 3 N   1 
ATOM   2083  C  CA  . VAL C  3  153  ? 21.561  124.717 17.412  1.00 100.35 ? 153  VAL 3 CA  1 
ATOM   2084  C  C   . VAL C  3  153  ? 23.092  124.715 17.577  1.00 101.71 ? 153  VAL 3 C   1 
ATOM   2085  O  O   . VAL C  3  153  ? 23.593  124.611 18.699  1.00 95.53  ? 153  VAL 3 O   1 
ATOM   2086  C  CB  . VAL C  3  153  ? 20.963  123.310 17.204  1.00 90.52  ? 153  VAL 3 CB  1 
ATOM   2087  C  CG1 . VAL C  3  153  ? 22.038  122.297 16.867  1.00 96.12  ? 153  VAL 3 CG1 1 
ATOM   2088  C  CG2 . VAL C  3  153  ? 20.177  122.906 18.440  1.00 80.47  ? 153  VAL 3 CG2 1 
ATOM   2089  N  N   . ARG C  3  154  ? 23.824  124.863 16.473  1.00 103.45 ? 154  ARG 3 N   1 
ATOM   2090  C  CA  . ARG C  3  154  ? 25.282  124.942 16.523  1.00 95.68  ? 154  ARG 3 CA  1 
ATOM   2091  C  C   . ARG C  3  154  ? 25.735  126.397 16.614  1.00 101.41 ? 154  ARG 3 C   1 
ATOM   2092  O  O   . ARG C  3  154  ? 25.970  127.057 15.600  1.00 111.32 ? 154  ARG 3 O   1 
ATOM   2093  C  CB  . ARG C  3  154  ? 25.889  124.285 15.294  1.00 90.58  ? 154  ARG 3 CB  1 
ATOM   2094  C  CG  . ARG C  3  154  ? 27.389  124.162 15.359  1.00 90.53  ? 154  ARG 3 CG  1 
ATOM   2095  C  CD  . ARG C  3  154  ? 27.984  123.844 14.002  1.00 94.30  ? 154  ARG 3 CD  1 
ATOM   2096  N  NE  . ARG C  3  154  ? 27.864  122.435 13.639  1.00 94.49  ? 154  ARG 3 NE  1 
ATOM   2097  C  CZ  . ARG C  3  154  ? 27.159  121.984 12.605  1.00 101.65 ? 154  ARG 3 CZ  1 
ATOM   2098  N  NH1 . ARG C  3  154  ? 26.494  122.828 11.822  1.00 106.78 ? 154  ARG 3 NH1 1 
ATOM   2099  N  NH2 . ARG C  3  154  ? 27.119  120.685 12.351  1.00 103.48 ? 154  ARG 3 NH2 1 
ATOM   2100  N  N   . VAL C  3  155  ? 25.854  126.889 17.842  1.00 92.67  ? 155  VAL 3 N   1 
ATOM   2101  C  CA  . VAL C  3  155  ? 26.130  128.295 18.087  1.00 89.54  ? 155  VAL 3 CA  1 
ATOM   2102  C  C   . VAL C  3  155  ? 27.563  128.495 18.552  1.00 88.36  ? 155  VAL 3 C   1 
ATOM   2103  O  O   . VAL C  3  155  ? 28.040  127.762 19.420  1.00 81.49  ? 155  VAL 3 O   1 
ATOM   2104  C  CB  . VAL C  3  155  ? 25.198  128.823 19.169  1.00 76.95  ? 155  VAL 3 CB  1 
ATOM   2105  C  CG1 . VAL C  3  155  ? 25.452  130.301 19.425  1.00 113.67 ? 155  VAL 3 CG1 1 
ATOM   2106  C  CG2 . VAL C  3  155  ? 23.762  128.582 18.768  1.00 86.44  ? 155  VAL 3 CG2 1 
ATOM   2107  N  N   . PRO C  3  156  ? 28.257  129.489 17.972  1.00 92.79  ? 156  PRO 3 N   1 
ATOM   2108  C  CA  . PRO C  3  156  ? 29.597  129.889 18.412  1.00 88.97  ? 156  PRO 3 CA  1 
ATOM   2109  C  C   . PRO C  3  156  ? 29.686  130.043 19.933  1.00 89.11  ? 156  PRO 3 C   1 
ATOM   2110  O  O   . PRO C  3  156  ? 28.703  130.397 20.584  1.00 88.24  ? 156  PRO 3 O   1 
ATOM   2111  C  CB  . PRO C  3  156  ? 29.777  131.253 17.745  1.00 88.14  ? 156  PRO 3 CB  1 
ATOM   2112  C  CG  . PRO C  3  156  ? 28.994  131.153 16.503  1.00 94.08  ? 156  PRO 3 CG  1 
ATOM   2113  C  CD  . PRO C  3  156  ? 27.807  130.277 16.810  1.00 95.43  ? 156  PRO 3 CD  1 
ATOM   2114  N  N   . ARG C  3  157  ? 30.857  129.764 20.495  1.00 90.47  ? 157  ARG 3 N   1 
ATOM   2115  C  CA  . ARG C  3  157  ? 31.077  129.968 21.919  1.00 87.98  ? 157  ARG 3 CA  1 
ATOM   2116  C  C   . ARG C  3  157  ? 31.129  131.464 22.202  1.00 86.96  ? 157  ARG 3 C   1 
ATOM   2117  O  O   . ARG C  3  157  ? 31.657  132.225 21.390  1.00 88.72  ? 157  ARG 3 O   1 
ATOM   2118  C  CB  . ARG C  3  157  ? 32.390  129.314 22.339  1.00 81.10  ? 157  ARG 3 CB  1 
ATOM   2119  C  CG  . ARG C  3  157  ? 32.640  129.290 23.834  1.00 80.35  ? 157  ARG 3 CG  1 
ATOM   2120  C  CD  . ARG C  3  157  ? 34.116  129.127 24.121  1.00 67.67  ? 157  ARG 3 CD  1 
ATOM   2121  N  NE  . ARG C  3  157  ? 34.711  130.369 24.593  1.00 87.01  ? 157  ARG 3 NE  1 
ATOM   2122  C  CZ  . ARG C  3  157  ? 35.046  130.577 25.858  1.00 87.72  ? 157  ARG 3 CZ  1 
ATOM   2123  N  NH1 . ARG C  3  157  ? 34.858  129.611 26.742  1.00 90.42  ? 157  ARG 3 NH1 1 
ATOM   2124  N  NH2 . ARG C  3  157  ? 35.572  131.729 26.238  1.00 67.25  ? 157  ARG 3 NH2 1 
ATOM   2125  N  N   . LYS C  3  158  ? 30.569  131.887 23.336  1.00 83.14  ? 158  LYS 3 N   1 
ATOM   2126  C  CA  . LYS C  3  158  ? 30.684  133.284 23.774  1.00 84.12  ? 158  LYS 3 CA  1 
ATOM   2127  C  C   . LYS C  3  158  ? 31.769  133.383 24.834  1.00 85.44  ? 158  LYS 3 C   1 
ATOM   2128  O  O   . LYS C  3  158  ? 31.914  132.463 25.637  1.00 87.86  ? 158  LYS 3 O   1 
ATOM   2129  C  CB  . LYS C  3  158  ? 29.369  133.793 24.363  1.00 83.06  ? 158  LYS 3 CB  1 
ATOM   2130  C  CG  . LYS C  3  158  ? 28.259  134.025 23.360  1.00 75.40  ? 158  LYS 3 CG  1 
ATOM   2131  C  CD  . LYS C  3  158  ? 26.948  134.387 24.050  1.00 86.99  ? 158  LYS 3 CD  1 
ATOM   2132  C  CE  . LYS C  3  158  ? 25.850  134.660 23.021  1.00 92.81  ? 158  LYS 3 CE  1 
ATOM   2133  N  NZ  . LYS C  3  158  ? 24.629  135.291 23.607  1.00 95.78  ? 158  LYS 3 NZ  1 
ATOM   2134  N  N   . ASP C  3  159  ? 32.530  134.482 24.836  1.00 82.51  ? 159  ASP 3 N   1 
ATOM   2135  C  CA  . ASP C  3  159  ? 33.579  134.680 25.842  1.00 80.23  ? 159  ASP 3 CA  1 
ATOM   2136  C  C   . ASP C  3  159  ? 32.920  134.890 27.196  1.00 79.66  ? 159  ASP 3 C   1 
ATOM   2137  O  O   . ASP C  3  159  ? 31.727  135.196 27.267  1.00 78.71  ? 159  ASP 3 O   1 
ATOM   2138  C  CB  . ASP C  3  159  ? 34.463  135.889 25.515  1.00 85.39  ? 159  ASP 3 CB  1 
ATOM   2139  C  CG  . ASP C  3  159  ? 35.556  135.580 24.496  1.00 90.21  ? 159  ASP 3 CG  1 
ATOM   2140  O  OD1 . ASP C  3  159  ? 35.827  134.382 24.225  1.00 88.78  ? 159  ASP 3 OD1 1 
ATOM   2141  O  OD2 . ASP C  3  159  ? 36.161  136.554 23.980  1.00 90.43  ? 159  ASP 3 OD2 1 
ATOM   2142  N  N   . VAL C  3  160  ? 33.679  134.708 28.272  1.00 78.79  ? 160  VAL 3 N   1 
ATOM   2143  C  CA  . VAL C  3  160  ? 33.171  135.057 29.589  1.00 78.67  ? 160  VAL 3 CA  1 
ATOM   2144  C  C   . VAL C  3  160  ? 33.051  136.579 29.632  1.00 80.85  ? 160  VAL 3 C   1 
ATOM   2145  O  O   . VAL C  3  160  ? 34.035  137.286 29.377  1.00 79.27  ? 160  VAL 3 O   1 
ATOM   2146  C  CB  . VAL C  3  160  ? 34.090  134.561 30.700  1.00 80.64  ? 160  VAL 3 CB  1 
ATOM   2147  C  CG1 . VAL C  3  160  ? 33.771  135.265 32.008  1.00 68.09  ? 160  VAL 3 CG1 1 
ATOM   2148  C  CG2 . VAL C  3  160  ? 33.948  133.070 30.842  1.00 66.94  ? 160  VAL 3 CG2 1 
ATOM   2149  N  N   . PRO C  3  161  ? 31.836  137.077 29.924  1.00 79.35  ? 161  PRO 3 N   1 
ATOM   2150  C  CA  . PRO C  3  161  ? 31.473  138.497 29.829  1.00 81.02  ? 161  PRO 3 CA  1 
ATOM   2151  C  C   . PRO C  3  161  ? 32.326  139.427 30.694  1.00 77.96  ? 161  PRO 3 C   1 
ATOM   2152  O  O   . PRO C  3  161  ? 32.510  139.197 31.894  1.00 75.44  ? 161  PRO 3 O   1 
ATOM   2153  C  CB  . PRO C  3  161  ? 30.006  138.525 30.283  1.00 73.89  ? 161  PRO 3 CB  1 
ATOM   2154  C  CG  . PRO C  3  161  ? 29.773  137.242 30.987  1.00 72.75  ? 161  PRO 3 CG  1 
ATOM   2155  C  CD  . PRO C  3  161  ? 30.706  136.248 30.379  1.00 76.67  ? 161  PRO 3 CD  1 
ATOM   2156  N  N   . LYS C  3  162  ? 32.857  140.470 30.065  1.00 76.68  ? 162  LYS 3 N   1 
ATOM   2157  C  CA  . LYS C  3  162  ? 33.616  141.479 30.784  1.00 83.65  ? 162  LYS 3 CA  1 
ATOM   2158  C  C   . LYS C  3  162  ? 32.670  142.240 31.716  1.00 90.69  ? 162  LYS 3 C   1 
ATOM   2159  O  O   . LYS C  3  162  ? 31.554  142.584 31.330  1.00 95.27  ? 162  LYS 3 O   1 
ATOM   2160  C  CB  . LYS C  3  162  ? 34.296  142.441 29.799  1.00 86.89  ? 162  LYS 3 CB  1 
ATOM   2161  C  CG  . LYS C  3  162  ? 35.743  142.108 29.441  1.00 91.03  ? 162  LYS 3 CG  1 
ATOM   2162  C  CD  . LYS C  3  162  ? 35.864  141.001 28.388  1.00 94.19  ? 162  LYS 3 CD  1 
ATOM   2163  C  CE  . LYS C  3  162  ? 37.332  140.547 28.183  1.00 104.74 ? 162  LYS 3 CE  1 
ATOM   2164  N  NZ  . LYS C  3  162  ? 37.487  139.383 27.231  1.00 100.72 ? 162  LYS 3 NZ  1 
ATOM   2165  N  N   . VAL C  3  163  ? 33.102  142.481 32.948  1.00 91.95  ? 163  VAL 3 N   1 
ATOM   2166  C  CA  . VAL C  3  163  ? 32.310  143.287 33.876  1.00 95.03  ? 163  VAL 3 CA  1 
ATOM   2167  C  C   . VAL C  3  163  ? 32.495  144.767 33.567  1.00 92.77  ? 163  VAL 3 C   1 
ATOM   2168  O  O   . VAL C  3  163  ? 33.616  145.273 33.560  1.00 92.35  ? 163  VAL 3 O   1 
ATOM   2169  C  CB  . VAL C  3  163  ? 32.728  143.042 35.332  1.00 95.84  ? 163  VAL 3 CB  1 
ATOM   2170  C  CG1 . VAL C  3  163  ? 31.820  143.812 36.285  1.00 90.59  ? 163  VAL 3 CG1 1 
ATOM   2171  C  CG2 . VAL C  3  163  ? 32.715  141.554 35.633  1.00 96.77  ? 163  VAL 3 CG2 1 
ATOM   2172  N  N   . GLU C  3  164  ? 31.393  145.461 33.321  1.00 92.81  ? 164  GLU 3 N   1 
ATOM   2173  C  CA  . GLU C  3  164  ? 31.459  146.831 32.822  1.00 97.84  ? 164  GLU 3 CA  1 
ATOM   2174  C  C   . GLU C  3  164  ? 31.639  147.866 33.927  1.00 102.57 ? 164  GLU 3 C   1 
ATOM   2175  O  O   . GLU C  3  164  ? 31.102  147.732 35.029  1.00 108.58 ? 164  GLU 3 O   1 
ATOM   2176  C  CB  . GLU C  3  164  ? 30.212  147.165 31.990  1.00 102.64 ? 164  GLU 3 CB  1 
ATOM   2177  C  CG  . GLU C  3  164  ? 30.010  146.292 30.748  1.00 104.32 ? 164  GLU 3 CG  1 
ATOM   2178  C  CD  . GLU C  3  164  ? 31.092  146.496 29.695  1.00 108.07 ? 164  GLU 3 CD  1 
ATOM   2179  O  OE1 . GLU C  3  164  ? 31.623  147.626 29.600  1.00 110.27 ? 164  GLU 3 OE1 1 
ATOM   2180  O  OE2 . GLU C  3  164  ? 31.409  145.523 28.963  1.00 107.35 ? 164  GLU 3 OE2 1 
ATOM   2181  N  N   . GLY C  3  165  ? 32.409  148.902 33.620  1.00 101.53 ? 165  GLY 3 N   1 
ATOM   2182  C  CA  . GLY C  3  165  ? 32.559  150.032 34.516  1.00 96.54  ? 165  GLY 3 CA  1 
ATOM   2183  C  C   . GLY C  3  165  ? 33.480  149.769 35.684  1.00 93.63  ? 165  GLY 3 C   1 
ATOM   2184  O  O   . GLY C  3  165  ? 33.135  150.023 36.823  1.00 93.42  ? 165  GLY 3 O   1 
ATOM   2185  N  N   . LEU C  3  166  ? 34.661  149.246 35.408  1.00 98.29  ? 166  LEU 3 N   1 
ATOM   2186  C  CA  . LEU C  3  166  ? 35.631  149.039 36.466  1.00 95.37  ? 166  LEU 3 CA  1 
ATOM   2187  C  C   . LEU C  3  166  ? 36.585  150.246 36.526  1.00 92.46  ? 166  LEU 3 C   1 
ATOM   2188  O  O   . LEU C  3  166  ? 37.097  150.704 35.496  1.00 88.25  ? 166  LEU 3 O   1 
ATOM   2189  C  CB  . LEU C  3  166  ? 36.372  147.707 36.267  1.00 88.77  ? 166  LEU 3 CB  1 
ATOM   2190  C  CG  . LEU C  3  166  ? 35.483  146.453 36.330  1.00 88.65  ? 166  LEU 3 CG  1 
ATOM   2191  C  CD1 . LEU C  3  166  ? 36.258  145.189 35.987  1.00 88.68  ? 166  LEU 3 CD1 1 
ATOM   2192  C  CD2 . LEU C  3  166  ? 34.822  146.287 37.686  1.00 87.08  ? 166  LEU 3 CD2 1 
ATOM   2193  N  N   . LYS C  3  167  ? 36.789  150.774 37.732  1.00 88.58  ? 167  LYS 3 N   1 
ATOM   2194  C  CA  . LYS C  3  167  ? 37.700  151.901 37.944  1.00 85.61  ? 167  LYS 3 CA  1 
ATOM   2195  C  C   . LYS C  3  167  ? 38.809  151.535 38.914  1.00 88.95  ? 167  LYS 3 C   1 
ATOM   2196  O  O   . LYS C  3  167  ? 38.771  150.475 39.546  1.00 94.62  ? 167  LYS 3 O   1 
ATOM   2197  C  CB  . LYS C  3  167  ? 36.957  153.137 38.473  1.00 83.46  ? 167  LYS 3 CB  1 
ATOM   2198  C  CG  . LYS C  3  167  ? 35.607  152.859 39.133  1.00 83.05  ? 167  LYS 3 CG  1 
ATOM   2199  C  CD  . LYS C  3  167  ? 35.492  153.509 40.507  1.00 87.37  ? 167  LYS 3 CD  1 
ATOM   2200  C  CE  . LYS C  3  167  ? 34.146  153.192 41.152  1.00 95.23  ? 167  LYS 3 CE  1 
ATOM   2201  N  NZ  . LYS C  3  167  ? 34.211  153.286 42.641  1.00 103.73 ? 167  LYS 3 NZ  1 
ATOM   2202  N  N   . LEU C  3  168  ? 39.796  152.416 39.023  1.00 89.73  ? 168  LEU 3 N   1 
ATOM   2203  C  CA  . LEU C  3  168  ? 40.832  152.285 40.037  1.00 89.93  ? 168  LEU 3 CA  1 
ATOM   2204  C  C   . LEU C  3  168  ? 40.187  152.128 41.408  1.00 93.88  ? 168  LEU 3 C   1 
ATOM   2205  O  O   . LEU C  3  168  ? 39.277  152.877 41.751  1.00 100.96 ? 168  LEU 3 O   1 
ATOM   2206  C  CB  . LEU C  3  168  ? 41.728  153.524 40.037  1.00 86.60  ? 168  LEU 3 CB  1 
ATOM   2207  C  CG  . LEU C  3  168  ? 42.590  153.694 38.792  1.00 83.64  ? 168  LEU 3 CG  1 
ATOM   2208  C  CD1 . LEU C  3  168  ? 43.254  155.047 38.770  1.00 78.48  ? 168  LEU 3 CD1 1 
ATOM   2209  C  CD2 . LEU C  3  168  ? 43.634  152.598 38.748  1.00 75.62  ? 168  LEU 3 CD2 1 
ATOM   2210  N  N   . GLU C  3  169  ? 40.640  151.139 42.172  1.00 90.40  ? 169  GLU 3 N   1 
ATOM   2211  C  CA  . GLU C  3  169  ? 40.171  150.938 43.540  1.00 86.97  ? 169  GLU 3 CA  1 
ATOM   2212  C  C   . GLU C  3  169  ? 41.389  150.805 44.454  1.00 80.88  ? 169  GLU 3 C   1 
ATOM   2213  O  O   . GLU C  3  169  ? 41.304  150.289 45.571  1.00 79.17  ? 169  GLU 3 O   1 
ATOM   2214  C  CB  . GLU C  3  169  ? 39.249  149.711 43.638  1.00 93.24  ? 169  GLU 3 CB  1 
ATOM   2215  C  CG  . GLU C  3  169  ? 37.944  149.801 42.810  1.00 102.82 ? 169  GLU 3 CG  1 
ATOM   2216  C  CD  . GLU C  3  169  ? 36.842  150.645 43.478  1.00 115.97 ? 169  GLU 3 CD  1 
ATOM   2217  O  OE1 . GLU C  3  169  ? 37.038  151.146 44.610  1.00 119.87 ? 169  GLU 3 OE1 1 
ATOM   2218  O  OE2 . GLU C  3  169  ? 35.764  150.803 42.869  1.00 118.76 ? 169  GLU 3 OE2 1 
ATOM   2219  N  N   . HIS C  3  170  ? 42.524  151.292 43.959  1.00 79.18  ? 170  HIS 3 N   1 
ATOM   2220  C  CA  . HIS C  3  170  ? 43.771  151.290 44.716  1.00 80.97  ? 170  HIS 3 CA  1 
ATOM   2221  C  C   . HIS C  3  170  ? 44.633  152.540 44.457  1.00 80.05  ? 170  HIS 3 C   1 
ATOM   2222  O  O   . HIS C  3  170  ? 44.871  152.933 43.311  1.00 74.19  ? 170  HIS 3 O   1 
ATOM   2223  C  CB  . HIS C  3  170  ? 44.571  150.032 44.386  1.00 81.97  ? 170  HIS 3 CB  1 
ATOM   2224  C  CG  . HIS C  3  170  ? 45.903  149.967 45.063  1.00 83.75  ? 170  HIS 3 CG  1 
ATOM   2225  N  ND1 . HIS C  3  170  ? 47.071  149.691 44.383  1.00 77.02  ? 170  HIS 3 ND1 1 
ATOM   2226  C  CD2 . HIS C  3  170  ? 46.252  150.137 46.358  1.00 86.49  ? 170  HIS 3 CD2 1 
ATOM   2227  C  CE1 . HIS C  3  170  ? 48.083  149.689 45.230  1.00 74.90  ? 170  HIS 3 CE1 1 
ATOM   2228  N  NE2 . HIS C  3  170  ? 47.613  149.958 46.435  1.00 86.73  ? 170  HIS 3 NE2 1 
ATOM   2229  N  N   . PHE C  3  171  ? 45.107  153.166 45.527  1.00 76.10  ? 171  PHE 3 N   1 
ATOM   2230  C  CA  . PHE C  3  171  ? 45.962  154.337 45.381  1.00 79.86  ? 171  PHE 3 CA  1 
ATOM   2231  C  C   . PHE C  3  171  ? 47.127  154.271 46.362  1.00 86.80  ? 171  PHE 3 C   1 
ATOM   2232  O  O   . PHE C  3  171  ? 47.044  153.612 47.404  1.00 92.68  ? 171  PHE 3 O   1 
ATOM   2233  C  CB  . PHE C  3  171  ? 45.142  155.610 45.568  1.00 79.91  ? 171  PHE 3 CB  1 
ATOM   2234  C  CG  . PHE C  3  171  ? 43.863  155.610 44.785  1.00 83.36  ? 171  PHE 3 CG  1 
ATOM   2235  C  CD1 . PHE C  3  171  ? 43.865  155.924 43.432  1.00 85.43  ? 171  PHE 3 CD1 1 
ATOM   2236  C  CD2 . PHE C  3  171  ? 42.665  155.258 45.388  1.00 77.36  ? 171  PHE 3 CD2 1 
ATOM   2237  C  CE1 . PHE C  3  171  ? 42.694  155.902 42.698  1.00 84.29  ? 171  PHE 3 CE1 1 
ATOM   2238  C  CE2 . PHE C  3  171  ? 41.493  155.230 44.660  1.00 86.93  ? 171  PHE 3 CE2 1 
ATOM   2239  C  CZ  . PHE C  3  171  ? 41.508  155.554 43.313  1.00 87.34  ? 171  PHE 3 CZ  1 
ATOM   2240  N  N   . ALA C  3  172  ? 48.227  154.922 46.011  1.00 84.24  ? 172  ALA 3 N   1 
ATOM   2241  C  CA  . ALA C  3  172  ? 49.397  154.917 46.872  1.00 82.58  ? 172  ALA 3 CA  1 
ATOM   2242  C  C   . ALA C  3  172  ? 49.005  155.584 48.179  1.00 87.18  ? 172  ALA 3 C   1 
ATOM   2243  O  O   . ALA C  3  172  ? 48.117  156.442 48.194  1.00 93.13  ? 172  ALA 3 O   1 
ATOM   2244  C  CB  . ALA C  3  172  ? 50.541  155.650 46.214  1.00 83.15  ? 172  ALA 3 CB  1 
ATOM   2245  N  N   . THR C  3  173  ? 49.641  155.184 49.275  1.00 80.83  ? 173  THR 3 N   1 
ATOM   2246  C  CA  . THR C  3  173  ? 49.238  155.690 50.577  1.00 79.87  ? 173  THR 3 CA  1 
ATOM   2247  C  C   . THR C  3  173  ? 49.433  157.196 50.607  1.00 86.15  ? 173  THR 3 C   1 
ATOM   2248  O  O   . THR C  3  173  ? 50.483  157.695 50.202  1.00 87.39  ? 173  THR 3 O   1 
ATOM   2249  C  CB  . THR C  3  173  ? 49.989  155.008 51.749  1.00 83.09  ? 173  THR 3 CB  1 
ATOM   2250  O  OG1 . THR C  3  173  ? 51.406  155.106 51.558  1.00 83.51  ? 173  THR 3 OG1 1 
ATOM   2251  C  CG2 . THR C  3  173  ? 49.599  153.547 51.855  1.00 81.82  ? 173  THR 3 CG2 1 
ATOM   2252  N  N   . GLY C  3  174  ? 48.399  157.910 51.049  1.00 87.48  ? 174  GLY 3 N   1 
ATOM   2253  C  CA  . GLY C  3  174  ? 48.432  159.361 51.110  1.00 83.14  ? 174  GLY 3 CA  1 
ATOM   2254  C  C   . GLY C  3  174  ? 47.617  160.015 50.006  1.00 88.39  ? 174  GLY 3 C   1 
ATOM   2255  O  O   . GLY C  3  174  ? 47.661  161.239 49.836  1.00 90.22  ? 174  GLY 3 O   1 
ATOM   2256  N  N   . TYR C  3  175  ? 46.884  159.196 49.252  1.00 90.15  ? 175  TYR 3 N   1 
ATOM   2257  C  CA  . TYR C  3  175  ? 46.044  159.673 48.157  1.00 89.19  ? 175  TYR 3 CA  1 
ATOM   2258  C  C   . TYR C  3  175  ? 44.754  158.880 48.126  1.00 92.73  ? 175  TYR 3 C   1 
ATOM   2259  O  O   . TYR C  3  175  ? 44.667  157.804 48.708  1.00 89.36  ? 175  TYR 3 O   1 
ATOM   2260  C  CB  . TYR C  3  175  ? 46.763  159.555 46.808  1.00 81.54  ? 175  TYR 3 CB  1 
ATOM   2261  C  CG  . TYR C  3  175  ? 48.126  160.198 46.811  1.00 82.08  ? 175  TYR 3 CG  1 
ATOM   2262  C  CD1 . TYR C  3  175  ? 48.280  161.552 46.552  1.00 88.96  ? 175  TYR 3 CD1 1 
ATOM   2263  C  CD2 . TYR C  3  175  ? 49.254  159.457 47.108  1.00 85.25  ? 175  TYR 3 CD2 1 
ATOM   2264  C  CE1 . TYR C  3  175  ? 49.522  162.147 46.575  1.00 93.08  ? 175  TYR 3 CE1 1 
ATOM   2265  C  CE2 . TYR C  3  175  ? 50.499  160.042 47.133  1.00 92.04  ? 175  TYR 3 CE2 1 
ATOM   2266  C  CZ  . TYR C  3  175  ? 50.629  161.388 46.868  1.00 95.85  ? 175  TYR 3 CZ  1 
ATOM   2267  O  OH  . TYR C  3  175  ? 51.875  161.976 46.894  1.00 101.52 ? 175  TYR 3 OH  1 
ATOM   2268  N  N   . ASP C  3  176  ? 43.750  159.416 47.446  1.00 100.97 ? 176  ASP 3 N   1 
ATOM   2269  C  CA  . ASP C  3  176  ? 42.456  158.763 47.381  1.00 103.59 ? 176  ASP 3 CA  1 
ATOM   2270  C  C   . ASP C  3  176  ? 41.853  158.987 46.012  1.00 106.35 ? 176  ASP 3 C   1 
ATOM   2271  O  O   . ASP C  3  176  ? 42.445  159.653 45.167  1.00 104.92 ? 176  ASP 3 O   1 
ATOM   2272  C  CB  . ASP C  3  176  ? 41.536  159.311 48.463  1.00 107.97 ? 176  ASP 3 CB  1 
ATOM   2273  C  CG  . ASP C  3  176  ? 41.567  160.816 48.527  1.00 121.87 ? 176  ASP 3 CG  1 
ATOM   2274  O  OD1 . ASP C  3  176  ? 40.810  161.463 47.764  1.00 127.38 ? 176  ASP 3 OD1 1 
ATOM   2275  O  OD2 . ASP C  3  176  ? 42.363  161.354 49.330  1.00 125.74 ? 176  ASP 3 OD2 1 
ATOM   2276  N  N   . ALA C  3  177  ? 40.671  158.423 45.806  1.00 112.60 ? 177  ALA 3 N   1 
ATOM   2277  C  CA  . ALA C  3  177  ? 40.005  158.457 44.513  1.00 116.81 ? 177  ALA 3 CA  1 
ATOM   2278  C  C   . ALA C  3  177  ? 39.949  159.843 43.848  1.00 118.16 ? 177  ALA 3 C   1 
ATOM   2279  O  O   . ALA C  3  177  ? 40.379  159.987 42.701  1.00 115.58 ? 177  ALA 3 O   1 
ATOM   2280  C  CB  . ALA C  3  177  ? 38.612  157.841 44.622  1.00 119.02 ? 177  ALA 3 CB  1 
ATOM   2281  N  N   . GLU C  3  178  ? 39.451  160.860 44.555  1.00 121.82 ? 178  GLU 3 N   1 
ATOM   2282  C  CA  . GLU C  3  178  ? 39.283  162.178 43.925  1.00 133.34 ? 178  GLU 3 CA  1 
ATOM   2283  C  C   . GLU C  3  178  ? 40.568  163.023 43.803  1.00 133.68 ? 178  GLU 3 C   1 
ATOM   2284  O  O   . GLU C  3  178  ? 40.511  164.228 43.547  1.00 128.64 ? 178  GLU 3 O   1 
ATOM   2285  C  CB  . GLU C  3  178  ? 38.128  162.980 44.546  1.00 139.59 ? 178  GLU 3 CB  1 
ATOM   2286  C  CG  . GLU C  3  178  ? 36.891  163.069 43.632  1.00 146.35 ? 178  GLU 3 CG  1 
ATOM   2287  C  CD  . GLU C  3  178  ? 36.326  164.490 43.497  1.00 153.07 ? 178  GLU 3 CD  1 
ATOM   2288  O  OE1 . GLU C  3  178  ? 36.694  165.377 44.301  1.00 154.26 ? 178  GLU 3 OE1 1 
ATOM   2289  O  OE2 . GLU C  3  178  ? 35.508  164.721 42.577  1.00 153.72 ? 178  GLU 3 OE2 1 
ATOM   2290  N  N   . ASP C  3  179  ? 41.718  162.373 43.969  1.00 137.01 ? 179  ASP 3 N   1 
ATOM   2291  C  CA  . ASP C  3  179  ? 43.012  162.961 43.619  1.00 138.28 ? 179  ASP 3 CA  1 
ATOM   2292  C  C   . ASP C  3  179  ? 43.399  162.492 42.212  1.00 130.53 ? 179  ASP 3 C   1 
ATOM   2293  O  O   . ASP C  3  179  ? 44.553  162.624 41.789  1.00 120.16 ? 179  ASP 3 O   1 
ATOM   2294  C  CB  . ASP C  3  179  ? 44.098  162.539 44.623  1.00 145.15 ? 179  ASP 3 CB  1 
ATOM   2295  C  CG  . ASP C  3  179  ? 43.846  163.069 46.031  1.00 152.43 ? 179  ASP 3 CG  1 
ATOM   2296  O  OD1 . ASP C  3  179  ? 42.974  163.952 46.193  1.00 161.29 ? 179  ASP 3 OD1 1 
ATOM   2297  O  OD2 . ASP C  3  179  ? 44.532  162.613 46.975  1.00 146.87 ? 179  ASP 3 OD2 1 
ATOM   2298  N  N   . PHE C  3  180  ? 42.420  161.921 41.508  1.00 134.09 ? 180  PHE 3 N   1 
ATOM   2299  C  CA  . PHE C  3  180  ? 42.624  161.320 40.192  1.00 133.71 ? 180  PHE 3 CA  1 
ATOM   2300  C  C   . PHE C  3  180  ? 41.400  161.486 39.275  1.00 139.35 ? 180  PHE 3 C   1 
ATOM   2301  O  O   . PHE C  3  180  ? 41.187  160.668 38.379  1.00 144.19 ? 180  PHE 3 O   1 
ATOM   2302  C  CB  . PHE C  3  180  ? 42.971  159.829 40.328  1.00 127.43 ? 180  PHE 3 CB  1 
ATOM   2303  C  CG  . PHE C  3  180  ? 44.248  159.564 41.091  1.00 127.52 ? 180  PHE 3 CG  1 
ATOM   2304  C  CD1 . PHE C  3  180  ? 45.474  159.508 40.434  1.00 127.47 ? 180  PHE 3 CD1 1 
ATOM   2305  C  CD2 . PHE C  3  180  ? 44.226  159.368 42.463  1.00 124.77 ? 180  PHE 3 CD2 1 
ATOM   2306  C  CE1 . PHE C  3  180  ? 46.659  159.269 41.135  1.00 120.80 ? 180  PHE 3 CE1 1 
ATOM   2307  C  CE2 . PHE C  3  180  ? 45.407  159.134 43.167  1.00 121.28 ? 180  PHE 3 CE2 1 
ATOM   2308  C  CZ  . PHE C  3  180  ? 46.624  159.087 42.499  1.00 116.88 ? 180  PHE 3 CZ  1 
ATOM   2309  N  N   . HIS C  3  181  ? 40.600  162.530 39.496  1.00 137.35 ? 181  HIS 3 N   1 
ATOM   2310  C  CA  . HIS C  3  181  ? 39.453  162.818 38.624  1.00 134.29 ? 181  HIS 3 CA  1 
ATOM   2311  C  C   . HIS C  3  181  ? 39.598  164.175 37.951  1.00 120.76 ? 181  HIS 3 C   1 
ATOM   2312  O  O   . HIS C  3  181  ? 38.608  164.773 37.541  1.00 113.82 ? 181  HIS 3 O   1 
ATOM   2313  C  CB  . HIS C  3  181  ? 38.112  162.750 39.383  1.00 143.16 ? 181  HIS 3 CB  1 
ATOM   2314  C  CG  . HIS C  3  181  ? 37.522  161.369 39.472  1.00 148.01 ? 181  HIS 3 CG  1 
ATOM   2315  N  ND1 . HIS C  3  181  ? 38.079  160.271 38.848  1.00 145.76 ? 181  HIS 3 ND1 1 
ATOM   2316  C  CD2 . HIS C  3  181  ? 36.419  160.913 40.114  1.00 148.93 ? 181  HIS 3 CD2 1 
ATOM   2317  C  CE1 . HIS C  3  181  ? 37.349  159.200 39.105  1.00 142.62 ? 181  HIS 3 CE1 1 
ATOM   2318  N  NE2 . HIS C  3  181  ? 36.336  159.562 39.871  1.00 145.20 ? 181  HIS 3 NE2 1 
ATOM   2319  N  N   . SER D  4  263  ? 18.756  47.184  91.471  1.00 152.17 ? 263  SER 4 N   1 
ATOM   2320  C  CA  . SER D  4  263  ? 19.608  46.389  90.597  1.00 152.75 ? 263  SER 4 CA  1 
ATOM   2321  C  C   . SER D  4  263  ? 20.876  47.169  90.249  1.00 156.02 ? 263  SER 4 C   1 
ATOM   2322  O  O   . SER D  4  263  ? 20.886  47.960  89.301  1.00 156.50 ? 263  SER 4 O   1 
ATOM   2323  C  CB  . SER D  4  263  ? 18.845  45.980  89.327  1.00 149.25 ? 263  SER 4 CB  1 
ATOM   2324  O  OG  . SER D  4  263  ? 17.711  45.168  89.624  1.00 147.01 ? 263  SER 4 OG  1 
ATOM   2325  N  N   . ARG D  4  264  ? 21.939  46.943  91.025  1.00 157.25 ? 264  ARG 4 N   1 
ATOM   2326  C  CA  . ARG D  4  264  ? 23.206  47.665  90.856  1.00 151.91 ? 264  ARG 4 CA  1 
ATOM   2327  C  C   . ARG D  4  264  ? 24.376  47.042  91.661  1.00 154.21 ? 264  ARG 4 C   1 
ATOM   2328  O  O   . ARG D  4  264  ? 24.199  46.629  92.808  1.00 155.52 ? 264  ARG 4 O   1 
ATOM   2329  C  CB  . ARG D  4  264  ? 23.014  49.144  91.210  1.00 146.56 ? 264  ARG 4 CB  1 
ATOM   2330  C  CG  . ARG D  4  264  ? 24.086  50.059  90.663  1.00 142.62 ? 264  ARG 4 CG  1 
ATOM   2331  C  CD  . ARG D  4  264  ? 23.579  51.485  90.547  1.00 143.17 ? 264  ARG 4 CD  1 
ATOM   2332  N  NE  . ARG D  4  264  ? 24.595  52.457  90.947  1.00 142.55 ? 264  ARG 4 NE  1 
ATOM   2333  C  CZ  . ARG D  4  264  ? 24.529  53.762  90.693  1.00 139.09 ? 264  ARG 4 CZ  1 
ATOM   2334  N  NH1 . ARG D  4  264  ? 23.495  54.257  90.026  1.00 139.61 ? 264  ARG 4 NH1 1 
ATOM   2335  N  NH2 . ARG D  4  264  ? 25.500  54.574  91.101  1.00 133.16 ? 264  ARG 4 NH2 1 
ATOM   2336  N  N   . SER D  4  265  ? 25.562  46.987  91.047  1.00 149.80 ? 265  SER 4 N   1 
ATOM   2337  C  CA  . SER D  4  265  ? 26.754  46.320  91.601  1.00 144.32 ? 265  SER 4 CA  1 
ATOM   2338  C  C   . SER D  4  265  ? 27.598  47.214  92.518  1.00 145.73 ? 265  SER 4 C   1 
ATOM   2339  O  O   . SER D  4  265  ? 27.197  48.326  92.855  1.00 143.97 ? 265  SER 4 O   1 
ATOM   2340  C  CB  . SER D  4  265  ? 27.628  45.777  90.457  1.00 133.82 ? 265  SER 4 CB  1 
ATOM   2341  O  OG  . SER D  4  265  ? 28.967  45.533  90.863  1.00 125.55 ? 265  SER 4 OG  1 
ATOM   2342  N  N   . GLN D  4  266  ? 28.768  46.716  92.917  1.00 148.48 ? 266  GLN 4 N   1 
ATOM   2343  C  CA  . GLN D  4  266  ? 29.678  47.469  93.777  1.00 151.23 ? 266  GLN 4 CA  1 
ATOM   2344  C  C   . GLN D  4  266  ? 30.624  48.303  92.917  1.00 145.42 ? 266  GLN 4 C   1 
ATOM   2345  O  O   . GLN D  4  266  ? 30.840  49.490  93.169  1.00 142.19 ? 266  GLN 4 O   1 
ATOM   2346  C  CB  . GLN D  4  266  ? 30.478  46.518  94.677  1.00 159.65 ? 266  GLN 4 CB  1 
ATOM   2347  C  CG  . GLN D  4  266  ? 31.094  47.171  95.919  1.00 163.92 ? 266  GLN 4 CG  1 
ATOM   2348  C  CD  . GLN D  4  266  ? 32.077  46.256  96.652  1.00 169.00 ? 266  GLN 4 CD  1 
ATOM   2349  O  OE1 . GLN D  4  266  ? 32.072  45.033  96.472  1.00 172.12 ? 266  GLN 4 OE1 1 
ATOM   2350  N  NE2 . GLN D  4  266  ? 32.939  46.855  97.474  1.00 167.05 ? 266  GLN 4 NE2 1 
ATOM   2351  N  N   . ALA D  4  267  ? 31.186  47.672  91.893  1.00 143.46 ? 267  ALA 4 N   1 
ATOM   2352  C  CA  . ALA D  4  267  ? 32.052  48.376  90.962  1.00 138.08 ? 267  ALA 4 CA  1 
ATOM   2353  C  C   . ALA D  4  267  ? 31.226  49.207  89.985  1.00 135.90 ? 267  ALA 4 C   1 
ATOM   2354  O  O   . ALA D  4  267  ? 31.743  50.117  89.341  1.00 133.64 ? 267  ALA 4 O   1 
ATOM   2355  C  CB  . ALA D  4  267  ? 32.943  47.397  90.219  1.00 135.54 ? 267  ALA 4 CB  1 
ATOM   2356  N  N   . GLU D  4  268  ? 29.938  48.901  89.881  1.00 137.29 ? 268  GLU 4 N   1 
ATOM   2357  C  CA  . GLU D  4  268  ? 29.056  49.685  89.024  1.00 137.78 ? 268  GLU 4 CA  1 
ATOM   2358  C  C   . GLU D  4  268  ? 28.654  51.011  89.683  1.00 133.15 ? 268  GLU 4 C   1 
ATOM   2359  O  O   . GLU D  4  268  ? 28.245  51.953  89.001  1.00 127.11 ? 268  GLU 4 O   1 
ATOM   2360  C  CB  . GLU D  4  268  ? 27.822  48.876  88.604  1.00 144.80 ? 268  GLU 4 CB  1 
ATOM   2361  C  CG  . GLU D  4  268  ? 28.072  47.903  87.450  1.00 147.43 ? 268  GLU 4 CG  1 
ATOM   2362  C  CD  . GLU D  4  268  ? 26.825  47.118  87.041  1.00 152.07 ? 268  GLU 4 CD  1 
ATOM   2363  O  OE1 . GLU D  4  268  ? 26.006  46.775  87.922  1.00 155.30 ? 268  GLU 4 OE1 1 
ATOM   2364  O  OE2 . GLU D  4  268  ? 26.663  46.844  85.832  1.00 151.24 ? 268  GLU 4 OE2 1 
ATOM   2365  N  N   . SER D  4  269  ? 28.780  51.087  91.005  1.00 132.48 ? 269  SER 4 N   1 
ATOM   2366  C  CA  . SER D  4  269  ? 28.483  52.331  91.714  1.00 126.77 ? 269  SER 4 CA  1 
ATOM   2367  C  C   . SER D  4  269  ? 29.744  53.110  92.077  1.00 123.05 ? 269  SER 4 C   1 
ATOM   2368  O  O   . SER D  4  269  ? 29.697  54.045  92.870  1.00 121.04 ? 269  SER 4 O   1 
ATOM   2369  C  CB  . SER D  4  269  ? 27.620  52.074  92.952  1.00 127.07 ? 269  SER 4 CB  1 
ATOM   2370  O  OG  . SER D  4  269  ? 27.706  50.719  93.355  1.00 130.90 ? 269  SER 4 OG  1 
ATOM   2371  N  N   . LEU D  4  270  ? 30.873  52.717  91.497  1.00 124.13 ? 270  LEU 4 N   1 
ATOM   2372  C  CA  . LEU D  4  270  ? 32.072  53.542  91.555  1.00 122.17 ? 270  LEU 4 CA  1 
ATOM   2373  C  C   . LEU D  4  270  ? 31.764  54.853  90.855  1.00 118.48 ? 270  LEU 4 C   1 
ATOM   2374  O  O   . LEU D  4  270  ? 31.120  54.860  89.806  1.00 118.74 ? 270  LEU 4 O   1 
ATOM   2375  C  CB  . LEU D  4  270  ? 33.233  52.861  90.834  1.00 121.65 ? 270  LEU 4 CB  1 
ATOM   2376  C  CG  . LEU D  4  270  ? 33.890  51.637  91.465  1.00 119.19 ? 270  LEU 4 CG  1 
ATOM   2377  C  CD1 . LEU D  4  270  ? 34.750  50.975  90.411  1.00 119.14 ? 270  LEU 4 CD1 1 
ATOM   2378  C  CD2 . LEU D  4  270  ? 34.720  52.016  92.685  1.00 114.44 ? 270  LEU 4 CD2 1 
ATOM   2379  N  N   . PRO D  4  271  ? 32.238  55.970  91.422  1.00 115.41 ? 271  PRO 4 N   1 
ATOM   2380  C  CA  . PRO D  4  271  ? 31.977  57.300  90.859  1.00 108.06 ? 271  PRO 4 CA  1 
ATOM   2381  C  C   . PRO D  4  271  ? 32.568  57.442  89.466  1.00 102.62 ? 271  PRO 4 C   1 
ATOM   2382  O  O   . PRO D  4  271  ? 33.727  57.087  89.245  1.00 98.93  ? 271  PRO 4 O   1 
ATOM   2383  C  CB  . PRO D  4  271  ? 32.728  58.225  91.811  1.00 105.18 ? 271  PRO 4 CB  1 
ATOM   2384  C  CG  . PRO D  4  271  ? 33.845  57.375  92.349  1.00 107.57 ? 271  PRO 4 CG  1 
ATOM   2385  C  CD  . PRO D  4  271  ? 33.222  56.017  92.518  1.00 114.75 ? 271  PRO 4 CD  1 
ATOM   2386  N  N   . ILE D  4  272  ? 31.781  57.947  88.529  1.00 101.04 ? 272  ILE 4 N   1 
ATOM   2387  C  CA  . ILE D  4  272  ? 32.305  58.217  87.199  1.00 100.36 ? 272  ILE 4 CA  1 
ATOM   2388  C  C   . ILE D  4  272  ? 32.848  59.656  87.160  1.00 100.06 ? 272  ILE 4 C   1 
ATOM   2389  O  O   . ILE D  4  272  ? 32.088  60.629  87.173  1.00 102.95 ? 272  ILE 4 O   1 
ATOM   2390  C  CB  . ILE D  4  272  ? 31.245  57.906  86.117  1.00 106.66 ? 272  ILE 4 CB  1 
ATOM   2391  C  CG1 . ILE D  4  272  ? 31.589  58.582  84.785  1.00 112.08 ? 272  ILE 4 CG1 1 
ATOM   2392  C  CG2 . ILE D  4  272  ? 29.846  58.269  86.613  1.00 107.71 ? 272  ILE 4 CG2 1 
ATOM   2393  C  CD1 . ILE D  4  272  ? 30.779  58.044  83.602  1.00 116.15 ? 272  ILE 4 CD1 1 
ATOM   2394  N  N   . VAL D  4  273  ? 34.173  59.781  87.145  1.00 93.91  ? 273  VAL 4 N   1 
ATOM   2395  C  CA  . VAL D  4  273  ? 34.821  61.046  87.504  1.00 88.54  ? 273  VAL 4 CA  1 
ATOM   2396  C  C   . VAL D  4  273  ? 34.354  62.250  86.708  1.00 93.88  ? 273  VAL 4 C   1 
ATOM   2397  O  O   . VAL D  4  273  ? 34.012  63.281  87.289  1.00 101.34 ? 273  VAL 4 O   1 
ATOM   2398  C  CB  . VAL D  4  273  ? 36.354  60.972  87.399  1.00 83.97  ? 273  VAL 4 CB  1 
ATOM   2399  C  CG1 . VAL D  4  273  ? 36.958  62.322  87.712  1.00 79.59  ? 273  VAL 4 CG1 1 
ATOM   2400  C  CG2 . VAL D  4  273  ? 36.912  59.927  88.340  1.00 83.61  ? 273  VAL 4 CG2 1 
ATOM   2401  N  N   . SER D  4  274  ? 34.348  62.117  85.385  1.00 89.90  ? 274  SER 4 N   1 
ATOM   2402  C  CA  . SER D  4  274  ? 33.996  63.222  84.501  1.00 87.68  ? 274  SER 4 CA  1 
ATOM   2403  C  C   . SER D  4  274  ? 32.636  63.845  84.855  1.00 92.67  ? 274  SER 4 C   1 
ATOM   2404  O  O   . SER D  4  274  ? 32.487  65.070  84.831  1.00 94.95  ? 274  SER 4 O   1 
ATOM   2405  C  CB  . SER D  4  274  ? 34.013  62.768  83.039  1.00 85.30  ? 274  SER 4 CB  1 
ATOM   2406  O  OG  . SER D  4  274  ? 32.725  62.353  82.615  1.00 90.90  ? 274  SER 4 OG  1 
ATOM   2407  N  N   . ASN D  4  275  ? 31.664  63.003  85.204  1.00 93.08  ? 275  ASN 4 N   1 
ATOM   2408  C  CA  . ASN D  4  275  ? 30.314  63.464  85.542  1.00 96.36  ? 275  ASN 4 CA  1 
ATOM   2409  C  C   . ASN D  4  275  ? 30.256  64.212  86.868  1.00 95.89  ? 275  ASN 4 C   1 
ATOM   2410  O  O   . ASN D  4  275  ? 29.517  65.192  87.017  1.00 94.44  ? 275  ASN 4 O   1 
ATOM   2411  C  CB  . ASN D  4  275  ? 29.323  62.295  85.569  1.00 100.70 ? 275  ASN 4 CB  1 
ATOM   2412  C  CG  . ASN D  4  275  ? 28.910  61.832  84.176  1.00 104.95 ? 275  ASN 4 CG  1 
ATOM   2413  O  OD1 . ASN D  4  275  ? 29.428  62.308  83.164  1.00 105.78 ? 275  ASN 4 OD1 1 
ATOM   2414  N  ND2 . ASN D  4  275  ? 27.977  60.888  84.123  1.00 106.93 ? 275  ASN 4 ND2 1 
ATOM   2415  N  N   . LYS D  4  276  ? 31.030  63.738  87.836  1.00 94.52  ? 276  LYS 4 N   1 
ATOM   2416  C  CA  . LYS D  4  276  ? 31.127  64.423  89.114  1.00 89.55  ? 276  LYS 4 CA  1 
ATOM   2417  C  C   . LYS D  4  276  ? 31.890  65.733  88.957  1.00 90.16  ? 276  LYS 4 C   1 
ATOM   2418  O  O   . LYS D  4  276  ? 31.574  66.717  89.614  1.00 98.30  ? 276  LYS 4 O   1 
ATOM   2419  C  CB  . LYS D  4  276  ? 31.790  63.532  90.164  1.00 87.17  ? 276  LYS 4 CB  1 
ATOM   2420  C  CG  . LYS D  4  276  ? 30.863  62.508  90.775  1.00 87.45  ? 276  LYS 4 CG  1 
ATOM   2421  C  CD  . LYS D  4  276  ? 31.295  62.173  92.188  1.00 106.39 ? 276  LYS 4 CD  1 
ATOM   2422  C  CE  . LYS D  4  276  ? 30.274  61.278  92.852  1.00 109.70 ? 276  LYS 4 CE  1 
ATOM   2423  N  NZ  . LYS D  4  276  ? 28.888  61.806  92.688  1.00 112.97 ? 276  LYS 4 NZ  1 
ATOM   2424  N  N   . LYS D  4  277  ? 32.888  65.741  88.078  1.00 88.02  ? 277  LYS 4 N   1 
ATOM   2425  C  CA  . LYS D  4  277  ? 33.681  66.940  87.817  1.00 86.09  ? 277  LYS 4 CA  1 
ATOM   2426  C  C   . LYS D  4  277  ? 32.831  68.110  87.331  1.00 84.25  ? 277  LYS 4 C   1 
ATOM   2427  O  O   . LYS D  4  277  ? 33.106  69.259  87.655  1.00 81.64  ? 277  LYS 4 O   1 
ATOM   2428  C  CB  . LYS D  4  277  ? 34.786  66.642  86.798  1.00 82.71  ? 277  LYS 4 CB  1 
ATOM   2429  C  CG  . LYS D  4  277  ? 35.593  67.862  86.379  1.00 75.41  ? 277  LYS 4 CG  1 
ATOM   2430  C  CD  . LYS D  4  277  ? 36.485  67.527  85.216  1.00 79.66  ? 277  LYS 4 CD  1 
ATOM   2431  C  CE  . LYS D  4  277  ? 37.126  68.766  84.624  1.00 89.13  ? 277  LYS 4 CE  1 
ATOM   2432  N  NZ  . LYS D  4  277  ? 38.145  69.351  85.533  1.00 94.78  ? 277  LYS 4 NZ  1 
ATOM   2433  N  N   . ILE D  4  278  ? 31.802  67.811  86.549  1.00 91.17  ? 278  ILE 4 N   1 
ATOM   2434  C  CA  . ILE D  4  278  ? 30.925  68.844  86.017  1.00 95.99  ? 278  ILE 4 CA  1 
ATOM   2435  C  C   . ILE D  4  278  ? 30.280  69.660  87.137  1.00 100.83 ? 278  ILE 4 C   1 
ATOM   2436  O  O   . ILE D  4  278  ? 30.327  70.887  87.130  1.00 102.06 ? 278  ILE 4 O   1 
ATOM   2437  C  CB  . ILE D  4  278  ? 29.839  68.251  85.103  1.00 98.42  ? 278  ILE 4 CB  1 
ATOM   2438  C  CG1 . ILE D  4  278  ? 30.437  67.918  83.738  1.00 98.11  ? 278  ILE 4 CG1 1 
ATOM   2439  C  CG2 . ILE D  4  278  ? 28.690  69.229  84.945  1.00 102.47 ? 278  ILE 4 CG2 1 
ATOM   2440  C  CD1 . ILE D  4  278  ? 29.421  67.862  82.610  1.00 97.93  ? 278  ILE 4 CD1 1 
ATOM   2441  N  N   . VAL D  4  279  ? 29.697  68.967  88.105  1.00 101.79 ? 279  VAL 4 N   1 
ATOM   2442  C  CA  . VAL D  4  279  ? 29.060  69.617  89.239  1.00 100.39 ? 279  VAL 4 CA  1 
ATOM   2443  C  C   . VAL D  4  279  ? 30.065  70.384  90.095  1.00 96.85  ? 279  VAL 4 C   1 
ATOM   2444  O  O   . VAL D  4  279  ? 29.787  71.498  90.561  1.00 95.44  ? 279  VAL 4 O   1 
ATOM   2445  C  CB  . VAL D  4  279  ? 28.340  68.576  90.109  1.00 98.66  ? 279  VAL 4 CB  1 
ATOM   2446  C  CG1 . VAL D  4  279  ? 27.908  69.192  91.442  1.00 96.43  ? 279  VAL 4 CG1 1 
ATOM   2447  C  CG2 . VAL D  4  279  ? 27.162  67.995  89.339  1.00 88.23  ? 279  VAL 4 CG2 1 
ATOM   2448  N  N   . PHE D  4  280  ? 31.232  69.774  90.279  1.00 91.79  ? 280  PHE 4 N   1 
ATOM   2449  C  CA  . PHE D  4  280  ? 32.274  70.288  91.157  1.00 92.62  ? 280  PHE 4 CA  1 
ATOM   2450  C  C   . PHE D  4  280  ? 32.942  71.535  90.543  1.00 92.09  ? 280  PHE 4 C   1 
ATOM   2451  O  O   . PHE D  4  280  ? 33.263  72.495  91.248  1.00 93.26  ? 280  PHE 4 O   1 
ATOM   2452  C  CB  . PHE D  4  280  ? 33.286  69.167  91.434  1.00 92.39  ? 280  PHE 4 CB  1 
ATOM   2453  C  CG  . PHE D  4  280  ? 34.188  69.413  92.617  1.00 95.87  ? 280  PHE 4 CG  1 
ATOM   2454  C  CD1 . PHE D  4  280  ? 33.939  70.437  93.516  1.00 100.98 ? 280  PHE 4 CD1 1 
ATOM   2455  C  CD2 . PHE D  4  280  ? 35.300  68.610  92.819  1.00 95.55  ? 280  PHE 4 CD2 1 
ATOM   2456  C  CE1 . PHE D  4  280  ? 34.786  70.657  94.593  1.00 100.97 ? 280  PHE 4 CE1 1 
ATOM   2457  C  CE2 . PHE D  4  280  ? 36.149  68.822  93.892  1.00 97.23  ? 280  PHE 4 CE2 1 
ATOM   2458  C  CZ  . PHE D  4  280  ? 35.892  69.847  94.782  1.00 99.92  ? 280  PHE 4 CZ  1 
ATOM   2459  N  N   . ASP D  4  281  ? 33.132  71.530  89.229  1.00 87.42  ? 281  ASP 4 N   1 
ATOM   2460  C  CA  . ASP D  4  281  ? 33.664  72.699  88.549  1.00 90.74  ? 281  ASP 4 CA  1 
ATOM   2461  C  C   . ASP D  4  281  ? 32.678  73.851  88.566  1.00 91.09  ? 281  ASP 4 C   1 
ATOM   2462  O  O   . ASP D  4  281  ? 33.076  75.005  88.635  1.00 89.52  ? 281  ASP 4 O   1 
ATOM   2463  C  CB  . ASP D  4  281  ? 33.989  72.378  87.097  1.00 100.61 ? 281  ASP 4 CB  1 
ATOM   2464  C  CG  . ASP D  4  281  ? 35.354  71.768  86.928  1.00 106.57 ? 281  ASP 4 CG  1 
ATOM   2465  O  OD1 . ASP D  4  281  ? 36.099  71.691  87.928  1.00 107.20 ? 281  ASP 4 OD1 1 
ATOM   2466  O  OD2 . ASP D  4  281  ? 35.683  71.383  85.785  1.00 109.20 ? 281  ASP 4 OD2 1 
ATOM   2467  N  N   . ASP D  4  282  ? 31.392  73.539  88.466  1.00 96.79  ? 282  ASP 4 N   1 
ATOM   2468  C  CA  . ASP D  4  282  ? 30.377  74.581  88.439  1.00 106.34 ? 282  ASP 4 CA  1 
ATOM   2469  C  C   . ASP D  4  282  ? 30.343  75.327  89.752  1.00 100.27 ? 282  ASP 4 C   1 
ATOM   2470  O  O   . ASP D  4  282  ? 30.393  76.553  89.765  1.00 92.88  ? 282  ASP 4 O   1 
ATOM   2471  C  CB  . ASP D  4  282  ? 28.996  74.013  88.128  1.00 127.82 ? 282  ASP 4 CB  1 
ATOM   2472  C  CG  . ASP D  4  282  ? 28.800  73.753  86.649  1.00 146.32 ? 282  ASP 4 CG  1 
ATOM   2473  O  OD1 . ASP D  4  282  ? 29.817  73.546  85.944  1.00 149.73 ? 282  ASP 4 OD1 1 
ATOM   2474  O  OD2 . ASP D  4  282  ? 27.633  73.756  86.191  1.00 155.14 ? 282  ASP 4 OD2 1 
ATOM   2475  N  N   . GLU D  4  283  ? 30.268  74.594  90.858  1.00 102.89 ? 283  GLU 4 N   1 
ATOM   2476  C  CA  . GLU D  4  283  ? 30.203  75.253  92.155  1.00 103.56 ? 283  GLU 4 CA  1 
ATOM   2477  C  C   . GLU D  4  283  ? 31.520  75.926  92.548  1.00 95.93  ? 283  GLU 4 C   1 
ATOM   2478  O  O   . GLU D  4  283  ? 31.517  76.923  93.265  1.00 99.62  ? 283  GLU 4 O   1 
ATOM   2479  C  CB  . GLU D  4  283  ? 29.651  74.333  93.256  1.00 113.66 ? 283  GLU 4 CB  1 
ATOM   2480  C  CG  . GLU D  4  283  ? 30.418  73.052  93.534  1.00 123.00 ? 283  GLU 4 CG  1 
ATOM   2481  C  CD  . GLU D  4  283  ? 29.718  72.175  94.582  1.00 133.05 ? 283  GLU 4 CD  1 
ATOM   2482  O  OE1 . GLU D  4  283  ? 28.477  72.004  94.501  1.00 134.27 ? 283  GLU 4 OE1 1 
ATOM   2483  O  OE2 . GLU D  4  283  ? 30.409  71.656  95.487  1.00 136.20 ? 283  GLU 4 OE2 1 
ATOM   2484  N  N   . VAL D  4  284  ? 32.640  75.412  92.059  1.00 86.29  ? 284  VAL 4 N   1 
ATOM   2485  C  CA  . VAL D  4  284  ? 33.906  76.086  92.300  1.00 78.12  ? 284  VAL 4 CA  1 
ATOM   2486  C  C   . VAL D  4  284  ? 34.018  77.345  91.445  1.00 80.00  ? 284  VAL 4 C   1 
ATOM   2487  O  O   . VAL D  4  284  ? 34.455  78.382  91.933  1.00 79.72  ? 284  VAL 4 O   1 
ATOM   2488  C  CB  . VAL D  4  284  ? 35.131  75.162  92.110  1.00 74.49  ? 284  VAL 4 CB  1 
ATOM   2489  C  CG1 . VAL D  4  284  ? 36.402  75.981  91.879  1.00 72.51  ? 284  VAL 4 CG1 1 
ATOM   2490  C  CG2 . VAL D  4  284  ? 35.297  74.263  93.316  1.00 75.37  ? 284  VAL 4 CG2 1 
ATOM   2491  N  N   . SER D  4  285  ? 33.607  77.272  90.180  1.00 82.41  ? 285  SER 4 N   1 
ATOM   2492  C  CA  . SER D  4  285  ? 33.652  78.456  89.328  1.00 74.10  ? 285  SER 4 CA  1 
ATOM   2493  C  C   . SER D  4  285  ? 32.814  79.547  89.935  1.00 79.93  ? 285  SER 4 C   1 
ATOM   2494  O  O   . SER D  4  285  ? 33.264  80.679  90.045  1.00 87.70  ? 285  SER 4 O   1 
ATOM   2495  C  CB  . SER D  4  285  ? 33.203  78.168  87.902  1.00 78.28  ? 285  SER 4 CB  1 
ATOM   2496  O  OG  . SER D  4  285  ? 34.278  77.643  87.133  1.00 89.37  ? 285  SER 4 OG  1 
ATOM   2497  N  N   . ILE D  4  286  ? 31.606  79.211  90.367  1.00 81.62  ? 286  ILE 4 N   1 
ATOM   2498  C  CA  . ILE D  4  286  ? 30.745  80.217  90.976  1.00 81.92  ? 286  ILE 4 CA  1 
ATOM   2499  C  C   . ILE D  4  286  ? 31.375  80.782  92.237  1.00 83.96  ? 286  ILE 4 C   1 
ATOM   2500  O  O   . ILE D  4  286  ? 31.451  81.998  92.396  1.00 85.15  ? 286  ILE 4 O   1 
ATOM   2501  C  CB  . ILE D  4  286  ? 29.351  79.676  91.283  1.00 83.45  ? 286  ILE 4 CB  1 
ATOM   2502  C  CG1 . ILE D  4  286  ? 28.629  79.351  89.979  1.00 81.39  ? 286  ILE 4 CG1 1 
ATOM   2503  C  CG2 . ILE D  4  286  ? 28.563  80.695  92.075  1.00 85.24  ? 286  ILE 4 CG2 1 
ATOM   2504  C  CD1 . ILE D  4  286  ? 27.294  78.705  90.171  1.00 99.19  ? 286  ILE 4 CD1 1 
ATOM   2505  N  N   . GLU D  4  287  ? 31.849  79.896  93.109  1.00 87.30  ? 287  GLU 4 N   1 
ATOM   2506  C  CA  . GLU D  4  287  ? 32.468  80.306  94.363  1.00 78.16  ? 287  GLU 4 CA  1 
ATOM   2507  C  C   . GLU D  4  287  ? 33.644  81.236  94.097  1.00 78.65  ? 287  GLU 4 C   1 
ATOM   2508  O  O   . GLU D  4  287  ? 33.686  82.350  94.598  1.00 84.63  ? 287  GLU 4 O   1 
ATOM   2509  C  CB  . GLU D  4  287  ? 32.917  79.086  95.167  1.00 91.83  ? 287  GLU 4 CB  1 
ATOM   2510  C  CG  . GLU D  4  287  ? 33.082  79.342  96.661  1.00 103.37 ? 287  GLU 4 CG  1 
ATOM   2511  C  CD  . GLU D  4  287  ? 33.226  78.054  97.475  1.00 116.47 ? 287  GLU 4 CD  1 
ATOM   2512  O  OE1 . GLU D  4  287  ? 33.007  76.950  96.918  1.00 118.66 ? 287  GLU 4 OE1 1 
ATOM   2513  O  OE2 . GLU D  4  287  ? 33.558  78.149  98.679  1.00 120.86 ? 287  GLU 4 OE2 1 
ATOM   2514  N  N   . ASN D  4  288  ? 34.584  80.791  93.278  1.00 74.59  ? 288  ASN 4 N   1 
ATOM   2515  C  CA  . ASN D  4  288  ? 35.779  81.576  92.990  1.00 72.84  ? 288  ASN 4 CA  1 
ATOM   2516  C  C   . ASN D  4  288  ? 35.491  82.929  92.337  1.00 77.72  ? 288  ASN 4 C   1 
ATOM   2517  O  O   . ASN D  4  288  ? 36.220  83.901  92.554  1.00 77.14  ? 288  ASN 4 O   1 
ATOM   2518  C  CB  . ASN D  4  288  ? 36.760  80.767  92.129  1.00 76.06  ? 288  ASN 4 CB  1 
ATOM   2519  C  CG  . ASN D  4  288  ? 37.599  79.791  92.946  1.00 73.94  ? 288  ASN 4 CG  1 
ATOM   2520  O  OD1 . ASN D  4  288  ? 37.712  79.917  94.161  1.00 76.99  ? 288  ASN 4 OD1 1 
ATOM   2521  N  ND2 . ASN D  4  288  ? 38.209  78.827  92.271  1.00 76.67  ? 288  ASN 4 ND2 1 
ATOM   2522  N  N   . LYS D  4  289  ? 34.436  83.003  91.536  1.00 83.30  ? 289  LYS 4 N   1 
ATOM   2523  C  CA  . LYS D  4  289  ? 34.166  84.243  90.831  1.00 83.31  ? 289  LYS 4 CA  1 
ATOM   2524  C  C   . LYS D  4  289  ? 33.585  85.254  91.805  1.00 80.56  ? 289  LYS 4 C   1 
ATOM   2525  O  O   . LYS D  4  289  ? 33.865  86.447  91.713  1.00 76.63  ? 289  LYS 4 O   1 
ATOM   2526  C  CB  . LYS D  4  289  ? 33.238  84.026  89.637  1.00 87.06  ? 289  LYS 4 CB  1 
ATOM   2527  C  CG  . LYS D  4  289  ? 33.191  85.216  88.696  1.00 93.55  ? 289  LYS 4 CG  1 
ATOM   2528  C  CD  . LYS D  4  289  ? 32.158  85.037  87.597  1.00 103.89 ? 289  LYS 4 CD  1 
ATOM   2529  C  CE  . LYS D  4  289  ? 32.062  86.288  86.728  1.00 110.42 ? 289  LYS 4 CE  1 
ATOM   2530  N  NZ  . LYS D  4  289  ? 30.956  86.203  85.728  1.00 114.40 ? 289  LYS 4 NZ  1 
ATOM   2531  N  N   . GLU D  4  290  ? 32.794  84.766  92.752  1.00 83.13  ? 290  GLU 4 N   1 
ATOM   2532  C  CA  . GLU D  4  290  ? 32.188  85.647  93.742  1.00 100.33 ? 290  GLU 4 CA  1 
ATOM   2533  C  C   . GLU D  4  290  ? 33.200  86.144  94.778  1.00 94.11  ? 290  GLU 4 C   1 
ATOM   2534  O  O   . GLU D  4  290  ? 33.091  87.277  95.241  1.00 96.74  ? 290  GLU 4 O   1 
ATOM   2535  C  CB  . GLU D  4  290  ? 30.996  84.974  94.437  1.00 119.46 ? 290  GLU 4 CB  1 
ATOM   2536  C  CG  . GLU D  4  290  ? 29.802  85.908  94.683  1.00 133.18 ? 290  GLU 4 CG  1 
ATOM   2537  C  CD  . GLU D  4  290  ? 29.057  86.268  93.395  1.00 143.38 ? 290  GLU 4 CD  1 
ATOM   2538  O  OE1 . GLU D  4  290  ? 29.047  85.433  92.460  1.00 148.46 ? 290  GLU 4 OE1 1 
ATOM   2539  O  OE2 . GLU D  4  290  ? 28.486  87.382  93.313  1.00 143.25 ? 290  GLU 4 OE2 1 
ATOM   2540  N  N   . SER D  4  291  ? 34.162  85.293  95.144  1.00 85.37  ? 291  SER 4 N   1 
ATOM   2541  C  CA  . SER D  4  291  ? 35.244  85.685  96.046  1.00 82.13  ? 291  SER 4 CA  1 
ATOM   2542  C  C   . SER D  4  291  ? 35.939  86.908  95.479  1.00 84.52  ? 291  SER 4 C   1 
ATOM   2543  O  O   . SER D  4  291  ? 36.127  87.920  96.153  1.00 91.09  ? 291  SER 4 O   1 
ATOM   2544  C  CB  . SER D  4  291  ? 36.293  84.583  96.165  1.00 80.04  ? 291  SER 4 CB  1 
ATOM   2545  O  OG  . SER D  4  291  ? 35.737  83.288  96.104  1.00 88.82  ? 291  SER 4 OG  1 
ATOM   2546  N  N   . HIS D  4  292  ? 36.315  86.803  94.216  1.00 84.76  ? 292  HIS 4 N   1 
ATOM   2547  C  CA  . HIS D  4  292  ? 37.059  87.855  93.560  1.00 88.10  ? 292  HIS 4 CA  1 
ATOM   2548  C  C   . HIS D  4  292  ? 36.234  89.120  93.348  1.00 90.85  ? 292  HIS 4 C   1 
ATOM   2549  O  O   . HIS D  4  292  ? 36.782  90.192  93.128  1.00 91.92  ? 292  HIS 4 O   1 
ATOM   2550  C  CB  . HIS D  4  292  ? 37.620  87.326  92.241  1.00 82.98  ? 292  HIS 4 CB  1 
ATOM   2551  C  CG  . HIS D  4  292  ? 38.806  86.437  92.419  1.00 82.54  ? 292  HIS 4 CG  1 
ATOM   2552  N  ND1 . HIS D  4  292  ? 38.972  85.264  91.720  1.00 90.60  ? 292  HIS 4 ND1 1 
ATOM   2553  C  CD2 . HIS D  4  292  ? 39.897  86.542  93.214  1.00 84.30  ? 292  HIS 4 CD2 1 
ATOM   2554  C  CE1 . HIS D  4  292  ? 40.109  84.696  92.065  1.00 91.64  ? 292  HIS 4 CE1 1 
ATOM   2555  N  NE2 . HIS D  4  292  ? 40.690  85.453  92.984  1.00 81.44  ? 292  HIS 4 NE2 1 
ATOM   2556  N  N   . LYS D  4  293  ? 34.918  88.997  93.437  1.00 94.46  ? 293  LYS 4 N   1 
ATOM   2557  C  CA  . LYS D  4  293  ? 34.043  90.113  93.113  1.00 103.05 ? 293  LYS 4 CA  1 
ATOM   2558  C  C   . LYS D  4  293  ? 34.217  91.297  94.063  1.00 108.99 ? 293  LYS 4 C   1 
ATOM   2559  O  O   . LYS D  4  293  ? 34.082  92.446  93.651  1.00 107.24 ? 293  LYS 4 O   1 
ATOM   2560  C  CB  . LYS D  4  293  ? 32.577  89.669  93.044  1.00 111.01 ? 293  LYS 4 CB  1 
ATOM   2561  C  CG  . LYS D  4  293  ? 31.742  90.496  92.068  1.00 117.57 ? 293  LYS 4 CG  1 
ATOM   2562  C  CD  . LYS D  4  293  ? 30.394  89.856  91.771  1.00 126.17 ? 293  LYS 4 CD  1 
ATOM   2563  C  CE  . LYS D  4  293  ? 29.567  90.733  90.832  1.00 130.38 ? 293  LYS 4 CE  1 
ATOM   2564  N  NZ  . LYS D  4  293  ? 28.149  90.274  90.730  1.00 133.61 ? 293  LYS 4 NZ  1 
ATOM   2565  N  N   . GLU D  4  294  ? 34.529  91.030  95.325  1.00 115.62 ? 294  GLU 4 N   1 
ATOM   2566  C  CA  . GLU D  4  294  ? 34.802  92.131  96.242  1.00 120.98 ? 294  GLU 4 CA  1 
ATOM   2567  C  C   . GLU D  4  294  ? 36.184  92.064  96.879  1.00 112.47 ? 294  GLU 4 C   1 
ATOM   2568  O  O   . GLU D  4  294  ? 36.368  92.318  98.071  1.00 114.10 ? 294  GLU 4 O   1 
ATOM   2569  C  CB  . GLU D  4  294  ? 33.683  92.303  97.270  1.00 128.09 ? 294  GLU 4 CB  1 
ATOM   2570  C  CG  . GLU D  4  294  ? 32.675  93.367  96.845  1.00 132.71 ? 294  GLU 4 CG  1 
ATOM   2571  C  CD  . GLU D  4  294  ? 31.361  93.250  97.576  1.00 144.02 ? 294  GLU 4 CD  1 
ATOM   2572  O  OE1 . GLU D  4  294  ? 31.166  92.239  98.281  1.00 147.61 ? 294  GLU 4 OE1 1 
ATOM   2573  O  OE2 . GLU D  4  294  ? 30.523  94.171  97.448  1.00 149.56 ? 294  GLU 4 OE2 1 
ATOM   2574  N  N   . LEU D  4  295  ? 37.157  91.735  96.045  1.00 98.95  ? 295  LEU 4 N   1 
ATOM   2575  C  CA  . LEU D  4  295  ? 38.541  91.792  96.441  1.00 89.55  ? 295  LEU 4 CA  1 
ATOM   2576  C  C   . LEU D  4  295  ? 39.000  93.248  96.354  1.00 93.60  ? 295  LEU 4 C   1 
ATOM   2577  O  O   . LEU D  4  295  ? 38.412  94.060  95.635  1.00 90.87  ? 295  LEU 4 O   1 
ATOM   2578  C  CB  . LEU D  4  295  ? 39.358  90.910  95.512  1.00 81.92  ? 295  LEU 4 CB  1 
ATOM   2579  C  CG  . LEU D  4  295  ? 40.603  90.262  96.077  1.00 78.03  ? 295  LEU 4 CG  1 
ATOM   2580  C  CD1 . LEU D  4  295  ? 40.311  89.770  97.459  1.00 74.36  ? 295  LEU 4 CD1 1 
ATOM   2581  C  CD2 . LEU D  4  295  ? 40.953  89.107  95.198  1.00 85.02  ? 295  LEU 4 CD2 1 
ATOM   2582  N  N   . ASP D  4  296  ? 40.056  93.572  97.086  1.00 99.09  ? 296  ASP 4 N   1 
ATOM   2583  C  CA  . ASP D  4  296  ? 40.546  94.935  97.157  1.00 103.45 ? 296  ASP 4 CA  1 
ATOM   2584  C  C   . ASP D  4  296  ? 42.026  94.993  96.799  1.00 105.96 ? 296  ASP 4 C   1 
ATOM   2585  O  O   . ASP D  4  296  ? 42.872  94.492  97.539  1.00 107.75 ? 296  ASP 4 O   1 
ATOM   2586  C  CB  . ASP D  4  296  ? 40.348  95.466  98.570  1.00 103.96 ? 296  ASP 4 CB  1 
ATOM   2587  C  CG  . ASP D  4  296  ? 40.754  96.913  98.707  1.00 102.87 ? 296  ASP 4 CG  1 
ATOM   2588  O  OD1 . ASP D  4  296  ? 41.971  97.214  98.652  1.00 94.87  ? 296  ASP 4 OD1 1 
ATOM   2589  O  OD2 . ASP D  4  296  ? 39.844  97.746  98.883  1.00 111.61 ? 296  ASP 4 OD2 1 
ATOM   2590  N  N   . LEU D  4  297  ? 42.347  95.639  95.687  1.00 105.85 ? 297  LEU 4 N   1 
ATOM   2591  C  CA  . LEU D  4  297  ? 43.719  95.616  95.191  1.00 108.33 ? 297  LEU 4 CA  1 
ATOM   2592  C  C   . LEU D  4  297  ? 44.579  96.822  95.616  1.00 115.39 ? 297  LEU 4 C   1 
ATOM   2593  O  O   . LEU D  4  297  ? 44.283  97.970  95.259  1.00 117.25 ? 297  LEU 4 O   1 
ATOM   2594  C  CB  . LEU D  4  297  ? 43.723  95.408  93.671  1.00 104.02 ? 297  LEU 4 CB  1 
ATOM   2595  C  CG  . LEU D  4  297  ? 43.030  94.110  93.234  1.00 91.75  ? 297  LEU 4 CG  1 
ATOM   2596  C  CD1 . LEU D  4  297  ? 43.059  93.945  91.731  1.00 91.79  ? 297  LEU 4 CD1 1 
ATOM   2597  C  CD2 . LEU D  4  297  ? 43.676  92.932  93.912  1.00 83.29  ? 297  LEU 4 CD2 1 
ATOM   2598  N  N   . PRO D  4  298  ? 45.658  96.546  96.378  1.00 120.14 ? 298  PRO 4 N   1 
ATOM   2599  C  CA  . PRO D  4  298  ? 46.573  97.512  97.003  1.00 120.76 ? 298  PRO 4 CA  1 
ATOM   2600  C  C   . PRO D  4  298  ? 47.766  97.940  96.136  1.00 115.39 ? 298  PRO 4 C   1 
ATOM   2601  O  O   . PRO D  4  298  ? 48.481  97.090  95.599  1.00 109.04 ? 298  PRO 4 O   1 
ATOM   2602  C  CB  . PRO D  4  298  ? 47.081  96.746  98.227  1.00 119.00 ? 298  PRO 4 CB  1 
ATOM   2603  C  CG  . PRO D  4  298  ? 47.125  95.341  97.773  1.00 116.97 ? 298  PRO 4 CG  1 
ATOM   2604  C  CD  . PRO D  4  298  ? 45.984  95.166  96.782  1.00 119.44 ? 298  PRO 4 CD  1 
ATOM   2605  N  N   . GLU D  4  299  ? 47.980  99.254  96.043  1.00 117.54 ? 299  GLU 4 N   1 
ATOM   2606  C  CA  . GLU D  4  299  ? 49.081  99.841  95.274  1.00 113.89 ? 299  GLU 4 CA  1 
ATOM   2607  C  C   . GLU D  4  299  ? 50.458  99.391  95.756  1.00 109.75 ? 299  GLU 4 C   1 
ATOM   2608  O  O   . GLU D  4  299  ? 50.764  99.455  96.948  1.00 111.09 ? 299  GLU 4 O   1 
ATOM   2609  C  CB  . GLU D  4  299  ? 49.021  101.374 95.324  1.00 116.99 ? 299  GLU 4 CB  1 
ATOM   2610  C  CG  . GLU D  4  299  ? 47.789  102.003 94.686  1.00 125.99 ? 299  GLU 4 CG  1 
ATOM   2611  C  CD  . GLU D  4  299  ? 47.757  103.524 94.838  1.00 135.60 ? 299  GLU 4 CD  1 
ATOM   2612  O  OE1 . GLU D  4  299  ? 47.250  104.013 95.877  1.00 139.04 ? 299  GLU 4 OE1 1 
ATOM   2613  O  OE2 . GLU D  4  299  ? 48.237  104.231 93.919  1.00 136.72 ? 299  GLU 4 OE2 1 
ATOM   2614  N  N   . VAL D  4  300  ? 51.290  98.952  94.819  1.00 105.66 ? 300  VAL 4 N   1 
ATOM   2615  C  CA  . VAL D  4  300  ? 52.668  98.611  95.138  1.00 102.29 ? 300  VAL 4 CA  1 
ATOM   2616  C  C   . VAL D  4  300  ? 53.633  99.398  94.261  1.00 102.90 ? 300  VAL 4 C   1 
ATOM   2617  O  O   . VAL D  4  300  ? 53.654  99.229  93.040  1.00 100.57 ? 300  VAL 4 O   1 
ATOM   2618  C  CB  . VAL D  4  300  ? 52.934  97.105  94.984  1.00 93.99  ? 300  VAL 4 CB  1 
ATOM   2619  C  CG1 . VAL D  4  300  ? 54.431  96.809  95.087  1.00 86.13  ? 300  VAL 4 CG1 1 
ATOM   2620  C  CG2 . VAL D  4  300  ? 52.136  96.326  96.025  1.00 91.51  ? 300  VAL 4 CG2 1 
ATOM   2621  N  N   . LYS D  4  301  ? 54.416  100.269 94.895  1.00 106.78 ? 301  LYS 4 N   1 
ATOM   2622  C  CA  . LYS D  4  301  ? 55.413  101.075 94.194  1.00 105.11 ? 301  LYS 4 CA  1 
ATOM   2623  C  C   . LYS D  4  301  ? 56.828  100.511 94.341  1.00 109.98 ? 301  LYS 4 C   1 
ATOM   2624  O  O   . LYS D  4  301  ? 57.203  100.008 95.394  1.00 110.90 ? 301  LYS 4 O   1 
ATOM   2625  C  CB  . LYS D  4  301  ? 55.376  102.534 94.665  1.00 97.67  ? 301  LYS 4 CB  1 
ATOM   2626  C  CG  . LYS D  4  301  ? 54.390  103.411 93.909  1.00 96.47  ? 301  LYS 4 CG  1 
ATOM   2627  C  CD  . LYS D  4  301  ? 54.682  104.887 94.132  1.00 98.26  ? 301  LYS 4 CD  1 
ATOM   2628  C  CE  . LYS D  4  301  ? 53.915  105.759 93.153  1.00 98.14  ? 301  LYS 4 CE  1 
ATOM   2629  N  NZ  . LYS D  4  301  ? 54.093  107.204 93.474  1.00 107.35 ? 301  LYS 4 NZ  1 
ATOM   2630  N  N   . GLU D  4  302  ? 57.605  100.586 93.267  1.00 115.40 ? 302  GLU 4 N   1 
ATOM   2631  C  CA  . GLU D  4  302  ? 59.009  100.218 93.318  1.00 118.06 ? 302  GLU 4 CA  1 
ATOM   2632  C  C   . GLU D  4  302  ? 59.784  101.366 93.935  1.00 118.04 ? 302  GLU 4 C   1 
ATOM   2633  O  O   . GLU D  4  302  ? 59.241  102.456 94.116  1.00 116.62 ? 302  GLU 4 O   1 
ATOM   2634  C  CB  . GLU D  4  302  ? 59.537  99.922  91.912  1.00 118.66 ? 302  GLU 4 CB  1 
ATOM   2635  C  CG  . GLU D  4  302  ? 59.060  98.602  91.359  1.00 117.95 ? 302  GLU 4 CG  1 
ATOM   2636  C  CD  . GLU D  4  302  ? 59.264  97.479  92.352  1.00 120.77 ? 302  GLU 4 CD  1 
ATOM   2637  O  OE1 . GLU D  4  302  ? 60.424  97.243  92.750  1.00 123.53 ? 302  GLU 4 OE1 1 
ATOM   2638  O  OE2 . GLU D  4  302  ? 58.265  96.847  92.753  1.00 121.40 ? 302  GLU 4 OE2 1 
ATOM   2639  N  N   . ASP D  4  303  ? 61.049  101.122 94.262  1.00 120.38 ? 303  ASP 4 N   1 
ATOM   2640  C  CA  . ASP D  4  303  ? 61.933  102.192 94.711  1.00 119.44 ? 303  ASP 4 CA  1 
ATOM   2641  C  C   . ASP D  4  303  ? 62.158  103.129 93.525  1.00 114.23 ? 303  ASP 4 C   1 
ATOM   2642  O  O   . ASP D  4  303  ? 62.397  104.322 93.691  1.00 114.84 ? 303  ASP 4 O   1 
ATOM   2643  C  CB  . ASP D  4  303  ? 63.257  101.624 95.243  1.00 123.23 ? 303  ASP 4 CB  1 
ATOM   2644  C  CG  . ASP D  4  303  ? 63.086  100.847 96.555  1.00 126.10 ? 303  ASP 4 CG  1 
ATOM   2645  O  OD1 . ASP D  4  303  ? 62.217  101.231 97.371  1.00 120.08 ? 303  ASP 4 OD1 1 
ATOM   2646  O  OD2 . ASP D  4  303  ? 63.824  99.854  96.770  1.00 130.47 ? 303  ASP 4 OD2 1 
ATOM   2647  N  N   . ASN D  4  304  ? 62.058  102.550 92.330  1.00 112.03 ? 304  ASN 4 N   1 
ATOM   2648  C  CA  . ASN D  4  304  ? 62.062  103.254 91.050  1.00 106.30 ? 304  ASN 4 CA  1 
ATOM   2649  C  C   . ASN D  4  304  ? 61.163  104.493 91.024  1.00 103.49 ? 304  ASN 4 C   1 
ATOM   2650  O  O   . ASN D  4  304  ? 61.572  105.557 90.564  1.00 100.38 ? 304  ASN 4 O   1 
ATOM   2651  C  CB  . ASN D  4  304  ? 61.582  102.278 89.976  1.00 104.29 ? 304  ASN 4 CB  1 
ATOM   2652  C  CG  . ASN D  4  304  ? 62.172  102.562 88.619  1.00 111.41 ? 304  ASN 4 CG  1 
ATOM   2653  O  OD1 . ASN D  4  304  ? 63.250  103.149 88.503  1.00 114.19 ? 304  ASN 4 OD1 1 
ATOM   2654  N  ND2 . ASN D  4  304  ? 61.472  102.131 87.573  1.00 114.94 ? 304  ASN 4 ND2 1 
ATOM   2655  N  N   . GLY D  4  305  ? 59.940  104.329 91.529  1.00 105.39 ? 305  GLY 4 N   1 
ATOM   2656  C  CA  . GLY D  4  305  ? 58.900  105.346 91.488  1.00 102.39 ? 305  GLY 4 CA  1 
ATOM   2657  C  C   . GLY D  4  305  ? 57.709  104.819 90.704  1.00 97.06  ? 305  GLY 4 C   1 
ATOM   2658  O  O   . GLY D  4  305  ? 56.977  105.553 90.051  1.00 96.16  ? 305  GLY 4 O   1 
ATOM   2659  N  N   . SER D  4  306  ? 57.501  103.518 90.790  1.00 98.21  ? 306  SER 4 N   1 
ATOM   2660  C  CA  . SER D  4  306  ? 56.691  102.822 89.804  1.00 94.29  ? 306  SER 4 CA  1 
ATOM   2661  C  C   . SER D  4  306  ? 55.534  102.036 90.405  1.00 83.94  ? 306  SER 4 C   1 
ATOM   2662  O  O   . SER D  4  306  ? 55.756  101.016 91.055  1.00 86.17  ? 306  SER 4 O   1 
ATOM   2663  C  CB  . SER D  4  306  ? 57.589  101.858 89.012  1.00 93.00  ? 306  SER 4 CB  1 
ATOM   2664  O  OG  . SER D  4  306  ? 58.672  102.542 88.390  1.00 91.28  ? 306  SER 4 OG  1 
ATOM   2665  N  N   . GLU D  4  307  ? 54.309  102.498 90.174  1.00 72.85  ? 307  GLU 4 N   1 
ATOM   2666  C  CA  . GLU D  4  307  ? 53.127  101.687 90.456  1.00 79.51  ? 307  GLU 4 CA  1 
ATOM   2667  C  C   . GLU D  4  307  ? 53.215  100.309 89.751  1.00 80.85  ? 307  GLU 4 C   1 
ATOM   2668  O  O   . GLU D  4  307  ? 53.687  100.210 88.626  1.00 78.15  ? 307  GLU 4 O   1 
ATOM   2669  C  CB  . GLU D  4  307  ? 51.887  102.437 89.972  1.00 94.37  ? 307  GLU 4 CB  1 
ATOM   2670  C  CG  . GLU D  4  307  ? 50.577  102.039 90.626  1.00 112.95 ? 307  GLU 4 CG  1 
ATOM   2671  C  CD  . GLU D  4  307  ? 49.778  103.256 91.077  1.00 132.94 ? 307  GLU 4 CD  1 
ATOM   2672  O  OE1 . GLU D  4  307  ? 50.356  104.369 91.140  1.00 138.77 ? 307  GLU 4 OE1 1 
ATOM   2673  O  OE2 . GLU D  4  307  ? 48.572  103.101 91.367  1.00 138.44 ? 307  GLU 4 OE2 1 
ATOM   2674  N  N   . ILE D  4  308  ? 52.788  99.236  90.405  1.00 78.67  ? 308  ILE 4 N   1 
ATOM   2675  C  CA  . ILE D  4  308  ? 52.714  97.962  89.704  1.00 71.63  ? 308  ILE 4 CA  1 
ATOM   2676  C  C   . ILE D  4  308  ? 51.272  97.622  89.395  1.00 71.64  ? 308  ILE 4 C   1 
ATOM   2677  O  O   . ILE D  4  308  ? 50.444  97.465  90.298  1.00 76.64  ? 308  ILE 4 O   1 
ATOM   2678  C  CB  . ILE D  4  308  ? 53.330  96.811  90.489  1.00 75.85  ? 308  ILE 4 CB  1 
ATOM   2679  C  CG1 . ILE D  4  308  ? 54.818  97.059  90.709  1.00 72.77  ? 308  ILE 4 CG1 1 
ATOM   2680  C  CG2 . ILE D  4  308  ? 53.119  95.496  89.737  1.00 76.88  ? 308  ILE 4 CG2 1 
ATOM   2681  C  CD1 . ILE D  4  308  ? 55.529  95.887  91.338  1.00 71.59  ? 308  ILE 4 CD1 1 
ATOM   2682  N  N   . VAL D  4  309  ? 50.977  97.509  88.109  1.00 71.38  ? 309  VAL 4 N   1 
ATOM   2683  C  CA  . VAL D  4  309  ? 49.607  97.328  87.658  1.00 74.37  ? 309  VAL 4 CA  1 
ATOM   2684  C  C   . VAL D  4  309  ? 49.235  95.854  87.543  1.00 85.88  ? 309  VAL 4 C   1 
ATOM   2685  O  O   . VAL D  4  309  ? 49.964  95.058  86.959  1.00 81.92  ? 309  VAL 4 O   1 
ATOM   2686  C  CB  . VAL D  4  309  ? 49.389  98.011  86.312  1.00 70.00  ? 309  VAL 4 CB  1 
ATOM   2687  C  CG1 . VAL D  4  309  ? 48.019  97.690  85.775  1.00 84.62  ? 309  VAL 4 CG1 1 
ATOM   2688  C  CG2 . VAL D  4  309  ? 49.562  99.502  86.452  1.00 64.91  ? 309  VAL 4 CG2 1 
ATOM   2689  N  N   . TYR D  4  310  ? 48.096  95.496  88.122  1.00 99.80  ? 310  TYR 4 N   1 
ATOM   2690  C  CA  . TYR D  4  310  ? 47.591  94.139  88.016  1.00 102.92 ? 310  TYR 4 CA  1 
ATOM   2691  C  C   . TYR D  4  310  ? 46.731  94.064  86.772  1.00 103.93 ? 310  TYR 4 C   1 
ATOM   2692  O  O   . TYR D  4  310  ? 45.536  94.383  86.807  1.00 113.90 ? 310  TYR 4 O   1 
ATOM   2693  C  CB  . TYR D  4  310  ? 46.758  93.766  89.250  1.00 110.70 ? 310  TYR 4 CB  1 
ATOM   2694  C  CG  . TYR D  4  310  ? 47.508  93.867  90.558  1.00 112.37 ? 310  TYR 4 CG  1 
ATOM   2695  C  CD1 . TYR D  4  310  ? 48.899  93.786  90.596  1.00 110.98 ? 310  TYR 4 CD1 1 
ATOM   2696  C  CD2 . TYR D  4  310  ? 46.831  94.049  91.751  1.00 117.49 ? 310  TYR 4 CD2 1 
ATOM   2697  C  CE1 . TYR D  4  310  ? 49.593  93.888  91.783  1.00 112.52 ? 310  TYR 4 CE1 1 
ATOM   2698  C  CE2 . TYR D  4  310  ? 47.516  94.149  92.947  1.00 124.09 ? 310  TYR 4 CE2 1 
ATOM   2699  C  CZ  . TYR D  4  310  ? 48.898  94.069  92.953  1.00 123.82 ? 310  TYR 4 CZ  1 
ATOM   2700  O  OH  . TYR D  4  310  ? 49.581  94.171  94.141  1.00 131.03 ? 310  TYR 4 OH  1 
ATOM   2701  N  N   . GLU D  4  311  ? 47.353  93.690  85.661  1.00 97.18  ? 311  GLU 4 N   1 
ATOM   2702  C  CA  . GLU D  4  311  ? 46.612  93.401  84.442  1.00 99.60  ? 311  GLU 4 CA  1 
ATOM   2703  C  C   . GLU D  4  311  ? 47.359  92.339  83.653  1.00 100.34 ? 311  GLU 4 C   1 
ATOM   2704  O  O   . GLU D  4  311  ? 48.590  92.305  83.658  1.00 99.00  ? 311  GLU 4 O   1 
ATOM   2705  C  CB  . GLU D  4  311  ? 46.310  94.669  83.618  1.00 103.50 ? 311  GLU 4 CB  1 
ATOM   2706  C  CG  . GLU D  4  311  ? 47.445  95.221  82.762  1.00 105.71 ? 311  GLU 4 CG  1 
ATOM   2707  C  CD  . GLU D  4  311  ? 46.995  96.381  81.873  1.00 106.14 ? 311  GLU 4 CD  1 
ATOM   2708  O  OE1 . GLU D  4  311  ? 46.519  96.133  80.733  1.00 104.36 ? 311  GLU 4 OE1 1 
ATOM   2709  O  OE2 . GLU D  4  311  ? 47.115  97.541  82.323  1.00 104.15 ? 311  GLU 4 OE2 1 
ATOM   2710  N  N   . GLU D  4  312  ? 46.595  91.465  83.003  1.00 105.48 ? 312  GLU 4 N   1 
ATOM   2711  C  CA  . GLU D  4  312  ? 47.091  90.212  82.430  1.00 105.92 ? 312  GLU 4 CA  1 
ATOM   2712  C  C   . GLU D  4  312  ? 47.015  90.312  80.911  1.00 102.87 ? 312  GLU 4 C   1 
ATOM   2713  O  O   . GLU D  4  312  ? 46.873  89.317  80.212  1.00 90.97  ? 312  GLU 4 O   1 
ATOM   2714  C  CB  . GLU D  4  312  ? 46.186  89.088  82.937  1.00 109.14 ? 312  GLU 4 CB  1 
ATOM   2715  C  CG  . GLU D  4  312  ? 46.647  87.666  82.749  1.00 111.38 ? 312  GLU 4 CG  1 
ATOM   2716  C  CD  . GLU D  4  312  ? 45.562  86.671  83.173  1.00 119.82 ? 312  GLU 4 CD  1 
ATOM   2717  O  OE1 . GLU D  4  312  ? 44.601  87.078  83.871  1.00 121.51 ? 312  GLU 4 OE1 1 
ATOM   2718  O  OE2 . GLU D  4  312  ? 45.665  85.481  82.807  1.00 123.02 ? 312  GLU 4 OE2 1 
ATOM   2719  N  N   . ASN D  4  313  ? 47.126  91.537  80.411  1.00 118.15 ? 313  ASN 4 N   1 
ATOM   2720  C  CA  . ASN D  4  313  ? 46.801  91.844  79.026  1.00 129.46 ? 313  ASN 4 CA  1 
ATOM   2721  C  C   . ASN D  4  313  ? 47.668  92.964  78.404  1.00 134.08 ? 313  ASN 4 C   1 
ATOM   2722  O  O   . ASN D  4  313  ? 47.250  94.126  78.340  1.00 137.36 ? 313  ASN 4 O   1 
ATOM   2723  C  CB  . ASN D  4  313  ? 45.309  92.202  78.942  1.00 137.88 ? 313  ASN 4 CB  1 
ATOM   2724  C  CG  . ASN D  4  313  ? 44.798  92.270  77.518  1.00 150.03 ? 313  ASN 4 CG  1 
ATOM   2725  O  OD1 . ASN D  4  313  ? 45.338  91.621  76.619  1.00 159.46 ? 313  ASN 4 OD1 1 
ATOM   2726  N  ND2 . ASN D  4  313  ? 43.750  93.060  77.303  1.00 149.55 ? 313  ASN 4 ND2 1 
ATOM   2727  N  N   . THR D  4  314  ? 48.875  92.618  77.953  1.00 135.03 ? 314  THR 4 N   1 
ATOM   2728  C  CA  . THR D  4  314  ? 49.669  93.545  77.147  1.00 137.80 ? 314  THR 4 CA  1 
ATOM   2729  C  C   . THR D  4  314  ? 48.950  93.773  75.822  1.00 143.17 ? 314  THR 4 C   1 
ATOM   2730  O  O   . THR D  4  314  ? 49.221  93.081  74.832  1.00 151.46 ? 314  THR 4 O   1 
ATOM   2731  C  CB  . THR D  4  314  ? 51.118  93.034  76.920  1.00 101.71 ? 314  THR 4 CB  1 
ATOM   2732  O  OG1 . THR D  4  314  ? 51.156  91.976  75.920  1.00 55.44  ? 314  THR 4 OG1 1 
ATOM   2733  C  CG2 . THR D  4  314  ? 51.712  92.592  78.290  1.00 55.33  ? 314  THR 4 CG2 1 
ATOM   2734  N  N   . SER D  4  315  ? 48.018  94.730  75.823  1.00 134.78 ? 315  SER 4 N   1 
ATOM   2735  C  CA  . SER D  4  315  ? 47.159  94.990  74.669  1.00 130.93 ? 315  SER 4 CA  1 
ATOM   2736  C  C   . SER D  4  315  ? 47.697  96.092  73.763  1.00 130.84 ? 315  SER 4 C   1 
ATOM   2737  O  O   . SER D  4  315  ? 47.193  97.214  73.772  1.00 132.00 ? 315  SER 4 O   1 
ATOM   2738  C  CB  . SER D  4  315  ? 45.739  95.347  75.121  1.00 130.18 ? 315  SER 4 CB  1 
ATOM   2739  O  OG  . SER D  4  315  ? 44.904  95.655  74.013  1.00 130.05 ? 315  SER 4 OG  1 
ATOM   2740  N  N   . GLU D  4  316  ? 48.698  95.749  72.957  1.00 129.44 ? 316  GLU 4 N   1 
ATOM   2741  C  CA  . GLU D  4  316  ? 49.288  96.683  72.003  1.00 122.48 ? 316  GLU 4 CA  1 
ATOM   2742  C  C   . GLU D  4  316  ? 48.699  96.517  70.599  1.00 127.29 ? 316  GLU 4 C   1 
ATOM   2743  O  O   . GLU D  4  316  ? 49.399  96.650  69.595  1.00 129.62 ? 316  GLU 4 O   1 
ATOM   2744  C  CB  . GLU D  4  316  ? 50.818  96.550  71.985  1.00 108.03 ? 316  GLU 4 CB  1 
ATOM   2745  C  CG  . GLU D  4  316  ? 51.506  97.422  73.025  1.00 99.90  ? 316  GLU 4 CG  1 
ATOM   2746  C  CD  . GLU D  4  316  ? 51.788  96.716  74.346  1.00 99.29  ? 316  GLU 4 CD  1 
ATOM   2747  O  OE1 . GLU D  4  316  ? 51.530  95.502  74.450  1.00 104.16 ? 316  GLU 4 OE1 1 
ATOM   2748  O  OE2 . GLU D  4  316  ? 52.286  97.373  75.287  1.00 95.96  ? 316  GLU 4 OE2 1 
ATOM   2749  N  N   . MET E  5  1    ? 23.854  100.348 130.045 1.00 50.51  ? 1    MET A N   1 
ATOM   2750  C  CA  . MET E  5  1    ? 22.432  99.965  130.222 1.00 64.95  ? 1    MET A CA  1 
ATOM   2751  C  C   . MET E  5  1    ? 21.465  101.055 129.770 1.00 57.89  ? 1    MET A C   1 
ATOM   2752  O  O   . MET E  5  1    ? 21.471  102.156 130.293 1.00 58.91  ? 1    MET A O   1 
ATOM   2753  C  CB  . MET E  5  1    ? 22.073  99.592  131.675 1.00 49.72  ? 1    MET A CB  1 
ATOM   2754  C  CG  . MET E  5  1    ? 20.638  98.939  131.901 1.00 49.76  ? 1    MET A CG  1 
ATOM   2755  S  SD  . MET E  5  1    ? 19.051  99.870  131.543 1.00 62.87  ? 1    MET A SD  1 
ATOM   2756  C  CE  . MET E  5  1    ? 18.430  100.394 133.135 1.00 51.13  ? 1    MET A CE  1 
ATOM   2757  N  N   . ASP E  5  2    ? 20.578  100.702 128.852 1.00 59.87  ? 2    ASP A N   1 
ATOM   2758  C  CA  . ASP E  5  2    ? 19.758  101.657 128.123 1.00 54.29  ? 2    ASP A CA  1 
ATOM   2759  C  C   . ASP E  5  2    ? 18.306  101.218 128.181 1.00 67.04  ? 2    ASP A C   1 
ATOM   2760  O  O   . ASP E  5  2    ? 17.969  100.120 127.740 1.00 54.38  ? 2    ASP A O   1 
ATOM   2761  C  CB  . ASP E  5  2    ? 20.221  101.628 126.673 1.00 63.82  ? 2    ASP A CB  1 
ATOM   2762  C  CG  . ASP E  5  2    ? 19.628  102.728 125.824 1.00 66.53  ? 2    ASP A CG  1 
ATOM   2763  O  OD1 . ASP E  5  2    ? 18.462  103.104 126.030 1.00 76.18  ? 2    ASP A OD1 1 
ATOM   2764  O  OD2 . ASP E  5  2    ? 20.348  103.209 124.927 1.00 64.70  ? 2    ASP A OD2 1 
ATOM   2765  N  N   . ILE E  5  3    ? 17.427  102.075 128.685 1.00 59.23  ? 3    ILE A N   1 
ATOM   2766  C  CA  . ILE E  5  3    ? 16.042  101.652 128.863 1.00 55.84  ? 3    ILE A CA  1 
ATOM   2767  C  C   . ILE E  5  3    ? 15.335  101.355 127.557 1.00 59.46  ? 3    ILE A C   1 
ATOM   2768  O  O   . ILE E  5  3    ? 14.230  100.834 127.553 1.00 64.27  ? 3    ILE A O   1 
ATOM   2769  C  CB  . ILE E  5  3    ? 15.192  102.638 129.702 1.00 63.12  ? 3    ILE A CB  1 
ATOM   2770  C  CG1 . ILE E  5  3    ? 15.194  104.032 129.084 1.00 58.13  ? 3    ILE A CG1 1 
ATOM   2771  C  CG2 . ILE E  5  3    ? 15.653  102.634 131.154 1.00 55.40  ? 3    ILE A CG2 1 
ATOM   2772  C  CD1 . ILE E  5  3    ? 14.018  104.856 129.506 1.00 81.99  ? 3    ILE A CD1 1 
ATOM   2773  N  N   . SER E  5  4    ? 15.976  101.675 126.441 1.00 57.65  ? 4    SER A N   1 
ATOM   2774  C  CA  . SER E  5  4    ? 15.373  101.423 125.144 1.00 58.89  ? 4    SER A CA  1 
ATOM   2775  C  C   . SER E  5  4    ? 15.999  100.216 124.442 1.00 62.56  ? 4    SER A C   1 
ATOM   2776  O  O   . SER E  5  4    ? 15.711  99.954  123.273 1.00 70.50  ? 4    SER A O   1 
ATOM   2777  C  CB  . SER E  5  4    ? 15.394  102.682 124.265 1.00 67.97  ? 4    SER A CB  1 
ATOM   2778  O  OG  . SER E  5  4    ? 16.673  102.945 123.721 1.00 70.22  ? 4    SER A OG  1 
ATOM   2779  N  N   . LYS E  5  5    ? 16.840  99.475  125.159 1.00 56.56  ? 5    LYS A N   1 
ATOM   2780  C  CA  . LYS E  5  5    ? 17.318  98.180  124.680 1.00 55.84  ? 5    LYS A CA  1 
ATOM   2781  C  C   . LYS E  5  5    ? 16.920  97.054  125.638 1.00 62.66  ? 5    LYS A C   1 
ATOM   2782  O  O   . LYS E  5  5    ? 17.759  96.476  126.344 1.00 53.27  ? 5    LYS A O   1 
ATOM   2783  C  CB  . LYS E  5  5    ? 18.835  98.195  124.462 1.00 55.16  ? 5    LYS A CB  1 
ATOM   2784  C  CG  . LYS E  5  5    ? 19.337  99.470  123.788 1.00 70.91  ? 5    LYS A CG  1 
ATOM   2785  C  CD  . LYS E  5  5    ? 20.810  99.413  123.426 1.00 64.95  ? 5    LYS A CD  1 
ATOM   2786  C  CE  . LYS E  5  5    ? 21.124  98.123  122.723 1.00 69.34  ? 5    LYS A CE  1 
ATOM   2787  N  NZ  . LYS E  5  5    ? 22.499  97.637  123.052 1.00 79.64  ? 5    LYS A NZ  1 
ATOM   2788  N  N   . PRO E  5  6    ? 15.625  96.734  125.678 1.00 55.24  ? 6    PRO A N   1 
ATOM   2789  C  CA  . PRO E  5  6    ? 15.223  95.693  126.620 1.00 54.22  ? 6    PRO A CA  1 
ATOM   2790  C  C   . PRO E  5  6    ? 15.759  94.323  126.236 1.00 58.50  ? 6    PRO A C   1 
ATOM   2791  O  O   . PRO E  5  6    ? 16.082  94.059  125.084 1.00 67.54  ? 6    PRO A O   1 
ATOM   2792  C  CB  . PRO E  5  6    ? 13.694  95.733  126.549 1.00 55.36  ? 6    PRO A CB  1 
ATOM   2793  C  CG  . PRO E  5  6    ? 13.390  96.372  125.260 1.00 58.87  ? 6    PRO A CG  1 
ATOM   2794  C  CD  . PRO E  5  6    ? 14.480  97.321  124.971 1.00 56.93  ? 6    PRO A CD  1 
ATOM   2795  N  N   . VAL E  5  7    ? 15.872  93.462  127.231 1.00 53.73  ? 7    VAL A N   1 
ATOM   2796  C  CA  . VAL E  5  7    ? 16.287  92.082  127.038 1.00 57.42  ? 7    VAL A CA  1 
ATOM   2797  C  C   . VAL E  5  7    ? 15.156  91.118  127.412 1.00 61.23  ? 7    VAL A C   1 
ATOM   2798  O  O   . VAL E  5  7    ? 14.570  91.222  128.502 1.00 56.71  ? 7    VAL A O   1 
ATOM   2799  C  CB  . VAL E  5  7    ? 17.501  91.759  127.916 1.00 50.16  ? 7    VAL A CB  1 
ATOM   2800  C  CG1 . VAL E  5  7    ? 17.915  90.354  127.703 1.00 60.02  ? 7    VAL A CG1 1 
ATOM   2801  C  CG2 . VAL E  5  7    ? 18.639  92.666  127.572 1.00 60.91  ? 7    VAL A CG2 1 
ATOM   2802  N  N   . GLY E  5  8    ? 14.861  90.173  126.520 1.00 65.23  ? 8    GLY A N   1 
ATOM   2803  C  CA  . GLY E  5  8    ? 13.796  89.215  126.757 1.00 52.62  ? 8    GLY A CA  1 
ATOM   2804  C  C   . GLY E  5  8    ? 14.257  87.963  127.481 1.00 56.11  ? 8    GLY A C   1 
ATOM   2805  O  O   . GLY E  5  8    ? 13.594  87.462  128.386 1.00 55.90  ? 8    GLY A O   1 
ATOM   2806  N  N   . SER E  5  9    ? 15.403  87.443  127.082 1.00 50.88  ? 9    SER A N   1 
ATOM   2807  C  CA  . SER E  5  9    ? 15.927  86.248  127.725 1.00 54.37  ? 9    SER A CA  1 
ATOM   2808  C  C   . SER E  5  9    ? 16.530  86.563  129.096 1.00 55.18  ? 9    SER A C   1 
ATOM   2809  O  O   . SER E  5  9    ? 17.087  87.635  129.312 1.00 53.43  ? 9    SER A O   1 
ATOM   2810  C  CB  . SER E  5  9    ? 16.961  85.586  126.822 1.00 56.83  ? 9    SER A CB  1 
ATOM   2811  O  OG  . SER E  5  9    ? 16.363  85.159  125.608 1.00 67.13  ? 9    SER A OG  1 
ATOM   2812  N  N   . GLU E  5  10   ? 16.435  85.611  130.014 1.00 56.62  ? 10   GLU A N   1 
ATOM   2813  C  CA  . GLU E  5  10   ? 16.827  85.840  131.398 1.00 57.08  ? 10   GLU A CA  1 
ATOM   2814  C  C   . GLU E  5  10   ? 17.530  84.591  131.895 1.00 52.99  ? 10   GLU A C   1 
ATOM   2815  O  O   . GLU E  5  10   ? 17.066  83.497  131.650 1.00 54.20  ? 10   GLU A O   1 
ATOM   2816  C  CB  . GLU E  5  10   ? 15.582  86.139  132.249 1.00 61.10  ? 10   GLU A CB  1 
ATOM   2817  C  CG  . GLU E  5  10   ? 15.804  87.088  133.426 1.00 80.99  ? 10   GLU A CG  1 
ATOM   2818  C  CD  . GLU E  5  10   ? 15.406  88.553  133.144 1.00 98.53  ? 10   GLU A CD  1 
ATOM   2819  O  OE1 . GLU E  5  10   ? 15.586  89.020  131.993 1.00 99.05  ? 10   GLU A OE1 1 
ATOM   2820  O  OE2 . GLU E  5  10   ? 14.928  89.244  134.088 1.00 102.28 ? 10   GLU A OE2 1 
ATOM   2821  N  N   . ILE E  5  11   ? 18.662  84.747  132.571 1.00 55.57  ? 11   ILE A N   1 
ATOM   2822  C  CA  . ILE E  5  11   ? 19.365  83.606  133.151 1.00 44.68  ? 11   ILE A CA  1 
ATOM   2823  C  C   . ILE E  5  11   ? 18.692  83.245  134.477 1.00 56.57  ? 11   ILE A C   1 
ATOM   2824  O  O   . ILE E  5  11   ? 18.495  84.105  135.316 1.00 49.15  ? 11   ILE A O   1 
ATOM   2825  C  CB  . ILE E  5  11   ? 20.834  83.958  133.408 1.00 54.71  ? 11   ILE A CB  1 
ATOM   2826  C  CG1 . ILE E  5  11   ? 21.595  84.071  132.108 1.00 44.22  ? 11   ILE A CG1 1 
ATOM   2827  C  CG2 . ILE E  5  11   ? 21.481  82.962  134.273 1.00 43.30  ? 11   ILE A CG2 1 
ATOM   2828  C  CD1 . ILE E  5  11   ? 23.005  84.341  132.330 1.00 43.61  ? 11   ILE A CD1 1 
ATOM   2829  N  N   . THR E  5  12   ? 18.330  81.984  134.688 1.00 57.29  ? 12   THR A N   1 
ATOM   2830  C  CA  . THR E  5  12   ? 17.615  81.655  135.916 1.00 53.89  ? 12   THR A CA  1 
ATOM   2831  C  C   . THR E  5  12   ? 18.365  80.776  136.879 1.00 49.73  ? 12   THR A C   1 
ATOM   2832  O  O   . THR E  5  12   ? 18.001  80.702  138.034 1.00 59.64  ? 12   THR A O   1 
ATOM   2833  C  CB  . THR E  5  12   ? 16.263  81.009  135.658 1.00 57.43  ? 12   THR A CB  1 
ATOM   2834  O  OG1 . THR E  5  12   ? 16.442  79.826  134.880 1.00 66.65  ? 12   THR A OG1 1 
ATOM   2835  C  CG2 . THR E  5  12   ? 15.374  81.977  134.932 1.00 58.80  ? 12   THR A CG2 1 
ATOM   2836  N  N   . SER E  5  13   ? 19.392  80.093  136.405 1.00 51.70  ? 13   SER A N   1 
ATOM   2837  C  CA  . SER E  5  13   ? 20.253  79.294  137.273 1.00 43.09  ? 13   SER A CA  1 
ATOM   2838  C  C   . SER E  5  13   ? 21.568  79.016  136.563 1.00 42.82  ? 13   SER A C   1 
ATOM   2839  O  O   . SER E  5  13   ? 21.675  79.145  135.342 1.00 56.22  ? 13   SER A O   1 
ATOM   2840  C  CB  . SER E  5  13   ? 19.579  77.979  137.651 1.00 43.51  ? 13   SER A CB  1 
ATOM   2841  O  OG  . SER E  5  13   ? 19.341  77.153  136.514 1.00 52.97  ? 13   SER A OG  1 
ATOM   2842  N  N   . VAL E  5  14   ? 22.579  78.643  137.332 1.00 49.23  ? 14   VAL A N   1 
ATOM   2843  C  CA  . VAL E  5  14   ? 23.865  78.255  136.754 1.00 51.76  ? 14   VAL A CA  1 
ATOM   2844  C  C   . VAL E  5  14   ? 24.273  76.851  137.203 1.00 53.25  ? 14   VAL A C   1 
ATOM   2845  O  O   . VAL E  5  14   ? 24.146  76.522  138.376 1.00 57.08  ? 14   VAL A O   1 
ATOM   2846  C  CB  . VAL E  5  14   ? 24.929  79.255  137.159 1.00 43.49  ? 14   VAL A CB  1 
ATOM   2847  C  CG1 . VAL E  5  14   ? 26.219  78.954  136.450 1.00 47.16  ? 14   VAL A CG1 1 
ATOM   2848  C  CG2 . VAL E  5  14   ? 24.451  80.662  136.830 1.00 46.07  ? 14   VAL A CG2 1 
ATOM   2849  N  N   . ASP E  5  15   ? 24.723  76.011  136.274 1.00 52.94  ? 15   ASP A N   1 
ATOM   2850  C  CA  . ASP E  5  15   ? 25.169  74.646  136.629 1.00 53.56  ? 15   ASP A CA  1 
ATOM   2851  C  C   . ASP E  5  15   ? 26.689  74.528  136.522 1.00 47.71  ? 15   ASP A C   1 
ATOM   2852  O  O   . ASP E  5  15   ? 27.270  74.873  135.495 1.00 46.25  ? 15   ASP A O   1 
ATOM   2853  C  CB  . ASP E  5  15   ? 24.526  73.584  135.725 1.00 43.64  ? 15   ASP A CB  1 
ATOM   2854  C  CG  . ASP E  5  15   ? 23.054  73.328  136.039 1.00 74.15  ? 15   ASP A CG  1 
ATOM   2855  O  OD1 . ASP E  5  15   ? 22.687  73.320  137.220 1.00 74.00  ? 15   ASP A OD1 1 
ATOM   2856  O  OD2 . ASP E  5  15   ? 22.255  73.106  135.102 1.00 77.60  ? 15   ASP A OD2 1 
ATOM   2857  N  N   . PHE E  5  16   ? 27.332  74.030  137.573 1.00 50.51  ? 16   PHE A N   1 
ATOM   2858  C  CA  . PHE E  5  16   ? 28.778  73.763  137.555 1.00 42.39  ? 16   PHE A CA  1 
ATOM   2859  C  C   . PHE E  5  16   ? 29.141  72.381  136.973 1.00 44.70  ? 16   PHE A C   1 
ATOM   2860  O  O   . PHE E  5  16   ? 28.464  71.376  137.226 1.00 54.79  ? 16   PHE A O   1 
ATOM   2861  C  CB  . PHE E  5  16   ? 29.331  73.883  138.968 1.00 42.07  ? 16   PHE A CB  1 
ATOM   2862  C  CG  . PHE E  5  16   ? 29.198  75.266  139.553 1.00 43.93  ? 16   PHE A CG  1 
ATOM   2863  C  CD1 . PHE E  5  16   ? 28.010  75.685  140.124 1.00 48.38  ? 16   PHE A CD1 1 
ATOM   2864  C  CD2 . PHE E  5  16   ? 30.268  76.147  139.531 1.00 47.82  ? 16   PHE A CD2 1 
ATOM   2865  C  CE1 . PHE E  5  16   ? 27.885  76.972  140.662 1.00 54.30  ? 16   PHE A CE1 1 
ATOM   2866  C  CE2 . PHE E  5  16   ? 30.154  77.424  140.062 1.00 49.84  ? 16   PHE A CE2 1 
ATOM   2867  C  CZ  . PHE E  5  16   ? 28.958  77.841  140.623 1.00 50.12  ? 16   PHE A CZ  1 
ATOM   2868  N  N   . GLY E  5  17   ? 30.208  72.319  136.186 1.00 43.79  ? 17   GLY A N   1 
ATOM   2869  C  CA  . GLY E  5  17   ? 30.609  71.051  135.619 1.00 43.90  ? 17   GLY A CA  1 
ATOM   2870  C  C   . GLY E  5  17   ? 31.977  71.061  134.993 1.00 46.14  ? 17   GLY A C   1 
ATOM   2871  O  O   . GLY E  5  17   ? 32.742  72.014  135.145 1.00 50.83  ? 17   GLY A O   1 
ATOM   2872  N  N   . ILE E  5  18   ? 32.292  69.991  134.273 1.00 47.16  ? 18   ILE A N   1 
ATOM   2873  C  CA  . ILE E  5  18   ? 33.637  69.826  133.730 1.00 54.30  ? 18   ILE A CA  1 
ATOM   2874  C  C   . ILE E  5  18   ? 33.655  69.733  132.220 1.00 58.13  ? 18   ILE A C   1 
ATOM   2875  O  O   . ILE E  5  18   ? 32.899  68.973  131.637 1.00 73.21  ? 18   ILE A O   1 
ATOM   2876  C  CB  . ILE E  5  18   ? 34.339  68.607  134.328 1.00 52.91  ? 18   ILE A CB  1 
ATOM   2877  C  CG1 . ILE E  5  18   ? 34.670  68.887  135.795 1.00 53.88  ? 18   ILE A CG1 1 
ATOM   2878  C  CG2 . ILE E  5  18   ? 35.606  68.329  133.578 1.00 54.32  ? 18   ILE A CG2 1 
ATOM   2879  C  CD1 . ILE E  5  18   ? 35.424  67.804  136.474 1.00 59.26  ? 18   ILE A CD1 1 
ATOM   2880  N  N   . LEU E  5  19   ? 34.513  70.530  131.593 1.00 50.52  ? 19   LEU A N   1 
ATOM   2881  C  CA  . LEU E  5  19   ? 34.713  70.473  130.155 1.00 48.23  ? 19   LEU A CA  1 
ATOM   2882  C  C   . LEU E  5  19   ? 35.413  69.178  129.743 1.00 54.65  ? 19   LEU A C   1 
ATOM   2883  O  O   . LEU E  5  19   ? 36.498  68.860  130.234 1.00 58.18  ? 19   LEU A O   1 
ATOM   2884  C  CB  . LEU E  5  19   ? 35.588  71.625  129.719 1.00 46.06  ? 19   LEU A CB  1 
ATOM   2885  C  CG  . LEU E  5  19   ? 34.963  72.981  129.531 1.00 45.51  ? 19   LEU A CG  1 
ATOM   2886  C  CD1 . LEU E  5  19   ? 36.044  73.950  129.123 1.00 45.48  ? 19   LEU A CD1 1 
ATOM   2887  C  CD2 . LEU E  5  19   ? 33.905  72.892  128.466 1.00 46.00  ? 19   LEU A CD2 1 
ATOM   2888  N  N   . THR E  5  20   ? 34.797  68.451  128.822 1.00 51.72  ? 20   THR A N   1 
ATOM   2889  C  CA  . THR E  5  20   ? 35.411  67.257  128.243 1.00 54.83  ? 20   THR A CA  1 
ATOM   2890  C  C   . THR E  5  20   ? 36.287  67.623  127.053 1.00 61.18  ? 20   THR A C   1 
ATOM   2891  O  O   . THR E  5  20   ? 36.027  68.610  126.351 1.00 64.23  ? 20   THR A O   1 
ATOM   2892  C  CB  . THR E  5  20   ? 34.363  66.239  127.758 1.00 59.03  ? 20   THR A CB  1 
ATOM   2893  O  OG1 . THR E  5  20   ? 33.783  66.687  126.525 1.00 50.34  ? 20   THR A OG1 1 
ATOM   2894  C  CG2 . THR E  5  20   ? 33.283  66.027  128.802 1.00 49.47  ? 20   THR A CG2 1 
ATOM   2895  N  N   . ALA E  5  21   ? 37.319  66.818  126.814 1.00 63.81  ? 21   ALA A N   1 
ATOM   2896  C  CA  . ALA E  5  21   ? 38.237  67.125  125.727 1.00 67.00  ? 21   ALA A CA  1 
ATOM   2897  C  C   . ALA E  5  21   ? 37.531  67.046  124.373 1.00 70.49  ? 21   ALA A C   1 
ATOM   2898  O  O   . ALA E  5  21   ? 37.962  67.673  123.408 1.00 72.94  ? 21   ALA A O   1 
ATOM   2899  C  CB  . ALA E  5  21   ? 39.448  66.224  125.772 1.00 65.68  ? 21   ALA A CB  1 
ATOM   2900  N  N   . LYS E  5  22   ? 36.433  66.296  124.310 1.00 66.15  ? 22   LYS A N   1 
ATOM   2901  C  CA  . LYS E  5  22   ? 35.646  66.244  123.087 1.00 59.81  ? 22   LYS A CA  1 
ATOM   2902  C  C   . LYS E  5  22   ? 34.953  67.589  122.794 1.00 59.03  ? 22   LYS A C   1 
ATOM   2903  O  O   . LYS E  5  22   ? 35.018  68.087  121.668 1.00 61.05  ? 22   LYS A O   1 
ATOM   2904  C  CB  . LYS E  5  22   ? 34.619  65.117  123.137 1.00 56.95  ? 22   LYS A CB  1 
ATOM   2905  C  CG  . LYS E  5  22   ? 34.228  64.595  121.754 1.00 65.73  ? 22   LYS A CG  1 
ATOM   2906  C  CD  . LYS E  5  22   ? 32.776  64.111  121.699 1.00 70.98  ? 22   LYS A CD  1 
ATOM   2907  C  CE  . LYS E  5  22   ? 32.461  63.432  120.362 1.00 77.71  ? 22   LYS A CE  1 
ATOM   2908  N  NZ  . LYS E  5  22   ? 30.998  63.209  120.125 1.00 80.74  ? 22   LYS A NZ  1 
ATOM   2909  N  N   . GLU E  5  23   ? 34.300  68.165  123.802 1.00 54.04  ? 23   GLU A N   1 
ATOM   2910  C  CA  . GLU E  5  23   ? 33.643  69.464  123.671 1.00 60.50  ? 23   GLU A CA  1 
ATOM   2911  C  C   . GLU E  5  23   ? 34.612  70.526  123.170 1.00 62.54  ? 23   GLU A C   1 
ATOM   2912  O  O   . GLU E  5  23   ? 34.357  71.230  122.169 1.00 57.14  ? 23   GLU A O   1 
ATOM   2913  C  CB  . GLU E  5  23   ? 33.141  69.941  125.030 1.00 66.43  ? 23   GLU A CB  1 
ATOM   2914  C  CG  . GLU E  5  23   ? 31.944  69.220  125.601 1.00 80.19  ? 23   GLU A CG  1 
ATOM   2915  C  CD  . GLU E  5  23   ? 31.434  69.907  126.872 1.00 96.03  ? 23   GLU A CD  1 
ATOM   2916  O  OE1 . GLU E  5  23   ? 30.669  70.895  126.736 1.00 104.85 ? 23   GLU A OE1 1 
ATOM   2917  O  OE2 . GLU E  5  23   ? 31.803  69.477  128.000 1.00 91.20  ? 23   GLU A OE2 1 
ATOM   2918  N  N   . ILE E  5  24   ? 35.710  70.648  123.914 1.00 55.74  ? 24   ILE A N   1 
ATOM   2919  C  CA  . ILE E  5  24   ? 36.755  71.613  123.631 1.00 52.20  ? 24   ILE A CA  1 
ATOM   2920  C  C   . ILE E  5  24   ? 37.226  71.536  122.171 1.00 55.60  ? 24   ILE A C   1 
ATOM   2921  O  O   . ILE E  5  24   ? 37.192  72.524  121.437 1.00 61.89  ? 24   ILE A O   1 
ATOM   2922  C  CB  . ILE E  5  24   ? 37.908  71.439  124.616 1.00 49.43  ? 24   ILE A CB  1 
ATOM   2923  C  CG1 . ILE E  5  24   ? 37.452  71.918  125.996 1.00 64.10  ? 24   ILE A CG1 1 
ATOM   2924  C  CG2 . ILE E  5  24   ? 39.080  72.243  124.183 1.00 49.62  ? 24   ILE A CG2 1 
ATOM   2925  C  CD1 . ILE E  5  24   ? 38.221  71.361  127.162 1.00 60.28  ? 24   ILE A CD1 1 
ATOM   2926  N  N   . ARG E  5  25   ? 37.628  70.355  121.740 1.00 51.98  ? 25   ARG A N   1 
ATOM   2927  C  CA  . ARG E  5  25   ? 38.058  70.169  120.356 1.00 67.59  ? 25   ARG A CA  1 
ATOM   2928  C  C   . ARG E  5  25   ? 37.006  70.628  119.357 1.00 61.40  ? 25   ARG A C   1 
ATOM   2929  O  O   . ARG E  5  25   ? 37.326  71.222  118.326 1.00 61.42  ? 25   ARG A O   1 
ATOM   2930  C  CB  . ARG E  5  25   ? 38.432  68.708  120.088 1.00 54.32  ? 25   ARG A CB  1 
ATOM   2931  C  CG  . ARG E  5  25   ? 39.734  68.296  120.751 1.00 57.15  ? 25   ARG A CG  1 
ATOM   2932  C  CD  . ARG E  5  25   ? 40.127  66.826  120.480 1.00 56.82  ? 25   ARG A CD  1 
ATOM   2933  N  NE  . ARG E  5  25   ? 41.303  66.451  121.272 1.00 55.39  ? 25   ARG A NE  1 
ATOM   2934  C  CZ  . ARG E  5  25   ? 41.303  65.530  122.228 1.00 55.28  ? 25   ARG A CZ  1 
ATOM   2935  N  NH1 . ARG E  5  25   ? 40.198  64.837  122.485 1.00 55.26  ? 25   ARG A NH1 1 
ATOM   2936  N  NH2 . ARG E  5  25   ? 42.419  65.288  122.904 1.00 55.96  ? 25   ARG A NH2 1 
ATOM   2937  N  N   . ASN E  5  26   ? 35.746  70.366  119.668 1.00 62.58  ? 26   ASN A N   1 
ATOM   2938  C  CA  . ASN E  5  26   ? 34.684  70.737  118.763 1.00 54.07  ? 26   ASN A CA  1 
ATOM   2939  C  C   . ASN E  5  26   ? 34.492  72.242  118.706 1.00 67.95  ? 26   ASN A C   1 
ATOM   2940  O  O   . ASN E  5  26   ? 34.365  72.809  117.618 1.00 71.07  ? 26   ASN A O   1 
ATOM   2941  C  CB  . ASN E  5  26   ? 33.382  70.035  119.131 1.00 65.38  ? 26   ASN A CB  1 
ATOM   2942  C  CG  . ASN E  5  26   ? 32.263  70.337  118.149 1.00 74.88  ? 26   ASN A CG  1 
ATOM   2943  O  OD1 . ASN E  5  26   ? 32.310  69.938  116.977 1.00 74.78  ? 26   ASN A OD1 1 
ATOM   2944  N  ND2 . ASN E  5  26   ? 31.247  71.048  118.623 1.00 84.10  ? 26   ASN A ND2 1 
ATOM   2945  N  N   . LEU E  5  27   ? 34.497  72.896  119.866 1.00 62.81  ? 27   LEU A N   1 
ATOM   2946  C  CA  . LEU E  5  27   ? 34.222  74.341  119.923 1.00 64.38  ? 27   LEU A CA  1 
ATOM   2947  C  C   . LEU E  5  27   ? 35.416  75.200  119.532 1.00 70.28  ? 27   LEU A C   1 
ATOM   2948  O  O   . LEU E  5  27   ? 35.263  76.386  119.207 1.00 78.29  ? 27   LEU A O   1 
ATOM   2949  C  CB  . LEU E  5  27   ? 33.747  74.752  121.318 1.00 56.71  ? 27   LEU A CB  1 
ATOM   2950  C  CG  . LEU E  5  27   ? 34.735  74.661  122.488 1.00 49.35  ? 27   LEU A CG  1 
ATOM   2951  C  CD1 . LEU E  5  27   ? 35.417  75.984  122.735 1.00 48.82  ? 27   LEU A CD1 1 
ATOM   2952  C  CD2 . LEU E  5  27   ? 34.036  74.192  123.751 1.00 48.52  ? 27   LEU A CD2 1 
ATOM   2953  N  N   . SER E  5  28   ? 36.605  74.608  119.583 1.00 62.31  ? 28   SER A N   1 
ATOM   2954  C  CA  . SER E  5  28   ? 37.835  75.362  119.386 1.00 59.18  ? 28   SER A CA  1 
ATOM   2955  C  C   . SER E  5  28   ? 37.929  76.073  118.034 1.00 65.29  ? 28   SER A C   1 
ATOM   2956  O  O   . SER E  5  28   ? 37.494  75.558  117.013 1.00 66.39  ? 28   SER A O   1 
ATOM   2957  C  CB  . SER E  5  28   ? 39.044  74.469  119.598 1.00 57.00  ? 28   SER A CB  1 
ATOM   2958  O  OG  . SER E  5  28   ? 40.228  75.194  119.331 1.00 62.58  ? 28   SER A OG  1 
ATOM   2959  N  N   . ALA E  5  29   ? 38.486  77.274  118.042 1.00 70.53  ? 29   ALA A N   1 
ATOM   2960  C  CA  . ALA E  5  29   ? 38.591  78.069  116.828 1.00 68.84  ? 29   ALA A CA  1 
ATOM   2961  C  C   . ALA E  5  29   ? 39.922  77.829  116.136 1.00 70.99  ? 29   ALA A C   1 
ATOM   2962  O  O   . ALA E  5  29   ? 40.095  78.189  114.968 1.00 82.44  ? 29   ALA A O   1 
ATOM   2963  C  CB  . ALA E  5  29   ? 38.440  79.535  117.163 1.00 71.69  ? 29   ALA A CB  1 
ATOM   2964  N  N   . LYS E  5  30   ? 40.861  77.223  116.861 1.00 61.65  ? 30   LYS A N   1 
ATOM   2965  C  CA  . LYS E  5  30   ? 42.214  77.019  116.362 1.00 63.91  ? 30   LYS A CA  1 
ATOM   2966  C  C   . LYS E  5  30   ? 42.985  76.219  117.381 1.00 66.01  ? 30   LYS A C   1 
ATOM   2967  O  O   . LYS E  5  30   ? 42.895  76.504  118.569 1.00 71.13  ? 30   LYS A O   1 
ATOM   2968  C  CB  . LYS E  5  30   ? 42.929  78.359  116.141 1.00 59.33  ? 30   LYS A CB  1 
ATOM   2969  C  CG  . LYS E  5  30   ? 44.174  78.299  115.250 1.00 58.79  ? 30   LYS A CG  1 
ATOM   2970  C  CD  . LYS E  5  30   ? 43.946  77.410  114.055 1.00 68.91  ? 30   LYS A CD  1 
ATOM   2971  C  CE  . LYS E  5  30   ? 45.104  77.495  113.103 1.00 76.73  ? 30   LYS A CE  1 
ATOM   2972  N  NZ  . LYS E  5  30   ? 45.161  78.848  112.491 1.00 75.63  ? 30   LYS A NZ  1 
ATOM   2973  N  N   . GLN E  5  31   ? 43.743  75.223  116.920 1.00 59.23  ? 31   GLN A N   1 
ATOM   2974  C  CA  . GLN E  5  31   ? 44.656  74.526  117.804 1.00 62.24  ? 31   GLN A CA  1 
ATOM   2975  C  C   . GLN E  5  31   ? 45.980  75.280  117.811 1.00 67.35  ? 31   GLN A C   1 
ATOM   2976  O  O   . GLN E  5  31   ? 46.527  75.557  116.758 1.00 74.25  ? 31   GLN A O   1 
ATOM   2977  C  CB  . GLN E  5  31   ? 44.855  73.071  117.377 1.00 56.58  ? 31   GLN A CB  1 
ATOM   2978  C  CG  . GLN E  5  31   ? 45.838  72.325  118.246 1.00 65.40  ? 31   GLN A CG  1 
ATOM   2979  C  CD  . GLN E  5  31   ? 46.266  71.005  117.661 1.00 67.11  ? 31   GLN A CD  1 
ATOM   2980  O  OE1 . GLN E  5  31   ? 45.563  70.403  116.845 1.00 70.72  ? 31   GLN A OE1 1 
ATOM   2981  N  NE2 . GLN E  5  31   ? 47.438  70.541  118.076 1.00 70.02  ? 31   GLN A NE2 1 
ATOM   2982  N  N   . ILE E  5  32   ? 46.474  75.621  118.997 1.00 68.12  ? 32   ILE A N   1 
ATOM   2983  C  CA  . ILE E  5  32   ? 47.681  76.415  119.141 1.00 55.32  ? 32   ILE A CA  1 
ATOM   2984  C  C   . ILE E  5  32   ? 48.844  75.472  119.373 1.00 72.87  ? 32   ILE A C   1 
ATOM   2985  O  O   . ILE E  5  32   ? 48.730  74.538  120.161 1.00 68.46  ? 32   ILE A O   1 
ATOM   2986  C  CB  . ILE E  5  32   ? 47.541  77.365  120.341 1.00 57.18  ? 32   ILE A CB  1 
ATOM   2987  C  CG1 . ILE E  5  32   ? 46.248  78.150  120.211 1.00 53.36  ? 32   ILE A CG1 1 
ATOM   2988  C  CG2 . ILE E  5  32   ? 48.726  78.307  120.445 1.00 54.46  ? 32   ILE A CG2 1 
ATOM   2989  C  CD1 . ILE E  5  32   ? 46.065  78.774  118.839 1.00 68.21  ? 32   ILE A CD1 1 
ATOM   2990  N  N   . THR E  5  33   ? 49.954  75.702  118.676 1.00 57.19  ? 33   THR A N   1 
ATOM   2991  C  CA  . THR E  5  33   ? 51.078  74.766  118.700 1.00 65.78  ? 33   THR A CA  1 
ATOM   2992  C  C   . THR E  5  33   ? 52.444  75.444  118.677 1.00 63.01  ? 33   THR A C   1 
ATOM   2993  O  O   . THR E  5  33   ? 53.457  74.792  118.910 1.00 61.05  ? 33   THR A O   1 
ATOM   2994  C  CB  . THR E  5  33   ? 51.037  73.784  117.502 1.00 70.84  ? 33   THR A CB  1 
ATOM   2995  O  OG1 . THR E  5  33   ? 51.016  74.527  116.282 1.00 60.32  ? 33   THR A OG1 1 
ATOM   2996  C  CG2 . THR E  5  33   ? 49.819  72.888  117.558 1.00 58.99  ? 33   THR A CG2 1 
ATOM   2997  N  N   . ASN E  5  34   ? 52.474  76.740  118.388 1.00 63.24  ? 34   ASN A N   1 
ATOM   2998  C  CA  . ASN E  5  34   ? 53.728  77.481  118.318 1.00 59.66  ? 34   ASN A CA  1 
ATOM   2999  C  C   . ASN E  5  34   ? 54.025  78.326  119.573 1.00 69.31  ? 34   ASN A C   1 
ATOM   3000  O  O   . ASN E  5  34   ? 53.246  79.208  119.942 1.00 70.62  ? 34   ASN A O   1 
ATOM   3001  C  CB  . ASN E  5  34   ? 53.721  78.358  117.075 1.00 60.57  ? 34   ASN A CB  1 
ATOM   3002  C  CG  . ASN E  5  34   ? 55.106  78.817  116.677 1.00 70.21  ? 34   ASN A CG  1 
ATOM   3003  O  OD1 . ASN E  5  34   ? 55.955  79.102  117.526 1.00 68.64  ? 34   ASN A OD1 1 
ATOM   3004  N  ND2 . ASN E  5  34   ? 55.344  78.890  115.369 1.00 66.84  ? 34   ASN A ND2 1 
ATOM   3005  N  N   . PRO E  5  35   ? 55.165  78.062  120.228 1.00 67.70  ? 35   PRO A N   1 
ATOM   3006  C  CA  . PRO E  5  35   ? 55.551  78.802  121.430 1.00 67.70  ? 35   PRO A CA  1 
ATOM   3007  C  C   . PRO E  5  35   ? 55.771  80.257  121.089 1.00 71.29  ? 35   PRO A C   1 
ATOM   3008  O  O   . PRO E  5  35   ? 55.521  81.125  121.917 1.00 76.07  ? 35   PRO A O   1 
ATOM   3009  C  CB  . PRO E  5  35   ? 56.905  78.190  121.802 1.00 68.18  ? 35   PRO A CB  1 
ATOM   3010  C  CG  . PRO E  5  35   ? 57.018  76.947  121.033 1.00 64.97  ? 35   PRO A CG  1 
ATOM   3011  C  CD  . PRO E  5  35   ? 56.210  77.116  119.805 1.00 65.21  ? 35   PRO A CD  1 
ATOM   3012  N  N   . THR E  5  36   ? 56.256  80.504  119.880 1.00 60.04  ? 36   THR A N   1 
ATOM   3013  C  CA  . THR E  5  36   ? 56.559  81.854  119.428 1.00 69.32  ? 36   THR A CA  1 
ATOM   3014  C  C   . THR E  5  36   ? 55.290  82.659  119.157 1.00 73.84  ? 36   THR A C   1 
ATOM   3015  O  O   . THR E  5  36   ? 54.327  82.165  118.588 1.00 79.11  ? 36   THR A O   1 
ATOM   3016  C  CB  . THR E  5  36   ? 57.447  81.833  118.194 1.00 68.79  ? 36   THR A CB  1 
ATOM   3017  O  OG1 . THR E  5  36   ? 58.721  81.304  118.560 1.00 68.13  ? 36   THR A OG1 1 
ATOM   3018  C  CG2 . THR E  5  36   ? 57.651  83.228  117.643 1.00 75.31  ? 36   THR A CG2 1 
ATOM   3019  N  N   . VAL E  5  37   ? 55.290  83.909  119.586 1.00 73.10  ? 37   VAL A N   1 
ATOM   3020  C  CA  . VAL E  5  37   ? 54.071  84.680  119.592 1.00 65.24  ? 37   VAL A CA  1 
ATOM   3021  C  C   . VAL E  5  37   ? 54.000  85.683  118.451 1.00 66.67  ? 37   VAL A C   1 
ATOM   3022  O  O   . VAL E  5  37   ? 52.952  85.795  117.812 1.00 59.26  ? 37   VAL A O   1 
ATOM   3023  C  CB  . VAL E  5  37   ? 53.872  85.331  120.957 1.00 62.16  ? 37   VAL A CB  1 
ATOM   3024  C  CG1 . VAL E  5  37   ? 52.936  86.485  120.866 1.00 64.29  ? 37   VAL A CG1 1 
ATOM   3025  C  CG2 . VAL E  5  37   ? 53.354  84.287  121.936 1.00 56.17  ? 37   VAL A CG2 1 
ATOM   3026  N  N   . LEU E  5  38   ? 55.114  86.373  118.183 1.00 69.43  ? 38   LEU A N   1 
ATOM   3027  C  CA  . LEU E  5  38   ? 55.190  87.327  117.073 1.00 72.68  ? 38   LEU A CA  1 
ATOM   3028  C  C   . LEU E  5  38   ? 56.369  87.076  116.123 1.00 78.35  ? 38   LEU A C   1 
ATOM   3029  O  O   . LEU E  5  38   ? 57.327  86.397  116.461 1.00 84.19  ? 38   LEU A O   1 
ATOM   3030  C  CB  . LEU E  5  38   ? 55.273  88.755  117.602 1.00 74.08  ? 38   LEU A CB  1 
ATOM   3031  C  CG  . LEU E  5  38   ? 54.331  89.222  118.715 1.00 73.48  ? 38   LEU A CG  1 
ATOM   3032  C  CD1 . LEU E  5  38   ? 54.738  90.606  119.192 1.00 60.58  ? 38   LEU A CD1 1 
ATOM   3033  C  CD2 . LEU E  5  38   ? 52.879  89.200  118.261 1.00 59.52  ? 38   LEU A CD2 1 
ATOM   3034  N  N   . ASP E  5  39   ? 56.292  87.636  114.925 1.00 85.00  ? 39   ASP A N   1 
ATOM   3035  C  CA  . ASP E  5  39   ? 57.394  87.553  113.973 1.00 90.22  ? 39   ASP A CA  1 
ATOM   3036  C  C   . ASP E  5  39   ? 58.196  88.852  113.974 1.00 100.33 ? 39   ASP A C   1 
ATOM   3037  O  O   . ASP E  5  39   ? 57.955  89.741  114.779 1.00 107.40 ? 39   ASP A O   1 
ATOM   3038  C  CB  . ASP E  5  39   ? 56.884  87.216  112.560 1.00 92.84  ? 39   ASP A CB  1 
ATOM   3039  C  CG  . ASP E  5  39   ? 55.885  88.249  112.004 1.00 103.54 ? 39   ASP A CG  1 
ATOM   3040  O  OD1 . ASP E  5  39   ? 56.128  89.468  112.110 1.00 104.68 ? 39   ASP A OD1 1 
ATOM   3041  O  OD2 . ASP E  5  39   ? 54.849  87.837  111.432 1.00 111.26 ? 39   ASP A OD2 1 
ATOM   3042  N  N   . ASN E  5  40   ? 59.129  88.976  113.048 1.00 105.07 ? 40   ASN A N   1 
ATOM   3043  C  CA  . ASN E  5  40   ? 59.959  90.168  112.967 1.00 111.15 ? 40   ASN A CA  1 
ATOM   3044  C  C   . ASN E  5  40   ? 59.203  91.454  112.610 1.00 120.95 ? 40   ASN A C   1 
ATOM   3045  O  O   . ASN E  5  40   ? 59.704  92.543  112.851 1.00 124.60 ? 40   ASN A O   1 
ATOM   3046  C  CB  . ASN E  5  40   ? 61.104  89.926  111.985 1.00 121.00 ? 40   ASN A CB  1 
ATOM   3047  C  CG  . ASN E  5  40   ? 61.777  88.591  112.217 1.00 127.42 ? 40   ASN A CG  1 
ATOM   3048  O  OD1 . ASN E  5  40   ? 61.212  87.715  112.870 1.00 131.70 ? 40   ASN A OD1 1 
ATOM   3049  N  ND2 . ASN E  5  40   ? 62.985  88.427  111.690 1.00 126.94 ? 40   ASN A ND2 1 
ATOM   3050  N  N   . LEU E  5  41   ? 58.007  91.338  112.038 1.00 128.23 ? 41   LEU A N   1 
ATOM   3051  C  CA  . LEU E  5  41   ? 57.207  92.523  111.707 1.00 128.77 ? 41   LEU A CA  1 
ATOM   3052  C  C   . LEU E  5  41   ? 56.046  92.726  112.678 1.00 118.09 ? 41   LEU A C   1 
ATOM   3053  O  O   . LEU E  5  41   ? 55.096  93.458  112.377 1.00 117.42 ? 41   LEU A O   1 
ATOM   3054  C  CB  . LEU E  5  41   ? 56.675  92.458  110.266 1.00 133.35 ? 41   LEU A CB  1 
ATOM   3055  C  CG  . LEU E  5  41   ? 57.679  92.698  109.131 1.00 136.76 ? 41   LEU A CG  1 
ATOM   3056  C  CD1 . LEU E  5  41   ? 56.980  92.689  107.786 1.00 140.43 ? 41   LEU A CD1 1 
ATOM   3057  C  CD2 . LEU E  5  41   ? 58.425  94.005  109.313 1.00 137.32 ? 41   LEU A CD2 1 
ATOM   3058  N  N   . GLY E  5  42   ? 56.127  92.065  113.832 1.00 104.14 ? 42   GLY A N   1 
ATOM   3059  C  CA  . GLY E  5  42   ? 55.125  92.203  114.873 1.00 96.03  ? 42   GLY A CA  1 
ATOM   3060  C  C   . GLY E  5  42   ? 53.743  91.686  114.524 1.00 92.92  ? 42   GLY A C   1 
ATOM   3061  O  O   . GLY E  5  42   ? 52.743  92.136  115.095 1.00 98.45  ? 42   GLY A O   1 
ATOM   3062  N  N   . HIS E  5  43   ? 53.664  90.755  113.581 1.00 85.27  ? 43   HIS A N   1 
ATOM   3063  C  CA  . HIS E  5  43   ? 52.378  90.154  113.275 1.00 88.46  ? 43   HIS A CA  1 
ATOM   3064  C  C   . HIS E  5  43   ? 52.235  88.877  114.075 1.00 75.31  ? 43   HIS A C   1 
ATOM   3065  O  O   . HIS E  5  43   ? 53.232  88.269  114.469 1.00 67.69  ? 43   HIS A O   1 
ATOM   3066  C  CB  . HIS E  5  43   ? 52.214  89.877  111.774 1.00 109.84 ? 43   HIS A CB  1 
ATOM   3067  C  CG  . HIS E  5  43   ? 51.938  91.102  110.943 1.00 129.37 ? 43   HIS A CG  1 
ATOM   3068  N  ND1 . HIS E  5  43   ? 51.323  92.227  111.486 1.00 137.35 ? 43   HIS A ND1 1 
ATOM   3069  C  CD2 . HIS E  5  43   ? 52.154  91.366  109.659 1.00 138.35 ? 43   HIS A CD2 1 
ATOM   3070  C  CE1 . HIS E  5  43   ? 51.206  93.130  110.546 1.00 142.06 ? 43   HIS A CE1 1 
ATOM   3071  N  NE2 . HIS E  5  43   ? 51.716  92.654  109.411 1.00 143.68 ? 43   HIS A NE2 1 
ATOM   3072  N  N   . PRO E  5  44   ? 50.994  88.496  114.369 1.00 74.20  ? 44   PRO A N   1 
ATOM   3073  C  CA  . PRO E  5  44   ? 50.800  87.199  115.010 1.00 60.67  ? 44   PRO A CA  1 
ATOM   3074  C  C   . PRO E  5  44   ? 51.379  86.041  114.190 1.00 65.66  ? 44   PRO A C   1 
ATOM   3075  O  O   . PRO E  5  44   ? 51.132  85.919  112.991 1.00 71.06  ? 44   PRO A O   1 
ATOM   3076  C  CB  . PRO E  5  44   ? 49.283  87.095  115.106 1.00 73.38  ? 44   PRO A CB  1 
ATOM   3077  C  CG  . PRO E  5  44   ? 48.828  88.520  115.231 1.00 75.91  ? 44   PRO A CG  1 
ATOM   3078  C  CD  . PRO E  5  44   ? 49.790  89.347  114.423 1.00 61.17  ? 44   PRO A CD  1 
ATOM   3079  N  N   . VAL E  5  45   ? 52.180  85.213  114.843 1.00 64.69  ? 45   VAL A N   1 
ATOM   3080  C  CA  . VAL E  5  45   ? 52.577  83.928  114.304 1.00 62.12  ? 45   VAL A CA  1 
ATOM   3081  C  C   . VAL E  5  45   ? 51.350  83.033  114.197 1.00 73.96  ? 45   VAL A C   1 
ATOM   3082  O  O   . VAL E  5  45   ? 50.589  82.894  115.152 1.00 74.62  ? 45   VAL A O   1 
ATOM   3083  C  CB  . VAL E  5  45   ? 53.578  83.258  115.241 1.00 61.87  ? 45   VAL A CB  1 
ATOM   3084  C  CG1 . VAL E  5  45   ? 53.833  81.841  114.832 1.00 62.44  ? 45   VAL A CG1 1 
ATOM   3085  C  CG2 . VAL E  5  45   ? 54.863  84.036  115.284 1.00 68.74  ? 45   VAL A CG2 1 
ATOM   3086  N  N   . SER E  5  46   ? 51.157  82.437  113.027 1.00 80.55  ? 46   SER A N   1 
ATOM   3087  C  CA  . SER E  5  46   ? 50.082  81.487  112.790 1.00 74.86  ? 46   SER A CA  1 
ATOM   3088  C  C   . SER E  5  46   ? 50.234  80.242  113.647 1.00 70.29  ? 46   SER A C   1 
ATOM   3089  O  O   . SER E  5  46   ? 51.305  79.647  113.717 1.00 72.90  ? 46   SER A O   1 
ATOM   3090  C  CB  . SER E  5  46   ? 50.096  81.084  111.324 1.00 85.80  ? 46   SER A CB  1 
ATOM   3091  O  OG  . SER E  5  46   ? 49.536  79.792  111.152 1.00 100.17 ? 46   SER A OG  1 
ATOM   3092  N  N   . GLY E  5  47   ? 49.155  79.828  114.288 1.00 60.08  ? 47   GLY A N   1 
ATOM   3093  C  CA  . GLY E  5  47   ? 49.219  78.683  115.174 1.00 67.74  ? 47   GLY A CA  1 
ATOM   3094  C  C   . GLY E  5  47   ? 49.861  79.012  116.510 1.00 66.30  ? 47   GLY A C   1 
ATOM   3095  O  O   . GLY E  5  47   ? 50.089  78.126  117.329 1.00 71.18  ? 47   GLY A O   1 
ATOM   3096  N  N   . GLY E  5  48   ? 50.149  80.294  116.721 1.00 65.02  ? 48   GLY A N   1 
ATOM   3097  C  CA  . GLY E  5  48   ? 50.702  80.786  117.967 1.00 61.25  ? 48   GLY A CA  1 
ATOM   3098  C  C   . GLY E  5  48   ? 49.623  81.358  118.871 1.00 60.38  ? 48   GLY A C   1 
ATOM   3099  O  O   . GLY E  5  48   ? 48.436  81.282  118.565 1.00 55.53  ? 48   GLY A O   1 
ATOM   3100  N  N   . LEU E  5  49   ? 50.034  81.937  119.990 1.00 57.86  ? 49   LEU A N   1 
ATOM   3101  C  CA  . LEU E  5  49   ? 49.078  82.387  120.989 1.00 56.71  ? 49   LEU A CA  1 
ATOM   3102  C  C   . LEU E  5  49   ? 48.283  83.628  120.599 1.00 59.40  ? 49   LEU A C   1 
ATOM   3103  O  O   . LEU E  5  49   ? 47.265  83.920  121.225 1.00 54.99  ? 49   LEU A O   1 
ATOM   3104  C  CB  . LEU E  5  49   ? 49.762  82.590  122.343 1.00 57.12  ? 49   LEU A CB  1 
ATOM   3105  C  CG  . LEU E  5  49   ? 50.041  81.287  123.073 1.00 53.03  ? 49   LEU A CG  1 
ATOM   3106  C  CD1 . LEU E  5  49   ? 50.977  81.532  124.239 1.00 52.89  ? 49   LEU A CD1 1 
ATOM   3107  C  CD2 . LEU E  5  49   ? 48.714  80.696  123.521 1.00 51.95  ? 49   LEU A CD2 1 
ATOM   3108  N  N   . TYR E  5  50   ? 48.734  84.365  119.588 1.00 63.40  ? 50   TYR A N   1 
ATOM   3109  C  CA  . TYR E  5  50   ? 47.959  85.523  119.150 1.00 64.43  ? 50   TYR A CA  1 
ATOM   3110  C  C   . TYR E  5  50   ? 47.295  85.254  117.816 1.00 68.47  ? 50   TYR A C   1 
ATOM   3111  O  O   . TYR E  5  50   ? 46.793  86.170  117.169 1.00 76.97  ? 50   TYR A O   1 
ATOM   3112  C  CB  . TYR E  5  50   ? 48.797  86.805  119.062 1.00 63.89  ? 50   TYR A CB  1 
ATOM   3113  C  CG  . TYR E  5  50   ? 49.069  87.471  120.381 1.00 61.26  ? 50   TYR A CG  1 
ATOM   3114  C  CD1 . TYR E  5  50   ? 48.173  87.358  121.445 1.00 61.21  ? 50   TYR A CD1 1 
ATOM   3115  C  CD2 . TYR E  5  50   ? 50.227  88.224  120.566 1.00 61.09  ? 50   TYR A CD2 1 
ATOM   3116  C  CE1 . TYR E  5  50   ? 48.435  87.980  122.671 1.00 61.78  ? 50   TYR A CE1 1 
ATOM   3117  C  CE2 . TYR E  5  50   ? 50.507  88.837  121.780 1.00 60.38  ? 50   TYR A CE2 1 
ATOM   3118  C  CZ  . TYR E  5  50   ? 49.608  88.718  122.824 1.00 64.48  ? 50   TYR A CZ  1 
ATOM   3119  O  OH  . TYR E  5  50   ? 49.896  89.327  124.020 1.00 65.73  ? 50   TYR A OH  1 
ATOM   3120  N  N   . ASP E  5  51   ? 47.292  83.994  117.411 1.00 55.97  ? 51   ASP A N   1 
ATOM   3121  C  CA  . ASP E  5  51   ? 46.632  83.600  116.174 1.00 56.80  ? 51   ASP A CA  1 
ATOM   3122  C  C   . ASP E  5  51   ? 45.265  84.255  116.064 1.00 60.35  ? 51   ASP A C   1 
ATOM   3123  O  O   . ASP E  5  51   ? 44.487  84.299  117.030 1.00 60.51  ? 51   ASP A O   1 
ATOM   3124  C  CB  . ASP E  5  51   ? 46.508  82.083  116.055 1.00 59.89  ? 51   ASP A CB  1 
ATOM   3125  C  CG  . ASP E  5  51   ? 46.032  81.642  114.670 1.00 64.86  ? 51   ASP A CG  1 
ATOM   3126  O  OD1 . ASP E  5  51   ? 44.852  81.872  114.334 1.00 64.33  ? 51   ASP A OD1 1 
ATOM   3127  O  OD2 . ASP E  5  51   ? 46.831  81.044  113.920 1.00 67.79  ? 51   ASP A OD2 1 
ATOM   3128  N  N   . LEU E  5  52   ? 44.996  84.774  114.874 1.00 60.60  ? 52   LEU A N   1 
ATOM   3129  C  CA  . LEU E  5  52   ? 43.867  85.655  114.661 1.00 64.17  ? 52   LEU A CA  1 
ATOM   3130  C  C   . LEU E  5  52   ? 42.510  84.952  114.695 1.00 56.81  ? 52   LEU A C   1 
ATOM   3131  O  O   . LEU E  5  52   ? 41.465  85.601  114.669 1.00 68.91  ? 52   LEU A O   1 
ATOM   3132  C  CB  . LEU E  5  52   ? 44.074  86.454  113.377 1.00 58.97  ? 52   LEU A CB  1 
ATOM   3133  C  CG  . LEU E  5  52   ? 45.103  87.572  113.519 1.00 59.41  ? 52   LEU A CG  1 
ATOM   3134  C  CD1 . LEU E  5  52   ? 45.422  88.174  112.207 1.00 61.15  ? 52   LEU A CD1 1 
ATOM   3135  C  CD2 . LEU E  5  52   ? 44.525  88.623  114.427 1.00 58.51  ? 52   LEU A CD2 1 
ATOM   3136  N  N   . ALA E  5  53   ? 42.528  83.633  114.796 1.00 56.61  ? 53   ALA A N   1 
ATOM   3137  C  CA  . ALA E  5  53   ? 41.294  82.880  114.971 1.00 62.50  ? 53   ALA A CA  1 
ATOM   3138  C  C   . ALA E  5  53   ? 40.776  83.036  116.396 1.00 55.99  ? 53   ALA A C   1 
ATOM   3139  O  O   . ALA E  5  53   ? 39.615  82.763  116.661 1.00 62.52  ? 53   ALA A O   1 
ATOM   3140  C  CB  . ALA E  5  53   ? 41.512  81.415  114.654 1.00 56.45  ? 53   ALA A CB  1 
ATOM   3141  N  N   . LEU E  5  54   ? 41.646  83.468  117.306 1.00 54.62  ? 54   LEU A N   1 
ATOM   3142  C  CA  . LEU E  5  54   ? 41.295  83.595  118.708 1.00 52.41  ? 54   LEU A CA  1 
ATOM   3143  C  C   . LEU E  5  54   ? 40.773  84.984  118.973 1.00 65.54  ? 54   LEU A C   1 
ATOM   3144  O  O   . LEU E  5  54   ? 40.348  85.307  120.082 1.00 63.11  ? 54   LEU A O   1 
ATOM   3145  C  CB  . LEU E  5  54   ? 42.513  83.343  119.575 1.00 63.28  ? 54   LEU A CB  1 
ATOM   3146  C  CG  . LEU E  5  54   ? 43.118  81.965  119.383 1.00 59.56  ? 54   LEU A CG  1 
ATOM   3147  C  CD1 . LEU E  5  54   ? 44.274  81.829  120.315 1.00 52.03  ? 54   LEU A CD1 1 
ATOM   3148  C  CD2 . LEU E  5  54   ? 42.075  80.916  119.668 1.00 51.82  ? 54   LEU A CD2 1 
ATOM   3149  N  N   . GLY E  5  55   ? 40.816  85.816  117.944 1.00 68.57  ? 55   GLY A N   1 
ATOM   3150  C  CA  . GLY E  5  55   ? 40.219  87.129  118.031 1.00 68.82  ? 55   GLY A CA  1 
ATOM   3151  C  C   . GLY E  5  55   ? 41.088  88.197  117.423 1.00 65.20  ? 55   GLY A C   1 
ATOM   3152  O  O   . GLY E  5  55   ? 42.289  88.000  117.227 1.00 70.09  ? 55   GLY A O   1 
ATOM   3153  N  N   . ALA E  5  56   ? 40.459  89.328  117.128 1.00 56.46  ? 56   ALA A N   1 
ATOM   3154  C  CA  . ALA E  5  56   ? 41.154  90.497  116.625 1.00 61.30  ? 56   ALA A CA  1 
ATOM   3155  C  C   . ALA E  5  56   ? 42.220  90.882  117.613 1.00 62.25  ? 56   ALA A C   1 
ATOM   3156  O  O   . ALA E  5  56   ? 42.031  90.750  118.821 1.00 57.65  ? 56   ALA A O   1 
ATOM   3157  C  CB  . ALA E  5  56   ? 40.202  91.634  116.453 1.00 61.21  ? 56   ALA A CB  1 
ATOM   3158  N  N   . PHE E  5  57   ? 43.333  91.366  117.084 1.00 63.28  ? 57   PHE A N   1 
ATOM   3159  C  CA  . PHE E  5  57   ? 44.480  91.726  117.885 1.00 67.57  ? 57   PHE A CA  1 
ATOM   3160  C  C   . PHE E  5  57   ? 45.105  92.930  117.214 1.00 76.51  ? 57   PHE A C   1 
ATOM   3161  O  O   . PHE E  5  57   ? 45.425  92.892  116.010 1.00 77.75  ? 57   PHE A O   1 
ATOM   3162  C  CB  . PHE E  5  57   ? 45.468  90.552  117.947 1.00 76.07  ? 57   PHE A CB  1 
ATOM   3163  C  CG  . PHE E  5  57   ? 46.763  90.872  118.648 1.00 71.18  ? 57   PHE A CG  1 
ATOM   3164  C  CD1 . PHE E  5  57   ? 46.790  91.119  120.007 1.00 69.74  ? 57   PHE A CD1 1 
ATOM   3165  C  CD2 . PHE E  5  57   ? 47.950  90.909  117.945 1.00 62.46  ? 57   PHE A CD2 1 
ATOM   3166  C  CE1 . PHE E  5  57   ? 47.967  91.405  120.638 1.00 69.94  ? 57   PHE A CE1 1 
ATOM   3167  C  CE2 . PHE E  5  57   ? 49.128  91.205  118.576 1.00 64.23  ? 57   PHE A CE2 1 
ATOM   3168  C  CZ  . PHE E  5  57   ? 49.141  91.448  119.923 1.00 67.40  ? 57   PHE A CZ  1 
ATOM   3169  N  N   . LEU E  5  58   ? 45.262  93.999  117.996 1.00 79.64  ? 58   LEU A N   1 
ATOM   3170  C  CA  . LEU E  5  58   ? 45.760  95.283  117.493 1.00 85.64  ? 58   LEU A CA  1 
ATOM   3171  C  C   . LEU E  5  58   ? 44.945  95.774  116.279 1.00 92.84  ? 58   LEU A C   1 
ATOM   3172  O  O   . LEU E  5  58   ? 43.719  95.909  116.359 1.00 90.08  ? 58   LEU A O   1 
ATOM   3173  C  CB  . LEU E  5  58   ? 47.265  95.218  117.205 1.00 90.04  ? 58   LEU A CB  1 
ATOM   3174  C  CG  . LEU E  5  58   ? 48.059  94.620  118.375 1.00 90.76  ? 58   LEU A CG  1 
ATOM   3175  C  CD1 . LEU E  5  58   ? 49.573  94.664  118.131 1.00 93.37  ? 58   LEU A CD1 1 
ATOM   3176  C  CD2 . LEU E  5  58   ? 47.678  95.277  119.704 1.00 84.09  ? 58   LEU A CD2 1 
ATOM   3177  N  N   . ARG E  5  59   ? 45.591  96.035  115.152 1.00 93.49  ? 59   ARG A N   1 
ATOM   3178  C  CA  . ARG E  5  59   ? 44.817  96.565  114.041 1.00 88.29  ? 59   ARG A CA  1 
ATOM   3179  C  C   . ARG E  5  59   ? 44.324  95.471  113.088 1.00 81.12  ? 59   ARG A C   1 
ATOM   3180  O  O   . ARG E  5  59   ? 43.680  95.750  112.083 1.00 79.44  ? 59   ARG A O   1 
ATOM   3181  C  CB  . ARG E  5  59   ? 45.560  97.712  113.347 1.00 97.59  ? 59   ARG A CB  1 
ATOM   3182  C  CG  . ARG E  5  59   ? 45.910  98.822  114.342 1.00 104.39 ? 59   ARG A CG  1 
ATOM   3183  C  CD  . ARG E  5  59   ? 46.164  100.195 113.728 1.00 114.03 ? 59   ARG A CD  1 
ATOM   3184  N  NE  . ARG E  5  59   ? 47.381  100.740 114.261 1.00 123.04 ? 59   ARG A NE  1 
ATOM   3185  C  CZ  . ARG E  5  59   ? 47.632  101.712 115.139 1.00 131.20 ? 59   ARG A CZ  1 
ATOM   3186  N  NH1 . ARG E  5  59   ? 46.736  102.510 115.724 1.00 130.78 ? 59   ARG A NH1 1 
ATOM   3187  N  NH2 . ARG E  5  59   ? 48.913  101.882 115.396 1.00 134.35 ? 59   ARG A NH2 1 
ATOM   3188  N  N   . ASN E  5  60   ? 44.583  94.219  113.439 1.00 83.59  ? 60   ASN A N   1 
ATOM   3189  C  CA  . ASN E  5  60   ? 44.090  93.097  112.639 1.00 88.68  ? 60   ASN A CA  1 
ATOM   3190  C  C   . ASN E  5  60   ? 42.644  92.721  112.957 1.00 84.69  ? 60   ASN A C   1 
ATOM   3191  O  O   . ASN E  5  60   ? 42.161  92.938  114.065 1.00 83.31  ? 60   ASN A O   1 
ATOM   3192  C  CB  . ASN E  5  60   ? 44.989  91.870  112.812 1.00 85.64  ? 60   ASN A CB  1 
ATOM   3193  C  CG  . ASN E  5  60   ? 46.449  92.208  112.669 1.00 83.29  ? 60   ASN A CG  1 
ATOM   3194  O  OD1 . ASN E  5  60   ? 47.063  92.717  113.613 1.00 87.61  ? 60   ASN A OD1 1 
ATOM   3195  N  ND2 . ASN E  5  60   ? 47.019  91.943  111.483 1.00 74.83  ? 60   ASN A ND2 1 
ATOM   3196  N  N   . LEU E  5  61   ? 41.961  92.144  111.978 1.00 78.56  ? 61   LEU A N   1 
ATOM   3197  C  CA  . LEU E  5  61   ? 40.595  91.694  112.169 1.00 73.39  ? 61   LEU A CA  1 
ATOM   3198  C  C   . LEU E  5  61   ? 40.576  90.225  112.543 1.00 71.62  ? 61   LEU A C   1 
ATOM   3199  O  O   . LEU E  5  61   ? 41.421  89.454  112.103 1.00 80.60  ? 61   LEU A O   1 
ATOM   3200  C  CB  . LEU E  5  61   ? 39.798  91.889  110.884 1.00 82.02  ? 61   LEU A CB  1 
ATOM   3201  C  CG  . LEU E  5  61   ? 39.061  93.191  110.568 1.00 63.08  ? 61   LEU A CG  1 
ATOM   3202  C  CD1 . LEU E  5  61   ? 39.805  94.404  111.075 1.00 70.04  ? 61   LEU A CD1 1 
ATOM   3203  C  CD2 . LEU E  5  61   ? 38.873  93.264  109.071 1.00 65.03  ? 61   LEU A CD2 1 
ATOM   3204  N  N   . CYS E  5  62   ? 39.599  89.846  113.354 1.00 67.07  ? 62   CYS A N   1 
ATOM   3205  C  CA  . CYS E  5  62   ? 39.403  88.465  113.791 1.00 66.36  ? 62   CYS A CA  1 
ATOM   3206  C  C   . CYS E  5  62   ? 39.148  87.583  112.577 1.00 69.25  ? 62   CYS A C   1 
ATOM   3207  O  O   . CYS E  5  62   ? 38.367  87.936  111.710 1.00 73.78  ? 62   CYS A O   1 
ATOM   3208  C  CB  . CYS E  5  62   ? 38.229  88.426  114.791 1.00 64.88  ? 62   CYS A CB  1 
ATOM   3209  S  SG  . CYS E  5  62   ? 37.474  86.822  115.249 1.00 59.17  ? 62   CYS A SG  1 
ATOM   3210  N  N   . SER E  5  63   ? 39.839  86.455  112.501 1.00 74.28  ? 63   SER A N   1 
ATOM   3211  C  CA  . SER E  5  63   ? 39.697  85.531  111.383 1.00 59.99  ? 63   SER A CA  1 
ATOM   3212  C  C   . SER E  5  63   ? 38.512  84.615  111.571 1.00 69.38  ? 63   SER A C   1 
ATOM   3213  O  O   . SER E  5  63   ? 38.199  83.854  110.686 1.00 60.47  ? 63   SER A O   1 
ATOM   3214  C  CB  . SER E  5  63   ? 40.927  84.656  111.277 1.00 63.79  ? 63   SER A CB  1 
ATOM   3215  O  OG  . SER E  5  63   ? 42.080  85.454  111.252 1.00 74.10  ? 63   SER A OG  1 
ATOM   3216  N  N   . THR E  5  64   ? 37.864  84.652  112.729 1.00 64.28  ? 64   THR A N   1 
ATOM   3217  C  CA  . THR E  5  64   ? 36.761  83.734  112.961 1.00 59.89  ? 64   THR A CA  1 
ATOM   3218  C  C   . THR E  5  64   ? 35.412  84.404  112.686 1.00 67.25  ? 64   THR A C   1 
ATOM   3219  O  O   . THR E  5  64   ? 34.528  83.800  112.089 1.00 66.67  ? 64   THR A O   1 
ATOM   3220  C  CB  . THR E  5  64   ? 36.810  83.125  114.377 1.00 58.67  ? 64   THR A CB  1 
ATOM   3221  O  OG1 . THR E  5  64   ? 38.035  82.398  114.545 1.00 58.20  ? 64   THR A OG1 1 
ATOM   3222  C  CG2 . THR E  5  64   ? 35.627  82.186  114.612 1.00 58.89  ? 64   THR A CG2 1 
ATOM   3223  N  N   . CYS E  5  65   ? 35.271  85.662  113.094 1.00 71.76  ? 65   CYS A N   1 
ATOM   3224  C  CA  . CYS E  5  65   ? 34.017  86.398  112.934 1.00 70.77  ? 65   CYS A CA  1 
ATOM   3225  C  C   . CYS E  5  65   ? 34.182  87.574  111.990 1.00 81.13  ? 65   CYS A C   1 
ATOM   3226  O  O   . CYS E  5  65   ? 33.202  88.088  111.457 1.00 87.02  ? 65   CYS A O   1 
ATOM   3227  C  CB  . CYS E  5  65   ? 33.480  86.902  114.288 1.00 61.93  ? 65   CYS A CB  1 
ATOM   3228  S  SG  . CYS E  5  65   ? 34.720  87.631  115.414 1.00 55.24  ? 65   CYS A SG  1 
ATOM   3229  N  N   . GLY E  5  66   ? 35.417  88.013  111.797 1.00 59.52  ? 66   GLY A N   1 
ATOM   3230  C  CA  . GLY E  5  66   ? 35.677  89.135  110.919 1.00 60.91  ? 66   GLY A CA  1 
ATOM   3231  C  C   . GLY E  5  66   ? 35.578  90.516  111.544 1.00 72.49  ? 66   GLY A C   1 
ATOM   3232  O  O   . GLY E  5  66   ? 35.921  91.515  110.908 1.00 73.10  ? 66   GLY A O   1 
ATOM   3233  N  N   . LEU E  5  67   ? 35.116  90.583  112.788 1.00 66.98  ? 67   LEU A N   1 
ATOM   3234  C  CA  . LEU E  5  67   ? 34.960  91.865  113.461 1.00 66.67  ? 67   LEU A CA  1 
ATOM   3235  C  C   . LEU E  5  67   ? 36.294  92.419  113.974 1.00 66.61  ? 67   LEU A C   1 
ATOM   3236  O  O   . LEU E  5  67   ? 37.267  91.686  114.058 1.00 63.90  ? 67   LEU A O   1 
ATOM   3237  C  CB  . LEU E  5  67   ? 33.952  91.723  114.592 1.00 64.80  ? 67   LEU A CB  1 
ATOM   3238  C  CG  . LEU E  5  67   ? 32.628  91.184  114.070 1.00 64.45  ? 67   LEU A CG  1 
ATOM   3239  C  CD1 . LEU E  5  67   ? 31.621  91.061  115.179 1.00 56.61  ? 67   LEU A CD1 1 
ATOM   3240  C  CD2 . LEU E  5  67   ? 32.100  92.077  112.939 1.00 61.85  ? 67   LEU A CD2 1 
ATOM   3241  N  N   . ASP E  5  68   ? 36.354  93.710  114.302 1.00 68.40  ? 68   ASP A N   1 
ATOM   3242  C  CA  . ASP E  5  68   ? 37.614  94.279  114.792 1.00 67.68  ? 68   ASP A CA  1 
ATOM   3243  C  C   . ASP E  5  68   ? 37.756  94.261  116.326 1.00 67.20  ? 68   ASP A C   1 
ATOM   3244  O  O   . ASP E  5  68   ? 36.876  93.782  117.044 1.00 62.24  ? 68   ASP A O   1 
ATOM   3245  C  CB  . ASP E  5  68   ? 37.860  95.680  114.227 1.00 75.70  ? 68   ASP A CB  1 
ATOM   3246  C  CG  . ASP E  5  68   ? 36.835  96.718  114.711 1.00 85.33  ? 68   ASP A CG  1 
ATOM   3247  O  OD1 . ASP E  5  68   ? 36.367  96.639  115.865 1.00 87.49  ? 68   ASP A OD1 1 
ATOM   3248  O  OD2 . ASP E  5  68   ? 36.504  97.636  113.929 1.00 85.79  ? 68   ASP A OD2 1 
ATOM   3249  N  N   . GLU E  5  69   ? 38.862  94.814  116.816 1.00 70.89  ? 69   GLU A N   1 
ATOM   3250  C  CA  . GLU E  5  69   ? 39.241  94.712  118.220 1.00 69.02  ? 69   GLU A CA  1 
ATOM   3251  C  C   . GLU E  5  69   ? 38.145  95.180  119.185 1.00 70.07  ? 69   GLU A C   1 
ATOM   3252  O  O   . GLU E  5  69   ? 38.179  94.888  120.381 1.00 80.19  ? 69   GLU A O   1 
ATOM   3253  C  CB  . GLU E  5  69   ? 40.541  95.483  118.450 1.00 82.43  ? 69   GLU A CB  1 
ATOM   3254  C  CG  . GLU E  5  69   ? 41.410  94.892  119.539 1.00 107.31 ? 69   GLU A CG  1 
ATOM   3255  C  CD  . GLU E  5  69   ? 42.802  95.504  119.587 1.00 130.13 ? 69   GLU A CD  1 
ATOM   3256  O  OE1 . GLU E  5  69   ? 42.956  96.669  119.131 1.00 137.89 ? 69   GLU A OE1 1 
ATOM   3257  O  OE2 . GLU E  5  69   ? 43.735  94.811  120.080 1.00 132.72 ? 69   GLU A OE2 1 
ATOM   3258  N  N   . LYS E  5  70   ? 37.157  95.883  118.651 1.00 70.72  ? 70   LYS A N   1 
ATOM   3259  C  CA  . LYS E  5  70   ? 36.101  96.477  119.460 1.00 73.16  ? 70   LYS A CA  1 
ATOM   3260  C  C   . LYS E  5  70   ? 34.833  95.623  119.531 1.00 72.67  ? 70   LYS A C   1 
ATOM   3261  O  O   . LYS E  5  70   ? 34.265  95.457  120.602 1.00 81.39  ? 70   LYS A O   1 
ATOM   3262  C  CB  . LYS E  5  70   ? 35.775  97.879  118.936 1.00 91.17  ? 70   LYS A CB  1 
ATOM   3263  C  CG  . LYS E  5  70   ? 34.625  98.568  119.645 1.00 101.83 ? 70   LYS A CG  1 
ATOM   3264  C  CD  . LYS E  5  70   ? 34.316  99.918  119.020 1.00 105.54 ? 70   LYS A CD  1 
ATOM   3265  C  CE  . LYS E  5  70   ? 33.068  100.530 119.637 1.00 107.78 ? 70   LYS A CE  1 
ATOM   3266  N  NZ  . LYS E  5  70   ? 32.770  101.859 119.035 1.00 112.70 ? 70   LYS A NZ  1 
ATOM   3267  N  N   . PHE E  5  71   ? 34.400  95.072  118.401 1.00 71.16  ? 71   PHE A N   1 
ATOM   3268  C  CA  . PHE E  5  71   ? 33.166  94.277  118.348 1.00 72.31  ? 71   PHE A CA  1 
ATOM   3269  C  C   . PHE E  5  71   ? 33.397  92.760  118.364 1.00 70.58  ? 71   PHE A C   1 
ATOM   3270  O  O   . PHE E  5  71   ? 32.441  91.975  118.358 1.00 73.66  ? 71   PHE A O   1 
ATOM   3271  C  CB  . PHE E  5  71   ? 32.353  94.622  117.101 1.00 82.18  ? 71   PHE A CB  1 
ATOM   3272  C  CG  . PHE E  5  71   ? 31.686  95.970  117.149 1.00 89.05  ? 71   PHE A CG  1 
ATOM   3273  C  CD1 . PHE E  5  71   ? 32.432  97.140  117.156 1.00 87.42  ? 71   PHE A CD1 1 
ATOM   3274  C  CD2 . PHE E  5  71   ? 30.305  96.065  117.143 1.00 95.49  ? 71   PHE A CD2 1 
ATOM   3275  C  CE1 . PHE E  5  71   ? 31.811  98.372  117.195 1.00 87.27  ? 71   PHE A CE1 1 
ATOM   3276  C  CE2 . PHE E  5  71   ? 29.678  97.301  117.174 1.00 98.62  ? 71   PHE A CE2 1 
ATOM   3277  C  CZ  . PHE E  5  71   ? 30.433  98.455  117.204 1.00 93.91  ? 71   PHE A CZ  1 
ATOM   3278  N  N   . CYS E  5  72   ? 34.656  92.341  118.365 1.00 63.95  ? 72   CYS A N   1 
ATOM   3279  C  CA  . CYS E  5  72   ? 34.953  90.921  118.368 1.00 53.11  ? 72   CYS A CA  1 
ATOM   3280  C  C   . CYS E  5  72   ? 35.088  90.414  119.795 1.00 55.61  ? 72   CYS A C   1 
ATOM   3281  O  O   . CYS E  5  72   ? 35.932  90.895  120.557 1.00 51.87  ? 72   CYS A O   1 
ATOM   3282  C  CB  . CYS E  5  72   ? 36.242  90.637  117.605 1.00 53.84  ? 72   CYS A CB  1 
ATOM   3283  S  SG  . CYS E  5  72   ? 36.850  88.913  117.819 1.00 61.70  ? 72   CYS A SG  1 
ATOM   3284  N  N   . PRO E  5  73   ? 34.274  89.418  120.158 1.00 53.39  ? 73   PRO A N   1 
ATOM   3285  C  CA  . PRO E  5  73   ? 34.152  89.024  121.555 1.00 49.64  ? 73   PRO A CA  1 
ATOM   3286  C  C   . PRO E  5  73   ? 35.309  88.153  121.948 1.00 54.99  ? 73   PRO A C   1 
ATOM   3287  O  O   . PRO E  5  73   ? 35.484  87.906  123.144 1.00 56.92  ? 73   PRO A O   1 
ATOM   3288  C  CB  . PRO E  5  73   ? 32.882  88.191  121.554 1.00 49.44  ? 73   PRO A CB  1 
ATOM   3289  C  CG  . PRO E  5  73   ? 32.900  87.548  120.220 1.00 50.47  ? 73   PRO A CG  1 
ATOM   3290  C  CD  . PRO E  5  73   ? 33.417  88.601  119.287 1.00 51.55  ? 73   PRO A CD  1 
ATOM   3291  N  N   . GLY E  5  74   ? 36.073  87.687  120.961 1.00 56.62  ? 74   GLY A N   1 
ATOM   3292  C  CA  . GLY E  5  74   ? 37.143  86.726  121.207 1.00 60.33  ? 74   GLY A CA  1 
ATOM   3293  C  C   . GLY E  5  74   ? 36.629  85.304  121.103 1.00 60.46  ? 74   GLY A C   1 
ATOM   3294  O  O   . GLY E  5  74   ? 35.435  85.053  121.264 1.00 64.35  ? 74   GLY A O   1 
ATOM   3295  N  N   . HIS E  5  75   ? 37.520  84.361  120.830 1.00 55.28  ? 75   HIS A N   1 
ATOM   3296  C  CA  . HIS E  5  75   ? 37.108  82.969  120.686 1.00 54.24  ? 75   HIS A CA  1 
ATOM   3297  C  C   . HIS E  5  75   ? 38.143  82.075  121.304 1.00 53.96  ? 75   HIS A C   1 
ATOM   3298  O  O   . HIS E  5  75   ? 39.329  82.403  121.274 1.00 59.40  ? 75   HIS A O   1 
ATOM   3299  C  CB  . HIS E  5  75   ? 36.986  82.637  119.215 1.00 51.06  ? 75   HIS A CB  1 
ATOM   3300  C  CG  . HIS E  5  75   ? 36.243  83.667  118.438 1.00 56.60  ? 75   HIS A CG  1 
ATOM   3301  N  ND1 . HIS E  5  75   ? 34.881  83.838  118.554 1.00 58.62  ? 75   HIS A ND1 1 
ATOM   3302  C  CD2 . HIS E  5  75   ? 36.668  84.595  117.550 1.00 57.48  ? 75   HIS A CD2 1 
ATOM   3303  C  CE1 . HIS E  5  75   ? 34.499  84.821  117.758 1.00 61.65  ? 75   HIS A CE1 1 
ATOM   3304  N  NE2 . HIS E  5  75   ? 35.562  85.294  117.132 1.00 58.76  ? 75   HIS A NE2 1 
ATOM   3305  N  N   . GLN E  5  76   ? 37.731  80.947  121.872 1.00 49.43  ? 76   GLN A N   1 
ATOM   3306  C  CA  . GLN E  5  76   ? 38.742  80.121  122.529 1.00 48.70  ? 76   GLN A CA  1 
ATOM   3307  C  C   . GLN E  5  76   ? 39.319  79.099  121.573 1.00 51.02  ? 76   GLN A C   1 
ATOM   3308  O  O   . GLN E  5  76   ? 38.660  78.676  120.615 1.00 57.70  ? 76   GLN A O   1 
ATOM   3309  C  CB  . GLN E  5  76   ? 38.278  79.521  123.878 1.00 50.77  ? 76   GLN A CB  1 
ATOM   3310  C  CG  . GLN E  5  76   ? 36.811  79.192  124.011 1.00 57.35  ? 76   GLN A CG  1 
ATOM   3311  C  CD  . GLN E  5  76   ? 36.350  79.076  125.462 1.00 62.54  ? 76   GLN A CD  1 
ATOM   3312  O  OE1 . GLN E  5  76   ? 36.907  79.711  126.371 1.00 58.00  ? 76   GLN A OE1 1 
ATOM   3313  N  NE2 . GLN E  5  76   ? 35.313  78.267  125.684 1.00 66.83  ? 76   GLN A NE2 1 
ATOM   3314  N  N   . GLY E  5  77   ? 40.583  78.772  121.802 1.00 51.04  ? 77   GLY A N   1 
ATOM   3315  C  CA  . GLY E  5  77   ? 41.244  77.691  121.090 1.00 59.57  ? 77   GLY A CA  1 
ATOM   3316  C  C   . GLY E  5  77   ? 41.737  76.675  122.093 1.00 50.39  ? 77   GLY A C   1 
ATOM   3317  O  O   . GLY E  5  77   ? 41.436  76.764  123.264 1.00 75.07  ? 77   GLY A O   1 
ATOM   3318  N  N   . HIS E  5  78   ? 42.518  75.711  121.658 1.00 57.67  ? 78   HIS A N   1 
ATOM   3319  C  CA  . HIS E  5  78   ? 42.969  74.699  122.590 1.00 57.09  ? 78   HIS A CA  1 
ATOM   3320  C  C   . HIS E  5  78   ? 44.378  74.252  122.280 1.00 63.16  ? 78   HIS A C   1 
ATOM   3321  O  O   . HIS E  5  78   ? 44.813  74.355  121.146 1.00 52.92  ? 78   HIS A O   1 
ATOM   3322  C  CB  . HIS E  5  78   ? 42.018  73.507  122.572 1.00 54.75  ? 78   HIS A CB  1 
ATOM   3323  C  CG  . HIS E  5  78   ? 42.197  72.595  121.396 1.00 56.31  ? 78   HIS A CG  1 
ATOM   3324  N  ND1 . HIS E  5  78   ? 41.915  72.980  120.104 1.00 60.01  ? 78   HIS A ND1 1 
ATOM   3325  C  CD2 . HIS E  5  78   ? 42.595  71.300  121.323 1.00 58.53  ? 78   HIS A CD2 1 
ATOM   3326  C  CE1 . HIS E  5  78   ? 42.152  71.969  119.282 1.00 61.12  ? 78   HIS A CE1 1 
ATOM   3327  N  NE2 . HIS E  5  78   ? 42.556  70.933  119.998 1.00 57.53  ? 78   HIS A NE2 1 
ATOM   3328  N  N   . ILE E  5  79   ? 45.091  73.804  123.308 1.00 51.66  ? 79   ILE A N   1 
ATOM   3329  C  CA  . ILE E  5  79   ? 46.360  73.118  123.129 1.00 52.64  ? 79   ILE A CA  1 
ATOM   3330  C  C   . ILE E  5  79   ? 46.129  71.613  123.315 1.00 63.94  ? 79   ILE A C   1 
ATOM   3331  O  O   . ILE E  5  79   ? 45.351  71.191  124.175 1.00 61.15  ? 79   ILE A O   1 
ATOM   3332  C  CB  . ILE E  5  79   ? 47.401  73.605  124.136 1.00 52.35  ? 79   ILE A CB  1 
ATOM   3333  C  CG1 . ILE E  5  79   ? 47.764  75.055  123.854 1.00 52.25  ? 79   ILE A CG1 1 
ATOM   3334  C  CG2 . ILE E  5  79   ? 48.647  72.760  124.064 1.00 53.43  ? 79   ILE A CG2 1 
ATOM   3335  C  CD1 . ILE E  5  79   ? 48.604  75.691  124.941 1.00 51.88  ? 79   ILE A CD1 1 
ATOM   3336  N  N   . GLU E  5  80   ? 46.782  70.802  122.490 1.00 64.80  ? 80   GLU A N   1 
ATOM   3337  C  CA  . GLU E  5  80   ? 46.708  69.348  122.628 1.00 59.81  ? 80   GLU A CA  1 
ATOM   3338  C  C   . GLU E  5  80   ? 47.844  68.845  123.491 1.00 57.57  ? 80   GLU A C   1 
ATOM   3339  O  O   . GLU E  5  80   ? 48.998  68.885  123.079 1.00 65.33  ? 80   GLU A O   1 
ATOM   3340  C  CB  . GLU E  5  80   ? 46.785  68.665  121.259 1.00 56.27  ? 80   GLU A CB  1 
ATOM   3341  C  CG  . GLU E  5  80   ? 45.505  68.686  120.431 1.00 56.28  ? 80   GLU A CG  1 
ATOM   3342  C  CD  . GLU E  5  80   ? 44.419  67.734  120.963 1.00 68.60  ? 80   GLU A CD  1 
ATOM   3343  O  OE1 . GLU E  5  80   ? 44.648  67.016  121.977 1.00 67.74  ? 80   GLU A OE1 1 
ATOM   3344  O  OE2 . GLU E  5  80   ? 43.323  67.716  120.354 1.00 61.06  ? 80   GLU A OE2 1 
ATOM   3345  N  N   . LEU E  5  81   ? 47.517  68.385  124.691 1.00 57.83  ? 81   LEU A N   1 
ATOM   3346  C  CA  . LEU E  5  81   ? 48.509  67.791  125.578 1.00 60.75  ? 81   LEU A CA  1 
ATOM   3347  C  C   . LEU E  5  81   ? 48.813  66.369  125.115 1.00 61.51  ? 81   LEU A C   1 
ATOM   3348  O  O   . LEU E  5  81   ? 47.908  65.527  125.059 1.00 61.62  ? 81   LEU A O   1 
ATOM   3349  C  CB  . LEU E  5  81   ? 48.017  67.790  127.024 1.00 57.26  ? 81   LEU A CB  1 
ATOM   3350  C  CG  . LEU E  5  81   ? 47.933  69.166  127.674 1.00 57.08  ? 81   LEU A CG  1 
ATOM   3351  C  CD1 . LEU E  5  81   ? 47.400  69.037  129.090 1.00 56.61  ? 81   LEU A CD1 1 
ATOM   3352  C  CD2 . LEU E  5  81   ? 49.302  69.847  127.650 1.00 57.26  ? 81   LEU A CD2 1 
ATOM   3353  N  N   . PRO E  5  82   ? 50.090  66.102  124.783 1.00 59.07  ? 82   PRO A N   1 
ATOM   3354  C  CA  . PRO E  5  82   ? 50.541  64.865  124.142 1.00 58.93  ? 82   PRO A CA  1 
ATOM   3355  C  C   . PRO E  5  82   ? 50.447  63.682  125.095 1.00 68.77  ? 82   PRO A C   1 
ATOM   3356  O  O   . PRO E  5  82   ? 50.650  62.554  124.715 1.00 60.42  ? 82   PRO A O   1 
ATOM   3357  C  CB  . PRO E  5  82   ? 52.001  65.162  123.825 1.00 73.86  ? 82   PRO A CB  1 
ATOM   3358  C  CG  . PRO E  5  82   ? 52.417  66.108  124.882 1.00 75.76  ? 82   PRO A CG  1 
ATOM   3359  C  CD  . PRO E  5  82   ? 51.222  66.967  125.154 1.00 66.38  ? 82   PRO A CD  1 
ATOM   3360  N  N   . VAL E  5  83   ? 50.092  63.954  126.335 1.00 71.00  ? 83   VAL A N   1 
ATOM   3361  C  CA  . VAL E  5  83   ? 50.093  62.948  127.370 1.00 68.43  ? 83   VAL A CA  1 
ATOM   3362  C  C   . VAL E  5  83   ? 49.174  63.490  128.469 1.00 72.30  ? 83   VAL A C   1 
ATOM   3363  O  O   . VAL E  5  83   ? 49.212  64.678  128.771 1.00 69.76  ? 83   VAL A O   1 
ATOM   3364  C  CB  . VAL E  5  83   ? 51.537  62.747  127.849 1.00 66.91  ? 83   VAL A CB  1 
ATOM   3365  C  CG1 . VAL E  5  83   ? 51.669  62.948  129.339 1.00 72.89  ? 83   VAL A CG1 1 
ATOM   3366  C  CG2 . VAL E  5  83   ? 52.036  61.398  127.441 1.00 61.15  ? 83   VAL A CG2 1 
ATOM   3367  N  N   . PRO E  5  84   ? 48.318  62.633  129.047 1.00 68.50  ? 84   PRO A N   1 
ATOM   3368  C  CA  . PRO E  5  84   ? 47.329  63.097  130.031 1.00 63.35  ? 84   PRO A CA  1 
ATOM   3369  C  C   . PRO E  5  84   ? 47.978  63.690  131.275 1.00 64.38  ? 84   PRO A C   1 
ATOM   3370  O  O   . PRO E  5  84   ? 48.990  63.191  131.770 1.00 67.97  ? 84   PRO A O   1 
ATOM   3371  C  CB  . PRO E  5  84   ? 46.582  61.820  130.422 1.00 55.85  ? 84   PRO A CB  1 
ATOM   3372  C  CG  . PRO E  5  84   ? 46.966  60.807  129.398 1.00 67.77  ? 84   PRO A CG  1 
ATOM   3373  C  CD  . PRO E  5  84   ? 48.323  61.172  128.919 1.00 66.03  ? 84   PRO A CD  1 
ATOM   3374  N  N   . CYS E  5  85   ? 47.388  64.759  131.787 1.00 61.96  ? 85   CYS A N   1 
ATOM   3375  C  CA  . CYS E  5  85   ? 47.868  65.341  133.024 1.00 54.12  ? 85   CYS A CA  1 
ATOM   3376  C  C   . CYS E  5  85   ? 46.745  65.352  134.057 1.00 58.41  ? 85   CYS A C   1 
ATOM   3377  O  O   . CYS E  5  85   ? 45.559  65.443  133.697 1.00 62.77  ? 85   CYS A O   1 
ATOM   3378  C  CB  . CYS E  5  85   ? 48.374  66.756  132.779 1.00 52.51  ? 85   CYS A CB  1 
ATOM   3379  S  SG  . CYS E  5  85   ? 49.758  66.962  131.602 1.00 64.24  ? 85   CYS A SG  1 
ATOM   3380  N  N   . TYR E  5  86   ? 47.110  65.241  135.336 1.00 52.21  ? 86   TYR A N   1 
ATOM   3381  C  CA  . TYR E  5  86   ? 46.130  65.408  136.401 1.00 56.43  ? 86   TYR A CA  1 
ATOM   3382  C  C   . TYR E  5  86   ? 45.689  66.857  136.375 1.00 56.30  ? 86   TYR A C   1 
ATOM   3383  O  O   . TYR E  5  86   ? 46.519  67.734  136.221 1.00 50.07  ? 86   TYR A O   1 
ATOM   3384  C  CB  . TYR E  5  86   ? 46.728  65.125  137.778 1.00 51.78  ? 86   TYR A CB  1 
ATOM   3385  C  CG  . TYR E  5  86   ? 47.456  63.819  137.911 1.00 55.40  ? 86   TYR A CG  1 
ATOM   3386  C  CD1 . TYR E  5  86   ? 46.785  62.594  137.839 1.00 57.25  ? 86   TYR A CD1 1 
ATOM   3387  C  CD2 . TYR E  5  86   ? 48.826  63.798  138.138 1.00 55.36  ? 86   TYR A CD2 1 
ATOM   3388  C  CE1 . TYR E  5  86   ? 47.483  61.374  137.968 1.00 62.84  ? 86   TYR A CE1 1 
ATOM   3389  C  CE2 . TYR E  5  86   ? 49.517  62.595  138.263 1.00 64.50  ? 86   TYR A CE2 1 
ATOM   3390  C  CZ  . TYR E  5  86   ? 48.842  61.390  138.181 1.00 56.09  ? 86   TYR A CZ  1 
ATOM   3391  O  OH  . TYR E  5  86   ? 49.556  60.217  138.318 1.00 65.49  ? 86   TYR A OH  1 
ATOM   3392  N  N   . ASN E  5  87   ? 44.391  67.111  136.513 1.00 65.75  ? 87   ASN A N   1 
ATOM   3393  C  CA  . ASN E  5  87   ? 43.915  68.474  136.698 1.00 48.16  ? 87   ASN A CA  1 
ATOM   3394  C  C   . ASN E  5  87   ? 44.228  68.819  138.124 1.00 55.39  ? 87   ASN A C   1 
ATOM   3395  O  O   . ASN E  5  87   ? 43.704  68.206  139.043 1.00 67.35  ? 87   ASN A O   1 
ATOM   3396  C  CB  . ASN E  5  87   ? 42.415  68.588  136.442 1.00 52.23  ? 87   ASN A CB  1 
ATOM   3397  C  CG  . ASN E  5  87   ? 41.899  70.031  136.576 1.00 55.48  ? 87   ASN A CG  1 
ATOM   3398  O  OD1 . ASN E  5  87   ? 42.458  70.843  137.314 1.00 47.55  ? 87   ASN A OD1 1 
ATOM   3399  N  ND2 . ASN E  5  87   ? 40.823  70.342  135.867 1.00 55.42  ? 87   ASN A ND2 1 
ATOM   3400  N  N   . PRO E  5  88   ? 45.103  69.793  138.315 1.00 50.12  ? 88   PRO A N   1 
ATOM   3401  C  CA  . PRO E  5  88   ? 45.581  70.141  139.661 1.00 51.12  ? 88   PRO A CA  1 
ATOM   3402  C  C   . PRO E  5  88   ? 44.468  70.531  140.644 1.00 53.00  ? 88   PRO A C   1 
ATOM   3403  O  O   . PRO E  5  88   ? 44.609  70.252  141.838 1.00 51.36  ? 88   PRO A O   1 
ATOM   3404  C  CB  . PRO E  5  88   ? 46.535  71.312  139.412 1.00 53.47  ? 88   PRO A CB  1 
ATOM   3405  C  CG  . PRO E  5  88   ? 46.210  71.803  138.011 1.00 64.18  ? 88   PRO A CG  1 
ATOM   3406  C  CD  . PRO E  5  88   ? 45.697  70.620  137.255 1.00 47.88  ? 88   PRO A CD  1 
ATOM   3407  N  N   . LEU E  5  89   ? 43.390  71.154  140.159 1.00 53.36  ? 89   LEU A N   1 
ATOM   3408  C  CA  . LEU E  5  89   ? 42.267  71.519  141.025 1.00 55.30  ? 89   LEU A CA  1 
ATOM   3409  C  C   . LEU E  5  89   ? 41.614  70.315  141.690 1.00 57.72  ? 89   LEU A C   1 
ATOM   3410  O  O   . LEU E  5  89   ? 41.074  70.423  142.787 1.00 64.16  ? 89   LEU A O   1 
ATOM   3411  C  CB  . LEU E  5  89   ? 41.188  72.281  140.255 1.00 61.76  ? 89   LEU A CB  1 
ATOM   3412  C  CG  . LEU E  5  89   ? 41.458  73.737  139.883 1.00 62.72  ? 89   LEU A CG  1 
ATOM   3413  C  CD1 . LEU E  5  89   ? 40.278  74.308  139.116 1.00 62.61  ? 89   LEU A CD1 1 
ATOM   3414  C  CD2 . LEU E  5  89   ? 41.746  74.543  141.119 1.00 55.09  ? 89   LEU A CD2 1 
ATOM   3415  N  N   . PHE E  5  90   ? 41.653  69.173  141.020 1.00 56.45  ? 90   PHE A N   1 
ATOM   3416  C  CA  . PHE E  5  90   ? 40.954  67.986  141.499 1.00 60.15  ? 90   PHE A CA  1 
ATOM   3417  C  C   . PHE E  5  90   ? 41.878  66.862  141.994 1.00 59.92  ? 90   PHE A C   1 
ATOM   3418  O  O   . PHE E  5  90   ? 41.406  65.792  142.397 1.00 56.91  ? 90   PHE A O   1 
ATOM   3419  C  CB  . PHE E  5  90   ? 40.026  67.469  140.405 1.00 60.45  ? 90   PHE A CB  1 
ATOM   3420  C  CG  . PHE E  5  90   ? 39.116  68.519  139.856 1.00 63.11  ? 90   PHE A CG  1 
ATOM   3421  C  CD1 . PHE E  5  90   ? 38.179  69.134  140.674 1.00 65.12  ? 90   PHE A CD1 1 
ATOM   3422  C  CD2 . PHE E  5  90   ? 39.188  68.892  138.528 1.00 61.73  ? 90   PHE A CD2 1 
ATOM   3423  C  CE1 . PHE E  5  90   ? 37.327  70.102  140.182 1.00 60.52  ? 90   PHE A CE1 1 
ATOM   3424  C  CE2 . PHE E  5  90   ? 38.340  69.865  138.029 1.00 60.55  ? 90   PHE A CE2 1 
ATOM   3425  C  CZ  . PHE E  5  90   ? 37.406  70.470  138.864 1.00 59.72  ? 90   PHE A CZ  1 
ATOM   3426  N  N   . PHE E  5  91   ? 43.184  67.116  141.994 1.00 53.25  ? 91   PHE A N   1 
ATOM   3427  C  CA  . PHE E  5  91   ? 44.152  66.079  142.327 1.00 55.75  ? 91   PHE A CA  1 
ATOM   3428  C  C   . PHE E  5  91   ? 43.942  65.461  143.704 1.00 59.66  ? 91   PHE A C   1 
ATOM   3429  O  O   . PHE E  5  91   ? 44.259  64.302  143.892 1.00 63.32  ? 91   PHE A O   1 
ATOM   3430  C  CB  . PHE E  5  91   ? 45.584  66.599  142.202 1.00 53.88  ? 91   PHE A CB  1 
ATOM   3431  C  CG  . PHE E  5  91   ? 46.634  65.553  142.437 1.00 53.67  ? 91   PHE A CG  1 
ATOM   3432  C  CD1 . PHE E  5  91   ? 46.982  64.666  141.434 1.00 60.05  ? 91   PHE A CD1 1 
ATOM   3433  C  CD2 . PHE E  5  91   ? 47.278  65.460  143.650 1.00 57.33  ? 91   PHE A CD2 1 
ATOM   3434  C  CE1 . PHE E  5  91   ? 47.954  63.719  141.640 1.00 64.75  ? 91   PHE A CE1 1 
ATOM   3435  C  CE2 . PHE E  5  91   ? 48.253  64.508  143.859 1.00 53.61  ? 91   PHE A CE2 1 
ATOM   3436  C  CZ  . PHE E  5  91   ? 48.589  63.642  142.857 1.00 66.47  ? 91   PHE A CZ  1 
ATOM   3437  N  N   . ASN E  5  92   ? 43.414  66.218  144.663 1.00 54.88  ? 92   ASN A N   1 
ATOM   3438  C  CA  . ASN E  5  92   ? 43.214  65.653  145.991 1.00 53.82  ? 92   ASN A CA  1 
ATOM   3439  C  C   . ASN E  5  92   ? 42.124  64.607  145.991 1.00 59.50  ? 92   ASN A C   1 
ATOM   3440  O  O   . ASN E  5  92   ? 42.259  63.559  146.630 1.00 67.94  ? 92   ASN A O   1 
ATOM   3441  C  CB  . ASN E  5  92   ? 42.908  66.726  147.026 1.00 53.48  ? 92   ASN A CB  1 
ATOM   3442  C  CG  . ASN E  5  92   ? 44.107  67.560  147.355 1.00 68.54  ? 92   ASN A CG  1 
ATOM   3443  O  OD1 . ASN E  5  92   ? 45.243  67.112  147.216 1.00 77.39  ? 92   ASN A OD1 1 
ATOM   3444  N  ND2 . ASN E  5  92   ? 43.870  68.789  147.787 1.00 79.57  ? 92   ASN A ND2 1 
ATOM   3445  N  N   . GLN E  5  93   ? 41.047  64.890  145.269 1.00 58.62  ? 93   GLN A N   1 
ATOM   3446  C  CA  . GLN E  5  93   ? 39.939  63.953  145.173 1.00 56.16  ? 93   GLN A CA  1 
ATOM   3447  C  C   . GLN E  5  93   ? 40.335  62.712  144.406 1.00 55.17  ? 93   GLN A C   1 
ATOM   3448  O  O   . GLN E  5  93   ? 40.000  61.601  144.813 1.00 60.28  ? 93   GLN A O   1 
ATOM   3449  C  CB  . GLN E  5  93   ? 38.746  64.619  144.534 1.00 48.69  ? 93   GLN A CB  1 
ATOM   3450  C  CG  . GLN E  5  93   ? 38.210  65.695  145.424 1.00 65.34  ? 93   GLN A CG  1 
ATOM   3451  C  CD  . GLN E  5  93   ? 37.285  65.141  146.476 1.00 67.47  ? 93   GLN A CD  1 
ATOM   3452  O  OE1 . GLN E  5  93   ? 36.403  64.303  146.186 1.00 74.74  ? 93   GLN A OE1 1 
ATOM   3453  N  NE2 . GLN E  5  93   ? 37.479  65.589  147.715 1.00 58.56  ? 93   GLN A NE2 1 
ATOM   3454  N  N   . LEU E  5  94   ? 41.054  62.905  143.303 1.00 54.37  ? 94   LEU A N   1 
ATOM   3455  C  CA  . LEU E  5  94   ? 41.627  61.790  142.581 1.00 59.33  ? 94   LEU A CA  1 
ATOM   3456  C  C   . LEU E  5  94   ? 42.417  60.916  143.562 1.00 59.05  ? 94   LEU A C   1 
ATOM   3457  O  O   . LEU E  5  94   ? 42.223  59.705  143.621 1.00 60.37  ? 94   LEU A O   1 
ATOM   3458  C  CB  . LEU E  5  94   ? 42.502  62.282  141.424 1.00 51.72  ? 94   LEU A CB  1 
ATOM   3459  C  CG  . LEU E  5  94   ? 43.267  61.220  140.630 1.00 52.96  ? 94   LEU A CG  1 
ATOM   3460  C  CD1 . LEU E  5  94   ? 43.431  61.650  139.206 1.00 54.85  ? 94   LEU A CD1 1 
ATOM   3461  C  CD2 . LEU E  5  94   ? 44.632  61.000  141.234 1.00 75.70  ? 94   LEU A CD2 1 
ATOM   3462  N  N   . TYR E  5  95   ? 43.282  61.544  144.346 1.00 53.09  ? 95   TYR A N   1 
ATOM   3463  C  CA  . TYR E  5  95   ? 44.086  60.838  145.337 1.00 64.14  ? 95   TYR A CA  1 
ATOM   3464  C  C   . TYR E  5  95   ? 43.240  59.979  146.259 1.00 65.87  ? 95   TYR A C   1 
ATOM   3465  O  O   . TYR E  5  95   ? 43.594  58.832  146.526 1.00 66.05  ? 95   TYR A O   1 
ATOM   3466  C  CB  . TYR E  5  95   ? 44.875  61.819  146.191 1.00 63.00  ? 95   TYR A CB  1 
ATOM   3467  C  CG  . TYR E  5  95   ? 46.030  61.210  146.948 1.00 64.82  ? 95   TYR A CG  1 
ATOM   3468  C  CD1 . TYR E  5  95   ? 46.948  60.397  146.311 1.00 66.37  ? 95   TYR A CD1 1 
ATOM   3469  C  CD2 . TYR E  5  95   ? 46.226  61.488  148.287 1.00 70.14  ? 95   TYR A CD2 1 
ATOM   3470  C  CE1 . TYR E  5  95   ? 48.022  59.867  146.988 1.00 70.49  ? 95   TYR A CE1 1 
ATOM   3471  C  CE2 . TYR E  5  95   ? 47.295  60.960  148.978 1.00 72.34  ? 95   TYR A CE2 1 
ATOM   3472  C  CZ  . TYR E  5  95   ? 48.193  60.150  148.325 1.00 75.77  ? 95   TYR A CZ  1 
ATOM   3473  O  OH  . TYR E  5  95   ? 49.269  59.624  149.010 1.00 76.33  ? 95   TYR A OH  1 
ATOM   3474  N  N   . ILE E  5  96   ? 42.133  60.530  146.750 1.00 53.98  ? 96   ILE A N   1 
ATOM   3475  C  CA  . ILE E  5  96   ? 41.259  59.773  147.634 1.00 62.28  ? 96   ILE A CA  1 
ATOM   3476  C  C   . ILE E  5  96   ? 40.725  58.503  146.973 1.00 63.85  ? 96   ILE A C   1 
ATOM   3477  O  O   . ILE E  5  96   ? 40.861  57.406  147.520 1.00 63.72  ? 96   ILE A O   1 
ATOM   3478  C  CB  . ILE E  5  96   ? 40.073  60.591  148.118 1.00 60.75  ? 96   ILE A CB  1 
ATOM   3479  C  CG1 . ILE E  5  96   ? 40.559  61.777  148.950 1.00 59.70  ? 96   ILE A CG1 1 
ATOM   3480  C  CG2 . ILE E  5  96   ? 39.151  59.725  148.955 1.00 54.13  ? 96   ILE A CG2 1 
ATOM   3481  C  CD1 . ILE E  5  96   ? 39.423  62.657  149.453 1.00 53.26  ? 96   ILE A CD1 1 
ATOM   3482  N  N   . TYR E  5  97   ? 40.127  58.637  145.798 1.00 58.24  ? 97   TYR A N   1 
ATOM   3483  C  CA  . TYR E  5  97   ? 39.602  57.456  145.140 1.00 61.14  ? 97   TYR A CA  1 
ATOM   3484  C  C   . TYR E  5  97   ? 40.699  56.444  144.756 1.00 60.13  ? 97   TYR A C   1 
ATOM   3485  O  O   . TYR E  5  97   ? 40.526  55.244  144.955 1.00 60.98  ? 97   TYR A O   1 
ATOM   3486  C  CB  . TYR E  5  97   ? 38.696  57.831  143.975 1.00 54.59  ? 97   TYR A CB  1 
ATOM   3487  C  CG  . TYR E  5  97   ? 37.532  58.645  144.457 1.00 64.74  ? 97   TYR A CG  1 
ATOM   3488  C  CD1 . TYR E  5  97   ? 36.601  58.111  145.331 1.00 61.74  ? 97   TYR A CD1 1 
ATOM   3489  C  CD2 . TYR E  5  97   ? 37.380  59.968  144.073 1.00 63.93  ? 97   TYR A CD2 1 
ATOM   3490  C  CE1 . TYR E  5  97   ? 35.530  58.875  145.790 1.00 56.83  ? 97   TYR A CE1 1 
ATOM   3491  C  CE2 . TYR E  5  97   ? 36.331  60.731  144.527 1.00 60.96  ? 97   TYR A CE2 1 
ATOM   3492  C  CZ  . TYR E  5  97   ? 35.409  60.187  145.378 1.00 62.44  ? 97   TYR A CZ  1 
ATOM   3493  O  OH  . TYR E  5  97   ? 34.369  60.985  145.808 1.00 69.76  ? 97   TYR A OH  1 
ATOM   3494  N  N   . LEU E  5  98   ? 41.829  56.931  144.254 1.00 58.86  ? 98   LEU A N   1 
ATOM   3495  C  CA  . LEU E  5  98   ? 42.943  56.053  143.920 1.00 66.57  ? 98   LEU A CA  1 
ATOM   3496  C  C   . LEU E  5  98   ? 43.365  55.201  145.121 1.00 64.53  ? 98   LEU A C   1 
ATOM   3497  O  O   . LEU E  5  98   ? 43.506  53.980  145.009 1.00 63.63  ? 98   LEU A O   1 
ATOM   3498  C  CB  . LEU E  5  98   ? 44.141  56.846  143.379 1.00 57.91  ? 98   LEU A CB  1 
ATOM   3499  C  CG  . LEU E  5  98   ? 45.368  55.968  143.131 1.00 59.50  ? 98   LEU A CG  1 
ATOM   3500  C  CD1 . LEU E  5  98   ? 45.033  54.875  142.136 1.00 60.39  ? 98   LEU A CD1 1 
ATOM   3501  C  CD2 . LEU E  5  98   ? 46.552  56.764  142.648 1.00 60.36  ? 98   LEU A CD2 1 
ATOM   3502  N  N   . ARG E  5  99   ? 43.559  55.847  146.265 1.00 59.29  ? 99   ARG A N   1 
ATOM   3503  C  CA  . ARG E  5  99   ? 43.982  55.143  147.470 1.00 60.67  ? 99   ARG A CA  1 
ATOM   3504  C  C   . ARG E  5  99   ? 42.943  54.122  147.915 1.00 61.44  ? 99   ARG A C   1 
ATOM   3505  O  O   . ARG E  5  99   ? 43.285  53.034  148.336 1.00 76.46  ? 99   ARG A O   1 
ATOM   3506  C  CB  . ARG E  5  99   ? 44.280  56.133  148.598 1.00 60.14  ? 99   ARG A CB  1 
ATOM   3507  C  CG  . ARG E  5  99   ? 45.691  56.726  148.558 1.00 70.30  ? 99   ARG A CG  1 
ATOM   3508  C  CD  . ARG E  5  99   ? 45.932  57.669  149.728 1.00 72.19  ? 99   ARG A CD  1 
ATOM   3509  N  NE  . ARG E  5  99   ? 45.083  58.855  149.639 1.00 78.84  ? 99   ARG A NE  1 
ATOM   3510  C  CZ  . ARG E  5  99   ? 44.789  59.655  150.661 1.00 86.31  ? 99   ARG A CZ  1 
ATOM   3511  N  NH1 . ARG E  5  99   ? 45.278  59.405  151.866 1.00 95.86  ? 99   ARG A NH1 1 
ATOM   3512  N  NH2 . ARG E  5  99   ? 44.000  60.704  150.480 1.00 90.38  ? 99   ARG A NH2 1 
ATOM   3513  N  N   . ALA E  5  100  ? 41.673  54.478  147.767 1.00 60.34  ? 100  ALA A N   1 
ATOM   3514  C  CA  . ALA E  5  100  ? 40.544  53.666  148.205 1.00 70.45  ? 100  ALA A CA  1 
ATOM   3515  C  C   . ALA E  5  100  ? 40.318  52.430  147.345 1.00 74.13  ? 100  ALA A C   1 
ATOM   3516  O  O   . ALA E  5  100  ? 39.613  51.499  147.740 1.00 75.74  ? 100  ALA A O   1 
ATOM   3517  C  CB  . ALA E  5  100  ? 39.278  54.522  148.216 1.00 72.54  ? 100  ALA A CB  1 
ATOM   3518  N  N   . SER E  5  101  ? 40.907  52.436  146.163 1.00 61.97  ? 101  SER A N   1 
ATOM   3519  C  CA  . SER E  5  101  ? 40.692  51.369  145.210 1.00 66.65  ? 101  SER A CA  1 
ATOM   3520  C  C   . SER E  5  101  ? 41.367  50.039  145.585 1.00 76.08  ? 101  SER A C   1 
ATOM   3521  O  O   . SER E  5  101  ? 42.385  50.006  146.285 1.00 76.38  ? 101  SER A O   1 
ATOM   3522  C  CB  . SER E  5  101  ? 41.168  51.828  143.838 1.00 62.35  ? 101  SER A CB  1 
ATOM   3523  O  OG  . SER E  5  101  ? 40.322  52.830  143.328 1.00 60.69  ? 101  SER A OG  1 
ATOM   3524  N  N   . CYS E  5  102  ? 40.771  48.950  145.115 1.00 66.22  ? 102  CYS A N   1 
ATOM   3525  C  CA  . CYS E  5  102  ? 41.405  47.651  145.143 1.00 73.91  ? 102  CYS A CA  1 
ATOM   3526  C  C   . CYS E  5  102  ? 41.926  47.356  143.749 1.00 68.70  ? 102  CYS A C   1 
ATOM   3527  O  O   . CYS E  5  102  ? 41.150  47.225  142.818 1.00 68.41  ? 102  CYS A O   1 
ATOM   3528  C  CB  . CYS E  5  102  ? 40.395  46.576  145.539 1.00 77.85  ? 102  CYS A CB  1 
ATOM   3529  S  SG  . CYS E  5  102  ? 41.050  44.868  145.519 1.00 75.20  ? 102  CYS A SG  1 
ATOM   3530  N  N   . LEU E  5  103  ? 43.235  47.232  143.598 1.00 69.49  ? 103  LEU A N   1 
ATOM   3531  C  CA  . LEU E  5  103  ? 43.797  47.051  142.274 1.00 79.63  ? 103  LEU A CA  1 
ATOM   3532  C  C   . LEU E  5  103  ? 43.579  45.633  141.754 1.00 79.22  ? 103  LEU A C   1 
ATOM   3533  O  O   . LEU E  5  103  ? 44.037  45.296  140.671 1.00 83.59  ? 103  LEU A O   1 
ATOM   3534  C  CB  . LEU E  5  103  ? 45.280  47.393  142.274 1.00 70.16  ? 103  LEU A CB  1 
ATOM   3535  C  CG  . LEU E  5  103  ? 45.612  48.704  142.972 1.00 75.45  ? 103  LEU A CG  1 
ATOM   3536  C  CD1 . LEU E  5  103  ? 47.106  48.927  142.984 1.00 74.26  ? 103  LEU A CD1 1 
ATOM   3537  C  CD2 . LEU E  5  103  ? 44.873  49.903  142.344 1.00 66.46  ? 103  LEU A CD2 1 
ATOM   3538  N  N   . PHE E  5  104  ? 42.878  44.803  142.520 1.00 73.39  ? 104  PHE A N   1 
ATOM   3539  C  CA  . PHE E  5  104  ? 42.573  43.442  142.084 1.00 74.69  ? 104  PHE A CA  1 
ATOM   3540  C  C   . PHE E  5  104  ? 41.129  43.227  141.619 1.00 80.05  ? 104  PHE A C   1 
ATOM   3541  O  O   . PHE E  5  104  ? 40.913  42.873  140.469 1.00 76.37  ? 104  PHE A O   1 
ATOM   3542  C  CB  . PHE E  5  104  ? 42.955  42.432  143.160 1.00 76.65  ? 104  PHE A CB  1 
ATOM   3543  C  CG  . PHE E  5  104  ? 44.426  42.347  143.393 1.00 82.75  ? 104  PHE A CG  1 
ATOM   3544  C  CD1 . PHE E  5  104  ? 45.220  41.553  142.581 1.00 79.22  ? 104  PHE A CD1 1 
ATOM   3545  C  CD2 . PHE E  5  104  ? 45.030  43.086  144.400 1.00 84.77  ? 104  PHE A CD2 1 
ATOM   3546  C  CE1 . PHE E  5  104  ? 46.581  41.483  142.772 1.00 86.90  ? 104  PHE A CE1 1 
ATOM   3547  C  CE2 . PHE E  5  104  ? 46.398  43.013  144.600 1.00 87.78  ? 104  PHE A CE2 1 
ATOM   3548  C  CZ  . PHE E  5  104  ? 47.172  42.210  143.781 1.00 89.45  ? 104  PHE A CZ  1 
ATOM   3549  N  N   . CYS E  5  105  ? 40.142  43.433  142.493 1.00 81.31  ? 105  CYS A N   1 
ATOM   3550  C  CA  . CYS E  5  105  ? 38.745  43.236  142.091 1.00 73.51  ? 105  CYS A CA  1 
ATOM   3551  C  C   . CYS E  5  105  ? 38.101  44.512  141.547 1.00 75.67  ? 105  CYS A C   1 
ATOM   3552  O  O   . CYS E  5  105  ? 36.994  44.480  141.007 1.00 74.40  ? 105  CYS A O   1 
ATOM   3553  C  CB  . CYS E  5  105  ? 37.915  42.656  143.232 1.00 74.31  ? 105  CYS A CB  1 
ATOM   3554  S  SG  . CYS E  5  105  ? 37.511  43.784  144.550 1.00 72.59  ? 105  CYS A SG  1 
ATOM   3555  N  N   . HIS E  5  106  ? 38.802  45.632  141.712 1.00 78.18  ? 106  HIS A N   1 
ATOM   3556  C  CA  . HIS E  5  106  ? 38.422  46.916  141.125 1.00 78.02  ? 106  HIS A CA  1 
ATOM   3557  C  C   . HIS E  5  106  ? 37.168  47.552  141.704 1.00 75.30  ? 106  HIS A C   1 
ATOM   3558  O  O   . HIS E  5  106  ? 36.624  48.489  141.130 1.00 73.16  ? 106  HIS A O   1 
ATOM   3559  C  CB  . HIS E  5  106  ? 38.368  46.819  139.599 1.00 84.21  ? 106  HIS A CB  1 
ATOM   3560  C  CG  . HIS E  5  106  ? 39.717  46.646  138.976 1.00 94.71  ? 106  HIS A CG  1 
ATOM   3561  N  ND1 . HIS E  5  106  ? 40.283  47.583  138.142 1.00 100.86 ? 106  HIS A ND1 1 
ATOM   3562  C  CD2 . HIS E  5  106  ? 40.638  45.665  139.116 1.00 98.03  ? 106  HIS A CD2 1 
ATOM   3563  C  CE1 . HIS E  5  106  ? 41.484  47.177  137.770 1.00 98.27  ? 106  HIS A CE1 1 
ATOM   3564  N  NE2 . HIS E  5  106  ? 41.723  46.019  138.352 1.00 100.16 ? 106  HIS A NE2 1 
ATOM   3565  N  N   . HIS E  5  107  ? 36.722  47.049  142.848 1.00 77.86  ? 107  HIS A N   1 
ATOM   3566  C  CA  . HIS E  5  107  ? 35.746  47.766  143.653 1.00 81.01  ? 107  HIS A CA  1 
ATOM   3567  C  C   . HIS E  5  107  ? 36.536  48.640  144.617 1.00 75.95  ? 107  HIS A C   1 
ATOM   3568  O  O   . HIS E  5  107  ? 37.769  48.607  144.620 1.00 65.52  ? 107  HIS A O   1 
ATOM   3569  C  CB  . HIS E  5  107  ? 34.855  46.796  144.436 1.00 90.71  ? 107  HIS A CB  1 
ATOM   3570  C  CG  . HIS E  5  107  ? 33.809  46.121  143.604 1.00 101.68 ? 107  HIS A CG  1 
ATOM   3571  N  ND1 . HIS E  5  107  ? 32.625  45.654  144.133 1.00 107.28 ? 107  HIS A ND1 1 
ATOM   3572  C  CD2 . HIS E  5  107  ? 33.769  45.831  142.280 1.00 105.90 ? 107  HIS A CD2 1 
ATOM   3573  C  CE1 . HIS E  5  107  ? 31.901  45.105  143.173 1.00 109.74 ? 107  HIS A CE1 1 
ATOM   3574  N  NE2 . HIS E  5  107  ? 32.572  45.199  142.039 1.00 108.94 ? 107  HIS A NE2 1 
ATOM   3575  N  N   . PHE E  5  108  ? 35.844  49.433  145.427 1.00 70.66  ? 108  PHE A N   1 
ATOM   3576  C  CA  . PHE E  5  108  ? 36.522  50.083  146.538 1.00 68.85  ? 108  PHE A CA  1 
ATOM   3577  C  C   . PHE E  5  108  ? 36.782  48.992  147.552 1.00 70.83  ? 108  PHE A C   1 
ATOM   3578  O  O   . PHE E  5  108  ? 36.026  48.030  147.633 1.00 77.08  ? 108  PHE A O   1 
ATOM   3579  C  CB  . PHE E  5  108  ? 35.655  51.180  147.152 1.00 64.11  ? 108  PHE A CB  1 
ATOM   3580  C  CG  . PHE E  5  108  ? 35.529  52.398  146.297 1.00 61.75  ? 108  PHE A CG  1 
ATOM   3581  C  CD1 . PHE E  5  108  ? 36.653  52.985  145.740 1.00 65.83  ? 108  PHE A CD1 1 
ATOM   3582  C  CD2 . PHE E  5  108  ? 34.286  52.961  146.050 1.00 59.28  ? 108  PHE A CD2 1 
ATOM   3583  C  CE1 . PHE E  5  108  ? 36.541  54.113  144.945 1.00 68.34  ? 108  PHE A CE1 1 
ATOM   3584  C  CE2 . PHE E  5  108  ? 34.165  54.085  145.254 1.00 57.76  ? 108  PHE A CE2 1 
ATOM   3585  C  CZ  . PHE E  5  108  ? 35.290  54.665  144.701 1.00 60.71  ? 108  PHE A CZ  1 
ATOM   3586  N  N   . ARG E  5  109  ? 37.844  49.127  148.331 1.00 71.69  ? 109  ARG A N   1 
ATOM   3587  C  CA  . ARG E  5  109  ? 38.163  48.102  149.318 1.00 67.66  ? 109  ARG A CA  1 
ATOM   3588  C  C   . ARG E  5  109  ? 37.142  48.017  150.452 1.00 67.89  ? 109  ARG A C   1 
ATOM   3589  O  O   . ARG E  5  109  ? 37.130  47.053  151.202 1.00 69.94  ? 109  ARG A O   1 
ATOM   3590  C  CB  . ARG E  5  109  ? 39.580  48.291  149.851 1.00 68.13  ? 109  ARG A CB  1 
ATOM   3591  C  CG  . ARG E  5  109  ? 40.620  47.825  148.861 1.00 84.02  ? 109  ARG A CG  1 
ATOM   3592  C  CD  . ARG E  5  109  ? 42.027  47.927  149.399 1.00 83.29  ? 109  ARG A CD  1 
ATOM   3593  N  NE  . ARG E  5  109  ? 42.539  49.269  149.180 1.00 77.85  ? 109  ARG A NE  1 
ATOM   3594  C  CZ  . ARG E  5  109  ? 42.689  50.174  150.134 1.00 72.59  ? 109  ARG A CZ  1 
ATOM   3595  N  NH1 . ARG E  5  109  ? 42.381  49.892  151.389 1.00 74.35  ? 109  ARG A NH1 1 
ATOM   3596  N  NH2 . ARG E  5  109  ? 43.155  51.361  149.825 1.00 72.47  ? 109  ARG A NH2 1 
ATOM   3597  N  N   . LEU E  5  110  ? 36.279  49.023  150.563 1.00 74.90  ? 110  LEU A N   1 
ATOM   3598  C  CA  . LEU E  5  110  ? 35.179  48.995  151.516 1.00 66.43  ? 110  LEU A CA  1 
ATOM   3599  C  C   . LEU E  5  110  ? 34.141  47.981  151.043 1.00 79.79  ? 110  LEU A C   1 
ATOM   3600  O  O   . LEU E  5  110  ? 33.822  47.924  149.854 1.00 76.07  ? 110  LEU A O   1 
ATOM   3601  C  CB  . LEU E  5  110  ? 34.558  50.384  151.614 1.00 78.96  ? 110  LEU A CB  1 
ATOM   3602  C  CG  . LEU E  5  110  ? 33.502  50.662  152.683 1.00 79.53  ? 110  LEU A CG  1 
ATOM   3603  C  CD1 . LEU E  5  110  ? 33.999  50.153  154.026 1.00 81.01  ? 110  LEU A CD1 1 
ATOM   3604  C  CD2 . LEU E  5  110  ? 33.147  52.166  152.746 1.00 65.20  ? 110  LEU A CD2 1 
ATOM   3605  N  N   . LYS E  5  111  ? 33.620  47.179  151.965 1.00 68.87  ? 111  LYS A N   1 
ATOM   3606  C  CA  . LYS E  5  111  ? 32.666  46.135  151.607 1.00 81.87  ? 111  LYS A CA  1 
ATOM   3607  C  C   . LYS E  5  111  ? 31.484  46.693  150.824 1.00 78.02  ? 111  LYS A C   1 
ATOM   3608  O  O   . LYS E  5  111  ? 30.929  47.713  151.194 1.00 70.64  ? 111  LYS A O   1 
ATOM   3609  C  CB  . LYS E  5  111  ? 32.185  45.381  152.856 1.00 87.91  ? 111  LYS A CB  1 
ATOM   3610  C  CG  . LYS E  5  111  ? 32.248  46.190  154.154 1.00 95.84  ? 111  LYS A CG  1 
ATOM   3611  C  CD  . LYS E  5  111  ? 31.747  45.377  155.354 1.00 103.20 ? 111  LYS A CD  1 
ATOM   3612  C  CE  . LYS E  5  111  ? 31.964  46.103  156.689 1.00 104.72 ? 111  LYS A CE  1 
ATOM   3613  N  NZ  . LYS E  5  111  ? 31.917  45.145  157.848 1.00 106.16 ? 111  LYS A NZ  1 
ATOM   3614  N  N   . SER E  5  112  ? 31.121  46.018  149.736 1.00 82.28  ? 112  SER A N   1 
ATOM   3615  C  CA  . SER E  5  112  ? 30.036  46.445  148.847 1.00 80.57  ? 112  SER A CA  1 
ATOM   3616  C  C   . SER E  5  112  ? 28.748  46.863  149.571 1.00 83.35  ? 112  SER A C   1 
ATOM   3617  O  O   . SER E  5  112  ? 28.107  47.850  149.194 1.00 85.59  ? 112  SER A O   1 
ATOM   3618  C  CB  . SER E  5  112  ? 29.718  45.345  147.831 1.00 78.73  ? 112  SER A CB  1 
ATOM   3619  O  OG  . SER E  5  112  ? 30.825  45.104  146.987 1.00 81.77  ? 112  SER A OG  1 
ATOM   3620  N  N   . VAL E  5  113  ? 28.389  46.111  150.607 1.00 81.15  ? 113  VAL A N   1 
ATOM   3621  C  CA  . VAL E  5  113  ? 27.175  46.345  151.381 1.00 79.67  ? 113  VAL A CA  1 
ATOM   3622  C  C   . VAL E  5  113  ? 27.140  47.720  152.040 1.00 80.08  ? 113  VAL A C   1 
ATOM   3623  O  O   . VAL E  5  113  ? 26.083  48.362  152.127 1.00 85.65  ? 113  VAL A O   1 
ATOM   3624  C  CB  . VAL E  5  113  ? 27.067  45.305  152.479 1.00 87.50  ? 113  VAL A CB  1 
ATOM   3625  C  CG1 . VAL E  5  113  ? 25.656  45.279  153.041 1.00 71.90  ? 113  VAL A CG1 1 
ATOM   3626  C  CG2 . VAL E  5  113  ? 27.480  43.947  151.916 1.00 97.35  ? 113  VAL A CG2 1 
ATOM   3627  N  N   . GLU E  5  114  ? 28.300  48.153  152.521 1.00 74.03  ? 114  GLU A N   1 
ATOM   3628  C  CA  . GLU E  5  114  ? 28.437  49.443  153.175 1.00 70.46  ? 114  GLU A CA  1 
ATOM   3629  C  C   . GLU E  5  114  ? 28.352  50.529  152.136 1.00 72.85  ? 114  GLU A C   1 
ATOM   3630  O  O   . GLU E  5  114  ? 27.623  51.499  152.299 1.00 74.60  ? 114  GLU A O   1 
ATOM   3631  C  CB  . GLU E  5  114  ? 29.779  49.540  153.902 1.00 71.00  ? 114  GLU A CB  1 
ATOM   3632  C  CG  . GLU E  5  114  ? 29.669  49.345  155.396 1.00 80.43  ? 114  GLU A CG  1 
ATOM   3633  C  CD  . GLU E  5  114  ? 28.733  50.348  156.029 1.00 91.58  ? 114  GLU A CD  1 
ATOM   3634  O  OE1 . GLU E  5  114  ? 29.128  51.527  156.151 1.00 93.74  ? 114  GLU A OE1 1 
ATOM   3635  O  OE2 . GLU E  5  114  ? 27.602  49.960  156.395 1.00 95.95  ? 114  GLU A OE2 1 
ATOM   3636  N  N   . VAL E  5  115  ? 29.113  50.360  151.064 1.00 75.08  ? 115  VAL A N   1 
ATOM   3637  C  CA  . VAL E  5  115  ? 29.090  51.305  149.968 1.00 76.00  ? 115  VAL A CA  1 
ATOM   3638  C  C   . VAL E  5  115  ? 27.667  51.480  149.449 1.00 61.62  ? 115  VAL A C   1 
ATOM   3639  O  O   . VAL E  5  115  ? 27.234  52.578  149.163 1.00 60.18  ? 115  VAL A O   1 
ATOM   3640  C  CB  . VAL E  5  115  ? 30.047  50.876  148.858 1.00 62.19  ? 115  VAL A CB  1 
ATOM   3641  C  CG1 . VAL E  5  115  ? 29.837  51.712  147.611 1.00 60.76  ? 115  VAL A CG1 1 
ATOM   3642  C  CG2 . VAL E  5  115  ? 31.470  50.991  149.362 1.00 62.29  ? 115  VAL A CG2 1 
ATOM   3643  N  N   . HIS E  5  116  ? 26.915  50.402  149.386 1.00 63.06  ? 116  HIS A N   1 
ATOM   3644  C  CA  . HIS E  5  116  ? 25.546  50.509  148.923 1.00 71.96  ? 116  HIS A CA  1 
ATOM   3645  C  C   . HIS E  5  116  ? 24.689  51.271  149.934 1.00 69.75  ? 116  HIS A C   1 
ATOM   3646  O  O   . HIS E  5  116  ? 23.728  51.929  149.556 1.00 67.95  ? 116  HIS A O   1 
ATOM   3647  C  CB  . HIS E  5  116  ? 24.968  49.115  148.643 1.00 69.06  ? 116  HIS A CB  1 
ATOM   3648  C  CG  . HIS E  5  116  ? 23.533  49.124  148.224 1.00 67.36  ? 116  HIS A CG  1 
ATOM   3649  N  ND1 . HIS E  5  116  ? 22.509  48.750  149.070 1.00 72.12  ? 116  HIS A ND1 1 
ATOM   3650  C  CD2 . HIS E  5  116  ? 22.946  49.466  147.053 1.00 64.41  ? 116  HIS A CD2 1 
ATOM   3651  C  CE1 . HIS E  5  116  ? 21.356  48.857  148.436 1.00 71.68  ? 116  HIS A CE1 1 
ATOM   3652  N  NE2 . HIS E  5  116  ? 21.592  49.294  147.211 1.00 65.05  ? 116  HIS A NE2 1 
ATOM   3653  N  N   . ARG E  5  117  ? 25.044  51.187  151.213 1.00 62.86  ? 117  ARG A N   1 
ATOM   3654  C  CA  . ARG E  5  117  ? 24.280  51.849  152.271 1.00 66.96  ? 117  ARG A CA  1 
ATOM   3655  C  C   . ARG E  5  117  ? 24.477  53.356  152.166 1.00 63.74  ? 117  ARG A C   1 
ATOM   3656  O  O   . ARG E  5  117  ? 23.574  54.137  152.445 1.00 59.92  ? 117  ARG A O   1 
ATOM   3657  C  CB  . ARG E  5  117  ? 24.724  51.336  153.647 1.00 72.11  ? 117  ARG A CB  1 
ATOM   3658  C  CG  . ARG E  5  117  ? 23.988  51.918  154.844 1.00 70.96  ? 117  ARG A CG  1 
ATOM   3659  C  CD  . ARG E  5  117  ? 24.791  51.719  156.126 1.00 64.50  ? 117  ARG A CD  1 
ATOM   3660  N  NE  . ARG E  5  117  ? 24.827  52.947  156.913 1.00 80.79  ? 117  ARG A NE  1 
ATOM   3661  C  CZ  . ARG E  5  117  ? 25.941  53.578  157.284 1.00 79.50  ? 117  ARG A CZ  1 
ATOM   3662  N  NH1 . ARG E  5  117  ? 27.128  53.086  156.954 1.00 76.92  ? 117  ARG A NH1 1 
ATOM   3663  N  NH2 . ARG E  5  117  ? 25.873  54.710  157.986 1.00 77.59  ? 117  ARG A NH2 1 
ATOM   3664  N  N   . TYR E  5  118  ? 25.672  53.756  151.752 1.00 62.49  ? 118  TYR A N   1 
ATOM   3665  C  CA  . TYR E  5  118  ? 25.940  55.156  151.494 1.00 60.67  ? 118  TYR A CA  1 
ATOM   3666  C  C   . TYR E  5  118  ? 25.249  55.630  150.243 1.00 57.13  ? 118  TYR A C   1 
ATOM   3667  O  O   . TYR E  5  118  ? 24.822  56.763  150.167 1.00 55.92  ? 118  TYR A O   1 
ATOM   3668  C  CB  . TYR E  5  118  ? 27.437  55.417  151.386 1.00 63.09  ? 118  TYR A CB  1 
ATOM   3669  C  CG  . TYR E  5  118  ? 28.083  55.500  152.735 1.00 69.02  ? 118  TYR A CG  1 
ATOM   3670  C  CD1 . TYR E  5  118  ? 27.956  56.633  153.523 1.00 68.05  ? 118  TYR A CD1 1 
ATOM   3671  C  CD2 . TYR E  5  118  ? 28.793  54.433  153.235 1.00 72.71  ? 118  TYR A CD2 1 
ATOM   3672  C  CE1 . TYR E  5  118  ? 28.535  56.694  154.770 1.00 74.63  ? 118  TYR A CE1 1 
ATOM   3673  C  CE2 . TYR E  5  118  ? 29.377  54.488  154.472 1.00 74.62  ? 118  TYR A CE2 1 
ATOM   3674  C  CZ  . TYR E  5  118  ? 29.246  55.612  155.235 1.00 78.06  ? 118  TYR A CZ  1 
ATOM   3675  O  OH  . TYR E  5  118  ? 29.838  55.631  156.466 1.00 86.31  ? 118  TYR A OH  1 
ATOM   3676  N  N   . ALA E  5  119  ? 25.154  54.764  149.251 1.00 57.82  ? 119  ALA A N   1 
ATOM   3677  C  CA  . ALA E  5  119  ? 24.545  55.175  148.009 1.00 67.01  ? 119  ALA A CA  1 
ATOM   3678  C  C   . ALA E  5  119  ? 23.071  55.409  148.274 1.00 68.08  ? 119  ALA A C   1 
ATOM   3679  O  O   . ALA E  5  119  ? 22.476  56.367  147.758 1.00 62.44  ? 119  ALA A O   1 
ATOM   3680  C  CB  . ALA E  5  119  ? 24.743  54.131  146.947 1.00 58.09  ? 119  ALA A CB  1 
ATOM   3681  N  N   . CYS E  5  120  ? 22.488  54.552  149.104 1.00 58.57  ? 120  CYS A N   1 
ATOM   3682  C  CA  . CYS E  5  120  ? 21.077  54.692  149.431 1.00 68.21  ? 120  CYS A CA  1 
ATOM   3683  C  C   . CYS E  5  120  ? 20.817  55.996  150.136 1.00 67.06  ? 120  CYS A C   1 
ATOM   3684  O  O   . CYS E  5  120  ? 19.904  56.717  149.768 1.00 67.42  ? 120  CYS A O   1 
ATOM   3685  C  CB  . CYS E  5  120  ? 20.601  53.553  150.311 1.00 69.19  ? 120  CYS A CB  1 
ATOM   3686  S  SG  . CYS E  5  120  ? 20.549  52.013  149.457 1.00 76.02  ? 120  CYS A SG  1 
ATOM   3687  N  N   . LYS E  5  121  ? 21.626  56.294  151.148 1.00 65.48  ? 121  LYS A N   1 
ATOM   3688  C  CA  . LYS E  5  121  ? 21.446  57.509  151.931 1.00 64.49  ? 121  LYS A CA  1 
ATOM   3689  C  C   . LYS E  5  121  ? 21.594  58.792  151.097 1.00 60.52  ? 121  LYS A C   1 
ATOM   3690  O  O   . LYS E  5  121  ? 20.712  59.647  151.097 1.00 54.25  ? 121  LYS A O   1 
ATOM   3691  C  CB  . LYS E  5  121  ? 22.396  57.511  153.125 1.00 56.70  ? 121  LYS A CB  1 
ATOM   3692  C  CG  . LYS E  5  121  ? 22.072  56.449  154.139 1.00 70.31  ? 121  LYS A CG  1 
ATOM   3693  C  CD  . LYS E  5  121  ? 23.014  56.501  155.320 1.00 70.89  ? 121  LYS A CD  1 
ATOM   3694  C  CE  . LYS E  5  121  ? 22.664  57.622  156.262 1.00 80.83  ? 121  LYS A CE  1 
ATOM   3695  N  NZ  . LYS E  5  121  ? 23.217  57.330  157.613 1.00 89.18  ? 121  LYS A NZ  1 
ATOM   3696  N  N   . LEU E  5  122  ? 22.707  58.925  150.393 1.00 54.19  ? 122  LEU A N   1 
ATOM   3697  C  CA  . LEU E  5  122  ? 22.913  60.059  149.515 1.00 52.79  ? 122  LEU A CA  1 
ATOM   3698  C  C   . LEU E  5  122  ? 21.801  60.207  148.481 1.00 52.68  ? 122  LEU A C   1 
ATOM   3699  O  O   . LEU E  5  122  ? 21.404  61.320  148.140 1.00 63.07  ? 122  LEU A O   1 
ATOM   3700  C  CB  . LEU E  5  122  ? 24.237  59.941  148.788 1.00 52.43  ? 122  LEU A CB  1 
ATOM   3701  C  CG  . LEU E  5  122  ? 25.457  59.996  149.660 1.00 59.08  ? 122  LEU A CG  1 
ATOM   3702  C  CD1 . LEU E  5  122  ? 26.683  59.623  148.843 1.00 52.40  ? 122  LEU A CD1 1 
ATOM   3703  C  CD2 . LEU E  5  122  ? 25.573  61.376  150.219 1.00 51.31  ? 122  LEU A CD2 1 
ATOM   3704  N  N   . ARG E  5  123  ? 21.303  59.100  147.958 1.00 53.78  ? 123  ARG A N   1 
ATOM   3705  C  CA  . ARG E  5  123  ? 20.245  59.203  146.973 1.00 68.73  ? 123  ARG A CA  1 
ATOM   3706  C  C   . ARG E  5  123  ? 19.003  59.814  147.609 1.00 64.62  ? 123  ARG A C   1 
ATOM   3707  O  O   . ARG E  5  123  ? 18.347  60.661  147.009 1.00 61.57  ? 123  ARG A O   1 
ATOM   3708  C  CB  . ARG E  5  123  ? 19.901  57.850  146.350 1.00 63.64  ? 123  ARG A CB  1 
ATOM   3709  C  CG  . ARG E  5  123  ? 18.917  58.006  145.218 1.00 59.01  ? 123  ARG A CG  1 
ATOM   3710  C  CD  . ARG E  5  123  ? 18.362  56.709  144.720 1.00 64.19  ? 123  ARG A CD  1 
ATOM   3711  N  NE  . ARG E  5  123  ? 17.343  56.967  143.709 1.00 69.34  ? 123  ARG A NE  1 
ATOM   3712  C  CZ  . ARG E  5  123  ? 16.509  56.050  143.235 1.00 73.94  ? 123  ARG A CZ  1 
ATOM   3713  N  NH1 . ARG E  5  123  ? 16.567  54.793  143.668 1.00 74.82  ? 123  ARG A NH1 1 
ATOM   3714  N  NH2 . ARG E  5  123  ? 15.610  56.397  142.331 1.00 75.73  ? 123  ARG A NH2 1 
ATOM   3715  N  N   . LEU E  5  124  ? 18.689  59.381  148.825 1.00 61.68  ? 124  LEU A N   1 
ATOM   3716  C  CA  . LEU E  5  124  ? 17.552  59.922  149.558 1.00 61.82  ? 124  LEU A CA  1 
ATOM   3717  C  C   . LEU E  5  124  ? 17.726  61.420  149.808 1.00 63.33  ? 124  LEU A C   1 
ATOM   3718  O  O   . LEU E  5  124  ? 16.759  62.183  149.796 1.00 66.05  ? 124  LEU A O   1 
ATOM   3719  C  CB  . LEU E  5  124  ? 17.377  59.195  150.889 1.00 56.75  ? 124  LEU A CB  1 
ATOM   3720  C  CG  . LEU E  5  124  ? 16.838  57.772  150.843 1.00 59.93  ? 124  LEU A CG  1 
ATOM   3721  C  CD1 . LEU E  5  124  ? 17.086  57.131  152.170 1.00 58.53  ? 124  LEU A CD1 1 
ATOM   3722  C  CD2 . LEU E  5  124  ? 15.357  57.764  150.523 1.00 58.19  ? 124  LEU A CD2 1 
ATOM   3723  N  N   . LEU E  5  125  ? 18.966  61.838  150.019 1.00 59.78  ? 125  LEU A N   1 
ATOM   3724  C  CA  . LEU E  5  125  ? 19.238  63.225  150.340 1.00 62.90  ? 125  LEU A CA  1 
ATOM   3725  C  C   . LEU E  5  125  ? 19.141  64.115  149.120 1.00 67.56  ? 125  LEU A C   1 
ATOM   3726  O  O   . LEU E  5  125  ? 19.029  65.326  149.249 1.00 76.78  ? 125  LEU A O   1 
ATOM   3727  C  CB  . LEU E  5  125  ? 20.602  63.362  151.006 1.00 50.97  ? 125  LEU A CB  1 
ATOM   3728  C  CG  . LEU E  5  125  ? 20.695  62.776  152.414 1.00 51.91  ? 125  LEU A CG  1 
ATOM   3729  C  CD1 . LEU E  5  125  ? 22.079  62.957  152.953 1.00 51.88  ? 125  LEU A CD1 1 
ATOM   3730  C  CD2 . LEU E  5  125  ? 19.689  63.437  153.342 1.00 63.32  ? 125  LEU A CD2 1 
ATOM   3731  N  N   . GLN E  5  126  ? 19.181  63.526  147.935 1.00 50.58  ? 126  GLN A N   1 
ATOM   3732  C  CA  . GLN E  5  126  ? 18.989  64.319  146.725 1.00 57.86  ? 126  GLN A CA  1 
ATOM   3733  C  C   . GLN E  5  126  ? 17.568  64.884  146.714 1.00 57.24  ? 126  GLN A C   1 
ATOM   3734  O  O   . GLN E  5  126  ? 17.306  65.938  146.121 1.00 57.08  ? 126  GLN A O   1 
ATOM   3735  C  CB  . GLN E  5  126  ? 19.209  63.481  145.458 1.00 50.28  ? 126  GLN A CB  1 
ATOM   3736  C  CG  . GLN E  5  126  ? 20.647  63.161  145.120 1.00 49.97  ? 126  GLN A CG  1 
ATOM   3737  C  CD  . GLN E  5  126  ? 20.807  62.298  143.858 1.00 56.12  ? 126  GLN A CD  1 
ATOM   3738  O  OE1 . GLN E  5  126  ? 19.915  61.530  143.469 1.00 56.65  ? 126  GLN A OE1 1 
ATOM   3739  N  NE2 . GLN E  5  126  ? 21.962  62.430  143.214 1.00 51.72  ? 126  GLN A NE2 1 
ATOM   3740  N  N   . TYR E  5  127  ? 16.657  64.164  147.371 1.00 55.21  ? 127  TYR A N   1 
ATOM   3741  C  CA  . TYR E  5  127  ? 15.252  64.547  147.446 1.00 51.53  ? 127  TYR A CA  1 
ATOM   3742  C  C   . TYR E  5  127  ? 14.915  65.213  148.782 1.00 60.77  ? 127  TYR A C   1 
ATOM   3743  O  O   . TYR E  5  127  ? 13.745  65.463  149.088 1.00 66.10  ? 127  TYR A O   1 
ATOM   3744  C  CB  . TYR E  5  127  ? 14.368  63.328  147.188 1.00 52.95  ? 127  TYR A CB  1 
ATOM   3745  C  CG  . TYR E  5  127  ? 14.538  62.811  145.775 1.00 63.71  ? 127  TYR A CG  1 
ATOM   3746  C  CD1 . TYR E  5  127  ? 13.856  63.399  144.725 1.00 63.01  ? 127  TYR A CD1 1 
ATOM   3747  C  CD2 . TYR E  5  127  ? 15.394  61.749  145.482 1.00 63.89  ? 127  TYR A CD2 1 
ATOM   3748  C  CE1 . TYR E  5  127  ? 14.011  62.948  143.427 1.00 64.55  ? 127  TYR A CE1 1 
ATOM   3749  C  CE2 . TYR E  5  127  ? 15.555  61.292  144.176 1.00 61.45  ? 127  TYR A CE2 1 
ATOM   3750  C  CZ  . TYR E  5  127  ? 14.858  61.899  143.158 1.00 60.89  ? 127  TYR A CZ  1 
ATOM   3751  O  OH  . TYR E  5  127  ? 14.988  61.489  141.853 1.00 56.60  ? 127  TYR A OH  1 
ATOM   3752  N  N   . GLY E  5  128  ? 15.946  65.498  149.575 1.00 52.92  ? 128  GLY A N   1 
ATOM   3753  C  CA  . GLY E  5  128  ? 15.765  66.198  150.828 1.00 52.26  ? 128  GLY A CA  1 
ATOM   3754  C  C   . GLY E  5  128  ? 15.176  65.361  151.948 1.00 51.98  ? 128  GLY A C   1 
ATOM   3755  O  O   . GLY E  5  128  ? 14.862  65.869  153.029 1.00 74.85  ? 128  GLY A O   1 
ATOM   3756  N  N   . LEU E  5  129  ? 15.044  64.071  151.687 1.00 56.98  ? 129  LEU A N   1 
ATOM   3757  C  CA  . LEU E  5  129  ? 14.454  63.114  152.611 1.00 59.09  ? 129  LEU A CA  1 
ATOM   3758  C  C   . LEU E  5  129  ? 15.382  62.760  153.791 1.00 61.59  ? 129  LEU A C   1 
ATOM   3759  O  O   . LEU E  5  129  ? 15.870  61.630  153.898 1.00 61.21  ? 129  LEU A O   1 
ATOM   3760  C  CB  . LEU E  5  129  ? 14.107  61.850  151.825 1.00 65.67  ? 129  LEU A CB  1 
ATOM   3761  C  CG  . LEU E  5  129  ? 13.180  62.081  150.647 1.00 55.34  ? 129  LEU A CG  1 
ATOM   3762  C  CD1 . LEU E  5  129  ? 13.060  60.814  149.851 1.00 82.27  ? 129  LEU A CD1 1 
ATOM   3763  C  CD2 . LEU E  5  129  ? 11.861  62.450  151.201 1.00 56.00  ? 129  LEU A CD2 1 
ATOM   3764  N  N   . ILE E  5  130  ? 15.609  63.718  154.684 1.00 62.83  ? 130  ILE A N   1 
ATOM   3765  C  CA  . ILE E  5  130  ? 16.524  63.499  155.793 1.00 57.03  ? 130  ILE A CA  1 
ATOM   3766  C  C   . ILE E  5  130  ? 16.045  62.420  156.771 1.00 60.52  ? 130  ILE A C   1 
ATOM   3767  O  O   . ILE E  5  130  ? 16.835  61.585  157.189 1.00 58.80  ? 130  ILE A O   1 
ATOM   3768  C  CB  . ILE E  5  130  ? 16.815  64.789  156.559 1.00 56.20  ? 130  ILE A CB  1 
ATOM   3769  C  CG1 . ILE E  5  130  ? 17.174  65.913  155.597 1.00 62.53  ? 130  ILE A CG1 1 
ATOM   3770  C  CG2 . ILE E  5  130  ? 17.973  64.578  157.478 1.00 63.76  ? 130  ILE A CG2 1 
ATOM   3771  C  CD1 . ILE E  5  130  ? 17.629  67.169  156.293 1.00 65.42  ? 130  ILE A CD1 1 
ATOM   3772  N  N   . ASP E  5  131  ? 14.767  62.432  157.146 1.00 67.22  ? 131  ASP A N   1 
ATOM   3773  C  CA  . ASP E  5  131  ? 14.270  61.441  158.109 1.00 68.44  ? 131  ASP A CA  1 
ATOM   3774  C  C   . ASP E  5  131  ? 14.442  60.044  157.547 1.00 74.78  ? 131  ASP A C   1 
ATOM   3775  O  O   . ASP E  5  131  ? 14.833  59.114  158.256 1.00 83.03  ? 131  ASP A O   1 
ATOM   3776  C  CB  . ASP E  5  131  ? 12.789  61.685  158.479 1.00 69.91  ? 131  ASP A CB  1 
ATOM   3777  C  CG  . ASP E  5  131  ? 12.233  60.635  159.476 1.00 112.12 ? 131  ASP A CG  1 
ATOM   3778  O  OD1 . ASP E  5  131  ? 13.024  60.018  160.231 1.00 112.84 ? 131  ASP A OD1 1 
ATOM   3779  O  OD2 . ASP E  5  131  ? 10.994  60.429  159.509 1.00 110.23 ? 131  ASP A OD2 1 
ATOM   3780  N  N   . GLU E  5  132  ? 14.153  59.907  156.258 1.00 73.85  ? 132  GLU A N   1 
ATOM   3781  C  CA  . GLU E  5  132  ? 14.200  58.616  155.605 1.00 69.16  ? 132  GLU A CA  1 
ATOM   3782  C  C   . GLU E  5  132  ? 15.605  58.036  155.594 1.00 71.40  ? 132  GLU A C   1 
ATOM   3783  O  O   . GLU E  5  132  ? 15.772  56.826  155.759 1.00 75.25  ? 132  GLU A O   1 
ATOM   3784  C  CB  . GLU E  5  132  ? 13.644  58.720  154.192 1.00 75.59  ? 132  GLU A CB  1 
ATOM   3785  C  CG  . GLU E  5  132  ? 12.120  58.758  154.130 1.00 83.61  ? 132  GLU A CG  1 
ATOM   3786  C  CD  . GLU E  5  132  ? 11.544  60.174  154.122 1.00 85.65  ? 132  GLU A CD  1 
ATOM   3787  O  OE1 . GLU E  5  132  ? 12.294  61.148  154.382 1.00 77.27  ? 132  GLU A OE1 1 
ATOM   3788  O  OE2 . GLU E  5  132  ? 10.328  60.301  153.849 1.00 93.20  ? 132  GLU A OE2 1 
ATOM   3789  N  N   . SER E  5  133  ? 16.613  58.888  155.420 1.00 58.27  ? 133  SER A N   1 
ATOM   3790  C  CA  . SER E  5  133  ? 17.995  58.421  155.376 1.00 58.14  ? 133  SER A CA  1 
ATOM   3791  C  C   . SER E  5  133  ? 18.471  57.857  156.706 1.00 78.52  ? 133  SER A C   1 
ATOM   3792  O  O   . SER E  5  133  ? 19.460  57.120  156.763 1.00 80.10  ? 133  SER A O   1 
ATOM   3793  C  CB  . SER E  5  133  ? 18.946  59.525  154.918 1.00 66.84  ? 133  SER A CB  1 
ATOM   3794  O  OG  . SER E  5  133  ? 19.014  60.559  155.877 1.00 66.48  ? 133  SER A OG  1 
ATOM   3795  N  N   . TYR E  5  134  ? 17.780  58.211  157.782 1.00 77.61  ? 134  TYR A N   1 
ATOM   3796  C  CA  . TYR E  5  134  ? 18.120  57.667  159.087 1.00 71.33  ? 134  TYR A CA  1 
ATOM   3797  C  C   . TYR E  5  134  ? 17.348  56.366  159.254 1.00 73.78  ? 134  TYR A C   1 
ATOM   3798  O  O   . TYR E  5  134  ? 17.874  55.368  159.767 1.00 77.79  ? 134  TYR A O   1 
ATOM   3799  C  CB  . TYR E  5  134  ? 17.843  58.684  160.213 1.00 70.99  ? 134  TYR A CB  1 
ATOM   3800  C  CG  . TYR E  5  134  ? 18.917  59.768  160.361 1.00 77.49  ? 134  TYR A CG  1 
ATOM   3801  C  CD1 . TYR E  5  134  ? 20.089  59.522  161.076 1.00 77.31  ? 134  TYR A CD1 1 
ATOM   3802  C  CD2 . TYR E  5  134  ? 18.756  61.035  159.789 1.00 79.16  ? 134  TYR A CD2 1 
ATOM   3803  C  CE1 . TYR E  5  134  ? 21.074  60.491  161.210 1.00 77.51  ? 134  TYR A CE1 1 
ATOM   3804  C  CE2 . TYR E  5  134  ? 19.740  62.018  159.926 1.00 79.40  ? 134  TYR A CE2 1 
ATOM   3805  C  CZ  . TYR E  5  134  ? 20.902  61.735  160.641 1.00 78.37  ? 134  TYR A CZ  1 
ATOM   3806  O  OH  . TYR E  5  134  ? 21.900  62.684  160.793 1.00 73.24  ? 134  TYR A OH  1 
ATOM   3807  N  N   . LYS E  5  135  ? 16.109  56.364  158.776 1.00 72.24  ? 135  LYS A N   1 
ATOM   3808  C  CA  . LYS E  5  135  ? 15.305  55.152  158.803 1.00 72.45  ? 135  LYS A CA  1 
ATOM   3809  C  C   . LYS E  5  135  ? 15.959  54.065  157.971 1.00 77.94  ? 135  LYS A C   1 
ATOM   3810  O  O   . LYS E  5  135  ? 15.849  52.885  158.293 1.00 85.20  ? 135  LYS A O   1 
ATOM   3811  C  CB  . LYS E  5  135  ? 13.879  55.422  158.328 1.00 73.18  ? 135  LYS A CB  1 
ATOM   3812  C  CG  . LYS E  5  135  ? 12.897  55.677  159.473 1.00 83.77  ? 135  LYS A CG  1 
ATOM   3813  C  CD  . LYS E  5  135  ? 11.615  56.355  158.999 1.00 91.32  ? 135  LYS A CD  1 
ATOM   3814  C  CE  . LYS E  5  135  ? 10.616  56.552  160.142 1.00 95.51  ? 135  LYS A CE  1 
ATOM   3815  N  NZ  . LYS E  5  135  ? 9.631   57.648  159.841 1.00 92.72  ? 135  LYS A NZ  1 
ATOM   3816  N  N   . LEU E  5  136  ? 16.656  54.457  156.910 1.00 77.88  ? 136  LEU A N   1 
ATOM   3817  C  CA  . LEU E  5  136  ? 17.336  53.472  156.086 1.00 75.78  ? 136  LEU A CA  1 
ATOM   3818  C  C   . LEU E  5  136  ? 18.297  52.649  156.930 1.00 81.32  ? 136  LEU A C   1 
ATOM   3819  O  O   . LEU E  5  136  ? 18.418  51.435  156.748 1.00 89.36  ? 136  LEU A O   1 
ATOM   3820  C  CB  . LEU E  5  136  ? 18.083  54.110  154.922 1.00 68.53  ? 136  LEU A CB  1 
ATOM   3821  C  CG  . LEU E  5  136  ? 18.781  52.990  154.149 1.00 73.71  ? 136  LEU A CG  1 
ATOM   3822  C  CD1 . LEU E  5  136  ? 18.145  52.752  152.798 1.00 77.13  ? 136  LEU A CD1 1 
ATOM   3823  C  CD2 . LEU E  5  136  ? 20.253  53.252  154.021 1.00 77.40  ? 136  LEU A CD2 1 
ATOM   3824  N  N   . ASP E  5  137  ? 18.945  53.306  157.885 1.00 80.32  ? 137  ASP A N   1 
ATOM   3825  C  CA  . ASP E  5  137  ? 19.907  52.628  158.744 1.00 83.65  ? 137  ASP A CA  1 
ATOM   3826  C  C   . ASP E  5  137  ? 19.227  51.620  159.662 1.00 90.09  ? 137  ASP A C   1 
ATOM   3827  O  O   . ASP E  5  137  ? 19.887  50.713  160.172 1.00 98.11  ? 137  ASP A O   1 
ATOM   3828  C  CB  . ASP E  5  137  ? 20.726  53.630  159.565 1.00 86.61  ? 137  ASP A CB  1 
ATOM   3829  C  CG  . ASP E  5  137  ? 21.942  54.175  158.808 1.00 94.70  ? 137  ASP A CG  1 
ATOM   3830  O  OD1 . ASP E  5  137  ? 22.021  54.017  157.567 1.00 99.59  ? 137  ASP A OD1 1 
ATOM   3831  O  OD2 . ASP E  5  137  ? 22.821  54.779  159.463 1.00 95.43  ? 137  ASP A OD2 1 
ATOM   3832  N  N   . GLU E  5  138  ? 17.914  51.767  159.861 1.00 88.56  ? 138  GLU A N   1 
ATOM   3833  C  CA  . GLU E  5  138  ? 17.159  50.883  160.760 1.00 87.26  ? 138  GLU A CA  1 
ATOM   3834  C  C   . GLU E  5  138  ? 16.883  49.524  160.139 1.00 82.59  ? 138  GLU A C   1 
ATOM   3835  O  O   . GLU E  5  138  ? 16.160  48.705  160.713 1.00 85.04  ? 138  GLU A O   1 
ATOM   3836  C  CB  . GLU E  5  138  ? 15.820  51.509  161.169 1.00 92.46  ? 138  GLU A CB  1 
ATOM   3837  C  CG  . GLU E  5  138  ? 15.911  52.656  162.168 1.00 101.61 ? 138  GLU A CG  1 
ATOM   3838  C  CD  . GLU E  5  138  ? 14.560  53.317  162.424 1.00 109.72 ? 138  GLU A CD  1 
ATOM   3839  O  OE1 . GLU E  5  138  ? 13.528  52.598  162.416 1.00 112.01 ? 138  GLU A OE1 1 
ATOM   3840  O  OE2 . GLU E  5  138  ? 14.538  54.558  162.617 1.00 106.73 ? 138  GLU A OE2 1 
ATOM   3841  N  N   . ILE E  5  139  ? 17.453  49.278  158.969 1.00 80.39  ? 139  ILE A N   1 
ATOM   3842  C  CA  . ILE E  5  139  ? 17.129  48.064  158.244 1.00 92.83  ? 139  ILE A CA  1 
ATOM   3843  C  C   . ILE E  5  139  ? 18.133  46.915  158.437 1.00 111.35 ? 139  ILE A C   1 
ATOM   3844  O  O   . ILE E  5  139  ? 19.257  46.976  157.922 1.00 116.86 ? 139  ILE A O   1 
ATOM   3845  C  CB  . ILE E  5  139  ? 16.897  48.363  156.746 1.00 86.98  ? 139  ILE A CB  1 
ATOM   3846  C  CG1 . ILE E  5  139  ? 15.669  49.259  156.574 1.00 80.76  ? 139  ILE A CG1 1 
ATOM   3847  C  CG2 . ILE E  5  139  ? 16.689  47.084  155.978 1.00 87.28  ? 139  ILE A CG2 1 
ATOM   3848  C  CD1 . ILE E  5  139  ? 15.204  49.396  155.156 1.00 70.07  ? 139  ILE A CD1 1 
ATOM   3849  N  N   . THR E  5  140  ? 17.708  45.907  159.221 1.00 120.11 ? 140  THR A N   1 
ATOM   3850  C  CA  . THR E  5  140  ? 18.262  44.531  159.267 1.00 124.97 ? 140  THR A CA  1 
ATOM   3851  C  C   . THR E  5  140  ? 17.109  43.589  159.672 1.00 130.45 ? 140  THR A C   1 
ATOM   3852  O  O   . THR E  5  140  ? 16.167  44.017  160.344 1.00 131.87 ? 140  THR A O   1 
ATOM   3853  C  CB  . THR E  5  140  ? 19.446  44.365  160.275 1.00 110.91 ? 140  THR A CB  1 
ATOM   3854  O  OG1 . THR E  5  140  ? 20.492  45.290  159.958 1.00 107.18 ? 140  THR A OG1 1 
ATOM   3855  C  CG2 . THR E  5  140  ? 20.021  42.907  160.278 1.00 94.18  ? 140  THR A CG2 1 
ATOM   3856  N  N   . LEU E  5  141  ? 17.170  42.320  159.270 1.00 130.19 ? 141  LEU A N   1 
ATOM   3857  C  CA  . LEU E  5  141  ? 16.083  41.380  159.564 1.00 126.26 ? 141  LEU A CA  1 
ATOM   3858  C  C   . LEU E  5  141  ? 16.232  40.645  160.894 1.00 123.28 ? 141  LEU A C   1 
ATOM   3859  O  O   . LEU E  5  141  ? 17.114  40.957  161.690 1.00 121.56 ? 141  LEU A O   1 
ATOM   3860  C  CB  . LEU E  5  141  ? 15.928  40.366  158.434 1.00 122.57 ? 141  LEU A CB  1 
ATOM   3861  C  CG  . LEU E  5  141  ? 15.426  40.940  157.110 1.00 113.61 ? 141  LEU A CG  1 
ATOM   3862  C  CD1 . LEU E  5  141  ? 16.553  41.565  156.270 1.00 97.38  ? 141  LEU A CD1 1 
ATOM   3863  C  CD2 . LEU E  5  141  ? 14.668  39.852  156.350 1.00 117.03 ? 141  LEU A CD2 1 
ATOM   3864  N  N   . SER E  5  174  ? 28.133  37.465  155.862 1.00 90.37  ? 174  SER A N   1 
ATOM   3865  C  CA  . SER E  5  174  ? 27.732  36.326  155.036 1.00 97.15  ? 174  SER A CA  1 
ATOM   3866  C  C   . SER E  5  174  ? 26.955  36.749  153.792 1.00 102.79 ? 174  SER A C   1 
ATOM   3867  O  O   . SER E  5  174  ? 25.966  37.469  153.902 1.00 100.82 ? 174  SER A O   1 
ATOM   3868  C  CB  . SER E  5  174  ? 26.850  35.380  155.832 1.00 97.04  ? 174  SER A CB  1 
ATOM   3869  O  OG  . SER E  5  174  ? 25.643  35.166  155.115 1.00 95.53  ? 174  SER A OG  1 
ATOM   3870  N  N   . SER E  5  175  ? 27.358  36.227  152.631 1.00 111.47 ? 175  SER A N   1 
ATOM   3871  C  CA  . SER E  5  175  ? 26.995  36.787  151.313 1.00 115.99 ? 175  SER A CA  1 
ATOM   3872  C  C   . SER E  5  175  ? 25.589  36.529  150.752 1.00 116.10 ? 175  SER A C   1 
ATOM   3873  O  O   . SER E  5  175  ? 25.200  37.146  149.757 1.00 109.20 ? 175  SER A O   1 
ATOM   3874  C  CB  . SER E  5  175  ? 28.029  36.384  150.245 1.00 117.67 ? 175  SER A CB  1 
ATOM   3875  O  OG  . SER E  5  175  ? 27.700  35.128  149.666 1.00 120.38 ? 175  SER A OG  1 
ATOM   3876  N  N   . THR E  5  176  ? 24.820  35.624  151.342 1.00 120.58 ? 176  THR A N   1 
ATOM   3877  C  CA  . THR E  5  176  ? 23.484  35.428  150.796 1.00 121.67 ? 176  THR A CA  1 
ATOM   3878  C  C   . THR E  5  176  ? 22.505  36.404  151.427 1.00 112.14 ? 176  THR A C   1 
ATOM   3879  O  O   . THR E  5  176  ? 21.682  37.009  150.734 1.00 97.85  ? 176  THR A O   1 
ATOM   3880  C  CB  . THR E  5  176  ? 22.997  33.969  150.911 1.00 131.96 ? 176  THR A CB  1 
ATOM   3881  O  OG1 . THR E  5  176  ? 23.138  33.505  152.262 1.00 133.88 ? 176  THR A OG1 1 
ATOM   3882  C  CG2 . THR E  5  176  ? 23.807  33.086  149.972 1.00 134.78 ? 176  THR A CG2 1 
ATOM   3883  N  N   . LEU E  5  177  ? 22.626  36.562  152.744 1.00 115.77 ? 177  LEU A N   1 
ATOM   3884  C  CA  . LEU E  5  177  ? 21.835  37.524  153.502 1.00 115.49 ? 177  LEU A CA  1 
ATOM   3885  C  C   . LEU E  5  177  ? 22.035  38.950  153.007 1.00 113.59 ? 177  LEU A C   1 
ATOM   3886  O  O   . LEU E  5  177  ? 21.078  39.712  152.900 1.00 115.26 ? 177  LEU A O   1 
ATOM   3887  C  CB  . LEU E  5  177  ? 22.210  37.461  154.982 1.00 115.25 ? 177  LEU A CB  1 
ATOM   3888  C  CG  . LEU E  5  177  ? 21.590  36.332  155.798 1.00 120.82 ? 177  LEU A CG  1 
ATOM   3889  C  CD1 . LEU E  5  177  ? 22.210  36.261  157.190 1.00 120.93 ? 177  LEU A CD1 1 
ATOM   3890  C  CD2 . LEU E  5  177  ? 20.082  36.530  155.882 1.00 122.68 ? 177  LEU A CD2 1 
ATOM   3891  N  N   . LEU E  5  178  ? 23.284  39.299  152.711 1.00 109.64 ? 178  LEU A N   1 
ATOM   3892  C  CA  . LEU E  5  178  ? 23.644  40.665  152.355 1.00 98.99  ? 178  LEU A CA  1 
ATOM   3893  C  C   . LEU E  5  178  ? 22.896  41.158  151.131 1.00 101.25 ? 178  LEU A C   1 
ATOM   3894  O  O   . LEU E  5  178  ? 22.396  42.274  151.117 1.00 105.45 ? 178  LEU A O   1 
ATOM   3895  C  CB  . LEU E  5  178  ? 25.151  40.801  152.134 1.00 95.38  ? 178  LEU A CB  1 
ATOM   3896  C  CG  . LEU E  5  178  ? 26.029  40.620  153.377 1.00 98.89  ? 178  LEU A CG  1 
ATOM   3897  C  CD1 . LEU E  5  178  ? 27.515  40.676  153.029 1.00 100.49 ? 178  LEU A CD1 1 
ATOM   3898  C  CD2 . LEU E  5  178  ? 25.684  41.630  154.458 1.00 97.61  ? 178  LEU A CD2 1 
ATOM   3899  N  N   . ASN E  5  179  ? 22.802  40.331  150.104 1.00 107.79 ? 179  ASN A N   1 
ATOM   3900  C  CA  . ASN E  5  179  ? 22.116  40.759  148.892 1.00 112.94 ? 179  ASN A CA  1 
ATOM   3901  C  C   . ASN E  5  179  ? 20.627  40.974  149.101 1.00 106.84 ? 179  ASN A C   1 
ATOM   3902  O  O   . ASN E  5  179  ? 20.010  41.767  148.393 1.00 107.18 ? 179  ASN A O   1 
ATOM   3903  C  CB  . ASN E  5  179  ? 22.375  39.783  147.756 1.00 126.96 ? 179  ASN A CB  1 
ATOM   3904  C  CG  . ASN E  5  179  ? 23.842  39.618  147.488 1.00 141.64 ? 179  ASN A CG  1 
ATOM   3905  O  OD1 . ASN E  5  179  ? 24.647  39.581  148.421 1.00 149.43 ? 179  ASN A OD1 1 
ATOM   3906  N  ND2 . ASN E  5  179  ? 24.211  39.540  146.216 1.00 146.23 ? 179  ASN A ND2 1 
ATOM   3907  N  N   . GLU E  5  180  ? 20.057  40.274  150.077 1.00 104.73 ? 180  GLU A N   1 
ATOM   3908  C  CA  . GLU E  5  180  ? 18.671  40.513  150.446 1.00 105.96 ? 180  GLU A CA  1 
ATOM   3909  C  C   . GLU E  5  180  ? 18.583  41.803  151.250 1.00 101.97 ? 180  GLU A C   1 
ATOM   3910  O  O   . GLU E  5  180  ? 17.650  42.579  151.062 1.00 110.26 ? 180  GLU A O   1 
ATOM   3911  C  CB  . GLU E  5  180  ? 18.064  39.324  151.198 1.00 115.83 ? 180  GLU A CB  1 
ATOM   3912  C  CG  . GLU E  5  180  ? 17.707  38.161  150.279 1.00 129.92 ? 180  GLU A CG  1 
ATOM   3913  C  CD  . GLU E  5  180  ? 17.222  36.929  151.025 1.00 144.72 ? 180  GLU A CD  1 
ATOM   3914  O  OE1 . GLU E  5  180  ? 17.122  36.987  152.270 1.00 150.83 ? 180  GLU A OE1 1 
ATOM   3915  O  OE2 . GLU E  5  180  ? 16.942  35.902  150.364 1.00 147.71 ? 180  GLU A OE2 1 
ATOM   3916  N  N   . LEU E  5  181  ? 19.565  42.046  152.117 1.00 86.68  ? 181  LEU A N   1 
ATOM   3917  C  CA  . LEU E  5  181  ? 19.635  43.307  152.844 1.00 82.79  ? 181  LEU A CA  1 
ATOM   3918  C  C   . LEU E  5  181  ? 19.743  44.495  151.878 1.00 84.20  ? 181  LEU A C   1 
ATOM   3919  O  O   . LEU E  5  181  ? 18.938  45.425  151.937 1.00 84.86  ? 181  LEU A O   1 
ATOM   3920  C  CB  . LEU E  5  181  ? 20.809  43.322  153.822 1.00 82.31  ? 181  LEU A CB  1 
ATOM   3921  C  CG  . LEU E  5  181  ? 21.013  44.681  154.504 1.00 85.18  ? 181  LEU A CG  1 
ATOM   3922  C  CD1 . LEU E  5  181  ? 20.043  44.840  155.658 1.00 80.73  ? 181  LEU A CD1 1 
ATOM   3923  C  CD2 . LEU E  5  181  ? 22.459  44.884  154.964 1.00 90.25  ? 181  LEU A CD2 1 
ATOM   3924  N  N   . LYS E  5  182  ? 20.741  44.448  150.996 1.00 84.06  ? 182  LYS A N   1 
ATOM   3925  C  CA  . LYS E  5  182  ? 20.909  45.434  149.928 1.00 84.19  ? 182  LYS A CA  1 
ATOM   3926  C  C   . LYS E  5  182  ? 19.598  45.649  149.189 1.00 86.26  ? 182  LYS A C   1 
ATOM   3927  O  O   . LYS E  5  182  ? 19.181  46.779  148.939 1.00 87.96  ? 182  LYS A O   1 
ATOM   3928  C  CB  . LYS E  5  182  ? 21.987  44.986  148.921 1.00 84.51  ? 182  LYS A CB  1 
ATOM   3929  C  CG  . LYS E  5  182  ? 23.435  45.285  149.333 1.00 87.07  ? 182  LYS A CG  1 
ATOM   3930  C  CD  . LYS E  5  182  ? 24.419  45.153  148.168 1.00 90.75  ? 182  LYS A CD  1 
ATOM   3931  C  CE  . LYS E  5  182  ? 24.565  43.714  147.712 1.00 108.18 ? 182  LYS A CE  1 
ATOM   3932  N  NZ  . LYS E  5  182  ? 25.728  43.511  146.799 1.00 115.93 ? 182  LYS A NZ  1 
ATOM   3933  N  N   . SER E  5  183  ? 18.945  44.548  148.854 1.00 87.94  ? 183  SER A N   1 
ATOM   3934  C  CA  . SER E  5  183  ? 17.725  44.597  148.069 1.00 94.75  ? 183  SER A CA  1 
ATOM   3935  C  C   . SER E  5  183  ? 16.573  45.293  148.794 1.00 98.60  ? 183  SER A C   1 
ATOM   3936  O  O   . SER E  5  183  ? 15.808  46.035  148.174 1.00 96.19  ? 183  SER A O   1 
ATOM   3937  C  CB  . SER E  5  183  ? 17.305  43.187  147.675 1.00 95.94  ? 183  SER A CB  1 
ATOM   3938  O  OG  . SER E  5  183  ? 16.131  43.227  146.892 1.00 102.45 ? 183  SER A OG  1 
ATOM   3939  N  N   . LYS E  5  184  ? 16.445  45.047  150.097 1.00 95.15  ? 184  LYS A N   1 
ATOM   3940  C  CA  . LYS E  5  184  ? 15.322  45.588  150.855 1.00 85.75  ? 184  LYS A CA  1 
ATOM   3941  C  C   . LYS E  5  184  ? 15.543  47.045  151.228 1.00 84.36  ? 184  LYS A C   1 
ATOM   3942  O  O   . LYS E  5  184  ? 14.589  47.807  151.356 1.00 85.21  ? 184  LYS A O   1 
ATOM   3943  C  CB  . LYS E  5  184  ? 14.995  44.738  152.087 1.00 83.19  ? 184  LYS A CB  1 
ATOM   3944  C  CG  . LYS E  5  184  ? 13.721  43.919  151.913 1.00 91.72  ? 184  LYS A CG  1 
ATOM   3945  C  CD  . LYS E  5  184  ? 13.333  43.163  153.176 1.00 100.82 ? 184  LYS A CD  1 
ATOM   3946  C  CE  . LYS E  5  184  ? 12.132  42.253  152.915 1.00 108.32 ? 184  LYS A CE  1 
ATOM   3947  N  NZ  . LYS E  5  184  ? 12.101  41.045  153.810 1.00 113.18 ? 184  LYS A NZ  1 
ATOM   3948  N  N   . ARG E  5  185  ? 16.801  47.423  151.404 1.00 82.00  ? 185  ARG A N   1 
ATOM   3949  C  CA  . ARG E  5  185  ? 17.149  48.824  151.561 1.00 84.72  ? 185  ARG A CA  1 
ATOM   3950  C  C   . ARG E  5  185  ? 16.824  49.564  150.271 1.00 85.66  ? 185  ARG A C   1 
ATOM   3951  O  O   . ARG E  5  185  ? 16.299  50.684  150.292 1.00 83.47  ? 185  ARG A O   1 
ATOM   3952  C  CB  . ARG E  5  185  ? 18.631  48.969  151.884 1.00 85.45  ? 185  ARG A CB  1 
ATOM   3953  C  CG  . ARG E  5  185  ? 18.962  48.747  153.336 1.00 68.54  ? 185  ARG A CG  1 
ATOM   3954  C  CD  . ARG E  5  185  ? 20.443  48.735  153.486 1.00 68.12  ? 185  ARG A CD  1 
ATOM   3955  N  NE  . ARG E  5  185  ? 20.869  48.527  154.859 1.00 75.40  ? 185  ARG A NE  1 
ATOM   3956  C  CZ  . ARG E  5  185  ? 22.141  48.385  155.210 1.00 79.62  ? 185  ARG A CZ  1 
ATOM   3957  N  NH1 . ARG E  5  185  ? 23.103  48.416  154.287 1.00 78.46  ? 185  ARG A NH1 1 
ATOM   3958  N  NH2 . ARG E  5  185  ? 22.452  48.209  156.479 1.00 86.11  ? 185  ARG A NH2 1 
ATOM   3959  N  N   . SER E  5  186  ? 17.133  48.923  149.145 1.00 84.24  ? 186  SER A N   1 
ATOM   3960  C  CA  . SER E  5  186  ? 16.885  49.513  147.842 1.00 72.05  ? 186  SER A CA  1 
ATOM   3961  C  C   . SER E  5  186  ? 15.407  49.726  147.622 1.00 74.60  ? 186  SER A C   1 
ATOM   3962  O  O   . SER E  5  186  ? 15.002  50.789  147.172 1.00 78.35  ? 186  SER A O   1 
ATOM   3963  C  CB  . SER E  5  186  ? 17.472  48.660  146.726 1.00 72.89  ? 186  SER A CB  1 
ATOM   3964  O  OG  . SER E  5  186  ? 18.399  49.417  145.956 1.00 76.69  ? 186  SER A OG  1 
ATOM   3965  N  N   . GLU E  5  187  ? 14.589  48.735  147.956 1.00 80.29  ? 187  GLU A N   1 
ATOM   3966  C  CA  . GLU E  5  187  ? 13.152  48.912  147.773 1.00 86.89  ? 187  GLU A CA  1 
ATOM   3967  C  C   . GLU E  5  187  ? 12.570  49.922  148.772 1.00 80.47  ? 187  GLU A C   1 
ATOM   3968  O  O   . GLU E  5  187  ? 11.474  50.434  148.567 1.00 79.72  ? 187  GLU A O   1 
ATOM   3969  C  CB  . GLU E  5  187  ? 12.383  47.578  147.765 1.00 101.38 ? 187  GLU A CB  1 
ATOM   3970  C  CG  . GLU E  5  187  ? 12.196  46.872  149.119 1.00 118.93 ? 187  GLU A CG  1 
ATOM   3971  C  CD  . GLU E  5  187  ? 11.202  45.695  149.049 1.00 134.78 ? 187  GLU A CD  1 
ATOM   3972  O  OE1 . GLU E  5  187  ? 10.112  45.869  148.453 1.00 140.05 ? 187  GLU A OE1 1 
ATOM   3973  O  OE2 . GLU E  5  187  ? 11.509  44.597  149.582 1.00 139.21 ? 187  GLU A OE2 1 
ATOM   3974  N  N   . TYR E  5  188  ? 13.304  50.229  149.838 1.00 75.26  ? 188  TYR A N   1 
ATOM   3975  C  CA  . TYR E  5  188  ? 12.827  51.236  150.773 1.00 78.84  ? 188  TYR A CA  1 
ATOM   3976  C  C   . TYR E  5  188  ? 13.055  52.625  150.190 1.00 78.55  ? 188  TYR A C   1 
ATOM   3977  O  O   . TYR E  5  188  ? 12.168  53.490  150.231 1.00 75.56  ? 188  TYR A O   1 
ATOM   3978  C  CB  . TYR E  5  188  ? 13.491  51.130  152.148 1.00 67.46  ? 188  TYR A CB  1 
ATOM   3979  C  CG  . TYR E  5  188  ? 13.105  52.288  153.042 1.00 67.64  ? 188  TYR A CG  1 
ATOM   3980  C  CD1 . TYR E  5  188  ? 11.836  52.353  153.616 1.00 73.61  ? 188  TYR A CD1 1 
ATOM   3981  C  CD2 . TYR E  5  188  ? 13.994  53.338  153.285 1.00 66.23  ? 188  TYR A CD2 1 
ATOM   3982  C  CE1 . TYR E  5  188  ? 11.462  53.423  154.430 1.00 81.95  ? 188  TYR A CE1 1 
ATOM   3983  C  CE2 . TYR E  5  188  ? 13.634  54.418  154.099 1.00 74.25  ? 188  TYR A CE2 1 
ATOM   3984  C  CZ  . TYR E  5  188  ? 12.363  54.458  154.667 1.00 81.27  ? 188  TYR A CZ  1 
ATOM   3985  O  OH  . TYR E  5  188  ? 11.991  55.522  155.468 1.00 76.38  ? 188  TYR A OH  1 
ATOM   3986  N  N   . VAL E  5  189  ? 14.247  52.827  149.640 1.00 69.18  ? 189  VAL A N   1 
ATOM   3987  C  CA  . VAL E  5  189  ? 14.578  54.100  149.041 1.00 65.03  ? 189  VAL A CA  1 
ATOM   3988  C  C   . VAL E  5  189  ? 13.589  54.445  147.933 1.00 65.98  ? 189  VAL A C   1 
ATOM   3989  O  O   . VAL E  5  189  ? 13.063  55.546  147.890 1.00 70.54  ? 189  VAL A O   1 
ATOM   3990  C  CB  . VAL E  5  189  ? 16.000  54.092  148.501 1.00 66.45  ? 189  VAL A CB  1 
ATOM   3991  C  CG1 . VAL E  5  189  ? 16.252  55.334  147.647 1.00 59.74  ? 189  VAL A CG1 1 
ATOM   3992  C  CG2 . VAL E  5  189  ? 16.991  53.994  149.655 1.00 61.34  ? 189  VAL A CG2 1 
ATOM   3993  N  N   . ASP E  5  190  ? 13.316  53.491  147.055 1.00 75.09  ? 190  ASP A N   1 
ATOM   3994  C  CA  . ASP E  5  190  ? 12.359  53.698  145.972 1.00 75.35  ? 190  ASP A CA  1 
ATOM   3995  C  C   . ASP E  5  190  ? 10.984  54.058  146.510 1.00 74.20  ? 190  ASP A C   1 
ATOM   3996  O  O   . ASP E  5  190  ? 10.366  55.003  146.037 1.00 69.35  ? 190  ASP A O   1 
ATOM   3997  C  CB  . ASP E  5  190  ? 12.260  52.456  145.081 1.00 81.25  ? 190  ASP A CB  1 
ATOM   3998  C  CG  . ASP E  5  190  ? 13.416  52.347  144.104 1.00 92.64  ? 190  ASP A CG  1 
ATOM   3999  O  OD1 . ASP E  5  190  ? 13.464  53.153  143.153 1.00 101.74 ? 190  ASP A OD1 1 
ATOM   4000  O  OD2 . ASP E  5  190  ? 14.278  51.461  144.285 1.00 92.89  ? 190  ASP A OD2 1 
ATOM   4001  N  N   . MET E  5  191  ? 10.515  53.307  147.506 1.00 75.77  ? 191  MET A N   1 
ATOM   4002  C  CA  . MET E  5  191  ? 9.185   53.515  148.062 1.00 80.51  ? 191  MET A CA  1 
ATOM   4003  C  C   . MET E  5  191  ? 9.080   54.891  148.706 1.00 80.76  ? 191  MET A C   1 
ATOM   4004  O  O   . MET E  5  191  ? 8.033   55.529  148.643 1.00 83.69  ? 191  MET A O   1 
ATOM   4005  C  CB  . MET E  5  191  ? 8.839   52.403  149.065 1.00 93.88  ? 191  MET A CB  1 
ATOM   4006  C  CG  . MET E  5  191  ? 7.435   52.481  149.679 1.00 102.29 ? 191  MET A CG  1 
ATOM   4007  S  SD  . MET E  5  191  ? 7.292   53.588  151.111 1.00 182.77 ? 191  MET A SD  1 
ATOM   4008  C  CE  . MET E  5  191  ? 8.369   52.784  152.297 1.00 84.64  ? 191  MET A CE  1 
ATOM   4009  N  N   . ALA E  5  192  ? 10.175  55.344  149.311 1.00 76.39  ? 192  ALA A N   1 
ATOM   4010  C  CA  . ALA E  5  192  ? 10.208  56.623  150.012 1.00 66.60  ? 192  ALA A CA  1 
ATOM   4011  C  C   . ALA E  5  192  ? 10.179  57.796  149.056 1.00 70.17  ? 192  ALA A C   1 
ATOM   4012  O  O   . ALA E  5  192  ? 9.449   58.766  149.278 1.00 74.88  ? 192  ALA A O   1 
ATOM   4013  C  CB  . ALA E  5  192  ? 11.434  56.710  150.888 1.00 64.43  ? 192  ALA A CB  1 
ATOM   4014  N  N   . ILE E  5  193  ? 10.991  57.716  148.007 1.00 60.39  ? 193  ILE A N   1 
ATOM   4015  C  CA  . ILE E  5  193  ? 10.999  58.735  146.968 1.00 65.28  ? 193  ILE A CA  1 
ATOM   4016  C  C   . ILE E  5  193  ? 9.670   58.793  146.220 1.00 64.39  ? 193  ILE A C   1 
ATOM   4017  O  O   . ILE E  5  193  ? 9.166   59.863  145.916 1.00 65.09  ? 193  ILE A O   1 
ATOM   4018  C  CB  . ILE E  5  193  ? 12.122  58.496  145.966 1.00 58.61  ? 193  ILE A CB  1 
ATOM   4019  C  CG1 . ILE E  5  193  ? 13.455  58.460  146.694 1.00 57.85  ? 193  ILE A CG1 1 
ATOM   4020  C  CG2 . ILE E  5  193  ? 12.136  59.590  144.891 1.00 57.49  ? 193  ILE A CG2 1 
ATOM   4021  C  CD1 . ILE E  5  193  ? 14.621  58.258  145.782 1.00 64.37  ? 193  ILE A CD1 1 
ATOM   4022  N  N   . ALA E  5  194  ? 9.104   57.636  145.921 1.00 64.18  ? 194  ALA A N   1 
ATOM   4023  C  CA  . ALA E  5  194  ? 7.810   57.587  145.260 1.00 65.88  ? 194  ALA A CA  1 
ATOM   4024  C  C   . ALA E  5  194  ? 6.792   58.299  146.117 1.00 70.86  ? 194  ALA A C   1 
ATOM   4025  O  O   . ALA E  5  194  ? 6.080   59.179  145.633 1.00 78.91  ? 194  ALA A O   1 
ATOM   4026  C  CB  . ALA E  5  194  ? 7.384   56.168  145.037 1.00 64.65  ? 194  ALA A CB  1 
ATOM   4027  N  N   . LYS E  5  195  ? 6.732   57.911  147.391 1.00 66.60  ? 195  LYS A N   1 
ATOM   4028  C  CA  . LYS E  5  195  ? 5.790   58.504  148.334 1.00 66.84  ? 195  LYS A CA  1 
ATOM   4029  C  C   . LYS E  5  195  ? 6.047   59.995  148.469 1.00 69.55  ? 195  LYS A C   1 
ATOM   4030  O  O   . LYS E  5  195  ? 5.111   60.791  148.501 1.00 70.50  ? 195  LYS A O   1 
ATOM   4031  C  CB  . LYS E  5  195  ? 5.876   57.820  149.697 1.00 67.25  ? 195  LYS A CB  1 
ATOM   4032  C  CG  . LYS E  5  195  ? 4.807   58.224  150.702 1.00 81.41  ? 195  LYS A CG  1 
ATOM   4033  C  CD  . LYS E  5  195  ? 4.772   57.230  151.874 1.00 94.75  ? 195  LYS A CD  1 
ATOM   4034  C  CE  . LYS E  5  195  ? 3.966   57.752  153.067 1.00 102.00 ? 195  LYS A CE  1 
ATOM   4035  N  NZ  . LYS E  5  195  ? 4.293   57.007  154.328 1.00 101.10 ? 195  LYS A NZ  1 
ATOM   4036  N  N   . ALA E  5  196  ? 7.315   60.380  148.516 1.00 66.10  ? 196  ALA A N   1 
ATOM   4037  C  CA  . ALA E  5  196  ? 7.631   61.791  148.671 1.00 72.35  ? 196  ALA A CA  1 
ATOM   4038  C  C   . ALA E  5  196  ? 7.192   62.611  147.465 1.00 71.72  ? 196  ALA A C   1 
ATOM   4039  O  O   . ALA E  5  196  ? 6.794   63.755  147.608 1.00 73.79  ? 196  ALA A O   1 
ATOM   4040  C  CB  . ALA E  5  196  ? 9.102   61.989  148.932 1.00 75.18  ? 196  ALA A CB  1 
ATOM   4041  N  N   . LEU E  5  197  ? 7.274   62.027  146.278 1.00 72.38  ? 197  LEU A N   1 
ATOM   4042  C  CA  . LEU E  5  197  ? 6.876   62.731  145.062 1.00 71.80  ? 197  LEU A CA  1 
ATOM   4043  C  C   . LEU E  5  197  ? 5.358   62.861  144.951 1.00 82.45  ? 197  LEU A C   1 
ATOM   4044  O  O   . LEU E  5  197  ? 4.857   63.871  144.452 1.00 82.05  ? 197  LEU A O   1 
ATOM   4045  C  CB  . LEU E  5  197  ? 7.408   62.011  143.829 1.00 66.73  ? 197  LEU A CB  1 
ATOM   4046  C  CG  . LEU E  5  197  ? 8.920   62.051  143.656 1.00 73.07  ? 197  LEU A CG  1 
ATOM   4047  C  CD1 . LEU E  5  197  ? 9.380   60.945  142.730 1.00 58.34  ? 197  LEU A CD1 1 
ATOM   4048  C  CD2 . LEU E  5  197  ? 9.340   63.415  143.140 1.00 71.96  ? 197  LEU A CD2 1 
ATOM   4049  N  N   . SER E  5  198  ? 4.630   61.837  145.402 1.00 84.48  ? 198  SER A N   1 
ATOM   4050  C  CA  . SER E  5  198  ? 3.178   61.834  145.269 1.00 82.79  ? 198  SER A CA  1 
ATOM   4051  C  C   . SER E  5  198  ? 2.563   62.941  146.112 1.00 81.60  ? 198  SER A C   1 
ATOM   4052  O  O   . SER E  5  198  ? 1.740   63.703  145.612 1.00 83.91  ? 198  SER A O   1 
ATOM   4053  C  CB  . SER E  5  198  ? 2.564   60.459  145.582 1.00 86.98  ? 198  SER A CB  1 
ATOM   4054  O  OG  . SER E  5  198  ? 2.672   60.118  146.953 1.00 91.40  ? 198  SER A OG  1 
ATOM   4055  N  N   . ASP E  5  199  ? 2.966   63.044  147.378 1.00 84.18  ? 199  ASP A N   1 
ATOM   4056  C  CA  . ASP E  5  199  ? 2.586   64.212  148.176 1.00 86.27  ? 199  ASP A CA  1 
ATOM   4057  C  C   . ASP E  5  199  ? 3.489   65.403  147.866 1.00 87.49  ? 199  ASP A C   1 
ATOM   4058  O  O   . ASP E  5  199  ? 4.255   65.380  146.905 1.00 90.15  ? 199  ASP A O   1 
ATOM   4059  C  CB  . ASP E  5  199  ? 2.471   63.924  149.693 1.00 90.38  ? 199  ASP A CB  1 
ATOM   4060  C  CG  . ASP E  5  199  ? 3.535   62.972  150.216 1.00 95.53  ? 199  ASP A CG  1 
ATOM   4061  O  OD1 . ASP E  5  199  ? 4.728   63.197  149.915 1.00 100.89 ? 199  ASP A OD1 1 
ATOM   4062  O  OD2 . ASP E  5  199  ? 3.174   62.012  150.948 1.00 92.43  ? 199  ASP A OD2 1 
ATOM   4063  N  N   . GLY E  5  200  ? 3.396   66.455  148.658 1.00 92.78  ? 200  GLY A N   1 
ATOM   4064  C  CA  . GLY E  5  200  ? 4.117   67.671  148.323 1.00 95.80  ? 200  GLY A CA  1 
ATOM   4065  C  C   . GLY E  5  200  ? 5.637   67.627  148.339 1.00 83.59  ? 200  GLY A C   1 
ATOM   4066  O  O   . GLY E  5  200  ? 6.270   68.353  147.574 1.00 79.45  ? 200  GLY A O   1 
ATOM   4067  N  N   . ARG E  5  201  ? 6.209   66.756  149.177 1.00 73.05  ? 201  ARG A N   1 
ATOM   4068  C  CA  . ARG E  5  201  ? 7.576   66.916  149.697 1.00 61.08  ? 201  ARG A CA  1 
ATOM   4069  C  C   . ARG E  5  201  ? 8.779   67.032  148.736 1.00 61.28  ? 201  ARG A C   1 
ATOM   4070  O  O   . ARG E  5  201  ? 9.846   67.476  149.179 1.00 65.82  ? 201  ARG A O   1 
ATOM   4071  C  CB  . ARG E  5  201  ? 7.846   65.888  150.797 1.00 60.34  ? 201  ARG A CB  1 
ATOM   4072  C  CG  . ARG E  5  201  ? 6.964   66.051  152.029 1.00 57.04  ? 201  ARG A CG  1 
ATOM   4073  C  CD  . ARG E  5  201  ? 6.495   64.719  152.571 1.00 64.63  ? 201  ARG A CD  1 
ATOM   4074  N  NE  . ARG E  5  201  ? 7.584   63.748  152.587 1.00 69.11  ? 201  ARG A NE  1 
ATOM   4075  C  CZ  . ARG E  5  201  ? 7.406   62.434  152.577 1.00 74.79  ? 201  ARG A CZ  1 
ATOM   4076  N  NH1 . ARG E  5  201  ? 6.176   61.925  152.556 1.00 74.01  ? 201  ARG A NH1 1 
ATOM   4077  N  NH2 . ARG E  5  201  ? 8.460   61.630  152.585 1.00 81.94  ? 201  ARG A NH2 1 
ATOM   4078  N  N   . THR E  5  202  ? 8.633   66.646  147.460 1.00 59.32  ? 202  THR A N   1 
ATOM   4079  C  CA  . THR E  5  202  ? 9.721   66.827  146.479 1.00 69.39  ? 202  THR A CA  1 
ATOM   4080  C  C   . THR E  5  202  ? 9.276   66.865  145.029 1.00 79.14  ? 202  THR A C   1 
ATOM   4081  O  O   . THR E  5  202  ? 8.174   66.453  144.693 1.00 88.94  ? 202  THR A O   1 
ATOM   4082  C  CB  . THR E  5  202  ? 10.774  65.692  146.499 1.00 72.93  ? 202  THR A CB  1 
ATOM   4083  O  OG1 . THR E  5  202  ? 10.679  64.936  147.708 1.00 87.75  ? 202  THR A OG1 1 
ATOM   4084  C  CG2 . THR E  5  202  ? 12.180  66.252  146.330 1.00 58.71  ? 202  THR A CG2 1 
ATOM   4085  N  N   . THR E  5  203  ? 10.180  67.336  144.177 1.00 80.80  ? 203  THR A N   1 
ATOM   4086  C  CA  . THR E  5  203  ? 10.061  67.219  142.737 1.00 81.78  ? 203  THR A CA  1 
ATOM   4087  C  C   . THR E  5  203  ? 11.189  66.338  142.222 1.00 85.88  ? 203  THR A C   1 
ATOM   4088  O  O   . THR E  5  203  ? 12.088  65.946  142.969 1.00 78.87  ? 203  THR A O   1 
ATOM   4089  C  CB  . THR E  5  203  ? 10.199  68.581  142.039 1.00 80.06  ? 203  THR A CB  1 
ATOM   4090  O  OG1 . THR E  5  203  ? 11.400  69.232  142.493 1.00 80.39  ? 203  THR A OG1 1 
ATOM   4091  C  CG2 . THR E  5  203  ? 8.991   69.453  142.330 1.00 79.78  ? 203  THR A CG2 1 
ATOM   4092  N  N   . GLU E  5  204  ? 11.146  66.053  140.926 1.00 89.44  ? 204  GLU A N   1 
ATOM   4093  C  CA  . GLU E  5  204  ? 12.155  65.240  140.284 1.00 84.16  ? 204  GLU A CA  1 
ATOM   4094  C  C   . GLU E  5  204  ? 13.457  66.005  140.185 1.00 75.13  ? 204  GLU A C   1 
ATOM   4095  O  O   . GLU E  5  204  ? 14.478  65.439  139.810 1.00 75.12  ? 204  GLU A O   1 
ATOM   4096  C  CB  . GLU E  5  204  ? 11.674  64.813  138.896 1.00 100.25 ? 204  GLU A CB  1 
ATOM   4097  C  CG  . GLU E  5  204  ? 10.898  63.496  138.887 1.00 117.01 ? 204  GLU A CG  1 
ATOM   4098  C  CD  . GLU E  5  204  ? 11.805  62.271  139.042 1.00 124.56 ? 204  GLU A CD  1 
ATOM   4099  O  OE1 . GLU E  5  204  ? 13.046  62.412  138.893 1.00 118.94 ? 204  GLU A OE1 1 
ATOM   4100  O  OE2 . GLU E  5  204  ? 11.273  61.168  139.312 1.00 130.24 ? 204  GLU A OE2 1 
ATOM   4101  N  N   . ARG E  5  205  ? 13.412  67.294  140.518 1.00 77.89  ? 205  ARG A N   1 
ATOM   4102  C  CA  . ARG E  5  205  ? 14.591  68.162  140.493 1.00 79.51  ? 205  ARG A CA  1 
ATOM   4103  C  C   . ARG E  5  205  ? 15.254  68.160  141.864 1.00 71.30  ? 205  ARG A C   1 
ATOM   4104  O  O   . ARG E  5  205  ? 16.295  68.776  142.073 1.00 71.47  ? 205  ARG A O   1 
ATOM   4105  C  CB  . ARG E  5  205  ? 14.205  69.594  140.100 1.00 89.95  ? 205  ARG A CB  1 
ATOM   4106  C  CG  . ARG E  5  205  ? 13.636  69.739  138.693 1.00 102.84 ? 205  ARG A CG  1 
ATOM   4107  C  CD  . ARG E  5  205  ? 12.889  71.061  138.539 1.00 115.30 ? 205  ARG A CD  1 
ATOM   4108  N  NE  . ARG E  5  205  ? 12.598  71.368  137.139 1.00 126.49 ? 205  ARG A NE  1 
ATOM   4109  C  CZ  . ARG E  5  205  ? 13.405  72.061  136.334 1.00 131.15 ? 205  ARG A CZ  1 
ATOM   4110  N  NH1 . ARG E  5  205  ? 14.567  72.532  136.778 1.00 128.55 ? 205  ARG A NH1 1 
ATOM   4111  N  NH2 . ARG E  5  205  ? 13.048  72.287  135.077 1.00 133.84 ? 205  ARG A NH2 1 
ATOM   4112  N  N   . GLY E  5  206  ? 14.636  67.466  142.809 1.00 72.46  ? 206  GLY A N   1 
ATOM   4113  C  CA  . GLY E  5  206  ? 15.204  67.343  144.138 1.00 71.97  ? 206  GLY A CA  1 
ATOM   4114  C  C   . GLY E  5  206  ? 14.747  68.441  145.073 1.00 71.66  ? 206  GLY A C   1 
ATOM   4115  O  O   . GLY E  5  206  ? 13.852  69.224  144.747 1.00 76.43  ? 206  GLY A O   1 
ATOM   4116  N  N   . SER E  5  207  ? 15.357  68.474  146.250 1.00 63.46  ? 207  SER A N   1 
ATOM   4117  C  CA  . SER E  5  207  ? 15.063  69.462  147.269 1.00 67.68  ? 207  SER A CA  1 
ATOM   4118  C  C   . SER E  5  207  ? 16.359  69.737  147.985 1.00 71.72  ? 207  SER A C   1 
ATOM   4119  O  O   . SER E  5  207  ? 17.007  68.820  148.467 1.00 71.82  ? 207  SER A O   1 
ATOM   4120  C  CB  . SER E  5  207  ? 14.020  68.947  148.263 1.00 76.17  ? 207  SER A CB  1 
ATOM   4121  O  OG  . SER E  5  207  ? 12.699  69.069  147.750 1.00 80.76  ? 207  SER A OG  1 
ATOM   4122  N  N   . PHE E  5  208  ? 16.754  70.999  148.048 1.00 77.00  ? 208  PHE A N   1 
ATOM   4123  C  CA  . PHE E  5  208  ? 18.072  71.291  148.559 1.00 77.81  ? 208  PHE A CA  1 
ATOM   4124  C  C   . PHE E  5  208  ? 18.146  72.528  149.451 1.00 86.20  ? 208  PHE A C   1 
ATOM   4125  O  O   . PHE E  5  208  ? 18.267  73.660  148.970 1.00 96.87  ? 208  PHE A O   1 
ATOM   4126  C  CB  . PHE E  5  208  ? 19.057  71.393  147.413 1.00 78.52  ? 208  PHE A CB  1 
ATOM   4127  C  CG  . PHE E  5  208  ? 20.444  71.030  147.802 1.00 97.26  ? 208  PHE A CG  1 
ATOM   4128  C  CD1 . PHE E  5  208  ? 20.755  69.724  148.140 1.00 106.64 ? 208  PHE A CD1 1 
ATOM   4129  C  CD2 . PHE E  5  208  ? 21.442  71.992  147.859 1.00 102.45 ? 208  PHE A CD2 1 
ATOM   4130  C  CE1 . PHE E  5  208  ? 22.049  69.384  148.522 1.00 108.87 ? 208  PHE A CE1 1 
ATOM   4131  C  CE2 . PHE E  5  208  ? 22.734  71.658  148.234 1.00 100.03 ? 208  PHE A CE2 1 
ATOM   4132  C  CZ  . PHE E  5  208  ? 23.039  70.358  148.562 1.00 101.32 ? 208  PHE A CZ  1 
ATOM   4133  N  N   . THR E  5  209  ? 18.093  72.286  150.757 1.00 75.20  ? 209  THR A N   1 
ATOM   4134  C  CA  . THR E  5  209  ? 18.193  73.331  151.756 1.00 67.68  ? 209  THR A CA  1 
ATOM   4135  C  C   . THR E  5  209  ? 19.471  73.153  152.542 1.00 68.69  ? 209  THR A C   1 
ATOM   4136  O  O   . THR E  5  209  ? 20.181  72.168  152.369 1.00 69.45  ? 209  THR A O   1 
ATOM   4137  C  CB  . THR E  5  209  ? 17.064  73.215  152.767 1.00 72.18  ? 209  THR A CB  1 
ATOM   4138  O  OG1 . THR E  5  209  ? 17.355  72.148  153.684 1.00 72.30  ? 209  THR A OG1 1 
ATOM   4139  C  CG2 . THR E  5  209  ? 15.752  72.937  152.054 1.00 76.90  ? 209  THR A CG2 1 
ATOM   4140  N  N   . ALA E  5  210  ? 19.740  74.091  153.442 1.00 66.85  ? 210  ALA A N   1 
ATOM   4141  C  CA  . ALA E  5  210  ? 20.954  74.040  154.241 1.00 57.28  ? 210  ALA A CA  1 
ATOM   4142  C  C   . ALA E  5  210  ? 21.031  72.801  155.111 1.00 62.92  ? 210  ALA A C   1 
ATOM   4143  O  O   . ALA E  5  210  ? 22.094  72.197  155.220 1.00 73.79  ? 210  ALA A O   1 
ATOM   4144  C  CB  . ALA E  5  210  ? 21.071  75.254  155.090 1.00 54.27  ? 210  ALA A CB  1 
ATOM   4145  N  N   . THR E  5  211  ? 19.928  72.427  155.751 1.00 60.74  ? 211  THR A N   1 
ATOM   4146  C  CA  . THR E  5  211  ? 19.963  71.262  156.631 1.00 59.47  ? 211  THR A CA  1 
ATOM   4147  C  C   . THR E  5  211  ? 20.244  70.012  155.807 1.00 62.58  ? 211  THR A C   1 
ATOM   4148  O  O   . THR E  5  211  ? 20.946  69.100  156.270 1.00 61.32  ? 211  THR A O   1 
ATOM   4149  C  CB  . THR E  5  211  ? 18.666  71.064  157.415 1.00 61.22  ? 211  THR A CB  1 
ATOM   4150  O  OG1 . THR E  5  211  ? 18.309  72.285  158.062 1.00 73.46  ? 211  THR A OG1 1 
ATOM   4151  C  CG2 . THR E  5  211  ? 18.846  69.995  158.481 1.00 58.35  ? 211  THR A CG2 1 
ATOM   4152  N  N   . VAL E  5  212  ? 19.720  69.977  154.582 1.00 55.08  ? 212  VAL A N   1 
ATOM   4153  C  CA  . VAL E  5  212  ? 19.979  68.850  153.708 1.00 49.79  ? 212  VAL A CA  1 
ATOM   4154  C  C   . VAL E  5  212  ? 21.439  68.847  153.293 1.00 53.20  ? 212  VAL A C   1 
ATOM   4155  O  O   . VAL E  5  212  ? 22.114  67.821  153.342 1.00 55.58  ? 212  VAL A O   1 
ATOM   4156  C  CB  . VAL E  5  212  ? 19.123  68.893  152.453 1.00 52.10  ? 212  VAL A CB  1 
ATOM   4157  C  CG1 . VAL E  5  212  ? 19.533  67.769  151.515 1.00 53.83  ? 212  VAL A CG1 1 
ATOM   4158  C  CG2 . VAL E  5  212  ? 17.672  68.764  152.807 1.00 50.98  ? 212  VAL A CG2 1 
ATOM   4159  N  N   . ASN E  5  213  ? 21.924  70.005  152.876 1.00 52.77  ? 213  ASN A N   1 
ATOM   4160  C  CA  . ASN E  5  213  ? 23.299  70.116  152.447 1.00 54.36  ? 213  ASN A CA  1 
ATOM   4161  C  C   . ASN E  5  213  ? 24.266  69.718  153.588 1.00 53.83  ? 213  ASN A C   1 
ATOM   4162  O  O   . ASN E  5  213  ? 25.330  69.143  153.355 1.00 57.72  ? 213  ASN A O   1 
ATOM   4163  C  CB  . ASN E  5  213  ? 23.570  71.526  151.890 1.00 59.00  ? 213  ASN A CB  1 
ATOM   4164  C  CG  . ASN E  5  213  ? 24.870  71.605  151.074 1.00 83.37  ? 213  ASN A CG  1 
ATOM   4165  O  OD1 . ASN E  5  213  ? 25.362  70.586  150.537 1.00 92.45  ? 213  ASN A OD1 1 
ATOM   4166  N  ND2 . ASN E  5  213  ? 25.442  72.817  150.984 1.00 81.81  ? 213  ASN A ND2 1 
ATOM   4167  N  N   . ASP E  5  214  ? 23.879  69.980  154.827 1.00 53.05  ? 214  ASP A N   1 
ATOM   4168  C  CA  . ASP E  5  214  ? 24.728  69.641  155.960 1.00 59.08  ? 214  ASP A CA  1 
ATOM   4169  C  C   . ASP E  5  214  ? 24.814  68.131  156.126 1.00 63.74  ? 214  ASP A C   1 
ATOM   4170  O  O   . ASP E  5  214  ? 25.914  67.572  156.274 1.00 59.62  ? 214  ASP A O   1 
ATOM   4171  C  CB  . ASP E  5  214  ? 24.202  70.307  157.232 1.00 75.13  ? 214  ASP A CB  1 
ATOM   4172  C  CG  . ASP E  5  214  ? 25.128  70.121  158.416 1.00 89.07  ? 214  ASP A CG  1 
ATOM   4173  O  OD1 . ASP E  5  214  ? 26.348  69.924  158.196 1.00 90.53  ? 214  ASP A OD1 1 
ATOM   4174  O  OD2 . ASP E  5  214  ? 24.624  70.170  159.565 1.00 95.14  ? 214  ASP A OD2 1 
ATOM   4175  N  N   . GLU E  5  215  ? 23.658  67.465  156.088 1.00 65.89  ? 215  GLU A N   1 
ATOM   4176  C  CA  . GLU E  5  215  ? 23.620  66.009  156.192 1.00 59.27  ? 215  GLU A CA  1 
ATOM   4177  C  C   . GLU E  5  215  ? 24.398  65.363  155.046 1.00 61.41  ? 215  GLU A C   1 
ATOM   4178  O  O   . GLU E  5  215  ? 25.149  64.401  155.250 1.00 63.32  ? 215  GLU A O   1 
ATOM   4179  C  CB  . GLU E  5  215  ? 22.179  65.501  156.222 1.00 60.52  ? 215  GLU A CB  1 
ATOM   4180  C  CG  . GLU E  5  215  ? 21.457  65.754  157.543 1.00 69.35  ? 215  GLU A CG  1 
ATOM   4181  C  CD  . GLU E  5  215  ? 22.132  65.074  158.735 1.00 80.18  ? 215  GLU A CD  1 
ATOM   4182  O  OE1 . GLU E  5  215  ? 22.787  64.022  158.535 1.00 81.69  ? 215  GLU A OE1 1 
ATOM   4183  O  OE2 . GLU E  5  215  ? 22.002  65.587  159.878 1.00 84.53  ? 215  GLU A OE2 1 
ATOM   4184  N  N   . ARG E  5  216  ? 24.236  65.901  153.843 1.00 61.55  ? 216  ARG A N   1 
ATOM   4185  C  CA  . ARG E  5  216  ? 24.964  65.381  152.698 1.00 49.04  ? 216  ARG A CA  1 
ATOM   4186  C  C   . ARG E  5  216  ? 26.466  65.456  152.894 1.00 53.29  ? 216  ARG A C   1 
ATOM   4187  O  O   . ARG E  5  216  ? 27.169  64.479  152.665 1.00 52.85  ? 216  ARG A O   1 
ATOM   4188  C  CB  . ARG E  5  216  ? 24.597  66.134  151.433 1.00 56.99  ? 216  ARG A CB  1 
ATOM   4189  C  CG  . ARG E  5  216  ? 25.343  65.652  150.235 1.00 47.91  ? 216  ARG A CG  1 
ATOM   4190  C  CD  . ARG E  5  216  ? 24.957  66.408  148.980 1.00 62.26  ? 216  ARG A CD  1 
ATOM   4191  N  NE  . ARG E  5  216  ? 26.012  66.268  147.982 1.00 55.50  ? 216  ARG A NE  1 
ATOM   4192  C  CZ  . ARG E  5  216  ? 26.164  65.202  147.209 1.00 55.93  ? 216  ARG A CZ  1 
ATOM   4193  N  NH1 . ARG E  5  216  ? 25.294  64.195  147.295 1.00 48.26  ? 216  ARG A NH1 1 
ATOM   4194  N  NH2 . ARG E  5  216  ? 27.179  65.149  146.356 1.00 52.95  ? 216  ARG A NH2 1 
ATOM   4195  N  N   . LYS E  5  217  ? 26.961  66.616  153.319 1.00 51.39  ? 217  LYS A N   1 
ATOM   4196  C  CA  . LYS E  5  217  ? 28.403  66.823  153.448 1.00 52.92  ? 217  LYS A CA  1 
ATOM   4197  C  C   . LYS E  5  217  ? 29.018  65.905  154.514 1.00 56.23  ? 217  LYS A C   1 
ATOM   4198  O  O   . LYS E  5  217  ? 30.127  65.403  154.348 1.00 60.08  ? 217  LYS A O   1 
ATOM   4199  C  CB  . LYS E  5  217  ? 28.719  68.281  153.766 1.00 51.18  ? 217  LYS A CB  1 
ATOM   4200  C  CG  . LYS E  5  217  ? 28.575  69.243  152.619 1.00 55.29  ? 217  LYS A CG  1 
ATOM   4201  C  CD  . LYS E  5  217  ? 29.137  70.632  152.981 1.00 67.25  ? 217  LYS A CD  1 
ATOM   4202  C  CE  . LYS E  5  217  ? 29.915  71.239  151.811 1.00 84.33  ? 217  LYS A CE  1 
ATOM   4203  N  NZ  . LYS E  5  217  ? 29.110  71.323  150.545 1.00 91.19  ? 217  LYS A NZ  1 
ATOM   4204  N  N   . LYS E  5  218  ? 28.296  65.700  155.607 1.00 54.48  ? 218  LYS A N   1 
ATOM   4205  C  CA  . LYS E  5  218  ? 28.761  64.798  156.640 1.00 54.74  ? 218  LYS A CA  1 
ATOM   4206  C  C   . LYS E  5  218  ? 28.948  63.414  156.051 1.00 58.77  ? 218  LYS A C   1 
ATOM   4207  O  O   . LYS E  5  218  ? 29.981  62.775  156.259 1.00 68.20  ? 218  LYS A O   1 
ATOM   4208  C  CB  . LYS E  5  218  ? 27.746  64.714  157.787 1.00 66.07  ? 218  LYS A CB  1 
ATOM   4209  C  CG  . LYS E  5  218  ? 27.796  65.832  158.821 1.00 73.66  ? 218  LYS A CG  1 
ATOM   4210  C  CD  . LYS E  5  218  ? 26.648  65.659  159.818 1.00 89.57  ? 218  LYS A CD  1 
ATOM   4211  C  CE  . LYS E  5  218  ? 26.502  64.196  160.262 1.00 99.67  ? 218  LYS A CE  1 
ATOM   4212  N  NZ  . LYS E  5  218  ? 25.439  63.975  161.294 1.00 103.12 ? 218  LYS A NZ  1 
ATOM   4213  N  N   . LEU E  5  219  ? 27.936  62.946  155.323 1.00 58.82  ? 219  LEU A N   1 
ATOM   4214  C  CA  . LEU E  5  219  ? 27.941  61.576  154.820 1.00 52.88  ? 219  LEU A CA  1 
ATOM   4215  C  C   . LEU E  5  219  ? 29.103  61.362  153.889 1.00 60.33  ? 219  LEU A C   1 
ATOM   4216  O  O   . LEU E  5  219  ? 29.819  60.372  153.999 1.00 63.91  ? 219  LEU A O   1 
ATOM   4217  C  CB  . LEU E  5  219  ? 26.655  61.268  154.088 1.00 52.84  ? 219  LEU A CB  1 
ATOM   4218  C  CG  . LEU E  5  219  ? 25.621  60.537  154.912 1.00 61.14  ? 219  LEU A CG  1 
ATOM   4219  C  CD1 . LEU E  5  219  ? 24.423  60.258  154.053 1.00 62.13  ? 219  LEU A CD1 1 
ATOM   4220  C  CD2 . LEU E  5  219  ? 26.245  59.258  155.380 1.00 66.88  ? 219  LEU A CD2 1 
ATOM   4221  N  N   . VAL E  5  220  ? 29.301  62.298  152.972 1.00 51.37  ? 220  VAL A N   1 
ATOM   4222  C  CA  . VAL E  5  220  ? 30.415  62.186  152.057 1.00 56.54  ? 220  VAL A CA  1 
ATOM   4223  C  C   . VAL E  5  220  ? 31.742  62.182  152.811 1.00 57.84  ? 220  VAL A C   1 
ATOM   4224  O  O   . VAL E  5  220  ? 32.685  61.503  152.421 1.00 67.13  ? 220  VAL A O   1 
ATOM   4225  C  CB  . VAL E  5  220  ? 30.386  63.272  150.987 1.00 49.79  ? 220  VAL A CB  1 
ATOM   4226  C  CG1 . VAL E  5  220  ? 31.545  63.086  150.036 1.00 49.69  ? 220  VAL A CG1 1 
ATOM   4227  C  CG2 . VAL E  5  220  ? 29.088  63.194  150.242 1.00 49.55  ? 220  VAL A CG2 1 
ATOM   4228  N  N   . HIS E  5  221  ? 31.813  62.914  153.909 1.00 60.70  ? 221  HIS A N   1 
ATOM   4229  C  CA  . HIS E  5  221  ? 33.048  62.935  154.659 1.00 70.09  ? 221  HIS A CA  1 
ATOM   4230  C  C   . HIS E  5  221  ? 33.234  61.563  155.314 1.00 71.05  ? 221  HIS A C   1 
ATOM   4231  O  O   . HIS E  5  221  ? 34.286  60.940  155.165 1.00 74.64  ? 221  HIS A O   1 
ATOM   4232  C  CB  . HIS E  5  221  ? 33.070  64.081  155.677 1.00 82.32  ? 221  HIS A CB  1 
ATOM   4233  C  CG  . HIS E  5  221  ? 34.406  64.282  156.323 1.00 101.67 ? 221  HIS A CG  1 
ATOM   4234  N  ND1 . HIS E  5  221  ? 35.414  65.016  155.734 1.00 106.11 ? 221  HIS A ND1 1 
ATOM   4235  C  CD2 . HIS E  5  221  ? 34.910  63.824  157.496 1.00 110.55 ? 221  HIS A CD2 1 
ATOM   4236  C  CE1 . HIS E  5  221  ? 36.475  65.013  156.522 1.00 111.86 ? 221  HIS A CE1 1 
ATOM   4237  N  NE2 . HIS E  5  221  ? 36.197  64.294  157.595 1.00 113.63 ? 221  HIS A NE2 1 
ATOM   4238  N  N   . GLU E  5  222  ? 32.192  61.101  156.007 1.00 68.72  ? 222  GLU A N   1 
ATOM   4239  C  CA  . GLU E  5  222  ? 32.148  59.789  156.649 1.00 55.90  ? 222  GLU A CA  1 
ATOM   4240  C  C   . GLU E  5  222  ? 32.499  58.693  155.653 1.00 62.67  ? 222  GLU A C   1 
ATOM   4241  O  O   . GLU E  5  222  ? 33.295  57.799  155.943 1.00 57.67  ? 222  GLU A O   1 
ATOM   4242  C  CB  . GLU E  5  222  ? 30.744  59.547  157.207 1.00 81.72  ? 222  GLU A CB  1 
ATOM   4243  C  CG  . GLU E  5  222  ? 30.545  58.243  157.978 1.00 86.34  ? 222  GLU A CG  1 
ATOM   4244  C  CD  . GLU E  5  222  ? 29.112  58.076  158.518 1.00 91.15  ? 222  GLU A CD  1 
ATOM   4245  O  OE1 . GLU E  5  222  ? 28.534  59.080  158.988 1.00 94.40  ? 222  GLU A OE1 1 
ATOM   4246  O  OE2 . GLU E  5  222  ? 28.565  56.946  158.485 1.00 89.93  ? 222  GLU A OE2 1 
ATOM   4247  N  N   . PHE E  5  223  ? 31.904  58.776  154.469 1.00 61.94  ? 223  PHE A N   1 
ATOM   4248  C  CA  . PHE E  5  223  ? 32.163  57.814  153.406 1.00 62.72  ? 223  PHE A CA  1 
ATOM   4249  C  C   . PHE E  5  223  ? 33.639  57.798  153.018 1.00 62.70  ? 223  PHE A C   1 
ATOM   4250  O  O   . PHE E  5  223  ? 34.230  56.733  152.920 1.00 60.64  ? 223  PHE A O   1 
ATOM   4251  C  CB  . PHE E  5  223  ? 31.291  58.126  152.191 1.00 61.13  ? 223  PHE A CB  1 
ATOM   4252  C  CG  . PHE E  5  223  ? 31.534  57.225  151.015 1.00 60.47  ? 223  PHE A CG  1 
ATOM   4253  C  CD1 . PHE E  5  223  ? 31.433  55.857  151.142 1.00 61.53  ? 223  PHE A CD1 1 
ATOM   4254  C  CD2 . PHE E  5  223  ? 31.829  57.754  149.773 1.00 54.57  ? 223  PHE A CD2 1 
ATOM   4255  C  CE1 . PHE E  5  223  ? 31.644  55.030  150.054 1.00 57.61  ? 223  PHE A CE1 1 
ATOM   4256  C  CE2 . PHE E  5  223  ? 32.045  56.934  148.679 1.00 55.10  ? 223  PHE A CE2 1 
ATOM   4257  C  CZ  . PHE E  5  223  ? 31.951  55.571  148.822 1.00 58.06  ? 223  PHE A CZ  1 
ATOM   4258  N  N   . HIS E  5  224  ? 34.232  58.974  152.812 1.00 58.69  ? 224  HIS A N   1 
ATOM   4259  C  CA  . HIS E  5  224  ? 35.634  59.054  152.416 1.00 57.25  ? 224  HIS A CA  1 
ATOM   4260  C  C   . HIS E  5  224  ? 36.570  58.552  153.506 1.00 63.02  ? 224  HIS A C   1 
ATOM   4261  O  O   . HIS E  5  224  ? 37.601  57.936  153.222 1.00 60.29  ? 224  HIS A O   1 
ATOM   4262  C  CB  . HIS E  5  224  ? 36.014  60.483  152.035 1.00 57.91  ? 224  HIS A CB  1 
ATOM   4263  C  CG  . HIS E  5  224  ? 35.549  60.888  150.672 1.00 66.93  ? 224  HIS A CG  1 
ATOM   4264  N  ND1 . HIS E  5  224  ? 35.313  62.199  150.325 1.00 71.40  ? 224  HIS A ND1 1 
ATOM   4265  C  CD2 . HIS E  5  224  ? 35.270  60.154  149.568 1.00 70.36  ? 224  HIS A CD2 1 
ATOM   4266  C  CE1 . HIS E  5  224  ? 34.904  62.256  149.070 1.00 69.69  ? 224  HIS A CE1 1 
ATOM   4267  N  NE2 . HIS E  5  224  ? 34.869  61.028  148.589 1.00 66.74  ? 224  HIS A NE2 1 
ATOM   4268  N  N   . LYS E  5  225  ? 36.211  58.829  154.754 1.00 66.92  ? 225  LYS A N   1 
ATOM   4269  C  CA  . LYS E  5  225  ? 37.003  58.376  155.885 1.00 70.30  ? 225  LYS A CA  1 
ATOM   4270  C  C   . LYS E  5  225  ? 36.992  56.843  155.886 1.00 77.10  ? 225  LYS A C   1 
ATOM   4271  O  O   . LYS E  5  225  ? 38.032  56.196  156.048 1.00 81.20  ? 225  LYS A O   1 
ATOM   4272  C  CB  . LYS E  5  225  ? 36.451  58.949  157.197 1.00 66.91  ? 225  LYS A CB  1 
ATOM   4273  C  CG  . LYS E  5  225  ? 37.512  59.335  158.226 1.00 83.81  ? 225  LYS A CG  1 
ATOM   4274  C  CD  . LYS E  5  225  ? 37.445  60.835  158.605 1.00 100.11 ? 225  LYS A CD  1 
ATOM   4275  C  CE  . LYS E  5  225  ? 38.475  61.213  159.700 1.00 107.30 ? 225  LYS A CE  1 
ATOM   4276  N  NZ  . LYS E  5  225  ? 38.445  62.664  160.087 1.00 107.84 ? 225  LYS A NZ  1 
ATOM   4277  N  N   . LYS E  5  226  ? 35.817  56.267  155.660 1.00 73.32  ? 226  LYS A N   1 
ATOM   4278  C  CA  . LYS E  5  226  ? 35.685  54.824  155.664 1.00 76.33  ? 226  LYS A CA  1 
ATOM   4279  C  C   . LYS E  5  226  ? 36.372  54.187  154.468 1.00 82.82  ? 226  LYS A C   1 
ATOM   4280  O  O   . LYS E  5  226  ? 36.781  53.028  154.530 1.00 93.77  ? 226  LYS A O   1 
ATOM   4281  C  CB  . LYS E  5  226  ? 34.219  54.401  155.708 1.00 76.90  ? 226  LYS A CB  1 
ATOM   4282  C  CG  . LYS E  5  226  ? 33.528  54.634  157.042 1.00 75.02  ? 226  LYS A CG  1 
ATOM   4283  C  CD  . LYS E  5  226  ? 32.466  53.575  157.258 1.00 83.89  ? 226  LYS A CD  1 
ATOM   4284  C  CE  . LYS E  5  226  ? 31.609  53.867  158.473 1.00 92.62  ? 226  LYS A CE  1 
ATOM   4285  N  NZ  . LYS E  5  226  ? 30.779  52.680  158.847 1.00 98.57  ? 226  LYS A NZ  1 
ATOM   4286  N  N   . LEU E  5  227  ? 36.495  54.938  153.380 1.00 74.81  ? 227  LEU A N   1 
ATOM   4287  C  CA  . LEU E  5  227  ? 37.142  54.417  152.184 1.00 70.38  ? 227  LEU A CA  1 
ATOM   4288  C  C   . LEU E  5  227  ? 38.617  54.177  152.417 1.00 77.31  ? 227  LEU A C   1 
ATOM   4289  O  O   . LEU E  5  227  ? 39.151  53.136  152.034 1.00 87.08  ? 227  LEU A O   1 
ATOM   4290  C  CB  . LEU E  5  227  ? 36.963  55.370  151.009 1.00 63.07  ? 227  LEU A CB  1 
ATOM   4291  C  CG  . LEU E  5  227  ? 35.578  55.280  150.366 1.00 68.56  ? 227  LEU A CG  1 
ATOM   4292  C  CD1 . LEU E  5  227  ? 35.542  56.032  149.061 1.00 69.17  ? 227  LEU A CD1 1 
ATOM   4293  C  CD2 . LEU E  5  227  ? 35.173  53.824  150.165 1.00 68.40  ? 227  LEU A CD2 1 
ATOM   4294  N  N   . LEU E  5  228  ? 39.258  55.149  153.055 1.00 72.42  ? 228  LEU A N   1 
ATOM   4295  C  CA  . LEU E  5  228  ? 40.697  55.149  153.251 1.00 69.27  ? 228  LEU A CA  1 
ATOM   4296  C  C   . LEU E  5  228  ? 41.088  54.353  154.485 1.00 74.77  ? 228  LEU A C   1 
ATOM   4297  O  O   . LEU E  5  228  ? 42.269  54.056  154.695 1.00 74.76  ? 228  LEU A O   1 
ATOM   4298  C  CB  . LEU E  5  228  ? 41.195  56.589  153.394 1.00 63.87  ? 228  LEU A CB  1 
ATOM   4299  C  CG  . LEU E  5  228  ? 40.833  57.570  152.272 1.00 65.26  ? 228  LEU A CG  1 
ATOM   4300  C  CD1 . LEU E  5  228  ? 41.209  58.963  152.673 1.00 67.75  ? 228  LEU A CD1 1 
ATOM   4301  C  CD2 . LEU E  5  228  ? 41.526  57.225  150.972 1.00 63.83  ? 228  LEU A CD2 1 
ATOM   4302  N  N   . SER E  5  229  ? 40.092  54.011  155.297 1.00 74.26  ? 229  SER A N   1 
ATOM   4303  C  CA  . SER E  5  229  ? 40.335  53.312  156.556 1.00 78.87  ? 229  SER A CA  1 
ATOM   4304  C  C   . SER E  5  229  ? 40.549  51.793  156.398 1.00 83.55  ? 229  SER A C   1 
ATOM   4305  O  O   . SER E  5  229  ? 40.800  51.084  157.378 1.00 87.46  ? 229  SER A O   1 
ATOM   4306  C  CB  . SER E  5  229  ? 39.172  53.544  157.515 1.00 77.52  ? 229  SER A CB  1 
ATOM   4307  O  OG  . SER E  5  229  ? 38.146  52.588  157.289 1.00 80.22  ? 229  SER A OG  1 
ATOM   4308  N  N   . ARG E  5  230  ? 40.436  51.289  155.178 1.00 75.30  ? 230  ARG A N   1 
ATOM   4309  C  CA  . ARG E  5  230  ? 40.500  49.861  154.985 1.00 72.51  ? 230  ARG A CA  1 
ATOM   4310  C  C   . ARG E  5  230  ? 41.870  49.491  154.447 1.00 84.65  ? 230  ARG A C   1 
ATOM   4311  O  O   . ARG E  5  230  ? 42.439  50.233  153.657 1.00 90.88  ? 230  ARG A O   1 
ATOM   4312  C  CB  . ARG E  5  230  ? 39.373  49.385  154.058 1.00 72.81  ? 230  ARG A CB  1 
ATOM   4313  C  CG  . ARG E  5  230  ? 38.004  50.003  154.381 1.00 86.33  ? 230  ARG A CG  1 
ATOM   4314  C  CD  . ARG E  5  230  ? 37.129  49.291  155.431 1.00 92.12  ? 230  ARG A CD  1 
ATOM   4315  N  NE  . ARG E  5  230  ? 37.847  48.703  156.514 1.00 105.88 ? 230  ARG A NE  1 
ATOM   4316  C  CZ  . ARG E  5  230  ? 37.676  47.542  157.146 1.00 115.85 ? 230  ARG A CZ  1 
ATOM   4317  N  NH1 . ARG E  5  230  ? 36.732  46.644  156.877 1.00 117.50 ? 230  ARG A NH1 1 
ATOM   4318  N  NH2 . ARG E  5  230  ? 38.540  47.304  158.113 1.00 118.90 ? 230  ARG A NH2 1 
ATOM   4319  N  N   . GLY E  5  231  ? 42.407  48.361  154.901 1.00 71.98  ? 231  GLY A N   1 
ATOM   4320  C  CA  . GLY E  5  231  ? 43.657  47.848  154.381 1.00 81.15  ? 231  GLY A CA  1 
ATOM   4321  C  C   . GLY E  5  231  ? 43.367  46.747  153.383 1.00 85.10  ? 231  GLY A C   1 
ATOM   4322  O  O   . GLY E  5  231  ? 43.290  46.984  152.180 1.00 87.90  ? 231  GLY A O   1 
ATOM   4323  N  N   . LYS E  5  232  ? 43.205  45.534  153.893 1.00 90.00  ? 232  LYS A N   1 
ATOM   4324  C  CA  . LYS E  5  232  ? 42.744  44.406  153.096 1.00 93.08  ? 232  LYS A CA  1 
ATOM   4325  C  C   . LYS E  5  232  ? 41.388  44.730  152.470 1.00 95.14  ? 232  LYS A C   1 
ATOM   4326  O  O   . LYS E  5  232  ? 40.539  45.332  153.121 1.00 74.46  ? 232  LYS A O   1 
ATOM   4327  C  CB  . LYS E  5  232  ? 42.629  43.173  154.002 1.00 93.44  ? 232  LYS A CB  1 
ATOM   4328  C  CG  . LYS E  5  232  ? 41.842  42.000  153.419 1.00 97.85  ? 232  LYS A CG  1 
ATOM   4329  C  CD  . LYS E  5  232  ? 41.574  40.933  154.477 1.00 99.10  ? 232  LYS A CD  1 
ATOM   4330  C  CE  . LYS E  5  232  ? 42.872  40.533  155.156 1.00 102.49 ? 232  LYS A CE  1 
ATOM   4331  N  NZ  . LYS E  5  232  ? 42.653  39.563  156.250 1.00 110.71 ? 232  LYS A NZ  1 
ATOM   4332  N  N   . CYS E  5  233  ? 41.190  44.342  151.214 1.00 75.32  ? 233  CYS A N   1 
ATOM   4333  C  CA  . CYS E  5  233  ? 39.896  44.519  150.552 1.00 79.99  ? 233  CYS A CA  1 
ATOM   4334  C  C   . CYS E  5  233  ? 38.816  43.652  151.196 1.00 80.99  ? 233  CYS A C   1 
ATOM   4335  O  O   . CYS E  5  233  ? 38.962  42.427  151.286 1.00 79.09  ? 233  CYS A O   1 
ATOM   4336  C  CB  . CYS E  5  233  ? 40.001  44.198  149.055 1.00 81.37  ? 233  CYS A CB  1 
ATOM   4337  S  SG  . CYS E  5  233  ? 38.452  44.295  148.110 1.00 73.01  ? 233  CYS A SG  1 
ATOM   4338  N  N   . ASP E  5  234  ? 37.725  44.278  151.626 1.00 74.20  ? 234  ASP A N   1 
ATOM   4339  C  CA  . ASP E  5  234  ? 36.636  43.554  152.281 1.00 75.31  ? 234  ASP A CA  1 
ATOM   4340  C  C   . ASP E  5  234  ? 35.893  42.628  151.335 1.00 82.63  ? 234  ASP A C   1 
ATOM   4341  O  O   . ASP E  5  234  ? 35.053  41.845  151.757 1.00 86.15  ? 234  ASP A O   1 
ATOM   4342  C  CB  . ASP E  5  234  ? 35.632  44.527  152.891 1.00 86.36  ? 234  ASP A CB  1 
ATOM   4343  C  CG  . ASP E  5  234  ? 36.210  45.325  154.040 1.00 89.98  ? 234  ASP A CG  1 
ATOM   4344  O  OD1 . ASP E  5  234  ? 37.158  44.832  154.680 1.00 93.28  ? 234  ASP A OD1 1 
ATOM   4345  O  OD2 . ASP E  5  234  ? 35.710  46.442  154.311 1.00 91.19  ? 234  ASP A OD2 1 
ATOM   4346  N  N   . ASN E  5  235  ? 36.203  42.713  150.054 1.00 75.55  ? 235  ASN A N   1 
ATOM   4347  C  CA  . ASN E  5  235  ? 35.401  42.027  149.064 1.00 82.49  ? 235  ASN A CA  1 
ATOM   4348  C  C   . ASN E  5  235  ? 36.081  40.856  148.397 1.00 84.66  ? 235  ASN A C   1 
ATOM   4349  O  O   . ASN E  5  235  ? 35.417  39.872  148.076 1.00 85.27  ? 235  ASN A O   1 
ATOM   4350  C  CB  . ASN E  5  235  ? 34.881  43.028  148.039 1.00 79.71  ? 235  ASN A CB  1 
ATOM   4351  C  CG  . ASN E  5  235  ? 34.017  44.112  148.686 1.00 77.39  ? 235  ASN A CG  1 
ATOM   4352  O  OD1 . ASN E  5  235  ? 33.020  43.815  149.355 1.00 74.90  ? 235  ASN A OD1 1 
ATOM   4353  N  ND2 . ASN E  5  235  ? 34.418  45.367  148.519 1.00 73.68  ? 235  ASN A ND2 1 
ATOM   4354  N  N   . CYS E  5  236  ? 37.395  40.949  148.196 1.00 86.44  ? 236  CYS A N   1 
ATOM   4355  C  CA  . CYS E  5  236  ? 38.154  39.838  147.616 1.00 86.48  ? 236  CYS A CA  1 
ATOM   4356  C  C   . CYS E  5  236  ? 39.310  39.406  148.513 1.00 92.07  ? 236  CYS A C   1 
ATOM   4357  O  O   . CYS E  5  236  ? 39.958  38.381  148.258 1.00 90.17  ? 236  CYS A O   1 
ATOM   4358  C  CB  . CYS E  5  236  ? 38.665  40.174  146.212 1.00 80.52  ? 236  CYS A CB  1 
ATOM   4359  S  SG  . CYS E  5  236  ? 39.945  41.444  146.147 1.00 79.29  ? 236  CYS A SG  1 
ATOM   4360  N  N   . GLY E  5  237  ? 39.566  40.204  149.550 1.00 91.92  ? 237  GLY A N   1 
ATOM   4361  C  CA  . GLY E  5  237  ? 40.528  39.866  150.583 1.00 91.99  ? 237  GLY A CA  1 
ATOM   4362  C  C   . GLY E  5  237  ? 41.988  40.106  150.256 1.00 92.23  ? 237  GLY A C   1 
ATOM   4363  O  O   . GLY E  5  237  ? 42.863  39.717  151.021 1.00 95.28  ? 237  GLY A O   1 
ATOM   4364  N  N   . MET E  5  238  ? 42.266  40.744  149.127 1.00 91.48  ? 238  MET A N   1 
ATOM   4365  C  CA  . MET E  5  238  ? 43.651  40.988  148.722 1.00 87.55  ? 238  MET A CA  1 
ATOM   4366  C  C   . MET E  5  238  ? 44.190  42.301  149.279 1.00 86.41  ? 238  MET A C   1 
ATOM   4367  O  O   . MET E  5  238  ? 43.437  43.156  149.750 1.00 87.19  ? 238  MET A O   1 
ATOM   4368  C  CB  . MET E  5  238  ? 43.781  40.981  147.198 1.00 80.97  ? 238  MET A CB  1 
ATOM   4369  C  CG  . MET E  5  238  ? 43.209  39.744  146.539 1.00 88.07  ? 238  MET A CG  1 
ATOM   4370  S  SD  . MET E  5  238  ? 44.405  38.400  146.510 1.00 93.70  ? 238  MET A SD  1 
ATOM   4371  C  CE  . MET E  5  238  ? 45.511  38.978  145.224 1.00 84.38  ? 238  MET A CE  1 
ATOM   4372  N  N   . PHE E  5  239  ? 45.507  42.444  149.224 1.00 87.39  ? 239  PHE A N   1 
ATOM   4373  C  CA  . PHE E  5  239  ? 46.166  43.694  149.566 1.00 87.02  ? 239  PHE A CA  1 
ATOM   4374  C  C   . PHE E  5  239  ? 46.633  44.376  148.283 1.00 88.39  ? 239  PHE A C   1 
ATOM   4375  O  O   . PHE E  5  239  ? 47.273  43.744  147.438 1.00 85.42  ? 239  PHE A O   1 
ATOM   4376  C  CB  . PHE E  5  239  ? 47.386  43.427  150.453 1.00 87.06  ? 239  PHE A CB  1 
ATOM   4377  C  CG  . PHE E  5  239  ? 47.058  43.191  151.901 1.00 90.92  ? 239  PHE A CG  1 
ATOM   4378  C  CD1 . PHE E  5  239  ? 46.595  44.219  152.701 1.00 90.93  ? 239  PHE A CD1 1 
ATOM   4379  C  CD2 . PHE E  5  239  ? 47.251  41.949  152.474 1.00 98.61  ? 239  PHE A CD2 1 
ATOM   4380  C  CE1 . PHE E  5  239  ? 46.307  44.008  154.040 1.00 89.49  ? 239  PHE A CE1 1 
ATOM   4381  C  CE2 . PHE E  5  239  ? 46.963  41.732  153.818 1.00 96.61  ? 239  PHE A CE2 1 
ATOM   4382  C  CZ  . PHE E  5  239  ? 46.488  42.765  154.596 1.00 90.02  ? 239  PHE A CZ  1 
ATOM   4383  N  N   . SER E  5  240  ? 46.319  45.659  148.133 1.00 87.85  ? 240  SER A N   1 
ATOM   4384  C  CA  . SER E  5  240  ? 46.902  46.448  147.050 1.00 82.01  ? 240  SER A CA  1 
ATOM   4385  C  C   . SER E  5  240  ? 48.073  47.265  147.608 1.00 82.06  ? 240  SER A C   1 
ATOM   4386  O  O   . SER E  5  240  ? 48.055  47.669  148.771 1.00 83.20  ? 240  SER A O   1 
ATOM   4387  C  CB  . SER E  5  240  ? 45.854  47.359  146.410 1.00 74.63  ? 240  SER A CB  1 
ATOM   4388  O  OG  . SER E  5  240  ? 44.668  46.641  146.118 1.00 78.09  ? 240  SER A OG  1 
ATOM   4389  N  N   . PRO E  5  241  ? 49.116  47.473  146.792 1.00 79.45  ? 241  PRO A N   1 
ATOM   4390  C  CA  . PRO E  5  241  ? 50.234  48.328  147.195 1.00 80.89  ? 241  PRO A CA  1 
ATOM   4391  C  C   . PRO E  5  241  ? 49.741  49.741  147.504 1.00 78.27  ? 241  PRO A C   1 
ATOM   4392  O  O   . PRO E  5  241  ? 48.798  50.227  146.862 1.00 69.64  ? 241  PRO A O   1 
ATOM   4393  C  CB  . PRO E  5  241  ? 51.128  48.342  145.950 1.00 80.53  ? 241  PRO A CB  1 
ATOM   4394  C  CG  . PRO E  5  241  ? 50.219  47.963  144.810 1.00 75.70  ? 241  PRO A CG  1 
ATOM   4395  C  CD  . PRO E  5  241  ? 49.276  46.973  145.416 1.00 77.19  ? 241  PRO A CD  1 
ATOM   4396  N  N   . LYS E  5  242  ? 50.364  50.384  148.486 1.00 75.13  ? 242  LYS A N   1 
ATOM   4397  C  CA  . LYS E  5  242  ? 49.917  51.698  148.931 1.00 82.18  ? 242  LYS A CA  1 
ATOM   4398  C  C   . LYS E  5  242  ? 50.389  52.825  148.012 1.00 79.21  ? 242  LYS A C   1 
ATOM   4399  O  O   . LYS E  5  242  ? 51.487  52.762  147.453 1.00 78.91  ? 242  LYS A O   1 
ATOM   4400  C  CB  . LYS E  5  242  ? 50.356  51.960  150.371 1.00 70.06  ? 242  LYS A CB  1 
ATOM   4401  C  CG  . LYS E  5  242  ? 49.387  51.426  151.405 1.00 70.49  ? 242  LYS A CG  1 
ATOM   4402  C  CD  . LYS E  5  242  ? 49.905  51.672  152.813 1.00 95.90  ? 242  LYS A CD  1 
ATOM   4403  C  CE  . LYS E  5  242  ? 48.930  51.167  153.862 1.00 92.52  ? 242  LYS A CE  1 
ATOM   4404  N  NZ  . LYS E  5  242  ? 49.588  50.978  155.187 1.00 88.99  ? 242  LYS A NZ  1 
ATOM   4405  N  N   . PHE E  5  243  ? 49.556  53.851  147.855 1.00 75.16  ? 243  PHE A N   1 
ATOM   4406  C  CA  . PHE E  5  243  ? 49.930  55.000  147.029 1.00 77.69  ? 243  PHE A CA  1 
ATOM   4407  C  C   . PHE E  5  243  ? 50.315  56.239  147.850 1.00 80.89  ? 243  PHE A C   1 
ATOM   4408  O  O   . PHE E  5  243  ? 49.661  56.581  148.841 1.00 81.11  ? 243  PHE A O   1 
ATOM   4409  C  CB  . PHE E  5  243  ? 48.811  55.352  146.052 1.00 75.94  ? 243  PHE A CB  1 
ATOM   4410  C  CG  . PHE E  5  243  ? 48.558  54.302  145.007 1.00 78.47  ? 243  PHE A CG  1 
ATOM   4411  C  CD1 . PHE E  5  243  ? 49.432  54.135  143.949 1.00 79.87  ? 243  PHE A CD1 1 
ATOM   4412  C  CD2 . PHE E  5  243  ? 47.429  53.500  145.068 1.00 80.34  ? 243  PHE A CD2 1 
ATOM   4413  C  CE1 . PHE E  5  243  ? 49.195  53.170  142.974 1.00 78.95  ? 243  PHE A CE1 1 
ATOM   4414  C  CE2 . PHE E  5  243  ? 47.185  52.537  144.100 1.00 80.10  ? 243  PHE A CE2 1 
ATOM   4415  C  CZ  . PHE E  5  243  ? 48.071  52.374  143.051 1.00 77.79  ? 243  PHE A CZ  1 
ATOM   4416  N  N   . ARG E  5  244  ? 51.379  56.910  147.418 1.00 84.24  ? 244  ARG A N   1 
ATOM   4417  C  CA  . ARG E  5  244  ? 51.894  58.090  148.107 1.00 89.21  ? 244  ARG A CA  1 
ATOM   4418  C  C   . ARG E  5  244  ? 52.048  59.238  147.103 1.00 82.23  ? 244  ARG A C   1 
ATOM   4419  O  O   . ARG E  5  244  ? 52.209  58.993  145.911 1.00 81.70  ? 244  ARG A O   1 
ATOM   4420  C  CB  . ARG E  5  244  ? 53.235  57.759  148.775 1.00 100.03 ? 244  ARG A CB  1 
ATOM   4421  C  CG  . ARG E  5  244  ? 53.559  58.588  150.012 1.00 111.98 ? 244  ARG A CG  1 
ATOM   4422  C  CD  . ARG E  5  244  ? 55.074  58.771  150.187 1.00 128.02 ? 244  ARG A CD  1 
ATOM   4423  N  NE  . ARG E  5  244  ? 55.793  57.504  150.351 1.00 139.54 ? 244  ARG A NE  1 
ATOM   4424  C  CZ  . ARG E  5  244  ? 56.576  56.947  149.426 1.00 144.82 ? 244  ARG A CZ  1 
ATOM   4425  N  NH1 . ARG E  5  244  ? 56.758  57.543  148.254 1.00 142.29 ? 244  ARG A NH1 1 
ATOM   4426  N  NH2 . ARG E  5  244  ? 57.182  55.790  149.677 1.00 148.93 ? 244  ARG A NH2 1 
ATOM   4427  N  N   . LYS E  5  245  ? 52.013  60.485  147.571 1.00 83.71  ? 245  LYS A N   1 
ATOM   4428  C  CA  . LYS E  5  245  ? 52.058  61.629  146.650 1.00 84.15  ? 245  LYS A CA  1 
ATOM   4429  C  C   . LYS E  5  245  ? 53.200  62.658  146.824 1.00 94.68  ? 245  LYS A C   1 
ATOM   4430  O  O   . LYS E  5  245  ? 54.150  62.445  147.573 1.00 87.10  ? 245  LYS A O   1 
ATOM   4431  C  CB  . LYS E  5  245  ? 50.713  62.356  146.663 1.00 76.77  ? 245  LYS A CB  1 
ATOM   4432  C  CG  . LYS E  5  245  ? 50.394  63.093  147.960 1.00 72.88  ? 245  LYS A CG  1 
ATOM   4433  C  CD  . LYS E  5  245  ? 49.176  63.994  147.774 1.00 74.68  ? 245  LYS A CD  1 
ATOM   4434  C  CE  . LYS E  5  245  ? 48.901  64.842  149.010 1.00 84.44  ? 245  LYS A CE  1 
ATOM   4435  N  NZ  . LYS E  5  245  ? 47.666  65.685  148.885 1.00 86.83  ? 245  LYS A NZ  1 
ATOM   4436  N  N   . ASP E  5  246  ? 53.083  63.764  146.076 1.00 111.02 ? 246  ASP A N   1 
ATOM   4437  C  CA  . ASP E  5  246  ? 53.901  64.983  146.218 1.00 107.09 ? 246  ASP A CA  1 
ATOM   4438  C  C   . ASP E  5  246  ? 52.986  66.162  146.530 1.00 112.47 ? 246  ASP A C   1 
ATOM   4439  O  O   . ASP E  5  246  ? 51.766  66.004  146.632 1.00 116.68 ? 246  ASP A O   1 
ATOM   4440  C  CB  . ASP E  5  246  ? 54.619  65.312  144.914 1.00 97.99  ? 246  ASP A CB  1 
ATOM   4441  C  CG  . ASP E  5  246  ? 55.998  64.723  144.844 1.00 110.91 ? 246  ASP A CG  1 
ATOM   4442  O  OD1 . ASP E  5  246  ? 56.205  63.593  145.350 1.00 115.28 ? 246  ASP A OD1 1 
ATOM   4443  O  OD2 . ASP E  5  246  ? 56.884  65.394  144.273 1.00 118.00 ? 246  ASP A OD2 1 
ATOM   4444  N  N   . GLY E  5  247  ? 53.569  67.350  146.664 1.00 113.14 ? 247  GLY A N   1 
ATOM   4445  C  CA  . GLY E  5  247  ? 52.783  68.576  146.709 1.00 115.30 ? 247  GLY A CA  1 
ATOM   4446  C  C   . GLY E  5  247  ? 52.772  69.165  145.309 1.00 111.03 ? 247  GLY A C   1 
ATOM   4447  O  O   . GLY E  5  247  ? 52.203  70.239  145.041 1.00 96.01  ? 247  GLY A O   1 
ATOM   4448  N  N   . PHE E  5  248  ? 53.426  68.414  144.422 1.00 115.26 ? 248  PHE A N   1 
ATOM   4449  C  CA  . PHE E  5  248  ? 53.664  68.795  143.042 1.00 114.41 ? 248  PHE A CA  1 
ATOM   4450  C  C   . PHE E  5  248  ? 53.012  67.769  142.127 1.00 98.89  ? 248  PHE A C   1 
ATOM   4451  O  O   . PHE E  5  248  ? 53.463  67.551  141.001 1.00 95.61  ? 248  PHE A O   1 
ATOM   4452  C  CB  . PHE E  5  248  ? 55.176  68.837  142.769 1.00 127.06 ? 248  PHE A CB  1 
ATOM   4453  C  CG  . PHE E  5  248  ? 55.919  69.883  143.568 1.00 131.21 ? 248  PHE A CG  1 
ATOM   4454  C  CD1 . PHE E  5  248  ? 55.365  71.145  143.782 1.00 128.43 ? 248  PHE A CD1 1 
ATOM   4455  C  CD2 . PHE E  5  248  ? 57.170  69.604  144.105 1.00 133.02 ? 248  PHE A CD2 1 
ATOM   4456  C  CE1 . PHE E  5  248  ? 56.039  72.107  144.515 1.00 127.44 ? 248  PHE A CE1 1 
ATOM   4457  C  CE2 . PHE E  5  248  ? 57.852  70.561  144.840 1.00 133.94 ? 248  PHE A CE2 1 
ATOM   4458  C  CZ  . PHE E  5  248  ? 57.285  71.816  145.045 1.00 132.08 ? 248  PHE A CZ  1 
ATOM   4459  N  N   . THR E  5  249  ? 51.965  67.128  142.632 1.00 91.19  ? 249  THR A N   1 
ATOM   4460  C  CA  . THR E  5  249  ? 51.203  66.141  141.866 1.00 93.42  ? 249  THR A CA  1 
ATOM   4461  C  C   . THR E  5  249  ? 52.057  65.074  141.120 1.00 102.69 ? 249  THR A C   1 
ATOM   4462  O  O   . THR E  5  249  ? 52.061  64.998  139.890 1.00 103.11 ? 249  THR A O   1 
ATOM   4463  C  CB  . THR E  5  249  ? 50.165  66.833  140.919 1.00 80.75  ? 249  THR A CB  1 
ATOM   4464  O  OG1 . THR E  5  249  ? 50.839  67.518  139.852 1.00 78.31  ? 249  THR A OG1 1 
ATOM   4465  C  CG2 . THR E  5  249  ? 49.298  67.832  141.696 1.00 78.49  ? 249  THR A CG2 1 
ATOM   4466  N  N   . LYS E  5  250  ? 52.804  64.279  141.881 1.00 102.28 ? 250  LYS A N   1 
ATOM   4467  C  CA  . LYS E  5  250  ? 53.408  63.048  141.374 1.00 99.23  ? 250  LYS A CA  1 
ATOM   4468  C  C   . LYS E  5  250  ? 52.917  61.911  142.268 1.00 96.91  ? 250  LYS A C   1 
ATOM   4469  O  O   . LYS E  5  250  ? 52.723  62.103  143.471 1.00 98.89  ? 250  LYS A O   1 
ATOM   4470  C  CB  . LYS E  5  250  ? 54.935  63.105  141.407 1.00 95.59  ? 250  LYS A CB  1 
ATOM   4471  C  CG  . LYS E  5  250  ? 55.534  64.206  140.573 1.00 99.36  ? 250  LYS A CG  1 
ATOM   4472  C  CD  . LYS E  5  250  ? 56.996  64.405  140.934 1.00 106.44 ? 250  LYS A CD  1 
ATOM   4473  C  CE  . LYS E  5  250  ? 57.341  65.890  141.017 1.00 108.69 ? 250  LYS A CE  1 
ATOM   4474  N  NZ  . LYS E  5  250  ? 58.568  66.152  141.837 1.00 111.92 ? 250  LYS A NZ  1 
ATOM   4475  N  N   . ILE E  5  251  ? 52.699  60.734  141.691 1.00 87.14  ? 251  ILE A N   1 
ATOM   4476  C  CA  . ILE E  5  251  ? 52.206  59.611  142.483 1.00 78.00  ? 251  ILE A CA  1 
ATOM   4477  C  C   . ILE E  5  251  ? 53.176  58.431  142.531 1.00 79.12  ? 251  ILE A C   1 
ATOM   4478  O  O   . ILE E  5  251  ? 53.601  57.904  141.497 1.00 77.20  ? 251  ILE A O   1 
ATOM   4479  C  CB  . ILE E  5  251  ? 50.839  59.156  141.990 1.00 70.96  ? 251  ILE A CB  1 
ATOM   4480  C  CG1 . ILE E  5  251  ? 49.786  60.190  142.390 1.00 68.23  ? 251  ILE A CG1 1 
ATOM   4481  C  CG2 . ILE E  5  251  ? 50.482  57.815  142.578 1.00 65.89  ? 251  ILE A CG2 1 
ATOM   4482  C  CD1 . ILE E  5  251  ? 48.452  59.940  141.768 1.00 71.60  ? 251  ILE A CD1 1 
ATOM   4483  N  N   . PHE E  5  252  ? 53.543  58.029  143.741 1.00 80.53  ? 252  PHE A N   1 
ATOM   4484  C  CA  . PHE E  5  252  ? 54.416  56.877  143.898 1.00 88.08  ? 252  PHE A CA  1 
ATOM   4485  C  C   . PHE E  5  252  ? 53.646  55.646  144.382 1.00 84.40  ? 252  PHE A C   1 
ATOM   4486  O  O   . PHE E  5  252  ? 52.654  55.764  145.102 1.00 65.48  ? 252  PHE A O   1 
ATOM   4487  C  CB  . PHE E  5  252  ? 55.607  57.221  144.803 1.00 97.39  ? 252  PHE A CB  1 
ATOM   4488  C  CG  . PHE E  5  252  ? 56.640  58.100  144.133 1.00 102.97 ? 252  PHE A CG  1 
ATOM   4489  C  CD1 . PHE E  5  252  ? 56.469  59.475  144.072 1.00 97.15  ? 252  PHE A CD1 1 
ATOM   4490  C  CD2 . PHE E  5  252  ? 57.778  57.544  143.550 1.00 108.95 ? 252  PHE A CD2 1 
ATOM   4491  C  CE1 . PHE E  5  252  ? 57.414  60.281  143.448 1.00 99.29  ? 252  PHE A CE1 1 
ATOM   4492  C  CE2 . PHE E  5  252  ? 58.730  58.348  142.922 1.00 107.21 ? 252  PHE A CE2 1 
ATOM   4493  C  CZ  . PHE E  5  252  ? 58.546  59.715  142.873 1.00 103.98 ? 252  PHE A CZ  1 
ATOM   4494  N  N   . GLU E  5  253  ? 54.090  54.467  143.948 1.00 83.30  ? 253  GLU A N   1 
ATOM   4495  C  CA  . GLU E  5  253  ? 53.464  53.206  144.357 1.00 81.56  ? 253  GLU A CA  1 
ATOM   4496  C  C   . GLU E  5  253  ? 54.429  52.358  145.165 1.00 87.48  ? 253  GLU A C   1 
ATOM   4497  O  O   . GLU E  5  253  ? 55.410  51.865  144.625 1.00 92.22  ? 253  GLU A O   1 
ATOM   4498  C  CB  . GLU E  5  253  ? 53.002  52.419  143.133 1.00 80.18  ? 253  GLU A CB  1 
ATOM   4499  C  CG  . GLU E  5  253  ? 52.322  51.104  143.467 1.00 89.58  ? 253  GLU A CG  1 
ATOM   4500  C  CD  . GLU E  5  253  ? 51.883  50.335  142.228 1.00 96.80  ? 253  GLU A CD  1 
ATOM   4501  O  OE1 . GLU E  5  253  ? 50.785  50.625  141.697 1.00 90.13  ? 253  GLU A OE1 1 
ATOM   4502  O  OE2 . GLU E  5  253  ? 52.639  49.439  141.787 1.00 104.45 ? 253  GLU A OE2 1 
ATOM   4503  N  N   . THR E  5  254  ? 54.157  52.187  146.456 1.00 94.07  ? 254  THR A N   1 
ATOM   4504  C  CA  . THR E  5  254  ? 55.007  51.347  147.319 1.00 98.34  ? 254  THR A CA  1 
ATOM   4505  C  C   . THR E  5  254  ? 54.675  49.852  147.228 1.00 97.66  ? 254  THR A C   1 
ATOM   4506  O  O   . THR E  5  254  ? 53.596  49.415  147.641 1.00 101.35 ? 254  THR A O   1 
ATOM   4507  C  CB  . THR E  5  254  ? 54.889  51.759  148.801 1.00 95.16  ? 254  THR A CB  1 
ATOM   4508  O  OG1 . THR E  5  254  ? 55.096  53.179  148.936 1.00 93.81  ? 254  THR A OG1 1 
ATOM   4509  C  CG2 . THR E  5  254  ? 55.891  50.986  149.644 1.00 82.43  ? 254  THR A CG2 1 
ATOM   4510  N  N   . ALA E  5  255  ? 55.610  49.069  146.704 1.00 96.02  ? 255  ALA A N   1 
ATOM   4511  C  CA  . ALA E  5  255  ? 55.407  47.623  146.557 1.00 92.22  ? 255  ALA A CA  1 
ATOM   4512  C  C   . ALA E  5  255  ? 55.060  46.894  147.862 1.00 93.55  ? 255  ALA A C   1 
ATOM   4513  O  O   . ALA E  5  255  ? 55.258  47.406  148.974 1.00 87.52  ? 255  ALA A O   1 
ATOM   4514  C  CB  . ALA E  5  255  ? 56.614  46.975  145.896 1.00 86.29  ? 255  ALA A CB  1 
ATOM   4515  N  N   . LEU E  5  256  ? 54.558  45.676  147.702 1.00 98.73  ? 256  LEU A N   1 
ATOM   4516  C  CA  . LEU E  5  256  ? 53.952  44.932  148.800 1.00 100.38 ? 256  LEU A CA  1 
ATOM   4517  C  C   . LEU E  5  256  ? 54.885  44.427  149.901 1.00 107.09 ? 256  LEU A C   1 
ATOM   4518  O  O   . LEU E  5  256  ? 56.007  43.972  149.643 1.00 107.51 ? 256  LEU A O   1 
ATOM   4519  C  CB  . LEU E  5  256  ? 53.134  43.775  148.240 1.00 97.54  ? 256  LEU A CB  1 
ATOM   4520  C  CG  . LEU E  5  256  ? 51.680  44.162  147.979 1.00 93.17  ? 256  LEU A CG  1 
ATOM   4521  C  CD1 . LEU E  5  256  ? 50.876  42.958  147.503 1.00 92.97  ? 256  LEU A CD1 1 
ATOM   4522  C  CD2 . LEU E  5  256  ? 51.083  44.761  149.245 1.00 89.51  ? 256  LEU A CD2 1 
ATOM   4523  N  N   . ASN E  5  257  ? 54.380  44.499  151.132 1.00 109.78 ? 257  ASN A N   1 
ATOM   4524  C  CA  . ASN E  5  257  ? 55.081  44.029  152.332 1.00 111.93 ? 257  ASN A CA  1 
ATOM   4525  C  C   . ASN E  5  257  ? 54.970  42.500  152.521 1.00 119.23 ? 257  ASN A C   1 
ATOM   4526  O  O   . ASN E  5  257  ? 54.044  41.870  152.012 1.00 119.53 ? 257  ASN A O   1 
ATOM   4527  C  CB  . ASN E  5  257  ? 54.571  44.839  153.539 1.00 107.07 ? 257  ASN A CB  1 
ATOM   4528  C  CG  . ASN E  5  257  ? 54.479  44.035  154.813 1.00 108.93 ? 257  ASN A CG  1 
ATOM   4529  O  OD1 . ASN E  5  257  ? 55.435  43.381  155.219 1.00 121.13 ? 257  ASN A OD1 1 
ATOM   4530  N  ND2 . ASN E  5  257  ? 53.323  44.098  155.469 1.00 104.42 ? 257  ASN A ND2 1 
ATOM   4531  N  N   . GLU E  5  258  ? 55.923  41.915  153.246 1.00 128.52 ? 258  GLU A N   1 
ATOM   4532  C  CA  . GLU E  5  258  ? 56.078  40.449  153.346 1.00 132.27 ? 258  GLU A CA  1 
ATOM   4533  C  C   . GLU E  5  258  ? 54.863  39.621  153.783 1.00 127.73 ? 258  GLU A C   1 
ATOM   4534  O  O   . GLU E  5  258  ? 54.483  38.666  153.096 1.00 124.14 ? 258  GLU A O   1 
ATOM   4535  C  CB  . GLU E  5  258  ? 57.286  40.088  154.216 1.00 136.50 ? 258  GLU A CB  1 
ATOM   4536  C  CG  . GLU E  5  258  ? 58.595  40.101  153.450 1.00 139.05 ? 258  GLU A CG  1 
ATOM   4537  C  CD  . GLU E  5  258  ? 58.454  39.487  152.065 1.00 138.55 ? 258  GLU A CD  1 
ATOM   4538  O  OE1 . GLU E  5  258  ? 58.004  38.324  151.969 1.00 136.11 ? 258  GLU A OE1 1 
ATOM   4539  O  OE2 . GLU E  5  258  ? 58.781  40.175  151.071 1.00 138.33 ? 258  GLU A OE2 1 
ATOM   4540  N  N   . LYS E  5  259  ? 54.288  39.965  154.934 1.00 126.15 ? 259  LYS A N   1 
ATOM   4541  C  CA  . LYS E  5  259  ? 53.062  39.328  155.405 1.00 125.76 ? 259  LYS A CA  1 
ATOM   4542  C  C   . LYS E  5  259  ? 51.972  39.443  154.353 1.00 117.99 ? 259  LYS A C   1 
ATOM   4543  O  O   . LYS E  5  259  ? 51.158  38.535  154.189 1.00 118.64 ? 259  LYS A O   1 
ATOM   4544  C  CB  . LYS E  5  259  ? 52.577  39.981  156.698 1.00 132.40 ? 259  LYS A CB  1 
ATOM   4545  C  CG  . LYS E  5  259  ? 53.456  39.713  157.902 1.00 145.69 ? 259  LYS A CG  1 
ATOM   4546  C  CD  . LYS E  5  259  ? 53.027  40.571  159.084 1.00 152.35 ? 259  LYS A CD  1 
ATOM   4547  C  CE  . LYS E  5  259  ? 53.864  40.280  160.325 1.00 158.73 ? 259  LYS A CE  1 
ATOM   4548  N  NZ  . LYS E  5  259  ? 53.576  41.253  161.419 1.00 159.37 ? 259  LYS A NZ  1 
ATOM   4549  N  N   . GLN E  5  260  ? 51.981  40.561  153.632 1.00 109.12 ? 260  GLN A N   1 
ATOM   4550  C  CA  . GLN E  5  260  ? 50.932  40.882  152.675 1.00 103.68 ? 260  GLN A CA  1 
ATOM   4551  C  C   . GLN E  5  260  ? 51.068  40.113  151.363 1.00 110.54 ? 260  GLN A C   1 
ATOM   4552  O  O   . GLN E  5  260  ? 50.074  39.783  150.724 1.00 117.47 ? 260  GLN A O   1 
ATOM   4553  C  CB  . GLN E  5  260  ? 50.892  42.391  152.425 1.00 96.11  ? 260  GLN A CB  1 
ATOM   4554  C  CG  . GLN E  5  260  ? 50.654  43.205  153.692 1.00 95.98  ? 260  GLN A CG  1 
ATOM   4555  C  CD  . GLN E  5  260  ? 50.817  44.708  153.485 1.00 94.74  ? 260  GLN A CD  1 
ATOM   4556  O  OE1 . GLN E  5  260  ? 51.461  45.154  152.529 1.00 93.94  ? 260  GLN A OE1 1 
ATOM   4557  N  NE2 . GLN E  5  260  ? 50.235  45.495  154.390 1.00 91.54  ? 260  GLN A NE2 1 
ATOM   4558  N  N   . ILE E  5  261  ? 52.293  39.824  150.954 1.00 111.61 ? 261  ILE A N   1 
ATOM   4559  C  CA  . ILE E  5  261  ? 52.478  39.012  149.763 1.00 116.47 ? 261  ILE A CA  1 
ATOM   4560  C  C   . ILE E  5  261  ? 52.106  37.574  150.088 1.00 119.70 ? 261  ILE A C   1 
ATOM   4561  O  O   . ILE E  5  261  ? 51.583  36.855  149.237 1.00 119.73 ? 261  ILE A O   1 
ATOM   4562  C  CB  . ILE E  5  261  ? 53.921  39.071  149.255 1.00 119.27 ? 261  ILE A CB  1 
ATOM   4563  C  CG1 . ILE E  5  261  ? 54.369  40.529  149.136 1.00 119.52 ? 261  ILE A CG1 1 
ATOM   4564  C  CG2 . ILE E  5  261  ? 54.042  38.346  147.919 1.00 115.81 ? 261  ILE A CG2 1 
ATOM   4565  C  CD1 . ILE E  5  261  ? 55.800  40.768  149.576 1.00 120.74 ? 261  ILE A CD1 1 
ATOM   4566  N  N   . THR E  5  262  ? 52.373  37.161  151.327 1.00 122.09 ? 262  THR A N   1 
ATOM   4567  C  CA  . THR E  5  262  ? 51.977  35.833  151.796 1.00 123.53 ? 262  THR A CA  1 
ATOM   4568  C  C   . THR E  5  262  ? 50.452  35.693  151.782 1.00 117.40 ? 262  THR A C   1 
ATOM   4569  O  O   . THR E  5  262  ? 49.907  34.760  151.178 1.00 112.39 ? 262  THR A O   1 
ATOM   4570  C  CB  . THR E  5  262  ? 52.550  35.511  153.206 1.00 118.91 ? 262  THR A CB  1 
ATOM   4571  O  OG1 . THR E  5  262  ? 53.886  35.005  153.082 1.00 115.24 ? 262  THR A OG1 1 
ATOM   4572  C  CG2 . THR E  5  262  ? 51.696  34.466  153.914 1.00 122.78 ? 262  THR A CG2 1 
ATOM   4573  N  N   . ASN E  5  263  ? 49.777  36.639  152.430 1.00 115.96 ? 263  ASN A N   1 
ATOM   4574  C  CA  . ASN E  5  263  ? 48.315  36.707  152.438 1.00 110.31 ? 263  ASN A CA  1 
ATOM   4575  C  C   . ASN E  5  263  ? 47.712  36.679  151.038 1.00 101.27 ? 263  ASN A C   1 
ATOM   4576  O  O   . ASN E  5  263  ? 46.673  36.064  150.811 1.00 96.34  ? 263  ASN A O   1 
ATOM   4577  C  CB  . ASN E  5  263  ? 47.864  37.976  153.167 1.00 108.92 ? 263  ASN A CB  1 
ATOM   4578  C  CG  . ASN E  5  263  ? 46.365  38.186  153.117 1.00 107.58 ? 263  ASN A CG  1 
ATOM   4579  O  OD1 . ASN E  5  263  ? 45.644  37.744  154.012 1.00 108.32 ? 263  ASN A OD1 1 
ATOM   4580  N  ND2 . ASN E  5  263  ? 45.889  38.879  152.078 1.00 87.58  ? 263  ASN A ND2 1 
ATOM   4581  N  N   . ASN E  5  264  ? 48.369  37.345  150.099 1.00 91.08  ? 264  ASN A N   1 
ATOM   4582  C  CA  . ASN E  5  264  ? 47.842  37.452  148.746 1.00 89.88  ? 264  ASN A CA  1 
ATOM   4583  C  C   . ASN E  5  264  ? 47.824  36.144  147.946 1.00 95.66  ? 264  ASN A C   1 
ATOM   4584  O  O   . ASN E  5  264  ? 46.870  35.891  147.208 1.00 94.47  ? 264  ASN A O   1 
ATOM   4585  C  CB  . ASN E  5  264  ? 48.546  38.571  147.968 1.00 88.04  ? 264  ASN A CB  1 
ATOM   4586  C  CG  . ASN E  5  264  ? 47.792  39.906  148.045 1.00 90.61  ? 264  ASN A CG  1 
ATOM   4587  O  OD1 . ASN E  5  264  ? 46.973  40.113  148.940 1.00 84.61  ? 264  ASN A OD1 1 
ATOM   4588  N  ND2 . ASN E  5  264  ? 48.066  40.810  147.100 1.00 83.45  ? 264  ASN A ND2 1 
ATOM   4589  N  N   . ARG E  5  265  ? 48.857  35.309  148.082 1.00 95.35  ? 265  ARG A N   1 
ATOM   4590  C  CA  . ARG E  5  265  ? 48.889  34.072  147.299 1.00 97.02  ? 265  ARG A CA  1 
ATOM   4591  C  C   . ARG E  5  265  ? 48.051  32.959  147.911 1.00 102.07 ? 265  ARG A C   1 
ATOM   4592  O  O   . ARG E  5  265  ? 47.652  32.028  147.219 1.00 99.70  ? 265  ARG A O   1 
ATOM   4593  C  CB  . ARG E  5  265  ? 50.312  33.608  146.976 1.00 100.98 ? 265  ARG A CB  1 
ATOM   4594  C  CG  . ARG E  5  265  ? 51.317  33.793  148.087 1.00 106.52 ? 265  ARG A CG  1 
ATOM   4595  C  CD  . ARG E  5  265  ? 52.721  33.342  147.662 1.00 104.20 ? 265  ARG A CD  1 
ATOM   4596  N  NE  . ARG E  5  265  ? 53.671  33.582  148.740 1.00 113.39 ? 265  ARG A NE  1 
ATOM   4597  C  CZ  . ARG E  5  265  ? 53.830  32.771  149.783 1.00 130.36 ? 265  ARG A CZ  1 
ATOM   4598  N  NH1 . ARG E  5  265  ? 53.106  31.657  149.882 1.00 138.54 ? 265  ARG A NH1 1 
ATOM   4599  N  NH2 . ARG E  5  265  ? 54.720  33.063  150.724 1.00 132.68 ? 265  ARG A NH2 1 
ATOM   4600  N  N   . VAL E  5  266  ? 47.771  33.062  149.204 1.00 98.49  ? 266  VAL A N   1 
ATOM   4601  C  CA  . VAL E  5  266  ? 46.818  32.161  149.840 1.00 102.78 ? 266  VAL A CA  1 
ATOM   4602  C  C   . VAL E  5  266  ? 45.432  32.299  149.194 1.00 107.67 ? 266  VAL A C   1 
ATOM   4603  O  O   . VAL E  5  266  ? 44.716  31.307  149.001 1.00 109.51 ? 266  VAL A O   1 
ATOM   4604  C  CB  . VAL E  5  266  ? 46.761  32.398  151.371 1.00 119.08 ? 266  VAL A CB  1 
ATOM   4605  C  CG1 . VAL E  5  266  ? 45.355  32.170  151.923 1.00 117.29 ? 266  VAL A CG1 1 
ATOM   4606  C  CG2 . VAL E  5  266  ? 47.793  31.521  152.089 1.00 125.48 ? 266  VAL A CG2 1 
ATOM   4607  N  N   . LYS E  5  267  ? 45.076  33.534  148.837 1.00 107.09 ? 267  LYS A N   1 
ATOM   4608  C  CA  . LYS E  5  267  ? 43.833  33.818  148.125 1.00 102.59 ? 267  LYS A CA  1 
ATOM   4609  C  C   . LYS E  5  267  ? 43.979  33.610  146.626 1.00 103.69 ? 267  LYS A C   1 
ATOM   4610  O  O   . LYS E  5  267  ? 43.053  33.899  145.863 1.00 106.71 ? 267  LYS A O   1 
ATOM   4611  C  CB  . LYS E  5  267  ? 43.378  35.248  148.382 1.00 94.40  ? 267  LYS A CB  1 
ATOM   4612  C  CG  . LYS E  5  267  ? 42.595  35.414  149.647 1.00 96.29  ? 267  LYS A CG  1 
ATOM   4613  C  CD  . LYS E  5  267  ? 43.357  36.211  150.662 1.00 90.23  ? 267  LYS A CD  1 
ATOM   4614  C  CE  . LYS E  5  267  ? 42.491  36.445  151.874 1.00 89.93  ? 267  LYS A CE  1 
ATOM   4615  N  NZ  . LYS E  5  267  ? 43.126  37.341  152.863 1.00 92.20  ? 267  LYS A NZ  1 
ATOM   4616  N  N   . GLY E  5  268  ? 45.145  33.115  146.218 1.00 98.66  ? 268  GLY A N   1 
ATOM   4617  C  CA  . GLY E  5  268  ? 45.442  32.868  144.819 1.00 99.19  ? 268  GLY A CA  1 
ATOM   4618  C  C   . GLY E  5  268  ? 44.521  31.884  144.106 1.00 103.99 ? 268  GLY A C   1 
ATOM   4619  O  O   . GLY E  5  268  ? 44.248  32.050  142.914 1.00 104.87 ? 268  GLY A O   1 
ATOM   4620  N  N   . PHE E  5  269  ? 44.045  30.861  144.814 1.00 103.68 ? 269  PHE A N   1 
ATOM   4621  C  CA  . PHE E  5  269  ? 43.220  29.842  144.180 1.00 103.47 ? 269  PHE A CA  1 
ATOM   4622  C  C   . PHE E  5  269  ? 41.775  30.278  143.984 1.00 111.64 ? 269  PHE A C   1 
ATOM   4623  O  O   . PHE E  5  269  ? 41.130  29.895  143.007 1.00 115.13 ? 269  PHE A O   1 
ATOM   4624  C  CB  . PHE E  5  269  ? 43.238  28.537  144.962 1.00 105.89 ? 269  PHE A CB  1 
ATOM   4625  C  CG  . PHE E  5  269  ? 42.342  27.490  144.375 1.00 116.59 ? 269  PHE A CG  1 
ATOM   4626  C  CD1 . PHE E  5  269  ? 42.754  26.746  143.274 1.00 125.37 ? 269  PHE A CD1 1 
ATOM   4627  C  CD2 . PHE E  5  269  ? 41.074  27.268  144.894 1.00 119.16 ? 269  PHE A CD2 1 
ATOM   4628  C  CE1 . PHE E  5  269  ? 41.922  25.781  142.711 1.00 129.38 ? 269  PHE A CE1 1 
ATOM   4629  C  CE2 . PHE E  5  269  ? 40.233  26.306  144.334 1.00 124.27 ? 269  PHE A CE2 1 
ATOM   4630  C  CZ  . PHE E  5  269  ? 40.659  25.559  143.242 1.00 127.43 ? 269  PHE A CZ  1 
ATOM   4631  N  N   . ILE E  5  270  ? 41.256  31.047  144.932 1.00 116.25 ? 270  ILE A N   1 
ATOM   4632  C  CA  . ILE E  5  270  ? 39.922  31.621  144.808 1.00 122.27 ? 270  ILE A CA  1 
ATOM   4633  C  C   . ILE E  5  270  ? 39.762  32.477  143.544 1.00 123.85 ? 270  ILE A C   1 
ATOM   4634  O  O   . ILE E  5  270  ? 38.753  32.385  142.836 1.00 123.29 ? 270  ILE A O   1 
ATOM   4635  C  CB  . ILE E  5  270  ? 39.577  32.441  146.051 1.00 124.89 ? 270  ILE A CB  1 
ATOM   4636  C  CG1 . ILE E  5  270  ? 39.126  31.498  147.162 1.00 137.87 ? 270  ILE A CG1 1 
ATOM   4637  C  CG2 . ILE E  5  270  ? 38.501  33.480  145.746 1.00 116.07 ? 270  ILE A CG2 1 
ATOM   4638  C  CD1 . ILE E  5  270  ? 38.415  32.210  148.278 1.00 147.54 ? 270  ILE A CD1 1 
ATOM   4639  N  N   . ARG E  5  271  ? 40.761  33.302  143.254 1.00 124.93 ? 271  ARG A N   1 
ATOM   4640  C  CA  . ARG E  5  271  ? 40.787  34.001  141.978 1.00 127.95 ? 271  ARG A CA  1 
ATOM   4641  C  C   . ARG E  5  271  ? 41.226  33.041  140.860 1.00 136.60 ? 271  ARG A C   1 
ATOM   4642  O  O   . ARG E  5  271  ? 42.417  32.943  140.540 1.00 135.87 ? 271  ARG A O   1 
ATOM   4643  C  CB  . ARG E  5  271  ? 41.707  35.224  142.034 1.00 125.20 ? 271  ARG A CB  1 
ATOM   4644  C  CG  . ARG E  5  271  ? 42.183  35.610  143.425 1.00 123.53 ? 271  ARG A CG  1 
ATOM   4645  C  CD  . ARG E  5  271  ? 42.045  37.112  143.655 1.00 123.19 ? 271  ARG A CD  1 
ATOM   4646  N  NE  . ARG E  5  271  ? 42.307  37.894  142.448 1.00 125.42 ? 271  ARG A NE  1 
ATOM   4647  C  CZ  . ARG E  5  271  ? 41.674  39.025  142.142 1.00 132.67 ? 271  ARG A CZ  1 
ATOM   4648  N  NH1 . ARG E  5  271  ? 40.739  39.513  142.956 1.00 131.90 ? 271  ARG A NH1 1 
ATOM   4649  N  NH2 . ARG E  5  271  ? 41.971  39.671  141.019 1.00 133.72 ? 271  ARG A NH2 1 
ATOM   4650  N  N   . GLN E  5  272  ? 40.254  32.322  140.299 1.00 140.76 ? 272  GLN A N   1 
ATOM   4651  C  CA  . GLN E  5  272  ? 40.464  31.466  139.128 1.00 140.28 ? 272  GLN A CA  1 
ATOM   4652  C  C   . GLN E  5  272  ? 39.160  30.935  138.525 1.00 142.10 ? 272  GLN A C   1 
ATOM   4653  O  O   . GLN E  5  272  ? 38.709  29.827  138.837 1.00 133.17 ? 272  GLN A O   1 
ATOM   4654  C  CB  . GLN E  5  272  ? 41.420  30.324  139.433 1.00 140.49 ? 272  GLN A CB  1 
ATOM   4655  C  CG  . GLN E  5  272  ? 42.773  30.520  138.781 1.00 143.10 ? 272  GLN A CG  1 
ATOM   4656  C  CD  . GLN E  5  272  ? 43.921  30.168  139.703 1.00 145.34 ? 272  GLN A CD  1 
ATOM   4657  O  OE1 . GLN E  5  272  ? 44.212  28.987  139.934 1.00 146.09 ? 272  GLN A OE1 1 
ATOM   4658  N  NE2 . GLN E  5  272  ? 44.583  31.194  140.239 1.00 140.23 ? 272  GLN A NE2 1 
ATOM   4659  N  N   . ASP E  5  273  ? 38.597  31.742  137.625 1.00 150.39 ? 273  ASP A N   1 
ATOM   4660  C  CA  . ASP E  5  273  ? 37.325  31.474  136.961 1.00 148.73 ? 273  ASP A CA  1 
ATOM   4661  C  C   . ASP E  5  273  ? 37.186  32.378  135.728 1.00 142.33 ? 273  ASP A C   1 
ATOM   4662  O  O   . ASP E  5  273  ? 37.868  33.406  135.608 1.00 133.38 ? 273  ASP A O   1 
ATOM   4663  C  CB  . ASP E  5  273  ? 36.159  31.705  137.933 1.00 146.09 ? 273  ASP A CB  1 
ATOM   4664  C  CG  . ASP E  5  273  ? 36.335  32.971  138.780 1.00 136.94 ? 273  ASP A CG  1 
ATOM   4665  O  OD1 . ASP E  5  273  ? 36.130  34.083  138.245 1.00 130.12 ? 273  ASP A OD1 1 
ATOM   4666  O  OD2 . ASP E  5  273  ? 36.685  32.855  139.979 1.00 132.99 ? 273  ASP A OD2 1 
ATOM   4667  N  N   . SER E  5  312  ? 59.472  51.409  146.064 1.00 101.41 ? 312  SER A N   1 
ATOM   4668  C  CA  . SER E  5  312  ? 58.711  52.526  145.497 1.00 104.70 ? 312  SER A CA  1 
ATOM   4669  C  C   . SER E  5  312  ? 58.963  52.748  143.999 1.00 105.39 ? 312  SER A C   1 
ATOM   4670  O  O   . SER E  5  312  ? 59.952  52.267  143.457 1.00 115.34 ? 312  SER A O   1 
ATOM   4671  C  CB  . SER E  5  312  ? 58.996  53.812  146.273 1.00 109.15 ? 312  SER A CB  1 
ATOM   4672  O  OG  . SER E  5  312  ? 57.853  54.226  147.011 1.00 112.40 ? 312  SER A OG  1 
ATOM   4673  N  N   . THR E  5  313  ? 58.053  53.461  143.337 1.00 100.26 ? 313  THR A N   1 
ATOM   4674  C  CA  . THR E  5  313  ? 58.165  53.773  141.908 1.00 99.00  ? 313  THR A CA  1 
ATOM   4675  C  C   . THR E  5  313  ? 57.237  54.922  141.522 1.00 100.76 ? 313  THR A C   1 
ATOM   4676  O  O   . THR E  5  313  ? 56.109  55.002  142.018 1.00 98.49  ? 313  THR A O   1 
ATOM   4677  C  CB  . THR E  5  313  ? 57.731  52.586  141.027 1.00 95.59  ? 313  THR A CB  1 
ATOM   4678  O  OG1 . THR E  5  313  ? 58.178  51.354  141.603 1.00 100.75 ? 313  THR A OG1 1 
ATOM   4679  C  CG2 . THR E  5  313  ? 58.290  52.736  139.612 1.00 95.85  ? 313  THR A CG2 1 
ATOM   4680  N  N   . TYR E  5  314  ? 57.695  55.805  140.634 1.00 101.30 ? 314  TYR A N   1 
ATOM   4681  C  CA  . TYR E  5  314  ? 56.765  56.731  139.995 1.00 100.84 ? 314  TYR A CA  1 
ATOM   4682  C  C   . TYR E  5  314  ? 55.802  55.883  139.173 1.00 89.94  ? 314  TYR A C   1 
ATOM   4683  O  O   . TYR E  5  314  ? 56.189  54.873  138.582 1.00 77.35  ? 314  TYR A O   1 
ATOM   4684  C  CB  . TYR E  5  314  ? 57.466  57.784  139.106 1.00 105.45 ? 314  TYR A CB  1 
ATOM   4685  C  CG  . TYR E  5  314  ? 56.507  58.792  138.465 1.00 107.80 ? 314  TYR A CG  1 
ATOM   4686  C  CD1 . TYR E  5  314  ? 55.948  59.831  139.216 1.00 110.64 ? 314  TYR A CD1 1 
ATOM   4687  C  CD2 . TYR E  5  314  ? 56.153  58.697  137.114 1.00 106.29 ? 314  TYR A CD2 1 
ATOM   4688  C  CE1 . TYR E  5  314  ? 55.056  60.747  138.645 1.00 114.78 ? 314  TYR A CE1 1 
ATOM   4689  C  CE2 . TYR E  5  314  ? 55.265  59.614  136.531 1.00 110.91 ? 314  TYR A CE2 1 
ATOM   4690  C  CZ  . TYR E  5  314  ? 54.714  60.641  137.301 1.00 113.14 ? 314  TYR A CZ  1 
ATOM   4691  O  OH  . TYR E  5  314  ? 53.821  61.559  136.746 1.00 106.01 ? 314  TYR A OH  1 
ATOM   4692  N  N   . ILE E  5  315  ? 54.535  56.270  139.179 1.00 85.18  ? 315  ILE A N   1 
ATOM   4693  C  CA  . ILE E  5  315  ? 53.565  55.627  138.317 1.00 80.85  ? 315  ILE A CA  1 
ATOM   4694  C  C   . ILE E  5  315  ? 52.907  56.678  137.424 1.00 74.07  ? 315  ILE A C   1 
ATOM   4695  O  O   . ILE E  5  315  ? 52.378  57.677  137.908 1.00 77.94  ? 315  ILE A O   1 
ATOM   4696  C  CB  . ILE E  5  315  ? 52.538  54.792  139.123 1.00 76.40  ? 315  ILE A CB  1 
ATOM   4697  C  CG1 . ILE E  5  315  ? 51.190  54.769  138.422 1.00 79.33  ? 315  ILE A CG1 1 
ATOM   4698  C  CG2 . ILE E  5  315  ? 52.337  55.355  140.495 1.00 71.55  ? 315  ILE A CG2 1 
ATOM   4699  C  CD1 . ILE E  5  315  ? 50.119  54.131  139.248 1.00 82.95  ? 315  ILE A CD1 1 
ATOM   4700  N  N   . LEU E  5  316  ? 52.983  56.448  136.117 1.00 68.75  ? 316  LEU A N   1 
ATOM   4701  C  CA  . LEU E  5  316  ? 52.457  57.354  135.107 1.00 68.28  ? 316  LEU A CA  1 
ATOM   4702  C  C   . LEU E  5  316  ? 50.996  57.729  135.309 1.00 68.94  ? 316  LEU A C   1 
ATOM   4703  O  O   . LEU E  5  316  ? 50.212  56.942  135.820 1.00 71.48  ? 316  LEU A O   1 
ATOM   4704  C  CB  . LEU E  5  316  ? 52.611  56.716  133.735 1.00 71.85  ? 316  LEU A CB  1 
ATOM   4705  C  CG  . LEU E  5  316  ? 54.053  56.447  133.341 1.00 70.74  ? 316  LEU A CG  1 
ATOM   4706  C  CD1 . LEU E  5  316  ? 54.096  55.872  131.953 1.00 66.37  ? 316  LEU A CD1 1 
ATOM   4707  C  CD2 . LEU E  5  316  ? 54.829  57.753  133.428 1.00 66.86  ? 316  LEU A CD2 1 
ATOM   4708  N  N   . SER E  5  317  ? 50.633  58.936  134.895 1.00 69.40  ? 317  SER A N   1 
ATOM   4709  C  CA  . SER E  5  317  ? 49.248  59.375  134.979 1.00 65.96  ? 317  SER A CA  1 
ATOM   4710  C  C   . SER E  5  317  ? 48.338  58.447  134.170 1.00 66.49  ? 317  SER A C   1 
ATOM   4711  O  O   . SER E  5  317  ? 47.181  58.239  134.521 1.00 58.35  ? 317  SER A O   1 
ATOM   4712  C  CB  . SER E  5  317  ? 49.118  60.820  134.487 1.00 62.52  ? 317  SER A CB  1 
ATOM   4713  O  OG  . SER E  5  317  ? 49.348  60.905  133.087 1.00 64.92  ? 317  SER A OG  1 
ATOM   4714  N  N   . THR E  5  318  ? 48.873  57.875  133.097 1.00 60.07  ? 318  THR A N   1 
ATOM   4715  C  CA  . THR E  5  318  ? 48.117  56.921  132.286 1.00 60.77  ? 318  THR A CA  1 
ATOM   4716  C  C   . THR E  5  318  ? 47.790  55.628  133.034 1.00 72.40  ? 318  THR A C   1 
ATOM   4717  O  O   . THR E  5  318  ? 46.733  55.051  132.817 1.00 74.29  ? 318  THR A O   1 
ATOM   4718  C  CB  . THR E  5  318  ? 48.842  56.557  130.984 1.00 64.00  ? 318  THR A CB  1 
ATOM   4719  O  OG1 . THR E  5  318  ? 50.177  56.147  131.288 1.00 79.57  ? 318  THR A OG1 1 
ATOM   4720  C  CG2 . THR E  5  318  ? 48.904  57.725  130.060 1.00 61.14  ? 318  THR A CG2 1 
ATOM   4721  N  N   . GLU E  5  319  ? 48.689  55.157  133.894 1.00 62.65  ? 319  GLU A N   1 
ATOM   4722  C  CA  . GLU E  5  319  ? 48.375  53.987  134.714 1.00 79.95  ? 319  GLU A CA  1 
ATOM   4723  C  C   . GLU E  5  319  ? 47.255  54.336  135.685 1.00 75.35  ? 319  GLU A C   1 
ATOM   4724  O  O   . GLU E  5  319  ? 46.256  53.627  135.779 1.00 73.63  ? 319  GLU A O   1 
ATOM   4725  C  CB  . GLU E  5  319  ? 49.595  53.482  135.495 1.00 85.93  ? 319  GLU A CB  1 
ATOM   4726  C  CG  . GLU E  5  319  ? 50.795  53.113  134.635 1.00 98.24  ? 319  GLU A CG  1 
ATOM   4727  C  CD  . GLU E  5  319  ? 51.975  52.563  135.436 1.00 103.17 ? 319  GLU A CD  1 
ATOM   4728  O  OE1 . GLU E  5  319  ? 51.897  51.398  135.898 1.00 107.95 ? 319  GLU A OE1 1 
ATOM   4729  O  OE2 . GLU E  5  319  ? 52.982  53.298  135.590 1.00 99.45  ? 319  GLU A OE2 1 
ATOM   4730  N  N   . VAL E  5  320  ? 47.433  55.439  136.404 1.00 67.21  ? 320  VAL A N   1 
ATOM   4731  C  CA  . VAL E  5  320  ? 46.441  55.910  137.352 1.00 63.49  ? 320  VAL A CA  1 
ATOM   4732  C  C   . VAL E  5  320  ? 45.069  56.019  136.690 1.00 68.93  ? 320  VAL A C   1 
ATOM   4733  O  O   . VAL E  5  320  ? 44.061  55.594  137.256 1.00 67.48  ? 320  VAL A O   1 
ATOM   4734  C  CB  . VAL E  5  320  ? 46.850  57.270  137.923 1.00 62.36  ? 320  VAL A CB  1 
ATOM   4735  C  CG1 . VAL E  5  320  ? 45.796  57.801  138.890 1.00 57.52  ? 320  VAL A CG1 1 
ATOM   4736  C  CG2 . VAL E  5  320  ? 48.196  57.156  138.596 1.00 59.87  ? 320  VAL A CG2 1 
ATOM   4737  N  N   . LYS E  5  321  ? 45.026  56.563  135.479 1.00 71.50  ? 321  LYS A N   1 
ATOM   4738  C  CA  . LYS E  5  321  ? 43.743  56.742  134.812 1.00 70.48  ? 321  LYS A CA  1 
ATOM   4739  C  C   . LYS E  5  321  ? 43.097  55.397  134.489 1.00 71.39  ? 321  LYS A C   1 
ATOM   4740  O  O   . LYS E  5  321  ? 41.885  55.238  134.601 1.00 72.41  ? 321  LYS A O   1 
ATOM   4741  C  CB  . LYS E  5  321  ? 43.867  57.628  133.567 1.00 65.41  ? 321  LYS A CB  1 
ATOM   4742  C  CG  . LYS E  5  321  ? 42.533  57.989  132.911 1.00 63.18  ? 321  LYS A CG  1 
ATOM   4743  C  CD  . LYS E  5  321  ? 42.752  58.938  131.759 1.00 70.54  ? 321  LYS A CD  1 
ATOM   4744  C  CE  . LYS E  5  321  ? 41.932  58.553  130.548 1.00 84.50  ? 321  LYS A CE  1 
ATOM   4745  N  NZ  . LYS E  5  321  ? 42.331  59.410  129.383 1.00 95.20  ? 321  LYS A NZ  1 
ATOM   4746  N  N   . ASN E  5  322  ? 43.902  54.415  134.116 1.00 76.01  ? 322  ASN A N   1 
ATOM   4747  C  CA  . ASN E  5  322  ? 43.341  53.111  133.811 1.00 82.83  ? 322  ASN A CA  1 
ATOM   4748  C  C   . ASN E  5  322  ? 42.738  52.446  135.042 1.00 79.36  ? 322  ASN A C   1 
ATOM   4749  O  O   . ASN E  5  322  ? 41.647  51.894  134.982 1.00 78.18  ? 322  ASN A O   1 
ATOM   4750  C  CB  . ASN E  5  322  ? 44.368  52.219  133.114 1.00 95.03  ? 322  ASN A CB  1 
ATOM   4751  C  CG  . ASN E  5  322  ? 44.400  52.450  131.617 1.00 107.25 ? 322  ASN A CG  1 
ATOM   4752  O  OD1 . ASN E  5  322  ? 43.358  52.675  130.999 1.00 114.02 ? 322  ASN A OD1 1 
ATOM   4753  N  ND2 . ASN E  5  322  ? 45.590  52.414  131.028 1.00 109.90 ? 322  ASN A ND2 1 
ATOM   4754  N  N   . ILE E  5  323  ? 43.437  52.529  136.163 1.00 62.39  ? 323  ILE A N   1 
ATOM   4755  C  CA  . ILE E  5  323  ? 42.920  52.017  137.420 1.00 62.64  ? 323  ILE A CA  1 
ATOM   4756  C  C   . ILE E  5  323  ? 41.577  52.636  137.799 1.00 71.53  ? 323  ILE A C   1 
ATOM   4757  O  O   . ILE E  5  323  ? 40.625  51.915  138.083 1.00 70.57  ? 323  ILE A O   1 
ATOM   4758  C  CB  . ILE E  5  323  ? 43.891  52.272  138.555 1.00 62.72  ? 323  ILE A CB  1 
ATOM   4759  C  CG1 . ILE E  5  323  ? 45.214  51.555  138.300 1.00 64.32  ? 323  ILE A CG1 1 
ATOM   4760  C  CG2 . ILE E  5  323  ? 43.280  51.832  139.848 1.00 62.95  ? 323  ILE A CG2 1 
ATOM   4761  C  CD1 . ILE E  5  323  ? 46.280  51.910  139.290 1.00 64.47  ? 323  ILE A CD1 1 
ATOM   4762  N  N   . LEU E  5  324  ? 41.500  53.970  137.797 1.00 59.65  ? 324  LEU A N   1 
ATOM   4763  C  CA  . LEU E  5  324  ? 40.266  54.674  138.127 1.00 69.95  ? 324  LEU A CA  1 
ATOM   4764  C  C   . LEU E  5  324  ? 39.139  54.452  137.103 1.00 70.89  ? 324  LEU A C   1 
ATOM   4765  O  O   . LEU E  5  324  ? 37.969  54.319  137.479 1.00 58.09  ? 324  LEU A O   1 
ATOM   4766  C  CB  . LEU E  5  324  ? 40.540  56.158  138.329 1.00 56.78  ? 324  LEU A CB  1 
ATOM   4767  C  CG  . LEU E  5  324  ? 41.371  56.461  139.569 1.00 61.39  ? 324  LEU A CG  1 
ATOM   4768  C  CD1 . LEU E  5  324  ? 41.745  57.928  139.640 1.00 63.63  ? 324  LEU A CD1 1 
ATOM   4769  C  CD2 . LEU E  5  324  ? 40.614  56.071  140.804 1.00 58.69  ? 324  LEU A CD2 1 
ATOM   4770  N  N   . ASP E  5  325  ? 39.491  54.401  135.817 1.00 67.30  ? 325  ASP A N   1 
ATOM   4771  C  CA  . ASP E  5  325  ? 38.516  54.082  134.771 1.00 64.55  ? 325  ASP A CA  1 
ATOM   4772  C  C   . ASP E  5  325  ? 37.711  52.840  135.120 1.00 65.11  ? 325  ASP A C   1 
ATOM   4773  O  O   . ASP E  5  325  ? 36.486  52.875  135.111 1.00 67.81  ? 325  ASP A O   1 
ATOM   4774  C  CB  . ASP E  5  325  ? 39.183  53.907  133.409 1.00 78.02  ? 325  ASP A CB  1 
ATOM   4775  C  CG  . ASP E  5  325  ? 39.257  55.206  132.619 1.00 100.89 ? 325  ASP A CG  1 
ATOM   4776  O  OD1 . ASP E  5  325  ? 38.482  56.145  132.920 1.00 108.95 ? 325  ASP A OD1 1 
ATOM   4777  O  OD2 . ASP E  5  325  ? 40.090  55.287  131.689 1.00 109.55 ? 325  ASP A OD2 1 
ATOM   4778  N  N   . THR E  5  326  ? 38.395  51.754  135.470 1.00 69.63  ? 326  THR A N   1 
ATOM   4779  C  CA  . THR E  5  326  ? 37.707  50.527  135.868 1.00 62.92  ? 326  THR A CA  1 
ATOM   4780  C  C   . THR E  5  326  ? 36.936  50.620  137.184 1.00 62.41  ? 326  THR A C   1 
ATOM   4781  O  O   . THR E  5  326  ? 35.793  50.171  137.263 1.00 69.76  ? 326  THR A O   1 
ATOM   4782  C  CB  . THR E  5  326  ? 38.654  49.325  135.963 1.00 65.16  ? 326  THR A CB  1 
ATOM   4783  O  OG1 . THR E  5  326  ? 39.679  49.418  134.962 1.00 66.58  ? 326  THR A OG1 1 
ATOM   4784  C  CG2 . THR E  5  326  ? 37.858  48.034  135.764 1.00 66.34  ? 326  THR A CG2 1 
ATOM   4785  N  N   . VAL E  5  327  ? 37.558  51.182  138.217 1.00 68.56  ? 327  VAL A N   1 
ATOM   4786  C  CA  . VAL E  5  327  ? 36.864  51.400  139.493 1.00 69.20  ? 327  VAL A CA  1 
ATOM   4787  C  C   . VAL E  5  327  ? 35.597  52.250  139.322 1.00 72.42  ? 327  VAL A C   1 
ATOM   4788  O  O   . VAL E  5  327  ? 34.564  51.970  139.945 1.00 70.44  ? 327  VAL A O   1 
ATOM   4789  C  CB  . VAL E  5  327  ? 37.775  52.062  140.539 1.00 65.43  ? 327  VAL A CB  1 
ATOM   4790  C  CG1 . VAL E  5  327  ? 37.067  52.169  141.861 1.00 63.65  ? 327  VAL A CG1 1 
ATOM   4791  C  CG2 . VAL E  5  327  ? 39.037  51.258  140.712 1.00 72.83  ? 327  VAL A CG2 1 
ATOM   4792  N  N   . PHE E  5  328  ? 35.669  53.275  138.470 1.00 58.70  ? 328  PHE A N   1 
ATOM   4793  C  CA  . PHE E  5  328  ? 34.502  54.110  138.222 1.00 57.55  ? 328  PHE A CA  1 
ATOM   4794  C  C   . PHE E  5  328  ? 33.383  53.355  137.485 1.00 67.21  ? 328  PHE A C   1 
ATOM   4795  O  O   . PHE E  5  328  ? 32.202  53.638  137.692 1.00 66.58  ? 328  PHE A O   1 
ATOM   4796  C  CB  . PHE E  5  328  ? 34.883  55.428  137.527 1.00 56.36  ? 328  PHE A CB  1 
ATOM   4797  C  CG  . PHE E  5  328  ? 35.386  56.508  138.475 1.00 65.66  ? 328  PHE A CG  1 
ATOM   4798  C  CD1 . PHE E  5  328  ? 36.298  56.212  139.488 1.00 64.90  ? 328  PHE A CD1 1 
ATOM   4799  C  CD2 . PHE E  5  328  ? 34.965  57.822  138.335 1.00 68.10  ? 328  PHE A CD2 1 
ATOM   4800  C  CE1 . PHE E  5  328  ? 36.761  57.202  140.351 1.00 54.44  ? 328  PHE A CE1 1 
ATOM   4801  C  CE2 . PHE E  5  328  ? 35.430  58.817  139.203 1.00 67.64  ? 328  PHE A CE2 1 
ATOM   4802  C  CZ  . PHE E  5  328  ? 36.324  58.503  140.208 1.00 53.02  ? 328  PHE A CZ  1 
ATOM   4803  N  N   . ARG E  5  329  ? 33.740  52.382  136.652 1.00 64.89  ? 329  ARG A N   1 
ATOM   4804  C  CA  . ARG E  5  329  ? 32.721  51.534  136.039 1.00 69.93  ? 329  ARG A CA  1 
ATOM   4805  C  C   . ARG E  5  329  ? 32.023  50.688  137.093 1.00 71.83  ? 329  ARG A C   1 
ATOM   4806  O  O   . ARG E  5  329  ? 30.798  50.634  137.127 1.00 78.88  ? 329  ARG A O   1 
ATOM   4807  C  CB  . ARG E  5  329  ? 33.327  50.604  135.003 1.00 83.90  ? 329  ARG A CB  1 
ATOM   4808  C  CG  . ARG E  5  329  ? 33.246  51.064  133.592 1.00 96.34  ? 329  ARG A CG  1 
ATOM   4809  C  CD  . ARG E  5  329  ? 34.507  50.581  132.898 1.00 115.32 ? 329  ARG A CD  1 
ATOM   4810  N  NE  . ARG E  5  329  ? 34.666  51.278  131.661 1.00 129.68 ? 329  ARG A NE  1 
ATOM   4811  C  CZ  . ARG E  5  329  ? 35.572  52.151  131.230 1.00 136.41 ? 329  ARG A CZ  1 
ATOM   4812  N  NH1 . ARG E  5  329  ? 36.660  52.552  131.879 1.00 136.58 ? 329  ARG A NH1 1 
ATOM   4813  N  NH2 . ARG E  5  329  ? 35.338  52.605  130.019 1.00 139.00 ? 329  ARG A NH2 1 
ATOM   4814  N  N   . LYS E  5  330  ? 32.807  50.027  137.946 1.00 69.16  ? 330  LYS A N   1 
ATOM   4815  C  CA  . LYS E  5  330  ? 32.262  49.096  138.938 1.00 70.84  ? 330  LYS A CA  1 
ATOM   4816  C  C   . LYS E  5  330  ? 31.508  49.822  140.035 1.00 69.27  ? 330  LYS A C   1 
ATOM   4817  O  O   . LYS E  5  330  ? 30.398  49.447  140.393 1.00 77.88  ? 330  LYS A O   1 
ATOM   4818  C  CB  . LYS E  5  330  ? 33.356  48.213  139.567 1.00 77.17  ? 330  LYS A CB  1 
ATOM   4819  C  CG  . LYS E  5  330  ? 34.066  47.238  138.617 1.00 80.31  ? 330  LYS A CG  1 
ATOM   4820  C  CD  . LYS E  5  330  ? 33.293  45.944  138.395 1.00 83.69  ? 330  LYS A CD  1 
ATOM   4821  C  CE  . LYS E  5  330  ? 34.103  44.979  137.506 1.00 91.67  ? 330  LYS A CE  1 
ATOM   4822  N  NZ  . LYS E  5  330  ? 33.449  43.648  137.257 1.00 92.82  ? 330  LYS A NZ  1 
ATOM   4823  N  N   . GLU E  5  331  ? 32.107  50.864  140.582 1.00 65.96  ? 331  GLU A N   1 
ATOM   4824  C  CA  . GLU E  5  331  ? 31.473  51.547  141.685 1.00 60.23  ? 331  GLU A CA  1 
ATOM   4825  C  C   . GLU E  5  331  ? 30.601  52.705  141.201 1.00 61.45  ? 331  GLU A C   1 
ATOM   4826  O  O   . GLU E  5  331  ? 30.387  53.660  141.928 1.00 63.59  ? 331  GLU A O   1 
ATOM   4827  C  CB  . GLU E  5  331  ? 32.527  52.012  142.697 1.00 59.76  ? 331  GLU A CB  1 
ATOM   4828  C  CG  . GLU E  5  331  ? 33.230  50.883  143.460 1.00 84.17  ? 331  GLU A CG  1 
ATOM   4829  C  CD  . GLU E  5  331  ? 32.314  50.135  144.427 1.00 88.62  ? 331  GLU A CD  1 
ATOM   4830  O  OE1 . GLU E  5  331  ? 31.142  50.542  144.585 1.00 93.00  ? 331  GLU A OE1 1 
ATOM   4831  O  OE2 . GLU E  5  331  ? 32.763  49.138  145.039 1.00 89.53  ? 331  GLU A OE2 1 
ATOM   4832  N  N   . GLN E  5  332  ? 30.086  52.607  139.979 1.00 61.09  ? 332  GLN A N   1 
ATOM   4833  C  CA  . GLN E  5  332  ? 29.334  53.701  139.364 1.00 63.92  ? 332  GLN A CA  1 
ATOM   4834  C  C   . GLN E  5  332  ? 28.104  54.149  140.162 1.00 66.18  ? 332  GLN A C   1 
ATOM   4835  O  O   . GLN E  5  332  ? 27.847  55.336  140.292 1.00 55.86  ? 332  GLN A O   1 
ATOM   4836  C  CB  . GLN E  5  332  ? 28.919  53.335  137.940 1.00 58.33  ? 332  GLN A CB  1 
ATOM   4837  C  CG  . GLN E  5  332  ? 28.103  54.410  137.223 1.00 57.28  ? 332  GLN A CG  1 
ATOM   4838  C  CD  . GLN E  5  332  ? 28.937  55.611  136.810 1.00 60.74  ? 332  GLN A CD  1 
ATOM   4839  O  OE1 . GLN E  5  332  ? 28.404  56.646  136.426 1.00 63.97  ? 332  GLN A OE1 1 
ATOM   4840  N  NE2 . GLN E  5  332  ? 30.255  55.475  136.879 1.00 62.28  ? 332  GLN A NE2 1 
ATOM   4841  N  N   . CYS E  5  333  ? 27.353  53.188  140.686 1.00 58.39  ? 333  CYS A N   1 
ATOM   4842  C  CA  . CYS E  5  333  ? 26.171  53.477  141.487 1.00 58.17  ? 333  CYS A CA  1 
ATOM   4843  C  C   . CYS E  5  333  ? 26.445  54.498  142.580 1.00 56.93  ? 333  CYS A C   1 
ATOM   4844  O  O   . CYS E  5  333  ? 25.830  55.542  142.605 1.00 85.36  ? 333  CYS A O   1 
ATOM   4845  C  CB  . CYS E  5  333  ? 25.602  52.196  142.105 1.00 86.08  ? 333  CYS A CB  1 
ATOM   4846  S  SG  . CYS E  5  333  ? 24.035  52.402  143.018 1.00 71.50  ? 333  CYS A SG  1 
ATOM   4847  N  N   . VAL E  5  334  ? 27.369  54.213  143.480 1.00 73.91  ? 334  VAL A N   1 
ATOM   4848  C  CA  . VAL E  5  334  ? 27.634  55.134  144.563 1.00 56.19  ? 334  VAL A CA  1 
ATOM   4849  C  C   . VAL E  5  334  ? 28.139  56.459  144.008 1.00 63.88  ? 334  VAL A C   1 
ATOM   4850  O  O   . VAL E  5  334  ? 27.731  57.510  144.489 1.00 61.49  ? 334  VAL A O   1 
ATOM   4851  C  CB  . VAL E  5  334  ? 28.593  54.547  145.634 1.00 76.57  ? 334  VAL A CB  1 
ATOM   4852  C  CG1 . VAL E  5  334  ? 30.020  54.470  145.137 1.00 56.93  ? 334  VAL A CG1 1 
ATOM   4853  C  CG2 . VAL E  5  334  ? 28.534  55.367  146.873 1.00 56.23  ? 334  VAL A CG2 1 
ATOM   4854  N  N   . LEU E  5  335  ? 28.972  56.419  142.974 1.00 54.56  ? 335  LEU A N   1 
ATOM   4855  C  CA  . LEU E  5  335  ? 29.603  57.640  142.483 1.00 58.94  ? 335  LEU A CA  1 
ATOM   4856  C  C   . LEU E  5  335  ? 28.567  58.589  141.873 1.00 54.30  ? 335  LEU A C   1 
ATOM   4857  O  O   . LEU E  5  335  ? 28.693  59.808  141.923 1.00 56.29  ? 335  LEU A O   1 
ATOM   4858  C  CB  . LEU E  5  335  ? 30.704  57.310  141.484 1.00 53.56  ? 335  LEU A CB  1 
ATOM   4859  C  CG  . LEU E  5  335  ? 31.887  56.542  142.073 1.00 67.11  ? 335  LEU A CG  1 
ATOM   4860  C  CD1 . LEU E  5  335  ? 32.950  56.301  141.011 1.00 66.49  ? 335  LEU A CD1 1 
ATOM   4861  C  CD2 . LEU E  5  335  ? 32.482  57.264  143.275 1.00 53.77  ? 335  LEU A CD2 1 
ATOM   4862  N  N   . GLN E  5  336  ? 27.519  57.992  141.339 1.00 56.23  ? 336  GLN A N   1 
ATOM   4863  C  CA  . GLN E  5  336  ? 26.408  58.690  140.738 1.00 58.03  ? 336  GLN A CA  1 
ATOM   4864  C  C   . GLN E  5  336  ? 25.754  59.629  141.770 1.00 51.66  ? 336  GLN A C   1 
ATOM   4865  O  O   . GLN E  5  336  ? 25.250  60.697  141.435 1.00 51.12  ? 336  GLN A O   1 
ATOM   4866  C  CB  . GLN E  5  336  ? 25.434  57.634  140.180 1.00 53.77  ? 336  GLN A CB  1 
ATOM   4867  C  CG  . GLN E  5  336  ? 24.456  58.083  139.109 1.00 54.40  ? 336  GLN A CG  1 
ATOM   4868  C  CD  . GLN E  5  336  ? 25.124  58.595  137.859 1.00 57.65  ? 336  GLN A CD  1 
ATOM   4869  O  OE1 . GLN E  5  336  ? 24.818  59.688  137.402 1.00 70.80  ? 336  GLN A OE1 1 
ATOM   4870  N  NE2 . GLN E  5  336  ? 26.028  57.824  137.298 1.00 53.89  ? 336  GLN A NE2 1 
ATOM   4871  N  N   . TYR E  5  337  ? 25.791  59.255  143.037 1.00 58.80  ? 337  TYR A N   1 
ATOM   4872  C  CA  . TYR E  5  337  ? 25.238  60.133  144.070 1.00 51.32  ? 337  TYR A CA  1 
ATOM   4873  C  C   . TYR E  5  337  ? 26.286  60.955  144.820 1.00 59.82  ? 337  TYR A C   1 
ATOM   4874  O  O   . TYR E  5  337  ? 25.989  62.006  145.348 1.00 65.13  ? 337  TYR A O   1 
ATOM   4875  C  CB  . TYR E  5  337  ? 24.391  59.322  145.032 1.00 52.33  ? 337  TYR A CB  1 
ATOM   4876  C  CG  . TYR E  5  337  ? 23.385  58.505  144.286 1.00 57.51  ? 337  TYR A CG  1 
ATOM   4877  C  CD1 . TYR E  5  337  ? 22.368  59.131  143.595 1.00 60.73  ? 337  TYR A CD1 1 
ATOM   4878  C  CD2 . TYR E  5  337  ? 23.458  57.121  144.239 1.00 56.38  ? 337  TYR A CD2 1 
ATOM   4879  C  CE1 . TYR E  5  337  ? 21.444  58.422  142.882 1.00 65.89  ? 337  TYR A CE1 1 
ATOM   4880  C  CE2 . TYR E  5  337  ? 22.508  56.380  143.516 1.00 58.32  ? 337  TYR A CE2 1 
ATOM   4881  C  CZ  . TYR E  5  337  ? 21.505  57.052  142.838 1.00 63.75  ? 337  TYR A CZ  1 
ATOM   4882  O  OH  . TYR E  5  337  ? 20.544  56.396  142.105 1.00 56.35  ? 337  TYR A OH  1 
ATOM   4883  N  N   . VAL E  5  338  ? 27.519  60.481  144.862 1.00 57.52  ? 338  VAL A N   1 
ATOM   4884  C  CA  . VAL E  5  338  ? 28.592  61.235  145.487 1.00 50.09  ? 338  VAL A CA  1 
ATOM   4885  C  C   . VAL E  5  338  ? 28.921  62.475  144.654 1.00 54.84  ? 338  VAL A C   1 
ATOM   4886  O  O   . VAL E  5  338  ? 29.372  63.502  145.177 1.00 56.86  ? 338  VAL A O   1 
ATOM   4887  C  CB  . VAL E  5  338  ? 29.827  60.332  145.674 1.00 50.91  ? 338  VAL A CB  1 
ATOM   4888  C  CG1 . VAL E  5  338  ? 31.087  61.120  145.869 1.00 50.27  ? 338  VAL A CG1 1 
ATOM   4889  C  CG2 . VAL E  5  338  ? 29.593  59.393  146.835 1.00 52.01  ? 338  VAL A CG2 1 
ATOM   4890  N  N   . PHE E  5  339  ? 28.678  62.392  143.353 1.00 53.04  ? 339  PHE A N   1 
ATOM   4891  C  CA  . PHE E  5  339  ? 29.072  63.482  142.476 1.00 53.04  ? 339  PHE A CA  1 
ATOM   4892  C  C   . PHE E  5  339  ? 27.885  64.311  142.007 1.00 52.57  ? 339  PHE A C   1 
ATOM   4893  O  O   . PHE E  5  339  ? 28.043  65.163  141.122 1.00 48.64  ? 339  PHE A O   1 
ATOM   4894  C  CB  . PHE E  5  339  ? 29.830  62.959  141.264 1.00 48.34  ? 339  PHE A CB  1 
ATOM   4895  C  CG  . PHE E  5  339  ? 31.258  62.591  141.544 1.00 52.48  ? 339  PHE A CG  1 
ATOM   4896  C  CD1 . PHE E  5  339  ? 31.585  61.333  142.004 1.00 63.41  ? 339  PHE A CD1 1 
ATOM   4897  C  CD2 . PHE E  5  339  ? 32.274  63.483  141.305 1.00 51.38  ? 339  PHE A CD2 1 
ATOM   4898  C  CE1 . PHE E  5  339  ? 32.905  60.989  142.244 1.00 66.61  ? 339  PHE A CE1 1 
ATOM   4899  C  CE2 . PHE E  5  339  ? 33.588  63.137  141.532 1.00 54.35  ? 339  PHE A CE2 1 
ATOM   4900  C  CZ  . PHE E  5  339  ? 33.903  61.895  142.009 1.00 56.48  ? 339  PHE A CZ  1 
ATOM   4901  N  N   . HIS E  5  340  ? 26.706  64.055  142.581 1.00 51.51  ? 340  HIS A N   1 
ATOM   4902  C  CA  . HIS E  5  340  ? 25.514  64.830  142.244 1.00 52.91  ? 340  HIS A CA  1 
ATOM   4903  C  C   . HIS E  5  340  ? 24.696  65.140  143.487 1.00 54.67  ? 340  HIS A C   1 
ATOM   4904  O  O   . HIS E  5  340  ? 24.078  64.243  144.061 1.00 56.50  ? 340  HIS A O   1 
ATOM   4905  C  CB  . HIS E  5  340  ? 24.630  64.101  141.223 1.00 48.07  ? 340  HIS A CB  1 
ATOM   4906  C  CG  . HIS E  5  340  ? 25.229  64.004  139.855 1.00 56.46  ? 340  HIS A CG  1 
ATOM   4907  N  ND1 . HIS E  5  340  ? 25.977  62.920  139.437 1.00 63.52  ? 340  HIS A ND1 1 
ATOM   4908  C  CD2 . HIS E  5  340  ? 25.181  64.848  138.800 1.00 57.19  ? 340  HIS A CD2 1 
ATOM   4909  C  CE1 . HIS E  5  340  ? 26.361  63.103  138.186 1.00 60.87  ? 340  HIS A CE1 1 
ATOM   4910  N  NE2 . HIS E  5  340  ? 25.894  64.268  137.777 1.00 59.57  ? 340  HIS A NE2 1 
ATOM   4911  N  N   . SER E  5  341  ? 24.670  66.414  143.885 1.00 54.66  ? 341  SER A N   1 
ATOM   4912  C  CA  . SER E  5  341  ? 23.827  66.862  145.000 1.00 46.32  ? 341  SER A CA  1 
ATOM   4913  C  C   . SER E  5  341  ? 22.334  66.885  144.645 1.00 50.44  ? 341  SER A C   1 
ATOM   4914  O  O   . SER E  5  341  ? 21.478  66.763  145.521 1.00 62.23  ? 341  SER A O   1 
ATOM   4915  C  CB  . SER E  5  341  ? 24.285  68.221  145.473 1.00 45.40  ? 341  SER A CB  1 
ATOM   4916  O  OG  . SER E  5  341  ? 24.440  69.108  144.384 1.00 67.40  ? 341  SER A OG  1 
ATOM   4917  N  N   . ARG E  5  342  ? 22.034  67.048  143.358 1.00 49.22  ? 342  ARG A N   1 
ATOM   4918  C  CA  . ARG E  5  342  ? 20.675  66.910  142.830 1.00 56.02  ? 342  ARG A CA  1 
ATOM   4919  C  C   . ARG E  5  342  ? 20.576  65.598  142.042 1.00 62.22  ? 342  ARG A C   1 
ATOM   4920  O  O   . ARG E  5  342  ? 21.600  65.046  141.613 1.00 63.10  ? 342  ARG A O   1 
ATOM   4921  C  CB  . ARG E  5  342  ? 20.377  68.046  141.856 1.00 60.61  ? 342  ARG A CB  1 
ATOM   4922  C  CG  . ARG E  5  342  ? 20.374  69.424  142.434 1.00 75.59  ? 342  ARG A CG  1 
ATOM   4923  C  CD  . ARG E  5  342  ? 20.106  70.394  141.308 1.00 83.41  ? 342  ARG A CD  1 
ATOM   4924  N  NE  . ARG E  5  342  ? 21.157  70.378  140.333 1.00 86.60  ? 342  ARG A NE  1 
ATOM   4925  C  CZ  . ARG E  5  342  ? 21.131  70.240  139.010 1.00 88.40  ? 342  ARG A CZ  1 
ATOM   4926  N  NH1 . ARG E  5  342  ? 20.023  70.058  138.281 1.00 97.24  ? 342  ARG A NH1 1 
ATOM   4927  N  NH2 . ARG E  5  342  ? 22.325  70.297  138.421 1.00 71.02  ? 342  ARG A NH2 1 
ATOM   4928  N  N   . PRO E  5  343  ? 19.347  65.109  141.820 1.00 55.47  ? 343  PRO A N   1 
ATOM   4929  C  CA  . PRO E  5  343  ? 19.135  64.004  140.886 1.00 60.24  ? 343  PRO A CA  1 
ATOM   4930  C  C   . PRO E  5  343  ? 19.760  64.325  139.549 1.00 62.80  ? 343  PRO A C   1 
ATOM   4931  O  O   . PRO E  5  343  ? 19.681  65.471  139.104 1.00 72.60  ? 343  PRO A O   1 
ATOM   4932  C  CB  . PRO E  5  343  ? 17.621  63.976  140.731 1.00 60.57  ? 343  PRO A CB  1 
ATOM   4933  C  CG  . PRO E  5  343  ? 17.131  64.453  142.038 1.00 61.05  ? 343  PRO A CG  1 
ATOM   4934  C  CD  . PRO E  5  343  ? 18.089  65.530  142.445 1.00 60.53  ? 343  PRO A CD  1 
ATOM   4935  N  N   . ASN E  5  344  ? 20.395  63.331  138.940 1.00 57.18  ? 344  ASN A N   1 
ATOM   4936  C  CA  . ASN E  5  344  ? 21.096  63.524  137.680 1.00 62.39  ? 344  ASN A CA  1 
ATOM   4937  C  C   . ASN E  5  344  ? 20.170  63.179  136.535 1.00 63.14  ? 344  ASN A C   1 
ATOM   4938  O  O   . ASN E  5  344  ? 20.227  62.077  135.975 1.00 59.97  ? 344  ASN A O   1 
ATOM   4939  C  CB  . ASN E  5  344  ? 22.401  62.713  137.624 1.00 50.29  ? 344  ASN A CB  1 
ATOM   4940  C  CG  . ASN E  5  344  ? 23.085  62.779  136.269 1.00 66.21  ? 344  ASN A CG  1 
ATOM   4941  O  OD1 . ASN E  5  344  ? 22.826  63.667  135.465 1.00 74.05  ? 344  ASN A OD1 1 
ATOM   4942  N  ND2 . ASN E  5  344  ? 23.968  61.827  136.011 1.00 67.33  ? 344  ASN A ND2 1 
ATOM   4943  N  N   . LEU E  5  345  ? 19.314  64.139  136.199 1.00 62.90  ? 345  LEU A N   1 
ATOM   4944  C  CA  . LEU E  5  345  ? 18.362  63.964  135.120 1.00 65.44  ? 345  LEU A CA  1 
ATOM   4945  C  C   . LEU E  5  345  ? 19.056  63.706  133.788 1.00 69.71  ? 345  LEU A C   1 
ATOM   4946  O  O   . LEU E  5  345  ? 18.631  62.832  133.031 1.00 70.01  ? 345  LEU A O   1 
ATOM   4947  C  CB  . LEU E  5  345  ? 17.457  65.180  135.054 1.00 65.21  ? 345  LEU A CB  1 
ATOM   4948  C  CG  . LEU E  5  345  ? 16.637  65.234  136.345 1.00 63.33  ? 345  LEU A CG  1 
ATOM   4949  C  CD1 . LEU E  5  345  ? 15.929  66.570  136.507 1.00 57.92  ? 345  LEU A CD1 1 
ATOM   4950  C  CD2 . LEU E  5  345  ? 15.649  64.037  136.405 1.00 57.00  ? 345  LEU A CD2 1 
ATOM   4951  N  N   . SER E  5  346  ? 20.140  64.446  133.537 1.00 74.55  ? 346  SER A N   1 
ATOM   4952  C  CA  . SER E  5  346  ? 20.967  64.294  132.334 1.00 74.82  ? 346  SER A CA  1 
ATOM   4953  C  C   . SER E  5  346  ? 21.399  62.849  132.050 1.00 70.12  ? 346  SER A C   1 
ATOM   4954  O  O   . SER E  5  346  ? 21.672  62.490  130.905 1.00 71.24  ? 346  SER A O   1 
ATOM   4955  C  CB  . SER E  5  346  ? 22.228  65.144  132.456 1.00 78.93  ? 346  SER A CB  1 
ATOM   4956  O  OG  . SER E  5  346  ? 23.355  64.306  132.679 1.00 78.69  ? 346  SER A OG  1 
ATOM   4957  N  N   . ARG E  5  347  ? 21.479  62.042  133.103 1.00 68.06  ? 347  ARG A N   1 
ATOM   4958  C  CA  . ARG E  5  347  ? 21.827  60.622  133.005 1.00 68.30  ? 347  ARG A CA  1 
ATOM   4959  C  C   . ARG E  5  347  ? 23.263  60.350  132.546 1.00 68.82  ? 347  ARG A C   1 
ATOM   4960  O  O   . ARG E  5  347  ? 23.568  59.232  132.163 1.00 68.87  ? 347  ARG A O   1 
ATOM   4961  C  CB  . ARG E  5  347  ? 20.847  59.870  132.104 1.00 70.20  ? 347  ARG A CB  1 
ATOM   4962  C  CG  . ARG E  5  347  ? 19.517  59.481  132.728 1.00 86.59  ? 347  ARG A CG  1 
ATOM   4963  C  CD  . ARG E  5  347  ? 18.583  58.946  131.628 1.00 107.81 ? 347  ARG A CD  1 
ATOM   4964  N  NE  . ARG E  5  347  ? 17.536  58.040  132.105 1.00 122.91 ? 347  ARG A NE  1 
ATOM   4965  C  CZ  . ARG E  5  347  ? 16.741  57.326  131.306 1.00 131.97 ? 347  ARG A CZ  1 
ATOM   4966  N  NH1 . ARG E  5  347  ? 16.870  57.405  129.984 1.00 131.15 ? 347  ARG A NH1 1 
ATOM   4967  N  NH2 . ARG E  5  347  ? 15.815  56.526  131.827 1.00 135.68 ? 347  ARG A NH2 1 
ATOM   4968  N  N   . LYS E  5  348  ? 24.138  61.355  132.596 1.00 68.54  ? 348  LYS A N   1 
ATOM   4969  C  CA  . LYS E  5  348  ? 25.536  61.175  132.196 1.00 66.51  ? 348  LYS A CA  1 
ATOM   4970  C  C   . LYS E  5  348  ? 26.286  60.293  133.194 1.00 71.59  ? 348  LYS A C   1 
ATOM   4971  O  O   . LYS E  5  348  ? 26.102  60.435  134.416 1.00 75.85  ? 348  LYS A O   1 
ATOM   4972  C  CB  . LYS E  5  348  ? 26.251  62.527  132.113 1.00 72.11  ? 348  LYS A CB  1 
ATOM   4973  C  CG  . LYS E  5  348  ? 25.955  63.365  130.889 1.00 87.11  ? 348  LYS A CG  1 
ATOM   4974  C  CD  . LYS E  5  348  ? 26.750  64.684  130.933 1.00 101.84 ? 348  LYS A CD  1 
ATOM   4975  C  CE  . LYS E  5  348  ? 26.648  65.463  129.612 1.00 105.39 ? 348  LYS A CE  1 
ATOM   4976  N  NZ  . LYS E  5  348  ? 27.286  66.810  129.703 1.00 96.01  ? 348  LYS A NZ  1 
ATOM   4977  N  N   . LEU E  5  349  ? 27.145  59.401  132.691 1.00 64.35  ? 349  LEU A N   1 
ATOM   4978  C  CA  . LEU E  5  349  ? 27.984  58.595  133.582 1.00 65.00  ? 349  LEU A CA  1 
ATOM   4979  C  C   . LEU E  5  349  ? 29.003  59.475  134.277 1.00 64.92  ? 349  LEU A C   1 
ATOM   4980  O  O   . LEU E  5  349  ? 29.373  60.529  133.758 1.00 67.48  ? 349  LEU A O   1 
ATOM   4981  C  CB  . LEU E  5  349  ? 28.737  57.514  132.821 1.00 55.07  ? 349  LEU A CB  1 
ATOM   4982  C  CG  . LEU E  5  349  ? 27.907  56.516  132.044 1.00 59.28  ? 349  LEU A CG  1 
ATOM   4983  C  CD1 . LEU E  5  349  ? 28.862  55.650  131.316 1.00 57.63  ? 349  LEU A CD1 1 
ATOM   4984  C  CD2 . LEU E  5  349  ? 27.010  55.688  132.943 1.00 58.31  ? 349  LEU A CD2 1 
ATOM   4985  N  N   . VAL E  5  350  ? 29.454  59.044  135.450 1.00 61.65  ? 350  VAL A N   1 
ATOM   4986  C  CA  . VAL E  5  350  ? 30.548  59.721  136.122 1.00 59.51  ? 350  VAL A CA  1 
ATOM   4987  C  C   . VAL E  5  350  ? 31.836  59.067  135.679 1.00 68.46  ? 350  VAL A C   1 
ATOM   4988  O  O   . VAL E  5  350  ? 32.070  57.896  135.964 1.00 74.45  ? 350  VAL A O   1 
ATOM   4989  C  CB  . VAL E  5  350  ? 30.412  59.630  137.640 1.00 53.19  ? 350  VAL A CB  1 
ATOM   4990  C  CG1 . VAL E  5  350  ? 31.684  60.108  138.318 1.00 52.18  ? 350  VAL A CG1 1 
ATOM   4991  C  CG2 . VAL E  5  350  ? 29.249  60.447  138.085 1.00 54.30  ? 350  VAL A CG2 1 
ATOM   4992  N  N   . LYS E  5  351  ? 32.668  59.817  134.970 1.00 67.33  ? 351  LYS A N   1 
ATOM   4993  C  CA  . LYS E  5  351  ? 33.864  59.242  134.364 1.00 61.21  ? 351  LYS A CA  1 
ATOM   4994  C  C   . LYS E  5  351  ? 35.139  59.672  135.062 1.00 61.49  ? 351  LYS A C   1 
ATOM   4995  O  O   . LYS E  5  351  ? 35.231  60.774  135.580 1.00 67.33  ? 351  LYS A O   1 
ATOM   4996  C  CB  . LYS E  5  351  ? 33.945  59.619  132.887 1.00 60.82  ? 351  LYS A CB  1 
ATOM   4997  C  CG  . LYS E  5  351  ? 33.024  58.821  132.006 1.00 69.09  ? 351  LYS A CG  1 
ATOM   4998  C  CD  . LYS E  5  351  ? 33.176  59.242  130.555 1.00 84.05  ? 351  LYS A CD  1 
ATOM   4999  C  CE  . LYS E  5  351  ? 32.478  58.259  129.620 1.00 93.29  ? 351  LYS A CE  1 
ATOM   5000  N  NZ  . LYS E  5  351  ? 32.359  58.805  128.236 1.00 91.08  ? 351  LYS A NZ  1 
ATOM   5001  N  N   . ALA E  5  352  ? 36.134  58.797  135.057 1.00 66.93  ? 352  ALA A N   1 
ATOM   5002  C  CA  . ALA E  5  352  ? 37.437  59.113  135.631 1.00 64.95  ? 352  ALA A CA  1 
ATOM   5003  C  C   . ALA E  5  352  ? 38.134  60.254  134.881 1.00 61.59  ? 352  ALA A C   1 
ATOM   5004  O  O   . ALA E  5  352  ? 38.948  60.973  135.453 1.00 51.92  ? 352  ALA A O   1 
ATOM   5005  C  CB  . ALA E  5  352  ? 38.325  57.863  135.658 1.00 54.65  ? 352  ALA A CB  1 
ATOM   5006  N  N   . ASP E  5  353  ? 37.804  60.417  133.604 1.00 64.90  ? 353  ASP A N   1 
ATOM   5007  C  CA  . ASP E  5  353  ? 38.467  61.400  132.749 1.00 63.08  ? 353  ASP A CA  1 
ATOM   5008  C  C   . ASP E  5  353  ? 38.325  62.777  133.343 1.00 62.48  ? 353  ASP A C   1 
ATOM   5009  O  O   . ASP E  5  353  ? 39.190  63.631  133.155 1.00 68.81  ? 353  ASP A O   1 
ATOM   5010  C  CB  . ASP E  5  353  ? 37.868  61.417  131.338 1.00 71.33  ? 353  ASP A CB  1 
ATOM   5011  C  CG  . ASP E  5  353  ? 37.698  60.024  130.750 1.00 97.79  ? 353  ASP A CG  1 
ATOM   5012  O  OD1 . ASP E  5  353  ? 38.536  59.124  131.039 1.00 111.01 ? 353  ASP A OD1 1 
ATOM   5013  O  OD2 . ASP E  5  353  ? 36.715  59.833  129.993 1.00 99.25  ? 353  ASP A OD2 1 
ATOM   5014  N  N   . SER E  5  354  ? 37.228  62.986  134.066 1.00 56.34  ? 354  SER A N   1 
ATOM   5015  C  CA  . SER E  5  354  ? 36.926  64.287  134.648 1.00 55.38  ? 354  SER A CA  1 
ATOM   5016  C  C   . SER E  5  354  ? 38.060  64.820  135.519 1.00 49.89  ? 354  SER A C   1 
ATOM   5017  O  O   . SER E  5  354  ? 38.194  66.022  135.684 1.00 53.63  ? 354  SER A O   1 
ATOM   5018  C  CB  . SER E  5  354  ? 35.609  64.243  135.424 1.00 57.59  ? 354  SER A CB  1 
ATOM   5019  O  OG  . SER E  5  354  ? 34.590  63.637  134.641 1.00 67.37  ? 354  SER A OG  1 
ATOM   5020  N  N   . PHE E  5  355  ? 38.891  63.927  136.049 1.00 50.41  ? 355  PHE A N   1 
ATOM   5021  C  CA  . PHE E  5  355  ? 40.032  64.317  136.866 1.00 49.29  ? 355  PHE A CA  1 
ATOM   5022  C  C   . PHE E  5  355  ? 41.311  64.579  136.075 1.00 49.69  ? 355  PHE A C   1 
ATOM   5023  O  O   . PHE E  5  355  ? 42.326  64.951  136.659 1.00 77.41  ? 355  PHE A O   1 
ATOM   5024  C  CB  . PHE E  5  355  ? 40.309  63.265  137.942 1.00 66.19  ? 355  PHE A CB  1 
ATOM   5025  C  CG  . PHE E  5  355  ? 39.202  63.103  138.938 1.00 65.22  ? 355  PHE A CG  1 
ATOM   5026  C  CD1 . PHE E  5  355  ? 39.138  63.893  140.045 1.00 68.84  ? 355  PHE A CD1 1 
ATOM   5027  C  CD2 . PHE E  5  355  ? 38.245  62.135  138.770 1.00 72.52  ? 355  PHE A CD2 1 
ATOM   5028  C  CE1 . PHE E  5  355  ? 38.124  63.736  140.955 1.00 74.70  ? 355  PHE A CE1 1 
ATOM   5029  C  CE2 . PHE E  5  355  ? 37.238  61.977  139.679 1.00 74.63  ? 355  PHE A CE2 1 
ATOM   5030  C  CZ  . PHE E  5  355  ? 37.176  62.778  140.768 1.00 72.86  ? 355  PHE A CZ  1 
ATOM   5031  N  N   . PHE E  5  356  ? 41.260  64.393  134.758 1.00 75.60  ? 356  PHE A N   1 
ATOM   5032  C  CA  . PHE E  5  356  ? 42.441  64.504  133.887 1.00 65.40  ? 356  PHE A CA  1 
ATOM   5033  C  C   . PHE E  5  356  ? 42.200  65.524  132.792 1.00 67.44  ? 356  PHE A C   1 
ATOM   5034  O  O   . PHE E  5  356  ? 41.052  65.870  132.506 1.00 74.81  ? 356  PHE A O   1 
ATOM   5035  C  CB  . PHE E  5  356  ? 42.767  63.152  133.228 1.00 57.36  ? 356  PHE A CB  1 
ATOM   5036  C  CG  . PHE E  5  356  ? 43.167  62.083  134.202 1.00 58.99  ? 356  PHE A CG  1 
ATOM   5037  C  CD1 . PHE E  5  356  ? 42.208  61.391  134.930 1.00 62.35  ? 356  PHE A CD1 1 
ATOM   5038  C  CD2 . PHE E  5  356  ? 44.500  61.776  134.412 1.00 59.96  ? 356  PHE A CD2 1 
ATOM   5039  C  CE1 . PHE E  5  356  ? 42.578  60.410  135.841 1.00 61.55  ? 356  PHE A CE1 1 
ATOM   5040  C  CE2 . PHE E  5  356  ? 44.859  60.797  135.327 1.00 66.43  ? 356  PHE A CE2 1 
ATOM   5041  C  CZ  . PHE E  5  356  ? 43.898  60.118  136.030 1.00 54.52  ? 356  PHE A CZ  1 
ATOM   5042  N  N   . MET E  5  357  ? 43.274  65.996  132.170 1.00 62.40  ? 357  MET A N   1 
ATOM   5043  C  CA  . MET E  5  357  ? 43.139  66.923  131.042 1.00 59.90  ? 357  MET A CA  1 
ATOM   5044  C  C   . MET E  5  357  ? 43.939  66.412  129.845 1.00 59.35  ? 357  MET A C   1 
ATOM   5045  O  O   . MET E  5  357  ? 45.144  66.187  129.940 1.00 64.10  ? 357  MET A O   1 
ATOM   5046  C  CB  . MET E  5  357  ? 43.604  68.347  131.415 1.00 57.67  ? 357  MET A CB  1 
ATOM   5047  C  CG  . MET E  5  357  ? 43.572  68.660  132.905 1.00 48.69  ? 357  MET A CG  1 
ATOM   5048  S  SD  . MET E  5  357  ? 44.062  70.334  133.298 1.00 77.04  ? 357  MET A SD  1 
ATOM   5049  C  CE  . MET E  5  357  ? 42.635  71.280  132.779 1.00 47.23  ? 357  MET A CE  1 
ATOM   5050  N  N   . ASP E  5  358  ? 43.271  66.222  128.718 1.00 56.11  ? 358  ASP A N   1 
ATOM   5051  C  CA  . ASP E  5  358  ? 43.979  65.813  127.512 1.00 59.30  ? 358  ASP A CA  1 
ATOM   5052  C  C   . ASP E  5  358  ? 44.196  67.043  126.623 1.00 62.00  ? 358  ASP A C   1 
ATOM   5053  O  O   . ASP E  5  358  ? 44.968  67.002  125.659 1.00 53.46  ? 358  ASP A O   1 
ATOM   5054  C  CB  . ASP E  5  358  ? 43.222  64.707  126.753 1.00 65.32  ? 358  ASP A CB  1 
ATOM   5055  C  CG  . ASP E  5  358  ? 43.167  63.371  127.517 1.00 79.44  ? 358  ASP A CG  1 
ATOM   5056  O  OD1 . ASP E  5  358  ? 43.877  63.211  128.535 1.00 85.90  ? 358  ASP A OD1 1 
ATOM   5057  O  OD2 . ASP E  5  358  ? 42.416  62.461  127.085 1.00 86.54  ? 358  ASP A OD2 1 
ATOM   5058  N  N   . VAL E  5  359  ? 43.495  68.130  126.950 1.00 51.42  ? 359  VAL A N   1 
ATOM   5059  C  CA  . VAL E  5  359  ? 43.652  69.410  126.258 1.00 54.26  ? 359  VAL A CA  1 
ATOM   5060  C  C   . VAL E  5  359  ? 43.575  70.573  127.251 1.00 55.15  ? 359  VAL A C   1 
ATOM   5061  O  O   . VAL E  5  359  ? 43.055  70.432  128.348 1.00 57.70  ? 359  VAL A O   1 
ATOM   5062  C  CB  . VAL E  5  359  ? 42.545  69.648  125.230 1.00 54.32  ? 359  VAL A CB  1 
ATOM   5063  C  CG1 . VAL E  5  359  ? 42.505  68.534  124.213 1.00 58.17  ? 359  VAL A CG1 1 
ATOM   5064  C  CG2 . VAL E  5  359  ? 41.199  69.769  125.937 1.00 59.23  ? 359  VAL A CG2 1 
ATOM   5065  N  N   . LEU E  5  360  ? 44.100  71.723  126.858 1.00 53.65  ? 360  LEU A N   1 
ATOM   5066  C  CA  . LEU E  5  360  ? 43.987  72.938  127.648 1.00 50.95  ? 360  LEU A CA  1 
ATOM   5067  C  C   . LEU E  5  360  ? 43.250  73.939  126.813 1.00 56.93  ? 360  LEU A C   1 
ATOM   5068  O  O   . LEU E  5  360  ? 43.570  74.101  125.638 1.00 50.92  ? 360  LEU A O   1 
ATOM   5069  C  CB  . LEU E  5  360  ? 45.355  73.539  127.943 1.00 51.32  ? 360  LEU A CB  1 
ATOM   5070  C  CG  . LEU E  5  360  ? 46.143  73.126  129.178 1.00 56.35  ? 360  LEU A CG  1 
ATOM   5071  C  CD1 . LEU E  5  360  ? 47.113  74.235  129.521 1.00 50.37  ? 360  LEU A CD1 1 
ATOM   5072  C  CD2 . LEU E  5  360  ? 45.215  72.830  130.343 1.00 60.76  ? 360  LEU A CD2 1 
ATOM   5073  N  N   . VAL E  5  361  ? 42.287  74.632  127.415 1.00 61.59  ? 361  VAL A N   1 
ATOM   5074  C  CA  . VAL E  5  361  ? 41.585  75.680  126.699 1.00 47.56  ? 361  VAL A CA  1 
ATOM   5075  C  C   . VAL E  5  361  ? 42.434  76.940  126.724 1.00 47.53  ? 361  VAL A C   1 
ATOM   5076  O  O   . VAL E  5  361  ? 42.771  77.446  127.783 1.00 60.64  ? 361  VAL A O   1 
ATOM   5077  C  CB  . VAL E  5  361  ? 40.183  75.974  127.299 1.00 55.13  ? 361  VAL A CB  1 
ATOM   5078  C  CG1 . VAL E  5  361  ? 39.542  77.117  126.586 1.00 46.64  ? 361  VAL A CG1 1 
ATOM   5079  C  CG2 . VAL E  5  361  ? 39.292  74.759  127.186 1.00 53.92  ? 361  VAL A CG2 1 
ATOM   5080  N  N   . VAL E  5  362  ? 42.797  77.426  125.548 1.00 48.24  ? 362  VAL A N   1 
ATOM   5081  C  CA  . VAL E  5  362  ? 43.442  78.723  125.407 1.00 51.39  ? 362  VAL A CA  1 
ATOM   5082  C  C   . VAL E  5  362  ? 42.349  79.778  125.374 1.00 54.39  ? 362  VAL A C   1 
ATOM   5083  O  O   . VAL E  5  362  ? 41.534  79.790  124.463 1.00 57.79  ? 362  VAL A O   1 
ATOM   5084  C  CB  . VAL E  5  362  ? 44.177  78.821  124.073 1.00 49.48  ? 362  VAL A CB  1 
ATOM   5085  C  CG1 . VAL E  5  362  ? 44.879  80.140  123.971 1.00 49.69  ? 362  VAL A CG1 1 
ATOM   5086  C  CG2 . VAL E  5  362  ? 45.144  77.662  123.912 1.00 50.22  ? 362  VAL A CG2 1 
ATOM   5087  N  N   . PRO E  5  363  ? 42.330  80.669  126.363 1.00 47.11  ? 363  PRO A N   1 
ATOM   5088  C  CA  . PRO E  5  363  ? 41.306  81.704  126.443 1.00 50.12  ? 363  PRO A CA  1 
ATOM   5089  C  C   . PRO E  5  363  ? 41.510  82.659  125.282 1.00 53.25  ? 363  PRO A C   1 
ATOM   5090  O  O   . PRO E  5  363  ? 42.613  82.682  124.735 1.00 55.68  ? 363  PRO A O   1 
ATOM   5091  C  CB  . PRO E  5  363  ? 41.636  82.415  127.768 1.00 50.39  ? 363  PRO A CB  1 
ATOM   5092  C  CG  . PRO E  5  363  ? 42.560  81.504  128.500 1.00 48.88  ? 363  PRO A CG  1 
ATOM   5093  C  CD  . PRO E  5  363  ? 43.324  80.792  127.438 1.00 58.56  ? 363  PRO A CD  1 
ATOM   5094  N  N   . PRO E  5  364  ? 40.484  83.450  124.921 1.00 59.01  ? 364  PRO A N   1 
ATOM   5095  C  CA  . PRO E  5  364  ? 40.541  84.387  123.789 1.00 48.15  ? 364  PRO A CA  1 
ATOM   5096  C  C   . PRO E  5  364  ? 41.619  85.452  123.938 1.00 48.48  ? 364  PRO A C   1 
ATOM   5097  O  O   . PRO E  5  364  ? 41.983  85.806  125.046 1.00 70.12  ? 364  PRO A O   1 
ATOM   5098  C  CB  . PRO E  5  364  ? 39.160  85.031  123.797 1.00 47.94  ? 364  PRO A CB  1 
ATOM   5099  C  CG  . PRO E  5  364  ? 38.290  84.090  124.534 1.00 47.07  ? 364  PRO A CG  1 
ATOM   5100  C  CD  . PRO E  5  364  ? 39.152  83.412  125.542 1.00 61.86  ? 364  PRO A CD  1 
ATOM   5101  N  N   . THR E  5  365  ? 42.119  85.962  122.820 1.00 58.77  ? 365  THR A N   1 
ATOM   5102  C  CA  . THR E  5  365  ? 43.205  86.930  122.843 1.00 54.51  ? 365  THR A CA  1 
ATOM   5103  C  C   . THR E  5  365  ? 42.917  88.163  123.716 1.00 59.32  ? 365  THR A C   1 
ATOM   5104  O  O   . THR E  5  365  ? 43.831  88.689  124.366 1.00 56.78  ? 365  THR A O   1 
ATOM   5105  C  CB  . THR E  5  365  ? 43.580  87.387  121.425 1.00 57.46  ? 365  THR A CB  1 
ATOM   5106  O  OG1 . THR E  5  365  ? 43.905  86.250  120.613 1.00 57.36  ? 365  THR A OG1 1 
ATOM   5107  C  CG2 . THR E  5  365  ? 44.779  88.329  121.469 1.00 51.98  ? 365  THR A CG2 1 
ATOM   5108  N  N   . ARG E  5  366  ? 41.663  88.623  123.755 1.00 58.71  ? 366  ARG A N   1 
ATOM   5109  C  CA  . ARG E  5  366  ? 41.366  89.829  124.545 1.00 59.72  ? 366  ARG A CA  1 
ATOM   5110  C  C   . ARG E  5  366  ? 41.557  89.672  126.051 1.00 59.55  ? 366  ARG A C   1 
ATOM   5111  O  O   . ARG E  5  366  ? 41.631  90.672  126.774 1.00 64.72  ? 366  ARG A O   1 
ATOM   5112  C  CB  . ARG E  5  366  ? 39.982  90.411  124.244 1.00 59.84  ? 366  ARG A CB  1 
ATOM   5113  C  CG  . ARG E  5  366  ? 38.826  89.474  124.464 1.00 63.13  ? 366  ARG A CG  1 
ATOM   5114  C  CD  . ARG E  5  366  ? 37.542  90.257  124.460 1.00 68.00  ? 366  ARG A CD  1 
ATOM   5115  N  NE  . ARG E  5  366  ? 37.623  91.304  125.462 1.00 85.67  ? 366  ARG A NE  1 
ATOM   5116  C  CZ  . ARG E  5  366  ? 37.378  92.587  125.229 1.00 97.09  ? 366  ARG A CZ  1 
ATOM   5117  N  NH1 . ARG E  5  366  ? 37.015  92.990  124.010 1.00 96.87  ? 366  ARG A NH1 1 
ATOM   5118  N  NH2 . ARG E  5  366  ? 37.497  93.460  126.223 1.00 99.42  ? 366  ARG A NH2 1 
ATOM   5119  N  N   . PHE E  5  367  ? 41.650  88.431  126.520 1.00 52.11  ? 367  PHE A N   1 
ATOM   5120  C  CA  . PHE E  5  367  ? 41.962  88.195  127.925 1.00 50.21  ? 367  PHE A CA  1 
ATOM   5121  C  C   . PHE E  5  367  ? 43.444  87.944  128.177 1.00 57.55  ? 367  PHE A C   1 
ATOM   5122  O  O   . PHE E  5  367  ? 43.840  87.689  129.314 1.00 65.26  ? 367  PHE A O   1 
ATOM   5123  C  CB  . PHE E  5  367  ? 41.113  87.072  128.500 1.00 45.79  ? 367  PHE A CB  1 
ATOM   5124  C  CG  . PHE E  5  367  ? 39.644  87.342  128.446 1.00 45.42  ? 367  PHE A CG  1 
ATOM   5125  C  CD1 . PHE E  5  367  ? 39.103  88.428  129.110 1.00 60.34  ? 367  PHE A CD1 1 
ATOM   5126  C  CD2 . PHE E  5  367  ? 38.800  86.520  127.730 1.00 62.42  ? 367  PHE A CD2 1 
ATOM   5127  C  CE1 . PHE E  5  367  ? 37.739  88.697  129.057 1.00 62.16  ? 367  PHE A CE1 1 
ATOM   5128  C  CE2 . PHE E  5  367  ? 37.434  86.775  127.679 1.00 62.80  ? 367  PHE A CE2 1 
ATOM   5129  C  CZ  . PHE E  5  367  ? 36.904  87.870  128.344 1.00 61.43  ? 367  PHE A CZ  1 
ATOM   5130  N  N   . ARG E  5  368  ? 44.258  88.044  127.125 1.00 53.74  ? 368  ARG A N   1 
ATOM   5131  C  CA  . ARG E  5  368  ? 45.697  87.784  127.228 1.00 53.93  ? 368  ARG A CA  1 
ATOM   5132  C  C   . ARG E  5  368  ? 46.526  88.833  126.506 1.00 53.82  ? 368  ARG A C   1 
ATOM   5133  O  O   . ARG E  5  368  ? 47.531  88.504  125.870 1.00 54.14  ? 368  ARG A O   1 
ATOM   5134  C  CB  . ARG E  5  368  ? 46.056  86.408  126.650 1.00 54.52  ? 368  ARG A CB  1 
ATOM   5135  C  CG  . ARG E  5  368  ? 45.463  85.249  127.400 1.00 57.31  ? 368  ARG A CG  1 
ATOM   5136  C  CD  . ARG E  5  368  ? 45.780  83.927  126.719 1.00 63.19  ? 368  ARG A CD  1 
ATOM   5137  N  NE  . ARG E  5  368  ? 45.026  83.744  125.489 1.00 56.28  ? 368  ARG A NE  1 
ATOM   5138  C  CZ  . ARG E  5  368  ? 45.540  83.901  124.282 1.00 54.14  ? 368  ARG A CZ  1 
ATOM   5139  N  NH1 . ARG E  5  368  ? 46.817  84.242  124.150 1.00 50.45  ? 368  ARG A NH1 1 
ATOM   5140  N  NH2 . ARG E  5  368  ? 44.773  83.719  123.216 1.00 52.01  ? 368  ARG A NH2 1 
ATOM   5141  N  N   . LEU E  5  369  ? 46.117  90.090  126.606 1.00 56.82  ? 369  LEU A N   1 
ATOM   5142  C  CA  . LEU E  5  369  ? 46.797  91.164  125.884 1.00 58.85  ? 369  LEU A CA  1 
ATOM   5143  C  C   . LEU E  5  369  ? 48.077  91.588  126.572 1.00 51.24  ? 369  LEU A C   1 
ATOM   5144  O  O   . LEU E  5  369  ? 48.243  91.393  127.766 1.00 56.23  ? 369  LEU A O   1 
ATOM   5145  C  CB  . LEU E  5  369  ? 45.856  92.360  125.703 1.00 55.20  ? 369  LEU A CB  1 
ATOM   5146  C  CG  . LEU E  5  369  ? 44.623  92.050  124.842 1.00 59.17  ? 369  LEU A CG  1 
ATOM   5147  C  CD1 . LEU E  5  369  ? 43.608  93.125  125.003 1.00 50.53  ? 369  LEU A CD1 1 
ATOM   5148  C  CD2 . LEU E  5  369  ? 45.002  91.910  123.394 1.00 51.74  ? 369  LEU A CD2 1 
ATOM   5149  N  N   . PRO E  5  370  ? 49.004  92.164  125.816 1.00 73.77  ? 370  PRO A N   1 
ATOM   5150  C  CA  . PRO E  5  370  ? 50.205  92.675  126.472 1.00 53.05  ? 370  PRO A CA  1 
ATOM   5151  C  C   . PRO E  5  370  ? 49.847  93.896  127.332 1.00 61.97  ? 370  PRO A C   1 
ATOM   5152  O  O   . PRO E  5  370  ? 48.708  94.369  127.293 1.00 52.37  ? 370  PRO A O   1 
ATOM   5153  C  CB  . PRO E  5  370  ? 51.092  93.106  125.292 1.00 54.50  ? 370  PRO A CB  1 
ATOM   5154  C  CG  . PRO E  5  370  ? 50.420  92.642  124.061 1.00 54.61  ? 370  PRO A CG  1 
ATOM   5155  C  CD  . PRO E  5  370  ? 48.990  92.435  124.374 1.00 53.41  ? 370  PRO A CD  1 
ATOM   5156  N  N   . SER E  5  371  ? 50.807  94.417  128.087 1.00 61.56  ? 371  SER A N   1 
ATOM   5157  C  CA  . SER E  5  371  ? 50.569  95.609  128.897 1.00 68.84  ? 371  SER A CA  1 
ATOM   5158  C  C   . SER E  5  371  ? 51.542  96.689  128.476 1.00 79.08  ? 371  SER A C   1 
ATOM   5159  O  O   . SER E  5  371  ? 52.643  96.373  128.027 1.00 81.87  ? 371  SER A O   1 
ATOM   5160  C  CB  . SER E  5  371  ? 50.787  95.302  130.377 1.00 68.69  ? 371  SER A CB  1 
ATOM   5161  O  OG  . SER E  5  371  ? 50.154  94.091  130.754 1.00 76.30  ? 371  SER A OG  1 
ATOM   5162  N  N   . LYS E  5  372  ? 51.162  97.959  128.597 1.00 87.44  ? 372  LYS A N   1 
ATOM   5163  C  CA  . LYS E  5  372  ? 52.198  98.986  128.502 1.00 97.67  ? 372  LYS A CA  1 
ATOM   5164  C  C   . LYS E  5  372  ? 52.449  99.712  129.827 1.00 99.63  ? 372  LYS A C   1 
ATOM   5165  O  O   . LYS E  5  372  ? 51.551  100.338 130.406 1.00 96.59  ? 372  LYS A O   1 
ATOM   5166  C  CB  . LYS E  5  372  ? 52.075  99.924  127.271 1.00 112.60 ? 372  LYS A CB  1 
ATOM   5167  C  CG  . LYS E  5  372  ? 50.873  100.864 127.176 1.00 113.03 ? 372  LYS A CG  1 
ATOM   5168  C  CD  . LYS E  5  372  ? 51.023  101.759 125.926 1.00 112.69 ? 372  LYS A CD  1 
ATOM   5169  C  CE  . LYS E  5  372  ? 49.748  102.526 125.565 1.00 109.85 ? 372  LYS A CE  1 
ATOM   5170  N  NZ  . LYS E  5  372  ? 49.754  103.032 124.148 1.00 110.02 ? 372  LYS A NZ  1 
ATOM   5171  N  N   . LEU E  5  373  ? 53.680  99.551  130.312 1.00 102.04 ? 373  LEU A N   1 
ATOM   5172  C  CA  . LEU E  5  373  ? 54.171  100.233 131.496 1.00 108.03 ? 373  LEU A CA  1 
ATOM   5173  C  C   . LEU E  5  373  ? 54.769  101.544 131.019 1.00 110.76 ? 373  LEU A C   1 
ATOM   5174  O  O   . LEU E  5  373  ? 55.976  101.641 130.739 1.00 106.88 ? 373  LEU A O   1 
ATOM   5175  C  CB  . LEU E  5  373  ? 55.229  99.383  132.217 1.00 112.41 ? 373  LEU A CB  1 
ATOM   5176  C  CG  . LEU E  5  373  ? 55.558  99.682  133.691 1.00 109.60 ? 373  LEU A CG  1 
ATOM   5177  C  CD1 . LEU E  5  373  ? 55.413  98.424  134.554 1.00 102.56 ? 373  LEU A CD1 1 
ATOM   5178  C  CD2 . LEU E  5  373  ? 56.953  100.292 133.843 1.00 107.85 ? 373  LEU A CD2 1 
ATOM   5179  N  N   . GLY E  5  374  ? 53.902  102.546 130.907 1.00 113.86 ? 374  GLY A N   1 
ATOM   5180  C  CA  . GLY E  5  374  ? 54.282  103.830 130.358 1.00 115.97 ? 374  GLY A CA  1 
ATOM   5181  C  C   . GLY E  5  374  ? 54.512  103.735 128.866 1.00 119.90 ? 374  GLY A C   1 
ATOM   5182  O  O   . GLY E  5  374  ? 53.561  103.763 128.075 1.00 119.74 ? 374  GLY A O   1 
ATOM   5183  N  N   . GLU E  5  375  ? 55.778  103.614 128.477 1.00 123.64 ? 375  GLU A N   1 
ATOM   5184  C  CA  . GLU E  5  375  ? 56.123  103.537 127.065 1.00 129.59 ? 375  GLU A CA  1 
ATOM   5185  C  C   . GLU E  5  375  ? 56.573  102.133 126.658 1.00 130.60 ? 375  GLU A C   1 
ATOM   5186  O  O   . GLU E  5  375  ? 56.347  101.712 125.520 1.00 132.26 ? 375  GLU A O   1 
ATOM   5187  C  CB  . GLU E  5  375  ? 57.183  104.581 126.703 1.00 136.84 ? 375  GLU A CB  1 
ATOM   5188  C  CG  . GLU E  5  375  ? 58.552  104.365 127.344 1.00 144.85 ? 375  GLU A CG  1 
ATOM   5189  C  CD  . GLU E  5  375  ? 59.603  105.343 126.819 1.00 152.72 ? 375  GLU A CD  1 
ATOM   5190  O  OE1 . GLU E  5  375  ? 59.229  106.478 126.440 1.00 153.73 ? 375  GLU A OE1 1 
ATOM   5191  O  OE2 . GLU E  5  375  ? 60.802  104.978 126.782 1.00 154.94 ? 375  GLU A OE2 1 
ATOM   5192  N  N   . GLU E  5  376  ? 57.191  101.407 127.587 1.00 125.95 ? 376  GLU A N   1 
ATOM   5193  C  CA  . GLU E  5  376  ? 57.660  100.053 127.302 1.00 120.08 ? 376  GLU A CA  1 
ATOM   5194  C  C   . GLU E  5  376  ? 56.519  99.029  127.345 1.00 112.88 ? 376  GLU A C   1 
ATOM   5195  O  O   . GLU E  5  376  ? 55.620  99.131  128.182 1.00 115.18 ? 376  GLU A O   1 
ATOM   5196  C  CB  . GLU E  5  376  ? 58.763  99.660  128.277 1.00 123.62 ? 376  GLU A CB  1 
ATOM   5197  C  CG  . GLU E  5  376  ? 59.647  98.543  127.765 1.00 131.52 ? 376  GLU A CG  1 
ATOM   5198  C  CD  . GLU E  5  376  ? 60.870  98.335  128.633 1.00 139.47 ? 376  GLU A CD  1 
ATOM   5199  O  OE1 . GLU E  5  376  ? 60.793  98.654  129.841 1.00 142.86 ? 376  GLU A OE1 1 
ATOM   5200  O  OE2 . GLU E  5  376  ? 61.905  97.864  128.104 1.00 139.00 ? 376  GLU A OE2 1 
ATOM   5201  N  N   . VAL E  5  377  ? 56.562  98.049  126.440 1.00 101.49 ? 377  VAL A N   1 
ATOM   5202  C  CA  . VAL E  5  377  ? 55.507  97.036  126.321 1.00 84.72  ? 377  VAL A CA  1 
ATOM   5203  C  C   . VAL E  5  377  ? 55.955  95.689  126.875 1.00 73.05  ? 377  VAL A C   1 
ATOM   5204  O  O   . VAL E  5  377  ? 57.021  95.213  126.531 1.00 76.21  ? 377  VAL A O   1 
ATOM   5205  C  CB  . VAL E  5  377  ? 55.078  96.848  124.858 1.00 81.96  ? 377  VAL A CB  1 
ATOM   5206  C  CG1 . VAL E  5  377  ? 54.009  95.783  124.754 1.00 79.02  ? 377  VAL A CG1 1 
ATOM   5207  C  CG2 . VAL E  5  377  ? 54.574  98.158  124.291 1.00 84.02  ? 377  VAL A CG2 1 
ATOM   5208  N  N   . HIS E  5  378  ? 55.140  95.084  127.735 1.00 68.04  ? 378  HIS A N   1 
ATOM   5209  C  CA  . HIS E  5  378  ? 55.499  93.837  128.414 1.00 71.02  ? 378  HIS A CA  1 
ATOM   5210  C  C   . HIS E  5  378  ? 54.592  92.699  127.993 1.00 66.63  ? 378  HIS A C   1 
ATOM   5211  O  O   . HIS E  5  378  ? 53.384  92.895  127.875 1.00 58.12  ? 378  HIS A O   1 
ATOM   5212  C  CB  . HIS E  5  378  ? 55.381  93.995  129.932 1.00 86.12  ? 378  HIS A CB  1 
ATOM   5213  C  CG  . HIS E  5  378  ? 56.385  94.933  130.521 1.00 104.67 ? 378  HIS A CG  1 
ATOM   5214  N  ND1 . HIS E  5  378  ? 57.547  95.283  129.867 1.00 114.49 ? 378  HIS A ND1 1 
ATOM   5215  C  CD2 . HIS E  5  378  ? 56.395  95.605  131.697 1.00 108.72 ? 378  HIS A CD2 1 
ATOM   5216  C  CE1 . HIS E  5  378  ? 58.233  96.128  130.617 1.00 119.30 ? 378  HIS A CE1 1 
ATOM   5217  N  NE2 . HIS E  5  378  ? 57.555  96.340  131.732 1.00 116.25 ? 378  HIS A NE2 1 
ATOM   5218  N  N   . GLU E  5  379  ? 55.157  91.505  127.800 1.00 69.48  ? 379  GLU A N   1 
ATOM   5219  C  CA  . GLU E  5  379  ? 54.336  90.354  127.426 1.00 67.06  ? 379  GLU A CA  1 
ATOM   5220  C  C   . GLU E  5  379  ? 53.328  89.984  128.500 1.00 62.99  ? 379  GLU A C   1 
ATOM   5221  O  O   . GLU E  5  379  ? 53.519  90.269  129.675 1.00 70.05  ? 379  GLU A O   1 
ATOM   5222  C  CB  . GLU E  5  379  ? 55.164  89.123  127.026 1.00 71.53  ? 379  GLU A CB  1 
ATOM   5223  C  CG  . GLU E  5  379  ? 56.619  89.100  127.471 1.00 86.27  ? 379  GLU A CG  1 
ATOM   5224  C  CD  . GLU E  5  379  ? 57.310  87.804  127.064 1.00 94.39  ? 379  GLU A CD  1 
ATOM   5225  O  OE1 . GLU E  5  379  ? 56.648  86.970  126.397 1.00 102.79 ? 379  GLU A OE1 1 
ATOM   5226  O  OE2 . GLU E  5  379  ? 58.501  87.619  127.408 1.00 92.53  ? 379  GLU A OE2 1 
ATOM   5227  N  N   . ASN E  5  380  ? 52.246  89.353  128.069 1.00 61.98  ? 380  ASN A N   1 
ATOM   5228  C  CA  . ASN E  5  380  ? 51.231  88.846  128.972 1.00 57.53  ? 380  ASN A CA  1 
ATOM   5229  C  C   . ASN E  5  380  ? 51.731  87.612  129.728 1.00 61.05  ? 380  ASN A C   1 
ATOM   5230  O  O   . ASN E  5  380  ? 52.216  86.661  129.118 1.00 66.36  ? 380  ASN A O   1 
ATOM   5231  C  CB  . ASN E  5  380  ? 49.988  88.501  128.163 1.00 56.89  ? 380  ASN A CB  1 
ATOM   5232  C  CG  . ASN E  5  380  ? 48.882  87.984  129.016 1.00 64.36  ? 380  ASN A CG  1 
ATOM   5233  O  OD1 . ASN E  5  380  ? 48.913  86.832  129.427 1.00 71.43  ? 380  ASN A OD1 1 
ATOM   5234  N  ND2 . ASN E  5  380  ? 47.898  88.833  129.312 1.00 63.66  ? 380  ASN A ND2 1 
ATOM   5235  N  N   . SER E  5  381  ? 51.608  87.607  131.050 1.00 64.15  ? 381  SER A N   1 
ATOM   5236  C  CA  . SER E  5  381  ? 52.201  86.532  131.838 1.00 67.40  ? 381  SER A CA  1 
ATOM   5237  C  C   . SER E  5  381  ? 51.519  85.161  131.607 1.00 64.10  ? 381  SER A C   1 
ATOM   5238  O  O   . SER E  5  381  ? 52.166  84.105  131.624 1.00 59.67  ? 381  SER A O   1 
ATOM   5239  C  CB  . SER E  5  381  ? 52.152  86.903  133.297 1.00 66.86  ? 381  SER A CB  1 
ATOM   5240  O  OG  . SER E  5  381  ? 50.831  86.756  133.762 1.00 77.07  ? 381  SER A OG  1 
ATOM   5241  N  N   . GLN E  5  382  ? 50.216  85.165  131.369 1.00 58.00  ? 382  GLN A N   1 
ATOM   5242  C  CA  . GLN E  5  382  ? 49.556  83.917  131.052 1.00 48.63  ? 382  GLN A CA  1 
ATOM   5243  C  C   . GLN E  5  382  ? 50.077  83.338  129.719 1.00 59.41  ? 382  GLN A C   1 
ATOM   5244  O  O   . GLN E  5  382  ? 50.060  82.129  129.510 1.00 59.42  ? 382  GLN A O   1 
ATOM   5245  C  CB  . GLN E  5  382  ? 48.045  84.106  131.030 1.00 47.67  ? 382  GLN A CB  1 
ATOM   5246  C  CG  . GLN E  5  382  ? 47.268  82.821  130.950 1.00 59.69  ? 382  GLN A CG  1 
ATOM   5247  C  CD  . GLN E  5  382  ? 45.778  83.009  131.182 1.00 56.90  ? 382  GLN A CD  1 
ATOM   5248  O  OE1 . GLN E  5  382  ? 45.046  83.387  130.276 1.00 59.61  ? 382  GLN A OE1 1 
ATOM   5249  N  NE2 . GLN E  5  382  ? 45.323  82.729  132.396 1.00 52.05  ? 382  GLN A NE2 1 
ATOM   5250  N  N   . ASN E  5  383  ? 50.549  84.189  128.813 1.00 57.55  ? 383  ASN A N   1 
ATOM   5251  C  CA  . ASN E  5  383  ? 51.096  83.680  127.564 1.00 58.73  ? 383  ASN A CA  1 
ATOM   5252  C  C   . ASN E  5  383  ? 52.437  83.048  127.806 1.00 57.60  ? 383  ASN A C   1 
ATOM   5253  O  O   . ASN E  5  383  ? 52.771  82.054  127.189 1.00 64.94  ? 383  ASN A O   1 
ATOM   5254  C  CB  . ASN E  5  383  ? 51.257  84.770  126.524 1.00 51.85  ? 383  ASN A CB  1 
ATOM   5255  C  CG  . ASN E  5  383  ? 49.973  85.088  125.808 1.00 56.38  ? 383  ASN A CG  1 
ATOM   5256  O  OD1 . ASN E  5  383  ? 48.976  84.358  125.897 1.00 53.39  ? 383  ASN A OD1 1 
ATOM   5257  N  ND2 . ASN E  5  383  ? 49.981  86.197  125.092 1.00 56.62  ? 383  ASN A ND2 1 
ATOM   5258  N  N   . GLN E  5  384  ? 53.211  83.639  128.703 1.00 52.23  ? 384  GLN A N   1 
ATOM   5259  C  CA  . GLN E  5  384  ? 54.516  83.104  129.053 1.00 53.15  ? 384  GLN A CA  1 
ATOM   5260  C  C   . GLN E  5  384  ? 54.393  81.690  129.595 1.00 57.00  ? 384  GLN A C   1 
ATOM   5261  O  O   . GLN E  5  384  ? 55.196  80.814  129.274 1.00 61.98  ? 384  GLN A O   1 
ATOM   5262  C  CB  . GLN E  5  384  ? 55.185  83.988  130.089 1.00 53.37  ? 384  GLN A CB  1 
ATOM   5263  C  CG  . GLN E  5  384  ? 55.671  85.277  129.536 1.00 61.11  ? 384  GLN A CG  1 
ATOM   5264  C  CD  . GLN E  5  384  ? 56.421  86.057  130.562 1.00 60.90  ? 384  GLN A CD  1 
ATOM   5265  O  OE1 . GLN E  5  384  ? 55.845  86.501  131.546 1.00 59.72  ? 384  GLN A OE1 1 
ATOM   5266  N  NE2 . GLN E  5  384  ? 57.719  86.207  130.363 1.00 70.55  ? 384  GLN A NE2 1 
ATOM   5267  N  N   . LEU E  5  385  ? 53.380  81.475  130.419 1.00 53.14  ? 385  LEU A N   1 
ATOM   5268  C  CA  . LEU E  5  385  ? 53.109  80.145  130.935 1.00 56.94  ? 385  LEU A CA  1 
ATOM   5269  C  C   . LEU E  5  385  ? 52.618  79.177  129.861 1.00 58.85  ? 385  LEU A C   1 
ATOM   5270  O  O   . LEU E  5  385  ? 53.053  78.042  129.845 1.00 60.30  ? 385  LEU A O   1 
ATOM   5271  C  CB  . LEU E  5  385  ? 52.101  80.219  132.077 1.00 54.88  ? 385  LEU A CB  1 
ATOM   5272  C  CG  . LEU E  5  385  ? 52.735  80.777  133.343 1.00 57.81  ? 385  LEU A CG  1 
ATOM   5273  C  CD1 . LEU E  5  385  ? 51.716  80.999  134.440 1.00 50.42  ? 385  LEU A CD1 1 
ATOM   5274  C  CD2 . LEU E  5  385  ? 53.783  79.806  133.774 1.00 51.28  ? 385  LEU A CD2 1 
ATOM   5275  N  N   . LEU E  5  386  ? 51.717  79.621  128.979 1.00 56.57  ? 386  LEU A N   1 
ATOM   5276  C  CA  . LEU E  5  386  ? 51.174  78.759  127.928 1.00 51.33  ? 386  LEU A CA  1 
ATOM   5277  C  C   . LEU E  5  386  ? 52.221  78.346  126.907 1.00 62.42  ? 386  LEU A C   1 
ATOM   5278  O  O   . LEU E  5  386  ? 52.161  77.245  126.360 1.00 67.78  ? 386  LEU A O   1 
ATOM   5279  C  CB  . LEU E  5  386  ? 49.991  79.402  127.216 1.00 50.75  ? 386  LEU A CB  1 
ATOM   5280  C  CG  . LEU E  5  386  ? 48.688  79.410  128.011 1.00 49.53  ? 386  LEU A CG  1 
ATOM   5281  C  CD1 . LEU E  5  386  ? 47.590  80.100  127.242 1.00 49.17  ? 386  LEU A CD1 1 
ATOM   5282  C  CD2 . LEU E  5  386  ? 48.276  78.010  128.373 1.00 49.33  ? 386  LEU A CD2 1 
ATOM   5283  N  N   . SER E  5  387  ? 53.192  79.209  126.650 1.00 54.97  ? 387  SER A N   1 
ATOM   5284  C  CA  . SER E  5  387  ? 54.195  78.861  125.658 1.00 62.56  ? 387  SER A CA  1 
ATOM   5285  C  C   . SER E  5  387  ? 55.145  77.793  126.205 1.00 56.54  ? 387  SER A C   1 
ATOM   5286  O  O   . SER E  5  387  ? 55.735  77.017  125.452 1.00 59.39  ? 387  SER A O   1 
ATOM   5287  C  CB  . SER E  5  387  ? 54.950  80.096  125.162 1.00 55.50  ? 387  SER A CB  1 
ATOM   5288  O  OG  . SER E  5  387  ? 55.818  80.538  126.171 1.00 103.62 ? 387  SER A OG  1 
ATOM   5289  N  N   . LYS E  5  388  ? 55.279  77.746  127.520 1.00 57.69  ? 388  LYS A N   1 
ATOM   5290  C  CA  . LYS E  5  388  ? 56.080  76.705  128.149 1.00 59.79  ? 388  LYS A CA  1 
ATOM   5291  C  C   . LYS E  5  388  ? 55.381  75.354  128.007 1.00 59.98  ? 388  LYS A C   1 
ATOM   5292  O  O   . LYS E  5  388  ? 56.040  74.327  127.807 1.00 62.39  ? 388  LYS A O   1 
ATOM   5293  C  CB  . LYS E  5  388  ? 56.373  77.045  129.610 1.00 55.25  ? 388  LYS A CB  1 
ATOM   5294  C  CG  . LYS E  5  388  ? 57.424  78.128  129.786 1.00 59.69  ? 388  LYS A CG  1 
ATOM   5295  C  CD  . LYS E  5  388  ? 57.580  78.532  131.221 1.00 55.58  ? 388  LYS A CD  1 
ATOM   5296  C  CE  . LYS E  5  388  ? 59.017  78.918  131.518 1.00 80.94  ? 388  LYS A CE  1 
ATOM   5297  N  NZ  . LYS E  5  388  ? 59.510  79.951  130.575 1.00 78.27  ? 388  LYS A NZ  1 
ATOM   5298  N  N   . VAL E  5  389  ? 54.050  75.364  128.085 1.00 56.67  ? 389  VAL A N   1 
ATOM   5299  C  CA  . VAL E  5  389  ? 53.259  74.176  127.782 1.00 62.47  ? 389  VAL A CA  1 
ATOM   5300  C  C   . VAL E  5  389  ? 53.483  73.773  126.325 1.00 68.60  ? 389  VAL A C   1 
ATOM   5301  O  O   . VAL E  5  389  ? 53.593  72.589  126.005 1.00 71.72  ? 389  VAL A O   1 
ATOM   5302  C  CB  . VAL E  5  389  ? 51.751  74.411  127.987 1.00 57.85  ? 389  VAL A CB  1 
ATOM   5303  C  CG1 . VAL E  5  389  ? 50.965  73.271  127.395 1.00 56.06  ? 389  VAL A CG1 1 
ATOM   5304  C  CG2 . VAL E  5  389  ? 51.418  74.565  129.453 1.00 51.88  ? 389  VAL A CG2 1 
ATOM   5305  N  N   . LEU E  5  390  ? 53.572  74.768  125.446 1.00 63.14  ? 390  LEU A N   1 
ATOM   5306  C  CA  . LEU E  5  390  ? 53.722  74.507  124.022 1.00 58.68  ? 390  LEU A CA  1 
ATOM   5307  C  C   . LEU E  5  390  ? 55.049  73.861  123.650 1.00 64.35  ? 390  LEU A C   1 
ATOM   5308  O  O   . LEU E  5  390  ? 55.072  72.927  122.852 1.00 66.41  ? 390  LEU A O   1 
ATOM   5309  C  CB  . LEU E  5  390  ? 53.529  75.785  123.225 1.00 56.30  ? 390  LEU A CB  1 
ATOM   5310  C  CG  . LEU E  5  390  ? 52.081  76.222  123.241 1.00 57.16  ? 390  LEU A CG  1 
ATOM   5311  C  CD1 . LEU E  5  390  ? 51.968  77.619  122.659 1.00 56.19  ? 390  LEU A CD1 1 
ATOM   5312  C  CD2 . LEU E  5  390  ? 51.224  75.222  122.486 1.00 55.26  ? 390  LEU A CD2 1 
ATOM   5313  N  N   . THR E  5  391  ? 56.146  74.364  124.214 1.00 58.30  ? 391  THR A N   1 
ATOM   5314  C  CA  . THR E  5  391  ? 57.465  73.797  123.945 1.00 69.09  ? 391  THR A CA  1 
ATOM   5315  C  C   . THR E  5  391  ? 57.567  72.352  124.430 1.00 68.13  ? 391  THR A C   1 
ATOM   5316  O  O   . THR E  5  391  ? 58.080  71.470  123.730 1.00 61.48  ? 391  THR A O   1 
ATOM   5317  C  CB  . THR E  5  391  ? 58.585  74.567  124.658 1.00 60.26  ? 391  THR A CB  1 
ATOM   5318  O  OG1 . THR E  5  391  ? 58.287  74.629  126.055 1.00 59.36  ? 391  THR A OG1 1 
ATOM   5319  C  CG2 . THR E  5  391  ? 58.760  75.963  124.096 1.00 60.34  ? 391  THR A CG2 1 
ATOM   5320  N  N   . THR E  5  392  ? 57.110  72.125  125.654 1.00 60.25  ? 392  THR A N   1 
ATOM   5321  C  CA  . THR E  5  392  ? 57.196  70.808  126.244 1.00 59.62  ? 392  THR A CA  1 
ATOM   5322  C  C   . THR E  5  392  ? 56.390  69.882  125.382 1.00 59.76  ? 392  THR A C   1 
ATOM   5323  O  O   . THR E  5  392  ? 56.743  68.728  125.176 1.00 72.06  ? 392  THR A O   1 
ATOM   5324  C  CB  . THR E  5  392  ? 56.633  70.825  127.653 1.00 67.40  ? 392  THR A CB  1 
ATOM   5325  O  OG1 . THR E  5  392  ? 57.474  71.647  128.458 1.00 66.69  ? 392  THR A OG1 1 
ATOM   5326  C  CG2 . THR E  5  392  ? 56.592  69.428  128.243 1.00 58.87  ? 392  THR A CG2 1 
ATOM   5327  N  N   . SER E  5  393  ? 55.309  70.422  124.846 1.00 63.46  ? 393  SER A N   1 
ATOM   5328  C  CA  . SER E  5  393  ? 54.407  69.653  124.019 1.00 66.24  ? 393  SER A CA  1 
ATOM   5329  C  C   . SER E  5  393  ? 55.087  69.183  122.735 1.00 60.53  ? 393  SER A C   1 
ATOM   5330  O  O   . SER E  5  393  ? 55.045  68.006  122.403 1.00 63.63  ? 393  SER A O   1 
ATOM   5331  C  CB  . SER E  5  393  ? 53.173  70.478  123.710 1.00 68.67  ? 393  SER A CB  1 
ATOM   5332  O  OG  . SER E  5  393  ? 52.030  69.674  123.828 1.00 75.08  ? 393  SER A OG  1 
ATOM   5333  N  N   . LEU E  5  394  ? 55.728  70.099  122.025 1.00 61.06  ? 394  LEU A N   1 
ATOM   5334  C  CA  . LEU E  5  394  ? 56.468  69.740  120.828 1.00 62.69  ? 394  LEU A CA  1 
ATOM   5335  C  C   . LEU E  5  394  ? 57.546  68.741  121.167 1.00 70.08  ? 394  LEU A C   1 
ATOM   5336  O  O   . LEU E  5  394  ? 57.770  67.792  120.422 1.00 79.67  ? 394  LEU A O   1 
ATOM   5337  C  CB  . LEU E  5  394  ? 57.124  70.963  120.206 1.00 63.13  ? 394  LEU A CB  1 
ATOM   5338  C  CG  . LEU E  5  394  ? 56.110  71.952  119.651 1.00 66.70  ? 394  LEU A CG  1 
ATOM   5339  C  CD1 . LEU E  5  394  ? 56.774  73.129  118.945 1.00 62.87  ? 394  LEU A CD1 1 
ATOM   5340  C  CD2 . LEU E  5  394  ? 55.172  71.194  118.738 1.00 64.90  ? 394  LEU A CD2 1 
ATOM   5341  N  N   . LEU E  5  395  ? 58.221  68.958  122.289 1.00 65.18  ? 395  LEU A N   1 
ATOM   5342  C  CA  . LEU E  5  395  ? 59.335  68.111  122.677 1.00 65.04  ? 395  LEU A CA  1 
ATOM   5343  C  C   . LEU E  5  395  ? 58.895  66.689  122.967 1.00 75.01  ? 395  LEU A C   1 
ATOM   5344  O  O   . LEU E  5  395  ? 59.614  65.747  122.647 1.00 66.82  ? 395  LEU A O   1 
ATOM   5345  C  CB  . LEU E  5  395  ? 60.072  68.695  123.875 1.00 64.76  ? 395  LEU A CB  1 
ATOM   5346  C  CG  . LEU E  5  395  ? 60.996  69.841  123.501 1.00 65.33  ? 395  LEU A CG  1 
ATOM   5347  C  CD1 . LEU E  5  395  ? 61.710  70.290  124.716 1.00 73.01  ? 395  LEU A CD1 1 
ATOM   5348  C  CD2 . LEU E  5  395  ? 61.985  69.398  122.461 1.00 67.24  ? 395  LEU A CD2 1 
ATOM   5349  N  N   . ILE E  5  396  ? 57.716  66.533  123.562 1.00 70.81  ? 396  ILE A N   1 
ATOM   5350  C  CA  . ILE E  5  396  ? 57.189  65.202  123.851 1.00 72.93  ? 396  ILE A CA  1 
ATOM   5351  C  C   . ILE E  5  396  ? 56.714  64.519  122.565 1.00 81.38  ? 396  ILE A C   1 
ATOM   5352  O  O   . ILE E  5  396  ? 56.827  63.295  122.411 1.00 79.92  ? 396  ILE A O   1 
ATOM   5353  C  CB  . ILE E  5  396  ? 56.051  65.253  124.877 1.00 70.23  ? 396  ILE A CB  1 
ATOM   5354  C  CG1 . ILE E  5  396  ? 56.601  65.518  126.265 1.00 62.12  ? 396  ILE A CG1 1 
ATOM   5355  C  CG2 . ILE E  5  396  ? 55.318  63.942  124.929 1.00 67.23  ? 396  ILE A CG2 1 
ATOM   5356  C  CD1 . ILE E  5  396  ? 55.523  65.602  127.306 1.00 64.87  ? 396  ILE A CD1 1 
ATOM   5357  N  N   . ARG E  5  397  ? 56.214  65.318  121.625 1.00 87.46  ? 397  ARG A N   1 
ATOM   5358  C  CA  . ARG E  5  397  ? 55.756  64.776  120.349 1.00 90.06  ? 397  ARG A CA  1 
ATOM   5359  C  C   . ARG E  5  397  ? 56.942  64.222  119.564 1.00 90.75  ? 397  ARG A C   1 
ATOM   5360  O  O   . ARG E  5  397  ? 56.758  63.434  118.646 1.00 98.26  ? 397  ARG A O   1 
ATOM   5361  C  CB  . ARG E  5  397  ? 54.939  65.809  119.537 1.00 94.01  ? 397  ARG A CB  1 
ATOM   5362  C  CG  . ARG E  5  397  ? 53.803  65.166  118.705 1.00 97.49  ? 397  ARG A CG  1 
ATOM   5363  C  CD  . ARG E  5  397  ? 52.660  66.083  118.226 1.00 97.15  ? 397  ARG A CD  1 
ATOM   5364  N  NE  . ARG E  5  397  ? 52.136  66.889  119.294 1.00 110.63 ? 397  ARG A NE  1 
ATOM   5365  C  CZ  . ARG E  5  397  ? 50.953  66.927  119.921 1.00 116.63 ? 397  ARG A CZ  1 
ATOM   5366  N  NH1 . ARG E  5  397  ? 49.888  66.170  119.667 1.00 119.48 ? 397  ARG A NH1 1 
ATOM   5367  N  NH2 . ARG E  5  397  ? 50.871  67.836  120.878 1.00 109.79 ? 397  ARG A NH2 1 
ATOM   5368  N  N   . ASP E  5  398  ? 58.154  64.619  119.953 1.00 89.16  ? 398  ASP A N   1 
ATOM   5369  C  CA  . ASP E  5  398  ? 59.387  64.132  119.329 1.00 95.26  ? 398  ASP A CA  1 
ATOM   5370  C  C   . ASP E  5  398  ? 59.913  62.889  120.014 1.00 92.59  ? 398  ASP A C   1 
ATOM   5371  O  O   . ASP E  5  398  ? 60.441  61.982  119.371 1.00 91.98  ? 398  ASP A O   1 
ATOM   5372  C  CB  . ASP E  5  398  ? 60.469  65.204  119.368 1.00 104.56 ? 398  ASP A CB  1 
ATOM   5373  C  CG  . ASP E  5  398  ? 60.404  66.124  118.184 1.00 119.45 ? 398  ASP A CG  1 
ATOM   5374  O  OD1 . ASP E  5  398  ? 60.272  65.602  117.053 1.00 126.81 ? 398  ASP A OD1 1 
ATOM   5375  O  OD2 . ASP E  5  398  ? 60.468  67.359  118.381 1.00 122.73 ? 398  ASP A OD2 1 
ATOM   5376  N  N   . LEU E  5  399  ? 59.793  62.874  121.333 1.00 87.30  ? 399  LEU A N   1 
ATOM   5377  C  CA  . LEU E  5  399  ? 60.149  61.710  122.109 1.00 81.99  ? 399  LEU A CA  1 
ATOM   5378  C  C   . LEU E  5  399  ? 59.268  60.573  121.627 1.00 86.58  ? 399  LEU A C   1 
ATOM   5379  O  O   . LEU E  5  399  ? 59.723  59.449  121.449 1.00 85.36  ? 399  LEU A O   1 
ATOM   5380  C  CB  . LEU E  5  399  ? 59.890  61.975  123.587 1.00 73.04  ? 399  LEU A CB  1 
ATOM   5381  C  CG  . LEU E  5  399  ? 60.029  60.751  124.478 1.00 74.92  ? 399  LEU A CG  1 
ATOM   5382  C  CD1 . LEU E  5  399  ? 61.462  60.234  124.386 1.00 84.42  ? 399  LEU A CD1 1 
ATOM   5383  C  CD2 . LEU E  5  399  ? 59.646  61.086  125.900 1.00 68.68  ? 399  LEU A CD2 1 
ATOM   5384  N  N   . ASN E  5  400  ? 57.999  60.890  121.390 1.00 92.27  ? 400  ASN A N   1 
ATOM   5385  C  CA  . ASN E  5  400  ? 57.026  59.901  120.949 1.00 98.45  ? 400  ASN A CA  1 
ATOM   5386  C  C   . ASN E  5  400  ? 57.313  59.418  119.523 1.00 100.09 ? 400  ASN A C   1 
ATOM   5387  O  O   . ASN E  5  400  ? 56.836  58.369  119.099 1.00 100.30 ? 400  ASN A O   1 
ATOM   5388  C  CB  . ASN E  5  400  ? 55.617  60.493  121.035 1.00 102.84 ? 400  ASN A CB  1 
ATOM   5389  C  CG  . ASN E  5  400  ? 54.539  59.432  121.048 1.00 112.44 ? 400  ASN A CG  1 
ATOM   5390  O  OD1 . ASN E  5  400  ? 54.679  58.395  121.701 1.00 115.05 ? 400  ASN A OD1 1 
ATOM   5391  N  ND2 . ASN E  5  400  ? 53.453  59.683  120.319 1.00 116.62 ? 400  ASN A ND2 1 
ATOM   5392  N  N   . ASP E  5  401  ? 58.101  60.192  118.788 1.00 98.34  ? 401  ASP A N   1 
ATOM   5393  C  CA  . ASP E  5  401  ? 58.371  59.896  117.395 1.00 99.23  ? 401  ASP A CA  1 
ATOM   5394  C  C   . ASP E  5  401  ? 59.544  58.930  117.314 1.00 105.94 ? 401  ASP A C   1 
ATOM   5395  O  O   . ASP E  5  401  ? 59.558  57.996  116.503 1.00 104.16 ? 401  ASP A O   1 
ATOM   5396  C  CB  . ASP E  5  401  ? 58.690  61.191  116.647 1.00 101.78 ? 401  ASP A CB  1 
ATOM   5397  C  CG  . ASP E  5  401  ? 58.655  61.023  115.144 1.00 109.14 ? 401  ASP A CG  1 
ATOM   5398  O  OD1 . ASP E  5  401  ? 57.543  60.858  114.595 1.00 110.25 ? 401  ASP A OD1 1 
ATOM   5399  O  OD2 . ASP E  5  401  ? 59.734  61.065  114.514 1.00 113.91 ? 401  ASP A OD2 1 
ATOM   5400  N  N   . ASP E  5  402  ? 60.530  59.164  118.170 1.00 107.13 ? 402  ASP A N   1 
ATOM   5401  C  CA  . ASP E  5  402  ? 61.706  58.315  118.235 1.00 105.09 ? 402  ASP A CA  1 
ATOM   5402  C  C   . ASP E  5  402  ? 61.358  57.018  118.952 1.00 106.27 ? 402  ASP A C   1 
ATOM   5403  O  O   . ASP E  5  402  ? 61.989  55.985  118.738 1.00 117.08 ? 402  ASP A O   1 
ATOM   5404  C  CB  . ASP E  5  402  ? 62.838  59.036  118.974 1.00 107.05 ? 402  ASP A CB  1 
ATOM   5405  C  CG  . ASP E  5  402  ? 63.343  60.266  118.227 1.00 106.47 ? 402  ASP A CG  1 
ATOM   5406  O  OD1 . ASP E  5  402  ? 62.633  60.751  117.317 1.00 105.84 ? 402  ASP A OD1 1 
ATOM   5407  O  OD2 . ASP E  5  402  ? 64.454  60.746  118.550 1.00 105.09 ? 402  ASP A OD2 1 
ATOM   5408  N  N   . LEU E  5  403  ? 60.349  57.079  119.807 1.00 100.76 ? 403  LEU A N   1 
ATOM   5409  C  CA  . LEU E  5  403  ? 59.938  55.928  120.588 1.00 101.23 ? 403  LEU A CA  1 
ATOM   5410  C  C   . LEU E  5  403  ? 59.328  54.856  119.706 1.00 112.74 ? 403  LEU A C   1 
ATOM   5411  O  O   . LEU E  5  403  ? 59.507  53.662  119.955 1.00 119.95 ? 403  LEU A O   1 
ATOM   5412  C  CB  . LEU E  5  403  ? 58.922  56.354  121.635 1.00 98.66  ? 403  LEU A CB  1 
ATOM   5413  C  CG  . LEU E  5  403  ? 59.160  55.786  123.024 1.00 94.11  ? 403  LEU A CG  1 
ATOM   5414  C  CD1 . LEU E  5  403  ? 60.644  55.774  123.314 1.00 87.63  ? 403  LEU A CD1 1 
ATOM   5415  C  CD2 . LEU E  5  403  ? 58.401  56.630  124.043 1.00 92.21  ? 403  LEU A CD2 1 
ATOM   5416  N  N   . SER E  5  404  ? 58.601  55.285  118.679 1.00 114.28 ? 404  SER A N   1 
ATOM   5417  C  CA  . SER E  5  404  ? 57.954  54.358  117.753 1.00 111.58 ? 404  SER A CA  1 
ATOM   5418  C  C   . SER E  5  404  ? 58.956  53.735  116.782 1.00 113.83 ? 404  SER A C   1 
ATOM   5419  O  O   . SER E  5  404  ? 58.724  52.646  116.269 1.00 115.75 ? 404  SER A O   1 
ATOM   5420  C  CB  . SER E  5  404  ? 56.848  55.065  116.971 1.00 103.31 ? 404  SER A CB  1 
ATOM   5421  O  OG  . SER E  5  404  ? 57.394  56.085  116.151 1.00 96.85  ? 404  SER A OG  1 
ATOM   5422  N  N   . LYS E  5  405  ? 60.066  54.433  116.538 1.00 113.96 ? 405  LYS A N   1 
ATOM   5423  C  CA  . LYS E  5  405  ? 61.125  53.947  115.650 1.00 110.62 ? 405  LYS A CA  1 
ATOM   5424  C  C   . LYS E  5  405  ? 62.082  52.969  116.345 1.00 118.55 ? 405  LYS A C   1 
ATOM   5425  O  O   . LYS E  5  405  ? 63.140  52.630  115.812 1.00 123.02 ? 405  LYS A O   1 
ATOM   5426  C  CB  . LYS E  5  405  ? 61.906  55.112  115.024 1.00 101.84 ? 405  LYS A CB  1 
ATOM   5427  C  CG  . LYS E  5  405  ? 61.082  55.966  114.062 1.00 102.15 ? 405  LYS A CG  1 
ATOM   5428  C  CD  . LYS E  5  405  ? 61.855  57.204  113.596 1.00 110.33 ? 405  LYS A CD  1 
ATOM   5429  C  CE  . LYS E  5  405  ? 60.900  58.335  113.160 1.00 111.29 ? 405  LYS A CE  1 
ATOM   5430  N  NZ  . LYS E  5  405  ? 61.600  59.624  112.842 1.00 108.81 ? 405  LYS A NZ  1 
ATOM   5431  N  N   . LEU E  5  406  ? 61.705  52.520  117.537 1.00 120.91 ? 406  LEU A N   1 
ATOM   5432  C  CA  . LEU E  5  406  ? 62.411  51.426  118.188 1.00 123.81 ? 406  LEU A CA  1 
ATOM   5433  C  C   . LEU E  5  406  ? 61.777  50.099  117.774 1.00 136.27 ? 406  LEU A C   1 
ATOM   5434  O  O   . LEU E  5  406  ? 60.566  49.908  117.924 1.00 132.38 ? 406  LEU A O   1 
ATOM   5435  C  CB  . LEU E  5  406  ? 62.349  51.555  119.714 1.00 112.32 ? 406  LEU A CB  1 
ATOM   5436  C  CG  . LEU E  5  406  ? 63.053  52.701  120.447 1.00 103.95 ? 406  LEU A CG  1 
ATOM   5437  C  CD1 . LEU E  5  406  ? 62.929  52.499  121.953 1.00 100.40 ? 406  LEU A CD1 1 
ATOM   5438  C  CD2 . LEU E  5  406  ? 64.511  52.814  120.045 1.00 99.72  ? 406  LEU A CD2 1 
ATOM   5439  N  N   . GLN E  5  407  ? 62.597  49.189  117.251 1.00 145.92 ? 407  GLN A N   1 
ATOM   5440  C  CA  . GLN E  5  407  ? 62.158  47.823  116.993 1.00 145.72 ? 407  GLN A CA  1 
ATOM   5441  C  C   . GLN E  5  407  ? 62.412  46.982  118.246 1.00 144.36 ? 407  GLN A C   1 
ATOM   5442  O  O   . GLN E  5  407  ? 63.519  47.011  118.791 1.00 142.84 ? 407  GLN A O   1 
ATOM   5443  C  CB  . GLN E  5  407  ? 62.934  47.235  115.819 1.00 149.05 ? 407  GLN A CB  1 
ATOM   5444  C  CG  . GLN E  5  407  ? 63.144  48.181  114.654 1.00 153.32 ? 407  GLN A CG  1 
ATOM   5445  C  CD  . GLN E  5  407  ? 63.931  47.533  113.521 1.00 163.19 ? 407  GLN A CD  1 
ATOM   5446  O  OE1 . GLN E  5  407  ? 64.281  46.349  113.583 1.00 166.32 ? 407  GLN A OE1 1 
ATOM   5447  N  NE2 . GLN E  5  407  ? 64.213  48.309  112.478 1.00 164.34 ? 407  GLN A NE2 1 
ATOM   5448  N  N   . LYS E  5  408  ? 61.400  46.235  118.694 1.00 143.71 ? 408  LYS A N   1 
ATOM   5449  C  CA  . LYS E  5  408  ? 61.506  45.419  119.915 1.00 144.71 ? 408  LYS A CA  1 
ATOM   5450  C  C   . LYS E  5  408  ? 62.523  44.261  119.874 1.00 147.95 ? 408  LYS A C   1 
ATOM   5451  O  O   . LYS E  5  408  ? 62.802  43.644  120.906 1.00 146.07 ? 408  LYS A O   1 
ATOM   5452  C  CB  . LYS E  5  408  ? 60.134  44.885  120.342 1.00 141.99 ? 408  LYS A CB  1 
ATOM   5453  C  CG  . LYS E  5  408  ? 59.459  45.710  121.417 1.00 139.32 ? 408  LYS A CG  1 
ATOM   5454  C  CD  . LYS E  5  408  ? 58.542  46.765  120.824 1.00 137.60 ? 408  LYS A CD  1 
ATOM   5455  C  CE  . LYS E  5  408  ? 57.370  46.123  120.098 1.00 137.13 ? 408  LYS A CE  1 
ATOM   5456  N  NZ  . LYS E  5  408  ? 56.187  47.028  120.054 1.00 136.72 ? 408  LYS A NZ  1 
ATOM   5457  N  N   . ASP E  5  409  ? 63.061  43.966  118.690 1.00 151.21 ? 409  ASP A N   1 
ATOM   5458  C  CA  . ASP E  5  409  ? 64.097  42.938  118.529 1.00 155.64 ? 409  ASP A CA  1 
ATOM   5459  C  C   . ASP E  5  409  ? 65.485  43.477  118.891 1.00 156.94 ? 409  ASP A C   1 
ATOM   5460  O  O   . ASP E  5  409  ? 66.459  42.720  118.985 1.00 150.88 ? 409  ASP A O   1 
ATOM   5461  C  CB  . ASP E  5  409  ? 64.097  42.376  117.100 1.00 157.46 ? 409  ASP A CB  1 
ATOM   5462  C  CG  . ASP E  5  409  ? 64.221  43.463  116.036 1.00 157.14 ? 409  ASP A CG  1 
ATOM   5463  O  OD1 . ASP E  5  409  ? 63.180  44.023  115.629 1.00 154.37 ? 409  ASP A OD1 1 
ATOM   5464  O  OD2 . ASP E  5  409  ? 65.356  43.750  115.596 1.00 159.97 ? 409  ASP A OD2 1 
ATOM   5465  N  N   . LYS E  5  410  ? 65.559  44.794  119.082 1.00 160.27 ? 410  LYS A N   1 
ATOM   5466  C  CA  . LYS E  5  410  ? 66.774  45.462  119.535 1.00 159.50 ? 410  LYS A CA  1 
ATOM   5467  C  C   . LYS E  5  410  ? 66.549  46.006  120.942 1.00 154.65 ? 410  LYS A C   1 
ATOM   5468  O  O   . LYS E  5  410  ? 67.504  46.286  121.672 1.00 153.35 ? 410  LYS A O   1 
ATOM   5469  C  CB  . LYS E  5  410  ? 67.152  46.600  118.581 1.00 159.55 ? 410  LYS A CB  1 
ATOM   5470  C  CG  . LYS E  5  410  ? 67.390  46.155  117.139 1.00 163.10 ? 410  LYS A CG  1 
ATOM   5471  C  CD  . LYS E  5  410  ? 67.596  47.347  116.211 1.00 162.04 ? 410  LYS A CD  1 
ATOM   5472  C  CE  . LYS E  5  410  ? 67.755  46.910  114.759 1.00 160.94 ? 410  LYS A CE  1 
ATOM   5473  N  NZ  . LYS E  5  410  ? 67.890  48.077  113.843 1.00 158.32 ? 410  LYS A NZ  1 
ATOM   5474  N  N   . VAL E  5  411  ? 65.274  46.142  121.314 1.00 150.81 ? 411  VAL A N   1 
ATOM   5475  C  CA  . VAL E  5  411  ? 64.891  46.651  122.632 1.00 142.97 ? 411  VAL A CA  1 
ATOM   5476  C  C   . VAL E  5  411  ? 65.212  45.665  123.743 1.00 133.39 ? 411  VAL A C   1 
ATOM   5477  O  O   . VAL E  5  411  ? 64.544  44.639  123.903 1.00 129.44 ? 411  VAL A O   1 
ATOM   5478  C  CB  . VAL E  5  411  ? 63.396  47.015  122.716 1.00 142.47 ? 411  VAL A CB  1 
ATOM   5479  C  CG1 . VAL E  5  411  ? 63.042  47.437  124.133 1.00 141.47 ? 411  VAL A CG1 1 
ATOM   5480  C  CG2 . VAL E  5  411  ? 63.069  48.128  121.741 1.00 140.75 ? 411  VAL A CG2 1 
ATOM   5481  N  N   . SER E  5  412  ? 66.234  46.020  124.512 1.00 127.41 ? 412  SER A N   1 
ATOM   5482  C  CA  . SER E  5  412  ? 66.769  45.208  125.592 1.00 123.12 ? 412  SER A CA  1 
ATOM   5483  C  C   . SER E  5  412  ? 65.749  44.920  126.701 1.00 124.82 ? 412  SER A C   1 
ATOM   5484  O  O   . SER E  5  412  ? 64.539  45.089  126.524 1.00 119.45 ? 412  SER A O   1 
ATOM   5485  C  CB  . SER E  5  412  ? 68.002  45.921  126.169 1.00 115.74 ? 412  SER A CB  1 
ATOM   5486  O  OG  . SER E  5  412  ? 68.521  45.262  127.308 1.00 116.06 ? 412  SER A OG  1 
ATOM   5487  N  N   . LEU E  5  413  ? 66.254  44.442  127.833 1.00 134.01 ? 413  LEU A N   1 
ATOM   5488  C  CA  . LEU E  5  413  ? 65.474  44.358  129.061 1.00 136.70 ? 413  LEU A CA  1 
ATOM   5489  C  C   . LEU E  5  413  ? 65.923  45.552  129.895 1.00 133.72 ? 413  LEU A C   1 
ATOM   5490  O  O   . LEU E  5  413  ? 65.200  46.045  130.767 1.00 128.07 ? 413  LEU A O   1 
ATOM   5491  C  CB  . LEU E  5  413  ? 65.758  43.044  129.800 1.00 138.22 ? 413  LEU A CB  1 
ATOM   5492  C  CG  . LEU E  5  413  ? 64.548  42.287  130.361 1.00 139.27 ? 413  LEU A CG  1 
ATOM   5493  C  CD1 . LEU E  5  413  ? 63.705  43.184  131.274 1.00 136.47 ? 413  LEU A CD1 1 
ATOM   5494  C  CD2 . LEU E  5  413  ? 63.700  41.691  129.234 1.00 139.12 ? 413  LEU A CD2 1 
ATOM   5495  N  N   . GLU E  5  414  ? 67.136  46.007  129.590 1.00 132.84 ? 414  GLU A N   1 
ATOM   5496  C  CA  . GLU E  5  414  ? 67.734  47.176  130.214 1.00 130.78 ? 414  GLU A CA  1 
ATOM   5497  C  C   . GLU E  5  414  ? 67.234  48.452  129.541 1.00 129.03 ? 414  GLU A C   1 
ATOM   5498  O  O   . GLU E  5  414  ? 67.093  49.495  130.184 1.00 128.42 ? 414  GLU A O   1 
ATOM   5499  C  CB  . GLU E  5  414  ? 69.256  47.086  130.116 1.00 133.66 ? 414  GLU A CB  1 
ATOM   5500  C  CG  . GLU E  5  414  ? 69.982  48.364  130.494 1.00 135.93 ? 414  GLU A CG  1 
ATOM   5501  C  CD  . GLU E  5  414  ? 69.788  48.739  131.947 1.00 135.92 ? 414  GLU A CD  1 
ATOM   5502  O  OE1 . GLU E  5  414  ? 70.073  47.890  132.820 1.00 136.71 ? 414  GLU A OE1 1 
ATOM   5503  O  OE2 . GLU E  5  414  ? 69.358  49.884  132.211 1.00 133.55 ? 414  GLU A OE2 1 
ATOM   5504  N  N   . ASP E  5  415  ? 66.965  48.363  128.241 1.00 127.09 ? 415  ASP A N   1 
ATOM   5505  C  CA  . ASP E  5  415  ? 66.366  49.476  127.515 1.00 121.90 ? 415  ASP A CA  1 
ATOM   5506  C  C   . ASP E  5  415  ? 64.962  49.762  128.057 1.00 114.80 ? 415  ASP A C   1 
ATOM   5507  O  O   . ASP E  5  415  ? 64.469  50.886  127.981 1.00 104.10 ? 415  ASP A O   1 
ATOM   5508  C  CB  . ASP E  5  415  ? 66.336  49.209  126.002 1.00 127.56 ? 415  ASP A CB  1 
ATOM   5509  C  CG  . ASP E  5  415  ? 67.706  49.409  125.332 1.00 132.58 ? 415  ASP A CG  1 
ATOM   5510  O  OD1 . ASP E  5  415  ? 68.608  50.016  125.959 1.00 135.89 ? 415  ASP A OD1 1 
ATOM   5511  O  OD2 . ASP E  5  415  ? 67.876  48.970  124.169 1.00 128.90 ? 415  ASP A OD2 1 
ATOM   5512  N  N   . ARG E  5  416  ? 64.329  48.736  128.619 1.00 119.59 ? 416  ARG A N   1 
ATOM   5513  C  CA  . ARG E  5  416  ? 63.038  48.903  129.277 1.00 117.59 ? 416  ARG A CA  1 
ATOM   5514  C  C   . ARG E  5  416  ? 63.147  49.941  130.378 1.00 106.03 ? 416  ARG A C   1 
ATOM   5515  O  O   . ARG E  5  416  ? 62.255  50.754  130.547 1.00 107.47 ? 416  ARG A O   1 
ATOM   5516  C  CB  . ARG E  5  416  ? 62.540  47.580  129.876 1.00 128.93 ? 416  ARG A CB  1 
ATOM   5517  C  CG  . ARG E  5  416  ? 62.360  46.456  128.880 1.00 136.12 ? 416  ARG A CG  1 
ATOM   5518  C  CD  . ARG E  5  416  ? 61.245  46.777  127.890 1.00 137.05 ? 416  ARG A CD  1 
ATOM   5519  N  NE  . ARG E  5  416  ? 61.366  45.933  126.737 1.00 141.07 ? 416  ARG A NE  1 
ATOM   5520  C  CZ  . ARG E  5  416  ? 60.497  45.146  126.110 1.00 134.70 ? 416  ARG A CZ  1 
ATOM   5521  N  NH1 . ARG E  5  416  ? 59.215  44.987  126.433 1.00 128.70 ? 416  ARG A NH1 1 
ATOM   5522  N  NH2 . ARG E  5  416  ? 61.003  44.504  125.072 1.00 131.38 ? 416  ARG A NH2 1 
ATOM   5523  N  N   . ARG E  5  417  ? 64.242  49.909  131.128 1.00 104.55 ? 417  ARG A N   1 
ATOM   5524  C  CA  . ARG E  5  417  ? 64.446  50.855  132.229 1.00 107.84 ? 417  ARG A CA  1 
ATOM   5525  C  C   . ARG E  5  417  ? 64.701  52.283  131.732 1.00 100.23 ? 417  ARG A C   1 
ATOM   5526  O  O   . ARG E  5  417  ? 64.196  53.259  132.300 1.00 86.03  ? 417  ARG A O   1 
ATOM   5527  C  CB  . ARG E  5  417  ? 65.588  50.394  133.148 1.00 113.33 ? 417  ARG A CB  1 
ATOM   5528  C  CG  . ARG E  5  417  ? 65.120  49.719  134.431 1.00 117.08 ? 417  ARG A CG  1 
ATOM   5529  C  CD  . ARG E  5  417  ? 66.133  48.703  134.927 1.00 126.75 ? 417  ARG A CD  1 
ATOM   5530  N  NE  . ARG E  5  417  ? 66.187  47.529  134.056 1.00 134.82 ? 417  ARG A NE  1 
ATOM   5531  C  CZ  . ARG E  5  417  ? 66.965  46.470  134.265 1.00 138.25 ? 417  ARG A CZ  1 
ATOM   5532  N  NH1 . ARG E  5  417  ? 67.768  46.432  135.320 1.00 137.94 ? 417  ARG A NH1 1 
ATOM   5533  N  NH2 . ARG E  5  417  ? 66.941  45.448  133.416 1.00 141.03 ? 417  ARG A NH2 1 
ATOM   5534  N  N   . VAL E  5  418  ? 65.480  52.398  130.663 1.00 99.23  ? 418  VAL A N   1 
ATOM   5535  C  CA  . VAL E  5  418  ? 65.811  53.705  130.129 1.00 92.78  ? 418  VAL A CA  1 
ATOM   5536  C  C   . VAL E  5  418  ? 64.601  54.362  129.446 1.00 90.76  ? 418  VAL A C   1 
ATOM   5537  O  O   . VAL E  5  418  ? 64.389  55.566  129.586 1.00 86.28  ? 418  VAL A O   1 
ATOM   5538  C  CB  . VAL E  5  418  ? 67.070  53.651  129.213 1.00 97.38  ? 418  VAL A CB  1 
ATOM   5539  C  CG1 . VAL E  5  418  ? 66.795  52.902  127.941 1.00 96.04  ? 418  VAL A CG1 1 
ATOM   5540  C  CG2 . VAL E  5  418  ? 67.553  55.047  128.890 1.00 102.90 ? 418  VAL A CG2 1 
ATOM   5541  N  N   . ILE E  5  419  ? 63.798  53.572  128.735 1.00 91.94  ? 419  ILE A N   1 
ATOM   5542  C  CA  . ILE E  5  419  ? 62.604  54.096  128.079 1.00 83.26  ? 419  ILE A CA  1 
ATOM   5543  C  C   . ILE E  5  419  ? 61.662  54.623  129.138 1.00 81.90  ? 419  ILE A C   1 
ATOM   5544  O  O   . ILE E  5  419  ? 61.073  55.704  128.990 1.00 81.34  ? 419  ILE A O   1 
ATOM   5545  C  CB  . ILE E  5  419  ? 61.886  53.025  127.238 1.00 86.52  ? 419  ILE A CB  1 
ATOM   5546  C  CG1 . ILE E  5  419  ? 62.789  52.540  126.103 1.00 90.58  ? 419  ILE A CG1 1 
ATOM   5547  C  CG2 . ILE E  5  419  ? 60.601  53.568  126.654 1.00 76.95  ? 419  ILE A CG2 1 
ATOM   5548  C  CD1 . ILE E  5  419  ? 62.253  51.330  125.371 1.00 90.70  ? 419  ILE A CD1 1 
ATOM   5549  N  N   . PHE E  5  420  ? 61.531  53.875  130.229 1.00 86.12  ? 420  PHE A N   1 
ATOM   5550  C  CA  . PHE E  5  420  ? 60.690  54.330  131.336 1.00 90.64  ? 420  PHE A CA  1 
ATOM   5551  C  C   . PHE E  5  420  ? 61.229  55.636  131.924 1.00 95.49  ? 420  PHE A C   1 
ATOM   5552  O  O   . PHE E  5  420  ? 60.474  56.560  132.201 1.00 97.94  ? 420  PHE A O   1 
ATOM   5553  C  CB  . PHE E  5  420  ? 60.557  53.263  132.428 1.00 85.70  ? 420  PHE A CB  1 
ATOM   5554  C  CG  . PHE E  5  420  ? 59.526  53.601  133.465 1.00 81.86  ? 420  PHE A CG  1 
ATOM   5555  C  CD1 . PHE E  5  420  ? 58.176  53.415  133.202 1.00 83.76  ? 420  PHE A CD1 1 
ATOM   5556  C  CD2 . PHE E  5  420  ? 59.901  54.124  134.693 1.00 81.30  ? 420  PHE A CD2 1 
ATOM   5557  C  CE1 . PHE E  5  420  ? 57.224  53.734  134.143 1.00 86.38  ? 420  PHE A CE1 1 
ATOM   5558  C  CE2 . PHE E  5  420  ? 58.953  54.450  135.641 1.00 82.22  ? 420  PHE A CE2 1 
ATOM   5559  C  CZ  . PHE E  5  420  ? 57.611  54.254  135.367 1.00 85.97  ? 420  PHE A CZ  1 
ATOM   5560  N  N   . SER E  5  421  ? 62.543  55.699  132.104 1.00 96.58  ? 421  SER A N   1 
ATOM   5561  C  CA  . SER E  5  421  ? 63.200  56.891  132.612 1.00 85.64  ? 421  SER A CA  1 
ATOM   5562  C  C   . SER E  5  421  ? 62.846  58.113  131.772 1.00 77.25  ? 421  SER A C   1 
ATOM   5563  O  O   . SER E  5  421  ? 62.540  59.167  132.314 1.00 74.46  ? 421  SER A O   1 
ATOM   5564  C  CB  . SER E  5  421  ? 64.713  56.683  132.631 1.00 86.79  ? 421  SER A CB  1 
ATOM   5565  O  OG  . SER E  5  421  ? 65.375  57.803  133.178 1.00 84.20  ? 421  SER A OG  1 
ATOM   5566  N  N   . ARG E  5  422  ? 62.871  57.963  130.451 1.00 75.82  ? 422  ARG A N   1 
ATOM   5567  C  CA  . ARG E  5  422  ? 62.571  59.080  129.566 1.00 75.65  ? 422  ARG A CA  1 
ATOM   5568  C  C   . ARG E  5  422  ? 61.093  59.432  129.640 1.00 77.11  ? 422  ARG A C   1 
ATOM   5569  O  O   . ARG E  5  422  ? 60.722  60.593  129.506 1.00 82.69  ? 422  ARG A O   1 
ATOM   5570  C  CB  . ARG E  5  422  ? 62.936  58.764  128.112 1.00 77.81  ? 422  ARG A CB  1 
ATOM   5571  C  CG  . ARG E  5  422  ? 64.392  58.416  127.836 1.00 81.27  ? 422  ARG A CG  1 
ATOM   5572  C  CD  . ARG E  5  422  ? 65.335  59.615  127.799 1.00 83.42  ? 422  ARG A CD  1 
ATOM   5573  N  NE  . ARG E  5  422  ? 66.398  59.365  128.722 1.00 92.72  ? 422  ARG A NE  1 
ATOM   5574  C  CZ  . ARG E  5  422  ? 67.665  59.004  128.547 1.00 97.35  ? 422  ARG A CZ  1 
ATOM   5575  N  NH1 . ARG E  5  422  ? 68.292  58.896  127.379 1.00 97.55  ? 422  ARG A NH1 1 
ATOM   5576  N  NH2 . ARG E  5  422  ? 68.331  58.790  129.664 1.00 96.00  ? 422  ARG A NH2 1 
ATOM   5577  N  N   . LEU E  5  423  ? 60.247  58.428  129.834 1.00 75.26  ? 423  LEU A N   1 
ATOM   5578  C  CA  . LEU E  5  423  ? 58.810  58.667  129.867 1.00 76.56  ? 423  LEU A CA  1 
ATOM   5579  C  C   . LEU E  5  423  ? 58.401  59.387  131.140 1.00 80.12  ? 423  LEU A C   1 
ATOM   5580  O  O   . LEU E  5  423  ? 57.574  60.308  131.105 1.00 78.28  ? 423  LEU A O   1 
ATOM   5581  C  CB  . LEU E  5  423  ? 58.023  57.361  129.709 1.00 83.38  ? 423  LEU A CB  1 
ATOM   5582  C  CG  . LEU E  5  423  ? 57.834  56.884  128.266 1.00 91.13  ? 423  LEU A CG  1 
ATOM   5583  C  CD1 . LEU E  5  423  ? 57.235  55.496  128.246 1.00 91.74  ? 423  LEU A CD1 1 
ATOM   5584  C  CD2 . LEU E  5  423  ? 56.966  57.866  127.464 1.00 68.35  ? 423  LEU A CD2 1 
ATOM   5585  N  N   . MET E  5  424  ? 58.980  58.962  132.263 1.00 83.47  ? 424  MET A N   1 
ATOM   5586  C  CA  . MET E  5  424  ? 58.709  59.598  133.545 1.00 76.15  ? 424  MET A CA  1 
ATOM   5587  C  C   . MET E  5  424  ? 59.096  61.056  133.430 1.00 75.47  ? 424  MET A C   1 
ATOM   5588  O  O   . MET E  5  424  ? 58.326  61.935  133.814 1.00 79.56  ? 424  MET A O   1 
ATOM   5589  C  CB  . MET E  5  424  ? 59.483  58.927  134.682 1.00 72.97  ? 424  MET A CB  1 
ATOM   5590  C  CG  . MET E  5  424  ? 59.287  59.603  136.026 1.00 75.64  ? 424  MET A CG  1 
ATOM   5591  S  SD  . MET E  5  424  ? 60.337  58.983  137.360 1.00 130.36 ? 424  MET A SD  1 
ATOM   5592  C  CE  . MET E  5  424  ? 60.009  60.201  138.660 1.00 76.40  ? 424  MET A CE  1 
ATOM   5593  N  N   . ASN E  5  425  ? 60.276  61.308  132.868 1.00 71.69  ? 425  ASN A N   1 
ATOM   5594  C  CA  . ASN E  5  425  ? 60.758  62.670  132.669 1.00 73.20  ? 425  ASN A CA  1 
ATOM   5595  C  C   . ASN E  5  425  ? 59.764  63.557  131.909 1.00 74.61  ? 425  ASN A C   1 
ATOM   5596  O  O   . ASN E  5  425  ? 59.417  64.664  132.358 1.00 75.11  ? 425  ASN A O   1 
ATOM   5597  C  CB  . ASN E  5  425  ? 62.094  62.655  131.948 1.00 68.01  ? 425  ASN A CB  1 
ATOM   5598  C  CG  . ASN E  5  425  ? 62.613  64.032  131.678 1.00 81.76  ? 425  ASN A CG  1 
ATOM   5599  O  OD1 . ASN E  5  425  ? 62.225  64.664  130.704 1.00 88.07  ? 425  ASN A OD1 1 
ATOM   5600  N  ND2 . ASN E  5  425  ? 63.499  64.512  132.540 1.00 74.49  ? 425  ASN A ND2 1 
ATOM   5601  N  N   . ALA E  5  426  ? 59.301  63.061  130.768 1.00 64.89  ? 426  ALA A N   1 
ATOM   5602  C  CA  . ALA E  5  426  ? 58.314  63.784  129.972 1.00 66.68  ? 426  ALA A CA  1 
ATOM   5603  C  C   . ALA E  5  426  ? 57.004  64.090  130.733 1.00 62.53  ? 426  ALA A C   1 
ATOM   5604  O  O   . ALA E  5  426  ? 56.560  65.227  130.764 1.00 60.56  ? 426  ALA A O   1 
ATOM   5605  C  CB  . ALA E  5  426  ? 58.033  63.039  128.679 1.00 64.29  ? 426  ALA A CB  1 
ATOM   5606  N  N   . PHE E  5  427  ? 56.403  63.070  131.339 1.00 64.55  ? 427  PHE A N   1 
ATOM   5607  C  CA  . PHE E  5  427  ? 55.168  63.225  132.090 1.00 60.42  ? 427  PHE A CA  1 
ATOM   5608  C  C   . PHE E  5  427  ? 55.353  64.249  133.189 1.00 68.95  ? 427  PHE A C   1 
ATOM   5609  O  O   . PHE E  5  427  ? 54.511  65.119  133.379 1.00 58.13  ? 427  PHE A O   1 
ATOM   5610  C  CB  . PHE E  5  427  ? 54.747  61.901  132.729 1.00 60.97  ? 427  PHE A CB  1 
ATOM   5611  C  CG  . PHE E  5  427  ? 53.930  61.016  131.833 1.00 70.30  ? 427  PHE A CG  1 
ATOM   5612  C  CD1 . PHE E  5  427  ? 54.524  60.308  130.789 1.00 67.49  ? 427  PHE A CD1 1 
ATOM   5613  C  CD2 . PHE E  5  427  ? 52.570  60.862  132.055 1.00 67.73  ? 427  PHE A CD2 1 
ATOM   5614  C  CE1 . PHE E  5  427  ? 53.761  59.493  129.969 1.00 68.90  ? 427  PHE A CE1 1 
ATOM   5615  C  CE2 . PHE E  5  427  ? 51.804  60.047  131.250 1.00 65.94  ? 427  PHE A CE2 1 
ATOM   5616  C  CZ  . PHE E  5  427  ? 52.396  59.361  130.204 1.00 72.64  ? 427  PHE A CZ  1 
ATOM   5617  N  N   . VAL E  5  428  ? 56.453  64.151  133.926 1.00 68.62  ? 428  VAL A N   1 
ATOM   5618  C  CA  . VAL E  5  428  ? 56.657  65.062  135.051 1.00 72.44  ? 428  VAL A CA  1 
ATOM   5619  C  C   . VAL E  5  428  ? 56.721  66.520  134.598 1.00 76.21  ? 428  VAL A C   1 
ATOM   5620  O  O   . VAL E  5  428  ? 56.060  67.390  135.175 1.00 77.43  ? 428  VAL A O   1 
ATOM   5621  C  CB  . VAL E  5  428  ? 57.901  64.700  135.878 1.00 67.64  ? 428  VAL A CB  1 
ATOM   5622  C  CG1 . VAL E  5  428  ? 58.187  65.771  136.905 1.00 60.79  ? 428  VAL A CG1 1 
ATOM   5623  C  CG2 . VAL E  5  428  ? 57.674  63.381  136.566 1.00 75.05  ? 428  VAL A CG2 1 
ATOM   5624  N  N   . THR E  5  429  ? 57.484  66.785  133.544 1.00 69.58  ? 429  THR A N   1 
ATOM   5625  C  CA  . THR E  5  429  ? 57.652  68.160  133.128 1.00 68.61  ? 429  THR A CA  1 
ATOM   5626  C  C   . THR E  5  429  ? 56.432  68.732  132.391 1.00 62.77  ? 429  THR A C   1 
ATOM   5627  O  O   . THR E  5  429  ? 56.140  69.909  132.525 1.00 59.80  ? 429  THR A O   1 
ATOM   5628  C  CB  . THR E  5  429  ? 58.963  68.378  132.363 1.00 73.25  ? 429  THR A CB  1 
ATOM   5629  O  OG1 . THR E  5  429  ? 58.841  67.827  131.060 1.00 72.44  ? 429  THR A OG1 1 
ATOM   5630  C  CG2 . THR E  5  429  ? 60.136  67.714  133.109 1.00 71.92  ? 429  THR A CG2 1 
ATOM   5631  N  N   . ILE E  5  430  ? 55.693  67.922  131.646 1.00 61.70  ? 430  ILE A N   1 
ATOM   5632  C  CA  . ILE E  5  430  ? 54.457  68.451  131.096 1.00 56.51  ? 430  ILE A CA  1 
ATOM   5633  C  C   . ILE E  5  430  ? 53.499  68.743  132.248 1.00 65.14  ? 430  ILE A C   1 
ATOM   5634  O  O   . ILE E  5  430  ? 52.864  69.795  132.279 1.00 62.24  ? 430  ILE A O   1 
ATOM   5635  C  CB  . ILE E  5  430  ? 53.807  67.549  130.010 1.00 68.32  ? 430  ILE A CB  1 
ATOM   5636  C  CG1 . ILE E  5  430  ? 52.560  68.212  129.427 1.00 55.65  ? 430  ILE A CG1 1 
ATOM   5637  C  CG2 . ILE E  5  430  ? 53.404  66.220  130.568 1.00 72.76  ? 430  ILE A CG2 1 
ATOM   5638  C  CD1 . ILE E  5  430  ? 52.845  69.437  128.623 1.00 60.36  ? 430  ILE A CD1 1 
ATOM   5639  N  N   . GLN E  5  431  ? 53.433  67.839  133.222 1.00 64.84  ? 431  GLN A N   1 
ATOM   5640  C  CA  . GLN E  5  431  ? 52.538  68.011  134.369 1.00 60.55  ? 431  GLN A CA  1 
ATOM   5641  C  C   . GLN E  5  431  ? 52.946  69.237  135.163 1.00 62.41  ? 431  GLN A C   1 
ATOM   5642  O  O   . GLN E  5  431  ? 52.114  69.909  135.783 1.00 52.78  ? 431  GLN A O   1 
ATOM   5643  C  CB  . GLN E  5  431  ? 52.561  66.777  135.272 1.00 55.04  ? 431  GLN A CB  1 
ATOM   5644  C  CG  . GLN E  5  431  ? 51.709  66.866  136.516 1.00 54.16  ? 431  GLN A CG  1 
ATOM   5645  C  CD  . GLN E  5  431  ? 50.218  66.905  136.225 1.00 75.15  ? 431  GLN A CD  1 
ATOM   5646  O  OE1 . GLN E  5  431  ? 49.629  65.936  135.768 1.00 53.31  ? 431  GLN A OE1 1 
ATOM   5647  N  NE2 . GLN E  5  431  ? 49.602  68.031  136.507 1.00 51.86  ? 431  GLN A NE2 1 
ATOM   5648  N  N   . ASN E  5  432  ? 54.237  69.540  135.151 1.00 60.85  ? 432  ASN A N   1 
ATOM   5649  C  CA  . ASN E  5  432  ? 54.669  70.733  135.842 1.00 59.44  ? 432  ASN A CA  1 
ATOM   5650  C  C   . ASN E  5  432  ? 54.218  71.999  135.116 1.00 64.63  ? 432  ASN A C   1 
ATOM   5651  O  O   . ASN E  5  432  ? 53.780  72.962  135.745 1.00 69.73  ? 432  ASN A O   1 
ATOM   5652  C  CB  . ASN E  5  432  ? 56.176  70.753  136.046 1.00 61.33  ? 432  ASN A CB  1 
ATOM   5653  C  CG  . ASN E  5  432  ? 56.615  71.919  136.914 1.00 72.10  ? 432  ASN A CG  1 
ATOM   5654  O  OD1 . ASN E  5  432  ? 56.345  71.947  138.118 1.00 78.13  ? 432  ASN A OD1 1 
ATOM   5655  N  ND2 . ASN E  5  432  ? 57.272  72.898  136.306 1.00 76.43  ? 432  ASN A ND2 1 
ATOM   5656  N  N   . ASP E  5  433  ? 54.323  71.989  133.790 1.00 61.34  ? 433  ASP A N   1 
ATOM   5657  C  CA  . ASP E  5  433  ? 53.974  73.152  132.990 1.00 60.74  ? 433  ASP A CA  1 
ATOM   5658  C  C   . ASP E  5  433  ? 52.483  73.447  133.058 1.00 61.18  ? 433  ASP A C   1 
ATOM   5659  O  O   . ASP E  5  433  ? 52.074  74.616  132.992 1.00 59.99  ? 433  ASP A O   1 
ATOM   5660  C  CB  . ASP E  5  433  ? 54.425  72.980  131.540 1.00 70.51  ? 433  ASP A CB  1 
ATOM   5661  C  CG  . ASP E  5  433  ? 55.935  73.146  131.366 1.00 85.86  ? 433  ASP A CG  1 
ATOM   5662  O  OD1 . ASP E  5  433  ? 56.565  73.986  132.053 1.00 87.17  ? 433  ASP A OD1 1 
ATOM   5663  O  OD2 . ASP E  5  433  ? 56.503  72.431  130.521 1.00 97.26  ? 433  ASP A OD2 1 
ATOM   5664  N  N   . VAL E  5  434  ? 51.683  72.387  133.189 1.00 56.22  ? 434  VAL A N   1 
ATOM   5665  C  CA  . VAL E  5  434  ? 50.240  72.527  133.374 1.00 56.54  ? 434  VAL A CA  1 
ATOM   5666  C  C   . VAL E  5  434  ? 49.956  73.107  134.754 1.00 59.26  ? 434  VAL A C   1 
ATOM   5667  O  O   . VAL E  5  434  ? 49.230  74.104  134.876 1.00 60.33  ? 434  VAL A O   1 
ATOM   5668  C  CB  . VAL E  5  434  ? 49.492  71.187  133.198 1.00 53.30  ? 434  VAL A CB  1 
ATOM   5669  C  CG1 . VAL E  5  434  ? 48.054  71.310  133.638 1.00 49.56  ? 434  VAL A CG1 1 
ATOM   5670  C  CG2 . VAL E  5  434  ? 49.556  70.736  131.755 1.00 51.33  ? 434  VAL A CG2 1 
ATOM   5671  N  N   . ASN E  5  435  ? 50.538  72.486  135.781 1.00 55.09  ? 435  ASN A N   1 
ATOM   5672  C  CA  . ASN E  5  435  ? 50.449  72.996  137.147 1.00 52.03  ? 435  ASN A CA  1 
ATOM   5673  C  C   . ASN E  5  435  ? 50.788  74.472  137.254 1.00 53.90  ? 435  ASN A C   1 
ATOM   5674  O  O   . ASN E  5  435  ? 50.068  75.243  137.882 1.00 55.36  ? 435  ASN A O   1 
ATOM   5675  C  CB  . ASN E  5  435  ? 51.372  72.218  138.075 1.00 55.41  ? 435  ASN A CB  1 
ATOM   5676  C  CG  . ASN E  5  435  ? 50.839  70.847  138.420 1.00 61.72  ? 435  ASN A CG  1 
ATOM   5677  O  OD1 . ASN E  5  435  ? 49.680  70.532  138.146 1.00 65.25  ? 435  ASN A OD1 1 
ATOM   5678  N  ND2 . ASN E  5  435  ? 51.682  70.024  139.037 1.00 62.01  ? 435  ASN A ND2 1 
ATOM   5679  N  N   . ALA E  5  436  ? 51.885  74.863  136.621 1.00 54.45  ? 436  ALA A N   1 
ATOM   5680  C  CA  . ALA E  5  436  ? 52.368  76.231  136.708 1.00 53.95  ? 436  ALA A CA  1 
ATOM   5681  C  C   . ALA E  5  436  ? 51.366  77.240  136.164 1.00 54.50  ? 436  ALA A C   1 
ATOM   5682  O  O   . ALA E  5  436  ? 51.368  78.397  136.568 1.00 57.09  ? 436  ALA A O   1 
ATOM   5683  C  CB  . ALA E  5  436  ? 53.686  76.355  135.986 1.00 51.52  ? 436  ALA A CB  1 
ATOM   5684  N  N   . PHE E  5  437  ? 50.520  76.780  135.247 1.00 58.98  ? 437  PHE A N   1 
ATOM   5685  C  CA  . PHE E  5  437  ? 49.587  77.611  134.501 1.00 54.53  ? 437  PHE A CA  1 
ATOM   5686  C  C   . PHE E  5  437  ? 48.283  77.774  135.276 1.00 56.51  ? 437  PHE A C   1 
ATOM   5687  O  O   . PHE E  5  437  ? 47.609  78.800  135.190 1.00 56.25  ? 437  PHE A O   1 
ATOM   5688  C  CB  . PHE E  5  437  ? 49.335  76.955  133.135 1.00 48.54  ? 437  PHE A CB  1 
ATOM   5689  C  CG  . PHE E  5  437  ? 48.096  77.441  132.429 1.00 54.52  ? 437  PHE A CG  1 
ATOM   5690  C  CD1 . PHE E  5  437  ? 47.968  78.766  132.026 1.00 59.86  ? 437  PHE A CD1 1 
ATOM   5691  C  CD2 . PHE E  5  437  ? 47.073  76.573  132.139 1.00 49.74  ? 437  PHE A CD2 1 
ATOM   5692  C  CE1 . PHE E  5  437  ? 46.830  79.212  131.370 1.00 57.17  ? 437  PHE A CE1 1 
ATOM   5693  C  CE2 . PHE E  5  437  ? 45.938  77.014  131.481 1.00 54.28  ? 437  PHE A CE2 1 
ATOM   5694  C  CZ  . PHE E  5  437  ? 45.817  78.339  131.105 1.00 46.75  ? 437  PHE A CZ  1 
ATOM   5695  N  N   . ILE E  5  438  ? 47.944  76.749  136.044 1.00 57.77  ? 438  ILE A N   1 
ATOM   5696  C  CA  . ILE E  5  438  ? 46.698  76.713  136.790 1.00 52.87  ? 438  ILE A CA  1 
ATOM   5697  C  C   . ILE E  5  438  ? 46.868  77.087  138.270 1.00 59.96  ? 438  ILE A C   1 
ATOM   5698  O  O   . ILE E  5  438  ? 46.075  77.848  138.807 1.00 69.27  ? 438  ILE A O   1 
ATOM   5699  C  CB  . ILE E  5  438  ? 46.066  75.345  136.671 1.00 48.19  ? 438  ILE A CB  1 
ATOM   5700  C  CG1 . ILE E  5  438  ? 45.736  75.091  135.202 1.00 51.74  ? 438  ILE A CG1 1 
ATOM   5701  C  CG2 . ILE E  5  438  ? 44.856  75.247  137.559 1.00 49.15  ? 438  ILE A CG2 1 
ATOM   5702  C  CD1 . ILE E  5  438  ? 44.728  73.986  134.949 1.00 49.97  ? 438  ILE A CD1 1 
ATOM   5703  N  N   . ASP E  5  439  ? 47.911  76.576  138.915 1.00 61.00  ? 439  ASP A N   1 
ATOM   5704  C  CA  . ASP E  5  439  ? 48.156  76.829  140.331 1.00 58.29  ? 439  ASP A CA  1 
ATOM   5705  C  C   . ASP E  5  439  ? 49.657  76.868  140.588 1.00 58.90  ? 439  ASP A C   1 
ATOM   5706  O  O   . ASP E  5  439  ? 50.295  75.823  140.743 1.00 53.31  ? 439  ASP A O   1 
ATOM   5707  C  CB  . ASP E  5  439  ? 47.517  75.724  141.179 1.00 64.11  ? 439  ASP A CB  1 
ATOM   5708  C  CG  . ASP E  5  439  ? 47.576  76.014  142.677 1.00 78.58  ? 439  ASP A CG  1 
ATOM   5709  O  OD1 . ASP E  5  439  ? 48.207  77.019  143.078 1.00 82.46  ? 439  ASP A OD1 1 
ATOM   5710  O  OD2 . ASP E  5  439  ? 46.986  75.230  143.453 1.00 82.52  ? 439  ASP A OD2 1 
ATOM   5711  N  N   . SER E  5  440  ? 50.223  78.068  140.658 1.00 64.17  ? 440  SER A N   1 
ATOM   5712  C  CA  . SER E  5  440  ? 51.679  78.199  140.734 1.00 66.06  ? 440  SER A CA  1 
ATOM   5713  C  C   . SER E  5  440  ? 52.274  77.544  141.983 1.00 67.59  ? 440  SER A C   1 
ATOM   5714  O  O   . SER E  5  440  ? 53.469  77.252  142.050 1.00 72.71  ? 440  SER A O   1 
ATOM   5715  C  CB  . SER E  5  440  ? 52.097  79.664  140.631 1.00 62.88  ? 440  SER A CB  1 
ATOM   5716  O  OG  . SER E  5  440  ? 51.493  80.434  141.645 1.00 62.95  ? 440  SER A OG  1 
ATOM   5717  N  N   . THR E  5  441  ? 51.416  77.313  142.963 1.00 66.73  ? 441  THR A N   1 
ATOM   5718  C  CA  . THR E  5  441  ? 51.772  76.635  144.197 1.00 64.50  ? 441  THR A CA  1 
ATOM   5719  C  C   . THR E  5  441  ? 52.194  75.211  143.947 1.00 64.07  ? 441  THR A C   1 
ATOM   5720  O  O   . THR E  5  441  ? 53.120  74.690  144.580 1.00 66.68  ? 441  THR A O   1 
ATOM   5721  C  CB  . THR E  5  441  ? 50.562  76.629  145.104 1.00 61.98  ? 441  THR A CB  1 
ATOM   5722  O  OG1 . THR E  5  441  ? 50.511  77.904  145.741 1.00 52.74  ? 441  THR A OG1 1 
ATOM   5723  C  CG2 . THR E  5  441  ? 50.611  75.492  146.143 1.00 66.23  ? 441  THR A CG2 1 
ATOM   5724  N  N   . LYS E  5  442  ? 51.502  74.585  143.009 1.00 64.09  ? 442  LYS A N   1 
ATOM   5725  C  CA  . LYS E  5  442  ? 51.757  73.194  142.731 1.00 66.81  ? 442  LYS A CA  1 
ATOM   5726  C  C   . LYS E  5  442  ? 52.864  73.019  141.676 1.00 70.61  ? 442  LYS A C   1 
ATOM   5727  O  O   . LYS E  5  442  ? 53.074  71.907  141.151 1.00 73.66  ? 442  LYS A O   1 
ATOM   5728  C  CB  . LYS E  5  442  ? 50.448  72.473  142.379 1.00 63.18  ? 442  LYS A CB  1 
ATOM   5729  C  CG  . LYS E  5  442  ? 49.467  72.397  143.562 1.00 62.78  ? 442  LYS A CG  1 
ATOM   5730  C  CD  . LYS E  5  442  ? 48.101  71.871  143.168 1.00 67.58  ? 442  LYS A CD  1 
ATOM   5731  C  CE  . LYS E  5  442  ? 47.221  71.652  144.393 1.00 71.57  ? 442  LYS A CE  1 
ATOM   5732  N  NZ  . LYS E  5  442  ? 47.343  70.260  144.953 1.00 78.36  ? 442  LYS A NZ  1 
ATOM   5733  N  N   . ALA E  5  443  ? 53.594  74.106  141.411 1.00 62.49  ? 443  ALA A N   1 
ATOM   5734  C  CA  . ALA E  5  443  ? 54.704  74.085  140.458 1.00 64.23  ? 443  ALA A CA  1 
ATOM   5735  C  C   . ALA E  5  443  ? 56.043  74.187  141.168 1.00 74.33  ? 443  ALA A C   1 
ATOM   5736  O  O   . ALA E  5  443  ? 56.154  74.857  142.201 1.00 73.72  ? 443  ALA A O   1 
ATOM   5737  C  CB  . ALA E  5  443  ? 54.568  75.208  139.456 1.00 57.50  ? 443  ALA A CB  1 
ATOM   5738  N  N   . GLN E  5  444  ? 57.054  73.527  140.603 1.00 82.99  ? 444  GLN A N   1 
ATOM   5739  C  CA  . GLN E  5  444  ? 58.397  73.556  141.157 1.00 95.93  ? 444  GLN A CA  1 
ATOM   5740  C  C   . GLN E  5  444  ? 58.994  74.926  140.915 1.00 107.13 ? 444  GLN A C   1 
ATOM   5741  O  O   . GLN E  5  444  ? 59.053  75.378  139.774 1.00 105.89 ? 444  GLN A O   1 
ATOM   5742  C  CB  . GLN E  5  444  ? 59.264  72.467  140.534 1.00 101.37 ? 444  GLN A CB  1 
ATOM   5743  C  CG  . GLN E  5  444  ? 58.873  71.061  140.969 1.00 113.21 ? 444  GLN A CG  1 
ATOM   5744  C  CD  . GLN E  5  444  ? 59.248  69.998  139.944 1.00 124.29 ? 444  GLN A CD  1 
ATOM   5745  O  OE1 . GLN E  5  444  ? 60.185  70.175  139.161 1.00 127.82 ? 444  GLN A OE1 1 
ATOM   5746  N  NE2 . GLN E  5  444  ? 58.505  68.890  139.937 1.00 124.45 ? 444  GLN A NE2 1 
ATOM   5747  N  N   . GLY E  5  445  ? 59.408  75.578  142.003 1.00 118.27 ? 445  GLY A N   1 
ATOM   5748  C  CA  . GLY E  5  445  ? 59.946  76.928  141.978 1.00 123.28 ? 445  GLY A CA  1 
ATOM   5749  C  C   . GLY E  5  445  ? 61.001  77.115  140.910 1.00 133.36 ? 445  GLY A C   1 
ATOM   5750  O  O   . GLY E  5  445  ? 61.972  76.357  140.843 1.00 133.48 ? 445  GLY A O   1 
ATOM   5751  N  N   . ARG E  5  446  ? 60.800  78.126  140.069 1.00 141.87 ? 446  ARG A N   1 
ATOM   5752  C  CA  . ARG E  5  446  ? 61.621  78.314  138.876 1.00 148.66 ? 446  ARG A CA  1 
ATOM   5753  C  C   . ARG E  5  446  ? 62.941  79.018  139.155 1.00 150.19 ? 446  ARG A C   1 
ATOM   5754  O  O   . ARG E  5  446  ? 62.981  79.979  139.929 1.00 147.44 ? 446  ARG A O   1 
ATOM   5755  C  CB  . ARG E  5  446  ? 60.841  79.064  137.779 1.00 151.18 ? 446  ARG A CB  1 
ATOM   5756  C  CG  . ARG E  5  446  ? 60.373  80.483  138.144 1.00 150.98 ? 446  ARG A CG  1 
ATOM   5757  C  CD  . ARG E  5  446  ? 59.742  81.196  136.936 1.00 150.92 ? 446  ARG A CD  1 
ATOM   5758  N  NE  . ARG E  5  446  ? 60.675  82.089  136.244 1.00 154.19 ? 446  ARG A NE  1 
ATOM   5759  C  CZ  . ARG E  5  446  ? 61.522  81.716  135.282 1.00 157.53 ? 446  ARG A CZ  1 
ATOM   5760  N  NH1 . ARG E  5  446  ? 61.577  80.452  134.875 1.00 158.11 ? 446  ARG A NH1 1 
ATOM   5761  N  NH2 . ARG E  5  446  ? 62.326  82.611  134.725 1.00 157.35 ? 446  ARG A NH2 1 
ATOM   5762  N  N   . THR E  5  447  ? 64.003  78.506  138.525 1.00 155.07 ? 447  THR A N   1 
ATOM   5763  C  CA  . THR E  5  447  ? 65.333  79.133  138.462 1.00 161.81 ? 447  THR A CA  1 
ATOM   5764  C  C   . THR E  5  447  ? 65.706  79.942  139.712 1.00 166.10 ? 447  THR A C   1 
ATOM   5765  O  O   . THR E  5  447  ? 66.209  81.066  139.597 1.00 167.60 ? 447  THR A O   1 
ATOM   5766  C  CB  . THR E  5  447  ? 65.472  80.036  137.191 1.00 125.28 ? 447  THR A CB  1 
ATOM   5767  O  OG1 . THR E  5  447  ? 64.683  79.500  136.117 1.00 126.25 ? 447  THR A OG1 1 
ATOM   5768  C  CG2 . THR E  5  447  ? 66.926  80.145  136.746 1.00 120.18 ? 447  THR A CG2 1 
ATOM   5769  N  N   . SER E  5  448  ? 65.449  79.345  140.885 1.00 165.82 ? 448  SER A N   1 
ATOM   5770  C  CA  . SER E  5  448  ? 65.541  79.983  142.219 1.00 162.72 ? 448  SER A CA  1 
ATOM   5771  C  C   . SER E  5  448  ? 65.752  81.502  142.239 1.00 161.45 ? 448  SER A C   1 
ATOM   5772  O  O   . SER E  5  448  ? 66.880  81.996  142.333 1.00 163.71 ? 448  SER A O   1 
ATOM   5773  C  CB  . SER E  5  448  ? 66.562  79.266  143.120 1.00 159.87 ? 448  SER A CB  1 
ATOM   5774  O  OG  . SER E  5  448  ? 65.998  78.091  143.693 1.00 155.25 ? 448  SER A OG  1 
ATOM   5775  N  N   . GLY E  5  449  ? 64.639  82.221  142.148 1.00 156.28 ? 449  GLY A N   1 
ATOM   5776  C  CA  . GLY E  5  449  ? 64.635  83.658  141.973 1.00 155.77 ? 449  GLY A CA  1 
ATOM   5777  C  C   . GLY E  5  449  ? 63.377  84.000  141.203 1.00 156.49 ? 449  GLY A C   1 
ATOM   5778  O  O   . GLY E  5  449  ? 62.349  83.347  141.388 1.00 156.05 ? 449  GLY A O   1 
ATOM   5779  N  N   . LYS E  5  450  ? 63.453  85.019  140.348 1.00 157.41 ? 450  LYS A N   1 
ATOM   5780  C  CA  . LYS E  5  450  ? 62.356  85.413  139.447 1.00 154.93 ? 450  LYS A CA  1 
ATOM   5781  C  C   . LYS E  5  450  ? 60.979  85.684  140.102 1.00 152.76 ? 450  LYS A C   1 
ATOM   5782  O  O   . LYS E  5  450  ? 60.231  86.549  139.629 1.00 155.05 ? 450  LYS A O   1 
ATOM   5783  C  CB  . LYS E  5  450  ? 62.191  84.391  138.308 1.00 152.81 ? 450  LYS A CB  1 
ATOM   5784  C  CG  . LYS E  5  450  ? 63.477  83.708  137.838 1.00 152.00 ? 450  LYS A CG  1 
ATOM   5785  C  CD  . LYS E  5  450  ? 64.365  84.620  137.016 1.00 150.82 ? 450  LYS A CD  1 
ATOM   5786  C  CE  . LYS E  5  450  ? 65.573  83.853  136.496 1.00 152.24 ? 450  LYS A CE  1 
ATOM   5787  N  NZ  . LYS E  5  450  ? 66.492  84.715  135.697 1.00 154.28 ? 450  LYS A NZ  1 
ATOM   5788  N  N   . VAL E  5  451  ? 60.663  84.951  141.176 1.00 145.61 ? 451  VAL A N   1 
ATOM   5789  C  CA  . VAL E  5  451  ? 59.310  84.868  141.754 1.00 136.74 ? 451  VAL A CA  1 
ATOM   5790  C  C   . VAL E  5  451  ? 58.296  84.302  140.753 1.00 127.84 ? 451  VAL A C   1 
ATOM   5791  O  O   . VAL E  5  451  ? 58.304  84.662  139.572 1.00 133.69 ? 451  VAL A O   1 
ATOM   5792  C  CB  . VAL E  5  451  ? 58.824  86.199  142.408 1.00 93.77  ? 451  VAL A CB  1 
ATOM   5793  C  CG1 . VAL E  5  451  ? 57.363  86.507  142.047 1.00 85.85  ? 451  VAL A CG1 1 
ATOM   5794  C  CG2 . VAL E  5  451  ? 59.015  86.138  143.923 1.00 94.14  ? 451  VAL A CG2 1 
ATOM   5795  N  N   . PRO E  5  452  ? 57.431  83.390  141.223 1.00 107.66 ? 452  PRO A N   1 
ATOM   5796  C  CA  . PRO E  5  452  ? 56.539  82.665  140.315 1.00 93.42  ? 452  PRO A CA  1 
ATOM   5797  C  C   . PRO E  5  452  ? 55.615  83.586  139.518 1.00 84.12  ? 452  PRO A C   1 
ATOM   5798  O  O   . PRO E  5  452  ? 55.272  84.680  139.971 1.00 85.19  ? 452  PRO A O   1 
ATOM   5799  C  CB  . PRO E  5  452  ? 55.719  81.790  141.269 1.00 88.22  ? 452  PRO A CB  1 
ATOM   5800  C  CG  . PRO E  5  452  ? 56.552  81.659  142.487 1.00 86.67  ? 452  PRO A CG  1 
ATOM   5801  C  CD  . PRO E  5  452  ? 57.244  82.973  142.622 1.00 97.30  ? 452  PRO A CD  1 
ATOM   5802  N  N   . ILE E  5  453  ? 55.239  83.145  138.324 1.00 76.16  ? 453  ILE A N   1 
ATOM   5803  C  CA  . ILE E  5  453  ? 54.209  83.821  137.559 1.00 69.64  ? 453  ILE A CA  1 
ATOM   5804  C  C   . ILE E  5  453  ? 52.868  83.237  137.998 1.00 67.67  ? 453  ILE A C   1 
ATOM   5805  O  O   . ILE E  5  453  ? 52.722  82.014  138.094 1.00 75.11  ? 453  ILE A O   1 
ATOM   5806  C  CB  . ILE E  5  453  ? 54.412  83.608  136.048 1.00 66.92  ? 453  ILE A CB  1 
ATOM   5807  C  CG1 . ILE E  5  453  ? 55.830  83.981  135.634 1.00 64.72  ? 453  ILE A CG1 1 
ATOM   5808  C  CG2 . ILE E  5  453  ? 53.435  84.419  135.251 1.00 72.26  ? 453  ILE A CG2 1 
ATOM   5809  C  CD1 . ILE E  5  453  ? 56.127  83.697  134.172 1.00 70.63  ? 453  ILE A CD1 1 
ATOM   5810  N  N   . PRO E  5  454  ? 51.889  84.110  138.276 1.00 57.61  ? 454  PRO A N   1 
ATOM   5811  C  CA  . PRO E  5  454  ? 50.564  83.707  138.758 1.00 55.58  ? 454  PRO A CA  1 
ATOM   5812  C  C   . PRO E  5  454  ? 49.863  82.778  137.794 1.00 56.64  ? 454  PRO A C   1 
ATOM   5813  O  O   . PRO E  5  454  ? 49.823  83.050  136.597 1.00 73.11  ? 454  PRO A O   1 
ATOM   5814  C  CB  . PRO E  5  454  ? 49.781  85.029  138.788 1.00 58.60  ? 454  PRO A CB  1 
ATOM   5815  C  CG  . PRO E  5  454  ? 50.803  86.090  138.828 1.00 59.94  ? 454  PRO A CG  1 
ATOM   5816  C  CD  . PRO E  5  454  ? 51.996  85.569  138.106 1.00 56.75  ? 454  PRO A CD  1 
ATOM   5817  N  N   . GLY E  5  455  ? 49.290  81.705  138.307 1.00 50.99  ? 455  GLY A N   1 
ATOM   5818  C  CA  . GLY E  5  455  ? 48.434  80.870  137.487 1.00 50.97  ? 455  GLY A CA  1 
ATOM   5819  C  C   . GLY E  5  455  ? 47.008  81.315  137.688 1.00 47.79  ? 455  GLY A C   1 
ATOM   5820  O  O   . GLY E  5  455  ? 46.764  82.231  138.461 1.00 48.49  ? 455  GLY A O   1 
ATOM   5821  N  N   . VAL E  5  456  ? 46.071  80.658  137.015 1.00 48.83  ? 456  VAL A N   1 
ATOM   5822  C  CA  . VAL E  5  456  ? 44.674  81.037  137.095 1.00 44.31  ? 456  VAL A CA  1 
ATOM   5823  C  C   . VAL E  5  456  ? 44.194  81.166  138.545 1.00 49.00  ? 456  VAL A C   1 
ATOM   5824  O  O   . VAL E  5  456  ? 43.575  82.165  138.901 1.00 47.02  ? 456  VAL A O   1 
ATOM   5825  C  CB  . VAL E  5  456  ? 43.803  80.083  136.290 1.00 47.76  ? 456  VAL A CB  1 
ATOM   5826  C  CG1 . VAL E  5  456  ? 42.342  80.549  136.295 1.00 47.18  ? 456  VAL A CG1 1 
ATOM   5827  C  CG2 . VAL E  5  456  ? 44.330  80.003  134.884 1.00 44.63  ? 456  VAL A CG2 1 
ATOM   5828  N  N   . LYS E  5  457  ? 44.521  80.196  139.389 1.00 47.72  ? 457  LYS A N   1 
ATOM   5829  C  CA  . LYS E  5  457  ? 44.113  80.271  140.795 1.00 53.19  ? 457  LYS A CA  1 
ATOM   5830  C  C   . LYS E  5  457  ? 44.522  81.609  141.421 1.00 57.25  ? 457  LYS A C   1 
ATOM   5831  O  O   . LYS E  5  457  ? 43.720  82.280  142.074 1.00 60.03  ? 457  LYS A O   1 
ATOM   5832  C  CB  . LYS E  5  457  ? 44.669  79.084  141.605 1.00 55.03  ? 457  LYS A CB  1 
ATOM   5833  C  CG  . LYS E  5  457  ? 44.244  79.021  143.087 1.00 57.08  ? 457  LYS A CG  1 
ATOM   5834  C  CD  . LYS E  5  457  ? 44.705  77.703  143.705 1.00 64.53  ? 457  LYS A CD  1 
ATOM   5835  C  CE  . LYS E  5  457  ? 44.035  77.397  145.040 1.00 65.78  ? 457  LYS A CE  1 
ATOM   5836  N  NZ  . LYS E  5  457  ? 44.600  78.207  146.143 1.00 68.59  ? 457  LYS A NZ  1 
ATOM   5837  N  N   . GLN E  5  458  ? 45.762  82.009  141.184 1.00 58.61  ? 458  GLN A N   1 
ATOM   5838  C  CA  . GLN E  5  458  ? 46.284  83.234  141.771 1.00 56.16  ? 458  GLN A CA  1 
ATOM   5839  C  C   . GLN E  5  458  ? 45.645  84.498  141.160 1.00 62.29  ? 458  GLN A C   1 
ATOM   5840  O  O   . GLN E  5  458  ? 45.480  85.497  141.848 1.00 70.28  ? 458  GLN A O   1 
ATOM   5841  C  CB  . GLN E  5  458  ? 47.803  83.260  141.673 1.00 53.75  ? 458  GLN A CB  1 
ATOM   5842  C  CG  . GLN E  5  458  ? 48.491  82.190  142.526 1.00 54.72  ? 458  GLN A CG  1 
ATOM   5843  C  CD  . GLN E  5  458  ? 48.293  80.751  142.022 1.00 68.59  ? 458  GLN A CD  1 
ATOM   5844  O  OE1 . GLN E  5  458  ? 48.204  80.506  140.815 1.00 77.64  ? 458  GLN A OE1 1 
ATOM   5845  N  NE2 . GLN E  5  458  ? 48.222  79.796  142.953 1.00 62.57  ? 458  GLN A NE2 1 
ATOM   5846  N  N   . ALA E  5  459  ? 45.262  84.447  139.887 1.00 54.39  ? 459  ALA A N   1 
ATOM   5847  C  CA  . ALA E  5  459  ? 44.519  85.543  139.280 1.00 52.37  ? 459  ALA A CA  1 
ATOM   5848  C  C   . ALA E  5  459  ? 43.147  85.738  139.955 1.00 60.61  ? 459  ALA A C   1 
ATOM   5849  O  O   . ALA E  5  459  ? 42.756  86.855  140.276 1.00 76.89  ? 459  ALA A O   1 
ATOM   5850  C  CB  . ALA E  5  459  ? 44.349  85.300  137.800 1.00 57.50  ? 459  ALA A CB  1 
ATOM   5851  N  N   . LEU E  5  460  ? 42.422  84.652  140.187 1.00 49.08  ? 460  LEU A N   1 
ATOM   5852  C  CA  . LEU E  5  460  ? 41.143  84.743  140.871 1.00 46.96  ? 460  LEU A CA  1 
ATOM   5853  C  C   . LEU E  5  460  ? 41.258  85.099  142.352 1.00 51.96  ? 460  LEU A C   1 
ATOM   5854  O  O   . LEU E  5  460  ? 40.304  85.610  142.945 1.00 45.23  ? 460  LEU A O   1 
ATOM   5855  C  CB  . LEU E  5  460  ? 40.394  83.431  140.749 1.00 42.03  ? 460  LEU A CB  1 
ATOM   5856  C  CG  . LEU E  5  460  ? 40.110  82.948  139.332 1.00 52.50  ? 460  LEU A CG  1 
ATOM   5857  C  CD1 . LEU E  5  460  ? 39.415  81.584  139.404 1.00 41.78  ? 460  LEU A CD1 1 
ATOM   5858  C  CD2 . LEU E  5  460  ? 39.309  83.958  138.538 1.00 41.78  ? 460  LEU A CD2 1 
ATOM   5859  N  N   . GLU E  5  461  ? 42.417  84.823  142.952 1.00 54.32  ? 461  GLU A N   1 
ATOM   5860  C  CA  . GLU E  5  461  ? 42.570  84.977  144.396 1.00 47.74  ? 461  GLU A CA  1 
ATOM   5861  C  C   . GLU E  5  461  ? 43.577  86.058  144.818 1.00 56.18  ? 461  GLU A C   1 
ATOM   5862  O  O   . GLU E  5  461  ? 43.841  86.227  146.004 1.00 66.20  ? 461  GLU A O   1 
ATOM   5863  C  CB  . GLU E  5  461  ? 42.897  83.625  145.045 1.00 50.44  ? 461  GLU A CB  1 
ATOM   5864  C  CG  . GLU E  5  461  ? 41.797  82.556  144.921 1.00 56.16  ? 461  GLU A CG  1 
ATOM   5865  C  CD  . GLU E  5  461  ? 42.105  81.274  145.710 1.00 68.36  ? 461  GLU A CD  1 
ATOM   5866  O  OE1 . GLU E  5  461  ? 43.160  81.245  146.397 1.00 81.31  ? 461  GLU A OE1 1 
ATOM   5867  O  OE2 . GLU E  5  461  ? 41.297  80.302  145.656 1.00 59.03  ? 461  GLU A OE2 1 
ATOM   5868  N  N   . LYS E  5  462  ? 44.111  86.803  143.853 1.00 62.27  ? 462  LYS A N   1 
ATOM   5869  C  CA  . LYS E  5  462  ? 45.001  87.939  144.128 1.00 66.76  ? 462  LYS A CA  1 
ATOM   5870  C  C   . LYS E  5  462  ? 44.381  88.916  145.134 1.00 65.97  ? 462  LYS A C   1 
ATOM   5871  O  O   . LYS E  5  462  ? 43.295  89.457  144.905 1.00 59.67  ? 462  LYS A O   1 
ATOM   5872  C  CB  . LYS E  5  462  ? 45.299  88.669  142.811 1.00 75.13  ? 462  LYS A CB  1 
ATOM   5873  C  CG  . LYS E  5  462  ? 46.274  89.828  142.885 1.00 83.21  ? 462  LYS A CG  1 
ATOM   5874  C  CD  . LYS E  5  462  ? 46.182  90.686  141.608 1.00 93.12  ? 462  LYS A CD  1 
ATOM   5875  C  CE  . LYS E  5  462  ? 46.618  92.152  141.860 1.00 137.05 ? 462  LYS A CE  1 
ATOM   5876  N  NZ  . LYS E  5  462  ? 46.230  93.125  140.778 1.00 131.84 ? 462  LYS A NZ  1 
ATOM   5877  N  N   . LYS E  5  463  ? 45.072  89.136  146.249 1.00 75.57  ? 463  LYS A N   1 
ATOM   5878  C  CA  . LYS E  5  463  ? 44.615  90.064  147.295 1.00 69.43  ? 463  LYS A CA  1 
ATOM   5879  C  C   . LYS E  5  463  ? 43.244  89.661  147.812 1.00 61.69  ? 463  LYS A C   1 
ATOM   5880  O  O   . LYS E  5  463  ? 43.039  88.505  148.186 1.00 72.26  ? 463  LYS A O   1 
ATOM   5881  C  CB  . LYS E  5  463  ? 44.627  91.509  146.786 1.00 73.67  ? 463  LYS A CB  1 
ATOM   5882  C  CG  . LYS E  5  463  ? 46.036  92.089  146.634 1.00 83.39  ? 463  LYS A CG  1 
ATOM   5883  C  CD  . LYS E  5  463  ? 46.096  93.235  145.625 1.00 96.25  ? 463  LYS A CD  1 
ATOM   5884  C  CE  . LYS E  5  463  ? 47.496  93.860  145.570 1.00 104.19 ? 463  LYS A CE  1 
ATOM   5885  N  NZ  . LYS E  5  463  ? 47.668  94.770  144.394 1.00 111.17 ? 463  LYS A NZ  1 
ATOM   5886  N  N   . GLU E  5  464  ? 42.297  90.591  147.814 1.00 50.76  ? 464  GLU A N   1 
ATOM   5887  C  CA  . GLU E  5  464  ? 40.930  90.260  148.208 1.00 48.85  ? 464  GLU A CA  1 
ATOM   5888  C  C   . GLU E  5  464  ? 40.246  89.320  147.216 1.00 55.90  ? 464  GLU A C   1 
ATOM   5889  O  O   . GLU E  5  464  ? 39.244  88.691  147.559 1.00 52.81  ? 464  GLU A O   1 
ATOM   5890  C  CB  . GLU E  5  464  ? 40.093  91.522  148.380 1.00 54.03  ? 464  GLU A CB  1 
ATOM   5891  C  CG  . GLU E  5  464  ? 40.512  92.391  149.552 1.00 59.29  ? 464  GLU A CG  1 
ATOM   5892  C  CD  . GLU E  5  464  ? 41.439  93.528  149.147 1.00 65.11  ? 464  GLU A CD  1 
ATOM   5893  O  OE1 . GLU E  5  464  ? 41.949  93.516  147.987 1.00 61.22  ? 464  GLU A OE1 1 
ATOM   5894  O  OE2 . GLU E  5  464  ? 41.638  94.433  150.000 1.00 69.49  ? 464  GLU A OE2 1 
ATOM   5895  N  N   . GLY E  5  465  ? 40.772  89.248  145.992 1.00 43.38  ? 465  GLY A N   1 
ATOM   5896  C  CA  . GLY E  5  465  ? 40.275  88.311  145.009 1.00 42.80  ? 465  GLY A CA  1 
ATOM   5897  C  C   . GLY E  5  465  ? 39.253  88.878  144.043 1.00 46.86  ? 465  GLY A C   1 
ATOM   5898  O  O   . GLY E  5  465  ? 38.550  89.819  144.381 1.00 50.78  ? 465  GLY A O   1 
ATOM   5899  N  N   . LEU E  5  466  ? 39.162  88.288  142.848 1.00 49.96  ? 466  LEU A N   1 
ATOM   5900  C  CA  . LEU E  5  466  ? 38.288  88.770  141.787 1.00 46.70  ? 466  LEU A CA  1 
ATOM   5901  C  C   . LEU E  5  466  ? 36.882  89.002  142.297 1.00 53.51  ? 466  LEU A C   1 
ATOM   5902  O  O   . LEU E  5  466  ? 36.278  90.028  142.013 1.00 56.11  ? 466  LEU A O   1 
ATOM   5903  C  CB  . LEU E  5  466  ? 38.246  87.767  140.634 1.00 41.70  ? 466  LEU A CB  1 
ATOM   5904  C  CG  . LEU E  5  466  ? 37.447  88.221  139.413 1.00 41.64  ? 466  LEU A CG  1 
ATOM   5905  C  CD1 . LEU E  5  466  ? 38.162  89.345  138.727 1.00 42.15  ? 466  LEU A CD1 1 
ATOM   5906  C  CD2 . LEU E  5  466  ? 37.191  87.100  138.451 1.00 41.47  ? 466  LEU A CD2 1 
ATOM   5907  N  N   . PHE E  5  467  ? 36.370  88.055  143.074 1.00 53.02  ? 467  PHE A N   1 
ATOM   5908  C  CA  . PHE E  5  467  ? 34.992  88.135  143.523 1.00 51.94  ? 467  PHE A CA  1 
ATOM   5909  C  C   . PHE E  5  467  ? 34.715  89.376  144.364 1.00 52.09  ? 467  PHE A C   1 
ATOM   5910  O  O   . PHE E  5  467  ? 33.708  90.052  144.157 1.00 54.11  ? 467  PHE A O   1 
ATOM   5911  C  CB  . PHE E  5  467  ? 34.581  86.857  144.254 1.00 40.78  ? 467  PHE A CB  1 
ATOM   5912  C  CG  . PHE E  5  467  ? 34.016  85.811  143.345 1.00 47.45  ? 467  PHE A CG  1 
ATOM   5913  C  CD1 . PHE E  5  467  ? 34.850  84.969  142.633 1.00 40.53  ? 467  PHE A CD1 1 
ATOM   5914  C  CD2 . PHE E  5  467  ? 32.660  85.674  143.189 1.00 40.29  ? 467  PHE A CD2 1 
ATOM   5915  C  CE1 . PHE E  5  467  ? 34.346  84.004  141.776 1.00 42.41  ? 467  PHE A CE1 1 
ATOM   5916  C  CE2 . PHE E  5  467  ? 32.147  84.711  142.334 1.00 48.55  ? 467  PHE A CE2 1 
ATOM   5917  C  CZ  . PHE E  5  467  ? 32.997  83.868  141.627 1.00 44.11  ? 467  PHE A CZ  1 
ATOM   5918  N  N   . ARG E  5  468  ? 35.611  89.681  145.299 1.00 42.16  ? 468  ARG A N   1 
ATOM   5919  C  CA  . ARG E  5  468  ? 35.370  90.766  146.213 1.00 46.22  ? 468  ARG A CA  1 
ATOM   5920  C  C   . ARG E  5  468  ? 35.737  92.126  145.614 1.00 52.37  ? 468  ARG A C   1 
ATOM   5921  O  O   . ARG E  5  468  ? 35.111  93.139  145.923 1.00 52.93  ? 468  ARG A O   1 
ATOM   5922  C  CB  . ARG E  5  468  ? 36.144  90.518  147.499 1.00 52.01  ? 468  ARG A CB  1 
ATOM   5923  C  CG  . ARG E  5  468  ? 35.576  89.415  148.333 1.00 42.20  ? 468  ARG A CG  1 
ATOM   5924  C  CD  . ARG E  5  468  ? 36.466  89.149  149.501 1.00 42.71  ? 468  ARG A CD  1 
ATOM   5925  N  NE  . ARG E  5  468  ? 36.408  90.214  150.488 1.00 56.57  ? 468  ARG A NE  1 
ATOM   5926  C  CZ  . ARG E  5  468  ? 37.361  90.462  151.379 1.00 53.51  ? 468  ARG A CZ  1 
ATOM   5927  N  NH1 . ARG E  5  468  ? 38.460  89.737  151.396 1.00 55.28  ? 468  ARG A NH1 1 
ATOM   5928  N  NH2 . ARG E  5  468  ? 37.220  91.450  152.239 1.00 60.29  ? 468  ARG A NH2 1 
ATOM   5929  N  N   . LYS E  5  469  ? 36.759  92.130  144.763 1.00 42.61  ? 469  LYS A N   1 
ATOM   5930  C  CA  . LYS E  5  469  ? 37.361  93.359  144.270 1.00 44.23  ? 469  LYS A CA  1 
ATOM   5931  C  C   . LYS E  5  469  ? 36.704  93.838  142.981 1.00 43.11  ? 469  LYS A C   1 
ATOM   5932  O  O   . LYS E  5  469  ? 36.662  95.034  142.710 1.00 53.89  ? 469  LYS A O   1 
ATOM   5933  C  CB  . LYS E  5  469  ? 38.873  93.161  144.089 1.00 49.17  ? 469  LYS A CB  1 
ATOM   5934  C  CG  . LYS E  5  469  ? 39.695  94.426  143.900 1.00 44.38  ? 469  LYS A CG  1 
ATOM   5935  C  CD  . LYS E  5  469  ? 40.972  94.376  144.712 1.00 70.70  ? 469  LYS A CD  1 
ATOM   5936  C  CE  . LYS E  5  469  ? 41.856  95.594  144.473 1.00 70.74  ? 469  LYS A CE  1 
ATOM   5937  N  NZ  . LYS E  5  469  ? 42.489  95.560  143.119 1.00 76.48  ? 469  LYS A NZ  1 
ATOM   5938  N  N   . HIS E  5  470  ? 36.144  92.911  142.213 1.00 54.59  ? 470  HIS A N   1 
ATOM   5939  C  CA  . HIS E  5  470  ? 35.513  93.255  140.935 1.00 49.66  ? 470  HIS A CA  1 
ATOM   5940  C  C   . HIS E  5  470  ? 34.107  92.692  140.724 1.00 42.15  ? 470  HIS A C   1 
ATOM   5941  O  O   . HIS E  5  470  ? 33.584  92.748  139.640 1.00 42.19  ? 470  HIS A O   1 
ATOM   5942  C  CB  . HIS E  5  470  ? 36.414  92.839  139.774 1.00 45.51  ? 470  HIS A CB  1 
ATOM   5943  C  CG  . HIS E  5  470  ? 37.725  93.544  139.760 1.00 50.71  ? 470  HIS A CG  1 
ATOM   5944  N  ND1 . HIS E  5  470  ? 38.850  93.041  140.378 1.00 63.67  ? 470  HIS A ND1 1 
ATOM   5945  C  CD2 . HIS E  5  470  ? 38.091  94.725  139.218 1.00 48.81  ? 470  HIS A CD2 1 
ATOM   5946  C  CE1 . HIS E  5  470  ? 39.856  93.880  140.209 1.00 61.44  ? 470  HIS A CE1 1 
ATOM   5947  N  NE2 . HIS E  5  470  ? 39.421  94.912  139.512 1.00 54.54  ? 470  HIS A NE2 1 
ATOM   5948  N  N   . MET E  5  471  ? 33.489  92.131  141.740 1.00 56.15  ? 471  MET A N   1 
ATOM   5949  C  CA  . MET E  5  471  ? 32.118  91.711  141.547 1.00 44.33  ? 471  MET A CA  1 
ATOM   5950  C  C   . MET E  5  471  ? 31.258  92.219  142.682 1.00 48.50  ? 471  MET A C   1 
ATOM   5951  O  O   . MET E  5  471  ? 30.248  92.855  142.440 1.00 59.23  ? 471  MET A O   1 
ATOM   5952  C  CB  . MET E  5  471  ? 31.992  90.200  141.426 1.00 41.07  ? 471  MET A CB  1 
ATOM   5953  C  CG  . MET E  5  471  ? 32.789  89.576  140.290 1.00 41.04  ? 471  MET A CG  1 
ATOM   5954  S  SD  . MET E  5  471  ? 32.435  87.829  140.245 1.00 57.98  ? 471  MET A SD  1 
ATOM   5955  C  CE  . MET E  5  471  ? 33.837  87.242  139.326 1.00 56.84  ? 471  MET A CE  1 
ATOM   5956  N  N   . MET E  5  472  ? 31.656  91.966  143.922 1.00 44.26  ? 472  MET A N   1 
ATOM   5957  C  CA  . MET E  5  472  ? 30.911  92.485  145.059 1.00 41.84  ? 472  MET A CA  1 
ATOM   5958  C  C   . MET E  5  472  ? 31.119  93.990  145.210 1.00 60.65  ? 472  MET A C   1 
ATOM   5959  O  O   . MET E  5  472  ? 30.403  94.650  145.962 1.00 59.70  ? 472  MET A O   1 
ATOM   5960  C  CB  . MET E  5  472  ? 31.351  91.795  146.335 1.00 41.78  ? 472  MET A CB  1 
ATOM   5961  C  CG  . MET E  5  472  ? 31.217  90.283  146.313 1.00 54.95  ? 472  MET A CG  1 
ATOM   5962  S  SD  . MET E  5  472  ? 29.531  89.666  146.231 1.00 49.00  ? 472  MET A SD  1 
ATOM   5963  C  CE  . MET E  5  472  ? 29.454  89.168  144.512 1.00 49.80  ? 472  MET A CE  1 
ATOM   5964  N  N   . GLY E  5  473  ? 32.103  94.526  144.499 1.00 42.69  ? 473  GLY A N   1 
ATOM   5965  C  CA  . GLY E  5  473  ? 32.401  95.933  144.538 1.00 43.39  ? 473  GLY A CA  1 
ATOM   5966  C  C   . GLY E  5  473  ? 33.043  96.227  143.216 1.00 67.30  ? 473  GLY A C   1 
ATOM   5967  O  O   . GLY E  5  473  ? 33.635  95.331  142.661 1.00 43.16  ? 473  GLY A O   1 
ATOM   5968  N  N   . LYS E  5  474  ? 32.917  97.460  142.723 1.00 44.18  ? 474  LYS A N   1 
ATOM   5969  C  CA  . LYS E  5  474  ? 33.362  97.854  141.376 1.00 44.49  ? 474  LYS A CA  1 
ATOM   5970  C  C   . LYS E  5  474  ? 33.663  99.342  141.338 1.00 46.12  ? 474  LYS A C   1 
ATOM   5971  O  O   . LYS E  5  474  ? 33.177  100.099 142.163 1.00 45.85  ? 474  LYS A O   1 
ATOM   5972  C  CB  . LYS E  5  474  ? 32.281  97.560  140.344 1.00 44.29  ? 474  LYS A CB  1 
ATOM   5973  C  CG  . LYS E  5  474  ? 32.198  96.133  139.905 1.00 43.55  ? 474  LYS A CG  1 
ATOM   5974  C  CD  . LYS E  5  474  ? 30.835  95.765  139.392 1.00 43.38  ? 474  LYS A CD  1 
ATOM   5975  C  CE  . LYS E  5  474  ? 30.862  94.340  138.893 1.00 42.78  ? 474  LYS A CE  1 
ATOM   5976  N  NZ  . LYS E  5  474  ? 29.529  93.760  138.622 1.00 54.50  ? 474  LYS A NZ  1 
ATOM   5977  N  N   . ARG E  5  475  ? 34.492  99.763  140.398 1.00 45.90  ? 475  ARG A N   1 
ATOM   5978  C  CA  . ARG E  5  475  ? 34.627  101.171 140.128 1.00 46.91  ? 475  ARG A CA  1 
ATOM   5979  C  C   . ARG E  5  475  ? 33.475  101.477 139.182 1.00 47.09  ? 475  ARG A C   1 
ATOM   5980  O  O   . ARG E  5  475  ? 33.084  100.641 138.403 1.00 46.57  ? 475  ARG A O   1 
ATOM   5981  C  CB  . ARG E  5  475  ? 35.990  101.493 139.538 1.00 47.46  ? 475  ARG A CB  1 
ATOM   5982  C  CG  . ARG E  5  475  ? 37.066  101.452 140.583 1.00 47.59  ? 475  ARG A CG  1 
ATOM   5983  C  CD  . ARG E  5  475  ? 38.436  101.904 140.081 1.00 48.35  ? 475  ARG A CD  1 
ATOM   5984  N  NE  . ARG E  5  475  ? 39.459  101.879 141.134 1.00 48.61  ? 475  ARG A NE  1 
ATOM   5985  C  CZ  . ARG E  5  475  ? 39.579  102.806 142.089 1.00 64.56  ? 475  ARG A CZ  1 
ATOM   5986  N  NH1 . ARG E  5  475  ? 38.739  103.826 142.148 1.00 60.64  ? 475  ARG A NH1 1 
ATOM   5987  N  NH2 . ARG E  5  475  ? 40.530  102.728 143.005 1.00 72.27  ? 475  ARG A NH2 1 
ATOM   5988  N  N   . VAL E  5  476  ? 32.876  102.650 139.284 1.00 47.90  ? 476  VAL A N   1 
ATOM   5989  C  CA  . VAL E  5  476  ? 31.680  102.912 138.509 1.00 48.15  ? 476  VAL A CA  1 
ATOM   5990  C  C   . VAL E  5  476  ? 31.785  104.159 137.684 1.00 50.27  ? 476  VAL A C   1 
ATOM   5991  O  O   . VAL E  5  476  ? 32.663  104.981 137.891 1.00 51.48  ? 476  VAL A O   1 
ATOM   5992  C  CB  . VAL E  5  476  ? 30.482  103.097 139.393 1.00 48.12  ? 476  VAL A CB  1 
ATOM   5993  C  CG1 . VAL E  5  476  ? 30.219  101.834 140.129 1.00 56.97  ? 476  VAL A CG1 1 
ATOM   5994  C  CG2 . VAL E  5  476  ? 30.746  104.226 140.376 1.00 54.16  ? 476  VAL A CG2 1 
ATOM   5995  N  N   . ASN E  5  477  ? 30.862  104.273 136.742 1.00 44.26  ? 477  ASN A N   1 
ATOM   5996  C  CA  . ASN E  5  477  ? 30.689  105.466 135.941 1.00 45.81  ? 477  ASN A CA  1 
ATOM   5997  C  C   . ASN E  5  477  ? 29.816  106.465 136.679 1.00 45.49  ? 477  ASN A C   1 
ATOM   5998  O  O   . ASN E  5  477  ? 29.131  106.114 137.630 1.00 45.04  ? 477  ASN A O   1 
ATOM   5999  C  CB  . ASN E  5  477  ? 30.017  105.106 134.614 1.00 49.03  ? 477  ASN A CB  1 
ATOM   6000  C  CG  . ASN E  5  477  ? 30.972  104.497 133.617 1.00 45.45  ? 477  ASN A CG  1 
ATOM   6001  O  OD1 . ASN E  5  477  ? 32.165  104.755 133.644 1.00 60.22  ? 477  ASN A OD1 1 
ATOM   6002  N  ND2 . ASN E  5  477  ? 30.443  103.708 132.717 1.00 45.78  ? 477  ASN A ND2 1 
ATOM   6003  N  N   . TYR E  5  478  ? 29.832  107.709 136.233 1.00 44.12  ? 478  TYR A N   1 
ATOM   6004  C  CA  . TYR E  5  478  ? 28.882  108.698 136.719 1.00 45.22  ? 478  TYR A CA  1 
ATOM   6005  C  C   . TYR E  5  478  ? 28.939  108.961 138.209 1.00 49.91  ? 478  TYR A C   1 
ATOM   6006  O  O   . TYR E  5  478  ? 27.936  108.838 138.910 1.00 42.68  ? 478  TYR A O   1 
ATOM   6007  C  CB  . TYR E  5  478  ? 27.461  108.339 136.277 1.00 43.66  ? 478  TYR A CB  1 
ATOM   6008  C  CG  . TYR E  5  478  ? 27.312  108.377 134.777 1.00 44.40  ? 478  TYR A CG  1 
ATOM   6009  C  CD1 . TYR E  5  478  ? 27.273  109.596 134.092 1.00 55.04  ? 478  TYR A CD1 1 
ATOM   6010  C  CD2 . TYR E  5  478  ? 27.239  107.211 134.031 1.00 44.59  ? 478  TYR A CD2 1 
ATOM   6011  C  CE1 . TYR E  5  478  ? 27.145  109.650 132.697 1.00 46.36  ? 478  TYR A CE1 1 
ATOM   6012  C  CE2 . TYR E  5  478  ? 27.102  107.251 132.646 1.00 49.45  ? 478  TYR A CE2 1 
ATOM   6013  C  CZ  . TYR E  5  478  ? 27.060  108.466 131.983 1.00 46.15  ? 478  TYR A CZ  1 
ATOM   6014  O  OH  . TYR E  5  478  ? 26.926  108.504 130.610 1.00 51.41  ? 478  TYR A OH  1 
ATOM   6015  N  N   . ALA E  5  479  ? 30.110  109.357 138.683 1.00 43.43  ? 479  ALA A N   1 
ATOM   6016  C  CA  . ALA E  5  479  ? 30.265  109.659 140.091 1.00 42.99  ? 479  ALA A CA  1 
ATOM   6017  C  C   . ALA E  5  479  ? 31.410  110.603 140.262 1.00 50.60  ? 479  ALA A C   1 
ATOM   6018  O  O   . ALA E  5  479  ? 32.178  110.786 139.334 1.00 44.18  ? 479  ALA A O   1 
ATOM   6019  C  CB  . ALA E  5  479  ? 30.507  108.413 140.894 1.00 42.49  ? 479  ALA A CB  1 
ATOM   6020  N  N   . ALA E  5  480  ? 31.525  111.190 141.449 1.00 43.33  ? 480  ALA A N   1 
ATOM   6021  C  CA  . ALA E  5  480  ? 32.567  112.169 141.710 1.00 51.04  ? 480  ALA A CA  1 
ATOM   6022  C  C   . ALA E  5  480  ? 33.046  112.081 143.165 1.00 51.35  ? 480  ALA A C   1 
ATOM   6023  O  O   . ALA E  5  480  ? 32.383  111.463 144.008 1.00 42.97  ? 480  ALA A O   1 
ATOM   6024  C  CB  . ALA E  5  480  ? 32.061  113.590 141.370 1.00 44.33  ? 480  ALA A CB  1 
ATOM   6025  N  N   . ARG E  5  481  ? 34.190  112.693 143.460 1.00 44.22  ? 481  ARG A N   1 
ATOM   6026  C  CA  . ARG E  5  481  ? 34.713  112.709 144.814 1.00 56.08  ? 481  ARG A CA  1 
ATOM   6027  C  C   . ARG E  5  481  ? 35.275  114.080 145.106 1.00 44.83  ? 481  ARG A C   1 
ATOM   6028  O  O   . ARG E  5  481  ? 35.854  114.706 144.234 1.00 45.54  ? 481  ARG A O   1 
ATOM   6029  C  CB  . ARG E  5  481  ? 35.785  111.638 145.012 1.00 44.20  ? 481  ARG A CB  1 
ATOM   6030  C  CG  . ARG E  5  481  ? 36.508  111.733 146.351 1.00 71.41  ? 481  ARG A CG  1 
ATOM   6031  C  CD  . ARG E  5  481  ? 37.515  110.586 146.587 1.00 44.41  ? 481  ARG A CD  1 
ATOM   6032  N  NE  . ARG E  5  481  ? 36.928  109.568 147.446 1.00 51.77  ? 481  ARG A NE  1 
ATOM   6033  C  CZ  . ARG E  5  481  ? 37.414  109.225 148.628 1.00 61.63  ? 481  ARG A CZ  1 
ATOM   6034  N  NH1 . ARG E  5  481  ? 38.520  109.800 149.066 1.00 44.35  ? 481  ARG A NH1 1 
ATOM   6035  N  NH2 . ARG E  5  481  ? 36.806  108.294 149.363 1.00 67.59  ? 481  ARG A NH2 1 
ATOM   6036  N  N   . SER E  5  482  ? 35.092  114.555 146.330 1.00 70.69  ? 482  SER A N   1 
ATOM   6037  C  CA  . SER E  5  482  ? 35.598  115.858 146.716 1.00 45.45  ? 482  SER A CA  1 
ATOM   6038  C  C   . SER E  5  482  ? 35.737  115.950 148.211 1.00 53.82  ? 482  SER A C   1 
ATOM   6039  O  O   . SER E  5  482  ? 35.053  115.252 148.935 1.00 44.65  ? 482  SER A O   1 
ATOM   6040  C  CB  . SER E  5  482  ? 34.625  116.938 146.263 1.00 53.36  ? 482  SER A CB  1 
ATOM   6041  O  OG  . SER E  5  482  ? 34.991  118.211 146.757 1.00 54.75  ? 482  SER A OG  1 
ATOM   6042  N  N   . VAL E  5  483  ? 36.639  116.798 148.676 1.00 46.16  ? 483  VAL A N   1 
ATOM   6043  C  CA  . VAL E  5  483  ? 36.556  117.308 150.042 1.00 49.28  ? 483  VAL A CA  1 
ATOM   6044  C  C   . VAL E  5  483  ? 35.181  117.960 150.334 1.00 52.83  ? 483  VAL A C   1 
ATOM   6045  O  O   . VAL E  5  483  ? 34.626  118.677 149.491 1.00 57.26  ? 483  VAL A O   1 
ATOM   6046  C  CB  . VAL E  5  483  ? 37.630  118.361 150.257 1.00 48.30  ? 483  VAL A CB  1 
ATOM   6047  C  CG1 . VAL E  5  483  ? 37.352  119.169 151.502 1.00 57.46  ? 483  VAL A CG1 1 
ATOM   6048  C  CG2 . VAL E  5  483  ? 38.969  117.686 150.345 1.00 49.54  ? 483  VAL A CG2 1 
ATOM   6049  N  N   . ILE E  5  484  ? 34.620  117.709 151.514 1.00 47.12  ? 484  ILE A N   1 
ATOM   6050  C  CA  . ILE E  5  484  ? 33.390  118.388 151.888 1.00 46.82  ? 484  ILE A CA  1 
ATOM   6051  C  C   . ILE E  5  484  ? 33.643  119.640 152.748 1.00 46.63  ? 484  ILE A C   1 
ATOM   6052  O  O   . ILE E  5  484  ? 34.634  119.726 153.460 1.00 55.54  ? 484  ILE A O   1 
ATOM   6053  C  CB  . ILE E  5  484  ? 32.412  117.444 152.591 1.00 44.48  ? 484  ILE A CB  1 
ATOM   6054  C  CG1 . ILE E  5  484  ? 33.058  116.819 153.822 1.00 50.04  ? 484  ILE A CG1 1 
ATOM   6055  C  CG2 . ILE E  5  484  ? 31.961  116.350 151.654 1.00 47.21  ? 484  ILE A CG2 1 
ATOM   6056  C  CD1 . ILE E  5  484  ? 32.041  116.143 154.759 1.00 49.45  ? 484  ILE A CD1 1 
ATOM   6057  N  N   . SER E  5  485  ? 32.744  120.614 152.627 1.00 50.60  ? 485  SER A N   1 
ATOM   6058  C  CA  . SER E  5  485  ? 32.767  121.858 153.406 1.00 56.62  ? 485  SER A CA  1 
ATOM   6059  C  C   . SER E  5  485  ? 31.386  122.119 153.984 1.00 55.03  ? 485  SER A C   1 
ATOM   6060  O  O   . SER E  5  485  ? 30.380  121.737 153.391 1.00 52.06  ? 485  SER A O   1 
ATOM   6061  C  CB  . SER E  5  485  ? 33.157  123.030 152.528 1.00 48.15  ? 485  SER A CB  1 
ATOM   6062  O  OG  . SER E  5  485  ? 34.367  122.751 151.880 1.00 62.81  ? 485  SER A OG  1 
ATOM   6063  N  N   . PRO E  5  486  ? 31.322  122.767 155.147 1.00 47.48  ? 486  PRO A N   1 
ATOM   6064  C  CA  . PRO E  5  486  ? 30.008  122.949 155.764 1.00 59.44  ? 486  PRO A CA  1 
ATOM   6065  C  C   . PRO E  5  486  ? 29.198  124.056 155.085 1.00 59.40  ? 486  PRO A C   1 
ATOM   6066  O  O   . PRO E  5  486  ? 29.771  124.995 154.518 1.00 48.52  ? 486  PRO A O   1 
ATOM   6067  C  CB  . PRO E  5  486  ? 30.354  123.316 157.210 1.00 56.88  ? 486  PRO A CB  1 
ATOM   6068  C  CG  . PRO E  5  486  ? 31.688  123.918 157.138 1.00 48.71  ? 486  PRO A CG  1 
ATOM   6069  C  CD  . PRO E  5  486  ? 32.405  123.315 155.973 1.00 55.02  ? 486  PRO A CD  1 
ATOM   6070  N  N   . ASP E  5  487  ? 27.876  123.930 155.120 1.00 54.13  ? 487  ASP A N   1 
ATOM   6071  C  CA  . ASP E  5  487  ? 27.012  124.983 154.615 1.00 52.24  ? 487  ASP A CA  1 
ATOM   6072  C  C   . ASP E  5  487  ? 25.701  125.000 155.356 1.00 48.86  ? 487  ASP A C   1 
ATOM   6073  O  O   . ASP E  5  487  ? 24.960  124.038 155.260 1.00 48.40  ? 487  ASP A O   1 
ATOM   6074  C  CB  . ASP E  5  487  ? 26.718  124.755 153.149 1.00 60.37  ? 487  ASP A CB  1 
ATOM   6075  C  CG  . ASP E  5  487  ? 26.275  126.013 152.455 1.00 67.60  ? 487  ASP A CG  1 
ATOM   6076  O  OD1 . ASP E  5  487  ? 25.604  126.855 153.092 1.00 64.06  ? 487  ASP A OD1 1 
ATOM   6077  O  OD2 . ASP E  5  487  ? 26.635  126.177 151.275 1.00 75.42  ? 487  ASP A OD2 1 
ATOM   6078  N  N   . PRO E  5  488  ? 25.394  126.099 156.085 1.00 53.08  ? 488  PRO A N   1 
ATOM   6079  C  CA  . PRO E  5  488  ? 24.117  126.162 156.809 1.00 51.72  ? 488  PRO A CA  1 
ATOM   6080  C  C   . PRO E  5  488  ? 22.970  126.615 155.910 1.00 54.43  ? 488  PRO A C   1 
ATOM   6081  O  O   . PRO E  5  488  ? 21.814  126.517 156.307 1.00 59.84  ? 488  PRO A O   1 
ATOM   6082  C  CB  . PRO E  5  488  ? 24.388  127.197 157.899 1.00 49.59  ? 488  PRO A CB  1 
ATOM   6083  C  CG  . PRO E  5  488  ? 25.351  128.086 157.300 1.00 50.36  ? 488  PRO A CG  1 
ATOM   6084  C  CD  . PRO E  5  488  ? 26.226  127.274 156.381 1.00 49.68  ? 488  PRO A CD  1 
ATOM   6085  N  N   . ASN E  5  489  ? 23.293  127.059 154.700 1.00 59.58  ? 489  ASN A N   1 
ATOM   6086  C  CA  . ASN E  5  489  ? 22.318  127.682 153.807 1.00 60.39  ? 489  ASN A CA  1 
ATOM   6087  C  C   . ASN E  5  489  ? 21.710  126.769 152.753 1.00 60.03  ? 489  ASN A C   1 
ATOM   6088  O  O   . ASN E  5  489  ? 20.913  127.216 151.930 1.00 73.18  ? 489  ASN A O   1 
ATOM   6089  C  CB  . ASN E  5  489  ? 22.934  128.911 153.147 1.00 50.21  ? 489  ASN A CB  1 
ATOM   6090  C  CG  . ASN E  5  489  ? 23.204  130.002 154.140 1.00 63.81  ? 489  ASN A CG  1 
ATOM   6091  O  OD1 . ASN E  5  489  ? 22.328  130.349 154.924 1.00 70.65  ? 489  ASN A OD1 1 
ATOM   6092  N  ND2 . ASN E  5  489  ? 24.424  130.530 154.145 1.00 57.90  ? 489  ASN A ND2 1 
ATOM   6093  N  N   . ILE E  5  490  ? 22.082  125.498 152.757 1.00 53.64  ? 490  ILE A N   1 
ATOM   6094  C  CA  . ILE E  5  490  ? 21.359  124.542 151.935 1.00 46.64  ? 490  ILE A CA  1 
ATOM   6095  C  C   . ILE E  5  490  ? 20.429  123.756 152.846 1.00 56.72  ? 490  ILE A C   1 
ATOM   6096  O  O   . ILE E  5  490  ? 20.576  123.796 154.077 1.00 53.17  ? 490  ILE A O   1 
ATOM   6097  C  CB  . ILE E  5  490  ? 22.285  123.591 151.162 1.00 58.41  ? 490  ILE A CB  1 
ATOM   6098  C  CG1 . ILE E  5  490  ? 23.227  122.856 152.105 1.00 52.46  ? 490  ILE A CG1 1 
ATOM   6099  C  CG2 . ILE E  5  490  ? 23.094  124.342 150.131 1.00 46.61  ? 490  ILE A CG2 1 
ATOM   6100  C  CD1 . ILE E  5  490  ? 24.047  121.837 151.397 1.00 53.79  ? 490  ILE A CD1 1 
ATOM   6101  N  N   . GLU E  5  491  ? 19.456  123.069 152.255 1.00 45.61  ? 491  GLU A N   1 
ATOM   6102  C  CA  . GLU E  5  491  ? 18.524  122.283 153.047 1.00 57.01  ? 491  GLU A CA  1 
ATOM   6103  C  C   . GLU E  5  491  ? 19.241  121.074 153.647 1.00 57.78  ? 491  GLU A C   1 
ATOM   6104  O  O   . GLU E  5  491  ? 20.272  120.617 153.142 1.00 58.19  ? 491  GLU A O   1 
ATOM   6105  C  CB  . GLU E  5  491  ? 17.309  121.858 152.216 1.00 59.93  ? 491  GLU A CB  1 
ATOM   6106  C  CG  . GLU E  5  491  ? 16.539  123.022 151.575 1.00 67.74  ? 491  GLU A CG  1 
ATOM   6107  C  CD  . GLU E  5  491  ? 15.588  123.745 152.533 1.00 82.48  ? 491  GLU A CD  1 
ATOM   6108  O  OE1 . GLU E  5  491  ? 14.464  123.244 152.779 1.00 89.95  ? 491  GLU A OE1 1 
ATOM   6109  O  OE2 . GLU E  5  491  ? 15.957  124.833 153.030 1.00 87.84  ? 491  GLU A OE2 1 
ATOM   6110  N  N   . THR E  5  492  ? 18.699  120.572 154.744 1.00 50.78  ? 492  THR A N   1 
ATOM   6111  C  CA  . THR E  5  492  ? 19.293  119.438 155.392 1.00 47.87  ? 492  THR A CA  1 
ATOM   6112  C  C   . THR E  5  492  ? 19.230  118.186 154.519 1.00 50.10  ? 492  THR A C   1 
ATOM   6113  O  O   . THR E  5  492  ? 19.880  117.192 154.832 1.00 57.14  ? 492  THR A O   1 
ATOM   6114  C  CB  . THR E  5  492  ? 18.651  119.191 156.764 1.00 53.37  ? 492  THR A CB  1 
ATOM   6115  O  OG1 . THR E  5  492  ? 17.271  118.813 156.610 1.00 50.23  ? 492  THR A OG1 1 
ATOM   6116  C  CG2 . THR E  5  492  ? 18.778  120.461 157.617 1.00 48.88  ? 492  THR A CG2 1 
ATOM   6117  N  N   . ASN E  5  493  ? 18.463  118.232 153.429 1.00 42.74  ? 493  ASN A N   1 
ATOM   6118  C  CA  . ASN E  5  493  ? 18.356  117.078 152.535 1.00 42.13  ? 493  ASN A CA  1 
ATOM   6119  C  C   . ASN E  5  493  ? 18.977  117.263 151.155 1.00 52.48  ? 493  ASN A C   1 
ATOM   6120  O  O   . ASN E  5  493  ? 18.778  116.432 150.252 1.00 50.75  ? 493  ASN A O   1 
ATOM   6121  C  CB  . ASN E  5  493  ? 16.915  116.625 152.386 1.00 49.67  ? 493  ASN A CB  1 
ATOM   6122  C  CG  . ASN E  5  493  ? 16.027  117.684 151.822 1.00 52.06  ? 493  ASN A CG  1 
ATOM   6123  O  OD1 . ASN E  5  493  ? 16.490  118.699 151.314 1.00 59.75  ? 493  ASN A OD1 1 
ATOM   6124  N  ND2 . ASN E  5  493  ? 14.728  117.457 151.907 1.00 58.75  ? 493  ASN A ND2 1 
ATOM   6125  N  N   . GLU E  5  494  ? 19.723  118.357 151.013 1.00 49.12  ? 494  GLU A N   1 
ATOM   6126  C  CA  . GLU E  5  494  ? 20.384  118.722 149.772 1.00 47.04  ? 494  GLU A CA  1 
ATOM   6127  C  C   . GLU E  5  494  ? 21.885  118.430 149.865 1.00 47.06  ? 494  GLU A C   1 
ATOM   6128  O  O   . GLU E  5  494  ? 22.390  118.018 150.908 1.00 44.91  ? 494  GLU A O   1 
ATOM   6129  C  CB  . GLU E  5  494  ? 20.145  120.210 149.447 1.00 43.88  ? 494  GLU A CB  1 
ATOM   6130  C  CG  . GLU E  5  494  ? 18.751  120.502 148.903 1.00 77.17  ? 494  GLU A CG  1 
ATOM   6131  C  CD  . GLU E  5  494  ? 18.469  121.995 148.614 1.00 75.59  ? 494  GLU A CD  1 
ATOM   6132  O  OE1 . GLU E  5  494  ? 18.932  122.876 149.377 1.00 72.89  ? 494  GLU A OE1 1 
ATOM   6133  O  OE2 . GLU E  5  494  ? 17.755  122.283 147.622 1.00 73.39  ? 494  GLU A OE2 1 
ATOM   6134  N  N   . ILE E  5  495  ? 22.578  118.634 148.754 1.00 43.12  ? 495  ILE A N   1 
ATOM   6135  C  CA  . ILE E  5  495  ? 24.026  118.583 148.698 1.00 43.22  ? 495  ILE A CA  1 
ATOM   6136  C  C   . ILE E  5  495  ? 24.462  119.656 147.711 1.00 49.60  ? 495  ILE A C   1 
ATOM   6137  O  O   . ILE E  5  495  ? 23.914  119.769 146.611 1.00 48.03  ? 495  ILE A O   1 
ATOM   6138  C  CB  . ILE E  5  495  ? 24.563  117.163 148.254 1.00 51.03  ? 495  ILE A CB  1 
ATOM   6139  C  CG1 . ILE E  5  495  ? 26.083  117.122 148.232 1.00 46.71  ? 495  ILE A CG1 1 
ATOM   6140  C  CG2 . ILE E  5  495  ? 24.068  116.770 146.887 1.00 42.54  ? 495  ILE A CG2 1 
ATOM   6141  C  CD1 . ILE E  5  495  ? 26.692  117.215 149.608 1.00 52.64  ? 495  ILE A CD1 1 
ATOM   6142  N  N   . GLY E  5  496  ? 25.440  120.456 148.101 1.00 44.52  ? 496  GLY A N   1 
ATOM   6143  C  CA  . GLY E  5  496  ? 25.879  121.545 147.253 1.00 59.03  ? 496  GLY A CA  1 
ATOM   6144  C  C   . GLY E  5  496  ? 26.882  121.048 146.245 1.00 51.08  ? 496  GLY A C   1 
ATOM   6145  O  O   . GLY E  5  496  ? 27.965  120.630 146.629 1.00 46.84  ? 496  GLY A O   1 
ATOM   6146  N  N   . VAL E  5  497  ? 26.525  121.099 144.964 1.00 45.53  ? 497  VAL A N   1 
ATOM   6147  C  CA  . VAL E  5  497  ? 27.344  120.502 143.918 1.00 47.78  ? 497  VAL A CA  1 
ATOM   6148  C  C   . VAL E  5  497  ? 28.096  121.569 143.165 1.00 47.32  ? 497  VAL A C   1 
ATOM   6149  O  O   . VAL E  5  497  ? 27.485  122.515 142.681 1.00 52.53  ? 497  VAL A O   1 
ATOM   6150  C  CB  . VAL E  5  497  ? 26.483  119.785 142.892 1.00 51.62  ? 497  VAL A CB  1 
ATOM   6151  C  CG1 . VAL E  5  497  ? 27.365  119.087 141.875 1.00 45.30  ? 497  VAL A CG1 1 
ATOM   6152  C  CG2 . VAL E  5  497  ? 25.561  118.813 143.579 1.00 44.40  ? 497  VAL A CG2 1 
ATOM   6153  N  N   . PRO E  5  498  ? 29.429  121.426 143.060 1.00 46.80  ? 498  PRO A N   1 
ATOM   6154  C  CA  . PRO E  5  498  ? 30.213  122.388 142.286 1.00 47.79  ? 498  PRO A CA  1 
ATOM   6155  C  C   . PRO E  5  498  ? 29.990  122.209 140.810 1.00 48.02  ? 498  PRO A C   1 
ATOM   6156  O  O   . PRO E  5  498  ? 29.845  121.089 140.356 1.00 72.26  ? 498  PRO A O   1 
ATOM   6157  C  CB  . PRO E  5  498  ? 31.661  122.063 142.677 1.00 47.96  ? 498  PRO A CB  1 
ATOM   6158  C  CG  . PRO E  5  498  ? 31.628  120.734 143.197 1.00 47.04  ? 498  PRO A CG  1 
ATOM   6159  C  CD  . PRO E  5  498  ? 30.300  120.534 143.833 1.00 46.35  ? 498  PRO A CD  1 
ATOM   6160  N  N   . PRO E  5  499  ? 29.948  123.320 140.070 1.00 65.87  ? 499  PRO A N   1 
ATOM   6161  C  CA  . PRO E  5  499  ? 29.627  123.376 138.644 1.00 60.89  ? 499  PRO A CA  1 
ATOM   6162  C  C   . PRO E  5  499  ? 30.587  122.518 137.847 1.00 59.18  ? 499  PRO A C   1 
ATOM   6163  O  O   . PRO E  5  499  ? 30.205  121.935 136.832 1.00 61.31  ? 499  PRO A O   1 
ATOM   6164  C  CB  . PRO E  5  499  ? 29.847  124.844 138.308 1.00 50.47  ? 499  PRO A CB  1 
ATOM   6165  C  CG  . PRO E  5  499  ? 29.620  125.534 139.549 1.00 59.53  ? 499  PRO A CG  1 
ATOM   6166  C  CD  . PRO E  5  499  ? 30.219  124.662 140.596 1.00 64.01  ? 499  PRO A CD  1 
ATOM   6167  N  N   . VAL E  5  500  ? 31.822  122.431 138.320 1.00 53.99  ? 500  VAL A N   1 
ATOM   6168  C  CA  . VAL E  5  500  ? 32.800  121.545 137.709 1.00 59.47  ? 500  VAL A CA  1 
ATOM   6169  C  C   . VAL E  5  500  ? 32.271  120.109 137.612 1.00 64.34  ? 500  VAL A C   1 
ATOM   6170  O  O   . VAL E  5  500  ? 32.603  119.385 136.676 1.00 73.08  ? 500  VAL A O   1 
ATOM   6171  C  CB  . VAL E  5  500  ? 34.130  121.584 138.475 1.00 65.17  ? 500  VAL A CB  1 
ATOM   6172  C  CG1 . VAL E  5  500  ? 35.217  120.923 137.673 1.00 71.55  ? 500  VAL A CG1 1 
ATOM   6173  C  CG2 . VAL E  5  500  ? 34.504  123.028 138.755 1.00 73.81  ? 500  VAL A CG2 1 
ATOM   6174  N  N   . PHE E  5  501  ? 31.434  119.703 138.560 1.00 47.80  ? 501  PHE A N   1 
ATOM   6175  C  CA  . PHE E  5  501  ? 30.786  118.403 138.483 1.00 46.96  ? 501  PHE A CA  1 
ATOM   6176  C  C   . PHE E  5  501  ? 29.536  118.496 137.623 1.00 54.00  ? 501  PHE A C   1 
ATOM   6177  O  O   . PHE E  5  501  ? 29.289  117.646 136.762 1.00 53.38  ? 501  PHE A O   1 
ATOM   6178  C  CB  . PHE E  5  501  ? 30.374  117.897 139.870 1.00 46.15  ? 501  PHE A CB  1 
ATOM   6179  C  CG  . PHE E  5  501  ? 31.522  117.566 140.777 1.00 49.83  ? 501  PHE A CG  1 
ATOM   6180  C  CD1 . PHE E  5  501  ? 32.801  117.432 140.288 1.00 46.91  ? 501  PHE A CD1 1 
ATOM   6181  C  CD2 . PHE E  5  501  ? 31.305  117.375 142.133 1.00 56.24  ? 501  PHE A CD2 1 
ATOM   6182  C  CE1 . PHE E  5  501  ? 33.834  117.122 141.126 1.00 49.70  ? 501  PHE A CE1 1 
ATOM   6183  C  CE2 . PHE E  5  501  ? 32.346  117.059 142.985 1.00 45.42  ? 501  PHE A CE2 1 
ATOM   6184  C  CZ  . PHE E  5  501  ? 33.601  116.933 142.482 1.00 45.97  ? 501  PHE A CZ  1 
ATOM   6185  N  N   . ALA E  5  502  ? 28.745  119.531 137.870 1.00 47.19  ? 502  ALA A N   1 
ATOM   6186  C  CA  . ALA E  5  502  ? 27.423  119.669 137.266 1.00 60.06  ? 502  ALA A CA  1 
ATOM   6187  C  C   . ALA E  5  502  ? 27.464  119.661 135.745 1.00 62.52  ? 502  ALA A C   1 
ATOM   6188  O  O   . ALA E  5  502  ? 26.500  119.297 135.083 1.00 71.39  ? 502  ALA A O   1 
ATOM   6189  C  CB  . ALA E  5  502  ? 26.750  120.930 137.764 1.00 61.85  ? 502  ALA A CB  1 
ATOM   6190  N  N   . VAL E  5  503  ? 28.606  120.050 135.206 1.00 54.50  ? 503  VAL A N   1 
ATOM   6191  C  CA  . VAL E  5  503  ? 28.782  120.160 133.784 1.00 53.15  ? 503  VAL A CA  1 
ATOM   6192  C  C   . VAL E  5  503  ? 29.283  118.850 133.146 1.00 57.37  ? 503  VAL A C   1 
ATOM   6193  O  O   . VAL E  5  503  ? 29.148  118.646 131.943 1.00 60.59  ? 503  VAL A O   1 
ATOM   6194  C  CB  . VAL E  5  503  ? 29.669  121.377 133.501 1.00 50.36  ? 503  VAL A CB  1 
ATOM   6195  C  CG1 . VAL E  5  503  ? 30.738  121.083 132.452 1.00 67.90  ? 503  VAL A CG1 1 
ATOM   6196  C  CG2 . VAL E  5  503  ? 28.787  122.538 133.133 1.00 50.98  ? 503  VAL A CG2 1 
ATOM   6197  N  N   . LYS E  5  504  ? 29.809  117.937 133.955 1.00 48.45  ? 504  LYS A N   1 
ATOM   6198  C  CA  . LYS E  5  504  ? 30.367  116.702 133.413 1.00 60.99  ? 504  LYS A CA  1 
ATOM   6199  C  C   . LYS E  5  504  ? 29.474  115.499 133.642 1.00 58.50  ? 504  LYS A C   1 
ATOM   6200  O  O   . LYS E  5  504  ? 29.528  114.536 132.889 1.00 55.66  ? 504  LYS A O   1 
ATOM   6201  C  CB  . LYS E  5  504  ? 31.743  116.416 134.009 1.00 62.83  ? 504  LYS A CB  1 
ATOM   6202  C  CG  . LYS E  5  504  ? 32.815  117.344 133.510 1.00 64.81  ? 504  LYS A CG  1 
ATOM   6203  C  CD  . LYS E  5  504  ? 33.031  117.138 132.033 1.00 67.42  ? 504  LYS A CD  1 
ATOM   6204  C  CE  . LYS E  5  504  ? 34.190  117.986 131.550 1.00 66.32  ? 504  LYS A CE  1 
ATOM   6205  N  NZ  . LYS E  5  504  ? 34.045  119.364 132.081 1.00 65.03  ? 504  LYS A NZ  1 
ATOM   6206  N  N   . LEU E  5  505  ? 28.672  115.553 134.696 1.00 46.78  ? 505  LEU A N   1 
ATOM   6207  C  CA  . LEU E  5  505  ? 27.737  114.481 134.998 1.00 61.01  ? 505  LEU A CA  1 
ATOM   6208  C  C   . LEU E  5  505  ? 26.466  114.659 134.197 1.00 57.24  ? 505  LEU A C   1 
ATOM   6209  O  O   . LEU E  5  505  ? 25.828  115.689 134.271 1.00 62.43  ? 505  LEU A O   1 
ATOM   6210  C  CB  . LEU E  5  505  ? 27.366  114.495 136.476 1.00 45.25  ? 505  LEU A CB  1 
ATOM   6211  C  CG  . LEU E  5  505  ? 28.437  114.146 137.492 1.00 44.91  ? 505  LEU A CG  1 
ATOM   6212  C  CD1 . LEU E  5  505  ? 27.807  114.269 138.837 1.00 44.27  ? 505  LEU A CD1 1 
ATOM   6213  C  CD2 . LEU E  5  505  ? 28.944  112.727 137.258 1.00 48.34  ? 505  LEU A CD2 1 
ATOM   6214  N  N   . THR E  5  506  ? 26.070  113.657 133.441 1.00 58.94  ? 506  THR A N   1 
ATOM   6215  C  CA  . THR E  5  506  ? 24.858  113.798 132.666 1.00 46.55  ? 506  THR A CA  1 
ATOM   6216  C  C   . THR E  5  506  ? 23.836  112.774 133.082 1.00 45.90  ? 506  THR A C   1 
ATOM   6217  O  O   . THR E  5  506  ? 24.100  111.902 133.902 1.00 67.44  ? 506  THR A O   1 
ATOM   6218  C  CB  . THR E  5  506  ? 25.141  113.664 131.173 1.00 51.18  ? 506  THR A CB  1 
ATOM   6219  O  OG1 . THR E  5  506  ? 25.779  112.407 130.907 1.00 59.42  ? 506  THR A OG1 1 
ATOM   6220  C  CG2 . THR E  5  506  ? 26.080  114.764 130.743 1.00 48.93  ? 506  THR A CG2 1 
ATOM   6221  N  N   . TYR E  5  507  ? 22.654  112.890 132.507 1.00 49.83  ? 507  TYR A N   1 
ATOM   6222  C  CA  . TYR E  5  507  ? 21.572  111.926 132.711 1.00 56.10  ? 507  TYR A CA  1 
ATOM   6223  C  C   . TYR E  5  507  ? 20.887  111.699 131.363 1.00 55.07  ? 507  TYR A C   1 
ATOM   6224  O  O   . TYR E  5  507  ? 20.664  112.635 130.614 1.00 56.21  ? 507  TYR A O   1 
ATOM   6225  C  CB  . TYR E  5  507  ? 20.560  112.453 133.731 1.00 45.33  ? 507  TYR A CB  1 
ATOM   6226  C  CG  . TYR E  5  507  ? 19.452  111.482 134.086 1.00 54.87  ? 507  TYR A CG  1 
ATOM   6227  C  CD1 . TYR E  5  507  ? 18.313  111.391 133.308 1.00 45.39  ? 507  TYR A CD1 1 
ATOM   6228  C  CD2 . TYR E  5  507  ? 19.550  110.656 135.217 1.00 52.59  ? 507  TYR A CD2 1 
ATOM   6229  C  CE1 . TYR E  5  507  ? 17.294  110.505 133.633 1.00 53.05  ? 507  TYR A CE1 1 
ATOM   6230  C  CE2 . TYR E  5  507  ? 18.538  109.765 135.558 1.00 50.44  ? 507  TYR A CE2 1 
ATOM   6231  C  CZ  . TYR E  5  507  ? 17.405  109.695 134.755 1.00 52.90  ? 507  TYR A CZ  1 
ATOM   6232  O  OH  . TYR E  5  507  ? 16.384  108.822 135.078 1.00 44.08  ? 507  TYR A OH  1 
ATOM   6233  N  N   . PRO E  5  508  ? 20.572  110.447 131.036 1.00 46.40  ? 508  PRO A N   1 
ATOM   6234  C  CA  . PRO E  5  508  ? 19.933  110.204 129.739 1.00 54.12  ? 508  PRO A CA  1 
ATOM   6235  C  C   . PRO E  5  508  ? 18.426  110.455 129.750 1.00 49.70  ? 508  PRO A C   1 
ATOM   6236  O  O   . PRO E  5  508  ? 17.696  109.535 130.077 1.00 50.02  ? 508  PRO A O   1 
ATOM   6237  C  CB  . PRO E  5  508  ? 20.209  108.727 129.516 1.00 47.07  ? 508  PRO A CB  1 
ATOM   6238  C  CG  . PRO E  5  508  ? 20.292  108.160 130.897 1.00 46.07  ? 508  PRO A CG  1 
ATOM   6239  C  CD  . PRO E  5  508  ? 20.914  109.201 131.742 1.00 45.70  ? 508  PRO A CD  1 
ATOM   6240  N  N   . GLU E  5  509  ? 17.968  111.660 129.404 1.00 54.42  ? 509  GLU A N   1 
ATOM   6241  C  CA  . GLU E  5  509  ? 16.525  111.941 129.317 1.00 51.81  ? 509  GLU A CA  1 
ATOM   6242  C  C   . GLU E  5  509  ? 15.942  111.605 127.967 1.00 49.16  ? 509  GLU A C   1 
ATOM   6243  O  O   . GLU E  5  509  ? 16.388  112.134 126.947 1.00 55.68  ? 509  GLU A O   1 
ATOM   6244  C  CB  . GLU E  5  509  ? 16.201  113.407 129.583 1.00 54.86  ? 509  GLU A CB  1 
ATOM   6245  C  CG  . GLU E  5  509  ? 16.083  113.789 131.033 1.00 63.87  ? 509  GLU A CG  1 
ATOM   6246  C  CD  . GLU E  5  509  ? 14.817  113.311 131.694 1.00 71.97  ? 509  GLU A CD  1 
ATOM   6247  O  OE1 . GLU E  5  509  ? 13.806  113.103 130.969 1.00 73.35  ? 509  GLU A OE1 1 
ATOM   6248  O  OE2 . GLU E  5  509  ? 14.850  113.157 132.949 1.00 73.39  ? 509  GLU A OE2 1 
ATOM   6249  N  N   . PRO E  5  510  ? 14.930  110.734 127.961 1.00 58.95  ? 510  PRO A N   1 
ATOM   6250  C  CA  . PRO E  5  510  ? 14.118  110.466 126.773 1.00 57.44  ? 510  PRO A CA  1 
ATOM   6251  C  C   . PRO E  5  510  ? 13.304  111.713 126.442 1.00 60.05  ? 510  PRO A C   1 
ATOM   6252  O  O   . PRO E  5  510  ? 12.796  112.372 127.358 1.00 57.93  ? 510  PRO A O   1 
ATOM   6253  C  CB  . PRO E  5  510  ? 13.194  109.324 127.219 1.00 55.40  ? 510  PRO A CB  1 
ATOM   6254  C  CG  . PRO E  5  510  ? 13.831  108.750 128.451 1.00 59.01  ? 510  PRO A CG  1 
ATOM   6255  C  CD  . PRO E  5  510  ? 14.532  109.902 129.107 1.00 58.43  ? 510  PRO A CD  1 
ATOM   6256  N  N   . VAL E  5  511  ? 13.203  112.031 125.153 1.00 63.96  ? 511  VAL A N   1 
ATOM   6257  C  CA  . VAL E  5  511  ? 12.533  113.235 124.677 1.00 65.77  ? 511  VAL A CA  1 
ATOM   6258  C  C   . VAL E  5  511  ? 11.042  112.996 124.415 1.00 71.95  ? 511  VAL A C   1 
ATOM   6259  O  O   . VAL E  5  511  ? 10.666  112.060 123.711 1.00 77.15  ? 511  VAL A O   1 
ATOM   6260  C  CB  . VAL E  5  511  ? 13.180  113.726 123.385 1.00 59.33  ? 511  VAL A CB  1 
ATOM   6261  C  CG1 . VAL E  5  511  ? 12.419  114.929 122.846 1.00 56.55  ? 511  VAL A CG1 1 
ATOM   6262  C  CG2 . VAL E  5  511  ? 14.646  114.048 123.623 1.00 55.63  ? 511  VAL A CG2 1 
ATOM   6263  N  N   . THR E  5  512  ? 10.190  113.839 124.987 1.00 69.47  ? 512  THR A N   1 
ATOM   6264  C  CA  . THR E  5  512  ? 8.753   113.655 124.838 1.00 70.10  ? 512  THR A CA  1 
ATOM   6265  C  C   . THR E  5  512  ? 8.061   114.990 124.621 1.00 70.84  ? 512  THR A C   1 
ATOM   6266  O  O   . THR E  5  512  ? 8.680   116.053 124.731 1.00 71.04  ? 512  THR A O   1 
ATOM   6267  C  CB  . THR E  5  512  ? 8.150   113.039 126.098 1.00 70.42  ? 512  THR A CB  1 
ATOM   6268  O  OG1 . THR E  5  512  ? 8.411   113.906 127.198 1.00 76.14  ? 512  THR A OG1 1 
ATOM   6269  C  CG2 . THR E  5  512  ? 8.778   111.689 126.407 1.00 64.47  ? 512  THR A CG2 1 
ATOM   6270  N  N   . ALA E  5  513  ? 6.768   114.932 124.331 1.00 71.84  ? 513  ALA A N   1 
ATOM   6271  C  CA  . ALA E  5  513  ? 5.957   116.133 124.190 1.00 56.58  ? 513  ALA A CA  1 
ATOM   6272  C  C   . ALA E  5  513  ? 6.072   117.004 125.419 1.00 70.48  ? 513  ALA A C   1 
ATOM   6273  O  O   . ALA E  5  513  ? 6.100   118.222 125.315 1.00 73.17  ? 513  ALA A O   1 
ATOM   6274  C  CB  . ALA E  5  513  ? 4.532   115.761 123.992 1.00 66.26  ? 513  ALA A CB  1 
ATOM   6275  N  N   . TYR E  5  514  ? 6.141   116.380 126.588 1.00 62.15  ? 514  TYR A N   1 
ATOM   6276  C  CA  . TYR E  5  514  ? 6.096   117.142 127.825 1.00 62.91  ? 514  TYR A CA  1 
ATOM   6277  C  C   . TYR E  5  514  ? 7.423   117.816 128.179 1.00 68.55  ? 514  TYR A C   1 
ATOM   6278  O  O   . TYR E  5  514  ? 7.463   118.707 129.029 1.00 72.27  ? 514  TYR A O   1 
ATOM   6279  C  CB  . TYR E  5  514  ? 5.549   116.294 128.994 1.00 60.27  ? 514  TYR A CB  1 
ATOM   6280  C  CG  . TYR E  5  514  ? 6.396   115.109 129.375 1.00 59.26  ? 514  TYR A CG  1 
ATOM   6281  C  CD1 . TYR E  5  514  ? 7.611   115.290 130.037 1.00 60.24  ? 514  TYR A CD1 1 
ATOM   6282  C  CD2 . TYR E  5  514  ? 5.983   113.807 129.094 1.00 58.83  ? 514  TYR A CD2 1 
ATOM   6283  C  CE1 . TYR E  5  514  ? 8.412   114.217 130.388 1.00 67.39  ? 514  TYR A CE1 1 
ATOM   6284  C  CE2 . TYR E  5  514  ? 6.777   112.711 129.452 1.00 62.71  ? 514  TYR A CE2 1 
ATOM   6285  C  CZ  . TYR E  5  514  ? 8.000   112.926 130.097 1.00 70.64  ? 514  TYR A CZ  1 
ATOM   6286  O  OH  . TYR E  5  514  ? 8.827   111.873 130.461 1.00 71.82  ? 514  TYR A OH  1 
ATOM   6287  N  N   . ASN E  5  515  ? 8.509   117.408 127.538 1.00 53.40  ? 515  ASN A N   1 
ATOM   6288  C  CA  . ASN E  5  515  ? 9.814   117.980 127.882 1.00 59.05  ? 515  ASN A CA  1 
ATOM   6289  C  C   . ASN E  5  515  ? 10.636  118.524 126.708 1.00 65.58  ? 515  ASN A C   1 
ATOM   6290  O  O   . ASN E  5  515  ? 11.816  118.853 126.860 1.00 60.89  ? 515  ASN A O   1 
ATOM   6291  C  CB  . ASN E  5  515  ? 10.656  116.990 128.707 1.00 53.96  ? 515  ASN A CB  1 
ATOM   6292  C  CG  . ASN E  5  515  ? 11.139  115.754 127.904 1.00 63.38  ? 515  ASN A CG  1 
ATOM   6293  O  OD1 . ASN E  5  515  ? 10.858  115.570 126.715 1.00 58.27  ? 515  ASN A OD1 1 
ATOM   6294  N  ND2 . ASN E  5  515  ? 11.877  114.903 128.582 1.00 77.03  ? 515  ASN A ND2 1 
ATOM   6295  N  N   . ILE E  5  516  ? 10.017  118.608 125.536 1.00 73.04  ? 516  ILE A N   1 
ATOM   6296  C  CA  . ILE E  5  516  ? 10.740  119.028 124.339 1.00 69.10  ? 516  ILE A CA  1 
ATOM   6297  C  C   . ILE E  5  516  ? 11.270  120.462 124.452 1.00 67.65  ? 516  ILE A C   1 
ATOM   6298  O  O   . ILE E  5  516  ? 12.344  120.768 123.915 1.00 65.35  ? 516  ILE A O   1 
ATOM   6299  C  CB  . ILE E  5  516  ? 9.916   118.810 123.047 1.00 63.71  ? 516  ILE A CB  1 
ATOM   6300  C  CG1 . ILE E  5  516  ? 10.729  119.232 121.831 1.00 63.17  ? 516  ILE A CG1 1 
ATOM   6301  C  CG2 . ILE E  5  516  ? 8.579   119.539 123.111 1.00 57.64  ? 516  ILE A CG2 1 
ATOM   6302  C  CD1 . ILE E  5  516  ? 12.062  118.548 121.705 1.00 64.02  ? 516  ILE A CD1 1 
ATOM   6303  N  N   . ALA E  5  517  ? 10.541  121.318 125.179 1.00 68.42  ? 517  ALA A N   1 
ATOM   6304  C  CA  . ALA E  5  517  ? 10.972  122.698 125.396 1.00 56.54  ? 517  ALA A CA  1 
ATOM   6305  C  C   . ALA E  5  517  ? 12.283  122.686 126.145 1.00 59.16  ? 517  ALA A C   1 
ATOM   6306  O  O   . ALA E  5  517  ? 13.282  123.201 125.650 1.00 66.53  ? 517  ALA A O   1 
ATOM   6307  C  CB  . ALA E  5  517  ? 9.933   123.469 126.159 1.00 56.75  ? 517  ALA A CB  1 
ATOM   6308  N  N   . GLU E  5  518  ? 12.267  122.062 127.324 1.00 58.68  ? 518  GLU A N   1 
ATOM   6309  C  CA  . GLU E  5  518  ? 13.440  121.920 128.191 1.00 63.82  ? 518  GLU A CA  1 
ATOM   6310  C  C   . GLU E  5  518  ? 14.666  121.363 127.482 1.00 68.70  ? 518  GLU A C   1 
ATOM   6311  O  O   . GLU E  5  518  ? 15.765  121.913 127.575 1.00 71.19  ? 518  GLU A O   1 
ATOM   6312  C  CB  . GLU E  5  518  ? 13.107  120.984 129.344 1.00 64.72  ? 518  GLU A CB  1 
ATOM   6313  C  CG  . GLU E  5  518  ? 13.215  121.616 130.703 1.00 83.70  ? 518  GLU A CG  1 
ATOM   6314  C  CD  . GLU E  5  518  ? 12.327  120.935 131.735 1.00 99.87  ? 518  GLU A CD  1 
ATOM   6315  O  OE1 . GLU E  5  518  ? 12.687  119.826 132.206 1.00 109.90 ? 518  GLU A OE1 1 
ATOM   6316  O  OE2 . GLU E  5  518  ? 11.270  121.515 132.073 1.00 97.47  ? 518  GLU A OE2 1 
ATOM   6317  N  N   . LEU E  5  519  ? 14.487  120.253 126.784 1.00 67.68  ? 519  LEU A N   1 
ATOM   6318  C  CA  . LEU E  5  519  ? 15.638  119.572 126.229 1.00 71.59  ? 519  LEU A CA  1 
ATOM   6319  C  C   . LEU E  5  519  ? 16.190  120.329 125.026 1.00 77.01  ? 519  LEU A C   1 
ATOM   6320  O  O   . LEU E  5  519  ? 17.395  120.275 124.761 1.00 83.09  ? 519  LEU A O   1 
ATOM   6321  C  CB  . LEU E  5  519  ? 15.316  118.103 125.926 1.00 68.89  ? 519  LEU A CB  1 
ATOM   6322  C  CG  . LEU E  5  519  ? 14.869  117.289 127.162 1.00 64.05  ? 519  LEU A CG  1 
ATOM   6323  C  CD1 . LEU E  5  519  ? 14.494  115.859 126.800 1.00 55.00  ? 519  LEU A CD1 1 
ATOM   6324  C  CD2 . LEU E  5  519  ? 15.924  117.281 128.256 1.00 50.77  ? 519  LEU A CD2 1 
ATOM   6325  N  N   . ARG E  5  520  ? 15.314  121.043 124.316 1.00 73.78  ? 520  ARG A N   1 
ATOM   6326  C  CA  . ARG E  5  520  ? 15.748  121.924 123.235 1.00 76.28  ? 520  ARG A CA  1 
ATOM   6327  C  C   . ARG E  5  520  ? 16.788  122.884 123.792 1.00 69.04  ? 520  ARG A C   1 
ATOM   6328  O  O   . ARG E  5  520  ? 17.884  123.029 123.250 1.00 67.05  ? 520  ARG A O   1 
ATOM   6329  C  CB  . ARG E  5  520  ? 14.574  122.731 122.660 1.00 81.99  ? 520  ARG A CB  1 
ATOM   6330  C  CG  . ARG E  5  520  ? 13.872  122.098 121.458 1.00 92.37  ? 520  ARG A CG  1 
ATOM   6331  C  CD  . ARG E  5  520  ? 12.881  123.073 120.786 1.00 100.50 ? 520  ARG A CD  1 
ATOM   6332  N  NE  . ARG E  5  520  ? 13.537  124.016 119.868 1.00 107.60 ? 520  ARG A NE  1 
ATOM   6333  C  CZ  . ARG E  5  520  ? 13.975  125.233 120.207 1.00 103.41 ? 520  ARG A CZ  1 
ATOM   6334  N  NH1 . ARG E  5  520  ? 13.832  125.666 121.454 1.00 110.24 ? 520  ARG A NH1 1 
ATOM   6335  N  NH2 . ARG E  5  520  ? 14.562  126.020 119.307 1.00 85.16  ? 520  ARG A NH2 1 
ATOM   6336  N  N   . GLN E  5  521  ? 16.437  123.515 124.905 1.00 61.76  ? 521  GLN A N   1 
ATOM   6337  C  CA  . GLN E  5  521  ? 17.283  124.528 125.511 1.00 63.03  ? 521  GLN A CA  1 
ATOM   6338  C  C   . GLN E  5  521  ? 18.623  123.951 125.967 1.00 68.95  ? 521  GLN A C   1 
ATOM   6339  O  O   . GLN E  5  521  ? 19.678  124.564 125.763 1.00 73.10  ? 521  GLN A O   1 
ATOM   6340  C  CB  . GLN E  5  521  ? 16.558  125.179 126.686 1.00 55.78  ? 521  GLN A CB  1 
ATOM   6341  C  CG  . GLN E  5  521  ? 17.230  126.431 127.151 1.00 56.17  ? 521  GLN A CG  1 
ATOM   6342  C  CD  . GLN E  5  521  ? 17.321  127.470 126.037 1.00 70.11  ? 521  GLN A CD  1 
ATOM   6343  O  OE1 . GLN E  5  521  ? 18.429  127.853 125.621 1.00 71.18  ? 521  GLN A OE1 1 
ATOM   6344  N  NE2 . GLN E  5  521  ? 16.153  127.926 125.535 1.00 60.69  ? 521  GLN A NE2 1 
ATOM   6345  N  N   . ALA E  5  522  ? 18.571  122.767 126.577 1.00 67.23  ? 522  ALA A N   1 
ATOM   6346  C  CA  . ALA E  5  522  ? 19.772  122.081 127.036 1.00 61.58  ? 522  ALA A CA  1 
ATOM   6347  C  C   . ALA E  5  522  ? 20.745  121.847 125.898 1.00 65.09  ? 522  ALA A C   1 
ATOM   6348  O  O   . ALA E  5  522  ? 21.914  122.209 125.994 1.00 75.86  ? 522  ALA A O   1 
ATOM   6349  C  CB  . ALA E  5  522  ? 19.408  120.787 127.663 1.00 62.91  ? 522  ALA A CB  1 
ATOM   6350  N  N   . VAL E  5  523  ? 20.258  121.243 124.820 1.00 62.10  ? 523  VAL A N   1 
ATOM   6351  C  CA  . VAL E  5  523  ? 21.076  121.027 123.636 1.00 59.51  ? 523  VAL A CA  1 
ATOM   6352  C  C   . VAL E  5  523  ? 21.637  122.332 123.074 1.00 64.73  ? 523  VAL A C   1 
ATOM   6353  O  O   . VAL E  5  523  ? 22.802  122.387 122.696 1.00 70.52  ? 523  VAL A O   1 
ATOM   6354  C  CB  . VAL E  5  523  ? 20.302  120.296 122.536 1.00 57.70  ? 523  VAL A CB  1 
ATOM   6355  C  CG1 . VAL E  5  523  ? 21.174  120.162 121.287 1.00 56.92  ? 523  VAL A CG1 1 
ATOM   6356  C  CG2 . VAL E  5  523  ? 19.852  118.931 123.029 1.00 58.11  ? 523  VAL A CG2 1 
ATOM   6357  N  N   . ILE E  5  524  ? 20.815  123.379 123.016 1.00 66.90  ? 524  ILE A N   1 
ATOM   6358  C  CA  . ILE E  5  524  ? 21.316  124.687 122.602 1.00 69.88  ? 524  ILE A CA  1 
ATOM   6359  C  C   . ILE E  5  524  ? 22.434  125.161 123.534 1.00 70.18  ? 524  ILE A C   1 
ATOM   6360  O  O   . ILE E  5  524  ? 23.495  125.581 123.068 1.00 73.15  ? 524  ILE A O   1 
ATOM   6361  C  CB  . ILE E  5  524  ? 20.192  125.753 122.497 1.00 74.08  ? 524  ILE A CB  1 
ATOM   6362  C  CG1 . ILE E  5  524  ? 19.552  125.700 121.117 1.00 70.13  ? 524  ILE A CG1 1 
ATOM   6363  C  CG2 . ILE E  5  524  ? 20.746  127.139 122.662 1.00 59.68  ? 524  ILE A CG2 1 
ATOM   6364  C  CD1 . ILE E  5  524  ? 18.053  125.612 121.153 1.00 60.09  ? 524  ILE A CD1 1 
ATOM   6365  N  N   . ASN E  5  525  ? 22.208  125.066 124.843 1.00 64.84  ? 525  ASN A N   1 
ATOM   6366  C  CA  . ASN E  5  525  ? 23.222  125.452 125.825 1.00 65.96  ? 525  ASN A CA  1 
ATOM   6367  C  C   . ASN E  5  525  ? 24.567  124.728 125.684 1.00 63.62  ? 525  ASN A C   1 
ATOM   6368  O  O   . ASN E  5  525  ? 25.624  125.292 125.982 1.00 65.34  ? 525  ASN A O   1 
ATOM   6369  C  CB  . ASN E  5  525  ? 22.678  125.307 127.248 1.00 64.76  ? 525  ASN A CB  1 
ATOM   6370  C  CG  . ASN E  5  525  ? 21.712  126.419 127.612 1.00 73.64  ? 525  ASN A CG  1 
ATOM   6371  O  OD1 . ASN E  5  525  ? 21.727  127.500 126.999 1.00 85.94  ? 525  ASN A OD1 1 
ATOM   6372  N  ND2 . ASN E  5  525  ? 20.861  126.166 128.609 1.00 69.65  ? 525  ASN A ND2 1 
ATOM   6373  N  N   . GLY E  5  526  ? 24.528  123.482 125.226 1.00 60.01  ? 526  GLY A N   1 
ATOM   6374  C  CA  . GLY E  5  526  ? 25.752  122.754 124.954 1.00 65.05  ? 526  GLY A CA  1 
ATOM   6375  C  C   . GLY E  5  526  ? 26.373  122.118 126.180 1.00 64.65  ? 526  GLY A C   1 
ATOM   6376  O  O   . GLY E  5  526  ? 25.782  122.097 127.268 1.00 65.06  ? 526  GLY A O   1 
ATOM   6377  N  N   . PRO E  5  527  ? 27.581  121.584 126.006 1.00 58.23  ? 527  PRO A N   1 
ATOM   6378  C  CA  . PRO E  5  527  ? 28.298  120.825 127.034 1.00 60.03  ? 527  PRO A CA  1 
ATOM   6379  C  C   . PRO E  5  527  ? 28.749  121.720 128.178 1.00 63.53  ? 527  PRO A C   1 
ATOM   6380  O  O   . PRO E  5  527  ? 28.950  121.242 129.289 1.00 59.48  ? 527  PRO A O   1 
ATOM   6381  C  CB  . PRO E  5  527  ? 29.542  120.322 126.294 1.00 54.15  ? 527  PRO A CB  1 
ATOM   6382  C  CG  . PRO E  5  527  ? 29.278  120.520 124.856 1.00 60.05  ? 527  PRO A CG  1 
ATOM   6383  C  CD  . PRO E  5  527  ? 28.351  121.695 124.766 1.00 57.01  ? 527  PRO A CD  1 
ATOM   6384  N  N   . ASP E  5  528  ? 28.916  123.011 127.917 1.00 70.68  ? 528  ASP A N   1 
ATOM   6385  C  CA  . ASP E  5  528  ? 29.673  123.828 128.856 1.00 67.06  ? 528  ASP A CA  1 
ATOM   6386  C  C   . ASP E  5  528  ? 28.905  124.940 129.562 1.00 66.51  ? 528  ASP A C   1 
ATOM   6387  O  O   . ASP E  5  528  ? 29.432  125.526 130.503 1.00 71.66  ? 528  ASP A O   1 
ATOM   6388  C  CB  . ASP E  5  528  ? 30.967  124.337 128.205 1.00 64.78  ? 528  ASP A CB  1 
ATOM   6389  C  CG  . ASP E  5  528  ? 31.981  123.224 128.002 1.00 78.79  ? 528  ASP A CG  1 
ATOM   6390  O  OD1 . ASP E  5  528  ? 32.178  122.434 128.957 1.00 83.61  ? 528  ASP A OD1 1 
ATOM   6391  O  OD2 . ASP E  5  528  ? 32.564  123.118 126.897 1.00 84.98  ? 528  ASP A OD2 1 
ATOM   6392  N  N   . LYS E  5  529  ? 27.675  125.215 129.126 1.00 58.36  ? 529  LYS A N   1 
ATOM   6393  C  CA  . LYS E  5  529  ? 26.798  126.157 129.820 1.00 54.63  ? 529  LYS A CA  1 
ATOM   6394  C  C   . LYS E  5  529  ? 25.705  125.399 130.579 1.00 59.05  ? 529  LYS A C   1 
ATOM   6395  O  O   . LYS E  5  529  ? 24.889  124.710 129.983 1.00 66.72  ? 529  LYS A O   1 
ATOM   6396  C  CB  . LYS E  5  529  ? 26.165  127.147 128.830 1.00 65.07  ? 529  LYS A CB  1 
ATOM   6397  C  CG  . LYS E  5  529  ? 25.258  128.216 129.470 1.00 63.95  ? 529  LYS A CG  1 
ATOM   6398  C  CD  . LYS E  5  529  ? 24.471  129.006 128.409 1.00 80.34  ? 529  LYS A CD  1 
ATOM   6399  C  CE  . LYS E  5  529  ? 23.676  130.172 129.034 1.00 85.40  ? 529  LYS A CE  1 
ATOM   6400  N  NZ  . LYS E  5  529  ? 22.834  130.947 128.050 1.00 79.79  ? 529  LYS A NZ  1 
ATOM   6401  N  N   . TRP E  5  530  ? 25.687  125.510 131.897 1.00 56.39  ? 530  TRP A N   1 
ATOM   6402  C  CA  . TRP E  5  530  ? 24.711  124.766 132.694 1.00 60.14  ? 530  TRP A CA  1 
ATOM   6403  C  C   . TRP E  5  530  ? 23.419  125.559 132.745 1.00 62.89  ? 530  TRP A C   1 
ATOM   6404  O  O   . TRP E  5  530  ? 23.472  126.774 132.838 1.00 68.76  ? 530  TRP A O   1 
ATOM   6405  C  CB  . TRP E  5  530  ? 25.251  124.577 134.109 1.00 51.07  ? 530  TRP A CB  1 
ATOM   6406  C  CG  . TRP E  5  530  ? 24.329  123.866 135.011 1.00 59.92  ? 530  TRP A CG  1 
ATOM   6407  C  CD1 . TRP E  5  530  ? 24.233  122.516 135.180 1.00 61.83  ? 530  TRP A CD1 1 
ATOM   6408  C  CD2 . TRP E  5  530  ? 23.370  124.448 135.894 1.00 58.85  ? 530  TRP A CD2 1 
ATOM   6409  N  NE1 . TRP E  5  530  ? 23.264  122.222 136.103 1.00 57.26  ? 530  TRP A NE1 1 
ATOM   6410  C  CE2 . TRP E  5  530  ? 22.721  123.391 136.560 1.00 58.05  ? 530  TRP A CE2 1 
ATOM   6411  C  CE3 . TRP E  5  530  ? 22.998  125.760 136.190 1.00 59.38  ? 530  TRP A CE3 1 
ATOM   6412  C  CZ2 . TRP E  5  530  ? 21.728  123.602 137.499 1.00 60.03  ? 530  TRP A CZ2 1 
ATOM   6413  C  CZ3 . TRP E  5  530  ? 22.011  125.968 137.118 1.00 56.42  ? 530  TRP A CZ3 1 
ATOM   6414  C  CH2 . TRP E  5  530  ? 21.384  124.894 137.765 1.00 60.03  ? 530  TRP A CH2 1 
ATOM   6415  N  N   . PRO E  5  531  ? 22.251  124.893 132.688 1.00 67.86  ? 531  PRO A N   1 
ATOM   6416  C  CA  . PRO E  5  531  ? 21.967  123.464 132.506 1.00 64.07  ? 531  PRO A CA  1 
ATOM   6417  C  C   . PRO E  5  531  ? 21.921  123.140 131.033 1.00 69.04  ? 531  PRO A C   1 
ATOM   6418  O  O   . PRO E  5  531  ? 21.049  123.659 130.323 1.00 67.62  ? 531  PRO A O   1 
ATOM   6419  C  CB  . PRO E  5  531  ? 20.546  123.310 133.072 1.00 54.82  ? 531  PRO A CB  1 
ATOM   6420  C  CG  . PRO E  5  531  ? 20.186  124.661 133.644 1.00 56.74  ? 531  PRO A CG  1 
ATOM   6421  C  CD  . PRO E  5  531  ? 21.011  125.645 132.910 1.00 52.05  ? 531  PRO A CD  1 
ATOM   6422  N  N   . GLY E  5  532  ? 22.843  122.298 130.586 1.00 66.95  ? 532  GLY A N   1 
ATOM   6423  C  CA  . GLY E  5  532  ? 22.968  121.971 129.182 1.00 60.42  ? 532  GLY A CA  1 
ATOM   6424  C  C   . GLY E  5  532  ? 23.007  120.478 128.987 1.00 58.27  ? 532  GLY A C   1 
ATOM   6425  O  O   . GLY E  5  532  ? 22.377  119.737 129.743 1.00 62.12  ? 532  GLY A O   1 
ATOM   6426  N  N   . ALA E  5  533  ? 23.768  120.038 127.990 1.00 59.33  ? 533  ALA A N   1 
ATOM   6427  C  CA  . ALA E  5  533  ? 23.714  118.666 127.533 1.00 51.52  ? 533  ALA A CA  1 
ATOM   6428  C  C   . ALA E  5  533  ? 25.018  118.335 126.827 1.00 60.06  ? 533  ALA A C   1 
ATOM   6429  O  O   . ALA E  5  533  ? 25.660  119.225 126.275 1.00 58.62  ? 533  ALA A O   1 
ATOM   6430  C  CB  . ALA E  5  533  ? 22.553  118.499 126.610 1.00 52.03  ? 533  ALA A CB  1 
ATOM   6431  N  N   . THR E  5  534  ? 25.433  117.069 126.846 1.00 56.74  ? 534  THR A N   1 
ATOM   6432  C  CA  . THR E  5  534  ? 26.713  116.733 126.228 1.00 56.40  ? 534  THR A CA  1 
ATOM   6433  C  C   . THR E  5  534  ? 26.549  115.899 124.979 1.00 60.94  ? 534  THR A C   1 
ATOM   6434  O  O   . THR E  5  534  ? 27.456  115.852 124.143 1.00 63.05  ? 534  THR A O   1 
ATOM   6435  C  CB  . THR E  5  534  ? 27.647  115.989 127.169 1.00 54.41  ? 534  THR A CB  1 
ATOM   6436  O  OG1 . THR E  5  534  ? 26.992  114.807 127.634 1.00 56.54  ? 534  THR A OG1 1 
ATOM   6437  C  CG2 . THR E  5  534  ? 28.030  116.867 128.341 1.00 59.03  ? 534  THR A CG2 1 
ATOM   6438  N  N   . GLN E  5  535  ? 25.408  115.234 124.848 1.00 62.98  ? 535  GLN A N   1 
ATOM   6439  C  CA  . GLN E  5  535  ? 25.142  114.494 123.623 1.00 67.91  ? 535  GLN A CA  1 
ATOM   6440  C  C   . GLN E  5  535  ? 23.717  114.041 123.442 1.00 73.42  ? 535  GLN A C   1 
ATOM   6441  O  O   . GLN E  5  535  ? 22.893  114.113 124.360 1.00 74.32  ? 535  GLN A O   1 
ATOM   6442  C  CB  . GLN E  5  535  ? 26.059  113.288 123.492 1.00 71.60  ? 535  GLN A CB  1 
ATOM   6443  C  CG  . GLN E  5  535  ? 26.149  112.393 124.700 1.00 76.56  ? 535  GLN A CG  1 
ATOM   6444  C  CD  . GLN E  5  535  ? 27.333  111.475 124.561 1.00 81.31  ? 535  GLN A CD  1 
ATOM   6445  O  OE1 . GLN E  5  535  ? 27.194  110.249 124.540 1.00 83.87  ? 535  GLN A OE1 1 
ATOM   6446  N  NE2 . GLN E  5  535  ? 28.516  112.071 124.410 1.00 82.37  ? 535  GLN A NE2 1 
ATOM   6447  N  N   . ILE E  5  536  ? 23.451  113.564 122.232 1.00 53.78  ? 536  ILE A N   1 
ATOM   6448  C  CA  . ILE E  5  536  ? 22.144  113.082 121.859 1.00 53.92  ? 536  ILE A CA  1 
ATOM   6449  C  C   . ILE E  5  536  ? 22.220  111.627 121.415 1.00 62.95  ? 536  ILE A C   1 
ATOM   6450  O  O   . ILE E  5  536  ? 23.116  111.234 120.661 1.00 63.03  ? 536  ILE A O   1 
ATOM   6451  C  CB  . ILE E  5  536  ? 21.586  113.926 120.740 1.00 55.13  ? 536  ILE A CB  1 
ATOM   6452  C  CG1 . ILE E  5  536  ? 21.347  115.338 121.281 1.00 55.07  ? 536  ILE A CG1 1 
ATOM   6453  C  CG2 . ILE E  5  536  ? 20.326  113.293 120.195 1.00 55.48  ? 536  ILE A CG2 1 
ATOM   6454  C  CD1 . ILE E  5  536  ? 20.951  116.361 120.275 1.00 56.30  ? 536  ILE A CD1 1 
ATOM   6455  N  N   . GLN E  5  537  ? 21.300  110.813 121.911 1.00 60.13  ? 537  GLN A N   1 
ATOM   6456  C  CA  . GLN E  5  537  ? 21.190  109.454 121.423 1.00 65.86  ? 537  GLN A CA  1 
ATOM   6457  C  C   . GLN E  5  537  ? 20.083  109.421 120.395 1.00 69.00  ? 537  GLN A C   1 
ATOM   6458  O  O   . GLN E  5  537  ? 18.961  109.857 120.665 1.00 70.60  ? 537  GLN A O   1 
ATOM   6459  C  CB  . GLN E  5  537  ? 20.879  108.478 122.564 1.00 72.17  ? 537  GLN A CB  1 
ATOM   6460  C  CG  . GLN E  5  537  ? 20.927  107.020 122.146 1.00 76.50  ? 537  GLN A CG  1 
ATOM   6461  C  CD  . GLN E  5  537  ? 21.125  106.095 123.313 1.00 79.94  ? 537  GLN A CD  1 
ATOM   6462  O  OE1 . GLN E  5  537  ? 20.492  106.252 124.351 1.00 76.92  ? 537  GLN A OE1 1 
ATOM   6463  N  NE2 . GLN E  5  537  ? 22.025  105.125 123.157 1.00 85.72  ? 537  GLN A NE2 1 
ATOM   6464  N  N   . ASN E  5  538  ? 20.397  108.911 119.211 1.00 70.94  ? 538  ASN A N   1 
ATOM   6465  C  CA  . ASN E  5  538  ? 19.377  108.738 118.189 1.00 70.25  ? 538  ASN A CA  1 
ATOM   6466  C  C   . ASN E  5  538  ? 18.617  107.427 118.348 1.00 70.86  ? 538  ASN A C   1 
ATOM   6467  O  O   . ASN E  5  538  ? 18.991  106.566 119.144 1.00 78.91  ? 538  ASN A O   1 
ATOM   6468  C  CB  . ASN E  5  538  ? 19.989  108.849 116.803 1.00 73.99  ? 538  ASN A CB  1 
ATOM   6469  C  CG  . ASN E  5  538  ? 20.394  110.263 116.464 1.00 76.25  ? 538  ASN A CG  1 
ATOM   6470  O  OD1 . ASN E  5  538  ? 19.641  111.221 116.688 1.00 76.60  ? 538  ASN A OD1 1 
ATOM   6471  N  ND2 . ASN E  5  538  ? 21.597  110.408 115.933 1.00 77.14  ? 538  ASN A ND2 1 
ATOM   6472  N  N   . GLU E  5  539  ? 17.536  107.287 117.598 1.00 68.70  ? 539  GLU A N   1 
ATOM   6473  C  CA  . GLU E  5  539  ? 16.664  106.131 117.746 1.00 75.28  ? 539  GLU A CA  1 
ATOM   6474  C  C   . GLU E  5  539  ? 17.379  104.835 117.352 1.00 80.99  ? 539  GLU A C   1 
ATOM   6475  O  O   . GLU E  5  539  ? 17.043  103.757 117.842 1.00 83.14  ? 539  GLU A O   1 
ATOM   6476  C  CB  . GLU E  5  539  ? 15.374  106.331 116.945 1.00 80.81  ? 539  GLU A CB  1 
ATOM   6477  C  CG  . GLU E  5  539  ? 14.642  107.657 117.238 1.00 81.06  ? 539  GLU A CG  1 
ATOM   6478  C  CD  . GLU E  5  539  ? 15.144  108.826 116.382 1.00 88.89  ? 539  GLU A CD  1 
ATOM   6479  O  OE1 . GLU E  5  539  ? 16.227  108.706 115.761 1.00 92.46  ? 539  GLU A OE1 1 
ATOM   6480  O  OE2 . GLU E  5  539  ? 14.451  109.870 116.323 1.00 92.06  ? 539  GLU A OE2 1 
ATOM   6481  N  N   . ASP E  5  540  ? 18.383  104.944 116.487 1.00 83.38  ? 540  ASP A N   1 
ATOM   6482  C  CA  . ASP E  5  540  ? 19.187  103.787 116.121 1.00 79.94  ? 540  ASP A CA  1 
ATOM   6483  C  C   . ASP E  5  540  ? 20.374  103.642 117.049 1.00 78.13  ? 540  ASP A C   1 
ATOM   6484  O  O   . ASP E  5  540  ? 21.431  103.185 116.637 1.00 90.42  ? 540  ASP A O   1 
ATOM   6485  C  CB  . ASP E  5  540  ? 19.664  103.900 114.679 1.00 86.43  ? 540  ASP A CB  1 
ATOM   6486  C  CG  . ASP E  5  540  ? 20.605  105.060 114.471 1.00 92.98  ? 540  ASP A CG  1 
ATOM   6487  O  OD1 . ASP E  5  540  ? 20.812  105.826 115.437 1.00 93.24  ? 540  ASP A OD1 1 
ATOM   6488  O  OD2 . ASP E  5  540  ? 21.132  105.212 113.342 1.00 95.24  ? 540  ASP A OD2 1 
ATOM   6489  N  N   . GLY E  5  541  ? 20.205  104.085 118.290 1.00 70.54  ? 541  GLY A N   1 
ATOM   6490  C  CA  . GLY E  5  541  ? 21.190  103.895 119.340 1.00 64.48  ? 541  GLY A CA  1 
ATOM   6491  C  C   . GLY E  5  541  ? 22.451  104.733 119.258 1.00 67.67  ? 541  GLY A C   1 
ATOM   6492  O  O   . GLY E  5  541  ? 23.148  104.913 120.257 1.00 76.03  ? 541  GLY A O   1 
ATOM   6493  N  N   . SER E  5  542  ? 22.750  105.249 118.075 1.00 63.48  ? 542  SER A N   1 
ATOM   6494  C  CA  . SER E  5  542  ? 23.966  106.021 117.877 1.00 68.24  ? 542  SER A CA  1 
ATOM   6495  C  C   . SER E  5  542  ? 23.987  107.329 118.660 1.00 77.75  ? 542  SER A C   1 
ATOM   6496  O  O   . SER E  5  542  ? 22.955  107.971 118.855 1.00 79.77  ? 542  SER A O   1 
ATOM   6497  C  CB  . SER E  5  542  ? 24.117  106.347 116.408 1.00 61.23  ? 542  SER A CB  1 
ATOM   6498  O  OG  . SER E  5  542  ? 22.975  107.060 115.995 1.00 64.30  ? 542  SER A OG  1 
ATOM   6499  N  N   . LEU E  5  543  ? 25.181  107.730 119.078 1.00 79.91  ? 543  LEU A N   1 
ATOM   6500  C  CA  . LEU E  5  543  ? 25.365  108.962 119.827 1.00 71.72  ? 543  LEU A CA  1 
ATOM   6501  C  C   . LEU E  5  543  ? 25.921  110.040 118.940 1.00 68.19  ? 543  LEU A C   1 
ATOM   6502  O  O   . LEU E  5  543  ? 26.670  109.758 118.016 1.00 65.05  ? 543  LEU A O   1 
ATOM   6503  C  CB  . LEU E  5  543  ? 26.346  108.729 120.960 1.00 72.40  ? 543  LEU A CB  1 
ATOM   6504  C  CG  . LEU E  5  543  ? 25.894  107.745 122.026 1.00 70.46  ? 543  LEU A CG  1 
ATOM   6505  C  CD1 . LEU E  5  543  ? 27.051  107.478 122.956 1.00 77.82  ? 543  LEU A CD1 1 
ATOM   6506  C  CD2 . LEU E  5  543  ? 24.746  108.352 122.782 1.00 63.74  ? 543  LEU A CD2 1 
ATOM   6507  N  N   . VAL E  5  544  ? 25.559  111.282 119.235 1.00 77.04  ? 544  VAL A N   1 
ATOM   6508  C  CA  . VAL E  5  544  ? 26.131  112.440 118.553 1.00 77.14  ? 544  VAL A CA  1 
ATOM   6509  C  C   . VAL E  5  544  ? 26.688  113.387 119.596 1.00 69.20  ? 544  VAL A C   1 
ATOM   6510  O  O   . VAL E  5  544  ? 25.950  113.826 120.473 1.00 64.76  ? 544  VAL A O   1 
ATOM   6511  C  CB  . VAL E  5  544  ? 25.072  113.193 117.756 1.00 57.95  ? 544  VAL A CB  1 
ATOM   6512  C  CG1 . VAL E  5  544  ? 25.678  114.430 117.114 1.00 58.98  ? 544  VAL A CG1 1 
ATOM   6513  C  CG2 . VAL E  5  544  ? 24.470  112.284 116.732 1.00 58.71  ? 544  VAL A CG2 1 
ATOM   6514  N  N   . SER E  5  545  ? 27.980  113.698 119.506 1.00 67.62  ? 545  SER A N   1 
ATOM   6515  C  CA  . SER E  5  545  ? 28.595  114.600 120.474 1.00 71.93  ? 545  SER A CA  1 
ATOM   6516  C  C   . SER E  5  545  ? 28.252  116.049 120.179 1.00 70.91  ? 545  SER A C   1 
ATOM   6517  O  O   . SER E  5  545  ? 28.276  116.477 119.033 1.00 78.49  ? 545  SER A O   1 
ATOM   6518  C  CB  . SER E  5  545  ? 30.110  114.431 120.520 1.00 76.63  ? 545  SER A CB  1 
ATOM   6519  O  OG  . SER E  5  545  ? 30.653  115.083 121.655 1.00 80.44  ? 545  SER A OG  1 
ATOM   6520  N  N   . LEU E  5  546  ? 27.927  116.790 121.231 1.00 63.83  ? 546  LEU A N   1 
ATOM   6521  C  CA  . LEU E  5  546  ? 27.654  118.206 121.128 1.00 62.27  ? 546  LEU A CA  1 
ATOM   6522  C  C   . LEU E  5  546  ? 28.930  118.995 121.397 1.00 70.04  ? 546  LEU A C   1 
ATOM   6523  O  O   . LEU E  5  546  ? 28.908  120.229 121.444 1.00 76.28  ? 546  LEU A O   1 
ATOM   6524  C  CB  . LEU E  5  546  ? 26.576  118.600 122.126 1.00 55.96  ? 546  LEU A CB  1 
ATOM   6525  C  CG  . LEU E  5  546  ? 25.230  117.918 121.917 1.00 65.77  ? 546  LEU A CG  1 
ATOM   6526  C  CD1 . LEU E  5  546  ? 24.169  118.592 122.754 1.00 62.53  ? 546  LEU A CD1 1 
ATOM   6527  C  CD2 . LEU E  5  546  ? 24.834  117.924 120.448 1.00 66.88  ? 546  LEU A CD2 1 
ATOM   6528  N  N   . ILE E  5  547  ? 30.048  118.291 121.539 1.00 69.92  ? 547  ILE A N   1 
ATOM   6529  C  CA  . ILE E  5  547  ? 31.268  118.931 122.009 1.00 74.60  ? 547  ILE A CA  1 
ATOM   6530  C  C   . ILE E  5  547  ? 31.916  119.886 121.008 1.00 80.92  ? 547  ILE A C   1 
ATOM   6531  O  O   . ILE E  5  547  ? 32.063  121.081 121.282 1.00 87.79  ? 547  ILE A O   1 
ATOM   6532  C  CB  . ILE E  5  547  ? 32.261  117.912 122.570 1.00 70.91  ? 547  ILE A CB  1 
ATOM   6533  C  CG1 . ILE E  5  547  ? 31.850  117.585 124.010 1.00 64.41  ? 547  ILE A CG1 1 
ATOM   6534  C  CG2 . ILE E  5  547  ? 33.659  118.460 122.554 1.00 68.53  ? 547  ILE A CG2 1 
ATOM   6535  C  CD1 . ILE E  5  547  ? 32.473  116.365 124.569 1.00 56.24  ? 547  ILE A CD1 1 
ATOM   6536  N  N   . GLY E  5  548  ? 32.274  119.396 119.838 1.00 77.82  ? 548  GLY A N   1 
ATOM   6537  C  CA  . GLY E  5  548  ? 32.925  120.281 118.893 1.00 83.82  ? 548  GLY A CA  1 
ATOM   6538  C  C   . GLY E  5  548  ? 32.054  121.368 118.277 1.00 84.80  ? 548  GLY A C   1 
ATOM   6539  O  O   . GLY E  5  548  ? 32.508  122.096 117.398 1.00 91.86  ? 548  GLY A O   1 
ATOM   6540  N  N   . MET E  5  549  ? 30.815  121.507 118.733 1.00 76.83  ? 549  MET A N   1 
ATOM   6541  C  CA  . MET E  5  549  ? 29.825  122.221 117.925 1.00 79.21  ? 549  MET A CA  1 
ATOM   6542  C  C   . MET E  5  549  ? 29.617  123.706 118.157 1.00 86.16  ? 549  MET A C   1 
ATOM   6543  O  O   . MET E  5  549  ? 29.782  124.223 119.263 1.00 89.83  ? 549  MET A O   1 
ATOM   6544  C  CB  . MET E  5  549  ? 28.477  121.524 117.994 1.00 74.27  ? 549  MET A CB  1 
ATOM   6545  C  CG  . MET E  5  549  ? 28.518  120.164 117.380 1.00 73.52  ? 549  MET A CG  1 
ATOM   6546  S  SD  . MET E  5  549  ? 26.873  119.517 117.134 1.00 95.23  ? 549  MET A SD  1 
ATOM   6547  C  CE  . MET E  5  549  ? 27.283  117.927 116.414 1.00 80.49  ? 549  MET A CE  1 
ATOM   6548  N  N   . SER E  5  550  ? 29.234  124.371 117.073 1.00 89.08  ? 550  SER A N   1 
ATOM   6549  C  CA  . SER E  5  550  ? 28.841  125.765 117.107 1.00 91.19  ? 550  SER A CA  1 
ATOM   6550  C  C   . SER E  5  550  ? 27.414  125.845 117.601 1.00 92.51  ? 550  SER A C   1 
ATOM   6551  O  O   . SER E  5  550  ? 26.718  124.830 117.706 1.00 90.50  ? 550  SER A O   1 
ATOM   6552  C  CB  . SER E  5  550  ? 28.862  126.346 115.709 1.00 90.65  ? 550  SER A CB  1 
ATOM   6553  O  OG  . SER E  5  550  ? 27.667  125.976 115.041 1.00 90.75  ? 550  SER A OG  1 
ATOM   6554  N  N   . VAL E  5  551  ? 26.978  127.067 117.874 1.00 92.50  ? 551  VAL A N   1 
ATOM   6555  C  CA  . VAL E  5  551  ? 25.630  127.319 118.343 1.00 87.83  ? 551  VAL A CA  1 
ATOM   6556  C  C   . VAL E  5  551  ? 24.599  126.960 117.273 1.00 88.16  ? 551  VAL A C   1 
ATOM   6557  O  O   . VAL E  5  551  ? 23.501  126.502 117.588 1.00 85.23  ? 551  VAL A O   1 
ATOM   6558  C  CB  . VAL E  5  551  ? 25.470  128.799 118.729 1.00 84.43  ? 551  VAL A CB  1 
ATOM   6559  C  CG1 . VAL E  5  551  ? 24.210  129.000 119.551 1.00 79.82  ? 551  VAL A CG1 1 
ATOM   6560  C  CG2 . VAL E  5  551  ? 26.702  129.275 119.485 1.00 84.20  ? 551  VAL A CG2 1 
ATOM   6561  N  N   . GLU E  5  552  ? 24.945  127.166 116.005 1.00 87.90  ? 552  GLU A N   1 
ATOM   6562  C  CA  . GLU E  5  552  ? 23.986  126.905 114.939 1.00 88.08  ? 552  GLU A CA  1 
ATOM   6563  C  C   . GLU E  5  552  ? 23.792  125.417 114.741 1.00 84.32  ? 552  GLU A C   1 
ATOM   6564  O  O   . GLU E  5  552  ? 22.663  124.958 114.602 1.00 88.01  ? 552  GLU A O   1 
ATOM   6565  C  CB  . GLU E  5  552  ? 24.387  127.568 113.621 1.00 98.25  ? 552  GLU A CB  1 
ATOM   6566  C  CG  . GLU E  5  552  ? 24.248  129.080 113.609 1.00 111.49 ? 552  GLU A CG  1 
ATOM   6567  C  CD  . GLU E  5  552  ? 25.553  129.786 113.940 1.00 122.73 ? 552  GLU A CD  1 
ATOM   6568  O  OE1 . GLU E  5  552  ? 26.290  129.310 114.837 1.00 122.53 ? 552  GLU A OE1 1 
ATOM   6569  O  OE2 . GLU E  5  552  ? 25.840  130.819 113.294 1.00 130.42 ? 552  GLU A OE2 1 
ATOM   6570  N  N   . GLN E  5  553  ? 24.889  124.666 114.724 1.00 76.09  ? 553  GLN A N   1 
ATOM   6571  C  CA  . GLN E  5  553  ? 24.787  123.229 114.582 1.00 77.39  ? 553  GLN A CA  1 
ATOM   6572  C  C   . GLN E  5  553  ? 23.919  122.657 115.710 1.00 85.12  ? 553  GLN A C   1 
ATOM   6573  O  O   . GLN E  5  553  ? 23.040  121.828 115.469 1.00 89.83  ? 553  GLN A O   1 
ATOM   6574  C  CB  . GLN E  5  553  ? 26.170  122.595 114.597 1.00 80.02  ? 553  GLN A CB  1 
ATOM   6575  C  CG  . GLN E  5  553  ? 27.170  123.249 113.675 1.00 88.41  ? 553  GLN A CG  1 
ATOM   6576  C  CD  . GLN E  5  553  ? 28.568  122.674 113.859 1.00 98.18  ? 553  GLN A CD  1 
ATOM   6577  O  OE1 . GLN E  5  553  ? 29.386  123.217 114.609 1.00 99.49  ? 553  GLN A OE1 1 
ATOM   6578  N  NE2 . GLN E  5  553  ? 28.845  121.562 113.183 1.00 99.73  ? 553  GLN A NE2 1 
ATOM   6579  N  N   . ARG E  5  554  ? 24.153  123.119 116.938 1.00 81.73  ? 554  ARG A N   1 
ATOM   6580  C  CA  . ARG E  5  554  ? 23.340  122.697 118.075 1.00 74.87  ? 554  ARG A CA  1 
ATOM   6581  C  C   . ARG E  5  554  ? 21.860  123.064 117.902 1.00 70.88  ? 554  ARG A C   1 
ATOM   6582  O  O   . ARG E  5  554  ? 20.980  122.245 118.169 1.00 64.96  ? 554  ARG A O   1 
ATOM   6583  C  CB  . ARG E  5  554  ? 23.893  123.258 119.393 1.00 72.09  ? 554  ARG A CB  1 
ATOM   6584  C  CG  . ARG E  5  554  ? 25.058  122.460 119.964 1.00 69.47  ? 554  ARG A CG  1 
ATOM   6585  C  CD  . ARG E  5  554  ? 25.539  123.007 121.298 1.00 65.96  ? 554  ARG A CD  1 
ATOM   6586  N  NE  . ARG E  5  554  ? 26.627  123.965 121.148 1.00 67.74  ? 554  ARG A NE  1 
ATOM   6587  C  CZ  . ARG E  5  554  ? 26.664  125.140 121.766 1.00 73.45  ? 554  ARG A CZ  1 
ATOM   6588  N  NH1 . ARG E  5  554  ? 25.672  125.486 122.577 1.00 66.54  ? 554  ARG A NH1 1 
ATOM   6589  N  NH2 . ARG E  5  554  ? 27.684  125.969 121.570 1.00 83.39  ? 554  ARG A NH2 1 
ATOM   6590  N  N   . LYS E  5  555  ? 21.588  124.287 117.449 1.00 73.30  ? 555  LYS A N   1 
ATOM   6591  C  CA  . LYS E  5  555  ? 20.209  124.718 117.214 1.00 77.61  ? 555  LYS A CA  1 
ATOM   6592  C  C   . LYS E  5  555  ? 19.517  123.808 116.200 1.00 81.40  ? 555  LYS A C   1 
ATOM   6593  O  O   . LYS E  5  555  ? 18.311  123.563 116.287 1.00 79.38  ? 555  LYS A O   1 
ATOM   6594  C  CB  . LYS E  5  555  ? 20.164  126.171 116.731 1.00 85.68  ? 555  LYS A CB  1 
ATOM   6595  C  CG  . LYS E  5  555  ? 20.328  127.215 117.826 1.00 95.62  ? 555  LYS A CG  1 
ATOM   6596  C  CD  . LYS E  5  555  ? 19.006  127.929 118.125 1.00 103.89 ? 555  LYS A CD  1 
ATOM   6597  C  CE  . LYS E  5  555  ? 18.812  129.163 117.247 1.00 113.84 ? 555  LYS A CE  1 
ATOM   6598  N  NZ  . LYS E  5  555  ? 19.651  130.326 117.679 1.00 116.15 ? 555  LYS A NZ  1 
ATOM   6599  N  N   . ALA E  5  556  ? 20.295  123.299 115.246 1.00 85.60  ? 556  ALA A N   1 
ATOM   6600  C  CA  . ALA E  5  556  ? 19.775  122.405 114.220 1.00 85.02  ? 556  ALA A CA  1 
ATOM   6601  C  C   . ALA E  5  556  ? 19.373  121.082 114.843 1.00 88.26  ? 556  ALA A C   1 
ATOM   6602  O  O   . ALA E  5  556  ? 18.232  120.641 114.692 1.00 96.80  ? 556  ALA A O   1 
ATOM   6603  C  CB  . ALA E  5  556  ? 20.802  122.184 113.146 1.00 65.74  ? 556  ALA A CB  1 
ATOM   6604  N  N   . LEU E  5  557  ? 20.306  120.456 115.558 1.00 80.90  ? 557  LEU A N   1 
ATOM   6605  C  CA  . LEU E  5  557  ? 20.020  119.203 116.257 1.00 73.80  ? 557  LEU A CA  1 
ATOM   6606  C  C   . LEU E  5  557  ? 18.858  119.349 117.244 1.00 70.49  ? 557  LEU A C   1 
ATOM   6607  O  O   . LEU E  5  557  ? 18.035  118.448 117.392 1.00 76.64  ? 557  LEU A O   1 
ATOM   6608  C  CB  . LEU E  5  557  ? 21.266  118.688 116.969 1.00 70.07  ? 557  LEU A CB  1 
ATOM   6609  C  CG  . LEU E  5  557  ? 22.419  118.321 116.038 1.00 72.57  ? 557  LEU A CG  1 
ATOM   6610  C  CD1 . LEU E  5  557  ? 23.663  117.986 116.824 1.00 74.03  ? 557  LEU A CD1 1 
ATOM   6611  C  CD2 . LEU E  5  557  ? 22.028  117.154 115.137 1.00 76.27  ? 557  LEU A CD2 1 
ATOM   6612  N  N   . ALA E  5  558  ? 18.775  120.495 117.900 1.00 63.60  ? 558  ALA A N   1 
ATOM   6613  C  CA  . ALA E  5  558  ? 17.683  120.743 118.821 1.00 68.12  ? 558  ALA A CA  1 
ATOM   6614  C  C   . ALA E  5  558  ? 16.319  120.802 118.125 1.00 78.34  ? 558  ALA A C   1 
ATOM   6615  O  O   . ALA E  5  558  ? 15.279  120.602 118.752 1.00 77.09  ? 558  ALA A O   1 
ATOM   6616  C  CB  . ALA E  5  558  ? 17.942  122.015 119.571 1.00 70.41  ? 558  ALA A CB  1 
ATOM   6617  N  N   . ASN E  5  559  ? 16.313  121.090 116.830 1.00 85.34  ? 559  ASN A N   1 
ATOM   6618  C  CA  . ASN E  5  559  ? 15.045  121.178 116.122 1.00 89.67  ? 559  ASN A CA  1 
ATOM   6619  C  C   . ASN E  5  559  ? 14.610  119.857 115.514 1.00 91.53  ? 559  ASN A C   1 
ATOM   6620  O  O   . ASN E  5  559  ? 13.532  119.756 114.942 1.00 94.42  ? 559  ASN A O   1 
ATOM   6621  C  CB  . ASN E  5  559  ? 15.088  122.261 115.047 1.00 93.14  ? 559  ASN A CB  1 
ATOM   6622  C  CG  . ASN E  5  559  ? 15.030  123.649 115.625 1.00 90.79  ? 559  ASN A CG  1 
ATOM   6623  O  OD1 . ASN E  5  559  ? 14.505  123.854 116.722 1.00 90.28  ? 559  ASN A OD1 1 
ATOM   6624  N  ND2 . ASN E  5  559  ? 15.568  124.618 114.891 1.00 88.85  ? 559  ASN A ND2 1 
ATOM   6625  N  N   . GLN E  5  560  ? 15.449  118.841 115.628 1.00 95.43  ? 560  GLN A N   1 
ATOM   6626  C  CA  . GLN E  5  560  ? 15.084  117.538 115.100 1.00 100.03 ? 560  GLN A CA  1 
ATOM   6627  C  C   . GLN E  5  560  ? 14.979  116.480 116.199 1.00 93.91  ? 560  GLN A C   1 
ATOM   6628  O  O   . GLN E  5  560  ? 15.003  115.277 115.919 1.00 92.80  ? 560  GLN A O   1 
ATOM   6629  C  CB  . GLN E  5  560  ? 16.065  117.119 114.007 1.00 106.79 ? 560  GLN A CB  1 
ATOM   6630  C  CG  . GLN E  5  560  ? 15.782  117.787 112.676 1.00 115.46 ? 560  GLN A CG  1 
ATOM   6631  C  CD  . GLN E  5  560  ? 16.935  117.660 111.700 1.00 125.37 ? 560  GLN A CD  1 
ATOM   6632  O  OE1 . GLN E  5  560  ? 18.059  117.326 112.086 1.00 122.07 ? 560  GLN A OE1 1 
ATOM   6633  N  NE2 . GLN E  5  560  ? 16.663  117.932 110.422 1.00 134.71 ? 560  GLN A NE2 1 
ATOM   6634  N  N   . LEU E  5  561  ? 14.846  116.939 117.443 1.00 86.11  ? 561  LEU A N   1 
ATOM   6635  C  CA  . LEU E  5  561  ? 14.741  116.046 118.596 1.00 79.57  ? 561  LEU A CA  1 
ATOM   6636  C  C   . LEU E  5  561  ? 13.493  115.184 118.551 1.00 84.41  ? 561  LEU A C   1 
ATOM   6637  O  O   . LEU E  5  561  ? 13.473  114.054 119.037 1.00 91.28  ? 561  LEU A O   1 
ATOM   6638  C  CB  . LEU E  5  561  ? 14.728  116.843 119.890 1.00 69.37  ? 561  LEU A CB  1 
ATOM   6639  C  CG  . LEU E  5  561  ? 16.065  117.411 120.348 1.00 69.68  ? 561  LEU A CG  1 
ATOM   6640  C  CD1 . LEU E  5  561  ? 15.903  118.003 121.732 1.00 71.41  ? 561  LEU A CD1 1 
ATOM   6641  C  CD2 . LEU E  5  561  ? 17.146  116.355 120.348 1.00 63.68  ? 561  LEU A CD2 1 
ATOM   6642  N  N   . LEU E  5  562  ? 12.449  115.716 117.948 1.00 85.62  ? 562  LEU A N   1 
ATOM   6643  C  CA  . LEU E  5  562  ? 11.156  115.078 118.039 1.00 87.14  ? 562  LEU A CA  1 
ATOM   6644  C  C   . LEU E  5  562  ? 10.554  114.767 116.659 1.00 94.48  ? 562  LEU A C   1 
ATOM   6645  O  O   . LEU E  5  562  ? 9.334   114.714 116.504 1.00 96.33  ? 562  LEU A O   1 
ATOM   6646  C  CB  . LEU E  5  562  ? 10.241  115.971 118.875 1.00 81.68  ? 562  LEU A CB  1 
ATOM   6647  C  CG  . LEU E  5  562  ? 9.075   115.351 119.629 1.00 83.96  ? 562  LEU A CG  1 
ATOM   6648  C  CD1 . LEU E  5  562  ? 9.523   114.125 120.420 1.00 83.90  ? 562  LEU A CD1 1 
ATOM   6649  C  CD2 . LEU E  5  562  ? 8.462   116.405 120.543 1.00 88.50  ? 562  LEU A CD2 1 
ATOM   6650  N  N   . THR E  5  563  ? 11.406  114.547 115.659 1.00 98.33  ? 563  THR A N   1 
ATOM   6651  C  CA  . THR E  5  563  ? 10.911  114.170 114.336 1.00 105.76 ? 563  THR A CA  1 
ATOM   6652  C  C   . THR E  5  563  ? 10.415  112.738 114.367 1.00 114.62 ? 563  THR A C   1 
ATOM   6653  O  O   . THR E  5  563  ? 10.992  111.908 115.068 1.00 117.31 ? 563  THR A O   1 
ATOM   6654  C  CB  . THR E  5  563  ? 11.987  114.282 113.235 1.00 104.47 ? 563  THR A CB  1 
ATOM   6655  O  OG1 . THR E  5  563  ? 13.018  113.306 113.457 1.00 98.69  ? 563  THR A OG1 1 
ATOM   6656  C  CG2 . THR E  5  563  ? 12.574  115.697 113.185 1.00 107.09 ? 563  THR A CG2 1 
ATOM   6657  N  N   . PRO E  5  564  ? 9.347   112.442 113.601 1.00 120.54 ? 564  PRO A N   1 
ATOM   6658  C  CA  . PRO E  5  564  ? 8.758   111.097 113.489 1.00 121.96 ? 564  PRO A CA  1 
ATOM   6659  C  C   . PRO E  5  564  ? 9.768   110.003 113.110 1.00 119.73 ? 564  PRO A C   1 
ATOM   6660  O  O   . PRO E  5  564  ? 10.963  110.270 112.947 1.00 116.19 ? 564  PRO A O   1 
ATOM   6661  C  CB  . PRO E  5  564  ? 7.728   111.263 112.364 1.00 122.95 ? 564  PRO A CB  1 
ATOM   6662  C  CG  . PRO E  5  564  ? 7.349   112.699 112.413 1.00 122.44 ? 564  PRO A CG  1 
ATOM   6663  C  CD  . PRO E  5  564  ? 8.594   113.438 112.814 1.00 121.77 ? 564  PRO A CD  1 
ATOM   6664  N  N   . SER E  5  565  ? 9.285   108.772 112.970 1.00 121.58 ? 565  SER A N   1 
ATOM   6665  C  CA  . SER E  5  565  ? 10.170  107.680 112.594 1.00 126.53 ? 565  SER A CA  1 
ATOM   6666  C  C   . SER E  5  565  ? 10.181  107.445 111.093 1.00 127.21 ? 565  SER A C   1 
ATOM   6667  O  O   . SER E  5  565  ? 9.135   107.423 110.439 1.00 123.51 ? 565  SER A O   1 
ATOM   6668  C  CB  . SER E  5  565  ? 9.812   106.389 113.327 1.00 130.34 ? 565  SER A CB  1 
ATOM   6669  O  OG  . SER E  5  565  ? 10.904  105.481 113.272 1.00 132.65 ? 565  SER A OG  1 
ATOM   6670  N  N   . SER E  5  566  ? 11.383  107.282 110.557 1.00 130.46 ? 566  SER A N   1 
ATOM   6671  C  CA  . SER E  5  566  ? 11.571  106.981 109.149 1.00 131.56 ? 566  SER A CA  1 
ATOM   6672  C  C   . SER E  5  566  ? 12.084  105.555 109.049 1.00 126.88 ? 566  SER A C   1 
ATOM   6673  O  O   . SER E  5  566  ? 12.870  105.221 108.163 1.00 132.42 ? 566  SER A O   1 
ATOM   6674  C  CB  . SER E  5  566  ? 12.583  107.949 108.539 1.00 136.53 ? 566  SER A CB  1 
ATOM   6675  O  OG  . SER E  5  566  ? 13.807  107.914 109.254 1.00 140.53 ? 566  SER A OG  1 
ATOM   6676  N  N   . ASN E  5  567  ? 11.625  104.719 109.973 1.00 116.61 ? 567  ASN A N   1 
ATOM   6677  C  CA  . ASN E  5  567  ? 12.164  103.377 110.146 1.00 107.03 ? 567  ASN A CA  1 
ATOM   6678  C  C   . ASN E  5  567  ? 11.256  102.613 111.100 1.00 96.50  ? 567  ASN A C   1 
ATOM   6679  O  O   . ASN E  5  567  ? 11.098  102.995 112.249 1.00 93.87  ? 567  ASN A O   1 
ATOM   6680  C  CB  . ASN E  5  567  ? 13.603  103.464 110.684 1.00 100.62 ? 567  ASN A CB  1 
ATOM   6681  C  CG  . ASN E  5  567  ? 14.273  102.108 110.829 1.00 93.35  ? 567  ASN A CG  1 
ATOM   6682  O  OD1 . ASN E  5  567  ? 13.803  101.099 110.306 1.00 89.91  ? 567  ASN A OD1 1 
ATOM   6683  N  ND2 . ASN E  5  567  ? 15.387  102.085 111.547 1.00 94.55  ? 567  ASN A ND2 1 
ATOM   6684  N  N   . VAL E  5  568  ? 10.644  101.544 110.605 1.00 93.90  ? 568  VAL A N   1 
ATOM   6685  C  CA  . VAL E  5  568  ? 9.683   100.768 111.379 1.00 90.67  ? 568  VAL A CA  1 
ATOM   6686  C  C   . VAL E  5  568  ? 10.300  100.109 112.617 1.00 87.83  ? 568  VAL A C   1 
ATOM   6687  O  O   . VAL E  5  568  ? 9.659   100.029 113.669 1.00 83.38  ? 568  VAL A O   1 
ATOM   6688  C  CB  . VAL E  5  568  ? 9.006   99.697  110.492 1.00 87.68  ? 568  VAL A CB  1 
ATOM   6689  C  CG1 . VAL E  5  568  ? 8.018   98.849  111.299 1.00 82.75  ? 568  VAL A CG1 1 
ATOM   6690  C  CG2 . VAL E  5  568  ? 8.311   100.365 109.316 1.00 89.72  ? 568  VAL A CG2 1 
ATOM   6691  N  N   . SER E  5  569  ? 11.548  99.659  112.487 1.00 86.54  ? 569  SER A N   1 
ATOM   6692  C  CA  . SER E  5  569  ? 12.247  98.937  113.555 1.00 81.17  ? 569  SER A CA  1 
ATOM   6693  C  C   . SER E  5  569  ? 12.550  99.761  114.811 1.00 80.17  ? 569  SER A C   1 
ATOM   6694  O  O   . SER E  5  569  ? 12.592  99.240  115.928 1.00 81.26  ? 569  SER A O   1 
ATOM   6695  C  CB  . SER E  5  569  ? 13.533  98.338  113.006 1.00 77.46  ? 569  SER A CB  1 
ATOM   6696  O  OG  . SER E  5  569  ? 13.214  97.325  112.076 1.00 85.34  ? 569  SER A OG  1 
ATOM   6697  N  N   . THR E  5  570  ? 12.761  101.052 114.627 1.00 81.42  ? 570  THR A N   1 
ATOM   6698  C  CA  . THR E  5  570  ? 13.032  101.924 115.753 1.00 85.75  ? 570  THR A CA  1 
ATOM   6699  C  C   . THR E  5  570  ? 11.823  102.800 116.080 1.00 88.60  ? 570  THR A C   1 
ATOM   6700  O  O   . THR E  5  570  ? 11.917  103.732 116.868 1.00 91.62  ? 570  THR A O   1 
ATOM   6701  C  CB  . THR E  5  570  ? 14.264  102.807 115.474 1.00 84.00  ? 570  THR A CB  1 
ATOM   6702  O  OG1 . THR E  5  570  ? 14.022  103.650 114.332 1.00 82.06  ? 570  THR A OG1 1 
ATOM   6703  C  CG2 . THR E  5  570  ? 15.479  101.926 115.222 1.00 76.27  ? 570  THR A CG2 1 
ATOM   6704  N  N   . HIS E  5  571  ? 10.678  102.486 115.491 1.00 84.87  ? 571  HIS A N   1 
ATOM   6705  C  CA  . HIS E  5  571  ? 9.539   103.379 115.596 1.00 81.22  ? 571  HIS A CA  1 
ATOM   6706  C  C   . HIS E  5  571  ? 9.004   103.535 117.006 1.00 78.80  ? 571  HIS A C   1 
ATOM   6707  O  O   . HIS E  5  571  ? 8.317   104.506 117.298 1.00 88.00  ? 571  HIS A O   1 
ATOM   6708  C  CB  . HIS E  5  571  ? 8.429   102.969 114.631 1.00 78.29  ? 571  HIS A CB  1 
ATOM   6709  C  CG  . HIS E  5  571  ? 7.484   101.943 115.170 1.00 75.93  ? 571  HIS A CG  1 
ATOM   6710  N  ND1 . HIS E  5  571  ? 7.537   100.618 114.792 1.00 72.78  ? 571  HIS A ND1 1 
ATOM   6711  C  CD2 . HIS E  5  571  ? 6.425   102.055 116.008 1.00 62.42  ? 571  HIS A CD2 1 
ATOM   6712  C  CE1 . HIS E  5  571  ? 6.565   99.955  115.392 1.00 73.84  ? 571  HIS A CE1 1 
ATOM   6713  N  NE2 . HIS E  5  571  ? 5.874   100.804 116.134 1.00 73.06  ? 571  HIS A NE2 1 
ATOM   6714  N  N   . THR E  5  572  ? 9.328   102.592 117.878 1.00 67.95  ? 572  THR A N   1 
ATOM   6715  C  CA  . THR E  5  572  ? 8.821   102.640 119.238 1.00 72.05  ? 572  THR A CA  1 
ATOM   6716  C  C   . THR E  5  572  ? 9.698   103.498 120.161 1.00 71.38  ? 572  THR A C   1 
ATOM   6717  O  O   . THR E  5  572  ? 9.336   103.780 121.300 1.00 77.36  ? 572  THR A O   1 
ATOM   6718  C  CB  . THR E  5  572  ? 8.647   101.227 119.816 1.00 76.34  ? 572  THR A CB  1 
ATOM   6719  O  OG1 . THR E  5  572  ? 9.923   100.581 119.895 1.00 77.12  ? 572  THR A OG1 1 
ATOM   6720  C  CG2 . THR E  5  572  ? 7.741   100.404 118.929 1.00 78.91  ? 572  THR A CG2 1 
ATOM   6721  N  N   . LEU E  5  573  ? 10.843  103.931 119.654 1.00 64.79  ? 573  LEU A N   1 
ATOM   6722  C  CA  . LEU E  5  573  ? 11.788  104.690 120.453 1.00 57.17  ? 573  LEU A CA  1 
ATOM   6723  C  C   . LEU E  5  573  ? 11.744  106.169 120.165 1.00 57.72  ? 573  LEU A C   1 
ATOM   6724  O  O   . LEU E  5  573  ? 11.276  106.601 119.129 1.00 73.97  ? 573  LEU A O   1 
ATOM   6725  C  CB  . LEU E  5  573  ? 13.210  104.193 120.204 1.00 56.57  ? 573  LEU A CB  1 
ATOM   6726  C  CG  . LEU E  5  573  ? 13.373  102.684 120.310 1.00 55.34  ? 573  LEU A CG  1 
ATOM   6727  C  CD1 . LEU E  5  573  ? 14.821  102.278 120.148 1.00 61.38  ? 573  LEU A CD1 1 
ATOM   6728  C  CD2 . LEU E  5  573  ? 12.829  102.231 121.636 1.00 57.93  ? 573  LEU A CD2 1 
ATOM   6729  N  N   . ASN E  5  574  ? 12.254  106.933 121.113 1.00 60.58  ? 574  ASN A N   1 
ATOM   6730  C  CA  . ASN E  5  574  ? 12.438  108.360 120.980 1.00 64.33  ? 574  ASN A CA  1 
ATOM   6731  C  C   . ASN E  5  574  ? 13.899  108.643 121.252 1.00 65.16  ? 574  ASN A C   1 
ATOM   6732  O  O   . ASN E  5  574  ? 14.603  107.812 121.819 1.00 79.48  ? 574  ASN A O   1 
ATOM   6733  C  CB  . ASN E  5  574  ? 11.533  109.123 121.965 1.00 74.96  ? 574  ASN A CB  1 
ATOM   6734  C  CG  . ASN E  5  574  ? 11.550  108.527 123.396 1.00 97.55  ? 574  ASN A CG  1 
ATOM   6735  O  OD1 . ASN E  5  574  ? 12.107  107.450 123.633 1.00 100.73 ? 574  ASN A OD1 1 
ATOM   6736  N  ND2 . ASN E  5  574  ? 10.911  109.225 124.340 1.00 88.97  ? 574  ASN A ND2 1 
ATOM   6737  N  N   . LYS E  5  575  ? 14.366  109.808 120.842 1.00 63.67  ? 575  LYS A N   1 
ATOM   6738  C  CA  . LYS E  5  575  ? 15.736  110.199 121.106 1.00 61.16  ? 575  LYS A CA  1 
ATOM   6739  C  C   . LYS E  5  575  ? 15.967  110.424 122.612 1.00 61.61  ? 575  LYS A C   1 
ATOM   6740  O  O   . LYS E  5  575  ? 15.031  110.561 123.400 1.00 52.68  ? 575  LYS A O   1 
ATOM   6741  C  CB  . LYS E  5  575  ? 16.065  111.470 120.330 1.00 55.38  ? 575  LYS A CB  1 
ATOM   6742  C  CG  . LYS E  5  575  ? 15.849  111.383 118.860 1.00 71.48  ? 575  LYS A CG  1 
ATOM   6743  C  CD  . LYS E  5  575  ? 16.543  112.530 118.179 1.00 77.37  ? 575  LYS A CD  1 
ATOM   6744  C  CE  . LYS E  5  575  ? 16.354  112.494 116.681 1.00 85.10  ? 575  LYS A CE  1 
ATOM   6745  N  NZ  . LYS E  5  575  ? 17.005  113.694 116.091 1.00 95.14  ? 575  LYS A NZ  1 
ATOM   6746  N  N   . LYS E  5  576  ? 17.226  110.463 123.010 1.00 59.38  ? 576  LYS A N   1 
ATOM   6747  C  CA  . LYS E  5  576  ? 17.550  110.754 124.387 1.00 58.55  ? 576  LYS A CA  1 
ATOM   6748  C  C   . LYS E  5  576  ? 18.531  111.919 124.416 1.00 61.91  ? 576  LYS A C   1 
ATOM   6749  O  O   . LYS E  5  576  ? 19.440  111.984 123.587 1.00 64.24  ? 576  LYS A O   1 
ATOM   6750  C  CB  . LYS E  5  576  ? 18.140  109.511 125.075 1.00 56.85  ? 576  LYS A CB  1 
ATOM   6751  C  CG  . LYS E  5  576  ? 17.102  108.613 125.738 1.00 58.36  ? 576  LYS A CG  1 
ATOM   6752  C  CD  . LYS E  5  576  ? 17.732  107.463 126.550 1.00 59.74  ? 576  LYS A CD  1 
ATOM   6753  C  CE  . LYS E  5  576  ? 17.742  106.145 125.778 1.00 62.99  ? 576  LYS A CE  1 
ATOM   6754  N  NZ  . LYS E  5  576  ? 16.391  105.779 125.242 1.00 76.06  ? 576  LYS A NZ  1 
ATOM   6755  N  N   . VAL E  5  577  ? 18.347  112.848 125.350 1.00 51.11  ? 577  VAL A N   1 
ATOM   6756  C  CA  . VAL E  5  577  ? 19.331  113.903 125.513 1.00 53.25  ? 577  VAL A CA  1 
ATOM   6757  C  C   . VAL E  5  577  ? 20.114  113.693 126.798 1.00 50.92  ? 577  VAL A C   1 
ATOM   6758  O  O   . VAL E  5  577  ? 19.538  113.596 127.870 1.00 49.88  ? 577  VAL A O   1 
ATOM   6759  C  CB  . VAL E  5  577  ? 18.685  115.292 125.499 1.00 57.38  ? 577  VAL A CB  1 
ATOM   6760  C  CG1 . VAL E  5  577  ? 19.700  116.362 125.864 1.00 54.43  ? 577  VAL A CG1 1 
ATOM   6761  C  CG2 . VAL E  5  577  ? 18.111  115.573 124.138 1.00 63.11  ? 577  VAL A CG2 1 
ATOM   6762  N  N   . TYR E  5  578  ? 21.432  113.604 126.674 1.00 52.76  ? 578  TYR A N   1 
ATOM   6763  C  CA  . TYR E  5  578  ? 22.302  113.440 127.829 1.00 53.06  ? 578  TYR A CA  1 
ATOM   6764  C  C   . TYR E  5  578  ? 22.511  114.806 128.468 1.00 54.27  ? 578  TYR A C   1 
ATOM   6765  O  O   . TYR E  5  578  ? 23.530  115.468 128.238 1.00 58.82  ? 578  TYR A O   1 
ATOM   6766  C  CB  . TYR E  5  578  ? 23.641  112.799 127.423 1.00 49.50  ? 578  TYR A CB  1 
ATOM   6767  C  CG  . TYR E  5  578  ? 23.601  111.294 127.272 1.00 75.68  ? 578  TYR A CG  1 
ATOM   6768  C  CD1 . TYR E  5  578  ? 22.801  110.700 126.315 1.00 78.97  ? 578  TYR A CD1 1 
ATOM   6769  C  CD2 . TYR E  5  578  ? 24.375  110.461 128.079 1.00 79.92  ? 578  TYR A CD2 1 
ATOM   6770  C  CE1 . TYR E  5  578  ? 22.758  109.320 126.161 1.00 78.41  ? 578  TYR A CE1 1 
ATOM   6771  C  CE2 . TYR E  5  578  ? 24.331  109.076 127.937 1.00 80.38  ? 578  TYR A CE2 1 
ATOM   6772  C  CZ  . TYR E  5  578  ? 23.516  108.521 126.968 1.00 79.88  ? 578  TYR A CZ  1 
ATOM   6773  O  OH  . TYR E  5  578  ? 23.449  107.163 126.784 1.00 80.25  ? 578  TYR A OH  1 
ATOM   6774  N  N   . ARG E  5  579  ? 21.525  115.218 129.257 1.00 48.90  ? 579  ARG A N   1 
ATOM   6775  C  CA  . ARG E  5  579  ? 21.494  116.526 129.905 1.00 61.10  ? 579  ARG A CA  1 
ATOM   6776  C  C   . ARG E  5  579  ? 22.379  116.616 131.146 1.00 61.14  ? 579  ARG A C   1 
ATOM   6777  O  O   . ARG E  5  579  ? 22.647  115.620 131.798 1.00 47.51  ? 579  ARG A O   1 
ATOM   6778  C  CB  . ARG E  5  579  ? 20.064  116.832 130.322 1.00 61.90  ? 579  ARG A CB  1 
ATOM   6779  C  CG  . ARG E  5  579  ? 19.497  115.838 131.317 1.00 47.87  ? 579  ARG A CG  1 
ATOM   6780  C  CD  . ARG E  5  579  ? 18.230  116.370 131.945 1.00 53.09  ? 579  ARG A CD  1 
ATOM   6781  N  NE  . ARG E  5  579  ? 17.706  115.466 132.961 1.00 51.99  ? 579  ARG A NE  1 
ATOM   6782  C  CZ  . ARG E  5  579  ? 18.088  115.470 134.235 1.00 57.70  ? 579  ARG A CZ  1 
ATOM   6783  N  NH1 . ARG E  5  579  ? 18.997  116.347 134.651 1.00 55.23  ? 579  ARG A NH1 1 
ATOM   6784  N  NH2 . ARG E  5  579  ? 17.563  114.597 135.089 1.00 59.17  ? 579  ARG A NH2 1 
ATOM   6785  N  N   . HIS E  5  580  ? 22.814  117.823 131.485 1.00 67.13  ? 580  HIS A N   1 
ATOM   6786  C  CA  . HIS E  5  580  ? 23.558  118.032 132.719 1.00 48.03  ? 580  HIS A CA  1 
ATOM   6787  C  C   . HIS E  5  580  ? 22.679  117.719 133.928 1.00 52.75  ? 580  HIS A C   1 
ATOM   6788  O  O   . HIS E  5  580  ? 21.455  117.817 133.865 1.00 49.82  ? 580  HIS A O   1 
ATOM   6789  C  CB  . HIS E  5  580  ? 23.995  119.475 132.818 1.00 48.69  ? 580  HIS A CB  1 
ATOM   6790  C  CG  . HIS E  5  580  ? 25.125  119.843 131.918 1.00 49.49  ? 580  HIS A CG  1 
ATOM   6791  N  ND1 . HIS E  5  580  ? 25.326  121.128 131.466 1.00 50.43  ? 580  HIS A ND1 1 
ATOM   6792  C  CD2 . HIS E  5  580  ? 26.145  119.106 131.419 1.00 54.23  ? 580  HIS A CD2 1 
ATOM   6793  C  CE1 . HIS E  5  580  ? 26.406  121.163 130.709 1.00 78.93  ? 580  HIS A CE1 1 
ATOM   6794  N  NE2 . HIS E  5  580  ? 26.925  119.950 130.672 1.00 50.54  ? 580  HIS A NE2 1 
ATOM   6795  N  N   . ILE E  5  581  ? 23.313  117.336 135.028 1.00 46.52  ? 581  ILE A N   1 
ATOM   6796  C  CA  . ILE E  5  581  ? 22.641  117.174 136.305 1.00 45.81  ? 581  ILE A CA  1 
ATOM   6797  C  C   . ILE E  5  581  ? 22.124  118.545 136.718 1.00 53.97  ? 581  ILE A C   1 
ATOM   6798  O  O   . ILE E  5  581  ? 22.756  119.561 136.417 1.00 46.89  ? 581  ILE A O   1 
ATOM   6799  C  CB  . ILE E  5  581  ? 23.636  116.627 137.352 1.00 48.84  ? 581  ILE A CB  1 
ATOM   6800  C  CG1 . ILE E  5  581  ? 22.966  116.300 138.679 1.00 49.49  ? 581  ILE A CG1 1 
ATOM   6801  C  CG2 . ILE E  5  581  ? 24.780  117.593 137.602 1.00 45.62  ? 581  ILE A CG2 1 
ATOM   6802  C  CD1 . ILE E  5  581  ? 23.939  115.687 139.635 1.00 43.92  ? 581  ILE A CD1 1 
ATOM   6803  N  N   . LYS E  5  582  ? 20.962  118.577 137.367 1.00 49.08  ? 582  LYS A N   1 
ATOM   6804  C  CA  . LYS E  5  582  ? 20.376  119.833 137.852 1.00 52.73  ? 582  LYS A CA  1 
ATOM   6805  C  C   . LYS E  5  582  ? 19.582  119.671 139.161 1.00 57.62  ? 582  LYS A C   1 
ATOM   6806  O  O   . LYS E  5  582  ? 19.591  118.609 139.779 1.00 64.14  ? 582  LYS A O   1 
ATOM   6807  C  CB  . LYS E  5  582  ? 19.547  120.540 136.765 1.00 61.36  ? 582  LYS A CB  1 
ATOM   6808  C  CG  . LYS E  5  582  ? 18.503  119.711 136.027 1.00 47.17  ? 582  LYS A CG  1 
ATOM   6809  C  CD  . LYS E  5  582  ? 17.672  120.606 135.113 1.00 74.27  ? 582  LYS A CD  1 
ATOM   6810  C  CE  . LYS E  5  582  ? 16.674  119.822 134.281 1.00 79.55  ? 582  LYS A CE  1 
ATOM   6811  N  NZ  . LYS E  5  582  ? 15.300  120.435 134.284 1.00 82.92  ? 582  LYS A NZ  1 
ATOM   6812  N  N   . ASN E  5  583  ? 18.901  120.723 139.594 1.00 55.70  ? 583  ASN A N   1 
ATOM   6813  C  CA  . ASN E  5  583  ? 18.410  120.759 140.970 1.00 49.36  ? 583  ASN A CA  1 
ATOM   6814  C  C   . ASN E  5  583  ? 17.246  119.812 141.243 1.00 48.32  ? 583  ASN A C   1 
ATOM   6815  O  O   . ASN E  5  583  ? 16.932  119.479 142.385 1.00 52.03  ? 583  ASN A O   1 
ATOM   6816  C  CB  . ASN E  5  583  ? 18.075  122.188 141.365 1.00 46.60  ? 583  ASN A CB  1 
ATOM   6817  C  CG  . ASN E  5  583  ? 19.312  123.041 141.532 1.00 57.55  ? 583  ASN A CG  1 
ATOM   6818  O  OD1 . ASN E  5  583  ? 20.440  122.547 141.438 1.00 49.07  ? 583  ASN A OD1 1 
ATOM   6819  N  ND2 . ASN E  5  583  ? 19.110  124.330 141.799 1.00 66.05  ? 583  ASN A ND2 1 
ATOM   6820  N  N   . ARG E  5  584  ? 16.631  119.367 140.161 1.00 53.02  ? 584  ARG A N   1 
ATOM   6821  C  CA  . ARG E  5  584  ? 15.521  118.421 140.170 1.00 50.39  ? 584  ARG A CA  1 
ATOM   6822  C  C   . ARG E  5  584  ? 16.040  117.013 140.585 1.00 62.02  ? 584  ARG A C   1 
ATOM   6823  O  O   . ARG E  5  584  ? 15.260  116.123 140.970 1.00 61.61  ? 584  ARG A O   1 
ATOM   6824  C  CB  . ARG E  5  584  ? 14.981  118.403 138.724 1.00 45.86  ? 584  ARG A CB  1 
ATOM   6825  C  CG  . ARG E  5  584  ? 13.550  118.089 138.546 1.00 61.26  ? 584  ARG A CG  1 
ATOM   6826  C  CD  . ARG E  5  584  ? 13.385  116.932 137.588 1.00 69.56  ? 584  ARG A CD  1 
ATOM   6827  N  NE  . ARG E  5  584  ? 13.811  117.177 136.211 1.00 67.40  ? 584  ARG A NE  1 
ATOM   6828  C  CZ  . ARG E  5  584  ? 14.052  116.193 135.340 1.00 65.32  ? 584  ARG A CZ  1 
ATOM   6829  N  NH1 . ARG E  5  584  ? 13.929  114.924 135.723 1.00 65.11  ? 584  ARG A NH1 1 
ATOM   6830  N  NH2 . ARG E  5  584  ? 14.440  116.463 134.097 1.00 61.36  ? 584  ARG A NH2 1 
ATOM   6831  N  N   . ASP E  5  585  ? 17.365  116.843 140.507 1.00 49.35  ? 585  ASP A N   1 
ATOM   6832  C  CA  . ASP E  5  585  ? 18.011  115.543 140.532 1.00 51.83  ? 585  ASP A CA  1 
ATOM   6833  C  C   . ASP E  5  585  ? 18.341  115.044 141.927 1.00 52.01  ? 585  ASP A C   1 
ATOM   6834  O  O   . ASP E  5  585  ? 18.367  115.821 142.889 1.00 58.64  ? 585  ASP A O   1 
ATOM   6835  C  CB  . ASP E  5  585  ? 19.304  115.594 139.711 1.00 62.36  ? 585  ASP A CB  1 
ATOM   6836  C  CG  . ASP E  5  585  ? 19.064  115.391 138.225 1.00 65.54  ? 585  ASP A CG  1 
ATOM   6837  O  OD1 . ASP E  5  585  ? 18.381  114.392 137.879 1.00 65.79  ? 585  ASP A OD1 1 
ATOM   6838  O  OD2 . ASP E  5  585  ? 19.576  116.218 137.423 1.00 56.79  ? 585  ASP A OD2 1 
ATOM   6839  N  N   . VAL E  5  586  ? 18.610  113.740 142.019 1.00 43.27  ? 586  VAL A N   1 
ATOM   6840  C  CA  . VAL E  5  586  ? 19.001  113.113 143.277 1.00 49.42  ? 586  VAL A CA  1 
ATOM   6841  C  C   . VAL E  5  586  ? 20.340  112.390 143.146 1.00 41.42  ? 586  VAL A C   1 
ATOM   6842  O  O   . VAL E  5  586  ? 20.584  111.692 142.192 1.00 52.46  ? 586  VAL A O   1 
ATOM   6843  C  CB  . VAL E  5  586  ? 17.896  112.150 143.801 1.00 41.29  ? 586  VAL A CB  1 
ATOM   6844  C  CG1 . VAL E  5  586  ? 17.721  110.971 142.872 1.00 50.14  ? 586  VAL A CG1 1 
ATOM   6845  C  CG2 . VAL E  5  586  ? 18.211  111.674 145.211 1.00 46.51  ? 586  VAL A CG2 1 
ATOM   6846  N  N   . VAL E  5  587  ? 21.232  112.581 144.089 1.00 77.29  ? 587  VAL A N   1 
ATOM   6847  C  CA  . VAL E  5  587  ? 22.421  111.778 144.058 1.00 41.01  ? 587  VAL A CA  1 
ATOM   6848  C  C   . VAL E  5  587  ? 22.540  110.960 145.327 1.00 51.50  ? 587  VAL A C   1 
ATOM   6849  O  O   . VAL E  5  587  ? 21.767  111.108 146.264 1.00 50.08  ? 587  VAL A O   1 
ATOM   6850  C  CB  . VAL E  5  587  ? 23.673  112.608 143.916 1.00 49.96  ? 587  VAL A CB  1 
ATOM   6851  C  CG1 . VAL E  5  587  ? 23.758  113.223 142.535 1.00 42.01  ? 587  VAL A CG1 1 
ATOM   6852  C  CG2 . VAL E  5  587  ? 23.718  113.640 145.002 1.00 41.53  ? 587  VAL A CG2 1 
ATOM   6853  N  N   . LEU E  5  588  ? 23.529  110.080 145.336 1.00 50.40  ? 588  LEU A N   1 
ATOM   6854  C  CA  . LEU E  5  588  ? 23.820  109.227 146.469 1.00 39.82  ? 588  LEU A CA  1 
ATOM   6855  C  C   . LEU E  5  588  ? 25.142  109.689 147.082 1.00 47.77  ? 588  LEU A C   1 
ATOM   6856  O  O   . LEU E  5  588  ? 26.190  109.657 146.427 1.00 42.47  ? 588  LEU A O   1 
ATOM   6857  C  CB  . LEU E  5  588  ? 23.948  107.799 145.962 1.00 46.17  ? 588  LEU A CB  1 
ATOM   6858  C  CG  . LEU E  5  588  ? 23.190  106.719 146.708 1.00 54.68  ? 588  LEU A CG  1 
ATOM   6859  C  CD1 . LEU E  5  588  ? 21.749  107.125 146.791 1.00 55.40  ? 588  LEU A CD1 1 
ATOM   6860  C  CD2 . LEU E  5  588  ? 23.344  105.379 145.971 1.00 61.12  ? 588  LEU A CD2 1 
ATOM   6861  N  N   . MET E  5  589  ? 25.107  110.152 148.322 1.00 39.91  ? 589  MET A N   1 
ATOM   6862  C  CA  . MET E  5  589  ? 26.330  110.622 148.953 1.00 40.16  ? 589  MET A CA  1 
ATOM   6863  C  C   . MET E  5  589  ? 26.897  109.546 149.855 1.00 39.84  ? 589  MET A C   1 
ATOM   6864  O  O   . MET E  5  589  ? 26.158  108.848 150.534 1.00 39.45  ? 589  MET A O   1 
ATOM   6865  C  CB  . MET E  5  589  ? 26.057  111.898 149.768 1.00 40.44  ? 589  MET A CB  1 
ATOM   6866  C  CG  . MET E  5  589  ? 25.622  113.088 148.963 1.00 41.10  ? 589  MET A CG  1 
ATOM   6867  S  SD  . MET E  5  589  ? 26.850  113.580 147.754 1.00 50.65  ? 589  MET A SD  1 
ATOM   6868  C  CE  . MET E  5  589  ? 28.302  113.815 148.776 1.00 41.73  ? 589  MET A CE  1 
ATOM   6869  N  N   . ASN E  5  590  ? 28.217  109.451 149.894 1.00 47.97  ? 590  ASN A N   1 
ATOM   6870  C  CA  . ASN E  5  590  ? 28.898  108.392 150.646 1.00 50.83  ? 590  ASN A CA  1 
ATOM   6871  C  C   . ASN E  5  590  ? 30.201  108.846 151.300 1.00 40.34  ? 590  ASN A C   1 
ATOM   6872  O  O   . ASN E  5  590  ? 31.056  109.438 150.657 1.00 52.86  ? 590  ASN A O   1 
ATOM   6873  C  CB  . ASN E  5  590  ? 29.171  107.195 149.724 1.00 48.03  ? 590  ASN A CB  1 
ATOM   6874  C  CG  . ASN E  5  590  ? 29.840  106.052 150.433 1.00 51.78  ? 590  ASN A CG  1 
ATOM   6875  O  OD1 . ASN E  5  590  ? 30.772  105.435 149.910 1.00 51.02  ? 590  ASN A OD1 1 
ATOM   6876  N  ND2 . ASN E  5  590  ? 29.371  105.755 151.637 1.00 56.40  ? 590  ASN A ND2 1 
ATOM   6877  N  N   . ARG E  5  591  ? 30.340  108.579 152.588 1.00 54.12  ? 591  ARG A N   1 
ATOM   6878  C  CA  . ARG E  5  591  ? 31.622  108.739 153.256 1.00 40.70  ? 591  ARG A CA  1 
ATOM   6879  C  C   . ARG E  5  591  ? 32.027  107.391 153.825 1.00 50.13  ? 591  ARG A C   1 
ATOM   6880  O  O   . ARG E  5  591  ? 31.207  106.715 154.440 1.00 52.62  ? 591  ARG A O   1 
ATOM   6881  C  CB  . ARG E  5  591  ? 31.536  109.752 154.378 1.00 47.05  ? 591  ARG A CB  1 
ATOM   6882  C  CG  . ARG E  5  591  ? 32.856  110.020 155.031 1.00 41.58  ? 591  ARG A CG  1 
ATOM   6883  C  CD  . ARG E  5  591  ? 32.617  110.702 156.345 1.00 50.56  ? 591  ARG A CD  1 
ATOM   6884  N  NE  . ARG E  5  591  ? 33.854  111.216 156.909 1.00 50.39  ? 591  ARG A NE  1 
ATOM   6885  C  CZ  . ARG E  5  591  ? 34.632  110.530 157.729 1.00 51.22  ? 591  ARG A CZ  1 
ATOM   6886  N  NH1 . ARG E  5  591  ? 34.290  109.299 158.069 1.00 51.03  ? 591  ARG A NH1 1 
ATOM   6887  N  NH2 . ARG E  5  591  ? 35.751  111.069 158.194 1.00 49.91  ? 591  ARG A NH2 1 
ATOM   6888  N  N   . GLN E  5  592  ? 33.280  107.002 153.590 1.00 49.15  ? 592  GLN A N   1 
ATOM   6889  C  CA  . GLN E  5  592  ? 33.822  105.739 154.079 1.00 44.90  ? 592  GLN A CA  1 
ATOM   6890  C  C   . GLN E  5  592  ? 34.538  105.962 155.394 1.00 46.87  ? 592  GLN A C   1 
ATOM   6891  O  O   . GLN E  5  592  ? 35.050  107.050 155.643 1.00 55.85  ? 592  GLN A O   1 
ATOM   6892  C  CB  . GLN E  5  592  ? 34.809  105.162 153.086 1.00 44.95  ? 592  GLN A CB  1 
ATOM   6893  C  CG  . GLN E  5  592  ? 34.195  104.461 151.890 1.00 55.03  ? 592  GLN A CG  1 
ATOM   6894  C  CD  . GLN E  5  592  ? 35.246  104.174 150.850 1.00 70.07  ? 592  GLN A CD  1 
ATOM   6895  O  OE1 . GLN E  5  592  ? 35.511  103.020 150.522 1.00 70.45  ? 592  GLN A OE1 1 
ATOM   6896  N  NE2 . GLN E  5  592  ? 35.872  105.234 150.331 1.00 74.76  ? 592  GLN A NE2 1 
ATOM   6897  N  N   . PRO E  5  593  ? 34.561  104.946 156.260 1.00 47.27  ? 593  PRO A N   1 
ATOM   6898  C  CA  . PRO E  5  593  ? 33.914  103.637 156.173 1.00 51.65  ? 593  PRO A CA  1 
ATOM   6899  C  C   . PRO E  5  593  ? 32.388  103.709 156.263 1.00 39.97  ? 593  PRO A C   1 
ATOM   6900  O  O   . PRO E  5  593  ? 31.833  104.468 157.047 1.00 87.07  ? 593  PRO A O   1 
ATOM   6901  C  CB  . PRO E  5  593  ? 34.451  102.921 157.413 1.00 55.23  ? 593  PRO A CB  1 
ATOM   6902  C  CG  . PRO E  5  593  ? 34.716  104.027 158.358 1.00 41.14  ? 593  PRO A CG  1 
ATOM   6903  C  CD  . PRO E  5  593  ? 35.311  105.089 157.513 1.00 41.51  ? 593  PRO A CD  1 
ATOM   6904  N  N   . THR E  5  594  ? 31.730  102.885 155.467 1.00 46.97  ? 594  THR A N   1 
ATOM   6905  C  CA  . THR E  5  594  ? 30.283  102.855 155.437 1.00 43.05  ? 594  THR A CA  1 
ATOM   6906  C  C   . THR E  5  594  ? 29.782  101.717 156.317 1.00 44.76  ? 594  THR A C   1 
ATOM   6907  O  O   . THR E  5  594  ? 29.568  100.604 155.829 1.00 45.50  ? 594  THR A O   1 
ATOM   6908  C  CB  . THR E  5  594  ? 29.752  102.625 153.994 1.00 43.25  ? 594  THR A CB  1 
ATOM   6909  O  OG1 . THR E  5  594  ? 30.401  103.515 153.080 1.00 41.20  ? 594  THR A OG1 1 
ATOM   6910  C  CG2 . THR E  5  594  ? 28.274  102.874 153.932 1.00 38.57  ? 594  THR A CG2 1 
ATOM   6911  N  N   . LEU E  5  595  ? 29.567  101.999 157.600 1.00 51.02  ? 595  LEU A N   1 
ATOM   6912  C  CA  . LEU E  5  595  ? 29.263  100.941 158.549 1.00 38.84  ? 595  LEU A CA  1 
ATOM   6913  C  C   . LEU E  5  595  ? 27.777  100.774 158.833 1.00 45.78  ? 595  LEU A C   1 
ATOM   6914  O  O   . LEU E  5  595  ? 27.366  99.775  159.401 1.00 42.08  ? 595  LEU A O   1 
ATOM   6915  C  CB  . LEU E  5  595  ? 30.066  101.130 159.837 1.00 39.24  ? 595  LEU A CB  1 
ATOM   6916  C  CG  . LEU E  5  595  ? 31.567  101.330 159.579 1.00 45.07  ? 595  LEU A CG  1 
ATOM   6917  C  CD1 . LEU E  5  595  ? 32.373  101.583 160.839 1.00 40.21  ? 595  LEU A CD1 1 
ATOM   6918  C  CD2 . LEU E  5  595  ? 32.112  100.156 158.794 1.00 44.88  ? 595  LEU A CD2 1 
ATOM   6919  N  N   . HIS E  5  596  ? 26.958  101.743 158.457 1.00 38.36  ? 596  HIS A N   1 
ATOM   6920  C  CA  . HIS E  5  596  ? 25.533  101.506 158.469 1.00 56.84  ? 596  HIS A CA  1 
ATOM   6921  C  C   . HIS E  5  596  ? 24.927  102.248 157.295 1.00 52.97  ? 596  HIS A C   1 
ATOM   6922  O  O   . HIS E  5  596  ? 25.614  103.025 156.631 1.00 38.12  ? 596  HIS A O   1 
ATOM   6923  C  CB  . HIS E  5  596  ? 24.906  101.875 159.810 1.00 62.81  ? 596  HIS A CB  1 
ATOM   6924  C  CG  . HIS E  5  596  ? 25.074  103.314 160.190 1.00 67.30  ? 596  HIS A CG  1 
ATOM   6925  N  ND1 . HIS E  5  596  ? 26.302  103.928 160.257 1.00 64.05  ? 596  HIS A ND1 1 
ATOM   6926  C  CD2 . HIS E  5  596  ? 24.164  104.256 160.528 1.00 71.88  ? 596  HIS A CD2 1 
ATOM   6927  C  CE1 . HIS E  5  596  ? 26.145  105.189 160.607 1.00 66.51  ? 596  HIS A CE1 1 
ATOM   6928  N  NE2 . HIS E  5  596  ? 24.856  105.413 160.780 1.00 72.43  ? 596  HIS A NE2 1 
ATOM   6929  N  N   . LYS E  5  597  ? 23.663  101.975 156.997 1.00 38.94  ? 597  LYS A N   1 
ATOM   6930  C  CA  . LYS E  5  597  ? 23.084  102.510 155.774 1.00 41.40  ? 597  LYS A CA  1 
ATOM   6931  C  C   . LYS E  5  597  ? 23.000  104.052 155.725 1.00 42.39  ? 597  LYS A C   1 
ATOM   6932  O  O   . LYS E  5  597  ? 23.067  104.640 154.663 1.00 57.29  ? 597  LYS A O   1 
ATOM   6933  C  CB  . LYS E  5  597  ? 21.764  101.812 155.395 1.00 37.58  ? 597  LYS A CB  1 
ATOM   6934  C  CG  . LYS E  5  597  ? 20.773  101.642 156.479 1.00 37.58  ? 597  LYS A CG  1 
ATOM   6935  C  CD  . LYS E  5  597  ? 19.520  100.989 155.974 1.00 52.77  ? 597  LYS A CD  1 
ATOM   6936  C  CE  . LYS E  5  597  ? 18.534  100.673 157.096 1.00 37.61  ? 597  LYS A CE  1 
ATOM   6937  N  NZ  . LYS E  5  597  ? 17.682  101.829 157.495 1.00 46.11  ? 597  LYS A NZ  1 
ATOM   6938  N  N   . ALA E  5  598  ? 22.916  104.709 156.866 1.00 38.08  ? 598  ALA A N   1 
ATOM   6939  C  CA  . ALA E  5  598  ? 22.898  106.167 156.871 1.00 47.70  ? 598  ALA A CA  1 
ATOM   6940  C  C   . ALA E  5  598  ? 24.232  106.794 156.466 1.00 46.50  ? 598  ALA A C   1 
ATOM   6941  O  O   . ALA E  5  598  ? 24.331  108.008 156.363 1.00 44.39  ? 598  ALA A O   1 
ATOM   6942  C  CB  . ALA E  5  598  ? 22.460  106.702 158.223 1.00 38.59  ? 598  ALA A CB  1 
ATOM   6943  N  N   . SER E  5  599  ? 25.267  105.987 156.250 1.00 48.25  ? 599  SER A N   1 
ATOM   6944  C  CA  . SER E  5  599  ? 26.499  106.531 155.676 1.00 50.01  ? 599  SER A CA  1 
ATOM   6945  C  C   . SER E  5  599  ? 26.439  106.483 154.158 1.00 49.77  ? 599  SER A C   1 
ATOM   6946  O  O   . SER E  5  599  ? 27.434  106.740 153.485 1.00 56.34  ? 599  SER A O   1 
ATOM   6947  C  CB  . SER E  5  599  ? 27.736  105.801 156.174 1.00 56.50  ? 599  SER A CB  1 
ATOM   6948  O  OG  . SER E  5  599  ? 28.165  106.328 157.417 1.00 72.67  ? 599  SER A OG  1 
ATOM   6949  N  N   . MET E  5  600  ? 25.274  106.125 153.626 1.00 40.13  ? 600  MET A N   1 
ATOM   6950  C  CA  . MET E  5  600  ? 25.011  106.273 152.204 1.00 41.29  ? 600  MET A CA  1 
ATOM   6951  C  C   . MET E  5  600  ? 23.582  106.698 151.926 1.00 46.27  ? 600  MET A C   1 
ATOM   6952  O  O   . MET E  5  600  ? 22.702  105.862 151.786 1.00 52.35  ? 600  MET A O   1 
ATOM   6953  C  CB  . MET E  5  600  ? 25.279  104.983 151.462 1.00 40.50  ? 600  MET A CB  1 
ATOM   6954  C  CG  . MET E  5  600  ? 25.415  105.227 150.002 1.00 38.61  ? 600  MET A CG  1 
ATOM   6955  S  SD  . MET E  5  600  ? 26.050  103.785 149.195 1.00 70.67  ? 600  MET A SD  1 
ATOM   6956  C  CE  . MET E  5  600  ? 26.789  104.530 147.750 1.00 53.20  ? 600  MET A CE  1 
ATOM   6957  N  N   . MET E  5  601  ? 23.345  107.999 151.848 1.00 42.69  ? 601  MET A N   1 
ATOM   6958  C  CA  . MET E  5  601  ? 21.985  108.480 151.684 1.00 41.02  ? 601  MET A CA  1 
ATOM   6959  C  C   . MET E  5  601  ? 21.748  109.234 150.375 1.00 44.66  ? 601  MET A C   1 
ATOM   6960  O  O   . MET E  5  601  ? 22.691  109.676 149.700 1.00 42.38  ? 601  MET A O   1 
ATOM   6961  C  CB  . MET E  5  601  ? 21.629  109.380 152.845 1.00 43.87  ? 601  MET A CB  1 
ATOM   6962  C  CG  . MET E  5  601  ? 21.566  108.696 154.195 1.00 51.30  ? 601  MET A CG  1 
ATOM   6963  S  SD  . MET E  5  601  ? 21.579  110.042 155.377 1.00 48.92  ? 601  MET A SD  1 
ATOM   6964  C  CE  . MET E  5  601  ? 20.767  109.304 156.768 1.00 111.01 ? 601  MET A CE  1 
ATOM   6965  N  N   . GLY E  5  602  ? 20.474  109.391 150.032 1.00 42.16  ? 602  GLY A N   1 
ATOM   6966  C  CA  . GLY E  5  602  ? 20.096  110.213 148.900 1.00 39.55  ? 602  GLY A CA  1 
ATOM   6967  C  C   . GLY E  5  602  ? 19.880  111.673 149.250 1.00 49.21  ? 602  GLY A C   1 
ATOM   6968  O  O   . GLY E  5  602  ? 19.088  111.990 150.133 1.00 55.28  ? 602  GLY A O   1 
ATOM   6969  N  N   . HIS E  5  603  ? 20.582  112.560 148.549 1.00 40.36  ? 603  HIS A N   1 
ATOM   6970  C  CA  . HIS E  5  603  ? 20.399  114.002 148.696 1.00 48.25  ? 603  HIS A CA  1 
ATOM   6971  C  C   . HIS E  5  603  ? 19.871  114.638 147.409 1.00 47.12  ? 603  HIS A C   1 
ATOM   6972  O  O   . HIS E  5  603  ? 20.201  114.196 146.302 1.00 47.19  ? 603  HIS A O   1 
ATOM   6973  C  CB  . HIS E  5  603  ? 21.716  114.672 149.054 1.00 41.15  ? 603  HIS A CB  1 
ATOM   6974  C  CG  . HIS E  5  603  ? 22.321  114.183 150.329 1.00 40.86  ? 603  HIS A CG  1 
ATOM   6975  N  ND1 . HIS E  5  603  ? 22.673  115.029 151.361 1.00 47.76  ? 603  HIS A ND1 1 
ATOM   6976  C  CD2 . HIS E  5  603  ? 22.668  112.939 150.733 1.00 40.35  ? 603  HIS A CD2 1 
ATOM   6977  C  CE1 . HIS E  5  603  ? 23.209  114.329 152.342 1.00 47.58  ? 603  HIS A CE1 1 
ATOM   6978  N  NE2 . HIS E  5  603  ? 23.223  113.058 151.982 1.00 53.80  ? 603  HIS A NE2 1 
ATOM   6979  N  N   . LYS E  5  604  ? 19.054  115.679 147.566 1.00 42.31  ? 604  LYS A N   1 
ATOM   6980  C  CA  . LYS E  5  604  ? 18.589  116.477 146.441 1.00 42.36  ? 604  LYS A CA  1 
ATOM   6981  C  C   . LYS E  5  604  ? 19.726  117.382 145.970 1.00 49.57  ? 604  LYS A C   1 
ATOM   6982  O  O   . LYS E  5  604  ? 20.441  117.967 146.779 1.00 47.14  ? 604  LYS A O   1 
ATOM   6983  C  CB  . LYS E  5  604  ? 17.377  117.315 146.858 1.00 49.96  ? 604  LYS A CB  1 
ATOM   6984  C  CG  . LYS E  5  604  ? 16.104  116.499 147.092 1.00 54.66  ? 604  LYS A CG  1 
ATOM   6985  C  CD  . LYS E  5  604  ? 14.914  117.380 147.429 1.00 65.35  ? 604  LYS A CD  1 
ATOM   6986  C  CE  . LYS E  5  604  ? 13.650  116.560 147.704 1.00 79.89  ? 604  LYS A CE  1 
ATOM   6987  N  NZ  . LYS E  5  604  ? 12.898  116.183 146.453 1.00 88.38  ? 604  LYS A NZ  1 
ATOM   6988  N  N   . VAL E  5  605  ? 19.913  117.489 144.660 1.00 45.85  ? 605  VAL A N   1 
ATOM   6989  C  CA  . VAL E  5  605  ? 21.013  118.294 144.134 1.00 46.76  ? 605  VAL A CA  1 
ATOM   6990  C  C   . VAL E  5  605  ? 20.717  119.792 144.190 1.00 49.47  ? 605  VAL A C   1 
ATOM   6991  O  O   . VAL E  5  605  ? 19.615  120.233 143.869 1.00 44.74  ? 605  VAL A O   1 
ATOM   6992  C  CB  . VAL E  5  605  ? 21.344  117.887 142.696 1.00 48.66  ? 605  VAL A CB  1 
ATOM   6993  C  CG1 . VAL E  5  605  ? 22.364  118.848 142.055 1.00 44.48  ? 605  VAL A CG1 1 
ATOM   6994  C  CG2 . VAL E  5  605  ? 21.847  116.464 142.682 1.00 46.19  ? 605  VAL A CG2 1 
ATOM   6995  N  N   . ARG E  5  606  ? 21.706  120.566 144.626 1.00 46.27  ? 606  ARG A N   1 
ATOM   6996  C  CA  . ARG E  5  606  ? 21.647  122.028 144.543 1.00 46.17  ? 606  ARG A CA  1 
ATOM   6997  C  C   . ARG E  5  606  ? 22.968  122.555 143.983 1.00 49.99  ? 606  ARG A C   1 
ATOM   6998  O  O   . ARG E  5  606  ? 23.984  122.605 144.697 1.00 50.17  ? 606  ARG A O   1 
ATOM   6999  C  CB  . ARG E  5  606  ? 21.366  122.623 145.923 1.00 51.60  ? 606  ARG A CB  1 
ATOM   7000  C  CG  . ARG E  5  606  ? 21.453  124.133 146.013 1.00 59.93  ? 606  ARG A CG  1 
ATOM   7001  C  CD  . ARG E  5  606  ? 20.103  124.829 145.858 1.00 73.27  ? 606  ARG A CD  1 
ATOM   7002  N  NE  . ARG E  5  606  ? 20.195  126.232 146.273 1.00 86.23  ? 606  ARG A NE  1 
ATOM   7003  C  CZ  . ARG E  5  606  ? 19.960  126.670 147.513 1.00 94.85  ? 606  ARG A CZ  1 
ATOM   7004  N  NH1 . ARG E  5  606  ? 19.598  125.823 148.475 1.00 95.67  ? 606  ARG A NH1 1 
ATOM   7005  N  NH2 . ARG E  5  606  ? 20.085  127.964 147.796 1.00 94.35  ? 606  ARG A NH2 1 
ATOM   7006  N  N   . VAL E  5  607  ? 22.964  122.911 142.697 1.00 49.49  ? 607  VAL A N   1 
ATOM   7007  C  CA  . VAL E  5  607  ? 24.162  123.438 142.057 1.00 47.28  ? 607  VAL A CA  1 
ATOM   7008  C  C   . VAL E  5  607  ? 24.479  124.858 142.528 1.00 54.33  ? 607  VAL A C   1 
ATOM   7009  O  O   . VAL E  5  607  ? 23.616  125.733 142.528 1.00 56.16  ? 607  VAL A O   1 
ATOM   7010  C  CB  . VAL E  5  607  ? 24.034  123.407 140.546 1.00 49.91  ? 607  VAL A CB  1 
ATOM   7011  C  CG1 . VAL E  5  607  ? 25.276  123.975 139.914 1.00 49.31  ? 607  VAL A CG1 1 
ATOM   7012  C  CG2 . VAL E  5  607  ? 23.860  121.988 140.101 1.00 54.21  ? 607  VAL A CG2 1 
ATOM   7013  N  N   . LEU E  5  608  ? 25.725  125.073 142.928 1.00 52.65  ? 608  LEU A N   1 
ATOM   7014  C  CA  . LEU E  5  608  ? 26.160  126.323 143.527 1.00 49.21  ? 608  LEU A CA  1 
ATOM   7015  C  C   . LEU E  5  608  ? 27.298  126.956 142.734 1.00 63.35  ? 608  LEU A C   1 
ATOM   7016  O  O   . LEU E  5  608  ? 28.378  126.375 142.615 1.00 71.40  ? 608  LEU A O   1 
ATOM   7017  C  CB  . LEU E  5  608  ? 26.667  126.059 144.942 1.00 48.85  ? 608  LEU A CB  1 
ATOM   7018  C  CG  . LEU E  5  608  ? 25.738  125.559 146.038 1.00 48.15  ? 608  LEU A CG  1 
ATOM   7019  C  CD1 . LEU E  5  608  ? 26.517  125.409 147.327 1.00 48.03  ? 608  LEU A CD1 1 
ATOM   7020  C  CD2 . LEU E  5  608  ? 24.587  126.494 146.241 1.00 48.65  ? 608  LEU A CD2 1 
ATOM   7021  N  N   . PRO E  5  609  ? 27.076  128.160 142.204 1.00 58.29  ? 609  PRO A N   1 
ATOM   7022  C  CA  . PRO E  5  609  ? 28.125  128.820 141.411 1.00 52.01  ? 609  PRO A CA  1 
ATOM   7023  C  C   . PRO E  5  609  ? 29.409  129.032 142.225 1.00 58.99  ? 609  PRO A C   1 
ATOM   7024  O  O   . PRO E  5  609  ? 29.369  129.185 143.460 1.00 55.32  ? 609  PRO A O   1 
ATOM   7025  C  CB  . PRO E  5  609  ? 27.486  130.164 141.039 1.00 53.05  ? 609  PRO A CB  1 
ATOM   7026  C  CG  . PRO E  5  609  ? 26.017  129.945 141.153 1.00 52.55  ? 609  PRO A CG  1 
ATOM   7027  C  CD  . PRO E  5  609  ? 25.827  128.941 142.251 1.00 55.72  ? 609  PRO A CD  1 
ATOM   7028  N  N   . ASN E  5  610  ? 30.540  129.019 141.527 1.00 55.63  ? 610  ASN A N   1 
ATOM   7029  C  CA  . ASN E  5  610  ? 31.841  129.344 142.124 1.00 60.43  ? 610  ASN A CA  1 
ATOM   7030  C  C   . ASN E  5  610  ? 32.407  128.375 143.165 1.00 61.04  ? 610  ASN A C   1 
ATOM   7031  O  O   . ASN E  5  610  ? 33.511  128.592 143.646 1.00 69.55  ? 610  ASN A O   1 
ATOM   7032  C  CB  . ASN E  5  610  ? 31.832  130.747 142.713 1.00 67.39  ? 610  ASN A CB  1 
ATOM   7033  C  CG  . ASN E  5  610  ? 31.187  131.753 141.793 1.00 80.33  ? 610  ASN A CG  1 
ATOM   7034  O  OD1 . ASN E  5  610  ? 31.595  131.898 140.640 1.00 86.58  ? 610  ASN A OD1 1 
ATOM   7035  N  ND2 . ASN E  5  610  ? 30.156  132.445 142.290 1.00 81.35  ? 610  ASN A ND2 1 
ATOM   7036  N  N   . GLU E  5  611  ? 31.692  127.310 143.509 1.00 53.69  ? 611  GLU A N   1 
ATOM   7037  C  CA  . GLU E  5  611  ? 32.238  126.366 144.482 1.00 53.28  ? 611  GLU A CA  1 
ATOM   7038  C  C   . GLU E  5  611  ? 33.173  125.338 143.856 1.00 52.91  ? 611  GLU A C   1 
ATOM   7039  O  O   . GLU E  5  611  ? 32.967  124.924 142.707 1.00 63.37  ? 611  GLU A O   1 
ATOM   7040  C  CB  . GLU E  5  611  ? 31.137  125.678 145.315 1.00 49.69  ? 611  GLU A CB  1 
ATOM   7041  C  CG  . GLU E  5  611  ? 31.243  125.943 146.842 1.00 81.26  ? 611  GLU A CG  1 
ATOM   7042  C  CD  . GLU E  5  611  ? 30.374  127.107 147.280 1.00 84.91  ? 611  GLU A CD  1 
ATOM   7043  O  OE1 . GLU E  5  611  ? 29.359  127.334 146.607 1.00 93.56  ? 611  GLU A OE1 1 
ATOM   7044  O  OE2 . GLU E  5  611  ? 30.677  127.797 148.278 1.00 84.14  ? 611  GLU A OE2 1 
ATOM   7045  N  N   . LYS E  5  612  ? 34.204  124.946 144.611 1.00 51.35  ? 612  LYS A N   1 
ATOM   7046  C  CA  . LYS E  5  612  ? 35.133  123.892 144.184 1.00 53.61  ? 612  LYS A CA  1 
ATOM   7047  C  C   . LYS E  5  612  ? 35.043  122.662 145.076 1.00 53.17  ? 612  LYS A C   1 
ATOM   7048  O  O   . LYS E  5  612  ? 35.639  121.634 144.780 1.00 62.27  ? 612  LYS A O   1 
ATOM   7049  C  CB  . LYS E  5  612  ? 36.585  124.391 144.074 1.00 58.85  ? 612  LYS A CB  1 
ATOM   7050  C  CG  . LYS E  5  612  ? 36.915  125.092 142.745 1.00 76.52  ? 612  LYS A CG  1 
ATOM   7051  C  CD  . LYS E  5  612  ? 38.123  126.039 142.857 1.00 91.07  ? 612  LYS A CD  1 
ATOM   7052  C  CE  . LYS E  5  612  ? 37.703  127.525 142.728 1.00 97.39  ? 612  LYS A CE  1 
ATOM   7053  N  NZ  . LYS E  5  612  ? 38.782  128.512 143.097 1.00 95.93  ? 612  LYS A NZ  1 
ATOM   7054  N  N   . THR E  5  613  ? 34.278  122.754 146.157 1.00 51.13  ? 613  THR A N   1 
ATOM   7055  C  CA  . THR E  5  613  ? 34.017  121.572 146.977 1.00 53.61  ? 613  THR A CA  1 
ATOM   7056  C  C   . THR E  5  613  ? 32.527  121.235 147.136 1.00 46.96  ? 613  THR A C   1 
ATOM   7057  O  O   . THR E  5  613  ? 31.668  122.003 146.775 1.00 61.02  ? 613  THR A O   1 
ATOM   7058  C  CB  . THR E  5  613  ? 34.672  121.684 148.367 1.00 51.23  ? 613  THR A CB  1 
ATOM   7059  O  OG1 . THR E  5  613  ? 33.840  122.457 149.230 1.00 49.70  ? 613  THR A OG1 1 
ATOM   7060  C  CG2 . THR E  5  613  ? 36.052  122.326 148.273 1.00 49.05  ? 613  THR A CG2 1 
ATOM   7061  N  N   . LEU E  5  614  ? 32.245  120.048 147.646 1.00 54.24  ? 614  LEU A N   1 
ATOM   7062  C  CA  . LEU E  5  614  ? 30.893  119.632 147.989 1.00 48.02  ? 614  LEU A CA  1 
ATOM   7063  C  C   . LEU E  5  614  ? 30.457  120.291 149.292 1.00 48.43  ? 614  LEU A C   1 
ATOM   7064  O  O   . LEU E  5  614  ? 31.172  120.249 150.287 1.00 48.15  ? 614  LEU A O   1 
ATOM   7065  C  CB  . LEU E  5  614  ? 30.849  118.118 148.195 1.00 44.49  ? 614  LEU A CB  1 
ATOM   7066  C  CG  . LEU E  5  614  ? 31.035  117.289 146.948 1.00 53.22  ? 614  LEU A CG  1 
ATOM   7067  C  CD1 . LEU E  5  614  ? 31.149  115.802 147.356 1.00 46.84  ? 614  LEU A CD1 1 
ATOM   7068  C  CD2 . LEU E  5  614  ? 29.877  117.535 146.014 1.00 44.20  ? 614  LEU A CD2 1 
ATOM   7069  N  N   . ARG E  5  615  ? 29.265  120.871 149.309 1.00 49.87  ? 615  ARG A N   1 
ATOM   7070  C  CA  . ARG E  5  615  ? 28.799  121.526 150.522 1.00 48.84  ? 615  ARG A CA  1 
ATOM   7071  C  C   . ARG E  5  615  ? 27.656  120.779 151.165 1.00 51.60  ? 615  ARG A C   1 
ATOM   7072  O  O   . ARG E  5  615  ? 26.719  120.356 150.491 1.00 57.02  ? 615  ARG A O   1 
ATOM   7073  C  CB  . ARG E  5  615  ? 28.519  123.002 150.270 1.00 46.60  ? 615  ARG A CB  1 
ATOM   7074  C  CG  . ARG E  5  615  ? 29.795  123.645 149.778 1.00 59.31  ? 615  ARG A CG  1 
ATOM   7075  C  CD  . ARG E  5  615  ? 29.934  125.068 150.079 1.00 48.45  ? 615  ARG A CD  1 
ATOM   7076  N  NE  . ARG E  5  615  ? 30.595  125.342 151.349 1.00 53.39  ? 615  ARG A NE  1 
ATOM   7077  C  CZ  . ARG E  5  615  ? 31.693  126.087 151.464 1.00 53.22  ? 615  ARG A CZ  1 
ATOM   7078  N  NH1 . ARG E  5  615  ? 32.281  126.581 150.392 1.00 50.37  ? 615  ARG A NH1 1 
ATOM   7079  N  NH2 . ARG E  5  615  ? 32.213  126.323 152.652 1.00 50.20  ? 615  ARG A NH2 1 
ATOM   7080  N  N   . LEU E  5  616  ? 27.768  120.591 152.473 1.00 44.87  ? 616  LEU A N   1 
ATOM   7081  C  CA  . LEU E  5  616  ? 26.912  119.670 153.190 1.00 51.57  ? 616  LEU A CA  1 
ATOM   7082  C  C   . LEU E  5  616  ? 26.429  120.311 154.483 1.00 48.62  ? 616  LEU A C   1 
ATOM   7083  O  O   . LEU E  5  616  ? 27.228  120.801 155.270 1.00 46.20  ? 616  LEU A O   1 
ATOM   7084  C  CB  . LEU E  5  616  ? 27.709  118.407 153.518 1.00 43.62  ? 616  LEU A CB  1 
ATOM   7085  C  CG  . LEU E  5  616  ? 26.958  117.312 154.255 1.00 44.43  ? 616  LEU A CG  1 
ATOM   7086  C  CD1 . LEU E  5  616  ? 26.004  116.636 153.317 1.00 43.26  ? 616  LEU A CD1 1 
ATOM   7087  C  CD2 . LEU E  5  616  ? 27.943  116.321 154.822 1.00 42.64  ? 616  LEU A CD2 1 
ATOM   7088  N  N   . HIS E  5  617  ? 25.126  120.295 154.713 1.00 51.34  ? 617  HIS A N   1 
ATOM   7089  C  CA  . HIS E  5  617  ? 24.586  120.834 155.954 1.00 50.25  ? 617  HIS A CA  1 
ATOM   7090  C  C   . HIS E  5  617  ? 25.054  120.049 157.164 1.00 44.42  ? 617  HIS A C   1 
ATOM   7091  O  O   . HIS E  5  617  ? 25.175  118.824 157.105 1.00 61.51  ? 617  HIS A O   1 
ATOM   7092  C  CB  . HIS E  5  617  ? 23.050  120.855 155.927 1.00 52.32  ? 617  HIS A CB  1 
ATOM   7093  C  CG  . HIS E  5  617  ? 22.449  121.689 157.014 1.00 57.37  ? 617  HIS A CG  1 
ATOM   7094  N  ND1 . HIS E  5  617  ? 22.473  121.314 158.339 1.00 53.68  ? 617  HIS A ND1 1 
ATOM   7095  C  CD2 . HIS E  5  617  ? 21.836  122.894 156.973 1.00 63.76  ? 617  HIS A CD2 1 
ATOM   7096  C  CE1 . HIS E  5  617  ? 21.897  122.250 159.068 1.00 56.57  ? 617  HIS A CE1 1 
ATOM   7097  N  NE2 . HIS E  5  617  ? 21.501  123.220 158.264 1.00 64.57  ? 617  HIS A NE2 1 
ATOM   7098  N  N   . TYR E  5  618  ? 25.284  120.751 158.268 1.00 45.38  ? 618  TYR A N   1 
ATOM   7099  C  CA  . TYR E  5  618  ? 25.762  120.123 159.490 1.00 45.76  ? 618  TYR A CA  1 
ATOM   7100  C  C   . TYR E  5  618  ? 24.885  118.975 159.983 1.00 44.68  ? 618  TYR A C   1 
ATOM   7101  O  O   . TYR E  5  618  ? 25.403  117.985 160.508 1.00 44.67  ? 618  TYR A O   1 
ATOM   7102  C  CB  . TYR E  5  618  ? 25.877  121.144 160.609 1.00 48.80  ? 618  TYR A CB  1 
ATOM   7103  C  CG  . TYR E  5  618  ? 26.795  122.317 160.353 1.00 50.67  ? 618  TYR A CG  1 
ATOM   7104  C  CD1 . TYR E  5  618  ? 28.152  122.227 160.603 1.00 47.16  ? 618  TYR A CD1 1 
ATOM   7105  C  CD2 . TYR E  5  618  ? 26.291  123.535 159.916 1.00 51.92  ? 618  TYR A CD2 1 
ATOM   7106  C  CE1 . TYR E  5  618  ? 28.976  123.300 160.409 1.00 48.09  ? 618  TYR A CE1 1 
ATOM   7107  C  CE2 . TYR E  5  618  ? 27.118  124.614 159.716 1.00 48.43  ? 618  TYR A CE2 1 
ATOM   7108  C  CZ  . TYR E  5  618  ? 28.455  124.485 159.969 1.00 48.72  ? 618  TYR A CZ  1 
ATOM   7109  O  OH  . TYR E  5  618  ? 29.295  125.544 159.778 1.00 49.99  ? 618  TYR A OH  1 
ATOM   7110  N  N   . ALA E  5  619  ? 23.568  119.097 159.810 1.00 45.51  ? 619  ALA A N   1 
ATOM   7111  C  CA  . ALA E  5  619  ? 22.620  118.093 160.315 1.00 43.57  ? 619  ALA A CA  1 
ATOM   7112  C  C   . ALA E  5  619  ? 22.930  116.664 159.841 1.00 52.11  ? 619  ALA A C   1 
ATOM   7113  O  O   . ALA E  5  619  ? 22.354  115.698 160.331 1.00 61.92  ? 619  ALA A O   1 
ATOM   7114  C  CB  . ALA E  5  619  ? 21.193  118.476 159.960 1.00 43.64  ? 619  ALA A CB  1 
ATOM   7115  N  N   . ASN E  5  620  ? 23.852  116.533 158.896 1.00 46.52  ? 620  ASN A N   1 
ATOM   7116  C  CA  . ASN E  5  620  ? 24.195  115.238 158.328 1.00 42.59  ? 620  ASN A CA  1 
ATOM   7117  C  C   . ASN E  5  620  ? 25.490  114.653 158.860 1.00 48.42  ? 620  ASN A C   1 
ATOM   7118  O  O   . ASN E  5  620  ? 25.839  113.535 158.501 1.00 54.74  ? 620  ASN A O   1 
ATOM   7119  C  CB  . ASN E  5  620  ? 24.315  115.356 156.809 1.00 43.64  ? 620  ASN A CB  1 
ATOM   7120  C  CG  . ASN E  5  620  ? 22.978  115.511 156.136 1.00 46.88  ? 620  ASN A CG  1 
ATOM   7121  O  OD1 . ASN E  5  620  ? 22.020  114.796 156.457 1.00 45.57  ? 620  ASN A OD1 1 
ATOM   7122  N  ND2 . ASN E  5  620  ? 22.890  116.461 155.214 1.00 41.95  ? 620  ASN A ND2 1 
ATOM   7123  N  N   . THR E  5  621  ? 26.229  115.398 159.680 1.00 48.35  ? 621  THR A N   1 
ATOM   7124  C  CA  . THR E  5  621  ? 27.521  114.896 160.129 1.00 46.36  ? 621  THR A CA  1 
ATOM   7125  C  C   . THR E  5  621  ? 27.326  113.633 160.924 1.00 44.26  ? 621  THR A C   1 
ATOM   7126  O  O   . THR E  5  621  ? 28.054  112.668 160.726 1.00 41.82  ? 621  THR A O   1 
ATOM   7127  C  CB  . THR E  5  621  ? 28.296  115.902 160.946 1.00 52.97  ? 621  THR A CB  1 
ATOM   7128  O  OG1 . THR E  5  621  ? 27.443  116.458 161.957 1.00 62.66  ? 621  THR A OG1 1 
ATOM   7129  C  CG2 . THR E  5  621  ? 28.787  116.994 160.042 1.00 51.01  ? 621  THR A CG2 1 
ATOM   7130  N  N   . GLY E  5  622  ? 26.313  113.627 161.784 1.00 42.51  ? 622  GLY A N   1 
ATOM   7131  C  CA  . GLY E  5  622  ? 26.008  112.475 162.608 1.00 41.77  ? 622  GLY A CA  1 
ATOM   7132  C  C   . GLY E  5  622  ? 25.956  111.185 161.813 1.00 48.34  ? 622  GLY A C   1 
ATOM   7133  O  O   . GLY E  5  622  ? 26.673  110.237 162.119 1.00 47.50  ? 622  GLY A O   1 
ATOM   7134  N  N   . ALA E  5  623  ? 25.124  111.176 160.774 1.00 42.72  ? 623  ALA A N   1 
ATOM   7135  C  CA  . ALA E  5  623  ? 24.926  110.016 159.919 1.00 42.05  ? 623  ALA A CA  1 
ATOM   7136  C  C   . ALA E  5  623  ? 26.222  109.574 159.301 1.00 43.57  ? 623  ALA A C   1 
ATOM   7137  O  O   . ALA E  5  623  ? 26.591  108.417 159.384 1.00 50.85  ? 623  ALA A O   1 
ATOM   7138  C  CB  . ALA E  5  623  ? 23.923  110.332 158.834 1.00 39.85  ? 623  ALA A CB  1 
ATOM   7139  N  N   . TYR E  5  624  ? 26.917  110.502 158.674 1.00 40.36  ? 624  TYR A N   1 
ATOM   7140  C  CA  . TYR E  5  624  ? 28.104  110.158 157.901 1.00 43.27  ? 624  TYR A CA  1 
ATOM   7141  C  C   . TYR E  5  624  ? 29.323  110.015 158.770 1.00 46.70  ? 624  TYR A C   1 
ATOM   7142  O  O   . TYR E  5  624  ? 30.353  109.559 158.297 1.00 52.81  ? 624  TYR A O   1 
ATOM   7143  C  CB  . TYR E  5  624  ? 28.383  111.227 156.823 1.00 44.56  ? 624  TYR A CB  1 
ATOM   7144  C  CG  . TYR E  5  624  ? 27.359  111.210 155.732 1.00 47.87  ? 624  TYR A CG  1 
ATOM   7145  C  CD1 . TYR E  5  624  ? 27.349  110.179 154.799 1.00 41.84  ? 624  TYR A CD1 1 
ATOM   7146  C  CD2 . TYR E  5  624  ? 26.371  112.193 155.655 1.00 40.54  ? 624  TYR A CD2 1 
ATOM   7147  C  CE1 . TYR E  5  624  ? 26.400  110.130 153.801 1.00 44.12  ? 624  TYR A CE1 1 
ATOM   7148  C  CE2 . TYR E  5  624  ? 25.412  112.146 154.663 1.00 49.36  ? 624  TYR A CE2 1 
ATOM   7149  C  CZ  . TYR E  5  624  ? 25.440  111.110 153.730 1.00 45.24  ? 624  TYR A CZ  1 
ATOM   7150  O  OH  . TYR E  5  624  ? 24.506  111.027 152.726 1.00 47.94  ? 624  TYR A OH  1 
ATOM   7151  N  N   . ASN E  5  625  ? 29.211  110.438 160.025 1.00 51.94  ? 625  ASN A N   1 
ATOM   7152  C  CA  . ASN E  5  625  ? 30.369  110.524 160.902 1.00 61.08  ? 625  ASN A CA  1 
ATOM   7153  C  C   . ASN E  5  625  ? 31.452  111.446 160.267 1.00 55.34  ? 625  ASN A C   1 
ATOM   7154  O  O   . ASN E  5  625  ? 32.640  111.129 160.222 1.00 58.65  ? 625  ASN A O   1 
ATOM   7155  C  CB  . ASN E  5  625  ? 30.869  109.104 161.242 1.00 66.97  ? 625  ASN A CB  1 
ATOM   7156  C  CG  . ASN E  5  625  ? 31.910  109.093 162.330 1.00 74.36  ? 625  ASN A CG  1 
ATOM   7157  O  OD1 . ASN E  5  625  ? 31.824  109.861 163.281 1.00 84.44  ? 625  ASN A OD1 1 
ATOM   7158  N  ND2 . ASN E  5  625  ? 32.913  108.230 162.189 1.00 69.52  ? 625  ASN A ND2 1 
ATOM   7159  N  N   . ALA E  5  626  ? 31.017  112.606 159.782 1.00 59.77  ? 626  ALA A N   1 
ATOM   7160  C  CA  . ALA E  5  626  ? 31.893  113.515 159.036 1.00 60.08  ? 626  ALA A CA  1 
ATOM   7161  C  C   . ALA E  5  626  ? 32.432  114.612 159.937 1.00 65.50  ? 626  ALA A C   1 
ATOM   7162  O  O   . ALA E  5  626  ? 31.706  115.113 160.788 1.00 73.38  ? 626  ALA A O   1 
ATOM   7163  C  CB  . ALA E  5  626  ? 31.137  114.122 157.880 1.00 53.06  ? 626  ALA A CB  1 
ATOM   7164  N  N   . ASP E  5  627  ? 33.692  115.001 159.743 1.00 59.03  ? 627  ASP A N   1 
ATOM   7165  C  CA  . ASP E  5  627  ? 34.320  115.980 160.634 1.00 54.45  ? 627  ASP A CA  1 
ATOM   7166  C  C   . ASP E  5  627  ? 34.657  117.350 160.028 1.00 56.73  ? 627  ASP A C   1 
ATOM   7167  O  O   . ASP E  5  627  ? 34.986  118.292 160.759 1.00 59.12  ? 627  ASP A O   1 
ATOM   7168  C  CB  . ASP E  5  627  ? 35.583  115.391 161.266 1.00 61.77  ? 627  ASP A CB  1 
ATOM   7169  C  CG  . ASP E  5  627  ? 36.401  114.570 160.294 1.00 76.24  ? 627  ASP A CG  1 
ATOM   7170  O  OD1 . ASP E  5  627  ? 37.114  115.159 159.455 1.00 78.17  ? 627  ASP A OD1 1 
ATOM   7171  O  OD2 . ASP E  5  627  ? 36.340  113.324 160.384 1.00 89.00  ? 627  ASP A OD2 1 
ATOM   7172  N  N   . PHE E  5  628  ? 34.585  117.452 158.709 1.00 46.00  ? 628  PHE A N   1 
ATOM   7173  C  CA  . PHE E  5  628  ? 35.067  118.621 157.967 1.00 50.06  ? 628  PHE A CA  1 
ATOM   7174  C  C   . PHE E  5  628  ? 36.555  118.919 158.116 1.00 50.85  ? 628  PHE A C   1 
ATOM   7175  O  O   . PHE E  5  628  ? 36.987  120.031 157.828 1.00 56.85  ? 628  PHE A O   1 
ATOM   7176  C  CB  . PHE E  5  628  ? 34.231  119.895 158.211 1.00 47.19  ? 628  PHE A CB  1 
ATOM   7177  C  CG  . PHE E  5  628  ? 32.796  119.754 157.845 1.00 55.00  ? 628  PHE A CG  1 
ATOM   7178  C  CD1 . PHE E  5  628  ? 32.401  119.702 156.521 1.00 46.06  ? 628  PHE A CD1 1 
ATOM   7179  C  CD2 . PHE E  5  628  ? 31.840  119.654 158.816 1.00 46.20  ? 628  PHE A CD2 1 
ATOM   7180  C  CE1 . PHE E  5  628  ? 31.069  119.543 156.175 1.00 52.25  ? 628  PHE A CE1 1 
ATOM   7181  C  CE2 . PHE E  5  628  ? 30.501  119.524 158.478 1.00 73.76  ? 628  PHE A CE2 1 
ATOM   7182  C  CZ  . PHE E  5  628  ? 30.115  119.467 157.154 1.00 45.22  ? 628  PHE A CZ  1 
ATOM   7183  N  N   . ASP E  5  629  ? 37.346  117.931 158.532 1.00 49.16  ? 629  ASP A N   1 
ATOM   7184  C  CA  . ASP E  5  629  ? 38.798  118.103 158.603 1.00 49.93  ? 629  ASP A CA  1 
ATOM   7185  C  C   . ASP E  5  629  ? 39.514  117.649 157.315 1.00 55.62  ? 629  ASP A C   1 
ATOM   7186  O  O   . ASP E  5  629  ? 40.632  117.148 157.357 1.00 64.47  ? 629  ASP A O   1 
ATOM   7187  C  CB  . ASP E  5  629  ? 39.355  117.382 159.837 1.00 58.85  ? 629  ASP A CB  1 
ATOM   7188  C  CG  . ASP E  5  629  ? 40.773  117.844 160.222 1.00 65.19  ? 629  ASP A CG  1 
ATOM   7189  O  OD1 . ASP E  5  629  ? 41.163  118.969 159.843 1.00 66.87  ? 629  ASP A OD1 1 
ATOM   7190  O  OD2 . ASP E  5  629  ? 41.492  117.077 160.913 1.00 61.27  ? 629  ASP A OD2 1 
ATOM   7191  N  N   . GLY E  5  630  ? 38.886  117.831 156.162 1.00 55.84  ? 630  GLY A N   1 
ATOM   7192  C  CA  . GLY E  5  630  ? 39.545  117.463 154.923 1.00 48.08  ? 630  GLY A CA  1 
ATOM   7193  C  C   . GLY E  5  630  ? 39.193  116.058 154.487 1.00 53.91  ? 630  GLY A C   1 
ATOM   7194  O  O   . GLY E  5  630  ? 39.794  115.475 153.579 1.00 47.13  ? 630  GLY A O   1 
ATOM   7195  N  N   . ASP E  5  631  ? 38.209  115.500 155.165 1.00 46.79  ? 631  ASP A N   1 
ATOM   7196  C  CA  . ASP E  5  631  ? 37.628  114.256 154.742 1.00 47.82  ? 631  ASP A CA  1 
ATOM   7197  C  C   . ASP E  5  631  ? 36.842  114.433 153.433 1.00 50.85  ? 631  ASP A C   1 
ATOM   7198  O  O   . ASP E  5  631  ? 36.357  115.522 153.114 1.00 56.31  ? 631  ASP A O   1 
ATOM   7199  C  CB  . ASP E  5  631  ? 36.767  113.652 155.864 1.00 57.98  ? 631  ASP A CB  1 
ATOM   7200  C  CG  . ASP E  5  631  ? 35.751  114.626 156.433 1.00 67.95  ? 631  ASP A CG  1 
ATOM   7201  O  OD1 . ASP E  5  631  ? 35.965  115.855 156.318 1.00 83.23  ? 631  ASP A OD1 1 
ATOM   7202  O  OD2 . ASP E  5  631  ? 34.742  114.158 157.013 1.00 60.55  ? 631  ASP A OD2 1 
ATOM   7203  N  N   . GLU E  5  632  ? 36.735  113.346 152.675 1.00 51.95  ? 632  GLU A N   1 
ATOM   7204  C  CA  . GLU E  5  632  ? 36.163  113.382 151.343 1.00 53.72  ? 632  GLU A CA  1 
ATOM   7205  C  C   . GLU E  5  632  ? 34.889  112.558 151.261 1.00 43.30  ? 632  GLU A C   1 
ATOM   7206  O  O   . GLU E  5  632  ? 34.698  111.626 152.016 1.00 63.27  ? 632  GLU A O   1 
ATOM   7207  C  CB  . GLU E  5  632  ? 37.204  112.906 150.336 1.00 44.60  ? 632  GLU A CB  1 
ATOM   7208  C  CG  . GLU E  5  632  ? 38.532  113.640 150.467 1.00 67.87  ? 632  GLU A CG  1 
ATOM   7209  C  CD  . GLU E  5  632  ? 39.643  113.086 149.589 1.00 68.29  ? 632  GLU A CD  1 
ATOM   7210  O  OE1 . GLU E  5  632  ? 39.349  112.304 148.661 1.00 71.23  ? 632  GLU A OE1 1 
ATOM   7211  O  OE2 . GLU E  5  632  ? 40.823  113.435 149.831 1.00 74.27  ? 632  GLU A OE2 1 
ATOM   7212  N  N   . MET E  5  633  ? 33.999  112.930 150.351 1.00 46.16  ? 633  MET A N   1 
ATOM   7213  C  CA  . MET E  5  633  ? 32.813  112.118 150.071 1.00 46.35  ? 633  MET A CA  1 
ATOM   7214  C  C   . MET E  5  633  ? 32.674  111.801 148.597 1.00 42.33  ? 633  MET A C   1 
ATOM   7215  O  O   . MET E  5  633  ? 33.285  112.431 147.759 1.00 71.11  ? 633  MET A O   1 
ATOM   7216  C  CB  . MET E  5  633  ? 31.551  112.762 150.629 1.00 44.47  ? 633  MET A CB  1 
ATOM   7217  C  CG  . MET E  5  633  ? 31.552  112.702 152.121 1.00 48.61  ? 633  MET A CG  1 
ATOM   7218  S  SD  . MET E  5  633  ? 30.095  113.405 152.907 1.00 58.41  ? 633  MET A SD  1 
ATOM   7219  C  CE  . MET E  5  633  ? 28.798  112.410 152.231 1.00 54.43  ? 633  MET A CE  1 
ATOM   7220  N  N   . ASN E  5  634  ? 31.905  110.774 148.310 1.00 45.58  ? 634  ASN A N   1 
ATOM   7221  C  CA  . ASN E  5  634  ? 31.664  110.349 146.949 1.00 43.88  ? 634  ASN A CA  1 
ATOM   7222  C  C   . ASN E  5  634  ? 30.260  110.753 146.583 1.00 45.01  ? 634  ASN A C   1 
ATOM   7223  O  O   . ASN E  5  634  ? 29.330  110.626 147.390 1.00 50.47  ? 634  ASN A O   1 
ATOM   7224  C  CB  . ASN E  5  634  ? 31.736  108.819 146.831 1.00 50.39  ? 634  ASN A CB  1 
ATOM   7225  C  CG  . ASN E  5  634  ? 33.113  108.260 147.087 1.00 57.26  ? 634  ASN A CG  1 
ATOM   7226  O  OD1 . ASN E  5  634  ? 34.131  108.887 146.819 1.00 52.37  ? 634  ASN A OD1 1 
ATOM   7227  N  ND2 . ASN E  5  634  ? 33.145  107.033 147.578 1.00 74.68  ? 634  ASN A ND2 1 
ATOM   7228  N  N   . MET E  5  635  ? 30.082  111.216 145.362 1.00 41.83  ? 635  MET A N   1 
ATOM   7229  C  CA  . MET E  5  635  ? 28.739  111.523 144.903 1.00 46.65  ? 635  MET A CA  1 
ATOM   7230  C  C   . MET E  5  635  ? 28.427  110.586 143.752 1.00 49.18  ? 635  MET A C   1 
ATOM   7231  O  O   . MET E  5  635  ? 29.192  110.509 142.802 1.00 49.27  ? 635  MET A O   1 
ATOM   7232  C  CB  . MET E  5  635  ? 28.650  112.983 144.472 1.00 48.67  ? 635  MET A CB  1 
ATOM   7233  C  CG  . MET E  5  635  ? 27.298  113.414 143.972 1.00 54.33  ? 635  MET A CG  1 
ATOM   7234  S  SD  . MET E  5  635  ? 27.404  115.063 143.299 1.00 50.41  ? 635  MET A SD  1 
ATOM   7235  C  CE  . MET E  5  635  ? 27.066  115.945 144.786 1.00 135.10 ? 635  MET A CE  1 
ATOM   7236  N  N   . HIS E  5  636  ? 27.332  109.846 143.859 1.00 41.12  ? 636  HIS A N   1 
ATOM   7237  C  CA  . HIS E  5  636  ? 26.969  108.881 142.831 1.00 41.10  ? 636  HIS A CA  1 
ATOM   7238  C  C   . HIS E  5  636  ? 25.701  109.329 142.159 1.00 49.86  ? 636  HIS A C   1 
ATOM   7239  O  O   . HIS E  5  636  ? 24.741  109.708 142.843 1.00 40.95  ? 636  HIS A O   1 
ATOM   7240  C  CB  . HIS E  5  636  ? 26.730  107.499 143.451 1.00 44.24  ? 636  HIS A CB  1 
ATOM   7241  C  CG  . HIS E  5  636  ? 27.978  106.821 143.910 1.00 46.54  ? 636  HIS A CG  1 
ATOM   7242  N  ND1 . HIS E  5  636  ? 28.933  106.354 143.033 1.00 40.96  ? 636  HIS A ND1 1 
ATOM   7243  C  CD2 . HIS E  5  636  ? 28.435  106.542 145.154 1.00 45.45  ? 636  HIS A CD2 1 
ATOM   7244  C  CE1 . HIS E  5  636  ? 29.930  105.823 143.719 1.00 40.94  ? 636  HIS A CE1 1 
ATOM   7245  N  NE2 . HIS E  5  636  ? 29.648  105.914 145.007 1.00 50.65  ? 636  HIS A NE2 1 
ATOM   7246  N  N   . PHE E  5  637  ? 25.682  109.269 140.827 1.00 41.63  ? 637  PHE A N   1 
ATOM   7247  C  CA  . PHE E  5  637  ? 24.541  109.802 140.083 1.00 41.88  ? 637  PHE A CA  1 
ATOM   7248  C  C   . PHE E  5  637  ? 23.769  108.727 139.350 1.00 41.85  ? 637  PHE A C   1 
ATOM   7249  O  O   . PHE E  5  637  ? 24.073  108.436 138.198 1.00 54.04  ? 637  PHE A O   1 
ATOM   7250  C  CB  . PHE E  5  637  ? 24.974  110.893 139.099 1.00 42.60  ? 637  PHE A CB  1 
ATOM   7251  C  CG  . PHE E  5  637  ? 23.829  111.672 138.522 1.00 58.58  ? 637  PHE A CG  1 
ATOM   7252  C  CD1 . PHE E  5  637  ? 22.610  111.735 139.178 1.00 63.18  ? 637  PHE A CD1 1 
ATOM   7253  C  CD2 . PHE E  5  637  ? 23.959  112.317 137.315 1.00 43.65  ? 637  PHE A CD2 1 
ATOM   7254  C  CE1 . PHE E  5  637  ? 21.549  112.440 138.631 1.00 70.85  ? 637  PHE A CE1 1 
ATOM   7255  C  CE2 . PHE E  5  637  ? 22.904  113.020 136.770 1.00 59.63  ? 637  PHE A CE2 1 
ATOM   7256  C  CZ  . PHE E  5  637  ? 21.701  113.086 137.422 1.00 43.72  ? 637  PHE A CZ  1 
ATOM   7257  N  N   . PRO E  5  638  ? 22.742  108.160 140.012 1.00 43.54  ? 638  PRO A N   1 
ATOM   7258  C  CA  . PRO E  5  638  ? 21.947  107.059 139.465 1.00 49.43  ? 638  PRO A CA  1 
ATOM   7259  C  C   . PRO E  5  638  ? 21.358  107.439 138.133 1.00 48.69  ? 638  PRO A C   1 
ATOM   7260  O  O   . PRO E  5  638  ? 21.023  108.600 137.906 1.00 55.11  ? 638  PRO A O   1 
ATOM   7261  C  CB  . PRO E  5  638  ? 20.839  106.869 140.503 1.00 49.58  ? 638  PRO A CB  1 
ATOM   7262  C  CG  . PRO E  5  638  ? 21.369  107.428 141.729 1.00 42.20  ? 638  PRO A CG  1 
ATOM   7263  C  CD  . PRO E  5  638  ? 22.231  108.585 141.324 1.00 40.98  ? 638  PRO A CD  1 
ATOM   7264  N  N   . GLN E  5  639  ? 21.194  106.449 137.273 1.00 47.00  ? 639  GLN A N   1 
ATOM   7265  C  CA  . GLN E  5  639  ? 21.077  106.710 135.852 1.00 47.03  ? 639  GLN A CA  1 
ATOM   7266  C  C   . GLN E  5  639  ? 19.766  106.304 135.154 1.00 49.90  ? 639  GLN A C   1 
ATOM   7267  O  O   . GLN E  5  639  ? 19.686  106.297 133.922 1.00 47.16  ? 639  GLN A O   1 
ATOM   7268  C  CB  . GLN E  5  639  ? 22.290  106.092 135.182 1.00 43.27  ? 639  GLN A CB  1 
ATOM   7269  C  CG  . GLN E  5  639  ? 22.792  106.877 134.036 1.00 62.52  ? 639  GLN A CG  1 
ATOM   7270  C  CD  . GLN E  5  639  ? 23.547  108.087 134.465 1.00 55.03  ? 639  GLN A CD  1 
ATOM   7271  O  OE1 . GLN E  5  639  ? 23.246  108.726 135.456 1.00 59.46  ? 639  GLN A OE1 1 
ATOM   7272  N  NE2 . GLN E  5  639  ? 24.529  108.423 133.701 1.00 65.47  ? 639  GLN A NE2 1 
ATOM   7273  N  N   . ASN E  5  640  ? 18.735  106.012 135.931 1.00 42.95  ? 640  ASN A N   1 
ATOM   7274  C  CA  . ASN E  5  640  ? 17.461  105.608 135.369 1.00 47.69  ? 640  ASN A CA  1 
ATOM   7275  C  C   . ASN E  5  640  ? 16.384  105.835 136.415 1.00 49.16  ? 640  ASN A C   1 
ATOM   7276  O  O   . ASN E  5  640  ? 16.691  105.890 137.607 1.00 47.90  ? 640  ASN A O   1 
ATOM   7277  C  CB  . ASN E  5  640  ? 17.508  104.137 134.955 1.00 48.25  ? 640  ASN A CB  1 
ATOM   7278  C  CG  . ASN E  5  640  ? 17.493  103.190 136.161 1.00 50.02  ? 640  ASN A CG  1 
ATOM   7279  O  OD1 . ASN E  5  640  ? 16.424  102.869 136.707 1.00 44.78  ? 640  ASN A OD1 1 
ATOM   7280  N  ND2 . ASN E  5  640  ? 18.684  102.750 136.587 1.00 42.38  ? 640  ASN A ND2 1 
ATOM   7281  N  N   . GLU E  5  641  ? 15.128  105.955 136.000 1.00 53.38  ? 641  GLU A N   1 
ATOM   7282  C  CA  . GLU E  5  641  ? 14.114  106.408 136.954 1.00 57.70  ? 641  GLU A CA  1 
ATOM   7283  C  C   . GLU E  5  641  ? 13.845  105.476 138.142 1.00 55.40  ? 641  GLU A C   1 
ATOM   7284  O  O   . GLU E  5  641  ? 13.457  105.960 139.196 1.00 49.15  ? 641  GLU A O   1 
ATOM   7285  C  CB  . GLU E  5  641  ? 12.793  106.810 136.278 1.00 54.49  ? 641  GLU A CB  1 
ATOM   7286  C  CG  . GLU E  5  641  ? 12.918  107.948 135.279 1.00 61.75  ? 641  GLU A CG  1 
ATOM   7287  C  CD  . GLU E  5  641  ? 13.220  109.308 135.900 1.00 61.91  ? 641  GLU A CD  1 
ATOM   7288  O  OE1 . GLU E  5  641  ? 12.926  109.498 137.096 1.00 66.97  ? 641  GLU A OE1 1 
ATOM   7289  O  OE2 . GLU E  5  641  ? 13.737  110.199 135.177 1.00 64.07  ? 641  GLU A OE2 1 
ATOM   7290  N  N   . ASN E  5  642  ? 14.034  104.164 137.988 1.00 55.76  ? 642  ASN A N   1 
ATOM   7291  C  CA  . ASN E  5  642  ? 13.861  103.265 139.124 1.00 41.93  ? 642  ASN A CA  1 
ATOM   7292  C  C   . ASN E  5  642  ? 14.859  103.617 140.210 1.00 49.47  ? 642  ASN A C   1 
ATOM   7293  O  O   . ASN E  5  642  ? 14.528  103.629 141.380 1.00 44.77  ? 642  ASN A O   1 
ATOM   7294  C  CB  . ASN E  5  642  ? 14.112  101.822 138.726 1.00 47.45  ? 642  ASN A CB  1 
ATOM   7295  C  CG  . ASN E  5  642  ? 12.955  101.195 138.014 1.00 48.94  ? 642  ASN A CG  1 
ATOM   7296  O  OD1 . ASN E  5  642  ? 11.810  101.328 138.421 1.00 48.76  ? 642  ASN A OD1 1 
ATOM   7297  N  ND2 . ASN E  5  642  ? 13.250  100.487 136.935 1.00 55.82  ? 642  ASN A ND2 1 
ATOM   7298  N  N   . ALA E  5  643  ? 16.096  103.887 139.823 1.00 41.24  ? 643  ALA A N   1 
ATOM   7299  C  CA  . ALA E  5  643  ? 17.085  104.209 140.815 1.00 43.32  ? 643  ALA A CA  1 
ATOM   7300  C  C   . ALA E  5  643  ? 16.777  105.591 141.394 1.00 44.35  ? 643  ALA A C   1 
ATOM   7301  O  O   . ALA E  5  643  ? 17.006  105.828 142.577 1.00 46.15  ? 643  ALA A O   1 
ATOM   7302  C  CB  . ALA E  5  643  ? 18.491  104.128 140.245 1.00 47.05  ? 643  ALA A CB  1 
ATOM   7303  N  N   . ARG E  5  644  ? 16.253  106.494 140.572 1.00 41.20  ? 644  ARG A N   1 
ATOM   7304  C  CA  . ARG E  5  644  ? 15.849  107.812 141.067 1.00 41.30  ? 644  ARG A CA  1 
ATOM   7305  C  C   . ARG E  5  644  ? 14.830  107.627 142.181 1.00 42.35  ? 644  ARG A C   1 
ATOM   7306  O  O   . ARG E  5  644  ? 14.999  108.154 143.282 1.00 45.56  ? 644  ARG A O   1 
ATOM   7307  C  CB  . ARG E  5  644  ? 15.265  108.690 139.948 1.00 42.00  ? 644  ARG A CB  1 
ATOM   7308  C  CG  . ARG E  5  644  ? 16.286  109.379 139.046 1.00 46.73  ? 644  ARG A CG  1 
ATOM   7309  C  CD  . ARG E  5  644  ? 16.081  110.904 138.993 1.00 48.51  ? 644  ARG A CD  1 
ATOM   7310  N  NE  . ARG E  5  644  ? 14.744  111.186 138.495 1.00 50.83  ? 644  ARG A NE  1 
ATOM   7311  C  CZ  . ARG E  5  644  ? 14.062  112.309 138.697 1.00 58.18  ? 644  ARG A CZ  1 
ATOM   7312  N  NH1 . ARG E  5  644  ? 14.581  113.316 139.380 1.00 58.48  ? 644  ARG A NH1 1 
ATOM   7313  N  NH2 . ARG E  5  644  ? 12.844  112.419 138.196 1.00 63.48  ? 644  ARG A NH2 1 
ATOM   7314  N  N   . ALA E  5  645  ? 13.782  106.860 141.895 1.00 41.24  ? 645  ALA A N   1 
ATOM   7315  C  CA  . ALA E  5  645  ? 12.670  106.722 142.815 1.00 50.15  ? 645  ALA A CA  1 
ATOM   7316  C  C   . ALA E  5  645  ? 13.161  106.189 144.166 1.00 51.13  ? 645  ALA A C   1 
ATOM   7317  O  O   . ALA E  5  645  ? 12.718  106.638 145.231 1.00 50.99  ? 645  ALA A O   1 
ATOM   7318  C  CB  . ALA E  5  645  ? 11.616  105.827 142.224 1.00 41.53  ? 645  ALA A CB  1 
ATOM   7319  N  N   . GLU E  5  646  ? 14.105  105.252 144.112 1.00 47.67  ? 646  GLU A N   1 
ATOM   7320  C  CA  . GLU E  5  646  ? 14.637  104.647 145.309 1.00 39.71  ? 646  GLU A CA  1 
ATOM   7321  C  C   . GLU E  5  646  ? 15.477  105.610 146.131 1.00 48.93  ? 646  GLU A C   1 
ATOM   7322  O  O   . GLU E  5  646  ? 15.362  105.645 147.353 1.00 51.84  ? 646  GLU A O   1 
ATOM   7323  C  CB  . GLU E  5  646  ? 15.486  103.463 144.939 1.00 44.89  ? 646  GLU A CB  1 
ATOM   7324  C  CG  . GLU E  5  646  ? 14.706  102.218 144.697 1.00 52.54  ? 646  GLU A CG  1 
ATOM   7325  C  CD  . GLU E  5  646  ? 15.617  101.070 144.312 1.00 69.72  ? 646  GLU A CD  1 
ATOM   7326  O  OE1 . GLU E  5  646  ? 16.856  101.268 144.369 1.00 76.86  ? 646  GLU A OE1 1 
ATOM   7327  O  OE2 . GLU E  5  646  ? 15.104  99.986  143.941 1.00 70.68  ? 646  GLU A OE2 1 
ATOM   7328  N  N   . ALA E  5  647  ? 16.345  106.368 145.474 1.00 40.58  ? 647  ALA A N   1 
ATOM   7329  C  CA  . ALA E  5  647  ? 17.164  107.340 146.170 1.00 39.53  ? 647  ALA A CA  1 
ATOM   7330  C  C   . ALA E  5  647  ? 16.334  108.484 146.761 1.00 50.16  ? 647  ALA A C   1 
ATOM   7331  O  O   . ALA E  5  647  ? 16.756  109.113 147.725 1.00 48.08  ? 647  ALA A O   1 
ATOM   7332  C  CB  . ALA E  5  647  ? 18.198  107.877 145.268 1.00 39.74  ? 647  ALA A CB  1 
ATOM   7333  N  N   . LEU E  5  648  ? 15.158  108.758 146.203 1.00 48.31  ? 648  LEU A N   1 
ATOM   7334  C  CA  . LEU E  5  648  ? 14.321  109.854 146.716 1.00 40.45  ? 648  LEU A CA  1 
ATOM   7335  C  C   . LEU E  5  648  ? 13.316  109.395 147.753 1.00 47.36  ? 648  LEU A C   1 
ATOM   7336  O  O   . LEU E  5  648  ? 12.797  110.206 148.509 1.00 52.50  ? 648  LEU A O   1 
ATOM   7337  C  CB  . LEU E  5  648  ? 13.561  110.533 145.584 1.00 41.04  ? 648  LEU A CB  1 
ATOM   7338  C  CG  . LEU E  5  648  ? 14.406  111.538 144.846 1.00 41.34  ? 648  LEU A CG  1 
ATOM   7339  C  CD1 . LEU E  5  648  ? 13.735  111.888 143.568 1.00 41.92  ? 648  LEU A CD1 1 
ATOM   7340  C  CD2 . LEU E  5  648  ? 14.609  112.739 145.721 1.00 43.53  ? 648  LEU A CD2 1 
ATOM   7341  N  N   . ASN E  5  649  ? 13.032  108.099 147.785 1.00 45.00  ? 649  ASN A N   1 
ATOM   7342  C  CA  . ASN E  5  649  ? 12.000  107.580 148.674 1.00 46.32  ? 649  ASN A CA  1 
ATOM   7343  C  C   . ASN E  5  649  ? 12.425  106.545 149.713 1.00 43.63  ? 649  ASN A C   1 
ATOM   7344  O  O   . ASN E  5  649  ? 11.696  106.327 150.681 1.00 42.49  ? 649  ASN A O   1 
ATOM   7345  C  CB  . ASN E  5  649  ? 10.833  107.032 147.859 1.00 44.35  ? 649  ASN A CB  1 
ATOM   7346  C  CG  . ASN E  5  649  ? 10.076  108.121 147.139 1.00 46.69  ? 649  ASN A CG  1 
ATOM   7347  O  OD1 . ASN E  5  649  ? 9.217   108.772 147.725 1.00 58.14  ? 649  ASN A OD1 1 
ATOM   7348  N  ND2 . ASN E  5  649  ? 10.393  108.329 145.855 1.00 44.10  ? 649  ASN A ND2 1 
ATOM   7349  N  N   . LEU E  5  650  ? 13.594  105.927 149.528 1.00 39.26  ? 650  LEU A N   1 
ATOM   7350  C  CA  . LEU E  5  650  ? 14.020  104.844 150.397 1.00 38.88  ? 650  LEU A CA  1 
ATOM   7351  C  C   . LEU E  5  650  ? 15.341  105.142 151.073 1.00 45.52  ? 650  LEU A C   1 
ATOM   7352  O  O   . LEU E  5  650  ? 15.484  104.936 152.267 1.00 46.46  ? 650  LEU A O   1 
ATOM   7353  C  CB  . LEU E  5  650  ? 14.125  103.547 149.615 1.00 42.07  ? 650  LEU A CB  1 
ATOM   7354  C  CG  . LEU E  5  650  ? 12.815  102.938 149.140 1.00 50.38  ? 650  LEU A CG  1 
ATOM   7355  C  CD1 . LEU E  5  650  ? 13.057  101.625 148.405 1.00 45.94  ? 650  LEU A CD1 1 
ATOM   7356  C  CD2 . LEU E  5  650  ? 11.895  102.733 150.331 1.00 39.17  ? 650  LEU A CD2 1 
ATOM   7357  N  N   . ALA E  5  651  ? 16.318  105.624 150.319 1.00 38.61  ? 651  ALA A N   1 
ATOM   7358  C  CA  . ALA E  5  651  ? 17.625  105.880 150.895 1.00 43.91  ? 651  ALA A CA  1 
ATOM   7359  C  C   . ALA E  5  651  ? 17.806  107.382 151.112 1.00 40.06  ? 651  ALA A C   1 
ATOM   7360  O  O   . ALA E  5  651  ? 18.914  107.858 151.411 1.00 39.53  ? 651  ALA A O   1 
ATOM   7361  C  CB  . ALA E  5  651  ? 18.742  105.307 150.015 1.00 38.35  ? 651  ALA A CB  1 
ATOM   7362  N  N   . ASN E  5  652  ? 16.721  108.138 150.980 1.00 40.54  ? 652  ASN A N   1 
ATOM   7363  C  CA  . ASN E  5  652  ? 16.834  109.592 151.114 1.00 39.37  ? 652  ASN A CA  1 
ATOM   7364  C  C   . ASN E  5  652  ? 17.083  110.000 152.559 1.00 47.56  ? 652  ASN A C   1 
ATOM   7365  O  O   . ASN E  5  652  ? 16.642  109.311 153.467 1.00 48.73  ? 652  ASN A O   1 
ATOM   7366  C  CB  . ASN E  5  652  ? 15.602  110.291 150.563 1.00 39.79  ? 652  ASN A CB  1 
ATOM   7367  C  CG  . ASN E  5  652  ? 14.330  109.800 151.194 1.00 58.01  ? 652  ASN A CG  1 
ATOM   7368  O  OD1 . ASN E  5  652  ? 14.049  108.598 151.186 1.00 63.21  ? 652  ASN A OD1 1 
ATOM   7369  N  ND2 . ASN E  5  652  ? 13.551  110.725 151.769 1.00 48.29  ? 652  ASN A ND2 1 
ATOM   7370  N  N   . THR E  5  653  ? 17.796  111.107 152.775 1.00 44.48  ? 653  THR A N   1 
ATOM   7371  C  CA  . THR E  5  653  ? 18.131  111.550 154.123 1.00 39.78  ? 653  THR A CA  1 
ATOM   7372  C  C   . THR E  5  653  ? 16.906  111.671 155.034 1.00 47.28  ? 653  THR A C   1 
ATOM   7373  O  O   . THR E  5  653  ? 16.947  111.354 156.223 1.00 51.84  ? 653  THR A O   1 
ATOM   7374  C  CB  . THR E  5  653  ? 18.797  112.925 154.115 1.00 46.48  ? 653  THR A CB  1 
ATOM   7375  O  OG1 . THR E  5  653  ? 17.849  113.890 153.645 1.00 48.58  ? 653  THR A OG1 1 
ATOM   7376  C  CG2 . THR E  5  653  ? 20.037  112.951 153.234 1.00 43.47  ? 653  THR A CG2 1 
ATOM   7377  N  N   . ASP E  5  654  ? 15.808  112.165 154.494 1.00 55.39  ? 654  ASP A N   1 
ATOM   7378  C  CA  . ASP E  5  654  ? 14.678  112.452 155.366 1.00 52.79  ? 654  ASP A CA  1 
ATOM   7379  C  C   . ASP E  5  654  ? 14.000  111.171 155.859 1.00 49.02  ? 654  ASP A C   1 
ATOM   7380  O  O   . ASP E  5  654  ? 13.282  111.173 156.853 1.00 52.84  ? 654  ASP A O   1 
ATOM   7381  C  CB  . ASP E  5  654  ? 13.702  113.412 154.690 1.00 54.73  ? 654  ASP A CB  1 
ATOM   7382  C  CG  . ASP E  5  654  ? 14.330  114.772 154.398 1.00 66.11  ? 654  ASP A CG  1 
ATOM   7383  O  OD1 . ASP E  5  654  ? 15.363  115.113 155.047 1.00 70.04  ? 654  ASP A OD1 1 
ATOM   7384  O  OD2 . ASP E  5  654  ? 13.779  115.505 153.533 1.00 68.18  ? 654  ASP A OD2 1 
ATOM   7385  N  N   . SER E  5  655  ? 14.269  110.072 155.167 1.00 49.05  ? 655  SER A N   1 
ATOM   7386  C  CA  . SER E  5  655  ? 13.708  108.768 155.512 1.00 48.93  ? 655  SER A CA  1 
ATOM   7387  C  C   . SER E  5  655  ? 14.463  108.168 156.651 1.00 52.94  ? 655  SER A C   1 
ATOM   7388  O  O   . SER E  5  655  ? 14.090  107.119 157.146 1.00 53.78  ? 655  SER A O   1 
ATOM   7389  C  CB  . SER E  5  655  ? 13.851  107.805 154.344 1.00 48.35  ? 655  SER A CB  1 
ATOM   7390  O  OG  . SER E  5  655  ? 12.588  107.489 153.797 1.00 64.77  ? 655  SER A OG  1 
ATOM   7391  N  N   . GLN E  5  656  ? 15.548  108.825 157.042 1.00 44.41  ? 656  GLN A N   1 
ATOM   7392  C  CA  . GLN E  5  656  ? 16.486  108.245 157.986 1.00 50.04  ? 656  GLN A CA  1 
ATOM   7393  C  C   . GLN E  5  656  ? 16.757  109.139 159.200 1.00 51.88  ? 656  GLN A C   1 
ATOM   7394  O  O   . GLN E  5  656  ? 17.910  109.305 159.632 1.00 49.90  ? 656  GLN A O   1 
ATOM   7395  C  CB  . GLN E  5  656  ? 17.779  107.970 157.277 1.00 53.89  ? 656  GLN A CB  1 
ATOM   7396  C  CG  . GLN E  5  656  ? 17.590  107.465 155.884 1.00 58.11  ? 656  GLN A CG  1 
ATOM   7397  C  CD  . GLN E  5  656  ? 18.133  106.115 155.737 1.00 62.29  ? 656  GLN A CD  1 
ATOM   7398  O  OE1 . GLN E  5  656  ? 19.216  105.816 156.237 1.00 64.81  ? 656  GLN A OE1 1 
ATOM   7399  N  NE2 . GLN E  5  656  ? 17.376  105.250 155.081 1.00 80.03  ? 656  GLN A NE2 1 
ATOM   7400  N  N   . TYR E  5  657  ? 15.682  109.705 159.742 1.00 47.68  ? 657  TYR A N   1 
ATOM   7401  C  CA  . TYR E  5  657  ? 15.773  110.517 160.923 1.00 43.59  ? 657  TYR A CA  1 
ATOM   7402  C  C   . TYR E  5  657  ? 16.117  109.633 162.149 1.00 51.81  ? 657  TYR A C   1 
ATOM   7403  O  O   . TYR E  5  657  ? 17.005  109.944 162.940 1.00 44.63  ? 657  TYR A O   1 
ATOM   7404  C  CB  . TYR E  5  657  ? 14.460  111.285 161.103 1.00 44.07  ? 657  TYR A CB  1 
ATOM   7405  C  CG  . TYR E  5  657  ? 14.453  112.144 162.323 1.00 43.93  ? 657  TYR A CG  1 
ATOM   7406  C  CD1 . TYR E  5  657  ? 15.186  113.311 162.368 1.00 48.92  ? 657  TYR A CD1 1 
ATOM   7407  C  CD2 . TYR E  5  657  ? 13.730  111.777 163.447 1.00 66.64  ? 657  TYR A CD2 1 
ATOM   7408  C  CE1 . TYR E  5  657  ? 15.184  114.106 163.498 1.00 53.89  ? 657  TYR A CE1 1 
ATOM   7409  C  CE2 . TYR E  5  657  ? 13.731  112.559 164.577 1.00 63.72  ? 657  TYR A CE2 1 
ATOM   7410  C  CZ  . TYR E  5  657  ? 14.457  113.720 164.590 1.00 54.98  ? 657  TYR A CZ  1 
ATOM   7411  O  OH  . TYR E  5  657  ? 14.478  114.486 165.705 1.00 43.75  ? 657  TYR A OH  1 
ATOM   7412  N  N   . LEU E  5  658  ? 15.416  108.526 162.311 1.00 43.71  ? 658  LEU A N   1 
ATOM   7413  C  CA  . LEU E  5  658  ? 15.730  107.627 163.400 1.00 43.58  ? 658  LEU A CA  1 
ATOM   7414  C  C   . LEU E  5  658  ? 16.683  106.513 162.938 1.00 50.56  ? 658  LEU A C   1 
ATOM   7415  O  O   . LEU E  5  658  ? 16.569  106.005 161.815 1.00 58.09  ? 658  LEU A O   1 
ATOM   7416  C  CB  . LEU E  5  658  ? 14.444  107.035 163.958 1.00 44.16  ? 658  LEU A CB  1 
ATOM   7417  C  CG  . LEU E  5  658  ? 13.365  108.047 164.317 1.00 44.51  ? 658  LEU A CG  1 
ATOM   7418  C  CD1 . LEU E  5  658  ? 12.108  107.349 164.773 1.00 45.15  ? 658  LEU A CD1 1 
ATOM   7419  C  CD2 . LEU E  5  658  ? 13.871  108.975 165.414 1.00 45.87  ? 658  LEU A CD2 1 
ATOM   7420  N  N   . THR E  5  659  ? 17.633  106.143 163.796 1.00 50.21  ? 659  THR A N   1 
ATOM   7421  C  CA  . THR E  5  659  ? 18.591  105.064 163.507 1.00 48.98  ? 659  THR A CA  1 
ATOM   7422  C  C   . THR E  5  659  ? 17.922  103.724 163.698 1.00 44.48  ? 659  THR A C   1 
ATOM   7423  O  O   . THR E  5  659  ? 17.017  103.588 164.517 1.00 44.54  ? 659  THR A O   1 
ATOM   7424  C  CB  . THR E  5  659  ? 19.764  105.077 164.497 1.00 56.94  ? 659  THR A CB  1 
ATOM   7425  O  OG1 . THR E  5  659  ? 19.298  104.666 165.797 1.00 64.29  ? 659  THR A OG1 1 
ATOM   7426  C  CG2 . THR E  5  659  ? 20.351  106.473 164.604 1.00 57.11  ? 659  THR A CG2 1 
ATOM   7427  N  N   . PRO E  5  660  ? 18.372  102.709 162.974 1.00 43.21  ? 660  PRO A N   1 
ATOM   7428  C  CA  . PRO E  5  660  ? 17.758  101.420 163.307 1.00 55.57  ? 660  PRO A CA  1 
ATOM   7429  C  C   . PRO E  5  660  ? 18.354  100.744 164.555 1.00 51.83  ? 660  PRO A C   1 
ATOM   7430  O  O   . PRO E  5  660  ? 17.690  99.873  165.087 1.00 57.85  ? 660  PRO A O   1 
ATOM   7431  C  CB  . PRO E  5  660  ? 18.000  100.572 162.050 1.00 52.95  ? 660  PRO A CB  1 
ATOM   7432  C  CG  . PRO E  5  660  ? 18.543  101.528 161.037 1.00 53.36  ? 660  PRO A CG  1 
ATOM   7433  C  CD  . PRO E  5  660  ? 19.197  102.630 161.770 1.00 43.00  ? 660  PRO A CD  1 
ATOM   7434  N  N   . THR E  5  661  ? 19.544  101.130 165.003 1.00 42.92  ? 661  THR A N   1 
ATOM   7435  C  CA  . THR E  5  661  ? 20.106  100.621 166.257 1.00 42.78  ? 661  THR A CA  1 
ATOM   7436  C  C   . THR E  5  661  ? 19.152  100.644 167.467 1.00 54.05  ? 661  THR A C   1 
ATOM   7437  O  O   . THR E  5  661  ? 18.923  99.613  168.098 1.00 54.95  ? 661  THR A O   1 
ATOM   7438  C  CB  . THR E  5  661  ? 21.336  101.388 166.657 1.00 48.26  ? 661  THR A CB  1 
ATOM   7439  O  OG1 . THR E  5  661  ? 22.009  101.830 165.488 1.00 64.14  ? 661  THR A OG1 1 
ATOM   7440  C  CG2 . THR E  5  661  ? 22.267  100.502 167.423 1.00 58.12  ? 661  THR A CG2 1 
ATOM   7441  N  N   . SER E  5  662  ? 18.600  101.815 167.781 1.00 50.82  ? 662  SER A N   1 
ATOM   7442  C  CA  . SER E  5  662  ? 17.747  101.981 168.953 1.00 55.12  ? 662  SER A CA  1 
ATOM   7443  C  C   . SER E  5  662  ? 16.528  102.810 168.615 1.00 60.16  ? 662  SER A C   1 
ATOM   7444  O  O   . SER E  5  662  ? 15.657  103.003 169.450 1.00 61.08  ? 662  SER A O   1 
ATOM   7445  C  CB  . SER E  5  662  ? 18.516  102.685 170.072 1.00 64.16  ? 662  SER A CB  1 
ATOM   7446  O  OG  . SER E  5  662  ? 19.035  103.925 169.603 1.00 72.61  ? 662  SER A OG  1 
ATOM   7447  N  N   . GLY E  5  663  ? 16.462  103.319 167.398 1.00 43.78  ? 663  GLY A N   1 
ATOM   7448  C  CA  . GLY E  5  663  ? 15.280  104.055 167.009 1.00 48.16  ? 663  GLY A CA  1 
ATOM   7449  C  C   . GLY E  5  663  ? 15.265  105.504 167.496 1.00 55.35  ? 663  GLY A C   1 
ATOM   7450  O  O   . GLY E  5  663  ? 14.214  106.073 167.812 1.00 57.32  ? 663  GLY A O   1 
ATOM   7451  N  N   . SER E  5  664  ? 16.440  106.118 167.524 1.00 44.70  ? 664  SER A N   1 
ATOM   7452  C  CA  . SER E  5  664  ? 16.588  107.450 168.053 1.00 48.04  ? 664  SER A CA  1 
ATOM   7453  C  C   . SER E  5  664  ? 17.126  108.389 166.999 1.00 52.15  ? 664  SER A C   1 
ATOM   7454  O  O   . SER E  5  664  ? 17.667  107.938 165.992 1.00 57.80  ? 664  SER A O   1 
ATOM   7455  C  CB  . SER E  5  664  ? 17.547  107.408 169.223 1.00 54.26  ? 664  SER A CB  1 
ATOM   7456  O  OG  . SER E  5  664  ? 17.163  106.370 170.097 1.00 62.40  ? 664  SER A OG  1 
ATOM   7457  N  N   . PRO E  5  665  ? 16.964  109.703 167.219 1.00 47.04  ? 665  PRO A N   1 
ATOM   7458  C  CA  . PRO E  5  665  ? 17.367  110.686 166.216 1.00 42.62  ? 665  PRO A CA  1 
ATOM   7459  C  C   . PRO E  5  665  ? 18.861  110.691 165.939 1.00 52.36  ? 665  PRO A C   1 
ATOM   7460  O  O   . PRO E  5  665  ? 19.633  110.485 166.866 1.00 50.63  ? 665  PRO A O   1 
ATOM   7461  C  CB  . PRO E  5  665  ? 16.940  112.003 166.855 1.00 42.76  ? 665  PRO A CB  1 
ATOM   7462  C  CG  . PRO E  5  665  ? 15.724  111.627 167.657 1.00 43.26  ? 665  PRO A CG  1 
ATOM   7463  C  CD  . PRO E  5  665  ? 16.038  110.277 168.217 1.00 45.38  ? 665  PRO A CD  1 
ATOM   7464  N  N   . VAL E  5  666  ? 19.241  110.905 164.676 1.00 54.91  ? 666  VAL A N   1 
ATOM   7465  C  CA  . VAL E  5  666  ? 20.631  111.144 164.285 1.00 52.91  ? 666  VAL A CA  1 
ATOM   7466  C  C   . VAL E  5  666  ? 20.831  112.503 163.662 1.00 53.72  ? 666  VAL A C   1 
ATOM   7467  O  O   . VAL E  5  666  ? 21.961  112.941 163.508 1.00 61.07  ? 666  VAL A O   1 
ATOM   7468  C  CB  . VAL E  5  666  ? 21.135  110.201 163.188 1.00 50.37  ? 666  VAL A CB  1 
ATOM   7469  C  CG1 . VAL E  5  666  ? 22.152  109.286 163.740 1.00 56.39  ? 666  VAL A CG1 1 
ATOM   7470  C  CG2 . VAL E  5  666  ? 20.006  109.483 162.543 1.00 41.88  ? 666  VAL A CG2 1 
ATOM   7471  N  N   . ARG E  5  667  ? 19.754  113.151 163.248 1.00 50.16  ? 667  ARG A N   1 
ATOM   7472  C  CA  . ARG E  5  667  ? 19.898  114.456 162.635 1.00 50.61  ? 667  ARG A CA  1 
ATOM   7473  C  C   . ARG E  5  667  ? 19.446  115.509 163.637 1.00 48.34  ? 667  ARG A C   1 
ATOM   7474  O  O   . ARG E  5  667  ? 18.403  115.353 164.270 1.00 56.14  ? 667  ARG A O   1 
ATOM   7475  C  CB  . ARG E  5  667  ? 19.092  114.571 161.321 1.00 50.82  ? 667  ARG A CB  1 
ATOM   7476  C  CG  . ARG E  5  667  ? 18.672  113.244 160.727 1.00 65.58  ? 667  ARG A CG  1 
ATOM   7477  C  CD  . ARG E  5  667  ? 18.127  113.343 159.300 1.00 60.64  ? 667  ARG A CD  1 
ATOM   7478  N  NE  . ARG E  5  667  ? 19.168  113.728 158.363 1.00 55.37  ? 667  ARG A NE  1 
ATOM   7479  C  CZ  . ARG E  5  667  ? 19.041  114.737 157.516 1.00 70.10  ? 667  ARG A CZ  1 
ATOM   7480  N  NH1 . ARG E  5  667  ? 17.901  115.437 157.465 1.00 83.33  ? 667  ARG A NH1 1 
ATOM   7481  N  NH2 . ARG E  5  667  ? 20.037  115.036 156.706 1.00 64.54  ? 667  ARG A NH2 1 
ATOM   7482  N  N   . GLY E  5  668  ? 20.234  116.575 163.774 1.00 44.25  ? 668  GLY A N   1 
ATOM   7483  C  CA  . GLY E  5  668  ? 19.828  117.736 164.536 1.00 42.08  ? 668  GLY A CA  1 
ATOM   7484  C  C   . GLY E  5  668  ? 20.802  118.861 164.303 1.00 41.93  ? 668  GLY A C   1 
ATOM   7485  O  O   . GLY E  5  668  ? 21.785  118.682 163.591 1.00 51.43  ? 668  GLY A O   1 
ATOM   7486  N  N   . LEU E  5  669  ? 20.539  120.018 164.908 1.00 49.34  ? 669  LEU A N   1 
ATOM   7487  C  CA  . LEU E  5  669  ? 21.423  121.168 164.797 1.00 42.09  ? 669  LEU A CA  1 
ATOM   7488  C  C   . LEU E  5  669  ? 22.456  121.144 165.916 1.00 45.43  ? 669  LEU A C   1 
ATOM   7489  O  O   . LEU E  5  669  ? 22.272  120.464 166.923 1.00 43.42  ? 669  LEU A O   1 
ATOM   7490  C  CB  . LEU E  5  669  ? 20.614  122.456 164.850 1.00 42.56  ? 669  LEU A CB  1 
ATOM   7491  C  CG  . LEU E  5  669  ? 19.486  122.430 163.833 1.00 50.59  ? 669  LEU A CG  1 
ATOM   7492  C  CD1 . LEU E  5  669  ? 18.727  123.750 163.869 1.00 49.24  ? 669  LEU A CD1 1 
ATOM   7493  C  CD2 . LEU E  5  669  ? 20.056  122.128 162.426 1.00 42.83  ? 669  LEU A CD2 1 
ATOM   7494  N  N   . ILE E  5  670  ? 23.555  121.869 165.737 1.00 41.62  ? 670  ILE A N   1 
ATOM   7495  C  CA  . ILE E  5  670  ? 24.668  121.799 166.670 1.00 41.32  ? 670  ILE A CA  1 
ATOM   7496  C  C   . ILE E  5  670  ? 25.174  123.214 166.958 1.00 51.19  ? 670  ILE A C   1 
ATOM   7497  O  O   . ILE E  5  670  ? 24.652  124.168 166.400 1.00 50.24  ? 670  ILE A O   1 
ATOM   7498  C  CB  . ILE E  5  670  ? 25.811  120.857 166.135 1.00 60.56  ? 670  ILE A CB  1 
ATOM   7499  C  CG1 . ILE E  5  670  ? 26.692  121.552 165.087 1.00 40.87  ? 670  ILE A CG1 1 
ATOM   7500  C  CG2 . ILE E  5  670  ? 25.236  119.576 165.577 1.00 40.79  ? 670  ILE A CG2 1 
ATOM   7501  C  CD1 . ILE E  5  670  ? 27.404  120.643 164.153 1.00 66.36  ? 670  ILE A CD1 1 
ATOM   7502  N  N   . GLN E  5  671  ? 26.151  123.342 167.858 1.00 49.70  ? 671  GLN A N   1 
ATOM   7503  C  CA  . GLN E  5  671  ? 26.902  124.591 168.110 1.00 48.81  ? 671  GLN A CA  1 
ATOM   7504  C  C   . GLN E  5  671  ? 26.165  125.948 168.013 1.00 49.72  ? 671  GLN A C   1 
ATOM   7505  O  O   . GLN E  5  671  ? 25.285  126.205 168.827 1.00 53.25  ? 671  GLN A O   1 
ATOM   7506  C  CB  . GLN E  5  671  ? 28.226  124.562 167.341 1.00 45.26  ? 671  GLN A CB  1 
ATOM   7507  C  CG  . GLN E  5  671  ? 28.973  123.277 167.689 1.00 43.07  ? 671  GLN A CG  1 
ATOM   7508  C  CD  . GLN E  5  671  ? 30.316  123.074 167.007 1.00 46.18  ? 671  GLN A CD  1 
ATOM   7509  O  OE1 . GLN E  5  671  ? 30.987  124.024 166.554 1.00 42.89  ? 671  GLN A OE1 1 
ATOM   7510  N  NE2 . GLN E  5  671  ? 30.736  121.806 166.962 1.00 41.12  ? 671  GLN A NE2 1 
ATOM   7511  N  N   . ASP E  5  672  ? 26.531  126.805 167.055 1.00 43.57  ? 672  ASP A N   1 
ATOM   7512  C  CA  . ASP E  5  672  ? 25.878  128.121 166.886 1.00 44.26  ? 672  ASP A CA  1 
ATOM   7513  C  C   . ASP E  5  672  ? 24.367  128.062 167.064 1.00 45.93  ? 672  ASP A C   1 
ATOM   7514  O  O   . ASP E  5  672  ? 23.760  128.939 167.664 1.00 44.63  ? 672  ASP A O   1 
ATOM   7515  C  CB  . ASP E  5  672  ? 26.117  128.707 165.487 1.00 42.96  ? 672  ASP A CB  1 
ATOM   7516  C  CG  . ASP E  5  672  ? 27.531  129.190 165.265 1.00 48.62  ? 672  ASP A CG  1 
ATOM   7517  O  OD1 . ASP E  5  672  ? 28.412  128.853 166.068 1.00 44.85  ? 672  ASP A OD1 1 
ATOM   7518  O  OD2 . ASP E  5  672  ? 27.771  129.898 164.255 1.00 57.34  ? 672  ASP A OD2 1 
ATOM   7519  N  N   . HIS E  5  673  ? 23.769  127.016 166.517 1.00 42.89  ? 673  HIS A N   1 
ATOM   7520  C  CA  . HIS E  5  673  ? 22.330  126.900 166.485 1.00 46.82  ? 673  HIS A CA  1 
ATOM   7521  C  C   . HIS E  5  673  ? 21.735  126.615 167.848 1.00 49.87  ? 673  HIS A C   1 
ATOM   7522  O  O   . HIS E  5  673  ? 20.624  127.051 168.135 1.00 56.30  ? 673  HIS A O   1 
ATOM   7523  C  CB  . HIS E  5  673  ? 21.915  125.838 165.473 1.00 55.08  ? 673  HIS A CB  1 
ATOM   7524  C  CG  . HIS E  5  673  ? 22.253  126.205 164.069 1.00 51.96  ? 673  HIS A CG  1 
ATOM   7525  N  ND1 . HIS E  5  673  ? 22.242  125.296 163.036 1.00 58.42  ? 673  HIS A ND1 1 
ATOM   7526  C  CD2 . HIS E  5  673  ? 22.612  127.389 163.525 1.00 49.71  ? 673  HIS A CD2 1 
ATOM   7527  C  CE1 . HIS E  5  673  ? 22.582  125.907 161.914 1.00 56.41  ? 673  HIS A CE1 1 
ATOM   7528  N  NE2 . HIS E  5  673  ? 22.810  127.178 162.182 1.00 53.70  ? 673  HIS A NE2 1 
ATOM   7529  N  N   . ILE E  5  674  ? 22.456  125.890 168.696 1.00 44.98  ? 674  ILE A N   1 
ATOM   7530  C  CA  . ILE E  5  674  ? 21.958  125.688 170.060 1.00 44.34  ? 674  ILE A CA  1 
ATOM   7531  C  C   . ILE E  5  674  ? 22.110  126.966 170.877 1.00 44.07  ? 674  ILE A C   1 
ATOM   7532  O  O   . ILE E  5  674  ? 21.168  127.412 171.519 1.00 47.60  ? 674  ILE A O   1 
ATOM   7533  C  CB  . ILE E  5  674  ? 22.641  124.522 170.790 1.00 44.49  ? 674  ILE A CB  1 
ATOM   7534  C  CG1 . ILE E  5  674  ? 21.988  123.220 170.394 1.00 42.42  ? 674  ILE A CG1 1 
ATOM   7535  C  CG2 . ILE E  5  674  ? 22.462  124.641 172.277 1.00 51.64  ? 674  ILE A CG2 1 
ATOM   7536  C  CD1 . ILE E  5  674  ? 22.446  122.750 169.103 1.00 66.99  ? 674  ILE A CD1 1 
ATOM   7537  N  N   . SER E  5  675  ? 23.297  127.557 170.838 1.00 44.77  ? 675  SER A N   1 
ATOM   7538  C  CA  . SER E  5  675  ? 23.548  128.794 171.532 1.00 43.67  ? 675  SER A CA  1 
ATOM   7539  C  C   . SER E  5  675  ? 22.536  129.850 171.102 1.00 48.50  ? 675  SER A C   1 
ATOM   7540  O  O   . SER E  5  675  ? 21.929  130.508 171.947 1.00 59.19  ? 675  SER A O   1 
ATOM   7541  C  CB  . SER E  5  675  ? 24.978  129.250 171.291 1.00 43.49  ? 675  SER A CB  1 
ATOM   7542  O  OG  . SER E  5  675  ? 25.874  128.430 172.012 1.00 43.10  ? 675  SER A OG  1 
ATOM   7543  N  N   . ALA E  5  676  ? 22.332  129.977 169.794 1.00 44.22  ? 676  ALA A N   1 
ATOM   7544  C  CA  . ALA E  5  676  ? 21.346  130.905 169.243 1.00 49.14  ? 676  ALA A CA  1 
ATOM   7545  C  C   . ALA E  5  676  ? 19.950  130.673 169.811 1.00 50.72  ? 676  ALA A C   1 
ATOM   7546  O  O   . ALA E  5  676  ? 19.270  131.622 170.197 1.00 49.54  ? 676  ALA A O   1 
ATOM   7547  C  CB  . ALA E  5  676  ? 21.305  130.796 167.743 1.00 50.86  ? 676  ALA A CB  1 
ATOM   7548  N  N   . GLY E  5  677  ? 19.513  129.421 169.855 1.00 51.39  ? 677  GLY A N   1 
ATOM   7549  C  CA  . GLY E  5  677  ? 18.195  129.102 170.381 1.00 54.12  ? 677  GLY A CA  1 
ATOM   7550  C  C   . GLY E  5  677  ? 17.943  129.513 171.820 1.00 45.41  ? 677  GLY A C   1 
ATOM   7551  O  O   . GLY E  5  677  ? 16.869  130.011 172.154 1.00 45.94  ? 677  GLY A O   1 
ATOM   7552  N  N   . VAL E  5  678  ? 18.933  129.302 172.676 1.00 49.21  ? 678  VAL A N   1 
ATOM   7553  C  CA  . VAL E  5  678  ? 18.813  129.683 174.079 1.00 52.06  ? 678  VAL A CA  1 
ATOM   7554  C  C   . VAL E  5  678  ? 18.555  131.175 174.173 1.00 60.19  ? 678  VAL A C   1 
ATOM   7555  O  O   . VAL E  5  678  ? 17.738  131.626 174.970 1.00 65.88  ? 678  VAL A O   1 
ATOM   7556  C  CB  . VAL E  5  678  ? 20.076  129.339 174.892 1.00 53.60  ? 678  VAL A CB  1 
ATOM   7557  C  CG1 . VAL E  5  678  ? 20.103  130.119 176.206 1.00 45.67  ? 678  VAL A CG1 1 
ATOM   7558  C  CG2 . VAL E  5  678  ? 20.136  127.850 175.151 1.00 48.74  ? 678  VAL A CG2 1 
ATOM   7559  N  N   . TRP E  5  679  ? 19.249  131.933 173.333 1.00 46.06  ? 679  TRP A N   1 
ATOM   7560  C  CA  . TRP E  5  679  ? 19.072  133.374 173.275 1.00 51.16  ? 679  TRP A CA  1 
ATOM   7561  C  C   . TRP E  5  679  ? 17.751  133.828 172.625 1.00 50.05  ? 679  TRP A C   1 
ATOM   7562  O  O   . TRP E  5  679  ? 17.036  134.641 173.191 1.00 50.22  ? 679  TRP A O   1 
ATOM   7563  C  CB  . TRP E  5  679  ? 20.263  134.023 172.576 1.00 46.52  ? 679  TRP A CB  1 
ATOM   7564  C  CG  . TRP E  5  679  ? 21.349  134.375 173.505 1.00 46.52  ? 679  TRP A CG  1 
ATOM   7565  C  CD1 . TRP E  5  679  ? 22.593  133.841 173.540 1.00 49.27  ? 679  TRP A CD1 1 
ATOM   7566  C  CD2 . TRP E  5  679  ? 21.298  135.345 174.558 1.00 56.38  ? 679  TRP A CD2 1 
ATOM   7567  N  NE1 . TRP E  5  679  ? 23.323  134.401 174.563 1.00 54.69  ? 679  TRP A NE1 1 
ATOM   7568  C  CE2 . TRP E  5  679  ? 22.549  135.336 175.198 1.00 53.27  ? 679  TRP A CE2 1 
ATOM   7569  C  CE3 . TRP E  5  679  ? 20.314  136.223 175.027 1.00 59.72  ? 679  TRP A CE3 1 
ATOM   7570  C  CZ2 . TRP E  5  679  ? 22.849  136.174 176.267 1.00 55.49  ? 679  TRP A CZ2 1 
ATOM   7571  C  CZ3 . TRP E  5  679  ? 20.612  137.043 176.099 1.00 48.33  ? 679  TRP A CZ3 1 
ATOM   7572  C  CH2 . TRP E  5  679  ? 21.864  137.010 176.705 1.00 48.15  ? 679  TRP A CH2 1 
ATOM   7573  N  N   . LEU E  5  680  ? 17.432  133.313 171.442 1.00 49.16  ? 680  LEU A N   1 
ATOM   7574  C  CA  . LEU E  5  680  ? 16.236  133.752 170.735 1.00 52.11  ? 680  LEU A CA  1 
ATOM   7575  C  C   . LEU E  5  680  ? 14.956  133.432 171.506 1.00 53.53  ? 680  LEU A C   1 
ATOM   7576  O  O   . LEU E  5  680  ? 13.988  134.174 171.431 1.00 55.55  ? 680  LEU A O   1 
ATOM   7577  C  CB  . LEU E  5  680  ? 16.182  133.151 169.325 1.00 47.02  ? 680  LEU A CB  1 
ATOM   7578  C  CG  . LEU E  5  680  ? 15.080  133.598 168.353 1.00 52.01  ? 680  LEU A CG  1 
ATOM   7579  C  CD1 . LEU E  5  680  ? 15.619  133.564 166.941 1.00 47.28  ? 680  LEU A CD1 1 
ATOM   7580  C  CD2 . LEU E  5  680  ? 13.830  132.730 168.443 1.00 49.94  ? 680  LEU A CD2 1 
ATOM   7581  N  N   . THR E  5  681  ? 14.947  132.337 172.251 1.00 50.85  ? 681  THR A N   1 
ATOM   7582  C  CA  . THR E  5  681  ? 13.716  131.918 172.897 1.00 47.72  ? 681  THR A CA  1 
ATOM   7583  C  C   . THR E  5  681  ? 13.672  132.358 174.365 1.00 48.11  ? 681  THR A C   1 
ATOM   7584  O  O   . THR E  5  681  ? 12.761  131.990 175.099 1.00 48.44  ? 681  THR A O   1 
ATOM   7585  C  CB  . THR E  5  681  ? 13.465  130.384 172.738 1.00 47.28  ? 681  THR A CB  1 
ATOM   7586  O  OG1 . THR E  5  681  ? 14.554  129.643 173.304 1.00 47.22  ? 681  THR A OG1 1 
ATOM   7587  C  CG2 . THR E  5  681  ? 13.354  130.026 171.299 1.00 47.03  ? 681  THR A CG2 1 
ATOM   7588  N  N   . SER E  5  682  ? 14.667  133.139 174.784 1.00 53.39  ? 682  SER A N   1 
ATOM   7589  C  CA  . SER E  5  682  ? 14.719  133.714 176.140 1.00 48.59  ? 682  SER A CA  1 
ATOM   7590  C  C   . SER E  5  682  ? 13.543  134.675 176.390 1.00 57.76  ? 682  SER A C   1 
ATOM   7591  O  O   . SER E  5  682  ? 13.100  135.363 175.470 1.00 54.28  ? 682  SER A O   1 
ATOM   7592  C  CB  . SER E  5  682  ? 16.043  134.465 176.328 1.00 48.50  ? 682  SER A CB  1 
ATOM   7593  O  OG  . SER E  5  682  ? 16.109  135.143 177.571 1.00 54.58  ? 682  SER A OG  1 
ATOM   7594  N  N   . LYS E  5  683  ? 13.035  134.724 177.621 1.00 49.89  ? 683  LYS A N   1 
ATOM   7595  C  CA  . LYS E  5  683  ? 12.007  135.699 177.981 1.00 55.80  ? 683  LYS A CA  1 
ATOM   7596  C  C   . LYS E  5  683  ? 12.418  137.147 177.644 1.00 58.28  ? 683  LYS A C   1 
ATOM   7597  O  O   . LYS E  5  683  ? 11.574  137.957 177.262 1.00 58.26  ? 683  LYS A O   1 
ATOM   7598  C  CB  . LYS E  5  683  ? 11.648  135.604 179.462 1.00 51.23  ? 683  LYS A CB  1 
ATOM   7599  C  CG  . LYS E  5  683  ? 10.253  135.091 179.772 1.00 58.35  ? 683  LYS A CG  1 
ATOM   7600  C  CD  . LYS E  5  683  ? 10.021  135.094 181.278 1.00 52.21  ? 683  LYS A CD  1 
ATOM   7601  C  CE  . LYS E  5  683  ? 9.281   133.862 181.718 1.00 80.43  ? 683  LYS A CE  1 
ATOM   7602  N  NZ  . LYS E  5  683  ? 9.545   133.598 183.154 1.00 80.53  ? 683  LYS A NZ  1 
ATOM   7603  N  N   . ASP E  5  684  ? 13.710  137.449 177.758 1.00 50.85  ? 684  ASP A N   1 
ATOM   7604  C  CA  . ASP E  5  684  ? 14.245  138.780 177.456 1.00 65.63  ? 684  ASP A CA  1 
ATOM   7605  C  C   . ASP E  5  684  ? 14.199  139.144 175.976 1.00 71.64  ? 684  ASP A C   1 
ATOM   7606  O  O   . ASP E  5  684  ? 14.572  140.263 175.595 1.00 69.16  ? 684  ASP A O   1 
ATOM   7607  C  CB  . ASP E  5  684  ? 15.706  138.884 177.905 1.00 72.59  ? 684  ASP A CB  1 
ATOM   7608  C  CG  . ASP E  5  684  ? 15.911  139.856 179.062 1.00 77.97  ? 684  ASP A CG  1 
ATOM   7609  O  OD1 . ASP E  5  684  ? 14.953  140.542 179.469 1.00 73.95  ? 684  ASP A OD1 1 
ATOM   7610  O  OD2 . ASP E  5  684  ? 17.046  139.924 179.573 1.00 85.29  ? 684  ASP A OD2 1 
ATOM   7611  N  N   . SER E  5  685  ? 13.766  138.204 175.137 1.00 75.13  ? 685  SER A N   1 
ATOM   7612  C  CA  . SER E  5  685  ? 13.780  138.411 173.689 1.00 63.50  ? 685  SER A CA  1 
ATOM   7613  C  C   . SER E  5  685  ? 12.496  138.999 173.102 1.00 62.18  ? 685  SER A C   1 
ATOM   7614  O  O   . SER E  5  685  ? 11.420  138.407 173.190 1.00 61.40  ? 685  SER A O   1 
ATOM   7615  C  CB  . SER E  5  685  ? 14.188  137.136 172.972 1.00 53.20  ? 685  SER A CB  1 
ATOM   7616  O  OG  . SER E  5  685  ? 15.593  137.088 172.862 1.00 59.19  ? 685  SER A OG  1 
ATOM   7617  N  N   . PHE E  5  686  ? 12.635  140.192 172.525 1.00 66.19  ? 686  PHE A N   1 
ATOM   7618  C  CA  . PHE E  5  686  ? 11.521  140.918 171.914 1.00 52.18  ? 686  PHE A CA  1 
ATOM   7619  C  C   . PHE E  5  686  ? 11.917  141.465 170.556 1.00 58.83  ? 686  PHE A C   1 
ATOM   7620  O  O   . PHE E  5  686  ? 13.089  141.743 170.302 1.00 64.04  ? 686  PHE A O   1 
ATOM   7621  C  CB  . PHE E  5  686  ? 11.077  142.065 172.801 1.00 53.03  ? 686  PHE A CB  1 
ATOM   7622  C  CG  . PHE E  5  686  ? 10.514  141.641 174.105 1.00 74.55  ? 686  PHE A CG  1 
ATOM   7623  C  CD1 . PHE E  5  686  ? 9.165   141.375 174.232 1.00 53.57  ? 686  PHE A CD1 1 
ATOM   7624  C  CD2 . PHE E  5  686  ? 11.320  141.535 175.211 1.00 53.07  ? 686  PHE A CD2 1 
ATOM   7625  C  CE1 . PHE E  5  686  ? 8.631   140.992 175.437 1.00 53.81  ? 686  PHE A CE1 1 
ATOM   7626  C  CE2 . PHE E  5  686  ? 10.796  141.165 176.422 1.00 53.31  ? 686  PHE A CE2 1 
ATOM   7627  C  CZ  . PHE E  5  686  ? 9.446   140.884 176.540 1.00 61.73  ? 686  PHE A CZ  1 
ATOM   7628  N  N   . PHE E  5  687  ? 10.936  141.613 169.678 1.00 58.49  ? 687  PHE A N   1 
ATOM   7629  C  CA  . PHE E  5  687  ? 11.203  142.002 168.301 1.00 56.87  ? 687  PHE A CA  1 
ATOM   7630  C  C   . PHE E  5  687  ? 10.103  142.909 167.839 1.00 61.19  ? 687  PHE A C   1 
ATOM   7631  O  O   . PHE E  5  687  ? 8.940   142.708 168.196 1.00 61.73  ? 687  PHE A O   1 
ATOM   7632  C  CB  . PHE E  5  687  ? 11.244  140.764 167.403 1.00 55.50  ? 687  PHE A CB  1 
ATOM   7633  C  CG  . PHE E  5  687  ? 12.266  139.745 167.824 1.00 56.84  ? 687  PHE A CG  1 
ATOM   7634  C  CD1 . PHE E  5  687  ? 13.564  139.824 167.366 1.00 50.67  ? 687  PHE A CD1 1 
ATOM   7635  C  CD2 . PHE E  5  687  ? 11.928  138.721 168.693 1.00 53.33  ? 687  PHE A CD2 1 
ATOM   7636  C  CE1 . PHE E  5  687  ? 14.497  138.910 167.762 1.00 61.22  ? 687  PHE A CE1 1 
ATOM   7637  C  CE2 . PHE E  5  687  ? 12.870  137.812 169.106 1.00 51.89  ? 687  PHE A CE2 1 
ATOM   7638  C  CZ  . PHE E  5  687  ? 14.152  137.905 168.637 1.00 49.61  ? 687  PHE A CZ  1 
ATOM   7639  N  N   . THR E  5  688  ? 10.457  143.913 167.051 1.00 53.81  ? 688  THR A N   1 
ATOM   7640  C  CA  . THR E  5  688  ? 9.451   144.803 166.501 1.00 67.56  ? 688  THR A CA  1 
ATOM   7641  C  C   . THR E  5  688  ? 8.806   144.129 165.315 1.00 70.13  ? 688  THR A C   1 
ATOM   7642  O  O   . THR E  5  688  ? 9.310   143.116 164.837 1.00 69.14  ? 688  THR A O   1 
ATOM   7643  C  CB  . THR E  5  688  ? 10.064  146.085 166.019 1.00 55.19  ? 688  THR A CB  1 
ATOM   7644  O  OG1 . THR E  5  688  ? 11.009  145.801 164.984 1.00 64.89  ? 688  THR A OG1 1 
ATOM   7645  C  CG2 . THR E  5  688  ? 10.769  146.743 167.139 1.00 57.96  ? 688  THR A CG2 1 
ATOM   7646  N  N   . ARG E  5  689  ? 7.698   144.693 164.845 1.00 72.98  ? 689  ARG A N   1 
ATOM   7647  C  CA  . ARG E  5  689  ? 7.012   144.173 163.672 1.00 68.41  ? 689  ARG A CA  1 
ATOM   7648  C  C   . ARG E  5  689  ? 7.995   143.910 162.532 1.00 64.78  ? 689  ARG A C   1 
ATOM   7649  O  O   . ARG E  5  689  ? 7.985   142.828 161.935 1.00 54.28  ? 689  ARG A O   1 
ATOM   7650  C  CB  . ARG E  5  689  ? 5.889   145.132 163.238 1.00 56.21  ? 689  ARG A CB  1 
ATOM   7651  C  CG  . ARG E  5  689  ? 5.083   144.672 162.031 1.00 56.35  ? 689  ARG A CG  1 
ATOM   7652  C  CD  . ARG E  5  689  ? 3.691   145.273 162.031 1.00 60.30  ? 689  ARG A CD  1 
ATOM   7653  N  NE  . ARG E  5  689  ? 2.984   145.093 160.757 1.00 65.40  ? 689  ARG A NE  1 
ATOM   7654  C  CZ  . ARG E  5  689  ? 3.089   145.921 159.721 1.00 66.80  ? 689  ARG A CZ  1 
ATOM   7655  N  NH1 . ARG E  5  689  ? 3.872   146.991 159.798 1.00 66.79  ? 689  ARG A NH1 1 
ATOM   7656  N  NH2 . ARG E  5  689  ? 2.408   145.681 158.610 1.00 58.41  ? 689  ARG A NH2 1 
ATOM   7657  N  N   . GLU E  5  690  ? 8.864   144.892 162.282 1.00 56.58  ? 690  GLU A N   1 
ATOM   7658  C  CA  . GLU E  5  690  ? 9.833   144.841 161.189 1.00 58.60  ? 690  GLU A CA  1 
ATOM   7659  C  C   . GLU E  5  690  ? 10.765  143.642 161.325 1.00 63.38  ? 690  GLU A C   1 
ATOM   7660  O  O   . GLU E  5  690  ? 10.963  142.898 160.368 1.00 69.18  ? 690  GLU A O   1 
ATOM   7661  C  CB  . GLU E  5  690  ? 10.654  146.137 161.112 1.00 65.96  ? 690  GLU A CB  1 
ATOM   7662  C  CG  . GLU E  5  690  ? 9.875   147.386 160.692 1.00 85.84  ? 690  GLU A CG  1 
ATOM   7663  C  CD  . GLU E  5  690  ? 8.817   147.826 161.721 1.00 97.70  ? 690  GLU A CD  1 
ATOM   7664  O  OE1 . GLU E  5  690  ? 9.040   147.616 162.938 1.00 100.98 ? 690  GLU A OE1 1 
ATOM   7665  O  OE2 . GLU E  5  690  ? 7.765   148.379 161.310 1.00 97.70  ? 690  GLU A OE2 1 
ATOM   7666  N  N   . GLN E  5  691  ? 11.324  143.460 162.518 1.00 65.82  ? 691  GLN A N   1 
ATOM   7667  C  CA  . GLN E  5  691  ? 12.271  142.382 162.772 1.00 67.35  ? 691  GLN A CA  1 
ATOM   7668  C  C   . GLN E  5  691  ? 11.585  141.013 162.695 1.00 66.17  ? 691  GLN A C   1 
ATOM   7669  O  O   . GLN E  5  691  ? 12.080  140.091 162.053 1.00 69.20  ? 691  GLN A O   1 
ATOM   7670  C  CB  . GLN E  5  691  ? 12.906  142.545 164.154 1.00 66.52  ? 691  GLN A CB  1 
ATOM   7671  C  CG  . GLN E  5  691  ? 13.667  143.835 164.412 1.00 63.58  ? 691  GLN A CG  1 
ATOM   7672  C  CD  . GLN E  5  691  ? 14.100  143.940 165.871 1.00 64.84  ? 691  GLN A CD  1 
ATOM   7673  O  OE1 . GLN E  5  691  ? 13.262  144.019 166.775 1.00 69.85  ? 691  GLN A OE1 1 
ATOM   7674  N  NE2 . GLN E  5  691  ? 15.409  143.909 166.109 1.00 60.80  ? 691  GLN A NE2 1 
ATOM   7675  N  N   . TYR E  5  692  ? 10.448  140.900 163.373 1.00 60.23  ? 692  TYR A N   1 
ATOM   7676  C  CA  . TYR E  5  692  ? 9.647   139.680 163.407 1.00 54.06  ? 692  TYR A CA  1 
ATOM   7677  C  C   . TYR E  5  692  ? 9.326   139.195 162.017 1.00 51.99  ? 692  TYR A C   1 
ATOM   7678  O  O   . TYR E  5  692  ? 9.597   138.058 161.695 1.00 57.17  ? 692  TYR A O   1 
ATOM   7679  C  CB  . TYR E  5  692  ? 8.363   139.938 164.196 1.00 53.18  ? 692  TYR A CB  1 
ATOM   7680  C  CG  . TYR E  5  692  ? 7.297   138.872 164.123 1.00 53.00  ? 692  TYR A CG  1 
ATOM   7681  C  CD1 . TYR E  5  692  ? 7.471   137.635 164.716 1.00 52.83  ? 692  TYR A CD1 1 
ATOM   7682  C  CD2 . TYR E  5  692  ? 6.093   139.127 163.511 1.00 53.94  ? 692  TYR A CD2 1 
ATOM   7683  C  CE1 . TYR E  5  692  ? 6.474   136.676 164.671 1.00 57.63  ? 692  TYR A CE1 1 
ATOM   7684  C  CE2 . TYR E  5  692  ? 5.094   138.185 163.458 1.00 53.07  ? 692  TYR A CE2 1 
ATOM   7685  C  CZ  . TYR E  5  692  ? 5.280   136.966 164.038 1.00 61.21  ? 692  TYR A CZ  1 
ATOM   7686  O  OH  . TYR E  5  692  ? 4.262   136.042 163.977 1.00 63.76  ? 692  TYR A OH  1 
ATOM   7687  N  N   . GLN E  5  693  ? 8.777   140.064 161.182 1.00 52.68  ? 693  GLN A N   1 
ATOM   7688  C  CA  . GLN E  5  693  ? 8.467   139.677 159.815 1.00 57.14  ? 693  GLN A CA  1 
ATOM   7689  C  C   . GLN E  5  693  ? 9.709   139.275 159.022 1.00 58.09  ? 693  GLN A C   1 
ATOM   7690  O  O   . GLN E  5  693  ? 9.661   138.365 158.182 1.00 54.97  ? 693  GLN A O   1 
ATOM   7691  C  CB  . GLN E  5  693  ? 7.674   140.765 159.088 1.00 53.70  ? 693  GLN A CB  1 
ATOM   7692  C  CG  . GLN E  5  693  ? 6.285   140.929 159.651 1.00 54.22  ? 693  GLN A CG  1 
ATOM   7693  C  CD  . GLN E  5  693  ? 5.418   141.861 158.853 1.00 63.42  ? 693  GLN A CD  1 
ATOM   7694  O  OE1 . GLN E  5  693  ? 5.823   142.385 157.818 1.00 61.81  ? 693  GLN A OE1 1 
ATOM   7695  N  NE2 . GLN E  5  693  ? 4.204   142.073 159.330 1.00 74.73  ? 693  GLN A NE2 1 
ATOM   7696  N  N   . GLN E  5  694  ? 10.826  139.927 159.308 1.00 52.16  ? 694  GLN A N   1 
ATOM   7697  C  CA  . GLN E  5  694  ? 12.040  139.631 158.575 1.00 60.43  ? 694  GLN A CA  1 
ATOM   7698  C  C   . GLN E  5  694  ? 12.659  138.279 158.967 1.00 61.21  ? 694  GLN A C   1 
ATOM   7699  O  O   . GLN E  5  694  ? 13.176  137.557 158.096 1.00 66.34  ? 694  GLN A O   1 
ATOM   7700  C  CB  . GLN E  5  694  ? 13.048  140.767 158.722 1.00 59.56  ? 694  GLN A CB  1 
ATOM   7701  C  CG  . GLN E  5  694  ? 14.434  140.442 158.202 1.00 55.38  ? 694  GLN A CG  1 
ATOM   7702  C  CD  . GLN E  5  694  ? 14.493  140.366 156.702 1.00 56.99  ? 694  GLN A CD  1 
ATOM   7703  O  OE1 . GLN E  5  694  ? 13.491  140.566 156.006 1.00 59.56  ? 694  GLN A OE1 1 
ATOM   7704  N  NE2 . GLN E  5  694  ? 15.674  140.095 156.187 1.00 51.44  ? 694  GLN A NE2 1 
ATOM   7705  N  N   . TYR E  5  695  ? 12.600  137.925 160.257 1.00 52.55  ? 695  TYR A N   1 
ATOM   7706  C  CA  . TYR E  5  695  ? 13.126  136.633 160.690 1.00 58.78  ? 695  TYR A CA  1 
ATOM   7707  C  C   . TYR E  5  695  ? 12.316  135.517 160.041 1.00 57.85  ? 695  TYR A C   1 
ATOM   7708  O  O   . TYR E  5  695  ? 12.882  134.523 159.567 1.00 56.56  ? 695  TYR A O   1 
ATOM   7709  C  CB  . TYR E  5  695  ? 13.158  136.498 162.218 1.00 49.46  ? 695  TYR A CB  1 
ATOM   7710  C  CG  . TYR E  5  695  ? 14.411  137.085 162.827 1.00 49.28  ? 695  TYR A CG  1 
ATOM   7711  C  CD1 . TYR E  5  695  ? 15.668  136.720 162.368 1.00 57.05  ? 695  TYR A CD1 1 
ATOM   7712  C  CD2 . TYR E  5  695  ? 14.336  138.044 163.831 1.00 61.13  ? 695  TYR A CD2 1 
ATOM   7713  C  CE1 . TYR E  5  695  ? 16.814  137.282 162.905 1.00 60.89  ? 695  TYR A CE1 1 
ATOM   7714  C  CE2 . TYR E  5  695  ? 15.472  138.613 164.369 1.00 61.39  ? 695  TYR A CE2 1 
ATOM   7715  C  CZ  . TYR E  5  695  ? 16.714  138.227 163.909 1.00 61.55  ? 695  TYR A CZ  1 
ATOM   7716  O  OH  . TYR E  5  695  ? 17.858  138.792 164.450 1.00 58.24  ? 695  TYR A OH  1 
ATOM   7717  N  N   . ILE E  5  696  ? 11.000  135.720 159.998 1.00 52.73  ? 696  ILE A N   1 
ATOM   7718  C  CA  . ILE E  5  696  ? 10.070  134.752 159.432 1.00 53.58  ? 696  ILE A CA  1 
ATOM   7719  C  C   . ILE E  5  696  ? 10.411  134.472 157.981 1.00 57.78  ? 696  ILE A C   1 
ATOM   7720  O  O   . ILE E  5  696  ? 10.678  133.335 157.613 1.00 63.09  ? 696  ILE A O   1 
ATOM   7721  C  CB  . ILE E  5  696  ? 8.604   135.236 159.515 1.00 50.86  ? 696  ILE A CB  1 
ATOM   7722  C  CG1 . ILE E  5  696  ? 8.169   135.359 160.963 1.00 63.38  ? 696  ILE A CG1 1 
ATOM   7723  C  CG2 . ILE E  5  696  ? 7.680   134.267 158.818 1.00 50.96  ? 696  ILE A CG2 1 
ATOM   7724  C  CD1 . ILE E  5  696  ? 8.504   134.143 161.772 1.00 64.98  ? 696  ILE A CD1 1 
ATOM   7725  N  N   . TYR E  5  697  ? 10.418  135.512 157.157 1.00 56.46  ? 697  TYR A N   1 
ATOM   7726  C  CA  . TYR E  5  697  ? 10.622  135.312 155.732 1.00 54.33  ? 697  TYR A CA  1 
ATOM   7727  C  C   . TYR E  5  697  ? 12.024  134.793 155.382 1.00 51.30  ? 697  TYR A C   1 
ATOM   7728  O  O   . TYR E  5  697  ? 12.215  134.093 154.388 1.00 50.19  ? 697  TYR A O   1 
ATOM   7729  C  CB  . TYR E  5  697  ? 10.334  136.589 154.952 1.00 51.69  ? 697  TYR A CB  1 
ATOM   7730  C  CG  . TYR E  5  697  ? 10.528  136.366 153.486 1.00 51.92  ? 697  TYR A CG  1 
ATOM   7731  C  CD1 . TYR E  5  697  ? 9.633   135.590 152.776 1.00 52.12  ? 697  TYR A CD1 1 
ATOM   7732  C  CD2 . TYR E  5  697  ? 11.624  136.887 152.821 1.00 58.56  ? 697  TYR A CD2 1 
ATOM   7733  C  CE1 . TYR E  5  697  ? 9.807   135.345 151.450 1.00 62.01  ? 697  TYR A CE1 1 
ATOM   7734  C  CE2 . TYR E  5  697  ? 11.801  136.656 151.469 1.00 61.77  ? 697  TYR A CE2 1 
ATOM   7735  C  CZ  . TYR E  5  697  ? 10.880  135.883 150.794 1.00 63.32  ? 697  TYR A CZ  1 
ATOM   7736  O  OH  . TYR E  5  697  ? 11.016  135.630 149.456 1.00 73.70  ? 697  TYR A OH  1 
ATOM   7737  N  N   . GLY E  5  698  ? 13.004  135.150 156.197 1.00 49.92  ? 698  GLY A N   1 
ATOM   7738  C  CA  . GLY E  5  698  ? 14.366  134.749 155.928 1.00 55.74  ? 698  GLY A CA  1 
ATOM   7739  C  C   . GLY E  5  698  ? 14.565  133.252 156.122 1.00 62.24  ? 698  GLY A C   1 
ATOM   7740  O  O   . GLY E  5  698  ? 15.511  132.674 155.582 1.00 66.66  ? 698  GLY A O   1 
ATOM   7741  N  N   . CYS E  5  699  ? 13.672  132.613 156.876 1.00 59.30  ? 699  CYS A N   1 
ATOM   7742  C  CA  . CYS E  5  699  ? 13.823  131.191 157.156 1.00 58.86  ? 699  CYS A CA  1 
ATOM   7743  C  C   . CYS E  5  699  ? 12.741  130.276 156.564 1.00 66.45  ? 699  CYS A C   1 
ATOM   7744  O  O   . CYS E  5  699  ? 12.939  129.067 156.475 1.00 71.47  ? 699  CYS A O   1 
ATOM   7745  C  CB  . CYS E  5  699  ? 13.949  130.947 158.663 1.00 50.27  ? 699  CYS A CB  1 
ATOM   7746  S  SG  . CYS E  5  699  ? 12.419  131.086 159.602 1.00 56.14  ? 699  CYS A SG  1 
ATOM   7747  N  N   . ILE E  5  700  ? 11.604  130.834 156.168 1.00 69.52  ? 700  ILE A N   1 
ATOM   7748  C  CA  . ILE E  5  700  ? 10.492  130.021 155.688 1.00 70.34  ? 700  ILE A CA  1 
ATOM   7749  C  C   . ILE E  5  700  ? 10.759  129.470 154.296 1.00 86.03  ? 700  ILE A C   1 
ATOM   7750  O  O   . ILE E  5  700  ? 10.562  128.273 154.044 1.00 89.49  ? 700  ILE A O   1 
ATOM   7751  C  CB  . ILE E  5  700  ? 9.154   130.800 155.719 1.00 66.38  ? 700  ILE A CB  1 
ATOM   7752  C  CG1 . ILE E  5  700  ? 8.565   130.782 157.131 1.00 65.29  ? 700  ILE A CG1 1 
ATOM   7753  C  CG2 . ILE E  5  700  ? 8.148   130.198 154.788 1.00 67.73  ? 700  ILE A CG2 1 
ATOM   7754  C  CD1 . ILE E  5  700  ? 8.677   129.455 157.837 1.00 64.16  ? 700  ILE A CD1 1 
ATOM   7755  N  N   . ARG E  5  701  ? 11.235  130.332 153.402 1.00 97.84  ? 701  ARG A N   1 
ATOM   7756  C  CA  . ARG E  5  701  ? 11.385  129.962 151.989 1.00 106.39 ? 701  ARG A CA  1 
ATOM   7757  C  C   . ARG E  5  701  ? 10.058  129.477 151.401 1.00 107.11 ? 701  ARG A C   1 
ATOM   7758  O  O   . ARG E  5  701  ? 9.970   128.358 150.902 1.00 102.04 ? 701  ARG A O   1 
ATOM   7759  C  CB  . ARG E  5  701  ? 12.475  128.893 151.801 1.00 106.83 ? 701  ARG A CB  1 
ATOM   7760  C  CG  . ARG E  5  701  ? 13.881  129.457 151.649 1.00 109.19 ? 701  ARG A CG  1 
ATOM   7761  C  CD  . ARG E  5  701  ? 14.908  128.358 151.463 1.00 107.96 ? 701  ARG A CD  1 
ATOM   7762  N  NE  . ARG E  5  701  ? 14.443  127.304 150.559 1.00 110.96 ? 701  ARG A NE  1 
ATOM   7763  C  CZ  . ARG E  5  701  ? 15.248  126.417 149.972 1.00 112.39 ? 701  ARG A CZ  1 
ATOM   7764  N  NH1 . ARG E  5  701  ? 16.563  126.468 150.189 1.00 120.33 ? 701  ARG A NH1 1 
ATOM   7765  N  NH2 . ARG E  5  701  ? 14.752  125.483 149.167 1.00 99.93  ? 701  ARG A NH2 1 
ATOM   7766  N  N   . PRO E  5  702  ? 9.017   130.327 151.455 1.00 116.49 ? 702  PRO A N   1 
ATOM   7767  C  CA  . PRO E  5  702  ? 7.661   129.893 151.089 1.00 121.21 ? 702  PRO A CA  1 
ATOM   7768  C  C   . PRO E  5  702  ? 7.551   129.596 149.604 1.00 122.20 ? 702  PRO A C   1 
ATOM   7769  O  O   . PRO E  5  702  ? 6.607   128.944 149.158 1.00 127.12 ? 702  PRO A O   1 
ATOM   7770  C  CB  . PRO E  5  702  ? 6.797   131.104 151.453 1.00 120.98 ? 702  PRO A CB  1 
ATOM   7771  C  CG  . PRO E  5  702  ? 7.709   132.260 151.299 1.00 118.70 ? 702  PRO A CG  1 
ATOM   7772  C  CD  . PRO E  5  702  ? 9.075   131.776 151.724 1.00 118.22 ? 702  PRO A CD  1 
ATOM   7773  N  N   . GLU E  5  703  ? 8.531   130.074 148.848 1.00 117.56 ? 703  GLU A N   1 
ATOM   7774  C  CA  . GLU E  5  703  ? 8.631   129.782 147.430 1.00 111.70 ? 703  GLU A CA  1 
ATOM   7775  C  C   . GLU E  5  703  ? 9.169   128.371 147.226 1.00 112.79 ? 703  GLU A C   1 
ATOM   7776  O  O   . GLU E  5  703  ? 10.092  128.166 146.439 1.00 106.35 ? 703  GLU A O   1 
ATOM   7777  C  CB  . GLU E  5  703  ? 9.556   130.797 146.759 1.00 105.70 ? 703  GLU A CB  1 
ATOM   7778  C  CG  . GLU E  5  703  ? 9.088   132.240 146.907 1.00 105.14 ? 703  GLU A CG  1 
ATOM   7779  C  CD  . GLU E  5  703  ? 9.815   133.007 148.003 1.00 101.26 ? 703  GLU A CD  1 
ATOM   7780  O  OE1 . GLU E  5  703  ? 10.949  132.610 148.357 1.00 100.10 ? 703  GLU A OE1 1 
ATOM   7781  O  OE2 . GLU E  5  703  ? 9.248   134.012 148.501 1.00 97.00  ? 703  GLU A OE2 1 
ATOM   7782  N  N   . ASP E  5  704  ? 8.588   127.410 147.946 1.00 123.61 ? 704  ASP A N   1 
ATOM   7783  C  CA  . ASP E  5  704  ? 9.027   126.016 147.907 1.00 131.02 ? 704  ASP A CA  1 
ATOM   7784  C  C   . ASP E  5  704  ? 7.895   125.023 147.700 1.00 138.16 ? 704  ASP A C   1 
ATOM   7785  O  O   . ASP E  5  704  ? 6.793   125.381 147.267 1.00 144.14 ? 704  ASP A O   1 
ATOM   7786  C  CB  . ASP E  5  704  ? 9.747   125.648 149.195 1.00 131.59 ? 704  ASP A CB  1 
ATOM   7787  C  CG  . ASP E  5  704  ? 11.227  125.543 149.003 1.00 137.88 ? 704  ASP A CG  1 
ATOM   7788  O  OD1 . ASP E  5  704  ? 11.649  125.577 147.825 1.00 133.65 ? 704  ASP A OD1 1 
ATOM   7789  O  OD2 . ASP E  5  704  ? 11.960  125.423 150.016 1.00 145.09 ? 704  ASP A OD2 1 
ATOM   7790  N  N   . GLY E  5  705  ? 8.186   123.766 148.019 1.00 135.50 ? 705  GLY A N   1 
ATOM   7791  C  CA  . GLY E  5  705  ? 7.191   122.715 147.982 1.00 136.99 ? 705  GLY A CA  1 
ATOM   7792  C  C   . GLY E  5  705  ? 6.283   122.793 149.193 1.00 139.69 ? 705  GLY A C   1 
ATOM   7793  O  O   . GLY E  5  705  ? 5.219   122.172 149.211 1.00 136.31 ? 705  GLY A O   1 
ATOM   7794  N  N   . HIS E  5  706  ? 6.703   123.553 150.206 1.00 146.18 ? 706  HIS A N   1 
ATOM   7795  C  CA  . HIS E  5  706  ? 5.850   123.803 151.370 1.00 152.48 ? 706  HIS A CA  1 
ATOM   7796  C  C   . HIS E  5  706  ? 4.947   125.038 151.215 1.00 158.54 ? 706  HIS A C   1 
ATOM   7797  O  O   . HIS E  5  706  ? 4.889   125.900 152.106 1.00 152.75 ? 706  HIS A O   1 
ATOM   7798  C  CB  . HIS E  5  706  ? 6.651   123.829 152.682 1.00 148.65 ? 706  HIS A CB  1 
ATOM   7799  C  CG  . HIS E  5  706  ? 6.762   122.483 153.340 1.00 147.25 ? 706  HIS A CG  1 
ATOM   7800  N  ND1 . HIS E  5  706  ? 7.608   121.494 152.880 1.00 145.76 ? 706  HIS A ND1 1 
ATOM   7801  C  CD2 . HIS E  5  706  ? 6.113   121.955 154.406 1.00 143.99 ? 706  HIS A CD2 1 
ATOM   7802  C  CE1 . HIS E  5  706  ? 7.485   120.419 153.642 1.00 140.32 ? 706  HIS A CE1 1 
ATOM   7803  N  NE2 . HIS E  5  706  ? 6.583   120.672 154.573 1.00 140.62 ? 706  HIS A NE2 1 
ATOM   7804  N  N   . THR E  5  707  ? 4.264   125.101 150.062 1.00 165.79 ? 707  THR A N   1 
ATOM   7805  C  CA  . THR E  5  707  ? 3.085   125.952 149.854 1.00 168.59 ? 707  THR A CA  1 
ATOM   7806  C  C   . THR E  5  707  ? 1.960   125.316 150.680 1.00 167.44 ? 707  THR A C   1 
ATOM   7807  O  O   . THR E  5  707  ? 1.001   124.759 150.136 1.00 167.28 ? 707  THR A O   1 
ATOM   7808  C  CB  . THR E  5  707  ? 2.670   126.097 148.318 1.00 111.06 ? 707  THR A CB  1 
ATOM   7809  O  OG1 . THR E  5  707  ? 3.716   126.735 147.567 1.00 115.84 ? 707  THR A OG1 1 
ATOM   7810  C  CG2 . THR E  5  707  ? 1.382   126.920 148.128 1.00 101.79 ? 707  THR A CG2 1 
ATOM   7811  N  N   . THR E  5  708  ? 2.114   125.357 152.004 1.00 166.53 ? 708  THR A N   1 
ATOM   7812  C  CA  . THR E  5  708  ? 1.045   124.959 152.914 1.00 168.97 ? 708  THR A CA  1 
ATOM   7813  C  C   . THR E  5  708  ? -0.030  126.045 152.839 1.00 171.50 ? 708  THR A C   1 
ATOM   7814  O  O   . THR E  5  708  ? -1.219  125.780 153.026 1.00 175.87 ? 708  THR A O   1 
ATOM   7815  C  CB  . THR E  5  708  ? 1.566   124.719 154.365 1.00 112.64 ? 708  THR A CB  1 
ATOM   7816  O  OG1 . THR E  5  708  ? 1.099   125.746 155.257 1.00 108.42 ? 708  THR A OG1 1 
ATOM   7817  C  CG2 . THR E  5  708  ? 3.088   124.661 154.372 1.00 112.77 ? 708  THR A CG2 1 
ATOM   7818  N  N   . ARG E  5  709  ? 0.421   127.269 152.550 1.00 164.58 ? 709  ARG A N   1 
ATOM   7819  C  CA  . ARG E  5  709  ? -0.424  128.374 152.088 1.00 150.66 ? 709  ARG A CA  1 
ATOM   7820  C  C   . ARG E  5  709  ? 0.362   129.134 151.015 1.00 136.55 ? 709  ARG A C   1 
ATOM   7821  O  O   . ARG E  5  709  ? 1.584   129.021 150.940 1.00 134.97 ? 709  ARG A O   1 
ATOM   7822  C  CB  . ARG E  5  709  ? -0.804  129.310 153.248 1.00 149.67 ? 709  ARG A CB  1 
ATOM   7823  C  CG  . ARG E  5  709  ? -0.174  128.950 154.601 1.00 144.56 ? 709  ARG A CG  1 
ATOM   7824  C  CD  . ARG E  5  709  ? -1.179  129.106 155.739 1.00 138.66 ? 709  ARG A CD  1 
ATOM   7825  N  NE  . ARG E  5  709  ? -0.912  128.180 156.841 1.00 132.40 ? 709  ARG A NE  1 
ATOM   7826  C  CZ  . ARG E  5  709  ? -1.720  128.005 157.884 1.00 124.87 ? 709  ARG A CZ  1 
ATOM   7827  N  NH1 . ARG E  5  709  ? -2.849  128.699 157.971 1.00 120.64 ? 709  ARG A NH1 1 
ATOM   7828  N  NH2 . ARG E  5  709  ? -1.402  127.136 158.839 1.00 121.15 ? 709  ARG A NH2 1 
ATOM   7829  N  N   . SER E  5  710  ? -0.309  129.896 150.166 1.00 128.58 ? 710  SER A N   1 
ATOM   7830  C  CA  . SER E  5  710  ? 0.448   130.757 149.270 1.00 125.33 ? 710  SER A CA  1 
ATOM   7831  C  C   . SER E  5  710  ? 0.376   132.185 149.802 1.00 118.37 ? 710  SER A C   1 
ATOM   7832  O  O   . SER E  5  710  ? 0.308   133.152 149.041 1.00 123.08 ? 710  SER A O   1 
ATOM   7833  C  CB  . SER E  5  710  ? -0.033  130.646 147.821 1.00 131.72 ? 710  SER A CB  1 
ATOM   7834  O  OG  . SER E  5  710  ? -1.086  131.554 147.559 1.00 140.61 ? 710  SER A OG  1 
ATOM   7835  N  N   . LYS E  5  711  ? 0.380   132.289 151.130 1.00 103.53 ? 711  LYS A N   1 
ATOM   7836  C  CA  . LYS E  5  711  ? 0.458   133.563 151.841 1.00 88.49  ? 711  LYS A CA  1 
ATOM   7837  C  C   . LYS E  5  711  ? 1.021   133.284 153.240 1.00 81.57  ? 711  LYS A C   1 
ATOM   7838  O  O   . LYS E  5  711  ? 0.513   132.407 153.937 1.00 84.02  ? 711  LYS A O   1 
ATOM   7839  C  CB  . LYS E  5  711  ? -0.929  134.203 151.939 1.00 79.60  ? 711  LYS A CB  1 
ATOM   7840  C  CG  . LYS E  5  711  ? -0.927  135.715 152.138 1.00 79.36  ? 711  LYS A CG  1 
ATOM   7841  C  CD  . LYS E  5  711  ? -2.271  136.341 151.743 1.00 87.57  ? 711  LYS A CD  1 
ATOM   7842  C  CE  . LYS E  5  711  ? -2.199  137.871 151.734 1.00 94.86  ? 711  LYS A CE  1 
ATOM   7843  N  NZ  . LYS E  5  711  ? -3.463  138.506 151.264 1.00 97.17  ? 711  LYS A NZ  1 
ATOM   7844  N  N   . ILE E  5  712  ? 2.071   134.000 153.646 1.00 68.36  ? 712  ILE A N   1 
ATOM   7845  C  CA  . ILE E  5  712  ? 2.626   133.823 154.990 1.00 60.27  ? 712  ILE A CA  1 
ATOM   7846  C  C   . ILE E  5  712  ? 1.717   134.344 156.113 1.00 64.74  ? 712  ILE A C   1 
ATOM   7847  O  O   . ILE E  5  712  ? 1.247   135.497 156.087 1.00 74.34  ? 712  ILE A O   1 
ATOM   7848  C  CB  . ILE E  5  712  ? 3.991   134.487 155.149 1.00 54.03  ? 712  ILE A CB  1 
ATOM   7849  C  CG1 . ILE E  5  712  ? 4.996   133.883 154.190 1.00 53.49  ? 712  ILE A CG1 1 
ATOM   7850  C  CG2 . ILE E  5  712  ? 4.501   134.314 156.574 1.00 52.71  ? 712  ILE A CG2 1 
ATOM   7851  C  CD1 . ILE E  5  712  ? 6.315   134.586 154.257 1.00 57.47  ? 712  ILE A CD1 1 
ATOM   7852  N  N   . VAL E  5  713  ? 1.495   133.488 157.107 1.00 56.82  ? 713  VAL A N   1 
ATOM   7853  C  CA  . VAL E  5  713  ? 0.642   133.806 158.237 1.00 58.77  ? 713  VAL A CA  1 
ATOM   7854  C  C   . VAL E  5  713  ? 1.473   134.302 159.407 1.00 53.61  ? 713  VAL A C   1 
ATOM   7855  O  O   . VAL E  5  713  ? 2.557   133.808 159.644 1.00 52.89  ? 713  VAL A O   1 
ATOM   7856  C  CB  . VAL E  5  713  ? -0.149  132.583 158.663 1.00 61.13  ? 713  VAL A CB  1 
ATOM   7857  C  CG1 . VAL E  5  713  ? -0.935  132.872 159.932 1.00 66.91  ? 713  VAL A CG1 1 
ATOM   7858  C  CG2 . VAL E  5  713  ? -1.077  132.192 157.557 1.00 54.51  ? 713  VAL A CG2 1 
ATOM   7859  N  N   . THR E  5  714  ? 0.971   135.305 160.117 1.00 67.91  ? 714  THR A N   1 
ATOM   7860  C  CA  . THR E  5  714  ? 1.675   135.844 161.275 1.00 65.84  ? 714  THR A CA  1 
ATOM   7861  C  C   . THR E  5  714  ? 0.749   135.890 162.481 1.00 63.15  ? 714  THR A C   1 
ATOM   7862  O  O   . THR E  5  714  ? -0.465  135.823 162.344 1.00 69.91  ? 714  THR A O   1 
ATOM   7863  C  CB  . THR E  5  714  ? 2.224   137.259 161.000 1.00 73.09  ? 714  THR A CB  1 
ATOM   7864  O  OG1 . THR E  5  714  ? 1.185   138.075 160.437 1.00 81.76  ? 714  THR A OG1 1 
ATOM   7865  C  CG2 . THR E  5  714  ? 3.412   137.198 160.033 1.00 63.41  ? 714  THR A CG2 1 
ATOM   7866  N  N   . LEU E  5  715  ? 1.321   136.001 163.667 1.00 53.90  ? 715  LEU A N   1 
ATOM   7867  C  CA  . LEU E  5  715  ? 0.512   136.121 164.866 1.00 54.30  ? 715  LEU A CA  1 
ATOM   7868  C  C   . LEU E  5  715  ? 0.322   137.587 165.221 1.00 63.14  ? 715  LEU A C   1 
ATOM   7869  O  O   . LEU E  5  715  ? 1.034   138.460 164.709 1.00 54.96  ? 715  LEU A O   1 
ATOM   7870  C  CB  . LEU E  5  715  ? 1.195   135.408 166.018 1.00 56.29  ? 715  LEU A CB  1 
ATOM   7871  C  CG  . LEU E  5  715  ? 1.362   133.902 165.938 1.00 58.80  ? 715  LEU A CG  1 
ATOM   7872  C  CD1 . LEU E  5  715  ? 2.168   133.448 167.147 1.00 65.34  ? 715  LEU A CD1 1 
ATOM   7873  C  CD2 . LEU E  5  715  ? 0.004   133.234 165.898 1.00 53.57  ? 715  LEU A CD2 1 
ATOM   7874  N  N   . PRO E  5  716  ? -0.662  137.876 166.081 1.00 61.88  ? 716  PRO A N   1 
ATOM   7875  C  CA  . PRO E  5  716  ? -0.683  139.237 166.639 1.00 67.39  ? 716  PRO A CA  1 
ATOM   7876  C  C   . PRO E  5  716  ? 0.445   139.387 167.653 1.00 69.61  ? 716  PRO A C   1 
ATOM   7877  O  O   . PRO E  5  716  ? 0.947   138.384 168.180 1.00 74.48  ? 716  PRO A O   1 
ATOM   7878  C  CB  . PRO E  5  716  ? -2.050  139.335 167.321 1.00 56.89  ? 716  PRO A CB  1 
ATOM   7879  C  CG  . PRO E  5  716  ? -2.522  137.924 167.489 1.00 58.84  ? 716  PRO A CG  1 
ATOM   7880  C  CD  . PRO E  5  716  ? -1.876  137.106 166.402 1.00 59.30  ? 716  PRO A CD  1 
ATOM   7881  N  N   . PRO E  5  717  ? 0.860   140.626 167.921 1.00 68.61  ? 717  PRO A N   1 
ATOM   7882  C  CA  . PRO E  5  717  ? 1.974   140.843 168.855 1.00 69.92  ? 717  PRO A CA  1 
ATOM   7883  C  C   . PRO E  5  717  ? 1.603   140.468 170.295 1.00 68.70  ? 717  PRO A C   1 
ATOM   7884  O  O   . PRO E  5  717  ? 0.422   140.438 170.646 1.00 67.53  ? 717  PRO A O   1 
ATOM   7885  C  CB  . PRO E  5  717  ? 2.214   142.350 168.740 1.00 65.61  ? 717  PRO A CB  1 
ATOM   7886  C  CG  . PRO E  5  717  ? 0.867   142.890 168.400 1.00 64.70  ? 717  PRO A CG  1 
ATOM   7887  C  CD  . PRO E  5  717  ? 0.286   141.896 167.450 1.00 65.02  ? 717  PRO A CD  1 
ATOM   7888  N  N   . THR E  5  718  ? 2.597   140.187 171.122 1.00 55.28  ? 718  THR A N   1 
ATOM   7889  C  CA  . THR E  5  718  ? 2.326   139.880 172.513 1.00 55.45  ? 718  THR A CA  1 
ATOM   7890  C  C   . THR E  5  718  ? 2.030   141.167 173.263 1.00 71.66  ? 718  THR A C   1 
ATOM   7891  O  O   . THR E  5  718  ? 1.070   141.249 174.023 1.00 74.33  ? 718  THR A O   1 
ATOM   7892  C  CB  . THR E  5  718  ? 3.486   139.109 173.155 1.00 54.67  ? 718  THR A CB  1 
ATOM   7893  O  OG1 . THR E  5  718  ? 3.468   137.762 172.660 1.00 54.04  ? 718  THR A OG1 1 
ATOM   7894  C  CG2 . THR E  5  718  ? 3.335   139.064 174.646 1.00 54.99  ? 718  THR A CG2 1 
ATOM   7895  N  N   . ILE E  5  719  ? 2.843   142.188 173.029 1.00 68.46  ? 719  ILE A N   1 
ATOM   7896  C  CA  . ILE E  5  719  ? 2.590   143.469 173.643 1.00 63.84  ? 719  ILE A CA  1 
ATOM   7897  C  C   . ILE E  5  719  ? 1.982   144.368 172.593 1.00 66.80  ? 719  ILE A C   1 
ATOM   7898  O  O   . ILE E  5  719  ? 2.587   144.608 171.550 1.00 70.01  ? 719  ILE A O   1 
ATOM   7899  C  CB  . ILE E  5  719  ? 3.874   144.091 174.203 1.00 57.08  ? 719  ILE A CB  1 
ATOM   7900  C  CG1 . ILE E  5  719  ? 4.572   143.097 175.132 1.00 56.44  ? 719  ILE A CG1 1 
ATOM   7901  C  CG2 . ILE E  5  719  ? 3.557   145.377 174.955 1.00 58.05  ? 719  ILE A CG2 1 
ATOM   7902  C  CD1 . ILE E  5  719  ? 5.890   143.577 175.651 1.00 56.33  ? 719  ILE A CD1 1 
ATOM   7903  N  N   . PHE E  5  720  ? 0.773   144.849 172.874 1.00 68.18  ? 720  PHE A N   1 
ATOM   7904  C  CA  . PHE E  5  720  ? 0.052   145.745 171.980 1.00 66.30  ? 720  PHE A CA  1 
ATOM   7905  C  C   . PHE E  5  720  ? 0.407   147.193 172.249 1.00 71.06  ? 720  PHE A C   1 
ATOM   7906  O  O   . PHE E  5  720  ? 0.534   147.995 171.324 1.00 77.71  ? 720  PHE A O   1 
ATOM   7907  C  CB  . PHE E  5  720  ? -1.452  145.598 172.193 1.00 62.54  ? 720  PHE A CB  1 
ATOM   7908  C  CG  . PHE E  5  720  ? -2.090  144.515 171.374 1.00 66.71  ? 720  PHE A CG  1 
ATOM   7909  C  CD1 . PHE E  5  720  ? -1.457  143.293 171.186 1.00 63.84  ? 720  PHE A CD1 1 
ATOM   7910  C  CD2 . PHE E  5  720  ? -3.342  144.716 170.801 1.00 66.53  ? 720  PHE A CD2 1 
ATOM   7911  C  CE1 . PHE E  5  720  ? -2.059  142.302 170.438 1.00 68.33  ? 720  PHE A CE1 1 
ATOM   7912  C  CE2 . PHE E  5  720  ? -3.955  143.728 170.057 1.00 60.06  ? 720  PHE A CE2 1 
ATOM   7913  C  CZ  . PHE E  5  720  ? -3.320  142.519 169.878 1.00 73.34  ? 720  PHE A CZ  1 
ATOM   7914  N  N   . LYS E  5  721  ? 0.526   147.534 173.527 1.00 68.31  ? 721  LYS A N   1 
ATOM   7915  C  CA  . LYS E  5  721  ? 0.711   148.913 173.939 1.00 70.03  ? 721  LYS A CA  1 
ATOM   7916  C  C   . LYS E  5  721  ? 1.591   148.914 175.177 1.00 74.64  ? 721  LYS A C   1 
ATOM   7917  O  O   . LYS E  5  721  ? 1.371   148.112 176.085 1.00 72.19  ? 721  LYS A O   1 
ATOM   7918  C  CB  . LYS E  5  721  ? -0.655  149.520 174.254 1.00 68.75  ? 721  LYS A CB  1 
ATOM   7919  C  CG  . LYS E  5  721  ? -0.642  150.962 174.722 1.00 70.84  ? 721  LYS A CG  1 
ATOM   7920  C  CD  . LYS E  5  721  ? -2.058  151.462 174.893 1.00 76.18  ? 721  LYS A CD  1 
ATOM   7921  C  CE  . LYS E  5  721  ? -2.110  152.961 175.177 1.00 75.86  ? 721  LYS A CE  1 
ATOM   7922  N  NZ  . LYS E  5  721  ? -3.526  153.433 175.075 1.00 73.47  ? 721  LYS A NZ  1 
ATOM   7923  N  N   . PRO E  5  722  ? 2.551   149.849 175.263 1.00 73.13  ? 722  PRO A N   1 
ATOM   7924  C  CA  . PRO E  5  722  ? 2.836   151.064 174.481 1.00 69.91  ? 722  PRO A CA  1 
ATOM   7925  C  C   . PRO E  5  722  ? 3.460   150.932 173.093 1.00 70.50  ? 722  PRO A C   1 
ATOM   7926  O  O   . PRO E  5  722  ? 3.567   151.931 172.394 1.00 75.23  ? 722  PRO A O   1 
ATOM   7927  C  CB  . PRO E  5  722  ? 3.823   151.806 175.376 1.00 71.53  ? 722  PRO A CB  1 
ATOM   7928  C  CG  . PRO E  5  722  ? 4.470   150.752 176.180 1.00 61.18  ? 722  PRO A CG  1 
ATOM   7929  C  CD  . PRO E  5  722  ? 3.375   149.789 176.479 1.00 61.07  ? 722  PRO A CD  1 
ATOM   7930  N  N   . TYR E  5  723  ? 3.874   149.742 172.697 1.00 72.73  ? 723  TYR A N   1 
ATOM   7931  C  CA  . TYR E  5  723  ? 4.649   149.577 171.473 1.00 64.74  ? 723  TYR A CA  1 
ATOM   7932  C  C   . TYR E  5  723  ? 4.411   148.148 171.030 1.00 68.34  ? 723  TYR A C   1 
ATOM   7933  O  O   . TYR E  5  723  ? 4.437   147.238 171.857 1.00 72.24  ? 723  TYR A O   1 
ATOM   7934  C  CB  . TYR E  5  723  ? 6.120   149.805 171.808 1.00 66.72  ? 723  TYR A CB  1 
ATOM   7935  C  CG  . TYR E  5  723  ? 7.040   150.009 170.640 1.00 84.10  ? 723  TYR A CG  1 
ATOM   7936  C  CD1 . TYR E  5  723  ? 7.257   151.276 170.107 1.00 96.77  ? 723  TYR A CD1 1 
ATOM   7937  C  CD2 . TYR E  5  723  ? 7.730   148.944 170.094 1.00 92.99  ? 723  TYR A CD2 1 
ATOM   7938  C  CE1 . TYR E  5  723  ? 8.128   151.466 169.034 1.00 106.93 ? 723  TYR A CE1 1 
ATOM   7939  C  CE2 . TYR E  5  723  ? 8.592   149.116 169.029 1.00 104.11 ? 723  TYR A CE2 1 
ATOM   7940  C  CZ  . TYR E  5  723  ? 8.794   150.372 168.498 1.00 110.09 ? 723  TYR A CZ  1 
ATOM   7941  O  OH  . TYR E  5  723  ? 9.665   150.511 167.434 1.00 112.56 ? 723  TYR A OH  1 
ATOM   7942  N  N   . PRO E  5  724  ? 4.134   147.928 169.735 1.00 69.23  ? 724  PRO A N   1 
ATOM   7943  C  CA  . PRO E  5  724  ? 3.937   146.545 169.275 1.00 64.99  ? 724  PRO A CA  1 
ATOM   7944  C  C   . PRO E  5  724  ? 5.225   145.704 169.295 1.00 62.47  ? 724  PRO A C   1 
ATOM   7945  O  O   . PRO E  5  724  ? 6.168   145.972 168.530 1.00 56.54  ? 724  PRO A O   1 
ATOM   7946  C  CB  . PRO E  5  724  ? 3.432   146.727 167.844 1.00 58.03  ? 724  PRO A CB  1 
ATOM   7947  C  CG  . PRO E  5  724  ? 3.983   148.015 167.428 1.00 79.23  ? 724  PRO A CG  1 
ATOM   7948  C  CD  . PRO E  5  724  ? 3.934   148.893 168.647 1.00 72.01  ? 724  PRO A CD  1 
ATOM   7949  N  N   . LEU E  5  725  ? 5.247   144.703 170.176 1.00 56.30  ? 725  LEU A N   1 
ATOM   7950  C  CA  . LEU E  5  725  ? 6.376   143.746 170.276 1.00 72.31  ? 725  LEU A CA  1 
ATOM   7951  C  C   . LEU E  5  725  ? 5.991   142.255 170.211 1.00 54.72  ? 725  LEU A C   1 
ATOM   7952  O  O   . LEU E  5  725  ? 5.011   141.823 170.831 1.00 60.03  ? 725  LEU A O   1 
ATOM   7953  C  CB  . LEU E  5  725  ? 7.187   143.978 171.560 1.00 67.62  ? 725  LEU A CB  1 
ATOM   7954  C  CG  . LEU E  5  725  ? 7.998   145.263 171.727 1.00 62.86  ? 725  LEU A CG  1 
ATOM   7955  C  CD1 . LEU E  5  725  ? 8.778   145.207 173.029 1.00 62.84  ? 725  LEU A CD1 1 
ATOM   7956  C  CD2 . LEU E  5  725  ? 8.922   145.474 170.552 1.00 55.40  ? 725  LEU A CD2 1 
ATOM   7957  N  N   . TRP E  5  726  ? 6.784   141.473 169.480 1.00 53.95  ? 726  TRP A N   1 
ATOM   7958  C  CA  . TRP E  5  726  ? 6.631   139.999 169.452 1.00 53.30  ? 726  TRP A CA  1 
ATOM   7959  C  C   . TRP E  5  726  ? 7.750   139.363 170.256 1.00 55.16  ? 726  TRP A C   1 
ATOM   7960  O  O   . TRP E  5  726  ? 8.842   139.918 170.336 1.00 60.00  ? 726  TRP A O   1 
ATOM   7961  C  CB  . TRP E  5  726  ? 6.674   139.476 168.020 1.00 52.96  ? 726  TRP A CB  1 
ATOM   7962  C  CG  . TRP E  5  726  ? 5.451   139.784 167.203 1.00 53.57  ? 726  TRP A CG  1 
ATOM   7963  C  CD1 . TRP E  5  726  ? 4.503   138.905 166.820 1.00 55.13  ? 726  TRP A CD1 1 
ATOM   7964  C  CD2 . TRP E  5  726  ? 5.042   141.059 166.680 1.00 64.38  ? 726  TRP A CD2 1 
ATOM   7965  N  NE1 . TRP E  5  726  ? 3.537   139.525 166.089 1.00 54.26  ? 726  TRP A NE1 1 
ATOM   7966  C  CE2 . TRP E  5  726  ? 3.843   140.851 165.982 1.00 64.24  ? 726  TRP A CE2 1 
ATOM   7967  C  CE3 . TRP E  5  726  ? 5.573   142.356 166.738 1.00 63.68  ? 726  TRP A CE3 1 
ATOM   7968  C  CZ2 . TRP E  5  726  ? 3.155   141.886 165.350 1.00 65.33  ? 726  TRP A CZ2 1 
ATOM   7969  C  CZ3 . TRP E  5  726  ? 4.897   143.376 166.105 1.00 59.64  ? 726  TRP A CZ3 1 
ATOM   7970  C  CH2 . TRP E  5  726  ? 3.701   143.138 165.421 1.00 66.11  ? 726  TRP A CH2 1 
ATOM   7971  N  N   . THR E  5  727  ? 7.497   138.209 170.860 1.00 60.38  ? 727  THR A N   1 
ATOM   7972  C  CA  . THR E  5  727  ? 8.569   137.473 171.545 1.00 51.60  ? 727  THR A CA  1 
ATOM   7973  C  C   . THR E  5  727  ? 9.227   136.427 170.643 1.00 60.32  ? 727  THR A C   1 
ATOM   7974  O  O   . THR E  5  727  ? 8.695   136.067 169.601 1.00 50.78  ? 727  THR A O   1 
ATOM   7975  C  CB  . THR E  5  727  ? 8.052   136.698 172.730 1.00 51.63  ? 727  THR A CB  1 
ATOM   7976  O  OG1 . THR E  5  727  ? 7.348   135.544 172.257 1.00 51.40  ? 727  THR A OG1 1 
ATOM   7977  C  CG2 . THR E  5  727  ? 7.142   137.556 173.572 1.00 52.49  ? 727  THR A CG2 1 
ATOM   7978  N  N   . GLY E  5  728  ? 10.383  135.930 171.076 1.00 59.39  ? 728  GLY A N   1 
ATOM   7979  C  CA  . GLY E  5  728  ? 11.108  134.898 170.356 1.00 55.23  ? 728  GLY A CA  1 
ATOM   7980  C  C   . GLY E  5  728  ? 10.291  133.632 170.222 1.00 51.67  ? 728  GLY A C   1 
ATOM   7981  O  O   . GLY E  5  728  ? 10.223  133.040 169.144 1.00 49.02  ? 728  GLY A O   1 
ATOM   7982  N  N   . LYS E  5  729  ? 9.644   133.243 171.313 1.00 52.70  ? 729  LYS A N   1 
ATOM   7983  C  CA  . LYS E  5  729  ? 8.783   132.076 171.314 1.00 60.41  ? 729  LYS A CA  1 
ATOM   7984  C  C   . LYS E  5  729  ? 7.688   132.176 170.232 1.00 64.11  ? 729  LYS A C   1 
ATOM   7985  O  O   . LYS E  5  729  ? 7.272   131.166 169.663 1.00 69.98  ? 729  LYS A O   1 
ATOM   7986  C  CB  . LYS E  5  729  ? 8.187   131.859 172.712 1.00 49.81  ? 729  LYS A CB  1 
ATOM   7987  C  CG  . LYS E  5  729  ? 9.203   131.569 173.822 1.00 49.46  ? 729  LYS A CG  1 
ATOM   7988  C  CD  . LYS E  5  729  ? 8.469   131.541 175.149 1.00 84.68  ? 729  LYS A CD  1 
ATOM   7989  C  CE  . LYS E  5  729  ? 9.248   130.936 176.295 1.00 49.72  ? 729  LYS A CE  1 
ATOM   7990  N  NZ  . LYS E  5  729  ? 10.636  131.388 176.382 1.00 49.32  ? 729  LYS A NZ  1 
ATOM   7991  N  N   . GLN E  5  730  ? 7.242   133.393 169.939 1.00 54.76  ? 730  GLN A N   1 
ATOM   7992  C  CA  . GLN E  5  730  ? 6.311   133.609 168.842 1.00 59.07  ? 730  GLN A CA  1 
ATOM   7993  C  C   . GLN E  5  730  ? 6.932   133.357 167.460 1.00 63.52  ? 730  GLN A C   1 
ATOM   7994  O  O   . GLN E  5  730  ? 6.237   132.955 166.526 1.00 68.94  ? 730  GLN A O   1 
ATOM   7995  C  CB  . GLN E  5  730  ? 5.742   135.022 168.894 1.00 60.19  ? 730  GLN A CB  1 
ATOM   7996  C  CG  . GLN E  5  730  ? 4.562   135.178 169.809 1.00 64.12  ? 730  GLN A CG  1 
ATOM   7997  C  CD  . GLN E  5  730  ? 4.119   136.618 169.920 1.00 67.28  ? 730  GLN A CD  1 
ATOM   7998  O  OE1 . GLN E  5  730  ? 4.907   137.497 170.293 1.00 63.18  ? 730  GLN A OE1 1 
ATOM   7999  N  NE2 . GLN E  5  730  ? 2.856   136.877 169.580 1.00 71.82  ? 730  GLN A NE2 1 
ATOM   8000  N  N   . ILE E  5  731  ? 8.229   133.601 167.318 1.00 53.71  ? 731  ILE A N   1 
ATOM   8001  C  CA  . ILE E  5  731  ? 8.881   133.314 166.057 1.00 55.57  ? 731  ILE A CA  1 
ATOM   8002  C  C   . ILE E  5  731  ? 8.811   131.798 165.782 1.00 58.75  ? 731  ILE A C   1 
ATOM   8003  O  O   . ILE E  5  731  ? 8.611   131.359 164.640 1.00 58.69  ? 731  ILE A O   1 
ATOM   8004  C  CB  . ILE E  5  731  ? 10.319  133.815 166.056 1.00 49.17  ? 731  ILE A CB  1 
ATOM   8005  C  CG1 . ILE E  5  731  ? 10.320  135.335 166.149 1.00 50.61  ? 731  ILE A CG1 1 
ATOM   8006  C  CG2 . ILE E  5  731  ? 11.033  133.377 164.798 1.00 51.54  ? 731  ILE A CG2 1 
ATOM   8007  C  CD1 . ILE E  5  731  ? 11.679  136.005 166.042 1.00 49.54  ? 731  ILE A CD1 1 
ATOM   8008  N  N   . ILE E  5  732  ? 8.945   131.004 166.844 1.00 50.44  ? 732  ILE A N   1 
ATOM   8009  C  CA  . ILE E  5  732  ? 8.895   129.574 166.713 1.00 48.36  ? 732  ILE A CA  1 
ATOM   8010  C  C   . ILE E  5  732  ? 7.480   129.159 166.358 1.00 59.14  ? 732  ILE A C   1 
ATOM   8011  O  O   . ILE E  5  732  ? 7.263   128.367 165.443 1.00 61.52  ? 732  ILE A O   1 
ATOM   8012  C  CB  . ILE E  5  732  ? 9.375   128.879 167.993 1.00 53.74  ? 732  ILE A CB  1 
ATOM   8013  C  CG1 . ILE E  5  732  ? 10.783  129.359 168.341 1.00 48.06  ? 732  ILE A CG1 1 
ATOM   8014  C  CG2 . ILE E  5  732  ? 9.361   127.345 167.843 1.00 47.61  ? 732  ILE A CG2 1 
ATOM   8015  C  CD1 . ILE E  5  732  ? 11.873  128.756 167.528 1.00 46.96  ? 732  ILE A CD1 1 
ATOM   8016  N  N   . THR E  5  733  ? 6.510   129.709 167.067 1.00 58.59  ? 733  THR A N   1 
ATOM   8017  C  CA  . THR E  5  733  ? 5.125   129.335 166.831 1.00 56.21  ? 733  THR A CA  1 
ATOM   8018  C  C   . THR E  5  733  ? 4.758   129.678 165.411 1.00 57.20  ? 733  THR A C   1 
ATOM   8019  O  O   . THR E  5  733  ? 4.000   128.948 164.771 1.00 54.73  ? 733  THR A O   1 
ATOM   8020  C  CB  . THR E  5  733  ? 4.164   130.054 167.794 1.00 59.54  ? 733  THR A CB  1 
ATOM   8021  O  OG1 . THR E  5  733  ? 4.458   129.650 169.137 1.00 54.54  ? 733  THR A OG1 1 
ATOM   8022  C  CG2 . THR E  5  733  ? 2.712   129.727 167.468 1.00 51.24  ? 733  THR A CG2 1 
ATOM   8023  N  N   . THR E  5  734  ? 5.321   130.782 164.920 1.00 59.81  ? 734  THR A N   1 
ATOM   8024  C  CA  . THR E  5  734  ? 4.980   131.287 163.594 1.00 62.61  ? 734  THR A CA  1 
ATOM   8025  C  C   . THR E  5  734  ? 5.590   130.381 162.537 1.00 56.95  ? 734  THR A C   1 
ATOM   8026  O  O   . THR E  5  734  ? 4.925   130.012 161.573 1.00 56.73  ? 734  THR A O   1 
ATOM   8027  C  CB  . THR E  5  734  ? 5.399   132.777 163.394 1.00 59.86  ? 734  THR A CB  1 
ATOM   8028  O  OG1 . THR E  5  734  ? 4.735   133.587 164.366 1.00 64.12  ? 734  THR A OG1 1 
ATOM   8029  C  CG2 . THR E  5  734  ? 4.990   133.277 162.032 1.00 56.69  ? 734  THR A CG2 1 
ATOM   8030  N  N   . VAL E  5  735  ? 6.850   130.011 162.736 1.00 56.57  ? 735  VAL A N   1 
ATOM   8031  C  CA  . VAL E  5  735  ? 7.506   129.022 161.890 1.00 58.02  ? 735  VAL A CA  1 
ATOM   8032  C  C   . VAL E  5  735  ? 6.670   127.741 161.740 1.00 63.98  ? 735  VAL A C   1 
ATOM   8033  O  O   . VAL E  5  735  ? 6.288   127.380 160.619 1.00 57.40  ? 735  VAL A O   1 
ATOM   8034  C  CB  . VAL E  5  735  ? 8.903   128.693 162.416 1.00 48.26  ? 735  VAL A CB  1 
ATOM   8035  C  CG1 . VAL E  5  735  ? 9.330   127.319 161.948 1.00 53.42  ? 735  VAL A CG1 1 
ATOM   8036  C  CG2 . VAL E  5  735  ? 9.890   129.726 161.943 1.00 48.20  ? 735  VAL A CG2 1 
ATOM   8037  N  N   . LEU E  5  736  ? 6.369   127.073 162.856 1.00 48.93  ? 736  LEU A N   1 
ATOM   8038  C  CA  . LEU E  5  736  ? 5.563   125.854 162.805 1.00 61.84  ? 736  LEU A CA  1 
ATOM   8039  C  C   . LEU E  5  736  ? 4.224   126.090 162.117 1.00 61.90  ? 736  LEU A C   1 
ATOM   8040  O  O   . LEU E  5  736  ? 3.726   125.249 161.366 1.00 60.05  ? 736  LEU A O   1 
ATOM   8041  C  CB  . LEU E  5  736  ? 5.298   125.290 164.200 1.00 50.95  ? 736  LEU A CB  1 
ATOM   8042  C  CG  . LEU E  5  736  ? 6.476   124.820 165.032 1.00 51.45  ? 736  LEU A CG  1 
ATOM   8043  C  CD1 . LEU E  5  736  ? 5.941   124.011 166.182 1.00 48.43  ? 736  LEU A CD1 1 
ATOM   8044  C  CD2 . LEU E  5  736  ? 7.441   124.027 164.201 1.00 52.87  ? 736  LEU A CD2 1 
ATOM   8045  N  N   . LEU E  5  737  ? 3.637   127.239 162.401 1.00 61.70  ? 737  LEU A N   1 
ATOM   8046  C  CA  . LEU E  5  737  ? 2.349   127.589 161.856 1.00 55.37  ? 737  LEU A CA  1 
ATOM   8047  C  C   . LEU E  5  737  ? 2.418   127.685 160.328 1.00 58.11  ? 737  LEU A C   1 
ATOM   8048  O  O   . LEU E  5  737  ? 1.455   127.383 159.629 1.00 59.78  ? 737  LEU A O   1 
ATOM   8049  C  CB  . LEU E  5  737  ? 1.920   128.900 162.463 1.00 55.58  ? 737  LEU A CB  1 
ATOM   8050  C  CG  . LEU E  5  737  ? 0.513   129.339 162.136 1.00 60.97  ? 737  LEU A CG  1 
ATOM   8051  C  CD1 . LEU E  5  737  ? -0.458  128.330 162.696 1.00 52.61  ? 737  LEU A CD1 1 
ATOM   8052  C  CD2 . LEU E  5  737  ? 0.315   130.715 162.737 1.00 61.19  ? 737  LEU A CD2 1 
ATOM   8053  N  N   . ASN E  5  738  ? 3.568   128.073 159.798 1.00 54.50  ? 738  ASN A N   1 
ATOM   8054  C  CA  . ASN E  5  738  ? 3.682   128.201 158.356 1.00 59.21  ? 738  ASN A CA  1 
ATOM   8055  C  C   . ASN E  5  738  ? 4.164   126.943 157.649 1.00 69.79  ? 738  ASN A C   1 
ATOM   8056  O  O   . ASN E  5  738  ? 4.095   126.864 156.428 1.00 79.19  ? 738  ASN A O   1 
ATOM   8057  C  CB  . ASN E  5  738  ? 4.551   129.406 157.963 1.00 59.17  ? 738  ASN A CB  1 
ATOM   8058  C  CG  . ASN E  5  738  ? 3.831   130.743 158.158 1.00 63.95  ? 738  ASN A CG  1 
ATOM   8059  O  OD1 . ASN E  5  738  ? 2.892   131.090 157.427 1.00 63.77  ? 738  ASN A OD1 1 
ATOM   8060  N  ND2 . ASN E  5  738  ? 4.278   131.501 159.143 1.00 66.93  ? 738  ASN A ND2 1 
ATOM   8061  N  N   . VAL E  5  739  ? 4.654   125.958 158.393 1.00 65.73  ? 739  VAL A N   1 
ATOM   8062  C  CA  . VAL E  5  739  ? 5.132   124.746 157.739 1.00 57.62  ? 739  VAL A CA  1 
ATOM   8063  C  C   . VAL E  5  739  ? 4.395   123.461 158.126 1.00 59.34  ? 739  VAL A C   1 
ATOM   8064  O  O   . VAL E  5  739  ? 4.607   122.430 157.486 1.00 64.63  ? 739  VAL A O   1 
ATOM   8065  C  CB  . VAL E  5  739  ? 6.666   124.539 157.889 1.00 60.35  ? 739  VAL A CB  1 
ATOM   8066  C  CG1 . VAL E  5  739  ? 7.380   125.875 157.968 1.00 65.49  ? 739  VAL A CG1 1 
ATOM   8067  C  CG2 . VAL E  5  739  ? 6.981   123.690 159.110 1.00 54.51  ? 739  VAL A CG2 1 
ATOM   8068  N  N   . THR E  5  740  ? 3.533   123.498 159.143 1.00 54.30  ? 740  THR A N   1 
ATOM   8069  C  CA  . THR E  5  740  ? 2.706   122.315 159.407 1.00 59.84  ? 740  THR A CA  1 
ATOM   8070  C  C   . THR E  5  740  ? 1.410   122.421 158.616 1.00 63.82  ? 740  THR A C   1 
ATOM   8071  O  O   . THR E  5  740  ? 1.014   123.526 158.229 1.00 71.46  ? 740  THR A O   1 
ATOM   8072  C  CB  . THR E  5  740  ? 2.438   122.043 160.920 1.00 55.11  ? 740  THR A CB  1 
ATOM   8073  O  OG1 . THR E  5  740  ? 1.561   123.032 161.450 1.00 63.05  ? 740  THR A OG1 1 
ATOM   8074  C  CG2 . THR E  5  740  ? 3.719   122.050 161.698 1.00 55.26  ? 740  THR A CG2 1 
ATOM   8075  N  N   . PRO E  5  741  ? 0.771   121.270 158.331 1.00 65.44  ? 741  PRO A N   1 
ATOM   8076  C  CA  . PRO E  5  741  ? -0.485  121.227 157.559 1.00 66.93  ? 741  PRO A CA  1 
ATOM   8077  C  C   . PRO E  5  741  ? -1.592  122.034 158.223 1.00 70.46  ? 741  PRO A C   1 
ATOM   8078  O  O   . PRO E  5  741  ? -1.790  121.957 159.441 1.00 67.68  ? 741  PRO A O   1 
ATOM   8079  C  CB  . PRO E  5  741  ? -0.850  119.740 157.556 1.00 52.24  ? 741  PRO A CB  1 
ATOM   8080  C  CG  . PRO E  5  741  ? 0.447   119.037 157.710 1.00 61.12  ? 741  PRO A CG  1 
ATOM   8081  C  CD  . PRO E  5  741  ? 1.310   119.918 158.574 1.00 63.58  ? 741  PRO A CD  1 
ATOM   8082  N  N   . PRO E  5  742  ? -2.313  122.817 157.420 1.00 79.71  ? 742  PRO A N   1 
ATOM   8083  C  CA  . PRO E  5  742  ? -3.325  123.759 157.909 1.00 81.20  ? 742  PRO A CA  1 
ATOM   8084  C  C   . PRO E  5  742  ? -4.607  123.036 158.301 1.00 86.87  ? 742  PRO A C   1 
ATOM   8085  O  O   . PRO E  5  742  ? -5.338  123.478 159.192 1.00 88.95  ? 742  PRO A O   1 
ATOM   8086  C  CB  . PRO E  5  742  ? -3.572  124.661 156.698 1.00 76.85  ? 742  PRO A CB  1 
ATOM   8087  C  CG  . PRO E  5  742  ? -2.428  124.358 155.729 1.00 76.99  ? 742  PRO A CG  1 
ATOM   8088  C  CD  . PRO E  5  742  ? -2.110  122.928 155.970 1.00 79.46  ? 742  PRO A CD  1 
ATOM   8089  N  N   . ASP E  5  743  ? -4.859  121.915 157.637 1.00 90.17  ? 743  ASP A N   1 
ATOM   8090  C  CA  . ASP E  5  743  ? -6.024  121.090 157.916 1.00 94.10  ? 743  ASP A CA  1 
ATOM   8091  C  C   . ASP E  5  743  ? -5.752  120.153 159.083 1.00 91.61  ? 743  ASP A C   1 
ATOM   8092  O  O   . ASP E  5  743  ? -6.343  119.077 159.170 1.00 100.03 ? 743  ASP A O   1 
ATOM   8093  C  CB  . ASP E  5  743  ? -6.382  120.268 156.678 1.00 104.09 ? 743  ASP A CB  1 
ATOM   8094  C  CG  . ASP E  5  743  ? -5.186  119.484 156.124 1.00 106.76 ? 743  ASP A CG  1 
ATOM   8095  O  OD1 . ASP E  5  743  ? -4.045  119.990 156.196 1.00 107.15 ? 743  ASP A OD1 1 
ATOM   8096  O  OD2 . ASP E  5  743  ? -5.389  118.364 155.607 1.00 106.43 ? 743  ASP A OD2 1 
ATOM   8097  N  N   . MET E  5  744  ? -4.865  120.567 159.982 1.00 81.38  ? 744  MET A N   1 
ATOM   8098  C  CA  . MET E  5  744  ? -4.404  119.693 161.053 1.00 73.70  ? 744  MET A CA  1 
ATOM   8099  C  C   . MET E  5  744  ? -3.983  120.477 162.285 1.00 71.05  ? 744  MET A C   1 
ATOM   8100  O  O   . MET E  5  744  ? -3.199  121.418 162.177 1.00 79.08  ? 744  MET A O   1 
ATOM   8101  C  CB  . MET E  5  744  ? -3.229  118.889 160.543 1.00 70.03  ? 744  MET A CB  1 
ATOM   8102  C  CG  . MET E  5  744  ? -3.065  117.593 161.219 1.00 68.56  ? 744  MET A CG  1 
ATOM   8103  S  SD  . MET E  5  744  ? -2.238  116.509 160.088 1.00 80.44  ? 744  MET A SD  1 
ATOM   8104  C  CE  . MET E  5  744  ? -1.691  115.217 161.211 1.00 70.41  ? 744  MET A CE  1 
ATOM   8105  N  N   . PRO E  5  745  ? -4.495  120.083 163.459 1.00 62.53  ? 745  PRO A N   1 
ATOM   8106  C  CA  . PRO E  5  745  ? -4.328  120.806 164.724 1.00 60.77  ? 745  PRO A CA  1 
ATOM   8107  C  C   . PRO E  5  745  ? -2.868  120.917 165.091 1.00 61.99  ? 745  PRO A C   1 
ATOM   8108  O  O   . PRO E  5  745  ? -2.092  120.074 164.668 1.00 64.93  ? 745  PRO A O   1 
ATOM   8109  C  CB  . PRO E  5  745  ? -5.051  119.915 165.732 1.00 57.47  ? 745  PRO A CB  1 
ATOM   8110  C  CG  . PRO E  5  745  ? -5.032  118.579 165.115 1.00 57.74  ? 745  PRO A CG  1 
ATOM   8111  C  CD  . PRO E  5  745  ? -5.188  118.807 163.656 1.00 61.25  ? 745  PRO A CD  1 
ATOM   8112  N  N   . GLY E  5  746  ? -2.500  121.936 165.855 1.00 65.77  ? 746  GLY A N   1 
ATOM   8113  C  CA  . GLY E  5  746  ? -1.105  122.195 166.154 1.00 51.93  ? 746  GLY A CA  1 
ATOM   8114  C  C   . GLY E  5  746  ? -0.595  121.240 167.193 1.00 62.62  ? 746  GLY A C   1 
ATOM   8115  O  O   . GLY E  5  746  ? -1.362  120.718 167.995 1.00 65.23  ? 746  GLY A O   1 
ATOM   8116  N  N   . ILE E  5  747  ? 0.709   121.015 167.179 1.00 63.71  ? 747  ILE A N   1 
ATOM   8117  C  CA  . ILE E  5  747  ? 1.326   120.023 168.046 1.00 58.53  ? 747  ILE A CA  1 
ATOM   8118  C  C   . ILE E  5  747  ? 1.129   120.329 169.545 1.00 58.82  ? 747  ILE A C   1 
ATOM   8119  O  O   . ILE E  5  747  ? 1.009   121.482 169.941 1.00 61.08  ? 747  ILE A O   1 
ATOM   8120  C  CB  . ILE E  5  747  ? 2.824   119.903 167.701 1.00 49.58  ? 747  ILE A CB  1 
ATOM   8121  C  CG1 . ILE E  5  747  ? 3.290   118.437 167.695 1.00 49.24  ? 747  ILE A CG1 1 
ATOM   8122  C  CG2 . ILE E  5  747  ? 3.660   120.791 168.585 1.00 54.42  ? 747  ILE A CG2 1 
ATOM   8123  C  CD1 . ILE E  5  747  ? 3.491   117.834 169.027 1.00 74.01  ? 747  ILE A CD1 1 
ATOM   8124  N  N   . ASN E  5  748  ? 1.063   119.277 170.359 1.00 66.62  ? 748  ASN A N   1 
ATOM   8125  C  CA  . ASN E  5  748  ? 0.932   119.383 171.811 1.00 50.99  ? 748  ASN A CA  1 
ATOM   8126  C  C   . ASN E  5  748  ? 2.027   118.623 172.550 1.00 52.05  ? 748  ASN A C   1 
ATOM   8127  O  O   . ASN E  5  748  ? 2.081   117.385 172.531 1.00 52.35  ? 748  ASN A O   1 
ATOM   8128  C  CB  . ASN E  5  748  ? -0.441  118.886 172.261 1.00 51.84  ? 748  ASN A CB  1 
ATOM   8129  C  CG  . ASN E  5  748  ? -1.552  119.868 171.922 1.00 62.95  ? 748  ASN A CG  1 
ATOM   8130  O  OD1 . ASN E  5  748  ? -1.462  121.065 172.248 1.00 64.43  ? 748  ASN A OD1 1 
ATOM   8131  N  ND2 . ASN E  5  748  ? -2.600  119.377 171.246 1.00 56.10  ? 748  ASN A ND2 1 
ATOM   8132  N  N   . LEU E  5  749  ? 2.908   119.358 173.216 1.00 51.68  ? 749  LEU A N   1 
ATOM   8133  C  CA  . LEU E  5  749  ? 4.054   118.731 173.848 1.00 51.80  ? 749  LEU A CA  1 
ATOM   8134  C  C   . LEU E  5  749  ? 4.391   119.315 175.222 1.00 56.28  ? 749  LEU A C   1 
ATOM   8135  O  O   . LEU E  5  749  ? 4.542   120.525 175.375 1.00 49.70  ? 749  LEU A O   1 
ATOM   8136  C  CB  . LEU E  5  749  ? 5.282   118.827 172.934 1.00 48.73  ? 749  LEU A CB  1 
ATOM   8137  C  CG  . LEU E  5  749  ? 6.518   118.160 173.552 1.00 65.89  ? 749  LEU A CG  1 
ATOM   8138  C  CD1 . LEU E  5  749  ? 6.260   116.689 173.799 1.00 48.27  ? 749  LEU A CD1 1 
ATOM   8139  C  CD2 . LEU E  5  749  ? 7.759   118.341 172.709 1.00 47.41  ? 749  LEU A CD2 1 
ATOM   8140  N  N   . ILE E  5  750  ? 4.525   118.441 176.216 1.00 56.82  ? 750  ILE A N   1 
ATOM   8141  C  CA  . ILE E  5  750  ? 5.097   118.833 177.493 1.00 57.58  ? 750  ILE A CA  1 
ATOM   8142  C  C   . ILE E  5  750  ? 6.427   118.123 177.703 1.00 57.05  ? 750  ILE A C   1 
ATOM   8143  O  O   . ILE E  5  750  ? 6.460   116.919 177.859 1.00 68.42  ? 750  ILE A O   1 
ATOM   8144  C  CB  . ILE E  5  750  ? 4.156   118.528 178.648 1.00 60.45  ? 750  ILE A CB  1 
ATOM   8145  C  CG1 . ILE E  5  750  ? 2.887   119.356 178.485 1.00 64.74  ? 750  ILE A CG1 1 
ATOM   8146  C  CG2 . ILE E  5  750  ? 4.827   118.860 179.963 1.00 50.62  ? 750  ILE A CG2 1 
ATOM   8147  C  CD1 . ILE E  5  750  ? 1.754   118.932 179.376 1.00 75.37  ? 750  ILE A CD1 1 
ATOM   8148  N  N   . SER E  5  751  ? 7.512   118.888 177.716 1.00 58.25  ? 751  SER A N   1 
ATOM   8149  C  CA  . SER E  5  751  ? 8.865   118.372 177.696 1.00 47.88  ? 751  SER A CA  1 
ATOM   8150  C  C   . SER E  5  751  ? 9.727   119.189 178.637 1.00 76.96  ? 751  SER A C   1 
ATOM   8151  O  O   . SER E  5  751  ? 9.236   120.068 179.324 1.00 48.29  ? 751  SER A O   1 
ATOM   8152  C  CB  . SER E  5  751  ? 9.407   118.513 176.282 1.00 53.93  ? 751  SER A CB  1 
ATOM   8153  O  OG  . SER E  5  751  ? 10.710  118.000 176.143 1.00 46.61  ? 751  SER A OG  1 
ATOM   8154  N  N   . LYS E  5  752  ? 11.020  118.900 178.664 1.00 47.16  ? 752  LYS A N   1 
ATOM   8155  C  CA  . LYS E  5  752  ? 11.977  119.648 179.485 1.00 47.04  ? 752  LYS A CA  1 
ATOM   8156  C  C   . LYS E  5  752  ? 13.245  119.887 178.701 1.00 49.06  ? 752  LYS A C   1 
ATOM   8157  O  O   . LYS E  5  752  ? 13.560  119.147 177.772 1.00 50.15  ? 752  LYS A O   1 
ATOM   8158  C  CB  . LYS E  5  752  ? 12.333  118.890 180.769 1.00 56.86  ? 752  LYS A CB  1 
ATOM   8159  C  CG  . LYS E  5  752  ? 11.273  118.972 181.849 1.00 70.03  ? 752  LYS A CG  1 
ATOM   8160  C  CD  . LYS E  5  752  ? 11.742  118.359 183.160 1.00 78.68  ? 752  LYS A CD  1 
ATOM   8161  C  CE  . LYS E  5  752  ? 10.705  118.552 184.265 1.00 83.40  ? 752  LYS A CE  1 
ATOM   8162  N  NZ  . LYS E  5  752  ? 9.447   117.796 183.992 1.00 88.74  ? 752  LYS A NZ  1 
ATOM   8163  N  N   . ASN E  5  753  ? 13.981  120.918 179.077 1.00 48.66  ? 753  ASN A N   1 
ATOM   8164  C  CA  . ASN E  5  753  ? 15.270  121.182 178.456 1.00 45.59  ? 753  ASN A CA  1 
ATOM   8165  C  C   . ASN E  5  753  ? 16.383  121.016 179.470 1.00 59.50  ? 753  ASN A C   1 
ATOM   8166  O  O   . ASN E  5  753  ? 16.120  120.613 180.607 1.00 54.24  ? 753  ASN A O   1 
ATOM   8167  C  CB  . ASN E  5  753  ? 15.315  122.571 177.832 1.00 54.71  ? 753  ASN A CB  1 
ATOM   8168  C  CG  . ASN E  5  753  ? 14.835  123.658 178.778 1.00 58.79  ? 753  ASN A CG  1 
ATOM   8169  O  OD1 . ASN E  5  753  ? 15.308  123.781 179.914 1.00 55.77  ? 753  ASN A OD1 1 
ATOM   8170  N  ND2 . ASN E  5  753  ? 13.885  124.457 178.309 1.00 46.67  ? 753  ASN A ND2 1 
ATOM   8171  N  N   . LYS E  5  754  ? 17.615  121.331 179.066 1.00 56.73  ? 754  LYS A N   1 
ATOM   8172  C  CA  . LYS E  5  754  ? 18.788  121.029 179.879 1.00 49.59  ? 754  LYS A CA  1 
ATOM   8173  C  C   . LYS E  5  754  ? 19.083  122.065 180.956 1.00 51.88  ? 754  LYS A C   1 
ATOM   8174  O  O   . LYS E  5  754  ? 19.952  121.862 181.785 1.00 62.78  ? 754  LYS A O   1 
ATOM   8175  C  CB  . LYS E  5  754  ? 20.034  120.861 179.007 1.00 53.66  ? 754  LYS A CB  1 
ATOM   8176  C  CG  . LYS E  5  754  ? 19.962  119.789 177.917 1.00 43.58  ? 754  LYS A CG  1 
ATOM   8177  C  CD  . LYS E  5  754  ? 21.311  119.675 177.193 1.00 42.96  ? 754  LYS A CD  1 
ATOM   8178  C  CE  . LYS E  5  754  ? 22.351  118.937 178.046 1.00 74.41  ? 754  LYS A CE  1 
ATOM   8179  N  NZ  . LYS E  5  754  ? 22.546  117.527 177.576 1.00 77.57  ? 754  LYS A NZ  1 
ATOM   8180  N  N   . ILE E  5  755  ? 18.370  123.180 180.947 1.00 59.46  ? 755  ILE A N   1 
ATOM   8181  C  CA  . ILE E  5  755  ? 18.678  124.278 181.864 1.00 45.95  ? 755  ILE A CA  1 
ATOM   8182  C  C   . ILE E  5  755  ? 17.711  124.405 183.041 1.00 59.00  ? 755  ILE A C   1 
ATOM   8183  O  O   . ILE E  5  755  ? 16.526  124.601 182.840 1.00 47.10  ? 755  ILE A O   1 
ATOM   8184  C  CB  . ILE E  5  755  ? 18.748  125.595 181.100 1.00 48.47  ? 755  ILE A CB  1 
ATOM   8185  C  CG1 . ILE E  5  755  ? 19.858  125.479 180.042 1.00 45.30  ? 755  ILE A CG1 1 
ATOM   8186  C  CG2 . ILE E  5  755  ? 18.955  126.745 182.054 1.00 46.53  ? 755  ILE A CG2 1 
ATOM   8187  C  CD1 . ILE E  5  755  ? 19.961  126.604 179.110 1.00 45.30  ? 755  ILE A CD1 1 
ATOM   8188  N  N   . LYS E  5  756  ? 18.229  124.268 184.264 1.00 56.09  ? 756  LYS A N   1 
ATOM   8189  C  CA  . LYS E  5  756  ? 17.403  124.274 185.462 1.00 56.95  ? 756  LYS A CA  1 
ATOM   8190  C  C   . LYS E  5  756  ? 16.747  125.631 185.648 1.00 60.93  ? 756  LYS A C   1 
ATOM   8191  O  O   . LYS E  5  756  ? 17.328  126.649 185.285 1.00 57.90  ? 756  LYS A O   1 
ATOM   8192  C  CB  . LYS E  5  756  ? 18.247  123.948 186.695 1.00 64.78  ? 756  LYS A CB  1 
ATOM   8193  C  CG  . LYS E  5  756  ? 18.610  122.483 186.851 1.00 86.16  ? 756  LYS A CG  1 
ATOM   8194  C  CD  . LYS E  5  756  ? 19.275  122.243 188.207 1.00 103.71 ? 756  LYS A CD  1 
ATOM   8195  C  CE  . LYS E  5  756  ? 20.351  123.297 188.497 1.00 113.07 ? 756  LYS A CE  1 
ATOM   8196  N  NZ  . LYS E  5  756  ? 21.105  123.089 189.777 1.00 117.86 ? 756  LYS A NZ  1 
ATOM   8197  N  N   . ASN E  5  757  ? 15.548  125.652 186.227 1.00 60.58  ? 757  ASN A N   1 
ATOM   8198  C  CA  . ASN E  5  757  ? 14.846  126.918 186.475 1.00 58.87  ? 757  ASN A CA  1 
ATOM   8199  C  C   . ASN E  5  757  ? 15.673  127.955 187.267 1.00 63.55  ? 757  ASN A C   1 
ATOM   8200  O  O   . ASN E  5  757  ? 15.601  129.163 186.999 1.00 61.70  ? 757  ASN A O   1 
ATOM   8201  C  CB  . ASN E  5  757  ? 13.535  126.671 187.217 1.00 50.48  ? 757  ASN A CB  1 
ATOM   8202  C  CG  . ASN E  5  757  ? 12.444  126.136 186.338 1.00 50.41  ? 757  ASN A CG  1 
ATOM   8203  O  OD1 . ASN E  5  757  ? 12.355  126.439 185.159 1.00 75.66  ? 757  ASN A OD1 1 
ATOM   8204  N  ND2 . ASN E  5  757  ? 11.589  125.333 186.923 1.00 57.88  ? 757  ASN A ND2 1 
ATOM   8205  N  N   . GLU E  5  758  ? 16.440  127.472 188.248 1.00 65.47  ? 758  GLU A N   1 
ATOM   8206  C  CA  . GLU E  5  758  ? 17.265  128.328 189.096 1.00 65.18  ? 758  GLU A CA  1 
ATOM   8207  C  C   . GLU E  5  758  ? 18.114  129.285 188.271 1.00 50.03  ? 758  GLU A C   1 
ATOM   8208  O  O   . GLU E  5  758  ? 18.339  130.409 188.672 1.00 74.07  ? 758  GLU A O   1 
ATOM   8209  C  CB  . GLU E  5  758  ? 18.116  127.489 190.067 1.00 78.09  ? 758  GLU A CB  1 
ATOM   8210  C  CG  . GLU E  5  758  ? 19.607  127.867 190.148 1.00 103.44 ? 758  GLU A CG  1 
ATOM   8211  C  CD  . GLU E  5  758  ? 20.518  126.700 190.591 1.00 117.19 ? 758  GLU A CD  1 
ATOM   8212  O  OE1 . GLU E  5  758  ? 20.024  125.787 191.294 1.00 126.10 ? 758  GLU A OE1 1 
ATOM   8213  O  OE2 . GLU E  5  758  ? 21.725  126.698 190.228 1.00 112.03 ? 758  GLU A OE2 1 
ATOM   8214  N  N   . TYR E  5  759  ? 18.547  128.864 187.089 1.00 53.12  ? 759  TYR A N   1 
ATOM   8215  C  CA  . TYR E  5  759  ? 19.411  129.713 186.263 1.00 50.87  ? 759  TYR A CA  1 
ATOM   8216  C  C   . TYR E  5  759  ? 18.746  130.989 185.736 1.00 58.93  ? 759  TYR A C   1 
ATOM   8217  O  O   . TYR E  5  759  ? 19.429  131.946 185.366 1.00 61.75  ? 759  TYR A O   1 
ATOM   8218  C  CB  . TYR E  5  759  ? 19.999  128.927 185.105 1.00 51.00  ? 759  TYR A CB  1 
ATOM   8219  C  CG  . TYR E  5  759  ? 21.160  128.067 185.505 1.00 53.56  ? 759  TYR A CG  1 
ATOM   8220  C  CD1 . TYR E  5  759  ? 22.428  128.614 185.684 1.00 58.83  ? 759  TYR A CD1 1 
ATOM   8221  C  CD2 . TYR E  5  759  ? 21.001  126.711 185.699 1.00 53.13  ? 759  TYR A CD2 1 
ATOM   8222  C  CE1 . TYR E  5  759  ? 23.505  127.819 186.051 1.00 62.66  ? 759  TYR A CE1 1 
ATOM   8223  C  CE2 . TYR E  5  759  ? 22.081  125.908 186.076 1.00 60.44  ? 759  TYR A CE2 1 
ATOM   8224  C  CZ  . TYR E  5  759  ? 23.327  126.465 186.244 1.00 58.80  ? 759  TYR A CZ  1 
ATOM   8225  O  OH  . TYR E  5  759  ? 24.387  125.664 186.614 1.00 59.01  ? 759  TYR A OH  1 
ATOM   8226  N  N   . TRP E  5  760  ? 17.421  131.022 185.703 1.00 59.87  ? 760  TRP A N   1 
ATOM   8227  C  CA  . TRP E  5  760  ? 16.750  132.201 185.173 1.00 56.98  ? 760  TRP A CA  1 
ATOM   8228  C  C   . TRP E  5  760  ? 16.336  133.174 186.284 1.00 58.49  ? 760  TRP A C   1 
ATOM   8229  O  O   . TRP E  5  760  ? 16.207  134.389 186.066 1.00 57.53  ? 760  TRP A O   1 
ATOM   8230  C  CB  . TRP E  5  760  ? 15.555  131.801 184.306 1.00 50.03  ? 760  TRP A CB  1 
ATOM   8231  C  CG  . TRP E  5  760  ? 15.953  131.073 183.062 1.00 56.56  ? 760  TRP A CG  1 
ATOM   8232  C  CD1 . TRP E  5  760  ? 15.824  129.744 182.821 1.00 55.68  ? 760  TRP A CD1 1 
ATOM   8233  C  CD2 . TRP E  5  760  ? 16.575  131.632 181.901 1.00 60.04  ? 760  TRP A CD2 1 
ATOM   8234  N  NE1 . TRP E  5  760  ? 16.314  129.434 181.578 1.00 57.28  ? 760  TRP A NE1 1 
ATOM   8235  C  CE2 . TRP E  5  760  ? 16.781  130.575 180.992 1.00 48.04  ? 760  TRP A CE2 1 
ATOM   8236  C  CE3 . TRP E  5  760  ? 16.965  132.921 181.539 1.00 48.99  ? 760  TRP A CE3 1 
ATOM   8237  C  CZ2 . TRP E  5  760  ? 17.357  130.763 179.745 1.00 47.55  ? 760  TRP A CZ2 1 
ATOM   8238  C  CZ3 . TRP E  5  760  ? 17.548  133.108 180.299 1.00 65.72  ? 760  TRP A CZ3 1 
ATOM   8239  C  CH2 . TRP E  5  760  ? 17.735  132.031 179.413 1.00 61.21  ? 760  TRP A CH2 1 
ATOM   8240  N  N   . GLY E  5  761  ? 16.132  132.639 187.477 1.00 55.45  ? 761  GLY A N   1 
ATOM   8241  C  CA  . GLY E  5  761  ? 15.741  133.461 188.593 1.00 52.42  ? 761  GLY A CA  1 
ATOM   8242  C  C   . GLY E  5  761  ? 14.606  132.861 189.391 1.00 70.88  ? 761  GLY A C   1 
ATOM   8243  O  O   . GLY E  5  761  ? 14.141  131.765 189.113 1.00 69.92  ? 761  GLY A O   1 
ATOM   8244  N  N   . LYS E  5  762  ? 14.173  133.590 190.408 1.00 77.68  ? 762  LYS A N   1 
ATOM   8245  C  CA  . LYS E  5  762  ? 13.069  133.156 191.236 1.00 78.63  ? 762  LYS A CA  1 
ATOM   8246  C  C   . LYS E  5  762  ? 11.842  132.888 190.368 1.00 70.69  ? 762  LYS A C   1 
ATOM   8247  O  O   . LYS E  5  762  ? 11.550  133.631 189.428 1.00 70.74  ? 762  LYS A O   1 
ATOM   8248  C  CB  . LYS E  5  762  ? 12.743  134.230 192.289 1.00 84.95  ? 762  LYS A CB  1 
ATOM   8249  C  CG  . LYS E  5  762  ? 11.581  133.862 193.193 1.00 79.31  ? 762  LYS A CG  1 
ATOM   8250  C  CD  . LYS E  5  762  ? 11.226  134.951 194.140 1.00 74.25  ? 762  LYS A CD  1 
ATOM   8251  C  CE  . LYS E  5  762  ? 10.134  134.476 195.096 1.00 80.98  ? 762  LYS A CE  1 
ATOM   8252  N  NZ  . LYS E  5  762  ? 9.711   135.547 196.069 1.00 81.81  ? 762  LYS A NZ  1 
ATOM   8253  N  N   . GLY E  5  763  ? 11.138  131.810 190.681 1.00 64.57  ? 763  GLY A N   1 
ATOM   8254  C  CA  . GLY E  5  763  ? 9.819   131.573 190.128 1.00 60.50  ? 763  GLY A CA  1 
ATOM   8255  C  C   . GLY E  5  763  ? 9.761   131.161 188.673 1.00 59.21  ? 763  GLY A C   1 
ATOM   8256  O  O   . GLY E  5  763  ? 8.673   130.939 188.144 1.00 66.50  ? 763  GLY A O   1 
ATOM   8257  N  N   . SER E  5  764  ? 10.921  131.051 188.029 1.00 58.87  ? 764  SER A N   1 
ATOM   8258  C  CA  . SER E  5  764  ? 10.982  130.665 186.626 1.00 52.35  ? 764  SER A CA  1 
ATOM   8259  C  C   . SER E  5  764  ? 10.421  129.291 186.381 1.00 61.13  ? 764  SER A C   1 
ATOM   8260  O  O   . SER E  5  764  ? 10.476  128.409 187.243 1.00 57.88  ? 764  SER A O   1 
ATOM   8261  C  CB  . SER E  5  764  ? 12.403  130.705 186.101 1.00 68.28  ? 764  SER A CB  1 
ATOM   8262  O  OG  . SER E  5  764  ? 12.373  130.709 184.691 1.00 71.89  ? 764  SER A OG  1 
ATOM   8263  N  N   . LEU E  5  765  ? 9.869   129.123 185.191 1.00 58.84  ? 765  LEU A N   1 
ATOM   8264  C  CA  . LEU E  5  765  ? 9.430   127.824 184.733 1.00 61.96  ? 765  LEU A CA  1 
ATOM   8265  C  C   . LEU E  5  765  ? 10.056  127.538 183.374 1.00 65.70  ? 765  LEU A C   1 
ATOM   8266  O  O   . LEU E  5  765  ? 9.582   126.684 182.642 1.00 63.13  ? 765  LEU A O   1 
ATOM   8267  C  CB  . LEU E  5  765  ? 7.913   127.795 184.635 1.00 52.07  ? 765  LEU A CB  1 
ATOM   8268  C  CG  . LEU E  5  765  ? 7.232   127.869 185.991 1.00 68.83  ? 765  LEU A CG  1 
ATOM   8269  C  CD1 . LEU E  5  765  ? 5.736   127.901 185.836 1.00 53.65  ? 765  LEU A CD1 1 
ATOM   8270  C  CD2 . LEU E  5  765  ? 7.646   126.671 186.803 1.00 52.88  ? 765  LEU A CD2 1 
ATOM   8271  N  N   . GLU E  5  766  ? 11.123  128.251 183.037 1.00 50.15  ? 766  GLU A N   1 
ATOM   8272  C  CA  . GLU E  5  766  ? 11.676  128.144 181.707 1.00 49.43  ? 766  GLU A CA  1 
ATOM   8273  C  C   . GLU E  5  766  ? 12.331  126.781 181.387 1.00 56.58  ? 766  GLU A C   1 
ATOM   8274  O  O   . GLU E  5  766  ? 12.783  126.564 180.265 1.00 49.04  ? 766  GLU A O   1 
ATOM   8275  C  CB  . GLU E  5  766  ? 12.664  129.281 181.452 1.00 52.94  ? 766  GLU A CB  1 
ATOM   8276  C  CG  . GLU E  5  766  ? 12.030  130.635 181.196 1.00 52.95  ? 766  GLU A CG  1 
ATOM   8277  C  CD  . GLU E  5  766  ? 11.398  130.772 179.819 1.00 62.70  ? 766  GLU A CD  1 
ATOM   8278  O  OE1 . GLU E  5  766  ? 10.279  130.262 179.616 1.00 68.13  ? 766  GLU A OE1 1 
ATOM   8279  O  OE2 . GLU E  5  766  ? 12.012  131.414 178.945 1.00 64.59  ? 766  GLU A OE2 1 
ATOM   8280  N  N   . ASN E  5  767  ? 12.396  125.875 182.364 1.00 56.98  ? 767  ASN A N   1 
ATOM   8281  C  CA  . ASN E  5  767  ? 12.962  124.554 182.124 1.00 56.53  ? 767  ASN A CA  1 
ATOM   8282  C  C   . ASN E  5  767  ? 11.910  123.647 181.500 1.00 60.87  ? 767  ASN A C   1 
ATOM   8283  O  O   . ASN E  5  767  ? 12.214  122.729 180.736 1.00 66.11  ? 767  ASN A O   1 
ATOM   8284  C  CB  . ASN E  5  767  ? 13.498  123.950 183.420 1.00 51.54  ? 767  ASN A CB  1 
ATOM   8285  C  CG  . ASN E  5  767  ? 13.880  122.494 183.268 1.00 55.36  ? 767  ASN A CG  1 
ATOM   8286  O  OD1 . ASN E  5  767  ? 13.140  121.601 183.686 1.00 57.81  ? 767  ASN A OD1 1 
ATOM   8287  N  ND2 . ASN E  5  767  ? 15.020  122.245 182.649 1.00 47.14  ? 767  ASN A ND2 1 
ATOM   8288  N  N   . GLU E  5  768  ? 10.664  123.933 181.836 1.00 55.13  ? 768  GLU A N   1 
ATOM   8289  C  CA  . GLU E  5  768  ? 9.513   123.247 181.288 1.00 54.89  ? 768  GLU A CA  1 
ATOM   8290  C  C   . GLU E  5  768  ? 9.208   123.728 179.846 1.00 55.60  ? 768  GLU A C   1 
ATOM   8291  O  O   . GLU E  5  768  ? 9.007   124.906 179.610 1.00 55.71  ? 768  GLU A O   1 
ATOM   8292  C  CB  . GLU E  5  768  ? 8.325   123.474 182.233 1.00 62.57  ? 768  GLU A CB  1 
ATOM   8293  C  CG  . GLU E  5  768  ? 6.979   123.111 181.673 1.00 86.59  ? 768  GLU A CG  1 
ATOM   8294  C  CD  . GLU E  5  768  ? 5.887   123.175 182.722 1.00 108.50 ? 768  GLU A CD  1 
ATOM   8295  O  OE1 . GLU E  5  768  ? 5.486   124.305 183.114 1.00 113.52 ? 768  GLU A OE1 1 
ATOM   8296  O  OE2 . GLU E  5  768  ? 5.437   122.084 183.149 1.00 115.27 ? 768  GLU A OE2 1 
ATOM   8297  N  N   . VAL E  5  769  ? 9.195   122.818 178.876 1.00 58.59  ? 769  VAL A N   1 
ATOM   8298  C  CA  . VAL E  5  769  ? 8.891   123.191 177.502 1.00 48.36  ? 769  VAL A CA  1 
ATOM   8299  C  C   . VAL E  5  769  ? 7.444   122.862 177.231 1.00 48.93  ? 769  VAL A C   1 
ATOM   8300  O  O   . VAL E  5  769  ? 7.055   121.710 177.290 1.00 48.98  ? 769  VAL A O   1 
ATOM   8301  C  CB  . VAL E  5  769  ? 9.774   122.432 176.516 1.00 48.41  ? 769  VAL A CB  1 
ATOM   8302  C  CG1 . VAL E  5  769  ? 9.332   122.659 175.094 1.00 47.54  ? 769  VAL A CG1 1 
ATOM   8303  C  CG2 . VAL E  5  769  ? 11.230  122.839 176.694 1.00 47.07  ? 769  VAL A CG2 1 
ATOM   8304  N  N   . LEU E  5  770  ? 6.637   123.881 176.944 1.00 54.78  ? 770  LEU A N   1 
ATOM   8305  C  CA  . LEU E  5  770  ? 5.217   123.683 176.701 1.00 50.03  ? 770  LEU A CA  1 
ATOM   8306  C  C   . LEU E  5  770  ? 4.776   124.113 175.306 1.00 60.53  ? 770  LEU A C   1 
ATOM   8307  O  O   . LEU E  5  770  ? 4.857   125.289 174.970 1.00 60.57  ? 770  LEU A O   1 
ATOM   8308  C  CB  . LEU E  5  770  ? 4.416   124.444 177.735 1.00 50.82  ? 770  LEU A CB  1 
ATOM   8309  C  CG  . LEU E  5  770  ? 2.920   124.364 177.475 1.00 51.52  ? 770  LEU A CG  1 
ATOM   8310  C  CD1 . LEU E  5  770  ? 2.464   122.945 177.433 1.00 51.56  ? 770  LEU A CD1 1 
ATOM   8311  C  CD2 . LEU E  5  770  ? 2.216   125.067 178.570 1.00 52.31  ? 770  LEU A CD2 1 
ATOM   8312  N  N   . PHE E  5  771  ? 4.314   123.160 174.494 1.00 58.60  ? 771  PHE A N   1 
ATOM   8313  C  CA  . PHE E  5  771  ? 3.629   123.484 173.242 1.00 57.61  ? 771  PHE A CA  1 
ATOM   8314  C  C   . PHE E  5  771  ? 2.155   123.168 173.395 1.00 50.89  ? 771  PHE A C   1 
ATOM   8315  O  O   . PHE E  5  771  ? 1.785   122.048 173.704 1.00 54.05  ? 771  PHE A O   1 
ATOM   8316  C  CB  . PHE E  5  771  ? 4.194   122.702 172.056 1.00 49.54  ? 771  PHE A CB  1 
ATOM   8317  C  CG  . PHE E  5  771  ? 5.530   123.188 171.578 1.00 48.86  ? 771  PHE A CG  1 
ATOM   8318  C  CD1 . PHE E  5  771  ? 6.705   122.758 172.179 1.00 48.30  ? 771  PHE A CD1 1 
ATOM   8319  C  CD2 . PHE E  5  771  ? 5.618   124.056 170.510 1.00 51.64  ? 771  PHE A CD2 1 
ATOM   8320  C  CE1 . PHE E  5  771  ? 7.941   123.202 171.731 1.00 47.72  ? 771  PHE A CE1 1 
ATOM   8321  C  CE2 . PHE E  5  771  ? 6.854   124.502 170.061 1.00 48.27  ? 771  PHE A CE2 1 
ATOM   8322  C  CZ  . PHE E  5  771  ? 8.009   124.077 170.676 1.00 47.72  ? 771  PHE A CZ  1 
ATOM   8323  N  N   . LYS E  5  772  ? 1.312   124.170 173.203 1.00 51.46  ? 772  LYS A N   1 
ATOM   8324  C  CA  . LYS E  5  772  ? -0.125  123.957 173.200 1.00 52.24  ? 772  LYS A CA  1 
ATOM   8325  C  C   . LYS E  5  772  ? -0.610  124.408 171.842 1.00 56.65  ? 772  LYS A C   1 
ATOM   8326  O  O   . LYS E  5  772  ? -0.218  125.471 171.371 1.00 60.32  ? 772  LYS A O   1 
ATOM   8327  C  CB  . LYS E  5  772  ? -0.817  124.743 174.331 1.00 53.66  ? 772  LYS A CB  1 
ATOM   8328  C  CG  . LYS E  5  772  ? -2.341  124.640 174.348 1.00 53.84  ? 772  LYS A CG  1 
ATOM   8329  C  CD  . LYS E  5  772  ? -2.901  124.526 175.761 1.00 70.86  ? 772  LYS A CD  1 
ATOM   8330  C  CE  . LYS E  5  772  ? -4.394  124.225 175.748 1.00 76.62  ? 772  LYS A CE  1 
ATOM   8331  N  NZ  . LYS E  5  772  ? -5.213  125.387 175.251 1.00 85.07  ? 772  LYS A NZ  1 
ATOM   8332  N  N   . ASP E  5  773  ? -1.432  123.578 171.208 1.00 54.20  ? 773  ASP A N   1 
ATOM   8333  C  CA  . ASP E  5  773  ? -1.981  123.832 169.869 1.00 52.85  ? 773  ASP A CA  1 
ATOM   8334  C  C   . ASP E  5  773  ? -0.985  124.453 168.885 1.00 54.35  ? 773  ASP A C   1 
ATOM   8335  O  O   . ASP E  5  773  ? -1.338  125.272 168.040 1.00 53.53  ? 773  ASP A O   1 
ATOM   8336  C  CB  . ASP E  5  773  ? -3.261  124.640 169.948 1.00 53.73  ? 773  ASP A CB  1 
ATOM   8337  C  CG  . ASP E  5  773  ? -4.280  124.030 170.904 1.00 99.23  ? 773  ASP A CG  1 
ATOM   8338  O  OD1 . ASP E  5  773  ? -4.402  122.783 170.915 1.00 98.41  ? 773  ASP A OD1 1 
ATOM   8339  O  OD2 . ASP E  5  773  ? -4.953  124.799 171.649 1.00 97.59  ? 773  ASP A OD2 1 
ATOM   8340  N  N   . GLY E  5  774  ? 0.271   124.041 169.006 1.00 51.50  ? 774  GLY A N   1 
ATOM   8341  C  CA  . GLY E  5  774  ? 1.299   124.411 168.058 1.00 50.92  ? 774  GLY A CA  1 
ATOM   8342  C  C   . GLY E  5  774  ? 2.071   125.649 168.438 1.00 53.05  ? 774  GLY A C   1 
ATOM   8343  O  O   . GLY E  5  774  ? 2.955   126.075 167.681 1.00 53.45  ? 774  GLY A O   1 
ATOM   8344  N  N   . ALA E  5  775  ? 1.726   126.222 169.596 1.00 52.60  ? 775  ALA A N   1 
ATOM   8345  C  CA  . ALA E  5  775  ? 2.365   127.443 170.099 1.00 51.78  ? 775  ALA A CA  1 
ATOM   8346  C  C   . ALA E  5  775  ? 3.294   127.149 171.263 1.00 56.75  ? 775  ALA A C   1 
ATOM   8347  O  O   . ALA E  5  775  ? 2.914   126.443 172.199 1.00 64.71  ? 775  ALA A O   1 
ATOM   8348  C  CB  . ALA E  5  775  ? 1.318   128.475 170.516 1.00 51.88  ? 775  ALA A CB  1 
ATOM   8349  N  N   . LEU E  5  776  ? 4.505   127.696 171.208 1.00 56.12  ? 776  LEU A N   1 
ATOM   8350  C  CA  . LEU E  5  776  ? 5.438   127.622 172.339 1.00 55.49  ? 776  LEU A CA  1 
ATOM   8351  C  C   . LEU E  5  776  ? 5.043   128.635 173.420 1.00 56.45  ? 776  LEU A C   1 
ATOM   8352  O  O   . LEU E  5  776  ? 5.291   129.826 173.280 1.00 61.08  ? 776  LEU A O   1 
ATOM   8353  C  CB  . LEU E  5  776  ? 6.873   127.864 171.861 1.00 52.13  ? 776  LEU A CB  1 
ATOM   8354  C  CG  . LEU E  5  776  ? 8.004   127.944 172.886 1.00 55.25  ? 776  LEU A CG  1 
ATOM   8355  C  CD1 . LEU E  5  776  ? 8.062   126.689 173.704 1.00 48.62  ? 776  LEU A CD1 1 
ATOM   8356  C  CD2 . LEU E  5  776  ? 9.344   128.225 172.232 1.00 48.20  ? 776  LEU A CD2 1 
ATOM   8357  N  N   . LEU E  5  777  ? 4.412   128.149 174.487 1.00 57.54  ? 777  LEU A N   1 
ATOM   8358  C  CA  . LEU E  5  777  ? 3.888   128.998 175.549 1.00 51.49  ? 777  LEU A CA  1 
ATOM   8359  C  C   . LEU E  5  777  ? 4.843   129.164 176.728 1.00 64.17  ? 777  LEU A C   1 
ATOM   8360  O  O   . LEU E  5  777  ? 4.704   130.095 177.507 1.00 61.41  ? 777  LEU A O   1 
ATOM   8361  C  CB  . LEU E  5  777  ? 2.578   128.439 176.074 1.00 52.14  ? 777  LEU A CB  1 
ATOM   8362  C  CG  . LEU E  5  777  ? 1.449   128.403 175.070 1.00 75.51  ? 777  LEU A CG  1 
ATOM   8363  C  CD1 . LEU E  5  777  ? 0.172   128.144 175.801 1.00 53.31  ? 777  LEU A CD1 1 
ATOM   8364  C  CD2 . LEU E  5  777  ? 1.404   129.701 174.334 1.00 52.69  ? 777  LEU A CD2 1 
ATOM   8365  N  N   . CYS E  5  778  ? 5.809   128.268 176.873 1.00 62.32  ? 778  CYS A N   1 
ATOM   8366  C  CA  . CYS E  5  778  ? 6.745   128.348 177.990 1.00 55.97  ? 778  CYS A CA  1 
ATOM   8367  C  C   . CYS E  5  778  ? 8.009   127.533 177.687 1.00 53.08  ? 778  CYS A C   1 
ATOM   8368  O  O   . CYS E  5  778  ? 7.964   126.555 176.953 1.00 58.76  ? 778  CYS A O   1 
ATOM   8369  C  CB  . CYS E  5  778  ? 6.055   127.873 179.271 1.00 51.10  ? 778  CYS A CB  1 
ATOM   8370  S  SG  . CYS E  5  778  ? 7.127   127.507 180.693 1.00 50.94  ? 778  CYS A SG  1 
ATOM   8371  N  N   . GLY E  5  779  ? 9.143   127.966 178.223 1.00 51.22  ? 779  GLY A N   1 
ATOM   8372  C  CA  . GLY E  5  779  ? 10.390  127.238 178.061 1.00 55.74  ? 779  GLY A CA  1 
ATOM   8373  C  C   . GLY E  5  779  ? 11.262  127.683 176.907 1.00 58.78  ? 779  GLY A C   1 
ATOM   8374  O  O   . GLY E  5  779  ? 10.750  128.159 175.918 1.00 48.23  ? 779  GLY A O   1 
ATOM   8375  N  N   . ILE E  5  780  ? 12.576  127.517 177.034 1.00 47.58  ? 780  ILE A N   1 
ATOM   8376  C  CA  . ILE E  5  780  ? 13.493  127.755 175.926 1.00 51.19  ? 780  ILE A CA  1 
ATOM   8377  C  C   . ILE E  5  780  ? 13.751  126.465 175.157 1.00 56.77  ? 780  ILE A C   1 
ATOM   8378  O  O   . ILE E  5  780  ? 13.503  125.380 175.675 1.00 59.32  ? 780  ILE A O   1 
ATOM   8379  C  CB  . ILE E  5  780  ? 14.849  128.294 176.407 1.00 46.80  ? 780  ILE A CB  1 
ATOM   8380  C  CG1 . ILE E  5  780  ? 15.422  127.381 177.487 1.00 46.59  ? 780  ILE A CG1 1 
ATOM   8381  C  CG2 . ILE E  5  780  ? 14.712  129.704 176.931 1.00 47.38  ? 780  ILE A CG2 1 
ATOM   8382  C  CD1 . ILE E  5  780  ? 16.424  126.377 176.978 1.00 57.04  ? 780  ILE A CD1 1 
ATOM   8383  N  N   . LEU E  5  781  ? 14.260  126.599 173.932 1.00 53.69  ? 781  LEU A N   1 
ATOM   8384  C  CA  . LEU E  5  781  ? 14.642  125.465 173.105 1.00 45.93  ? 781  LEU A CA  1 
ATOM   8385  C  C   . LEU E  5  781  ? 16.171  125.278 173.006 1.00 55.09  ? 781  LEU A C   1 
ATOM   8386  O  O   . LEU E  5  781  ? 16.940  126.221 172.882 1.00 53.20  ? 781  LEU A O   1 
ATOM   8387  C  CB  . LEU E  5  781  ? 14.009  125.583 171.719 1.00 45.64  ? 781  LEU A CB  1 
ATOM   8388  C  CG  . LEU E  5  781  ? 12.496  125.727 171.697 1.00 46.25  ? 781  LEU A CG  1 
ATOM   8389  C  CD1 . LEU E  5  781  ? 11.965  125.702 170.282 1.00 46.31  ? 781  LEU A CD1 1 
ATOM   8390  C  CD2 . LEU E  5  781  ? 11.853  124.647 172.516 1.00 55.76  ? 781  LEU A CD2 1 
ATOM   8391  N  N   . ASP E  5  782  ? 16.569  124.020 172.942 1.00 63.16  ? 782  ASP A N   1 
ATOM   8392  C  CA  . ASP E  5  782  ? 17.818  123.528 173.481 1.00 50.98  ? 782  ASP A CA  1 
ATOM   8393  C  C   . ASP E  5  782  ? 18.357  122.386 172.630 1.00 52.56  ? 782  ASP A C   1 
ATOM   8394  O  O   . ASP E  5  782  ? 17.684  121.909 171.729 1.00 63.22  ? 782  ASP A O   1 
ATOM   8395  C  CB  . ASP E  5  782  ? 17.419  122.888 174.788 1.00 51.37  ? 782  ASP A CB  1 
ATOM   8396  C  CG  . ASP E  5  782  ? 18.443  122.989 175.784 1.00 60.27  ? 782  ASP A CG  1 
ATOM   8397  O  OD1 . ASP E  5  782  ? 19.406  123.725 175.510 1.00 73.40  ? 782  ASP A OD1 1 
ATOM   8398  O  OD2 . ASP E  5  782  ? 18.278  122.354 176.842 1.00 61.06  ? 782  ASP A OD2 1 
ATOM   8399  N  N   . LYS E  5  783  ? 19.547  121.898 172.955 1.00 49.85  ? 783  LYS A N   1 
ATOM   8400  C  CA  . LYS E  5  783  ? 20.040  120.632 172.397 1.00 49.80  ? 783  LYS A CA  1 
ATOM   8401  C  C   . LYS E  5  783  ? 19.022  119.511 172.601 1.00 51.31  ? 783  LYS A C   1 
ATOM   8402  O  O   . LYS E  5  783  ? 18.938  118.591 171.792 1.00 56.55  ? 783  LYS A O   1 
ATOM   8403  C  CB  . LYS E  5  783  ? 21.361  120.228 173.041 1.00 42.29  ? 783  LYS A CB  1 
ATOM   8404  C  CG  . LYS E  5  783  ? 22.078  119.088 172.365 1.00 44.40  ? 783  LYS A CG  1 
ATOM   8405  C  CD  . LYS E  5  783  ? 22.308  117.901 173.312 1.00 59.63  ? 783  LYS A CD  1 
ATOM   8406  C  CE  . LYS E  5  783  ? 23.789  117.692 173.672 1.00 66.78  ? 783  LYS A CE  1 
ATOM   8407  N  NZ  . LYS E  5  783  ? 24.657  117.403 172.473 1.00 65.79  ? 783  LYS A NZ  1 
ATOM   8408  N  N   . SER E  5  784  ? 18.236  119.598 173.669 1.00 47.08  ? 784  SER A N   1 
ATOM   8409  C  CA  . SER E  5  784  ? 17.246  118.571 173.956 1.00 46.68  ? 784  SER A CA  1 
ATOM   8410  C  C   . SER E  5  784  ? 16.028  118.676 173.040 1.00 49.70  ? 784  SER A C   1 
ATOM   8411  O  O   . SER E  5  784  ? 15.205  117.772 172.989 1.00 48.48  ? 784  SER A O   1 
ATOM   8412  C  CB  . SER E  5  784  ? 16.783  118.668 175.412 1.00 47.09  ? 784  SER A CB  1 
ATOM   8413  O  OG  . SER E  5  784  ? 16.245  119.943 175.673 1.00 46.82  ? 784  SER A OG  1 
ATOM   8414  N  N   . GLN E  5  785  ? 15.892  119.778 172.321 1.00 49.22  ? 785  GLN A N   1 
ATOM   8415  C  CA  . GLN E  5  785  ? 14.675  119.968 171.556 1.00 51.23  ? 785  GLN A CA  1 
ATOM   8416  C  C   . GLN E  5  785  ? 14.849  119.869 170.031 1.00 52.15  ? 785  GLN A C   1 
ATOM   8417  O  O   . GLN E  5  785  ? 13.945  119.425 169.336 1.00 54.49  ? 785  GLN A O   1 
ATOM   8418  C  CB  . GLN E  5  785  ? 14.026  121.290 171.964 1.00 53.06  ? 785  GLN A CB  1 
ATOM   8419  C  CG  . GLN E  5  785  ? 13.597  121.306 173.415 1.00 48.47  ? 785  GLN A CG  1 
ATOM   8420  C  CD  . GLN E  5  785  ? 12.503  120.299 173.685 1.00 52.73  ? 785  GLN A CD  1 
ATOM   8421  O  OE1 . GLN E  5  785  ? 11.613  120.101 172.857 1.00 63.70  ? 785  GLN A OE1 1 
ATOM   8422  N  NE2 . GLN E  5  785  ? 12.567  119.644 174.838 1.00 47.43  ? 785  GLN A NE2 1 
ATOM   8423  N  N   . TYR E  5  786  ? 16.004  120.283 169.520 1.00 49.43  ? 786  TYR A N   1 
ATOM   8424  C  CA  . TYR E  5  786  ? 16.274  120.226 168.095 1.00 43.56  ? 786  TYR A CA  1 
ATOM   8425  C  C   . TYR E  5  786  ? 17.737  119.854 167.844 1.00 53.38  ? 786  TYR A C   1 
ATOM   8426  O  O   . TYR E  5  786  ? 18.277  120.094 166.763 1.00 57.40  ? 786  TYR A O   1 
ATOM   8427  C  CB  . TYR E  5  786  ? 15.880  121.535 167.393 1.00 50.95  ? 786  TYR A CB  1 
ATOM   8428  C  CG  . TYR E  5  786  ? 16.529  122.767 167.961 1.00 43.88  ? 786  TYR A CG  1 
ATOM   8429  C  CD1 . TYR E  5  786  ? 17.813  123.125 167.594 1.00 52.19  ? 786  TYR A CD1 1 
ATOM   8430  C  CD2 . TYR E  5  786  ? 15.865  123.563 168.876 1.00 62.97  ? 786  TYR A CD2 1 
ATOM   8431  C  CE1 . TYR E  5  786  ? 18.414  124.232 168.111 1.00 52.99  ? 786  TYR A CE1 1 
ATOM   8432  C  CE2 . TYR E  5  786  ? 16.462  124.689 169.408 1.00 57.18  ? 786  TYR A CE2 1 
ATOM   8433  C  CZ  . TYR E  5  786  ? 17.737  125.015 169.016 1.00 56.56  ? 786  TYR A CZ  1 
ATOM   8434  O  OH  . TYR E  5  786  ? 18.355  126.124 169.536 1.00 60.03  ? 786  TYR A OH  1 
ATOM   8435  N  N   . GLY E  5  787  ? 18.375  119.276 168.864 1.00 47.19  ? 787  GLY A N   1 
ATOM   8436  C  CA  . GLY E  5  787  ? 19.557  118.459 168.671 1.00 47.08  ? 787  GLY A CA  1 
ATOM   8437  C  C   . GLY E  5  787  ? 19.057  117.098 168.196 1.00 54.30  ? 787  GLY A C   1 
ATOM   8438  O  O   . GLY E  5  787  ? 17.842  116.921 167.958 1.00 49.57  ? 787  GLY A O   1 
ATOM   8439  N  N   . ALA E  5  788  ? 19.958  116.127 168.020 1.00 53.38  ? 788  ALA A N   1 
ATOM   8440  C  CA  . ALA E  5  788  ? 19.494  114.769 167.738 1.00 44.04  ? 788  ALA A CA  1 
ATOM   8441  C  C   . ALA E  5  788  ? 19.048  114.174 169.073 1.00 48.06  ? 788  ALA A C   1 
ATOM   8442  O  O   . ALA E  5  788  ? 19.847  113.605 169.786 1.00 55.36  ? 788  ALA A O   1 
ATOM   8443  C  CB  . ALA E  5  788  ? 20.566  113.969 167.126 1.00 41.49  ? 788  ALA A CB  1 
ATOM   8444  N  N   . SER E  5  789  ? 17.776  114.331 169.422 1.00 42.56  ? 789  SER A N   1 
ATOM   8445  C  CA  . SER E  5  789  ? 17.342  114.169 170.808 1.00 44.11  ? 789  SER A CA  1 
ATOM   8446  C  C   . SER E  5  789  ? 15.942  113.591 170.954 1.00 43.37  ? 789  SER A C   1 
ATOM   8447  O  O   . SER E  5  789  ? 14.958  114.227 170.578 1.00 50.66  ? 789  SER A O   1 
ATOM   8448  C  CB  . SER E  5  789  ? 17.413  115.512 171.552 1.00 42.93  ? 789  SER A CB  1 
ATOM   8449  O  OG  . SER E  5  789  ? 18.760  115.882 171.793 1.00 63.72  ? 789  SER A OG  1 
ATOM   8450  N  N   . LYS E  5  790  ? 15.850  112.404 171.535 1.00 43.46  ? 790  LYS A N   1 
ATOM   8451  C  CA  . LYS E  5  790  ? 14.584  111.718 171.607 1.00 51.62  ? 790  LYS A CA  1 
ATOM   8452  C  C   . LYS E  5  790  ? 13.505  112.540 172.366 1.00 48.42  ? 790  LYS A C   1 
ATOM   8453  O  O   . LYS E  5  790  ? 13.770  113.099 173.427 1.00 50.50  ? 790  LYS A O   1 
ATOM   8454  C  CB  . LYS E  5  790  ? 14.803  110.342 172.224 1.00 44.05  ? 790  LYS A CB  1 
ATOM   8455  C  CG  . LYS E  5  790  ? 13.898  109.257 171.674 1.00 65.10  ? 790  LYS A CG  1 
ATOM   8456  C  CD  . LYS E  5  790  ? 14.411  107.850 171.990 1.00 57.88  ? 790  LYS A CD  1 
ATOM   8457  C  CE  . LYS E  5  790  ? 13.411  106.780 171.555 1.00 55.77  ? 790  LYS A CE  1 
ATOM   8458  N  NZ  . LYS E  5  790  ? 13.977  105.411 171.614 1.00 56.06  ? 790  LYS A NZ  1 
ATOM   8459  N  N   . TYR E  5  791  ? 12.317  112.647 171.772 1.00 48.11  ? 791  TYR A N   1 
ATOM   8460  C  CA  . TYR E  5  791  ? 11.130  113.203 172.418 1.00 50.04  ? 791  TYR A CA  1 
ATOM   8461  C  C   . TYR E  5  791  ? 11.162  114.714 172.580 1.00 56.27  ? 791  TYR A C   1 
ATOM   8462  O  O   . TYR E  5  791  ? 10.369  115.278 173.336 1.00 66.17  ? 791  TYR A O   1 
ATOM   8463  C  CB  . TYR E  5  791  ? 10.853  112.509 173.762 1.00 51.55  ? 791  TYR A CB  1 
ATOM   8464  C  CG  . TYR E  5  791  ? 10.796  111.001 173.668 1.00 46.06  ? 791  TYR A CG  1 
ATOM   8465  C  CD1 . TYR E  5  791  ? 9.847   110.372 172.871 1.00 51.65  ? 791  TYR A CD1 1 
ATOM   8466  C  CD2 . TYR E  5  791  ? 11.684  110.211 174.367 1.00 60.49  ? 791  TYR A CD2 1 
ATOM   8467  C  CE1 . TYR E  5  791  ? 9.779   108.998 172.776 1.00 49.88  ? 791  TYR A CE1 1 
ATOM   8468  C  CE2 . TYR E  5  791  ? 11.636  108.825 174.273 1.00 57.33  ? 791  TYR A CE2 1 
ATOM   8469  C  CZ  . TYR E  5  791  ? 10.684  108.227 173.471 1.00 55.81  ? 791  TYR A CZ  1 
ATOM   8470  O  OH  . TYR E  5  791  ? 10.631  106.861 173.362 1.00 57.78  ? 791  TYR A OH  1 
ATOM   8471  N  N   . GLY E  5  792  ? 12.080  115.366 171.873 1.00 51.04  ? 792  GLY A N   1 
ATOM   8472  C  CA  . GLY E  5  792  ? 12.090  116.815 171.794 1.00 48.32  ? 792  GLY A CA  1 
ATOM   8473  C  C   . GLY E  5  792  ? 11.094  117.310 170.751 1.00 58.08  ? 792  GLY A C   1 
ATOM   8474  O  O   . GLY E  5  792  ? 10.292  116.536 170.225 1.00 58.78  ? 792  GLY A O   1 
ATOM   8475  N  N   . ILE E  5  793  ? 11.133  118.601 170.429 1.00 57.98  ? 793  ILE A N   1 
ATOM   8476  C  CA  . ILE E  5  793  ? 10.124  119.132 169.522 1.00 53.24  ? 793  ILE A CA  1 
ATOM   8477  C  C   . ILE E  5  793  ? 10.219  118.529 168.118 1.00 52.89  ? 793  ILE A C   1 
ATOM   8478  O  O   . ILE E  5  793  ? 9.205   118.115 167.552 1.00 49.07  ? 793  ILE A O   1 
ATOM   8479  C  CB  . ILE E  5  793  ? 10.109  120.676 169.474 1.00 57.46  ? 793  ILE A CB  1 
ATOM   8480  C  CG1 . ILE E  5  793  ? 8.944   121.174 168.600 1.00 46.69  ? 793  ILE A CG1 1 
ATOM   8481  C  CG2 . ILE E  5  793  ? 11.442  121.202 168.998 1.00 45.62  ? 793  ILE A CG2 1 
ATOM   8482  C  CD1 . ILE E  5  793  ? 7.573   120.716 169.055 1.00 47.31  ? 793  ILE A CD1 1 
ATOM   8483  N  N   . VAL E  5  794  ? 11.422  118.451 167.554 1.00 48.27  ? 794  VAL A N   1 
ATOM   8484  C  CA  . VAL E  5  794  ? 11.490  117.962 166.188 1.00 52.44  ? 794  VAL A CA  1 
ATOM   8485  C  C   . VAL E  5  794  ? 11.170  116.469 166.065 1.00 54.47  ? 794  VAL A C   1 
ATOM   8486  O  O   . VAL E  5  794  ? 10.554  116.052 165.084 1.00 55.19  ? 794  VAL A O   1 
ATOM   8487  C  CB  . VAL E  5  794  ? 12.743  118.423 165.397 1.00 44.69  ? 794  VAL A CB  1 
ATOM   8488  C  CG1 . VAL E  5  794  ? 13.507  119.440 166.168 1.00 44.48  ? 794  VAL A CG1 1 
ATOM   8489  C  CG2 . VAL E  5  794  ? 13.589  117.275 164.995 1.00 44.27  ? 794  VAL A CG2 1 
ATOM   8490  N  N   . HIS E  5  795  ? 11.518  115.677 167.073 1.00 49.48  ? 795  HIS A N   1 
ATOM   8491  C  CA  . HIS E  5  795  ? 11.121  114.273 167.053 1.00 48.73  ? 795  HIS A CA  1 
ATOM   8492  C  C   . HIS E  5  795  ? 9.603   114.168 167.225 1.00 55.59  ? 795  HIS A C   1 
ATOM   8493  O  O   . HIS E  5  795  ? 8.957   113.325 166.600 1.00 59.66  ? 795  HIS A O   1 
ATOM   8494  C  CB  . HIS E  5  795  ? 11.872  113.488 168.127 1.00 47.78  ? 795  HIS A CB  1 
ATOM   8495  C  CG  . HIS E  5  795  ? 11.552  112.027 168.164 1.00 52.56  ? 795  HIS A CG  1 
ATOM   8496  N  ND1 . HIS E  5  795  ? 11.905  111.219 169.224 1.00 45.00  ? 795  HIS A ND1 1 
ATOM   8497  C  CD2 . HIS E  5  795  ? 10.922  111.223 167.274 1.00 56.38  ? 795  HIS A CD2 1 
ATOM   8498  C  CE1 . HIS E  5  795  ? 11.500  109.985 168.988 1.00 49.32  ? 795  HIS A CE1 1 
ATOM   8499  N  NE2 . HIS E  5  795  ? 10.902  109.959 167.810 1.00 50.91  ? 795  HIS A NE2 1 
ATOM   8500  N  N   . SER E  5  796  ? 9.029   115.042 168.049 1.00 46.22  ? 796  SER A N   1 
ATOM   8501  C  CA  . SER E  5  796  ? 7.572   115.075 168.232 1.00 52.11  ? 796  SER A CA  1 
ATOM   8502  C  C   . SER E  5  796  ? 6.857   115.413 166.930 1.00 53.07  ? 796  SER A C   1 
ATOM   8503  O  O   . SER E  5  796  ? 5.786   114.894 166.652 1.00 47.80  ? 796  SER A O   1 
ATOM   8504  C  CB  . SER E  5  796  ? 7.175   116.100 169.307 1.00 52.69  ? 796  SER A CB  1 
ATOM   8505  O  OG  . SER E  5  796  ? 7.622   115.712 170.595 1.00 62.23  ? 796  SER A OG  1 
ATOM   8506  N  N   . LEU E  5  797  ? 7.459   116.306 166.149 1.00 51.33  ? 797  LEU A N   1 
ATOM   8507  C  CA  . LEU E  5  797  ? 6.862   116.763 164.913 1.00 47.27  ? 797  LEU A CA  1 
ATOM   8508  C  C   . LEU E  5  797  ? 6.949   115.663 163.897 1.00 60.88  ? 797  LEU A C   1 
ATOM   8509  O  O   . LEU E  5  797  ? 6.035   115.476 163.066 1.00 47.74  ? 797  LEU A O   1 
ATOM   8510  C  CB  . LEU E  5  797  ? 7.579   118.001 164.391 1.00 51.47  ? 797  LEU A CB  1 
ATOM   8511  C  CG  . LEU E  5  797  ? 7.268   119.307 165.120 1.00 47.22  ? 797  LEU A CG  1 
ATOM   8512  C  CD1 . LEU E  5  797  ? 8.217   120.396 164.648 1.00 47.33  ? 797  LEU A CD1 1 
ATOM   8513  C  CD2 . LEU E  5  797  ? 5.850   119.684 164.907 1.00 47.95  ? 797  LEU A CD2 1 
ATOM   8514  N  N   . HIS E  5  798  ? 8.064   114.934 163.975 1.00 46.68  ? 798  HIS A N   1 
ATOM   8515  C  CA  . HIS E  5  798  ? 8.295   113.771 163.155 1.00 46.61  ? 798  HIS A CA  1 
ATOM   8516  C  C   . HIS E  5  798  ? 7.208   112.750 163.389 1.00 47.28  ? 798  HIS A C   1 
ATOM   8517  O  O   . HIS E  5  798  ? 6.711   112.205 162.433 1.00 47.51  ? 798  HIS A O   1 
ATOM   8518  C  CB  . HIS E  5  798  ? 9.654   113.190 163.466 1.00 45.95  ? 798  HIS A CB  1 
ATOM   8519  C  CG  . HIS E  5  798  ? 10.066  112.061 162.569 1.00 53.28  ? 798  HIS A CG  1 
ATOM   8520  N  ND1 . HIS E  5  798  ? 9.599   110.772 162.724 1.00 56.78  ? 798  HIS A ND1 1 
ATOM   8521  C  CD2 . HIS E  5  798  ? 10.945  112.020 161.539 1.00 54.73  ? 798  HIS A CD2 1 
ATOM   8522  C  CE1 . HIS E  5  798  ? 10.154  109.993 161.814 1.00 45.99  ? 798  HIS A CE1 1 
ATOM   8523  N  NE2 . HIS E  5  798  ? 10.980  110.725 161.089 1.00 45.63  ? 798  HIS A NE2 1 
ATOM   8524  N  N   . GLU E  5  799  ? 6.809   112.495 164.632 1.00 47.34  ? 799  GLU A N   1 
ATOM   8525  C  CA  . GLU E  5  799  ? 5.719   111.527 164.884 1.00 47.97  ? 799  GLU A CA  1 
ATOM   8526  C  C   . GLU E  5  799  ? 4.338   111.930 164.401 1.00 48.70  ? 799  GLU A C   1 
ATOM   8527  O  O   . GLU E  5  799  ? 3.598   111.144 163.831 1.00 87.14  ? 799  GLU A O   1 
ATOM   8528  C  CB  . GLU E  5  799  ? 5.617   111.126 166.366 1.00 48.05  ? 799  GLU A CB  1 
ATOM   8529  C  CG  . GLU E  5  799  ? 6.221   109.766 166.649 1.00 74.83  ? 799  GLU A CG  1 
ATOM   8530  C  CD  . GLU E  5  799  ? 5.275   108.604 166.371 1.00 83.11  ? 799  GLU A CD  1 
ATOM   8531  O  OE1 . GLU E  5  799  ? 4.065   108.841 166.162 1.00 77.69  ? 799  GLU A OE1 1 
ATOM   8532  O  OE2 . GLU E  5  799  ? 5.743   107.438 166.373 1.00 93.65  ? 799  GLU A OE2 1 
ATOM   8533  N  N   . VAL E  5  800  ? 3.979   113.166 164.656 1.00 62.14  ? 800  VAL A N   1 
ATOM   8534  C  CA  . VAL E  5  800  ? 2.634   113.619 164.402 1.00 58.73  ? 800  VAL A CA  1 
ATOM   8535  C  C   . VAL E  5  800  ? 2.441   113.957 162.932 1.00 58.05  ? 800  VAL A C   1 
ATOM   8536  O  O   . VAL E  5  800  ? 1.417   113.616 162.365 1.00 56.36  ? 800  VAL A O   1 
ATOM   8537  C  CB  . VAL E  5  800  ? 2.325   114.821 165.289 1.00 55.90  ? 800  VAL A CB  1 
ATOM   8538  C  CG1 . VAL E  5  800  ? 0.994   115.411 164.927 1.00 57.96  ? 800  VAL A CG1 1 
ATOM   8539  C  CG2 . VAL E  5  800  ? 2.366   114.397 166.748 1.00 55.21  ? 800  VAL A CG2 1 
ATOM   8540  N  N   . TYR E  5  801  ? 3.440   114.585 162.309 1.00 53.84  ? 801  TYR A N   1 
ATOM   8541  C  CA  . TYR E  5  801  ? 3.270   115.090 160.947 1.00 54.46  ? 801  TYR A CA  1 
ATOM   8542  C  C   . TYR E  5  801  ? 4.136   114.398 159.873 1.00 57.21  ? 801  TYR A C   1 
ATOM   8543  O  O   . TYR E  5  801  ? 4.067   114.738 158.679 1.00 52.83  ? 801  TYR A O   1 
ATOM   8544  C  CB  . TYR E  5  801  ? 3.544   116.584 160.905 1.00 51.89  ? 801  TYR A CB  1 
ATOM   8545  C  CG  . TYR E  5  801  ? 2.727   117.437 161.835 1.00 49.61  ? 801  TYR A CG  1 
ATOM   8546  C  CD1 . TYR E  5  801  ? 1.367   117.601 161.650 1.00 57.91  ? 801  TYR A CD1 1 
ATOM   8547  C  CD2 . TYR E  5  801  ? 3.340   118.146 162.855 1.00 52.09  ? 801  TYR A CD2 1 
ATOM   8548  C  CE1 . TYR E  5  801  ? 0.630   118.438 162.479 1.00 61.43  ? 801  TYR A CE1 1 
ATOM   8549  C  CE2 . TYR E  5  801  ? 2.627   118.967 163.677 1.00 52.43  ? 801  TYR A CE2 1 
ATOM   8550  C  CZ  . TYR E  5  801  ? 1.275   119.119 163.495 1.00 63.21  ? 801  TYR A CZ  1 
ATOM   8551  O  OH  . TYR E  5  801  ? 0.578   119.951 164.344 1.00 70.21  ? 801  TYR A OH  1 
ATOM   8552  N  N   . GLY E  5  802  ? 4.968   113.452 160.291 1.00 48.57  ? 802  GLY A N   1 
ATOM   8553  C  CA  . GLY E  5  802  ? 5.767   112.695 159.349 1.00 48.30  ? 802  GLY A CA  1 
ATOM   8554  C  C   . GLY E  5  802  ? 7.148   113.254 159.079 1.00 55.92  ? 802  GLY A C   1 
ATOM   8555  O  O   . GLY E  5  802  ? 7.483   114.339 159.529 1.00 52.46  ? 802  GLY A O   1 
ATOM   8556  N  N   . PRO E  5  803  ? 7.972   112.509 158.330 1.00 63.14  ? 803  PRO A N   1 
ATOM   8557  C  CA  . PRO E  5  803  ? 9.370   112.930 158.175 1.00 56.83  ? 803  PRO A CA  1 
ATOM   8558  C  C   . PRO E  5  803  ? 9.551   114.152 157.291 1.00 52.23  ? 803  PRO A C   1 
ATOM   8559  O  O   . PRO E  5  803  ? 10.529  114.853 157.491 1.00 54.76  ? 803  PRO A O   1 
ATOM   8560  C  CB  . PRO E  5  803  ? 10.038  111.703 157.545 1.00 46.53  ? 803  PRO A CB  1 
ATOM   8561  C  CG  . PRO E  5  803  ? 8.964   111.008 156.913 1.00 47.20  ? 803  PRO A CG  1 
ATOM   8562  C  CD  . PRO E  5  803  ? 7.731   111.199 157.711 1.00 47.64  ? 803  PRO A CD  1 
ATOM   8563  N  N   . GLU E  5  804  ? 8.656   114.404 156.337 1.00 55.38  ? 804  GLU A N   1 
ATOM   8564  C  CA  . GLU E  5  804  ? 8.863   115.530 155.431 1.00 58.17  ? 804  GLU A CA  1 
ATOM   8565  C  C   . GLU E  5  804  ? 8.760   116.822 156.211 1.00 60.68  ? 804  GLU A C   1 
ATOM   8566  O  O   . GLU E  5  804  ? 9.651   117.659 156.128 1.00 53.69  ? 804  GLU A O   1 
ATOM   8567  C  CB  . GLU E  5  804  ? 7.867   115.538 154.283 1.00 63.01  ? 804  GLU A CB  1 
ATOM   8568  C  CG  . GLU E  5  804  ? 8.069   114.416 153.284 1.00 86.52  ? 804  GLU A CG  1 
ATOM   8569  C  CD  . GLU E  5  804  ? 7.252   113.157 153.609 1.00 105.74 ? 804  GLU A CD  1 
ATOM   8570  O  OE1 . GLU E  5  804  ? 6.921   112.922 154.807 1.00 110.34 ? 804  GLU A OE1 1 
ATOM   8571  O  OE2 . GLU E  5  804  ? 6.936   112.406 152.652 1.00 108.89 ? 804  GLU A OE2 1 
ATOM   8572  N  N   . VAL E  5  805  ? 7.676   116.976 156.975 1.00 62.50  ? 805  VAL A N   1 
ATOM   8573  C  CA  . VAL E  5  805  ? 7.506   118.142 157.833 1.00 47.72  ? 805  VAL A CA  1 
ATOM   8574  C  C   . VAL E  5  805  ? 8.666   118.336 158.827 1.00 55.11  ? 805  VAL A C   1 
ATOM   8575  O  O   . VAL E  5  805  ? 9.187   119.450 158.961 1.00 52.36  ? 805  VAL A O   1 
ATOM   8576  C  CB  . VAL E  5  805  ? 6.163   118.108 158.579 1.00 53.54  ? 805  VAL A CB  1 
ATOM   8577  C  CG1 . VAL E  5  805  ? 6.170   119.099 159.730 1.00 48.14  ? 805  VAL A CG1 1 
ATOM   8578  C  CG2 . VAL E  5  805  ? 5.041   118.414 157.646 1.00 48.97  ? 805  VAL A CG2 1 
ATOM   8579  N  N   . ALA E  5  806  ? 9.079   117.262 159.509 1.00 46.68  ? 806  ALA A N   1 
ATOM   8580  C  CA  . ALA E  5  806  ? 10.206  117.333 160.458 1.00 56.62  ? 806  ALA A CA  1 
ATOM   8581  C  C   . ALA E  5  806  ? 11.500  117.787 159.805 1.00 54.99  ? 806  ALA A C   1 
ATOM   8582  O  O   . ALA E  5  806  ? 12.236  118.615 160.343 1.00 54.49  ? 806  ALA A O   1 
ATOM   8583  C  CB  . ALA E  5  806  ? 10.426  116.018 161.118 1.00 45.81  ? 806  ALA A CB  1 
ATOM   8584  N  N   . ALA E  5  807  ? 11.780  117.236 158.640 1.00 45.63  ? 807  ALA A N   1 
ATOM   8585  C  CA  . ALA E  5  807  ? 12.937  117.677 157.884 1.00 58.67  ? 807  ALA A CA  1 
ATOM   8586  C  C   . ALA E  5  807  ? 12.841  119.155 157.488 1.00 51.57  ? 807  ALA A C   1 
ATOM   8587  O  O   . ALA E  5  807  ? 13.837  119.878 157.498 1.00 53.46  ? 807  ALA A O   1 
ATOM   8588  C  CB  . ALA E  5  807  ? 13.124  116.815 156.680 1.00 45.42  ? 807  ALA A CB  1 
ATOM   8589  N  N   . LYS E  5  808  ? 11.637  119.603 157.153 1.00 46.17  ? 808  LYS A N   1 
ATOM   8590  C  CA  . LYS E  5  808  ? 11.432  120.994 156.778 1.00 47.95  ? 808  LYS A CA  1 
ATOM   8591  C  C   . LYS E  5  808  ? 11.622  121.873 157.996 1.00 48.75  ? 808  LYS A C   1 
ATOM   8592  O  O   . LYS E  5  808  ? 12.316  122.870 157.910 1.00 50.05  ? 808  LYS A O   1 
ATOM   8593  C  CB  . LYS E  5  808  ? 10.058  121.211 156.142 1.00 47.23  ? 808  LYS A CB  1 
ATOM   8594  C  CG  . LYS E  5  808  ? 9.718   122.653 155.780 1.00 63.74  ? 808  LYS A CG  1 
ATOM   8595  C  CD  . LYS E  5  808  ? 10.630  123.257 154.689 1.00 68.72  ? 808  LYS A CD  1 
ATOM   8596  C  CE  . LYS E  5  808  ? 10.159  124.686 154.272 1.00 61.14  ? 808  LYS A CE  1 
ATOM   8597  N  NZ  . LYS E  5  808  ? 11.145  125.429 153.423 1.00 63.00  ? 808  LYS A NZ  1 
ATOM   8598  N  N   . VAL E  5  809  ? 11.044  121.488 159.130 1.00 46.30  ? 809  VAL A N   1 
ATOM   8599  C  CA  . VAL E  5  809  ? 11.210  122.262 160.353 1.00 56.08  ? 809  VAL A CA  1 
ATOM   8600  C  C   . VAL E  5  809  ? 12.683  122.413 160.708 1.00 45.57  ? 809  VAL A C   1 
ATOM   8601  O  O   . VAL E  5  809  ? 13.143  123.472 161.108 1.00 63.57  ? 809  VAL A O   1 
ATOM   8602  C  CB  . VAL E  5  809  ? 10.441  121.632 161.530 1.00 46.26  ? 809  VAL A CB  1 
ATOM   8603  C  CG1 . VAL E  5  809  ? 10.745  122.338 162.808 1.00 46.13  ? 809  VAL A CG1 1 
ATOM   8604  C  CG2 . VAL E  5  809  ? 8.968   121.709 161.291 1.00 46.93  ? 809  VAL A CG2 1 
ATOM   8605  N  N   . LEU E  5  810  ? 13.430  121.344 160.516 1.00 55.17  ? 810  LEU A N   1 
ATOM   8606  C  CA  . LEU E  5  810  ? 14.833  121.322 160.857 1.00 46.84  ? 810  LEU A CA  1 
ATOM   8607  C  C   . LEU E  5  810  ? 15.628  122.310 159.998 1.00 45.44  ? 810  LEU A C   1 
ATOM   8608  O  O   . LEU E  5  810  ? 16.475  123.028 160.510 1.00 46.62  ? 810  LEU A O   1 
ATOM   8609  C  CB  . LEU E  5  810  ? 15.359  119.893 160.712 1.00 44.19  ? 810  LEU A CB  1 
ATOM   8610  C  CG  . LEU E  5  810  ? 16.659  119.569 161.450 1.00 50.87  ? 810  LEU A CG  1 
ATOM   8611  C  CD1 . LEU E  5  810  ? 16.509  119.741 162.923 1.00 43.53  ? 810  LEU A CD1 1 
ATOM   8612  C  CD2 . LEU E  5  810  ? 17.072  118.154 161.136 1.00 43.33  ? 810  LEU A CD2 1 
ATOM   8613  N  N   . SER E  5  811  ? 15.354  122.340 158.697 1.00 44.87  ? 811  SER A N   1 
ATOM   8614  C  CA  . SER E  5  811  ? 15.998  123.289 157.782 1.00 49.21  ? 811  SER A CA  1 
ATOM   8615  C  C   . SER E  5  811  ? 15.614  124.731 158.078 1.00 48.49  ? 811  SER A C   1 
ATOM   8616  O  O   . SER E  5  811  ? 16.461  125.613 158.063 1.00 52.19  ? 811  SER A O   1 
ATOM   8617  C  CB  . SER E  5  811  ? 15.620  122.974 156.333 1.00 56.50  ? 811  SER A CB  1 
ATOM   8618  O  OG  . SER E  5  811  ? 16.290  121.827 155.855 1.00 62.36  ? 811  SER A OG  1 
ATOM   8619  N  N   . VAL E  5  812  ? 14.325  124.952 158.325 1.00 52.82  ? 812  VAL A N   1 
ATOM   8620  C  CA  . VAL E  5  812  ? 13.790  126.268 158.648 1.00 49.07  ? 812  VAL A CA  1 
ATOM   8621  C  C   . VAL E  5  812  ? 14.451  126.816 159.898 1.00 48.79  ? 812  VAL A C   1 
ATOM   8622  O  O   . VAL E  5  812  ? 14.971  127.934 159.882 1.00 50.97  ? 812  VAL A O   1 
ATOM   8623  C  CB  . VAL E  5  812  ? 12.246  126.248 158.836 1.00 46.78  ? 812  VAL A CB  1 
ATOM   8624  C  CG1 . VAL E  5  812  ? 11.767  127.553 159.385 1.00 47.20  ? 812  VAL A CG1 1 
ATOM   8625  C  CG2 . VAL E  5  812  ? 11.562  125.985 157.526 1.00 47.21  ? 812  VAL A CG2 1 
ATOM   8626  N  N   . LEU E  5  813  ? 14.441  126.024 160.968 1.00 47.88  ? 813  LEU A N   1 
ATOM   8627  C  CA  . LEU E  5  813  ? 15.068  126.419 162.225 1.00 45.38  ? 813  LEU A CA  1 
ATOM   8628  C  C   . LEU E  5  813  ? 16.541  126.736 162.010 1.00 54.06  ? 813  LEU A C   1 
ATOM   8629  O  O   . LEU E  5  813  ? 17.073  127.695 162.567 1.00 57.26  ? 813  LEU A O   1 
ATOM   8630  C  CB  . LEU E  5  813  ? 14.909  125.327 163.280 1.00 45.08  ? 813  LEU A CB  1 
ATOM   8631  C  CG  . LEU E  5  813  ? 13.491  125.168 163.816 1.00 75.57  ? 813  LEU A CG  1 
ATOM   8632  C  CD1 . LEU E  5  813  ? 13.421  123.963 164.694 1.00 45.25  ? 813  LEU A CD1 1 
ATOM   8633  C  CD2 . LEU E  5  813  ? 13.045  126.407 164.576 1.00 45.93  ? 813  LEU A CD2 1 
ATOM   8634  N  N   . GLY E  5  814  ? 17.193  125.925 161.189 1.00 47.98  ? 814  GLY A N   1 
ATOM   8635  C  CA  . GLY E  5  814  ? 18.578  126.145 160.836 1.00 47.11  ? 814  GLY A CA  1 
ATOM   8636  C  C   . GLY E  5  814  ? 18.790  127.525 160.255 1.00 50.94  ? 814  GLY A C   1 
ATOM   8637  O  O   . GLY E  5  814  ? 19.703  128.224 160.683 1.00 44.67  ? 814  GLY A O   1 
ATOM   8638  N  N   . ARG E  5  815  ? 17.961  127.933 159.290 1.00 53.19  ? 815  ARG A N   1 
ATOM   8639  C  CA  . ARG E  5  815  ? 18.138  129.269 158.689 1.00 54.84  ? 815  ARG A CA  1 
ATOM   8640  C  C   . ARG E  5  815  ? 17.811  130.371 159.703 1.00 53.11  ? 815  ARG A C   1 
ATOM   8641  O  O   . ARG E  5  815  ? 18.543  131.356 159.823 1.00 48.74  ? 815  ARG A O   1 
ATOM   8642  C  CB  . ARG E  5  815  ? 17.347  129.444 157.389 1.00 54.40  ? 815  ARG A CB  1 
ATOM   8643  C  CG  . ARG E  5  815  ? 18.225  129.664 156.150 1.00 76.02  ? 815  ARG A CG  1 
ATOM   8644  C  CD  . ARG E  5  815  ? 17.483  129.343 154.829 1.00 101.43 ? 815  ARG A CD  1 
ATOM   8645  N  NE  . ARG E  5  815  ? 16.968  127.962 154.742 1.00 113.31 ? 815  ARG A NE  1 
ATOM   8646  C  CZ  . ARG E  5  815  ? 15.683  127.616 154.869 1.00 113.54 ? 815  ARG A CZ  1 
ATOM   8647  N  NH1 . ARG E  5  815  ? 14.766  128.543 155.092 1.00 116.97 ? 815  ARG A NH1 1 
ATOM   8648  N  NH2 . ARG E  5  815  ? 15.306  126.345 154.774 1.00 110.75 ? 815  ARG A NH2 1 
ATOM   8649  N  N   . LEU E  5  816  ? 16.727  130.184 160.451 1.00 46.16  ? 816  LEU A N   1 
ATOM   8650  C  CA  . LEU E  5  816  ? 16.361  131.124 161.489 1.00 46.46  ? 816  LEU A CA  1 
ATOM   8651  C  C   . LEU E  5  816  ? 17.548  131.392 162.416 1.00 51.61  ? 816  LEU A C   1 
ATOM   8652  O  O   . LEU E  5  816  ? 17.972  132.524 162.591 1.00 46.39  ? 816  LEU A O   1 
ATOM   8653  C  CB  . LEU E  5  816  ? 15.176  130.599 162.277 1.00 46.56  ? 816  LEU A CB  1 
ATOM   8654  C  CG  . LEU E  5  816  ? 14.819  131.481 163.463 1.00 54.64  ? 816  LEU A CG  1 
ATOM   8655  C  CD1 . LEU E  5  816  ? 14.365  132.847 162.934 1.00 57.66  ? 816  LEU A CD1 1 
ATOM   8656  C  CD2 . LEU E  5  816  ? 13.750  130.844 164.318 1.00 46.96  ? 816  LEU A CD2 1 
ATOM   8657  N  N   . PHE E  5  817  ? 18.119  130.344 162.983 1.00 53.21  ? 817  PHE A N   1 
ATOM   8658  C  CA  . PHE E  5  817  ? 19.233  130.542 163.901 1.00 50.47  ? 817  PHE A CA  1 
ATOM   8659  C  C   . PHE E  5  817  ? 20.476  131.087 163.207 1.00 50.32  ? 817  PHE A C   1 
ATOM   8660  O  O   . PHE E  5  817  ? 21.186  131.909 163.772 1.00 55.72  ? 817  PHE A O   1 
ATOM   8661  C  CB  . PHE E  5  817  ? 19.530  129.270 164.677 1.00 44.67  ? 817  PHE A CB  1 
ATOM   8662  C  CG  . PHE E  5  817  ? 18.406  128.831 165.562 1.00 48.11  ? 817  PHE A CG  1 
ATOM   8663  C  CD1 . PHE E  5  817  ? 17.754  129.748 166.374 1.00 45.28  ? 817  PHE A CD1 1 
ATOM   8664  C  CD2 . PHE E  5  817  ? 17.992  127.494 165.583 1.00 44.53  ? 817  PHE A CD2 1 
ATOM   8665  C  CE1 . PHE E  5  817  ? 16.698  129.351 167.177 1.00 54.31  ? 817  PHE A CE1 1 
ATOM   8666  C  CE2 . PHE E  5  817  ? 16.931  127.089 166.396 1.00 44.73  ? 817  PHE A CE2 1 
ATOM   8667  C  CZ  . PHE E  5  817  ? 16.290  128.019 167.190 1.00 45.20  ? 817  PHE A CZ  1 
ATOM   8668  N  N   . THR E  5  818  ? 20.719  130.668 161.974 1.00 45.07  ? 818  THR A N   1 
ATOM   8669  C  CA  . THR E  5  818  ? 21.848  131.208 161.225 1.00 56.43  ? 818  THR A CA  1 
ATOM   8670  C  C   . THR E  5  818  ? 21.726  132.709 161.024 1.00 52.56  ? 818  THR A C   1 
ATOM   8671  O  O   . THR E  5  818  ? 22.681  133.455 161.268 1.00 56.57  ? 818  THR A O   1 
ATOM   8672  C  CB  . THR E  5  818  ? 22.012  130.530 159.877 1.00 53.90  ? 818  THR A CB  1 
ATOM   8673  O  OG1 . THR E  5  818  ? 22.394  129.172 160.100 1.00 55.75  ? 818  THR A OG1 1 
ATOM   8674  C  CG2 . THR E  5  818  ? 23.097  131.205 159.082 1.00 45.16  ? 818  THR A CG2 1 
ATOM   8675  N  N   . ASN E  5  819  ? 20.538  133.137 160.600 1.00 51.98  ? 819  ASN A N   1 
ATOM   8676  C  CA  . ASN E  5  819  ? 20.200  134.546 160.456 1.00 46.91  ? 819  ASN A CA  1 
ATOM   8677  C  C   . ASN E  5  819  ? 20.271  135.319 161.758 1.00 65.44  ? 819  ASN A C   1 
ATOM   8678  O  O   . ASN E  5  819  ? 20.857  136.387 161.806 1.00 47.42  ? 819  ASN A O   1 
ATOM   8679  C  CB  . ASN E  5  819  ? 18.805  134.675 159.885 1.00 50.89  ? 819  ASN A CB  1 
ATOM   8680  C  CG  . ASN E  5  819  ? 18.740  134.288 158.441 1.00 49.96  ? 819  ASN A CG  1 
ATOM   8681  O  OD1 . ASN E  5  819  ? 19.734  134.376 157.718 1.00 50.38  ? 819  ASN A OD1 1 
ATOM   8682  N  ND2 . ASN E  5  819  ? 17.563  133.860 158.000 1.00 54.39  ? 819  ASN A ND2 1 
ATOM   8683  N  N   . TYR E  5  820  ? 19.661  134.781 162.805 1.00 46.86  ?