data_4C33
# 
_entry.id   4C33 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4C33         
PDBE  EBI-58136    
WWPDB D_1290058136 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4C34 unspecified 'PKA-S6K1 CHIMERA WITH STAUROSPORINE BOUND'            
PDB 4C35 unspecified 'PKA-S6K1 CHIMERA WITH COMPOUND 1 (NU1085) BOUND'      
PDB 4C36 unspecified 'PKA-S6K1 CHIMERA WITH COMPOUND 15E (CCT147581) BOUND' 
PDB 4C37 unspecified 'PKA-S6K1 CHIMERA WITH COMPOUND 21A (CCT196539) BOUND' 
PDB 4C38 unspecified 'PKA-S6K1 CHIMERA WITH COMPOUND 21E (CCT239066) BOUND' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4C33 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-21 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Couty, S.'            1  
'Westwood, I.M.'       2  
'Kalusa, A.'           3  
'Cano, C.'             4  
'Travers, J.'          5  
'Boxall, K.'           6  
'Chow, C.L.'           7  
'Burns, S.'            8  
'Schmitt, J.'          9  
'Pickard, L.'          10 
'Barillari, C.'        11 
'McAndrew, P.C.'       12 
'Clarke, P.A.'         13 
'Linardopoulos, S.'    14 
'Griffin, R.J.'        15 
'Aherne, G.W.'         16 
'Raynaud, F.I.'        17 
'Workman, P.'          18 
'Jones, K.'            19 
'van Montfort, R.L.M.' 20 
# 
_citation.id                        primary 
_citation.title                     
'The discovery of potent ribosomal S6 kinase inhibitors by high-throughput screening and structure-guided drug design.' 
_citation.journal_abbrev            Oncotarget 
_citation.journal_volume            4 
_citation.page_first                1647 
_citation.page_last                 1661 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1949-2553 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24072592 
_citation.pdbx_database_id_DOI      10.18632/oncotarget.1255 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Couty, S.'          1  ? 
primary 'Westwood, I.M.'     2  ? 
primary 'Kalusa, A.'         3  ? 
primary 'Cano, C.'           4  ? 
primary 'Travers, J.'        5  ? 
primary 'Boxall, K.'         6  ? 
primary 'Chow, C.L.'         7  ? 
primary 'Burns, S.'          8  ? 
primary 'Schmitt, J.'        9  ? 
primary 'Pickard, L.'        10 ? 
primary 'Barillari, C.'      11 ? 
primary 'McAndrew, P.C.'     12 ? 
primary 'Clarke, P.A.'       13 ? 
primary 'Linardopoulos, S.'  14 ? 
primary 'Griffin, R.J.'      15 ? 
primary 'Aherne, G.W.'       16 ? 
primary 'Raynaud, F.I.'      17 ? 
primary 'Workman, P.'        18 ? 
primary 'Jones, K.'          19 ? 
primary 'van Montfort, R.L.' 20 ? 
# 
_cell.entry_id           4C33 
_cell.length_a           71.720 
_cell.length_b           75.200 
_cell.length_c           80.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4C33 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA' 40948.664 1   2.7.11.11 YES ?               
'PKA-S6K1 CHIMERA' 
2 polymer syn 'CAMP-DEPENDENT PROTEIN KINASE INHIBITOR ALPHA'         1973.177  1   ?         ?   'RESIDUES 6-23' ? 
3 water   nat water                                                   18.015    596 ?         ?   ?               ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'PKA C-ALPHA' 
2 PKI-ALPHA     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKV
VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRF(SEP)EPHARFYAAQIVLTFE
YLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTW(TPO)LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVE
APFIPKFKGPGDTSNFDDYEEEEIRV(SEP)INEKCGKEFSEF
;
;MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSYGRVMLVKHMETGNHYAMKILDKQKV
VKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVLEYLPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS
LDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFK
GPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
;
A ? 
2 'polypeptide(L)' no no  TTYADFIASGRTGRRNAI TTYADFIASGRTGRRNAI I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ASN n 
1 4   ALA n 
1 5   ALA n 
1 6   ALA n 
1 7   ALA n 
1 8   LYS n 
1 9   LYS n 
1 10  GLY n 
1 11  SER n 
1 12  GLU n 
1 13  GLN n 
1 14  GLU n 
1 15  SER n 
1 16  VAL n 
1 17  LYS n 
1 18  GLU n 
1 19  PHE n 
1 20  LEU n 
1 21  ALA n 
1 22  LYS n 
1 23  ALA n 
1 24  LYS n 
1 25  GLU n 
1 26  ASP n 
1 27  PHE n 
1 28  LEU n 
1 29  LYS n 
1 30  LYS n 
1 31  TRP n 
1 32  GLU n 
1 33  ASN n 
1 34  PRO n 
1 35  ALA n 
1 36  GLN n 
1 37  ASN n 
1 38  THR n 
1 39  ALA n 
1 40  HIS n 
1 41  LEU n 
1 42  ASP n 
1 43  GLN n 
1 44  PHE n 
1 45  GLU n 
1 46  ARG n 
1 47  ILE n 
1 48  LYS n 
1 49  THR n 
1 50  LEU n 
1 51  GLY n 
1 52  THR n 
1 53  GLY n 
1 54  SER n 
1 55  TYR n 
1 56  GLY n 
1 57  ARG n 
1 58  VAL n 
1 59  MET n 
1 60  LEU n 
1 61  VAL n 
1 62  LYS n 
1 63  HIS n 
1 64  MET n 
1 65  GLU n 
1 66  THR n 
1 67  GLY n 
1 68  ASN n 
1 69  HIS n 
1 70  TYR n 
1 71  ALA n 
1 72  MET n 
1 73  LYS n 
1 74  ILE n 
1 75  LEU n 
1 76  ASP n 
1 77  LYS n 
1 78  GLN n 
1 79  LYS n 
1 80  VAL n 
1 81  VAL n 
1 82  LYS n 
1 83  LEU n 
1 84  LYS n 
1 85  GLN n 
1 86  ILE n 
1 87  GLU n 
1 88  HIS n 
1 89  THR n 
1 90  LEU n 
1 91  ASN n 
1 92  GLU n 
1 93  LYS n 
1 94  ARG n 
1 95  ILE n 
1 96  LEU n 
1 97  GLN n 
1 98  ALA n 
1 99  VAL n 
1 100 ASN n 
1 101 PHE n 
1 102 PRO n 
1 103 PHE n 
1 104 LEU n 
1 105 VAL n 
1 106 LYS n 
1 107 LEU n 
1 108 GLU n 
1 109 PHE n 
1 110 SER n 
1 111 PHE n 
1 112 LYS n 
1 113 ASP n 
1 114 ASN n 
1 115 SER n 
1 116 ASN n 
1 117 LEU n 
1 118 TYR n 
1 119 MET n 
1 120 VAL n 
1 121 LEU n 
1 122 GLU n 
1 123 TYR n 
1 124 LEU n 
1 125 PRO n 
1 126 GLY n 
1 127 GLY n 
1 128 GLU n 
1 129 MET n 
1 130 PHE n 
1 131 SER n 
1 132 HIS n 
1 133 LEU n 
1 134 ARG n 
1 135 ARG n 
1 136 ILE n 
1 137 GLY n 
1 138 ARG n 
1 139 PHE n 
1 140 SEP n 
1 141 GLU n 
1 142 PRO n 
1 143 HIS n 
1 144 ALA n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 ALA n 
1 149 ALA n 
1 150 GLN n 
1 151 ILE n 
1 152 VAL n 
1 153 LEU n 
1 154 THR n 
1 155 PHE n 
1 156 GLU n 
1 157 TYR n 
1 158 LEU n 
1 159 HIS n 
1 160 SER n 
1 161 LEU n 
1 162 ASP n 
1 163 LEU n 
1 164 ILE n 
1 165 TYR n 
1 166 ARG n 
1 167 ASP n 
1 168 LEU n 
1 169 LYS n 
1 170 PRO n 
1 171 GLU n 
1 172 ASN n 
1 173 LEU n 
1 174 MET n 
1 175 ILE n 
1 176 ASP n 
1 177 GLN n 
1 178 GLN n 
1 179 GLY n 
1 180 TYR n 
1 181 ILE n 
1 182 LYS n 
1 183 VAL n 
1 184 THR n 
1 185 ASP n 
1 186 PHE n 
1 187 GLY n 
1 188 PHE n 
1 189 ALA n 
1 190 LYS n 
1 191 ARG n 
1 192 VAL n 
1 193 LYS n 
1 194 GLY n 
1 195 ARG n 
1 196 THR n 
1 197 TRP n 
1 198 TPO n 
1 199 LEU n 
1 200 CYS n 
1 201 GLY n 
1 202 THR n 
1 203 PRO n 
1 204 GLU n 
1 205 TYR n 
1 206 LEU n 
1 207 ALA n 
1 208 PRO n 
1 209 GLU n 
1 210 ILE n 
1 211 ILE n 
1 212 LEU n 
1 213 SER n 
1 214 LYS n 
1 215 GLY n 
1 216 TYR n 
1 217 ASN n 
1 218 LYS n 
1 219 ALA n 
1 220 VAL n 
1 221 ASP n 
1 222 TRP n 
1 223 TRP n 
1 224 ALA n 
1 225 LEU n 
1 226 GLY n 
1 227 VAL n 
1 228 LEU n 
1 229 ILE n 
1 230 TYR n 
1 231 GLU n 
1 232 MET n 
1 233 ALA n 
1 234 ALA n 
1 235 GLY n 
1 236 TYR n 
1 237 PRO n 
1 238 PRO n 
1 239 PHE n 
1 240 PHE n 
1 241 ALA n 
1 242 ASP n 
1 243 GLN n 
1 244 PRO n 
1 245 ILE n 
1 246 GLN n 
1 247 ILE n 
1 248 TYR n 
1 249 GLU n 
1 250 LYS n 
1 251 ILE n 
1 252 VAL n 
1 253 SER n 
1 254 GLY n 
1 255 LYS n 
1 256 VAL n 
1 257 ARG n 
1 258 PHE n 
1 259 PRO n 
1 260 SER n 
1 261 HIS n 
1 262 PHE n 
1 263 SER n 
1 264 SER n 
1 265 ASP n 
1 266 LEU n 
1 267 LYS n 
1 268 ASP n 
1 269 LEU n 
1 270 LEU n 
1 271 ARG n 
1 272 ASN n 
1 273 LEU n 
1 274 LEU n 
1 275 GLN n 
1 276 VAL n 
1 277 ASP n 
1 278 LEU n 
1 279 THR n 
1 280 LYS n 
1 281 ARG n 
1 282 PHE n 
1 283 GLY n 
1 284 ASN n 
1 285 LEU n 
1 286 LYS n 
1 287 ASN n 
1 288 GLY n 
1 289 VAL n 
1 290 ASN n 
1 291 ASP n 
1 292 ILE n 
1 293 LYS n 
1 294 ASN n 
1 295 HIS n 
1 296 LYS n 
1 297 TRP n 
1 298 PHE n 
1 299 ALA n 
1 300 THR n 
1 301 THR n 
1 302 ASP n 
1 303 TRP n 
1 304 ILE n 
1 305 ALA n 
1 306 ILE n 
1 307 TYR n 
1 308 GLN n 
1 309 ARG n 
1 310 LYS n 
1 311 VAL n 
1 312 GLU n 
1 313 ALA n 
1 314 PRO n 
1 315 PHE n 
1 316 ILE n 
1 317 PRO n 
1 318 LYS n 
1 319 PHE n 
1 320 LYS n 
1 321 GLY n 
1 322 PRO n 
1 323 GLY n 
1 324 ASP n 
1 325 THR n 
1 326 SER n 
1 327 ASN n 
1 328 PHE n 
1 329 ASP n 
1 330 ASP n 
1 331 TYR n 
1 332 GLU n 
1 333 GLU n 
1 334 GLU n 
1 335 GLU n 
1 336 ILE n 
1 337 ARG n 
1 338 VAL n 
1 339 SEP n 
1 340 ILE n 
1 341 ASN n 
1 342 GLU n 
1 343 LYS n 
1 344 CYS n 
1 345 GLY n 
1 346 LYS n 
1 347 GLU n 
1 348 PHE n 
1 349 SER n 
1 350 GLU n 
1 351 PHE n 
2 1   THR n 
2 2   THR n 
2 3   TYR n 
2 4   ALA n 
2 5   ASP n 
2 6   PHE n 
2 7   ILE n 
2 8   ALA n 
2 9   SER n 
2 10  GLY n 
2 11  ARG n 
2 12  THR n 
2 13  GLY n 
2 14  ARG n 
2 15  ARG n 
2 16  ASN n 
2 17  ALA n 
2 18  ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               BOVINE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'BOS TAURUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'BOS TAURUS' 
_pdbx_entity_src_syn.organism_common_name   BOVINE 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9913 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP KAPCA_BOVIN 1 ? ? P00517 ? 
2 UNP IPKA_BOVIN  2 ? ? Q3SX13 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4C33 A 1 ? 351 ? P00517 1 ? 351 ? 0 350 
2 2 4C33 I 1 ? 18  ? Q3SX13 6 ? 23  ? 5 22  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4C33 TYR A 55  ? UNP P00517 PHE 55  'engineered mutation' 54  1 
1 4C33 LEU A 121 ? UNP P00517 MET 121 'engineered mutation' 120 2 
1 4C33 LEU A 124 ? UNP P00517 VAL 124 'engineered mutation' 123 3 
1 4C33 MET A 174 ? UNP P00517 LEU 174 'engineered mutation' 173 4 
1 4C33 LYS A 182 ? UNP P00517 GLN 182 'engineered mutation' 181 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                  'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                  'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                  'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                  'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                  'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                  'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                  'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                  'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                  'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                  'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                  'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                  'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                  'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                  'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE    ?                  'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                  'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE    PHOSPHONOSERINE    'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE           ?                  'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                  'C4 H9 N O3'     119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                  'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                  'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                  'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4C33 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_percent_sol   51.13 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;18 MG/ML PROTEIN IN 25MM MES-BIS-TRIS PH 6.5, 75MM LICL, 0.1MM EDTA, 1MM MEGA-8, 1MM DTT AND 1MM PKI PEPTIDE MIXED 1:1 WITH 8-16% AQUEOUS METHANOL
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4C33 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.01 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   39431 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         82.5 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.40 
_reflns.B_iso_Wilson_estimate        19.95 
_reflns.pdbx_redundancy              3.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.77 
_reflns_shell.percent_possible_all   50.8 
_reflns_shell.Rmerge_I_obs           0.19 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.80 
_reflns_shell.pdbx_redundancy        2.6 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4C33 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39374 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.01 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    81.56 
_refine.ls_R_factor_obs                          0.1578 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1562 
_refine.ls_R_factor_R_free                       0.1871 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.04 
_refine.ls_number_reflns_R_free                  1983 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9605 
_refine.correlation_coeff_Fo_to_Fc_free          0.9465 
_refine.B_iso_mean                               20.76 
_refine.aniso_B[1][1]                            0.3891 
_refine.aniso_B[2][2]                            -0.1125 
_refine.aniso_B[3][3]                            -0.2766 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2GFC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.106 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.102 
_refine.pdbx_overall_SU_R_Blow_DPI               0.119 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.109 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4C33 
_refine_analyze.Luzzati_coordinate_error_obs    0.174 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2894 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             596 
_refine_hist.number_atoms_total               3490 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        17.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  3014 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.94  ? 2.00  4086 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1041 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  71   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  438  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3014 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           3.13  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           15.54 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  380  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  4015 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             1678 
_refine_ls_shell.R_factor_R_work                  0.1915 
_refine_ls_shell.percent_reflns_obs               81.56 
_refine_ls_shell.R_factor_R_free                  0.1790 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.66 
_refine_ls_shell.number_reflns_R_free             82 
_refine_ls_shell.number_reflns_all                1760 
_refine_ls_shell.R_factor_all                     0.1909 
# 
_struct.entry_id                  4C33 
_struct.title                     'PKA-S6K1 Chimera Apo' 
_struct.pdbx_descriptor           
'CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT ALPHA (E.C.2.7.11.11), CAMP-DEPENDENT PROTEIN KINASE INHIBITOR ALPHA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4C33 
_struct_keywords.pdbx_keywords   TRANSFERASE/INHIBITOR 
_struct_keywords.text            'TRANSFERASE-INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 15  ? ASN A 33  ? SER A 14  ASN A 32  1 ? 19 
HELX_P HELX_P2  2  HIS A 40  ? ASP A 42  ? HIS A 39  ASP A 41  5 ? 3  
HELX_P HELX_P3  3  LYS A 77  ? LEU A 83  ? LYS A 76  LEU A 82  1 ? 7  
HELX_P HELX_P4  4  GLN A 85  ? VAL A 99  ? GLN A 84  VAL A 98  1 ? 15 
HELX_P HELX_P5  5  GLU A 128 ? GLY A 137 ? GLU A 127 GLY A 136 1 ? 10 
HELX_P HELX_P6  6  SEP A 140 ? LEU A 161 ? SEP A 139 LEU A 160 1 ? 22 
HELX_P HELX_P7  7  LYS A 169 ? GLU A 171 ? LYS A 168 GLU A 170 5 ? 3  
HELX_P HELX_P8  8  THR A 202 ? LEU A 206 ? THR A 201 LEU A 205 5 ? 5  
HELX_P HELX_P9  9  ALA A 207 ? LEU A 212 ? ALA A 206 LEU A 211 1 ? 6  
HELX_P HELX_P10 10 LYS A 218 ? GLY A 235 ? LYS A 217 GLY A 234 1 ? 18 
HELX_P HELX_P11 11 GLN A 243 ? SER A 253 ? GLN A 242 SER A 252 1 ? 11 
HELX_P HELX_P12 12 SER A 263 ? LEU A 274 ? SER A 262 LEU A 273 1 ? 12 
HELX_P HELX_P13 13 VAL A 289 ? ASN A 294 ? VAL A 288 ASN A 293 1 ? 6  
HELX_P HELX_P14 14 HIS A 295 ? ALA A 299 ? HIS A 294 ALA A 298 5 ? 5  
HELX_P HELX_P15 15 ASP A 302 ? GLN A 308 ? ASP A 301 GLN A 307 1 ? 7  
HELX_P HELX_P16 16 THR B 1   ? SER B 9   ? THR I 5   SER I 13  1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A PHE 139 C ? ? ? 1_555 A SEP 140 N ? ? A PHE 138 A SEP 139 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2 covale both ? A SEP 140 C ? ? ? 1_555 A GLU 141 N ? ? A SEP 139 A GLU 140 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale3 covale both ? A TRP 197 C ? ? ? 1_555 A TPO 198 N ? ? A TRP 196 A TPO 197 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale4 covale both ? A TPO 198 C ? ? ? 1_555 A LEU 199 N ? ? A TPO 197 A LEU 198 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale5 covale both ? A VAL 338 C ? ? ? 1_555 A SEP 339 N ? ? A VAL 337 A SEP 338 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6 covale both ? A SEP 339 C ? ? ? 1_555 A ILE 340 N ? ? A SEP 338 A ILE 339 1_555 ? ? ? ? ? ? ? 1.336 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 44  ? GLY A 53  ? PHE A 43  GLY A 52  
AA 2 GLY A 56  ? HIS A 63  ? GLY A 55  HIS A 62  
AA 3 HIS A 69  ? ASP A 76  ? HIS A 68  ASP A 75  
AA 4 ASN A 116 ? GLU A 122 ? ASN A 115 GLU A 121 
AA 5 LEU A 107 ? LYS A 112 ? LEU A 106 LYS A 111 
AB 1 LEU A 163 ? ILE A 164 ? LEU A 162 ILE A 163 
AB 2 LYS A 190 ? ARG A 191 ? LYS A 189 ARG A 190 
AC 1 LEU A 173 ? ILE A 175 ? LEU A 172 ILE A 174 
AC 2 ILE A 181 ? VAL A 183 ? ILE A 180 VAL A 182 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLY A 53  ? N GLY A 52  O GLY A 56  ? O GLY A 55  
AA 2 3 N VAL A 61  ? N VAL A 60  O TYR A 70  ? O TYR A 69  
AA 3 4 N LEU A 75  ? N LEU A 74  O LEU A 117 ? O LEU A 116 
AA 4 5 O VAL A 120 ? O VAL A 119 N GLU A 108 ? N GLU A 107 
AB 1 2 N ILE A 164 ? N ILE A 163 O LYS A 190 ? O LYS A 189 
AC 1 2 N MET A 174 ? N MET A 173 O LYS A 182 ? O LYS A 181 
# 
_database_PDB_matrix.entry_id          4C33 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4C33 
_atom_sites.fract_transf_matrix[1][1]   0.013943 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013298 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012481 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 14  ? 49.860 -7.883  92.159  1.00 45.29 ? 13   GLU A N   1 
ATOM   2    C CA  . GLU A 1 14  ? 49.078 -8.086  93.381  1.00 44.11 ? 13   GLU A CA  1 
ATOM   3    C C   . GLU A 1 14  ? 47.841 -8.964  93.117  1.00 44.28 ? 13   GLU A C   1 
ATOM   4    O O   . GLU A 1 14  ? 47.381 -9.057  91.975  1.00 43.49 ? 13   GLU A O   1 
ATOM   5    C CB  . GLU A 1 14  ? 48.690 -6.725  94.014  1.00 44.90 ? 13   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 14  ? 47.480 -6.040  93.387  1.00 52.35 ? 13   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 14  ? 47.458 -4.525  93.453  1.00 71.53 ? 13   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 14  ? 47.451 -3.973  94.577  1.00 65.55 ? 13   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 14  ? 47.436 -3.889  92.374  1.00 65.09 ? 13   GLU A OE2 1 
ATOM   10   N N   . SER A 1 15  ? 47.302 -9.592  94.180  1.00 38.43 ? 14   SER A N   1 
ATOM   11   C CA  . SER A 1 15  ? 46.102 -10.435 94.114  1.00 36.26 ? 14   SER A CA  1 
ATOM   12   C C   . SER A 1 15  ? 44.844 -9.542  93.996  1.00 36.53 ? 14   SER A C   1 
ATOM   13   O O   . SER A 1 15  ? 44.941 -8.327  94.218  1.00 33.83 ? 14   SER A O   1 
ATOM   14   C CB  . SER A 1 15  ? 45.991 -11.279 95.379  1.00 38.29 ? 14   SER A CB  1 
ATOM   15   O OG  . SER A 1 15  ? 45.804 -10.429 96.500  1.00 38.61 ? 14   SER A OG  1 
ATOM   16   N N   . VAL A 1 16  ? 43.671 -10.160 93.682  1.00 32.71 ? 15   VAL A N   1 
ATOM   17   C CA  . VAL A 1 16  ? 42.360 -9.487  93.568  1.00 31.34 ? 15   VAL A CA  1 
ATOM   18   C C   . VAL A 1 16  ? 42.036 -8.805  94.900  1.00 33.98 ? 15   VAL A C   1 
ATOM   19   O O   . VAL A 1 16  ? 41.719 -7.617  94.906  1.00 31.96 ? 15   VAL A O   1 
ATOM   20   C CB  . VAL A 1 16  ? 41.217 -10.458 93.102  1.00 35.27 ? 15   VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 16  ? 39.833 -9.820  93.232  1.00 34.10 ? 15   VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 16  ? 41.439 -10.929 91.670  1.00 35.13 ? 15   VAL A CG2 1 
ATOM   23   N N   . LYS A 1 17  ? 42.175 -9.544  96.027  1.00 32.23 ? 16   LYS A N   1 
ATOM   24   C CA  . LYS A 1 17  ? 41.921 -9.041  97.382  1.00 31.34 ? 16   LYS A CA  1 
ATOM   25   C C   . LYS A 1 17  ? 42.789 -7.838  97.739  1.00 33.06 ? 16   LYS A C   1 
ATOM   26   O O   . LYS A 1 17  ? 42.266 -6.880  98.312  1.00 31.68 ? 16   LYS A O   1 
ATOM   27   C CB  . LYS A 1 17  ? 42.090 -10.155 98.428  1.00 35.28 ? 16   LYS A CB  1 
ATOM   28   C CG  . LYS A 1 17  ? 40.865 -11.058 98.575  1.00 45.68 ? 16   LYS A CG  1 
ATOM   29   N N   . GLU A 1 18  ? 44.108 -7.884  97.410  1.00 28.33 ? 17   GLU A N   1 
ATOM   30   C CA  . GLU A 1 18  ? 45.060 -6.800  97.709  1.00 27.53 ? 17   GLU A CA  1 
ATOM   31   C C   . GLU A 1 18  ? 44.646 -5.560  96.958  1.00 28.32 ? 17   GLU A C   1 
ATOM   32   O O   . GLU A 1 18  ? 44.561 -4.479  97.547  1.00 25.48 ? 17   GLU A O   1 
ATOM   33   C CB  . GLU A 1 18  ? 46.487 -7.166  97.301  1.00 29.45 ? 17   GLU A CB  1 
ATOM   34   C CG  . GLU A 1 18  ? 47.217 -8.015  98.315  1.00 39.67 ? 17   GLU A CG  1 
ATOM   35   C CD  . GLU A 1 18  ? 48.468 -8.624  97.724  1.00 55.77 ? 17   GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 18  ? 48.361 -9.286  96.666  1.00 33.63 ? 17   GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 18  ? 49.560 -8.408  98.294  1.00 60.50 ? 17   GLU A OE2 1 
ATOM   38   N N   . PHE A 1 19  ? 44.362 -5.738  95.652  1.00 24.88 ? 18   PHE A N   1 
ATOM   39   C CA  . PHE A 1 19  ? 43.902 -4.681  94.775  1.00 24.10 ? 18   PHE A CA  1 
ATOM   40   C C   . PHE A 1 19  ? 42.613 -4.064  95.336  1.00 25.62 ? 18   PHE A C   1 
ATOM   41   O O   . PHE A 1 19  ? 42.525 -2.839  95.435  1.00 25.33 ? 18   PHE A O   1 
ATOM   42   C CB  . PHE A 1 19  ? 43.680 -5.225  93.344  1.00 26.03 ? 18   PHE A CB  1 
ATOM   43   C CG  . PHE A 1 19  ? 42.945 -4.239  92.464  1.00 28.10 ? 18   PHE A CG  1 
ATOM   44   C CD1 . PHE A 1 19  ? 43.608 -3.147  91.912  1.00 32.66 ? 18   PHE A CD1 1 
ATOM   45   C CD2 . PHE A 1 19  ? 41.577 -4.368  92.239  1.00 29.46 ? 18   PHE A CD2 1 
ATOM   46   C CE1 . PHE A 1 19  ? 42.915 -2.204  91.150  1.00 33.76 ? 18   PHE A CE1 1 
ATOM   47   C CE2 . PHE A 1 19  ? 40.886 -3.422  91.488  1.00 33.00 ? 18   PHE A CE2 1 
ATOM   48   C CZ  . PHE A 1 19  ? 41.558 -2.348  90.944  1.00 32.07 ? 18   PHE A CZ  1 
ATOM   49   N N   . LEU A 1 20  ? 41.622 -4.900  95.700  1.00 21.14 ? 19   LEU A N   1 
ATOM   50   C CA  . LEU A 1 20  ? 40.321 -4.392  96.180  1.00 20.09 ? 19   LEU A CA  1 
ATOM   51   C C   . LEU A 1 20  ? 40.397 -3.673  97.513  1.00 22.72 ? 19   LEU A C   1 
ATOM   52   O O   . LEU A 1 20  ? 39.628 -2.724  97.738  1.00 21.10 ? 19   LEU A O   1 
ATOM   53   C CB  . LEU A 1 20  ? 39.231 -5.482  96.189  1.00 19.37 ? 19   LEU A CB  1 
ATOM   54   C CG  . LEU A 1 20  ? 38.729 -5.958  94.811  1.00 23.42 ? 19   LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 20  ? 37.721 -7.094  94.962  1.00 23.84 ? 19   LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 20  ? 38.107 -4.794  93.979  1.00 22.21 ? 19   LEU A CD2 1 
ATOM   57   N N   . ALA A 1 21  ? 41.329 -4.112  98.401  1.00 19.67 ? 20   ALA A N   1 
ATOM   58   C CA  . ALA A 1 21  ? 41.529 -3.484  99.708  1.00 19.35 ? 20   ALA A CA  1 
ATOM   59   C C   . ALA A 1 21  ? 42.068 -2.088  99.514  1.00 22.91 ? 20   ALA A C   1 
ATOM   60   O O   . ALA A 1 21  ? 41.548 -1.148  100.125 1.00 22.03 ? 20   ALA A O   1 
ATOM   61   C CB  . ALA A 1 21  ? 42.494 -4.310  100.561 1.00 20.96 ? 20   ALA A CB  1 
ATOM   62   N N   . LYS A 1 22  ? 43.088 -1.932  98.632  1.00 20.68 ? 21   LYS A N   1 
ATOM   63   C CA  . LYS A 1 22  ? 43.666 -0.612  98.346  1.00 21.21 ? 21   LYS A CA  1 
ATOM   64   C C   . LYS A 1 22  ? 42.611 0.246   97.638  1.00 22.94 ? 21   LYS A C   1 
ATOM   65   O O   . LYS A 1 22  ? 42.506 1.443   97.906  1.00 21.85 ? 21   LYS A O   1 
ATOM   66   C CB  . LYS A 1 22  ? 44.920 -0.738  97.462  1.00 25.62 ? 21   LYS A CB  1 
ATOM   67   N N   . ALA A 1 23  ? 41.799 -0.386  96.761  1.00 18.76 ? 22   ALA A N   1 
ATOM   68   C CA  . ALA A 1 23  ? 40.749 0.325   96.029  1.00 17.38 ? 22   ALA A CA  1 
ATOM   69   C C   . ALA A 1 23  ? 39.718 0.931   96.999  1.00 18.87 ? 22   ALA A C   1 
ATOM   70   O O   . ALA A 1 23  ? 39.306 2.070   96.813  1.00 18.69 ? 22   ALA A O   1 
ATOM   71   C CB  . ALA A 1 23  ? 40.069 -0.611  95.039  1.00 17.49 ? 22   ALA A CB  1 
ATOM   72   N N   . LYS A 1 24  ? 39.339 0.194   98.040  1.00 16.27 ? 23   LYS A N   1 
ATOM   73   C CA  . LYS A 1 24  ? 38.354 0.677   99.021  1.00 15.46 ? 23   LYS A CA  1 
ATOM   74   C C   . LYS A 1 24  ? 38.917 1.838   99.839  1.00 20.91 ? 23   LYS A C   1 
ATOM   75   O O   . LYS A 1 24  ? 38.236 2.843   100.017 1.00 18.52 ? 23   LYS A O   1 
ATOM   76   C CB  . LYS A 1 24  ? 37.866 -0.457  99.930  1.00 18.10 ? 23   LYS A CB  1 
ATOM   77   C CG  . LYS A 1 24  ? 36.632 -0.047  100.746 1.00 29.82 ? 23   LYS A CG  1 
ATOM   78   C CD  . LYS A 1 24  ? 35.586 -1.145  100.861 1.00 35.19 ? 23   LYS A CD  1 
ATOM   79   C CE  . LYS A 1 24  ? 34.188 -0.561  100.890 1.00 34.48 ? 23   LYS A CE  1 
ATOM   80   N NZ  . LYS A 1 24  ? 33.148 -1.610  101.099 1.00 32.33 ? 23   LYS A NZ  1 
ATOM   81   N N   . GLU A 1 25  ? 40.180 1.716   100.300 1.00 19.96 ? 24   GLU A N   1 
ATOM   82   C CA  . GLU A 1 25  ? 40.857 2.784   101.044 1.00 19.43 ? 24   GLU A CA  1 
ATOM   83   C C   . GLU A 1 25  ? 40.890 4.091   100.206 1.00 22.65 ? 24   GLU A C   1 
ATOM   84   O O   . GLU A 1 25  ? 40.521 5.152   100.727 1.00 20.91 ? 24   GLU A O   1 
ATOM   85   C CB  . GLU A 1 25  ? 42.267 2.320   101.429 1.00 21.89 ? 24   GLU A CB  1 
ATOM   86   C CG  . GLU A 1 25  ? 43.100 3.386   102.120 1.00 36.03 ? 24   GLU A CG  1 
ATOM   87   C CD  . GLU A 1 25  ? 44.474 2.891   102.525 1.00 57.45 ? 24   GLU A CD  1 
ATOM   88   O OE1 . GLU A 1 25  ? 45.346 2.756   101.636 1.00 54.15 ? 24   GLU A OE1 1 
ATOM   89   O OE2 . GLU A 1 25  ? 44.670 2.619   103.731 1.00 49.70 ? 24   GLU A OE2 1 
ATOM   90   N N   . ASP A 1 26  ? 41.285 4.000   98.897  1.00 19.24 ? 25   ASP A N   1 
ATOM   91   C CA  . ASP A 1 26  ? 41.334 5.162   97.992  1.00 18.02 ? 25   ASP A CA  1 
ATOM   92   C C   . ASP A 1 26  ? 39.922 5.760   97.817  1.00 18.55 ? 25   ASP A C   1 
ATOM   93   O O   . ASP A 1 26  ? 39.752 6.984   97.914  1.00 16.72 ? 25   ASP A O   1 
ATOM   94   C CB  . ASP A 1 26  ? 41.922 4.790   96.610  1.00 19.85 ? 25   ASP A CB  1 
ATOM   95   C CG  . ASP A 1 26  ? 43.350 4.270   96.593  1.00 34.81 ? 25   ASP A CG  1 
ATOM   96   O OD1 . ASP A 1 26  ? 44.029 4.355   97.642  1.00 34.92 ? 25   ASP A OD1 1 
ATOM   97   O OD2 . ASP A 1 26  ? 43.792 3.778   95.523  1.00 39.90 ? 25   ASP A OD2 1 
ATOM   98   N N   . PHE A 1 27  ? 38.917 4.889   97.568  1.00 14.64 ? 26   PHE A N   1 
ATOM   99   C CA  . PHE A 1 27  ? 37.525 5.332   97.371  1.00 13.10 ? 26   PHE A CA  1 
ATOM   100  C C   . PHE A 1 27  ? 36.982 6.032   98.616  1.00 17.19 ? 26   PHE A C   1 
ATOM   101  O O   . PHE A 1 27  ? 36.387 7.107   98.489  1.00 15.60 ? 26   PHE A O   1 
ATOM   102  C CB  . PHE A 1 27  ? 36.607 4.127   97.015  1.00 13.77 ? 26   PHE A CB  1 
ATOM   103  C CG  . PHE A 1 27  ? 35.133 4.459   97.009  1.00 13.57 ? 26   PHE A CG  1 
ATOM   104  C CD1 . PHE A 1 27  ? 34.542 5.059   95.900  1.00 13.82 ? 26   PHE A CD1 1 
ATOM   105  C CD2 . PHE A 1 27  ? 34.332 4.193   98.128  1.00 13.84 ? 26   PHE A CD2 1 
ATOM   106  C CE1 . PHE A 1 27  ? 33.181 5.376   95.897  1.00 13.47 ? 26   PHE A CE1 1 
ATOM   107  C CE2 . PHE A 1 27  ? 32.977 4.515   98.123  1.00 15.33 ? 26   PHE A CE2 1 
ATOM   108  C CZ  . PHE A 1 27  ? 32.409 5.119   97.017  1.00 14.03 ? 26   PHE A CZ  1 
ATOM   109  N N   . LEU A 1 28  ? 37.166 5.429   99.813  1.00 15.13 ? 27   LEU A N   1 
ATOM   110  C CA  . LEU A 1 28  ? 36.615 6.032   101.040 1.00 14.90 ? 27   LEU A CA  1 
ATOM   111  C C   . LEU A 1 28  ? 37.131 7.433   101.355 1.00 19.18 ? 27   LEU A C   1 
ATOM   112  O O   . LEU A 1 28  ? 36.355 8.281   101.798 1.00 18.16 ? 27   LEU A O   1 
ATOM   113  C CB  . LEU A 1 28  ? 36.728 5.105   102.262 1.00 14.55 ? 27   LEU A CB  1 
ATOM   114  C CG  . LEU A 1 28  ? 35.889 3.811   102.199 1.00 17.56 ? 27   LEU A CG  1 
ATOM   115  C CD1 . LEU A 1 28  ? 36.145 2.948   103.416 1.00 19.26 ? 27   LEU A CD1 1 
ATOM   116  C CD2 . LEU A 1 28  ? 34.397 4.126   102.044 1.00 20.06 ? 27   LEU A CD2 1 
ATOM   117  N N   . LYS A 1 29  ? 38.425 7.674   101.126 1.00 17.62 ? 28   LYS A N   1 
ATOM   118  C CA  . LYS A 1 29  ? 39.012 9.001   101.354 1.00 18.16 ? 28   LYS A CA  1 
ATOM   119  C C   . LYS A 1 29  ? 38.270 10.049  100.519 1.00 19.64 ? 28   LYS A C   1 
ATOM   120  O O   . LYS A 1 29  ? 37.849 11.070  101.060 1.00 19.44 ? 28   LYS A O   1 
ATOM   121  C CB  . LYS A 1 29  ? 40.513 9.021   101.013 1.00 21.74 ? 28   LYS A CB  1 
ATOM   122  C CG  . LYS A 1 29  ? 41.398 8.390   102.078 1.00 36.82 ? 28   LYS A CG  1 
ATOM   123  N N   . LYS A 1 30  ? 38.016 9.733   99.240  1.00 15.71 ? 29   LYS A N   1 
ATOM   124  C CA  . LYS A 1 30  ? 37.319 10.607  98.292  1.00 14.38 ? 29   LYS A CA  1 
ATOM   125  C C   . LYS A 1 30  ? 35.832 10.713  98.560  1.00 16.91 ? 29   LYS A C   1 
ATOM   126  O O   . LYS A 1 30  ? 35.254 11.804  98.463  1.00 14.84 ? 29   LYS A O   1 
ATOM   127  C CB  . LYS A 1 30  ? 37.585 10.166  96.856  1.00 15.61 ? 29   LYS A CB  1 
ATOM   128  C CG  . LYS A 1 30  ? 39.060 10.272  96.472  1.00 24.36 ? 29   LYS A CG  1 
ATOM   129  C CD  . LYS A 1 30  ? 39.290 9.833   95.022  1.00 30.77 ? 29   LYS A CD  1 
ATOM   130  C CE  . LYS A 1 30  ? 40.644 10.286  94.533  1.00 39.27 ? 29   LYS A CE  1 
ATOM   131  N N   . TRP A 1 31  ? 35.211 9.583   98.929  1.00 13.15 ? 30   TRP A N   1 
ATOM   132  C CA  . TRP A 1 31  ? 33.785 9.520   99.281  1.00 14.52 ? 30   TRP A CA  1 
ATOM   133  C C   . TRP A 1 31  ? 33.480 10.435  100.497 1.00 16.76 ? 30   TRP A C   1 
ATOM   134  O O   . TRP A 1 31  ? 32.459 11.120  100.516 1.00 15.68 ? 30   TRP A O   1 
ATOM   135  C CB  . TRP A 1 31  ? 33.418 8.055   99.583  1.00 14.21 ? 30   TRP A CB  1 
ATOM   136  C CG  . TRP A 1 31  ? 32.048 7.875   100.158 1.00 15.44 ? 30   TRP A CG  1 
ATOM   137  C CD1 . TRP A 1 31  ? 31.726 7.706   101.471 1.00 18.43 ? 30   TRP A CD1 1 
ATOM   138  C CD2 . TRP A 1 31  ? 30.810 7.838   99.431  1.00 14.81 ? 30   TRP A CD2 1 
ATOM   139  N NE1 . TRP A 1 31  ? 30.363 7.590   101.613 1.00 17.38 ? 30   TRP A NE1 1 
ATOM   140  C CE2 . TRP A 1 31  ? 29.774 7.702   100.379 1.00 18.25 ? 30   TRP A CE2 1 
ATOM   141  C CE3 . TRP A 1 31  ? 30.473 7.980   98.076  1.00 15.35 ? 30   TRP A CE3 1 
ATOM   142  C CZ2 . TRP A 1 31  ? 28.423 7.651   100.011 1.00 17.97 ? 30   TRP A CZ2 1 
ATOM   143  C CZ3 . TRP A 1 31  ? 29.132 7.975   97.717  1.00 16.78 ? 30   TRP A CZ3 1 
ATOM   144  C CH2 . TRP A 1 31  ? 28.127 7.786   98.675  1.00 17.31 ? 30   TRP A CH2 1 
ATOM   145  N N   . GLU A 1 32  ? 34.388 10.456  101.489 1.00 15.45 ? 31   GLU A N   1 
ATOM   146  C CA  . GLU A 1 32  ? 34.233 11.240  102.728 1.00 16.73 ? 31   GLU A CA  1 
ATOM   147  C C   . GLU A 1 32  ? 34.563 12.728  102.603 1.00 21.37 ? 31   GLU A C   1 
ATOM   148  O O   . GLU A 1 32  ? 33.992 13.538  103.334 1.00 19.58 ? 31   GLU A O   1 
ATOM   149  C CB  . GLU A 1 32  ? 34.993 10.582  103.886 1.00 18.59 ? 31   GLU A CB  1 
ATOM   150  C CG  . GLU A 1 32  ? 34.341 9.288   104.371 1.00 30.13 ? 31   GLU A CG  1 
ATOM   151  C CD  . GLU A 1 32  ? 32.896 9.343   104.862 1.00 51.38 ? 31   GLU A CD  1 
ATOM   152  O OE1 . GLU A 1 32  ? 32.479 10.384  105.422 1.00 46.32 ? 31   GLU A OE1 1 
ATOM   153  O OE2 . GLU A 1 32  ? 32.190 8.320   104.720 1.00 44.46 ? 31   GLU A OE2 1 
ATOM   154  N N   . ASN A 1 33  ? 35.478 13.090  101.684 1.00 18.90 ? 32   ASN A N   1 
ATOM   155  C CA  . ASN A 1 33  ? 35.842 14.494  101.442 1.00 18.74 ? 32   ASN A CA  1 
ATOM   156  C C   . ASN A 1 33  ? 35.816 14.774  99.934  1.00 19.33 ? 32   ASN A C   1 
ATOM   157  O O   . ASN A 1 33  ? 36.869 14.833  99.285  1.00 18.83 ? 32   ASN A O   1 
ATOM   158  C CB  . ASN A 1 33  ? 37.165 14.862  102.129 1.00 23.45 ? 32   ASN A CB  1 
ATOM   159  C CG  . ASN A 1 33  ? 36.992 15.055  103.619 1.00 40.95 ? 32   ASN A CG  1 
ATOM   160  O OD1 . ASN A 1 33  ? 36.235 15.929  104.083 1.00 32.95 ? 32   ASN A OD1 1 
ATOM   161  N ND2 . ASN A 1 33  ? 37.676 14.239  104.405 1.00 30.67 ? 32   ASN A ND2 1 
ATOM   162  N N   . PRO A 1 34  ? 34.598 14.894  99.345  1.00 15.38 ? 33   PRO A N   1 
ATOM   163  C CA  . PRO A 1 34  ? 34.502 15.071  97.888  1.00 14.53 ? 33   PRO A CA  1 
ATOM   164  C C   . PRO A 1 34  ? 35.085 16.350  97.319  1.00 18.77 ? 33   PRO A C   1 
ATOM   165  O O   . PRO A 1 34  ? 35.047 17.399  97.963  1.00 18.08 ? 33   PRO A O   1 
ATOM   166  C CB  . PRO A 1 34  ? 32.994 15.003  97.616  1.00 15.79 ? 33   PRO A CB  1 
ATOM   167  C CG  . PRO A 1 34  ? 32.418 14.307  98.811  1.00 19.15 ? 33   PRO A CG  1 
ATOM   168  C CD  . PRO A 1 34  ? 33.251 14.815  99.946  1.00 15.22 ? 33   PRO A CD  1 
ATOM   169  N N   . ALA A 1 35  ? 35.593 16.229  96.088  1.00 16.60 ? 34   ALA A N   1 
ATOM   170  C CA  . ALA A 1 35  ? 36.111 17.318  95.268  1.00 16.60 ? 34   ALA A CA  1 
ATOM   171  C C   . ALA A 1 35  ? 34.883 18.121  94.804  1.00 18.80 ? 34   ALA A C   1 
ATOM   172  O O   . ALA A 1 35  ? 33.844 17.538  94.491  1.00 17.55 ? 34   ALA A O   1 
ATOM   173  C CB  . ALA A 1 35  ? 36.870 16.760  94.076  1.00 17.64 ? 34   ALA A CB  1 
ATOM   174  N N   . GLN A 1 36  ? 34.992 19.458  94.801  1.00 16.58 ? 35   GLN A N   1 
ATOM   175  C CA  . GLN A 1 36  ? 33.875 20.336  94.463  1.00 15.91 ? 35   GLN A CA  1 
ATOM   176  C C   . GLN A 1 36  ? 34.402 21.574  93.779  1.00 19.09 ? 35   GLN A C   1 
ATOM   177  O O   . GLN A 1 36  ? 35.440 22.090  94.192  1.00 18.23 ? 35   GLN A O   1 
ATOM   178  C CB  . GLN A 1 36  ? 33.177 20.727  95.787  1.00 18.04 ? 35   GLN A CB  1 
ATOM   179  C CG  . GLN A 1 36  ? 31.844 21.459  95.703  1.00 25.89 ? 35   GLN A CG  1 
ATOM   180  C CD  . GLN A 1 36  ? 31.141 21.579  97.047  1.00 30.44 ? 35   GLN A CD  1 
ATOM   181  O OE1 . GLN A 1 36  ? 31.740 21.474  98.122  1.00 25.03 ? 35   GLN A OE1 1 
ATOM   182  N NE2 . GLN A 1 36  ? 29.847 21.855  97.022  1.00 27.00 ? 35   GLN A NE2 1 
ATOM   183  N N   . ASN A 1 37  ? 33.657 22.093  92.779  1.00 15.22 ? 36   ASN A N   1 
ATOM   184  C CA  . ASN A 1 37  ? 33.961 23.355  92.097  1.00 15.03 ? 36   ASN A CA  1 
ATOM   185  C C   . ASN A 1 37  ? 35.384 23.346  91.518  1.00 18.64 ? 36   ASN A C   1 
ATOM   186  O O   . ASN A 1 37  ? 36.210 24.205  91.881  1.00 18.73 ? 36   ASN A O   1 
ATOM   187  C CB  . ASN A 1 37  ? 33.812 24.503  93.122  1.00 17.25 ? 36   ASN A CB  1 
ATOM   188  C CG  . ASN A 1 37  ? 33.805 25.873  92.520  1.00 24.86 ? 36   ASN A CG  1 
ATOM   189  O OD1 . ASN A 1 37  ? 33.197 26.095  91.478  1.00 19.62 ? 36   ASN A OD1 1 
ATOM   190  N ND2 . ASN A 1 37  ? 34.459 26.820  93.191  1.00 19.32 ? 36   ASN A ND2 1 
ATOM   191  N N   . THR A 1 38  ? 35.678 22.366  90.661  1.00 14.47 ? 37   THR A N   1 
ATOM   192  C CA  . THR A 1 38  ? 37.030 22.185  90.112  1.00 14.37 ? 37   THR A CA  1 
ATOM   193  C C   . THR A 1 38  ? 37.282 22.844  88.752  1.00 18.03 ? 37   THR A C   1 
ATOM   194  O O   . THR A 1 38  ? 38.380 22.721  88.210  1.00 18.09 ? 37   THR A O   1 
ATOM   195  C CB  . THR A 1 38  ? 37.456 20.726  90.185  1.00 19.34 ? 37   THR A CB  1 
ATOM   196  O OG1 . THR A 1 38  ? 36.572 19.962  89.365  1.00 16.69 ? 37   THR A OG1 1 
ATOM   197  C CG2 . THR A 1 38  ? 37.450 20.178  91.616  1.00 19.96 ? 37   THR A CG2 1 
ATOM   198  N N   . ALA A 1 39  ? 36.279 23.540  88.202  1.00 15.00 ? 38   ALA A N   1 
ATOM   199  C CA  . ALA A 1 39  ? 36.424 24.275  86.931  1.00 15.15 ? 38   ALA A CA  1 
ATOM   200  C C   . ALA A 1 39  ? 35.310 25.304  86.827  1.00 17.62 ? 38   ALA A C   1 
ATOM   201  O O   . ALA A 1 39  ? 34.540 25.456  87.768  1.00 16.17 ? 38   ALA A O   1 
ATOM   202  C CB  . ALA A 1 39  ? 36.401 23.326  85.731  1.00 15.53 ? 38   ALA A CB  1 
ATOM   203  N N   . HIS A 1 40  ? 35.250 26.034  85.709  1.00 14.46 ? 39   HIS A N   1 
ATOM   204  C CA  . HIS A 1 40  ? 34.200 27.015  85.461  1.00 15.09 ? 39   HIS A CA  1 
ATOM   205  C C   . HIS A 1 40  ? 33.801 26.908  83.997  1.00 16.11 ? 39   HIS A C   1 
ATOM   206  O O   . HIS A 1 40  ? 34.646 26.572  83.164  1.00 13.93 ? 39   HIS A O   1 
ATOM   207  C CB  . HIS A 1 40  ? 34.685 28.438  85.768  1.00 17.17 ? 39   HIS A CB  1 
ATOM   208  C CG  . HIS A 1 40  ? 33.594 29.470  85.693  1.00 20.96 ? 39   HIS A CG  1 
ATOM   209  N ND1 . HIS A 1 40  ? 33.146 29.969  84.475  1.00 23.04 ? 39   HIS A ND1 1 
ATOM   210  C CD2 . HIS A 1 40  ? 32.913 30.082  86.693  1.00 23.64 ? 39   HIS A CD2 1 
ATOM   211  C CE1 . HIS A 1 40  ? 32.208 30.853  84.770  1.00 23.18 ? 39   HIS A CE1 1 
ATOM   212  N NE2 . HIS A 1 40  ? 32.028 30.956  86.093  1.00 23.66 ? 39   HIS A NE2 1 
ATOM   213  N N   . LEU A 1 41  ? 32.538 27.242  83.670  1.00 12.89 ? 40   LEU A N   1 
ATOM   214  C CA  . LEU A 1 41  ? 32.059 27.157  82.282  1.00 13.91 ? 40   LEU A CA  1 
ATOM   215  C C   . LEU A 1 41  ? 32.947 27.930  81.270  1.00 16.59 ? 40   LEU A C   1 
ATOM   216  O O   . LEU A 1 41  ? 33.140 27.456  80.145  1.00 16.48 ? 40   LEU A O   1 
ATOM   217  C CB  . LEU A 1 41  ? 30.609 27.665  82.176  1.00 14.57 ? 40   LEU A CB  1 
ATOM   218  C CG  . LEU A 1 41  ? 29.852 27.414  80.852  1.00 19.97 ? 40   LEU A CG  1 
ATOM   219  C CD1 . LEU A 1 41  ? 29.761 25.905  80.494  1.00 19.78 ? 40   LEU A CD1 1 
ATOM   220  C CD2 . LEU A 1 41  ? 28.468 28.074  80.879  1.00 22.26 ? 40   LEU A CD2 1 
ATOM   221  N N   . ASP A 1 42  ? 33.512 29.079  81.686  1.00 15.65 ? 41   ASP A N   1 
ATOM   222  C CA  . ASP A 1 42  ? 34.327 29.939  80.810  1.00 15.87 ? 41   ASP A CA  1 
ATOM   223  C C   . ASP A 1 42  ? 35.694 29.353  80.431  1.00 20.37 ? 41   ASP A C   1 
ATOM   224  O O   . ASP A 1 42  ? 36.448 29.962  79.653  1.00 20.07 ? 41   ASP A O   1 
ATOM   225  C CB  . ASP A 1 42  ? 34.435 31.356  81.394  1.00 18.99 ? 41   ASP A CB  1 
ATOM   226  C CG  . ASP A 1 42  ? 35.283 31.513  82.639  1.00 35.38 ? 41   ASP A CG  1 
ATOM   227  O OD1 . ASP A 1 42  ? 35.687 30.480  83.224  1.00 35.45 ? 41   ASP A OD1 1 
ATOM   228  O OD2 . ASP A 1 42  ? 35.493 32.667  83.066  1.00 47.37 ? 41   ASP A OD2 1 
ATOM   229  N N   . GLN A 1 43  ? 36.007 28.160  80.965  1.00 16.19 ? 42   GLN A N   1 
ATOM   230  C CA  . GLN A 1 43  ? 37.270 27.466  80.646  1.00 15.97 ? 42   GLN A CA  1 
ATOM   231  C C   . GLN A 1 43  ? 37.095 26.485  79.489  1.00 18.72 ? 42   GLN A C   1 
ATOM   232  O O   . GLN A 1 43  ? 38.082 25.877  79.043  1.00 16.53 ? 42   GLN A O   1 
ATOM   233  C CB  . GLN A 1 43  ? 37.794 26.745  81.895  1.00 16.45 ? 42   GLN A CB  1 
ATOM   234  C CG  . GLN A 1 43  ? 38.142 27.757  82.985  1.00 19.87 ? 42   GLN A CG  1 
ATOM   235  C CD  . GLN A 1 43  ? 38.407 27.136  84.328  1.00 33.60 ? 42   GLN A CD  1 
ATOM   236  O OE1 . GLN A 1 43  ? 38.103 25.976  84.574  1.00 21.42 ? 42   GLN A OE1 1 
ATOM   237  N NE2 . GLN A 1 43  ? 38.987 27.907  85.235  1.00 31.72 ? 42   GLN A NE2 1 
ATOM   238  N N   . PHE A 1 44  ? 35.861 26.410  78.947  1.00 15.29 ? 43   PHE A N   1 
ATOM   239  C CA  . PHE A 1 44  ? 35.482 25.502  77.860  1.00 14.38 ? 43   PHE A CA  1 
ATOM   240  C C   . PHE A 1 44  ? 34.831 26.202  76.667  1.00 19.84 ? 43   PHE A C   1 
ATOM   241  O O   . PHE A 1 44  ? 34.168 27.227  76.822  1.00 20.41 ? 43   PHE A O   1 
ATOM   242  C CB  . PHE A 1 44  ? 34.546 24.389  78.395  1.00 14.54 ? 43   PHE A CB  1 
ATOM   243  C CG  . PHE A 1 44  ? 35.075 23.637  79.597  1.00 13.42 ? 43   PHE A CG  1 
ATOM   244  C CD1 . PHE A 1 44  ? 35.864 22.505  79.437  1.00 15.82 ? 43   PHE A CD1 1 
ATOM   245  C CD2 . PHE A 1 44  ? 34.775 24.057  80.891  1.00 13.83 ? 43   PHE A CD2 1 
ATOM   246  C CE1 . PHE A 1 44  ? 36.401 21.846  80.548  1.00 15.61 ? 43   PHE A CE1 1 
ATOM   247  C CE2 . PHE A 1 44  ? 35.315 23.401  82.002  1.00 14.97 ? 43   PHE A CE2 1 
ATOM   248  C CZ  . PHE A 1 44  ? 36.132 22.301  81.824  1.00 13.72 ? 43   PHE A CZ  1 
ATOM   249  N N   . GLU A 1 45  ? 35.047 25.653  75.481  1.00 16.68 ? 44   GLU A N   1 
ATOM   250  C CA  . GLU A 1 45  ? 34.469 26.157  74.237  1.00 17.49 ? 44   GLU A CA  1 
ATOM   251  C C   . GLU A 1 45  ? 33.463 25.104  73.841  1.00 21.55 ? 44   GLU A C   1 
ATOM   252  O O   . GLU A 1 45  ? 33.802 23.917  73.848  1.00 19.05 ? 44   GLU A O   1 
ATOM   253  C CB  . GLU A 1 45  ? 35.554 26.293  73.165  1.00 19.94 ? 44   GLU A CB  1 
ATOM   254  C CG  . GLU A 1 45  ? 35.044 26.586  71.763  1.00 31.92 ? 44   GLU A CG  1 
ATOM   255  C CD  . GLU A 1 45  ? 36.085 26.428  70.672  1.00 53.71 ? 44   GLU A CD  1 
ATOM   256  O OE1 . GLU A 1 45  ? 37.243 26.071  70.993  1.00 33.35 ? 44   GLU A OE1 1 
ATOM   257  O OE2 . GLU A 1 45  ? 35.737 26.648  69.489  1.00 54.33 ? 44   GLU A OE2 1 
ATOM   258  N N   . ARG A 1 46  ? 32.226 25.535  73.529  1.00 18.82 ? 45   ARG A N   1 
ATOM   259  C CA  . ARG A 1 46  ? 31.133 24.646  73.126  1.00 18.87 ? 45   ARG A CA  1 
ATOM   260  C C   . ARG A 1 46  ? 31.366 24.183  71.691  1.00 20.81 ? 45   ARG A C   1 
ATOM   261  O O   . ARG A 1 46  ? 31.582 25.017  70.803  1.00 20.33 ? 45   ARG A O   1 
ATOM   262  C CB  . ARG A 1 46  ? 29.802 25.404  73.238  1.00 19.97 ? 45   ARG A CB  1 
ATOM   263  C CG  . ARG A 1 46  ? 28.583 24.612  72.799  1.00 28.53 ? 45   ARG A CG  1 
ATOM   264  C CD  . ARG A 1 46  ? 27.407 25.536  72.602  1.00 29.84 ? 45   ARG A CD  1 
ATOM   265  N NE  . ARG A 1 46  ? 26.252 24.784  72.120  1.00 30.39 ? 45   ARG A NE  1 
ATOM   266  C CZ  . ARG A 1 46  ? 25.007 24.989  72.527  1.00 34.43 ? 45   ARG A CZ  1 
ATOM   267  N NH1 . ARG A 1 46  ? 24.742 25.933  73.423  1.00 21.79 ? 45   ARG A NH1 1 
ATOM   268  N NH2 . ARG A 1 46  ? 24.018 24.236  72.059  1.00 19.78 ? 45   ARG A NH2 1 
ATOM   269  N N   . ILE A 1 47  ? 31.314 22.856  71.457  1.00 16.40 ? 46   ILE A N   1 
ATOM   270  C CA  . ILE A 1 47  ? 31.509 22.301  70.118  1.00 17.09 ? 46   ILE A CA  1 
ATOM   271  C C   . ILE A 1 47  ? 30.191 21.813  69.501  1.00 21.11 ? 46   ILE A C   1 
ATOM   272  O O   . ILE A 1 47  ? 29.804 22.299  68.440  1.00 23.03 ? 46   ILE A O   1 
ATOM   273  C CB  . ILE A 1 47  ? 32.659 21.231  70.025  1.00 20.06 ? 46   ILE A CB  1 
ATOM   274  C CG1 . ILE A 1 47  ? 34.022 21.725  70.645  1.00 20.43 ? 46   ILE A CG1 1 
ATOM   275  C CG2 . ILE A 1 47  ? 32.842 20.718  68.588  1.00 20.93 ? 46   ILE A CG2 1 
ATOM   276  C CD1 . ILE A 1 47  ? 34.691 23.049  70.004  1.00 24.70 ? 46   ILE A CD1 1 
ATOM   277  N N   . LYS A 1 48  ? 29.525 20.840  70.142  1.00 16.77 ? 47   LYS A N   1 
ATOM   278  C CA  . LYS A 1 48  ? 28.303 20.231  69.605  1.00 15.62 ? 47   LYS A CA  1 
ATOM   279  C C   . LYS A 1 48  ? 27.561 19.472  70.677  1.00 18.90 ? 47   LYS A C   1 
ATOM   280  O O   . LYS A 1 48  ? 28.183 18.933  71.590  1.00 16.27 ? 47   LYS A O   1 
ATOM   281  C CB  . LYS A 1 48  ? 28.721 19.227  68.508  1.00 16.91 ? 47   LYS A CB  1 
ATOM   282  C CG  . LYS A 1 48  ? 27.631 18.805  67.535  1.00 21.82 ? 47   LYS A CG  1 
ATOM   283  C CD  . LYS A 1 48  ? 28.234 17.902  66.461  1.00 24.13 ? 47   LYS A CD  1 
ATOM   284  C CE  . LYS A 1 48  ? 27.307 17.637  65.287  1.00 23.43 ? 47   LYS A CE  1 
ATOM   285  N NZ  . LYS A 1 48  ? 26.114 16.832  65.669  1.00 20.34 ? 47   LYS A NZ  1 
ATOM   286  N N   . THR A 1 49  ? 26.230 19.362  70.534  1.00 17.22 ? 48   THR A N   1 
ATOM   287  C CA  . THR A 1 49  ? 25.421 18.568  71.458  1.00 15.80 ? 48   THR A CA  1 
ATOM   288  C C   . THR A 1 49  ? 25.502 17.105  71.028  1.00 20.65 ? 48   THR A C   1 
ATOM   289  O O   . THR A 1 49  ? 25.170 16.795  69.887  1.00 20.54 ? 48   THR A O   1 
ATOM   290  C CB  . THR A 1 49  ? 23.991 19.094  71.527  1.00 17.77 ? 48   THR A CB  1 
ATOM   291  O OG1 . THR A 1 49  ? 24.020 20.460  71.933  1.00 16.95 ? 48   THR A OG1 1 
ATOM   292  C CG2 . THR A 1 49  ? 23.133 18.291  72.488  1.00 17.71 ? 48   THR A CG2 1 
ATOM   293  N N   . LEU A 1 50  ? 25.974 16.224  71.924  1.00 17.51 ? 49   LEU A N   1 
ATOM   294  C CA  . LEU A 1 50  ? 26.129 14.798  71.636  1.00 18.52 ? 49   LEU A CA  1 
ATOM   295  C C   . LEU A 1 50  ? 24.887 13.981  72.048  1.00 24.49 ? 49   LEU A C   1 
ATOM   296  O O   . LEU A 1 50  ? 24.737 12.847  71.588  1.00 25.12 ? 49   LEU A O   1 
ATOM   297  C CB  . LEU A 1 50  ? 27.376 14.225  72.341  1.00 18.76 ? 49   LEU A CB  1 
ATOM   298  C CG  . LEU A 1 50  ? 28.744 14.887  72.067  1.00 24.80 ? 49   LEU A CG  1 
ATOM   299  C CD1 . LEU A 1 50  ? 29.728 14.537  73.154  1.00 24.86 ? 49   LEU A CD1 1 
ATOM   300  C CD2 . LEU A 1 50  ? 29.312 14.453  70.730  1.00 27.91 ? 49   LEU A CD2 1 
ATOM   301  N N   . GLY A 1 51  ? 24.057 14.530  72.937  1.00 20.63 ? 50   GLY A N   1 
ATOM   302  C CA  . GLY A 1 51  ? 22.870 13.838  73.443  1.00 19.45 ? 50   GLY A CA  1 
ATOM   303  C C   . GLY A 1 51  ? 21.954 14.736  74.242  1.00 24.27 ? 50   GLY A C   1 
ATOM   304  O O   . GLY A 1 51  ? 22.428 15.711  74.826  1.00 23.06 ? 50   GLY A O   1 
ATOM   305  N N   . THR A 1 52  ? 20.613 14.463  74.235  1.00 21.06 ? 51   THR A N   1 
ATOM   306  C CA  . THR A 1 52  ? 19.610 15.282  74.940  1.00 21.12 ? 51   THR A CA  1 
ATOM   307  C C   . THR A 1 52  ? 18.345 14.479  75.236  1.00 28.03 ? 51   THR A C   1 
ATOM   308  O O   . THR A 1 52  ? 17.798 13.847  74.326  1.00 29.19 ? 51   THR A O   1 
ATOM   309  C CB  . THR A 1 52  ? 19.237 16.559  74.150  1.00 34.16 ? 51   THR A CB  1 
ATOM   310  O OG1 . THR A 1 52  ? 20.411 17.278  73.784  1.00 43.59 ? 51   THR A OG1 1 
ATOM   311  C CG2 . THR A 1 52  ? 18.318 17.492  74.943  1.00 31.51 ? 51   THR A CG2 1 
ATOM   312  N N   . GLY A 1 53  ? 17.884 14.562  76.486  1.00 28.88 ? 52   GLY A N   1 
ATOM   313  C CA  . GLY A 1 53  ? 16.673 13.907  76.977  1.00 28.76 ? 52   GLY A CA  1 
ATOM   314  C C   . GLY A 1 53  ? 16.222 14.511  78.290  1.00 31.30 ? 52   GLY A C   1 
ATOM   315  O O   . GLY A 1 53  ? 16.797 15.505  78.733  1.00 29.51 ? 52   GLY A O   1 
ATOM   316  N N   . SER A 1 54  ? 15.218 13.905  78.959  1.00 28.35 ? 53   SER A N   1 
ATOM   317  C CA  . SER A 1 54  ? 14.741 14.458  80.235  1.00 27.98 ? 53   SER A CA  1 
ATOM   318  C C   . SER A 1 54  ? 15.821 14.507  81.334  1.00 28.62 ? 53   SER A C   1 
ATOM   319  O O   . SER A 1 54  ? 15.826 15.427  82.150  1.00 25.46 ? 53   SER A O   1 
ATOM   320  C CB  . SER A 1 54  ? 13.477 13.747  80.707  1.00 33.81 ? 53   SER A CB  1 
ATOM   321  O OG  . SER A 1 54  ? 13.712 12.360  80.857  1.00 47.00 ? 53   SER A OG  1 
ATOM   322  N N   . TYR A 1 55  ? 16.792 13.590  81.286  1.00 23.20 ? 54   TYR A N   1 
ATOM   323  C CA  . TYR A 1 55  ? 17.877 13.562  82.262  1.00 24.72 ? 54   TYR A CA  1 
ATOM   324  C C   . TYR A 1 55  ? 18.941 14.624  82.076  1.00 28.44 ? 54   TYR A C   1 
ATOM   325  O O   . TYR A 1 55  ? 19.756 14.808  82.964  1.00 29.81 ? 54   TYR A O   1 
ATOM   326  C CB  . TYR A 1 55  ? 18.433 12.142  82.482  1.00 28.00 ? 54   TYR A CB  1 
ATOM   327  C CG  . TYR A 1 55  ? 17.409 11.228  83.117  1.00 31.23 ? 54   TYR A CG  1 
ATOM   328  C CD1 . TYR A 1 55  ? 17.297 11.128  84.503  1.00 33.93 ? 54   TYR A CD1 1 
ATOM   329  C CD2 . TYR A 1 55  ? 16.525 10.490  82.336  1.00 32.45 ? 54   TYR A CD2 1 
ATOM   330  C CE1 . TYR A 1 55  ? 16.319 10.325  85.092  1.00 35.37 ? 54   TYR A CE1 1 
ATOM   331  C CE2 . TYR A 1 55  ? 15.549 9.684   82.912  1.00 31.67 ? 54   TYR A CE2 1 
ATOM   332  C CZ  . TYR A 1 55  ? 15.448 9.604   84.290  1.00 41.11 ? 54   TYR A CZ  1 
ATOM   333  O OH  . TYR A 1 55  ? 14.490 8.796   84.847  1.00 43.87 ? 54   TYR A OH  1 
ATOM   334  N N   . GLY A 1 56  ? 18.878 15.367  80.973  1.00 22.53 ? 55   GLY A N   1 
ATOM   335  C CA  . GLY A 1 56  ? 19.798 16.465  80.688  1.00 21.74 ? 55   GLY A CA  1 
ATOM   336  C C   . GLY A 1 56  ? 20.430 16.356  79.318  1.00 24.78 ? 55   GLY A C   1 
ATOM   337  O O   . GLY A 1 56  ? 19.954 15.581  78.482  1.00 24.87 ? 55   GLY A O   1 
ATOM   338  N N   . ARG A 1 57  ? 21.498 17.127  79.081  1.00 17.83 ? 56   ARG A N   1 
ATOM   339  C CA  . ARG A 1 57  ? 22.223 17.138  77.787  1.00 17.37 ? 56   ARG A CA  1 
ATOM   340  C C   . ARG A 1 57  ? 23.657 16.707  77.989  1.00 18.37 ? 56   ARG A C   1 
ATOM   341  O O   . ARG A 1 57  ? 24.184 16.872  79.092  1.00 14.92 ? 56   ARG A O   1 
ATOM   342  C CB  . ARG A 1 57  ? 22.312 18.570  77.261  1.00 18.24 ? 56   ARG A CB  1 
ATOM   343  C CG  . ARG A 1 57  ? 21.008 19.207  76.886  1.00 27.90 ? 56   ARG A CG  1 
ATOM   344  C CD  . ARG A 1 57  ? 21.303 20.572  76.361  1.00 28.51 ? 56   ARG A CD  1 
ATOM   345  N NE  . ARG A 1 57  ? 21.281 21.577  77.423  1.00 21.73 ? 56   ARG A NE  1 
ATOM   346  C CZ  . ARG A 1 57  ? 21.463 22.869  77.210  1.00 29.98 ? 56   ARG A CZ  1 
ATOM   347  N NH1 . ARG A 1 57  ? 21.748 23.314  75.992  1.00 25.87 ? 56   ARG A NH1 1 
ATOM   348  N NH2 . ARG A 1 57  ? 21.342 23.733  78.207  1.00 18.89 ? 56   ARG A NH2 1 
ATOM   349  N N   . VAL A 1 58  ? 24.321 16.232  76.905  1.00 15.14 ? 57   VAL A N   1 
ATOM   350  C CA  . VAL A 1 58  ? 25.754 15.939  76.897  1.00 15.08 ? 57   VAL A CA  1 
ATOM   351  C C   . VAL A 1 58  ? 26.314 16.758  75.723  1.00 16.56 ? 57   VAL A C   1 
ATOM   352  O O   . VAL A 1 58  ? 25.801 16.682  74.612  1.00 15.40 ? 57   VAL A O   1 
ATOM   353  C CB  . VAL A 1 58  ? 26.124 14.427  76.824  1.00 19.25 ? 57   VAL A CB  1 
ATOM   354  C CG1 . VAL A 1 58  ? 27.644 14.246  76.779  1.00 19.31 ? 57   VAL A CG1 1 
ATOM   355  C CG2 . VAL A 1 58  ? 25.548 13.661  78.016  1.00 19.60 ? 57   VAL A CG2 1 
ATOM   356  N N   . MET A 1 59  ? 27.319 17.602  76.005  1.00 13.56 ? 58   MET A N   1 
ATOM   357  C CA  . MET A 1 59  ? 27.899 18.521  75.055  1.00 16.99 ? 58   MET A CA  1 
ATOM   358  C C   . MET A 1 59  ? 29.391 18.229  74.849  1.00 17.77 ? 58   MET A C   1 
ATOM   359  O O   . MET A 1 59  ? 30.139 18.144  75.831  1.00 16.61 ? 58   MET A O   1 
ATOM   360  C CB  . MET A 1 59  ? 27.760 19.935  75.659  1.00 22.21 ? 58   MET A CB  1 
ATOM   361  C CG  . MET A 1 59  ? 28.127 21.046  74.721  1.00 30.17 ? 58   MET A CG  1 
ATOM   362  S SD  . MET A 1 59  ? 26.730 21.422  73.652  1.00 38.80 ? 58   MET A SD  1 
ATOM   363  C CE  . MET A 1 59  ? 25.673 22.302  74.826  1.00 35.55 ? 58   MET A CE  1 
ATOM   364  N N   . LEU A 1 60  ? 29.826 18.151  73.588  1.00 12.57 ? 59   LEU A N   1 
ATOM   365  C CA  . LEU A 1 60  ? 31.259 18.044  73.307  1.00 11.87 ? 59   LEU A CA  1 
ATOM   366  C C   . LEU A 1 60  ? 31.829 19.452  73.549  1.00 14.63 ? 59   LEU A C   1 
ATOM   367  O O   . LEU A 1 60  ? 31.310 20.430  73.021  1.00 13.49 ? 59   LEU A O   1 
ATOM   368  C CB  . LEU A 1 60  ? 31.559 17.633  71.847  1.00 12.12 ? 59   LEU A CB  1 
ATOM   369  C CG  . LEU A 1 60  ? 33.054 17.653  71.472  1.00 15.91 ? 59   LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 60  ? 33.869 16.656  72.330  1.00 15.79 ? 59   LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 60  ? 33.263 17.374  70.007  1.00 18.60 ? 59   LEU A CD2 1 
ATOM   372  N N   . VAL A 1 61  ? 32.852 19.546  74.386  1.00 12.20 ? 60   VAL A N   1 
ATOM   373  C CA  . VAL A 1 61  ? 33.517 20.814  74.671  1.00 12.12 ? 60   VAL A CA  1 
ATOM   374  C C   . VAL A 1 61  ? 35.015 20.641  74.470  1.00 16.15 ? 60   VAL A C   1 
ATOM   375  O O   . VAL A 1 61  ? 35.524 19.514  74.524  1.00 13.61 ? 60   VAL A O   1 
ATOM   376  C CB  . VAL A 1 61  ? 33.205 21.364  76.086  1.00 15.93 ? 60   VAL A CB  1 
ATOM   377  C CG1 . VAL A 1 61  ? 31.714 21.641  76.263  1.00 15.07 ? 60   VAL A CG1 1 
ATOM   378  C CG2 . VAL A 1 61  ? 33.765 20.459  77.199  1.00 15.87 ? 60   VAL A CG2 1 
ATOM   379  N N   . LYS A 1 62  ? 35.718 21.773  74.299  1.00 14.25 ? 61   LYS A N   1 
ATOM   380  C CA  . LYS A 1 62  ? 37.161 21.808  74.219  1.00 13.35 ? 61   LYS A CA  1 
ATOM   381  C C   . LYS A 1 62  ? 37.646 22.681  75.362  1.00 17.24 ? 61   LYS A C   1 
ATOM   382  O O   . LYS A 1 62  ? 37.188 23.817  75.524  1.00 15.77 ? 61   LYS A O   1 
ATOM   383  C CB  . LYS A 1 62  ? 37.637 22.352  72.862  1.00 16.28 ? 61   LYS A CB  1 
ATOM   384  C CG  . LYS A 1 62  ? 39.117 22.138  72.606  1.00 25.01 ? 61   LYS A CG  1 
ATOM   385  C CD  . LYS A 1 62  ? 39.418 22.352  71.136  1.00 27.48 ? 61   LYS A CD  1 
ATOM   386  C CE  . LYS A 1 62  ? 40.862 22.082  70.828  1.00 33.15 ? 61   LYS A CE  1 
ATOM   387  N NZ  . LYS A 1 62  ? 41.206 22.415  69.414  1.00 30.82 ? 61   LYS A NZ  1 
ATOM   388  N N   . HIS A 1 63  ? 38.544 22.135  76.169  1.00 13.59 ? 62   HIS A N   1 
ATOM   389  C CA  . HIS A 1 63  ? 39.173 22.840  77.297  1.00 14.41 ? 62   HIS A CA  1 
ATOM   390  C C   . HIS A 1 63  ? 40.328 23.701  76.718  1.00 20.03 ? 62   HIS A C   1 
ATOM   391  O O   . HIS A 1 63  ? 41.313 23.143  76.255  1.00 20.59 ? 62   HIS A O   1 
ATOM   392  C CB  . HIS A 1 63  ? 39.697 21.780  78.273  1.00 15.47 ? 62   HIS A CB  1 
ATOM   393  C CG  . HIS A 1 63  ? 40.238 22.284  79.571  1.00 19.23 ? 62   HIS A CG  1 
ATOM   394  N ND1 . HIS A 1 63  ? 41.539 22.022  79.946  1.00 22.72 ? 62   HIS A ND1 1 
ATOM   395  C CD2 . HIS A 1 63  ? 39.619 22.952  80.574  1.00 20.31 ? 62   HIS A CD2 1 
ATOM   396  C CE1 . HIS A 1 63  ? 41.688 22.576  81.146  1.00 21.96 ? 62   HIS A CE1 1 
ATOM   397  N NE2 . HIS A 1 63  ? 40.550 23.125  81.573  1.00 20.96 ? 62   HIS A NE2 1 
ATOM   398  N N   . MET A 1 64  ? 40.212 25.042  76.732  1.00 19.62 ? 63   MET A N   1 
ATOM   399  C CA  . MET A 1 64  ? 41.262 25.904  76.143  1.00 21.67 ? 63   MET A CA  1 
ATOM   400  C C   . MET A 1 64  ? 42.698 25.736  76.674  1.00 27.29 ? 63   MET A C   1 
ATOM   401  O O   . MET A 1 64  ? 43.632 25.720  75.871  1.00 26.67 ? 63   MET A O   1 
ATOM   402  C CB  . MET A 1 64  ? 40.876 27.379  76.182  1.00 25.54 ? 63   MET A CB  1 
ATOM   403  C CG  . MET A 1 64  ? 39.861 27.751  75.151  1.00 29.31 ? 63   MET A CG  1 
ATOM   404  S SD  . MET A 1 64  ? 38.235 27.446  75.820  1.00 32.95 ? 63   MET A SD  1 
ATOM   405  C CE  . MET A 1 64  ? 37.979 28.974  76.789  1.00 29.69 ? 63   MET A CE  1 
ATOM   406  N N   . GLU A 1 65  ? 42.882 25.624  78.006  1.00 24.38 ? 64   GLU A N   1 
ATOM   407  C CA  . GLU A 1 65  ? 44.218 25.523  78.636  1.00 25.40 ? 64   GLU A CA  1 
ATOM   408  C C   . GLU A 1 65  ? 45.039 24.294  78.188  1.00 26.78 ? 64   GLU A C   1 
ATOM   409  O O   . GLU A 1 65  ? 46.271 24.308  78.276  1.00 27.63 ? 64   GLU A O   1 
ATOM   410  C CB  . GLU A 1 65  ? 44.091 25.521  80.171  1.00 27.27 ? 64   GLU A CB  1 
ATOM   411  C CG  . GLU A 1 65  ? 45.324 26.052  80.889  1.00 39.55 ? 64   GLU A CG  1 
ATOM   412  N N   . THR A 1 66  ? 44.361 23.232  77.767  1.00 21.10 ? 65   THR A N   1 
ATOM   413  C CA  . THR A 1 66  ? 45.020 21.991  77.363  1.00 20.63 ? 65   THR A CA  1 
ATOM   414  C C   . THR A 1 66  ? 44.787 21.609  75.890  1.00 21.61 ? 65   THR A C   1 
ATOM   415  O O   . THR A 1 66  ? 45.588 20.875  75.321  1.00 21.74 ? 65   THR A O   1 
ATOM   416  C CB  . THR A 1 66  ? 44.590 20.823  78.275  1.00 26.48 ? 65   THR A CB  1 
ATOM   417  O OG1 . THR A 1 66  ? 43.177 20.613  78.169  1.00 22.92 ? 65   THR A OG1 1 
ATOM   418  C CG2 . THR A 1 66  ? 45.005 21.018  79.743  1.00 28.61 ? 65   THR A CG2 1 
ATOM   419  N N   . GLY A 1 67  ? 43.671 22.046  75.319  1.00 16.35 ? 66   GLY A N   1 
ATOM   420  C CA  . GLY A 1 67  ? 43.256 21.619  73.984  1.00 15.43 ? 66   GLY A CA  1 
ATOM   421  C C   . GLY A 1 67  ? 42.555 20.262  74.056  1.00 17.00 ? 66   GLY A C   1 
ATOM   422  O O   . GLY A 1 67  ? 42.219 19.685  73.022  1.00 16.04 ? 66   GLY A O   1 
ATOM   423  N N   . ASN A 1 68  ? 42.330 19.718  75.271  1.00 15.30 ? 67   ASN A N   1 
ATOM   424  C CA  . ASN A 1 68  ? 41.654 18.422  75.391  1.00 14.34 ? 67   ASN A CA  1 
ATOM   425  C C   . ASN A 1 68  ? 40.171 18.565  75.069  1.00 15.21 ? 67   ASN A C   1 
ATOM   426  O O   . ASN A 1 68  ? 39.563 19.590  75.409  1.00 16.01 ? 67   ASN A O   1 
ATOM   427  C CB  . ASN A 1 68  ? 41.756 17.875  76.820  1.00 15.33 ? 67   ASN A CB  1 
ATOM   428  C CG  . ASN A 1 68  ? 43.100 17.323  77.217  1.00 34.99 ? 67   ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 68  ? 43.777 16.645  76.441  1.00 34.80 ? 67   ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 68  ? 43.454 17.507  78.481  1.00 20.94 ? 67   ASN A ND2 1 
ATOM   431  N N   . HIS A 1 69  ? 39.573 17.505  74.509  1.00 11.70 ? 68   HIS A N   1 
ATOM   432  C CA  . HIS A 1 69  ? 38.136 17.441  74.306  1.00 11.35 ? 68   HIS A CA  1 
ATOM   433  C C   . HIS A 1 69  ? 37.523 16.667  75.468  1.00 15.07 ? 68   HIS A C   1 
ATOM   434  O O   . HIS A 1 69  ? 38.126 15.704  75.956  1.00 15.12 ? 68   HIS A O   1 
ATOM   435  C CB  . HIS A 1 69  ? 37.775 16.747  72.989  1.00 11.37 ? 68   HIS A CB  1 
ATOM   436  C CG  . HIS A 1 69  ? 37.947 17.609  71.795  1.00 14.10 ? 68   HIS A CG  1 
ATOM   437  N ND1 . HIS A 1 69  ? 39.136 17.628  71.088  1.00 15.98 ? 68   HIS A ND1 1 
ATOM   438  C CD2 . HIS A 1 69  ? 37.089 18.498  71.237  1.00 15.91 ? 68   HIS A CD2 1 
ATOM   439  C CE1 . HIS A 1 69  ? 38.962 18.507  70.112  1.00 16.43 ? 68   HIS A CE1 1 
ATOM   440  N NE2 . HIS A 1 69  ? 37.741 19.044  70.145  1.00 16.13 ? 68   HIS A NE2 1 
ATOM   441  N N   . TYR A 1 70  ? 36.322 17.053  75.877  1.00 10.04 ? 69   TYR A N   1 
ATOM   442  C CA  . TYR A 1 70  ? 35.596 16.374  76.954  1.00 10.00 ? 69   TYR A CA  1 
ATOM   443  C C   . TYR A 1 70  ? 34.101 16.320  76.628  1.00 11.86 ? 69   TYR A C   1 
ATOM   444  O O   . TYR A 1 70  ? 33.637 17.109  75.809  1.00 10.86 ? 69   TYR A O   1 
ATOM   445  C CB  . TYR A 1 70  ? 35.748 17.144  78.269  1.00 11.05 ? 69   TYR A CB  1 
ATOM   446  C CG  . TYR A 1 70  ? 37.162 17.220  78.795  1.00 13.76 ? 69   TYR A CG  1 
ATOM   447  C CD1 . TYR A 1 70  ? 37.804 16.089  79.294  1.00 16.73 ? 69   TYR A CD1 1 
ATOM   448  C CD2 . TYR A 1 70  ? 37.857 18.426  78.805  1.00 14.64 ? 69   TYR A CD2 1 
ATOM   449  C CE1 . TYR A 1 70  ? 39.099 16.163  79.809  1.00 18.05 ? 69   TYR A CE1 1 
ATOM   450  C CE2 . TYR A 1 70  ? 39.150 18.513  79.319  1.00 14.29 ? 69   TYR A CE2 1 
ATOM   451  C CZ  . TYR A 1 70  ? 39.771 17.375  79.805  1.00 18.52 ? 69   TYR A CZ  1 
ATOM   452  O OH  . TYR A 1 70  ? 41.037 17.462  80.302  1.00 20.17 ? 69   TYR A OH  1 
ATOM   453  N N   . ALA A 1 71  ? 33.359 15.415  77.296  1.00 9.59  ? 70   ALA A N   1 
ATOM   454  C CA  . ALA A 1 71  ? 31.911 15.308  77.135  1.00 10.97 ? 70   ALA A CA  1 
ATOM   455  C C   . ALA A 1 71  ? 31.354 15.948  78.395  1.00 14.28 ? 70   ALA A C   1 
ATOM   456  O O   . ALA A 1 71  ? 31.592 15.436  79.498  1.00 13.39 ? 70   ALA A O   1 
ATOM   457  C CB  . ALA A 1 71  ? 31.470 13.837  77.057  1.00 11.56 ? 70   ALA A CB  1 
ATOM   458  N N   . MET A 1 72  ? 30.704 17.099  78.250  1.00 11.37 ? 71   MET A N   1 
ATOM   459  C CA  . MET A 1 72  ? 30.166 17.840  79.403  1.00 10.50 ? 71   MET A CA  1 
ATOM   460  C C   . MET A 1 72  ? 28.690 17.540  79.596  1.00 12.31 ? 71   MET A C   1 
ATOM   461  O O   . MET A 1 72  ? 27.873 17.945  78.775  1.00 11.78 ? 71   MET A O   1 
ATOM   462  C CB  . MET A 1 72  ? 30.385 19.351  79.215  1.00 12.82 ? 71   MET A CB  1 
ATOM   463  C CG  . MET A 1 72  ? 29.929 20.189  80.419  1.00 17.57 ? 71   MET A CG  1 
ATOM   464  S SD  . MET A 1 72  ? 30.326 21.955  80.199  1.00 22.62 ? 71   MET A SD  1 
ATOM   465  C CE  . MET A 1 72  ? 29.281 22.364  79.096  1.00 18.80 ? 71   MET A CE  1 
ATOM   466  N N   . LYS A 1 73  ? 28.344 16.863  80.701  1.00 12.01 ? 72   LYS A N   1 
ATOM   467  C CA  . LYS A 1 73  ? 26.945 16.573  81.044  1.00 12.46 ? 72   LYS A CA  1 
ATOM   468  C C   . LYS A 1 73  ? 26.395 17.845  81.707  1.00 15.60 ? 72   LYS A C   1 
ATOM   469  O O   . LYS A 1 73  ? 27.022 18.354  82.644  1.00 15.36 ? 72   LYS A O   1 
ATOM   470  C CB  . LYS A 1 73  ? 26.915 15.349  81.990  1.00 15.92 ? 72   LYS A CB  1 
ATOM   471  C CG  . LYS A 1 73  ? 25.536 14.865  82.397  1.00 26.30 ? 72   LYS A CG  1 
ATOM   472  C CD  . LYS A 1 73  ? 25.575 13.371  82.791  1.00 27.03 ? 72   LYS A CD  1 
ATOM   473  C CE  . LYS A 1 73  ? 24.219 12.957  83.299  1.00 25.36 ? 72   LYS A CE  1 
ATOM   474  N NZ  . LYS A 1 73  ? 24.182 11.534  83.713  1.00 24.63 ? 72   LYS A NZ  1 
ATOM   475  N N   . ILE A 1 74  ? 25.316 18.413  81.153  1.00 12.09 ? 73   ILE A N   1 
ATOM   476  C CA  . ILE A 1 74  ? 24.664 19.637  81.651  1.00 12.42 ? 73   ILE A CA  1 
ATOM   477  C C   . ILE A 1 74  ? 23.268 19.291  82.171  1.00 15.40 ? 73   ILE A C   1 
ATOM   478  O O   . ILE A 1 74  ? 22.416 18.841  81.387  1.00 14.06 ? 73   ILE A O   1 
ATOM   479  C CB  . ILE A 1 74  ? 24.552 20.775  80.607  1.00 15.92 ? 73   ILE A CB  1 
ATOM   480  C CG1 . ILE A 1 74  ? 25.907 21.062  79.922  1.00 15.98 ? 73   ILE A CG1 1 
ATOM   481  C CG2 . ILE A 1 74  ? 23.971 22.052  81.270  1.00 17.51 ? 73   ILE A CG2 1 
ATOM   482  C CD1 . ILE A 1 74  ? 25.727 21.915  78.595  1.00 18.30 ? 73   ILE A CD1 1 
ATOM   483  N N   . LEU A 1 75  ? 23.025 19.583  83.456  1.00 12.89 ? 74   LEU A N   1 
ATOM   484  C CA  . LEU A 1 75  ? 21.749 19.323  84.106  1.00 11.56 ? 74   LEU A CA  1 
ATOM   485  C C   . LEU A 1 75  ? 21.141 20.622  84.528  1.00 14.47 ? 74   LEU A C   1 
ATOM   486  O O   . LEU A 1 75  ? 21.820 21.448  85.135  1.00 13.79 ? 74   LEU A O   1 
ATOM   487  C CB  . LEU A 1 75  ? 21.884 18.412  85.359  1.00 11.98 ? 74   LEU A CB  1 
ATOM   488  C CG  . LEU A 1 75  ? 22.529 17.036  85.179  1.00 17.14 ? 74   LEU A CG  1 
ATOM   489  C CD1 . LEU A 1 75  ? 22.376 16.203  86.429  1.00 16.59 ? 74   LEU A CD1 1 
ATOM   490  C CD2 . LEU A 1 75  ? 21.893 16.281  84.107  1.00 24.81 ? 74   LEU A CD2 1 
ATOM   491  N N   . ASP A 1 76  ? 19.868 20.807  84.200  1.00 10.42 ? 75   ASP A N   1 
ATOM   492  C CA  . ASP A 1 76  ? 19.124 21.983  84.634  1.00 9.33  ? 75   ASP A CA  1 
ATOM   493  C C   . ASP A 1 76  ? 18.575 21.662  86.048  1.00 12.08 ? 75   ASP A C   1 
ATOM   494  O O   . ASP A 1 76  ? 17.736 20.774  86.223  1.00 12.19 ? 75   ASP A O   1 
ATOM   495  C CB  . ASP A 1 76  ? 17.982 22.317  83.630  1.00 11.06 ? 75   ASP A CB  1 
ATOM   496  C CG  . ASP A 1 76  ? 17.096 23.484  84.024  1.00 16.97 ? 75   ASP A CG  1 
ATOM   497  O OD1 . ASP A 1 76  ? 16.850 23.666  85.221  1.00 16.50 ? 75   ASP A OD1 1 
ATOM   498  O OD2 . ASP A 1 76  ? 16.571 24.156  83.127  1.00 20.29 ? 75   ASP A OD2 1 
ATOM   499  N N   . LYS A 1 77  ? 19.064 22.383  87.053  1.00 11.42 ? 76   LYS A N   1 
ATOM   500  C CA  . LYS A 1 77  ? 18.699 22.204  88.464  1.00 10.95 ? 76   LYS A CA  1 
ATOM   501  C C   . LYS A 1 77  ? 17.189 22.087  88.661  1.00 13.74 ? 76   LYS A C   1 
ATOM   502  O O   . LYS A 1 77  ? 16.725 21.154  89.331  1.00 13.23 ? 76   LYS A O   1 
ATOM   503  C CB  . LYS A 1 77  ? 19.230 23.382  89.308  1.00 12.26 ? 76   LYS A CB  1 
ATOM   504  C CG  . LYS A 1 77  ? 20.713 23.378  89.560  1.00 15.57 ? 76   LYS A CG  1 
ATOM   505  C CD  . LYS A 1 77  ? 20.965 24.472  90.567  1.00 17.64 ? 76   LYS A CD  1 
ATOM   506  C CE  . LYS A 1 77  ? 22.327 25.083  90.492  1.00 20.71 ? 76   LYS A CE  1 
ATOM   507  N NZ  . LYS A 1 77  ? 22.397 26.306  91.336  1.00 13.45 ? 76   LYS A NZ  1 
ATOM   508  N N   . GLN A 1 78  ? 16.420 23.008  88.047  1.00 12.29 ? 77   GLN A N   1 
ATOM   509  C CA  . GLN A 1 78  ? 14.946 23.008  88.202  1.00 11.86 ? 77   GLN A CA  1 
ATOM   510  C C   . GLN A 1 78  ? 14.297 21.765  87.605  1.00 14.74 ? 77   GLN A C   1 
ATOM   511  O O   . GLN A 1 78  ? 13.316 21.257  88.159  1.00 13.69 ? 77   GLN A O   1 
ATOM   512  C CB  . GLN A 1 78  ? 14.349 24.296  87.604  1.00 12.90 ? 77   GLN A CB  1 
ATOM   513  C CG  . GLN A 1 78  ? 14.797 25.530  88.382  1.00 12.86 ? 77   GLN A CG  1 
ATOM   514  C CD  . GLN A 1 78  ? 14.241 26.827  87.800  1.00 20.12 ? 77   GLN A CD  1 
ATOM   515  O OE1 . GLN A 1 78  ? 14.125 27.003  86.577  1.00 21.68 ? 77   GLN A OE1 1 
ATOM   516  N NE2 . GLN A 1 78  ? 13.893 27.752  88.673  1.00 19.75 ? 77   GLN A NE2 1 
ATOM   517  N N   . LYS A 1 79  ? 14.860 21.255  86.501  1.00 13.07 ? 78   LYS A N   1 
ATOM   518  C CA  . LYS A 1 79  ? 14.340 20.053  85.842  1.00 12.00 ? 78   LYS A CA  1 
ATOM   519  C C   . LYS A 1 79  ? 14.660 18.830  86.679  1.00 14.40 ? 78   LYS A C   1 
ATOM   520  O O   . LYS A 1 79  ? 13.793 17.955  86.840  1.00 13.43 ? 78   LYS A O   1 
ATOM   521  C CB  . LYS A 1 79  ? 14.860 19.931  84.407  1.00 11.57 ? 78   LYS A CB  1 
ATOM   522  C CG  . LYS A 1 79  ? 14.290 21.034  83.507  1.00 17.82 ? 78   LYS A CG  1 
ATOM   523  C CD  . LYS A 1 79  ? 14.608 20.779  82.035  1.00 21.19 ? 78   LYS A CD  1 
ATOM   524  C CE  . LYS A 1 79  ? 14.055 21.914  81.199  1.00 24.83 ? 78   LYS A CE  1 
ATOM   525  N NZ  . LYS A 1 79  ? 14.222 21.664  79.747  1.00 32.57 ? 78   LYS A NZ  1 
ATOM   526  N N   . VAL A 1 80  ? 15.855 18.812  87.292  1.00 11.53 ? 79   VAL A N   1 
ATOM   527  C CA  . VAL A 1 80  ? 16.274 17.720  88.217  1.00 10.19 ? 79   VAL A CA  1 
ATOM   528  C C   . VAL A 1 80  ? 15.278 17.652  89.395  1.00 14.74 ? 79   VAL A C   1 
ATOM   529  O O   . VAL A 1 80  ? 14.852 16.555  89.770  1.00 13.91 ? 79   VAL A O   1 
ATOM   530  C CB  . VAL A 1 80  ? 17.746 17.904  88.684  1.00 12.13 ? 79   VAL A CB  1 
ATOM   531  C CG1 . VAL A 1 80  ? 18.131 16.952  89.818  1.00 11.57 ? 79   VAL A CG1 1 
ATOM   532  C CG2 . VAL A 1 80  ? 18.719 17.726  87.508  1.00 11.89 ? 79   VAL A CG2 1 
ATOM   533  N N   . VAL A 1 81  ? 14.876 18.816  89.941  1.00 11.24 ? 80   VAL A N   1 
ATOM   534  C CA  . VAL A 1 81  ? 13.931 18.887  91.072  1.00 11.67 ? 80   VAL A CA  1 
ATOM   535  C C   . VAL A 1 81  ? 12.557 18.289  90.642  1.00 16.00 ? 80   VAL A C   1 
ATOM   536  O O   . VAL A 1 81  ? 11.991 17.425  91.338  1.00 13.99 ? 80   VAL A O   1 
ATOM   537  C CB  . VAL A 1 81  ? 13.846 20.350  91.621  1.00 15.10 ? 80   VAL A CB  1 
ATOM   538  C CG1 . VAL A 1 81  ? 12.723 20.523  92.646  1.00 16.04 ? 80   VAL A CG1 1 
ATOM   539  C CG2 . VAL A 1 81  ? 15.186 20.772  92.240  1.00 14.09 ? 80   VAL A CG2 1 
ATOM   540  N N   . LYS A 1 82  ? 12.068 18.696  89.473  1.00 13.48 ? 81   LYS A N   1 
ATOM   541  C CA  . LYS A 1 82  ? 10.776 18.207  88.970  1.00 14.32 ? 81   LYS A CA  1 
ATOM   542  C C   . LYS A 1 82  ? 10.762 16.716  88.704  1.00 15.65 ? 81   LYS A C   1 
ATOM   543  O O   . LYS A 1 82  ? 9.720  16.078  88.877  1.00 16.53 ? 81   LYS A O   1 
ATOM   544  C CB  . LYS A 1 82  ? 10.345 18.970  87.702  1.00 16.88 ? 81   LYS A CB  1 
ATOM   545  C CG  . LYS A 1 82  ? 9.828  20.371  88.011  1.00 20.76 ? 81   LYS A CG  1 
ATOM   546  C CD  . LYS A 1 82  ? 9.324  21.059  86.754  1.00 24.25 ? 81   LYS A CD  1 
ATOM   547  C CE  . LYS A 1 82  ? 8.898  22.487  87.020  1.00 23.13 ? 81   LYS A CE  1 
ATOM   548  N NZ  . LYS A 1 82  ? 7.661  22.559  87.857  1.00 21.01 ? 81   LYS A NZ  1 
ATOM   549  N N   . LEU A 1 83  ? 11.896 16.166  88.258  1.00 13.27 ? 82   LEU A N   1 
ATOM   550  C CA  . LEU A 1 83  ? 12.052 14.742  87.955  1.00 13.66 ? 82   LEU A CA  1 
ATOM   551  C C   . LEU A 1 83  ? 12.333 13.892  89.202  1.00 16.25 ? 82   LEU A C   1 
ATOM   552  O O   . LEU A 1 83  ? 12.513 12.677  89.070  1.00 15.09 ? 82   LEU A O   1 
ATOM   553  C CB  . LEU A 1 83  ? 13.189 14.567  86.944  1.00 14.72 ? 82   LEU A CB  1 
ATOM   554  C CG  . LEU A 1 83  ? 12.837 14.779  85.461  1.00 23.82 ? 82   LEU A CG  1 
ATOM   555  C CD1 . LEU A 1 83  ? 14.044 14.489  84.601  1.00 25.95 ? 82   LEU A CD1 1 
ATOM   556  C CD2 . LEU A 1 83  ? 11.727 13.819  85.020  1.00 30.43 ? 82   LEU A CD2 1 
ATOM   557  N N   . LYS A 1 84  ? 12.349 14.527  90.389  1.00 13.76 ? 83   LYS A N   1 
ATOM   558  C CA  . LYS A 1 84  ? 12.644 13.915  91.702  1.00 14.31 ? 83   LYS A CA  1 
ATOM   559  C C   . LYS A 1 84  ? 14.027 13.216  91.653  1.00 15.65 ? 83   LYS A C   1 
ATOM   560  O O   . LYS A 1 84  ? 14.198 12.104  92.190  1.00 15.08 ? 83   LYS A O   1 
ATOM   561  C CB  . LYS A 1 84  ? 11.525 12.943  92.169  1.00 15.63 ? 83   LYS A CB  1 
ATOM   562  C CG  . LYS A 1 84  ? 10.182 13.613  92.418  1.00 26.66 ? 83   LYS A CG  1 
ATOM   563  C CD  . LYS A 1 84  ? 9.146  12.630  92.979  1.00 33.64 ? 83   LYS A CD  1 
ATOM   564  C CE  . LYS A 1 84  ? 8.127  12.163  91.963  1.00 48.00 ? 83   LYS A CE  1 
ATOM   565  N NZ  . LYS A 1 84  ? 8.729  11.341  90.875  1.00 57.32 ? 83   LYS A NZ  1 
ATOM   566  N N   . GLN A 1 85  ? 15.012 13.881  91.006  1.00 10.12 ? 84   GLN A N   1 
ATOM   567  C CA  . GLN A 1 85  ? 16.359 13.306  90.860  1.00 9.63  ? 84   GLN A CA  1 
ATOM   568  C C   . GLN A 1 85  ? 17.426 14.037  91.685  1.00 12.81 ? 84   GLN A C   1 
ATOM   569  O O   . GLN A 1 85  ? 18.613 13.909  91.372  1.00 12.36 ? 84   GLN A O   1 
ATOM   570  C CB  . GLN A 1 85  ? 16.780 13.212  89.360  1.00 10.97 ? 84   GLN A CB  1 
ATOM   571  C CG  . GLN A 1 85  ? 15.828 12.378  88.480  1.00 11.03 ? 84   GLN A CG  1 
ATOM   572  C CD  . GLN A 1 85  ? 15.754 10.966  89.000  1.00 14.11 ? 84   GLN A CD  1 
ATOM   573  O OE1 . GLN A 1 85  ? 16.769 10.292  89.165  1.00 13.90 ? 84   GLN A OE1 1 
ATOM   574  N NE2 . GLN A 1 85  ? 14.553 10.514  89.301  1.00 13.81 ? 84   GLN A NE2 1 
ATOM   575  N N   . ILE A 1 86  ? 17.037 14.766  92.751  1.00 8.63  ? 85   ILE A N   1 
ATOM   576  C CA  . ILE A 1 86  ? 18.046 15.495  93.540  1.00 9.06  ? 85   ILE A CA  1 
ATOM   577  C C   . ILE A 1 86  ? 19.062 14.536  94.183  1.00 12.66 ? 85   ILE A C   1 
ATOM   578  O O   . ILE A 1 86  ? 20.276 14.664  93.942  1.00 11.50 ? 85   ILE A O   1 
ATOM   579  C CB  . ILE A 1 86  ? 17.392 16.404  94.625  1.00 12.33 ? 85   ILE A CB  1 
ATOM   580  C CG1 . ILE A 1 86  ? 16.403 17.412  94.008  1.00 11.75 ? 85   ILE A CG1 1 
ATOM   581  C CG2 . ILE A 1 86  ? 18.477 17.113  95.480  1.00 12.91 ? 85   ILE A CG2 1 
ATOM   582  C CD1 . ILE A 1 86  ? 15.420 18.006  95.077  1.00 13.94 ? 85   ILE A CD1 1 
ATOM   583  N N   . GLU A 1 87  ? 18.559 13.567  94.975  1.00 9.30  ? 86   GLU A N   1 
ATOM   584  C CA  . GLU A 1 87  ? 19.446 12.629  95.649  1.00 8.49  ? 86   GLU A CA  1 
ATOM   585  C C   . GLU A 1 87  ? 20.242 11.778  94.638  1.00 8.86  ? 86   GLU A C   1 
ATOM   586  O O   . GLU A 1 87  ? 21.425 11.528  94.865  1.00 9.41  ? 86   GLU A O   1 
ATOM   587  C CB  . GLU A 1 87  ? 18.624 11.731  96.583  1.00 10.86 ? 86   GLU A CB  1 
ATOM   588  C CG  . GLU A 1 87  ? 19.437 11.102  97.688  1.00 17.01 ? 86   GLU A CG  1 
ATOM   589  C CD  . GLU A 1 87  ? 20.014 12.034  98.743  1.00 18.86 ? 86   GLU A CD  1 
ATOM   590  O OE1 . GLU A 1 87  ? 19.322 12.967  99.207  1.00 21.18 ? 86   GLU A OE1 1 
ATOM   591  O OE2 . GLU A 1 87  ? 21.178 11.804  99.116  1.00 13.19 ? 86   GLU A OE2 1 
ATOM   592  N N   . HIS A 1 88  ? 19.598 11.350  93.526  1.00 7.51  ? 87   HIS A N   1 
ATOM   593  C CA  . HIS A 1 88  ? 20.279 10.564  92.493  1.00 8.56  ? 87   HIS A CA  1 
ATOM   594  C C   . HIS A 1 88  ? 21.411 11.364  91.831  1.00 11.75 ? 87   HIS A C   1 
ATOM   595  O O   . HIS A 1 88  ? 22.453 10.796  91.486  1.00 9.92  ? 87   HIS A O   1 
ATOM   596  C CB  . HIS A 1 88  ? 19.268 10.076  91.432  1.00 9.33  ? 87   HIS A CB  1 
ATOM   597  C CG  . HIS A 1 88  ? 18.384 8.958   91.910  1.00 11.50 ? 87   HIS A CG  1 
ATOM   598  N ND1 . HIS A 1 88  ? 17.272 8.562   91.183  1.00 12.65 ? 87   HIS A ND1 1 
ATOM   599  C CD2 . HIS A 1 88  ? 18.520 8.142   92.989  1.00 13.55 ? 87   HIS A CD2 1 
ATOM   600  C CE1 . HIS A 1 88  ? 16.744 7.552   91.866  1.00 13.13 ? 87   HIS A CE1 1 
ATOM   601  N NE2 . HIS A 1 88  ? 17.477 7.251   92.946  1.00 13.37 ? 87   HIS A NE2 1 
ATOM   602  N N   . THR A 1 89  ? 21.216 12.673  91.659  1.00 8.74  ? 88   THR A N   1 
ATOM   603  C CA  . THR A 1 89  ? 22.251 13.522  91.008  1.00 8.46  ? 88   THR A CA  1 
ATOM   604  C C   . THR A 1 89  ? 23.444 13.722  91.976  1.00 10.15 ? 88   THR A C   1 
ATOM   605  O O   . THR A 1 89  ? 24.612 13.720  91.565  1.00 10.14 ? 88   THR A O   1 
ATOM   606  C CB  . THR A 1 89  ? 21.659 14.866  90.549  1.00 13.75 ? 88   THR A CB  1 
ATOM   607  O OG1 . THR A 1 89  ? 20.569 14.624  89.648  1.00 11.46 ? 88   THR A OG1 1 
ATOM   608  C CG2 . THR A 1 89  ? 22.705 15.764  89.855  1.00 12.56 ? 88   THR A CG2 1 
ATOM   609  N N   . LEU A 1 90  ? 23.124 13.956  93.263  1.00 8.64  ? 89   LEU A N   1 
ATOM   610  C CA  . LEU A 1 90  ? 24.180 14.077  94.269  1.00 8.91  ? 89   LEU A CA  1 
ATOM   611  C C   . LEU A 1 90  ? 24.925 12.737  94.369  1.00 11.75 ? 89   LEU A C   1 
ATOM   612  O O   . LEU A 1 90  ? 26.151 12.744  94.454  1.00 11.14 ? 89   LEU A O   1 
ATOM   613  C CB  . LEU A 1 90  ? 23.587 14.506  95.608  1.00 9.79  ? 89   LEU A CB  1 
ATOM   614  C CG  . LEU A 1 90  ? 22.909 15.886  95.604  1.00 11.52 ? 89   LEU A CG  1 
ATOM   615  C CD1 . LEU A 1 90  ? 22.309 16.153  96.981  1.00 11.05 ? 89   LEU A CD1 1 
ATOM   616  C CD2 . LEU A 1 90  ? 23.907 17.024  95.203  1.00 11.15 ? 89   LEU A CD2 1 
ATOM   617  N N   . ASN A 1 91  ? 24.212 11.595  94.246  1.00 9.19  ? 90   ASN A N   1 
ATOM   618  C CA  . ASN A 1 91  ? 24.871 10.276  94.239  1.00 9.02  ? 90   ASN A CA  1 
ATOM   619  C C   . ASN A 1 91  ? 25.846 10.179  93.071  1.00 11.60 ? 90   ASN A C   1 
ATOM   620  O O   . ASN A 1 91  ? 27.001 9.788   93.255  1.00 9.58  ? 90   ASN A O   1 
ATOM   621  C CB  . ASN A 1 91  ? 23.841 9.144   94.051  1.00 9.68  ? 90   ASN A CB  1 
ATOM   622  C CG  . ASN A 1 91  ? 22.973 8.788   95.234  1.00 14.75 ? 90   ASN A CG  1 
ATOM   623  O OD1 . ASN A 1 91  ? 23.264 9.127   96.376  1.00 10.94 ? 90   ASN A OD1 1 
ATOM   624  N ND2 . ASN A 1 91  ? 21.858 8.086   94.967  1.00 12.59 ? 90   ASN A ND2 1 
ATOM   625  N N   . GLU A 1 92  ? 25.359 10.474  91.865  1.00 8.59  ? 91   GLU A N   1 
ATOM   626  C CA  . GLU A 1 92  ? 26.146 10.356  90.636  1.00 8.73  ? 91   GLU A CA  1 
ATOM   627  C C   . GLU A 1 92  ? 27.458 11.097  90.761  1.00 11.89 ? 91   GLU A C   1 
ATOM   628  O O   . GLU A 1 92  ? 28.510 10.520  90.520  1.00 11.45 ? 91   GLU A O   1 
ATOM   629  C CB  . GLU A 1 92  ? 25.342 10.911  89.451  1.00 10.27 ? 91   GLU A CB  1 
ATOM   630  C CG  . GLU A 1 92  ? 26.149 10.978  88.161  1.00 12.59 ? 91   GLU A CG  1 
ATOM   631  C CD  . GLU A 1 92  ? 25.350 11.358  86.931  1.00 15.81 ? 91   GLU A CD  1 
ATOM   632  O OE1 . GLU A 1 92  ? 24.238 11.913  87.081  1.00 17.12 ? 91   GLU A OE1 1 
ATOM   633  O OE2 . GLU A 1 92  ? 25.801 10.996  85.823  1.00 20.70 ? 91   GLU A OE2 1 
ATOM   634  N N   . LYS A 1 93  ? 27.401 12.373  91.124  1.00 10.02 ? 92   LYS A N   1 
ATOM   635  C CA  . LYS A 1 93  ? 28.614 13.190  91.215  1.00 9.89  ? 92   LYS A CA  1 
ATOM   636  C C   . LYS A 1 93  ? 29.542 12.737  92.358  1.00 11.44 ? 92   LYS A C   1 
ATOM   637  O O   . LYS A 1 93  ? 30.756 12.649  92.168  1.00 11.92 ? 92   LYS A O   1 
ATOM   638  C CB  . LYS A 1 93  ? 28.243 14.671  91.341  1.00 11.37 ? 92   LYS A CB  1 
ATOM   639  C CG  . LYS A 1 93  ? 29.486 15.600  91.425  1.00 12.16 ? 92   LYS A CG  1 
ATOM   640  C CD  . LYS A 1 93  ? 29.621 16.089  92.885  1.00 16.12 ? 92   LYS A CD  1 
ATOM   641  C CE  . LYS A 1 93  ? 30.979 16.640  93.194  1.00 16.23 ? 92   LYS A CE  1 
ATOM   642  N NZ  . LYS A 1 93  ? 30.968 17.256  94.543  1.00 14.22 ? 92   LYS A NZ  1 
ATOM   643  N N   . ARG A 1 94  ? 28.975 12.464  93.537  1.00 9.19  ? 93   ARG A N   1 
ATOM   644  C CA  . ARG A 1 94  ? 29.779 11.998  94.681  1.00 9.78  ? 93   ARG A CA  1 
ATOM   645  C C   . ARG A 1 94  ? 30.479 10.656  94.366  1.00 13.02 ? 93   ARG A C   1 
ATOM   646  O O   . ARG A 1 94  ? 31.637 10.458  94.717  1.00 12.73 ? 93   ARG A O   1 
ATOM   647  C CB  . ARG A 1 94  ? 28.899 11.886  95.954  1.00 8.44  ? 93   ARG A CB  1 
ATOM   648  C CG  . ARG A 1 94  ? 29.738 11.590  97.211  1.00 9.28  ? 93   ARG A CG  1 
ATOM   649  C CD  . ARG A 1 94  ? 28.892 11.628  98.470  1.00 12.60 ? 93   ARG A CD  1 
ATOM   650  N NE  . ARG A 1 94  ? 29.669 11.356  99.680  1.00 14.76 ? 93   ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 94  ? 29.116 11.161  100.877 1.00 20.15 ? 93   ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 94  ? 27.795 11.221  101.024 1.00 12.38 ? 93   ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 94  ? 29.881 10.930  101.939 1.00 14.28 ? 93   ARG A NH2 1 
ATOM   654  N N   . ILE A 1 95  ? 29.775 9.728   93.723  1.00 10.23 ? 94   ILE A N   1 
ATOM   655  C CA  . ILE A 1 95  ? 30.395 8.445   93.383  1.00 9.83  ? 94   ILE A CA  1 
ATOM   656  C C   . ILE A 1 95  ? 31.473 8.633   92.305  1.00 13.06 ? 94   ILE A C   1 
ATOM   657  O O   . ILE A 1 95  ? 32.581 8.126   92.461  1.00 12.12 ? 94   ILE A O   1 
ATOM   658  C CB  . ILE A 1 95  ? 29.325 7.409   92.949  1.00 12.34 ? 94   ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 95  ? 28.408 7.044   94.136  1.00 12.02 ? 94   ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 95  ? 29.985 6.154   92.326  1.00 12.55 ? 94   ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 95  ? 27.047 6.365   93.729  1.00 11.80 ? 94   ILE A CD1 1 
ATOM   662  N N   . LEU A 1 96  ? 31.136 9.330   91.198  1.00 11.21 ? 95   LEU A N   1 
ATOM   663  C CA  . LEU A 1 96  ? 32.070 9.537   90.086  1.00 11.41 ? 95   LEU A CA  1 
ATOM   664  C C   . LEU A 1 96  ? 33.384 10.171  90.486  1.00 13.66 ? 95   LEU A C   1 
ATOM   665  O O   . LEU A 1 96  ? 34.439 9.759   89.998  1.00 14.61 ? 95   LEU A O   1 
ATOM   666  C CB  . LEU A 1 96  ? 31.427 10.333  88.964  1.00 12.24 ? 95   LEU A CB  1 
ATOM   667  C CG  . LEU A 1 96  ? 30.553 9.538   88.020  1.00 16.72 ? 95   LEU A CG  1 
ATOM   668  C CD1 . LEU A 1 96  ? 29.886 10.482  86.984  1.00 17.53 ? 95   LEU A CD1 1 
ATOM   669  C CD2 . LEU A 1 96  ? 31.378 8.494   87.308  1.00 16.56 ? 95   LEU A CD2 1 
ATOM   670  N N   . GLN A 1 97  ? 33.338 11.163  91.386  1.00 11.27 ? 96   GLN A N   1 
ATOM   671  C CA  . GLN A 1 97  ? 34.572 11.812  91.798  1.00 9.96  ? 96   GLN A CA  1 
ATOM   672  C C   . GLN A 1 97  ? 35.436 10.902  92.672  1.00 14.63 ? 96   GLN A C   1 
ATOM   673  O O   . GLN A 1 97  ? 36.625 11.172  92.843  1.00 14.69 ? 96   GLN A O   1 
ATOM   674  C CB  . GLN A 1 97  ? 34.315 13.200  92.437  1.00 11.14 ? 96   GLN A CB  1 
ATOM   675  C CG  . GLN A 1 97  ? 33.532 13.207  93.751  1.00 11.92 ? 96   GLN A CG  1 
ATOM   676  C CD  . GLN A 1 97  ? 34.340 12.871  94.987  1.00 15.87 ? 96   GLN A CD  1 
ATOM   677  O OE1 . GLN A 1 97  ? 35.457 13.377  95.187  1.00 16.65 ? 96   GLN A OE1 1 
ATOM   678  N NE2 . GLN A 1 97  ? 33.748 12.082  95.894  1.00 11.59 ? 96   GLN A NE2 1 
ATOM   679  N N   . ALA A 1 98  ? 34.829 9.840   93.250  1.00 11.98 ? 97   ALA A N   1 
ATOM   680  C CA  . ALA A 1 98  ? 35.512 8.929   94.175  1.00 12.53 ? 97   ALA A CA  1 
ATOM   681  C C   . ALA A 1 98  ? 36.064 7.630   93.561  1.00 15.81 ? 97   ALA A C   1 
ATOM   682  O O   . ALA A 1 98  ? 36.962 7.010   94.144  1.00 15.76 ? 97   ALA A O   1 
ATOM   683  C CB  . ALA A 1 98  ? 34.575 8.608   95.335  1.00 13.59 ? 97   ALA A CB  1 
ATOM   684  N N   . VAL A 1 99  ? 35.518 7.201   92.417  1.00 12.38 ? 98   VAL A N   1 
ATOM   685  C CA  . VAL A 1 99  ? 35.926 5.947   91.791  1.00 11.75 ? 98   VAL A CA  1 
ATOM   686  C C   . VAL A 1 99  ? 37.155 6.098   90.877  1.00 15.57 ? 98   VAL A C   1 
ATOM   687  O O   . VAL A 1 99  ? 37.457 7.200   90.410  1.00 16.73 ? 98   VAL A O   1 
ATOM   688  C CB  . VAL A 1 99  ? 34.752 5.215   91.091  1.00 13.62 ? 98   VAL A CB  1 
ATOM   689  C CG1 . VAL A 1 99  ? 33.661 4.840   92.102  1.00 13.61 ? 98   VAL A CG1 1 
ATOM   690  C CG2 . VAL A 1 99  ? 34.184 6.062   89.952  1.00 12.29 ? 98   VAL A CG2 1 
ATOM   691  N N   . ASN A 1 100 ? 37.824 4.973   90.594  1.00 14.31 ? 99   ASN A N   1 
ATOM   692  C CA  . ASN A 1 100 ? 39.001 4.899   89.740  1.00 14.44 ? 99   ASN A CA  1 
ATOM   693  C C   . ASN A 1 100 ? 39.111 3.457   89.244  1.00 17.01 ? 99   ASN A C   1 
ATOM   694  O O   . ASN A 1 100 ? 39.483 2.578   90.018  1.00 16.18 ? 99   ASN A O   1 
ATOM   695  C CB  . ASN A 1 100 ? 40.280 5.305   90.533  1.00 19.52 ? 99   ASN A CB  1 
ATOM   696  C CG  . ASN A 1 100 ? 41.559 5.138   89.734  1.00 29.78 ? 99   ASN A CG  1 
ATOM   697  O OD1 . ASN A 1 100 ? 41.573 5.257   88.510  1.00 24.36 ? 99   ASN A OD1 1 
ATOM   698  N ND2 . ASN A 1 100 ? 42.644 4.814   90.402  1.00 32.53 ? 99   ASN A ND2 1 
ATOM   699  N N   . PHE A 1 101 ? 38.761 3.211   87.974  1.00 14.31 ? 100  PHE A N   1 
ATOM   700  C CA  . PHE A 1 101 ? 38.831 1.869   87.393  1.00 14.19 ? 100  PHE A CA  1 
ATOM   701  C C   . PHE A 1 101 ? 39.020 1.986   85.879  1.00 17.47 ? 100  PHE A C   1 
ATOM   702  O O   . PHE A 1 101 ? 38.463 2.915   85.272  1.00 15.62 ? 100  PHE A O   1 
ATOM   703  C CB  . PHE A 1 101 ? 37.596 1.019   87.773  1.00 15.31 ? 100  PHE A CB  1 
ATOM   704  C CG  . PHE A 1 101 ? 37.808 -0.474  87.599  1.00 15.83 ? 100  PHE A CG  1 
ATOM   705  C CD1 . PHE A 1 101 ? 38.679 -1.172  88.431  1.00 17.12 ? 100  PHE A CD1 1 
ATOM   706  C CD2 . PHE A 1 101 ? 37.137 -1.177  86.605  1.00 16.21 ? 100  PHE A CD2 1 
ATOM   707  C CE1 . PHE A 1 101 ? 38.873 -2.544  88.273  1.00 18.37 ? 100  PHE A CE1 1 
ATOM   708  C CE2 . PHE A 1 101 ? 37.342 -2.551  86.435  1.00 17.89 ? 100  PHE A CE2 1 
ATOM   709  C CZ  . PHE A 1 101 ? 38.201 -3.227  87.276  1.00 17.42 ? 100  PHE A CZ  1 
ATOM   710  N N   . PRO A 1 102 ? 39.865 1.115   85.261  1.00 15.10 ? 101  PRO A N   1 
ATOM   711  C CA  . PRO A 1 102 ? 40.156 1.279   83.826  1.00 14.93 ? 101  PRO A CA  1 
ATOM   712  C C   . PRO A 1 102 ? 38.940 1.293   82.905  1.00 17.05 ? 101  PRO A C   1 
ATOM   713  O O   . PRO A 1 102 ? 38.996 1.928   81.850  1.00 17.23 ? 101  PRO A O   1 
ATOM   714  C CB  . PRO A 1 102 ? 41.086 0.107   83.490  1.00 17.38 ? 101  PRO A CB  1 
ATOM   715  C CG  . PRO A 1 102 ? 41.600 -0.401  84.764  1.00 21.49 ? 101  PRO A CG  1 
ATOM   716  C CD  . PRO A 1 102 ? 40.641 -0.003  85.852  1.00 17.38 ? 101  PRO A CD  1 
ATOM   717  N N   . PHE A 1 103 ? 37.843 0.628   83.314  1.00 12.75 ? 102  PHE A N   1 
ATOM   718  C CA  . PHE A 1 103 ? 36.646 0.519   82.485  1.00 11.53 ? 102  PHE A CA  1 
ATOM   719  C C   . PHE A 1 103 ? 35.496 1.426   82.938  1.00 12.95 ? 102  PHE A C   1 
ATOM   720  O O   . PHE A 1 103 ? 34.337 1.136   82.646  1.00 11.80 ? 102  PHE A O   1 
ATOM   721  C CB  . PHE A 1 103 ? 36.205 -0.948  82.315  1.00 12.63 ? 102  PHE A CB  1 
ATOM   722  C CG  . PHE A 1 103 ? 37.358 -1.891  82.040  1.00 13.42 ? 102  PHE A CG  1 
ATOM   723  C CD1 . PHE A 1 103 ? 38.285 -1.618  81.025  1.00 14.87 ? 102  PHE A CD1 1 
ATOM   724  C CD2 . PHE A 1 103 ? 37.533 -3.035  82.804  1.00 13.97 ? 102  PHE A CD2 1 
ATOM   725  C CE1 . PHE A 1 103 ? 39.396 -2.459  80.816  1.00 15.55 ? 102  PHE A CE1 1 
ATOM   726  C CE2 . PHE A 1 103 ? 38.620 -3.892  82.573  1.00 16.11 ? 102  PHE A CE2 1 
ATOM   727  C CZ  . PHE A 1 103 ? 39.549 -3.587  81.591  1.00 14.72 ? 102  PHE A CZ  1 
ATOM   728  N N   . LEU A 1 104 ? 35.825 2.528   83.623  1.00 11.51 ? 103  LEU A N   1 
ATOM   729  C CA  . LEU A 1 104 ? 34.831 3.542   84.009  1.00 11.43 ? 103  LEU A CA  1 
ATOM   730  C C   . LEU A 1 104 ? 35.259 4.852   83.374  1.00 15.27 ? 103  LEU A C   1 
ATOM   731  O O   . LEU A 1 104 ? 36.447 5.200   83.435  1.00 15.39 ? 103  LEU A O   1 
ATOM   732  C CB  . LEU A 1 104 ? 34.763 3.724   85.547  1.00 11.70 ? 103  LEU A CB  1 
ATOM   733  C CG  . LEU A 1 104 ? 34.301 2.511   86.376  1.00 14.09 ? 103  LEU A CG  1 
ATOM   734  C CD1 . LEU A 1 104 ? 34.363 2.832   87.887  1.00 13.07 ? 103  LEU A CD1 1 
ATOM   735  C CD2 . LEU A 1 104 ? 32.895 2.086   85.986  1.00 12.93 ? 103  LEU A CD2 1 
ATOM   736  N N   . VAL A 1 105 ? 34.295 5.599   82.797  1.00 12.17 ? 104  VAL A N   1 
ATOM   737  C CA  . VAL A 1 105 ? 34.563 6.931   82.256  1.00 12.14 ? 104  VAL A CA  1 
ATOM   738  C C   . VAL A 1 105 ? 34.946 7.815   83.472  1.00 16.30 ? 104  VAL A C   1 
ATOM   739  O O   . VAL A 1 105 ? 34.275 7.763   84.506  1.00 16.24 ? 104  VAL A O   1 
ATOM   740  C CB  . VAL A 1 105 ? 33.356 7.483   81.449  1.00 14.31 ? 104  VAL A CB  1 
ATOM   741  C CG1 . VAL A 1 105 ? 33.516 8.965   81.156  1.00 13.89 ? 104  VAL A CG1 1 
ATOM   742  C CG2 . VAL A 1 105 ? 33.191 6.713   80.133  1.00 14.63 ? 104  VAL A CG2 1 
ATOM   743  N N   A LYS A 1 106 ? 36.049 8.570   83.352  0.50 13.51 ? 105  LYS A N   1 
ATOM   744  N N   B LYS A 1 106 ? 36.039 8.581   83.339  0.50 13.10 ? 105  LYS A N   1 
ATOM   745  C CA  A LYS A 1 106 ? 36.558 9.426   84.420  0.50 13.48 ? 105  LYS A CA  1 
ATOM   746  C CA  B LYS A 1 106 ? 36.550 9.452   84.390  0.50 12.87 ? 105  LYS A CA  1 
ATOM   747  C C   A LYS A 1 106 ? 35.865 10.789  84.460  0.50 16.76 ? 105  LYS A C   1 
ATOM   748  C C   B LYS A 1 106 ? 35.819 10.787  84.453  0.50 16.45 ? 105  LYS A C   1 
ATOM   749  O O   A LYS A 1 106 ? 35.692 11.430  83.422  0.50 16.16 ? 105  LYS A O   1 
ATOM   750  O O   B LYS A 1 106 ? 35.586 11.419  83.420  0.50 15.86 ? 105  LYS A O   1 
ATOM   751  C CB  A LYS A 1 106 ? 38.085 9.602   84.269  0.50 16.04 ? 105  LYS A CB  1 
ATOM   752  C CB  B LYS A 1 106 ? 38.049 9.736   84.170  0.50 14.87 ? 105  LYS A CB  1 
ATOM   753  C CG  A LYS A 1 106 ? 38.760 10.369  85.407  0.50 26.10 ? 105  LYS A CG  1 
ATOM   754  C CG  B LYS A 1 106 ? 38.983 8.572   84.452  0.50 19.44 ? 105  LYS A CG  1 
ATOM   755  C CD  A LYS A 1 106 ? 40.258 10.503  85.196  0.50 32.87 ? 105  LYS A CD  1 
ATOM   756  C CD  B LYS A 1 106 ? 40.430 9.032   84.376  0.50 29.98 ? 105  LYS A CD  1 
ATOM   757  N N   . LEU A 1 107 ? 35.521 11.245  85.673  1.00 13.13 ? 106  LEU A N   1 
ATOM   758  C CA  . LEU A 1 107 ? 34.947 12.568  85.906  1.00 12.48 ? 106  LEU A CA  1 
ATOM   759  C C   . LEU A 1 107 ? 36.176 13.466  86.042  1.00 15.30 ? 106  LEU A C   1 
ATOM   760  O O   . LEU A 1 107 ? 36.944 13.313  86.998  1.00 15.49 ? 106  LEU A O   1 
ATOM   761  C CB  . LEU A 1 107 ? 34.149 12.610  87.207  1.00 13.07 ? 106  LEU A CB  1 
ATOM   762  C CG  . LEU A 1 107 ? 33.566 13.995  87.559  1.00 17.35 ? 106  LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 107 ? 32.500 14.442  86.520  1.00 18.08 ? 106  LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 107 ? 32.953 13.987  88.938  1.00 20.43 ? 106  LEU A CD2 1 
ATOM   765  N N   . GLU A 1 108 ? 36.399 14.352  85.060  1.00 13.07 ? 107  GLU A N   1 
ATOM   766  C CA  . GLU A 1 108 ? 37.581 15.221  85.036  1.00 13.29 ? 107  GLU A CA  1 
ATOM   767  C C   . GLU A 1 108 ? 37.408 16.477  85.885  1.00 15.97 ? 107  GLU A C   1 
ATOM   768  O O   . GLU A 1 108 ? 38.353 16.888  86.570  1.00 16.30 ? 107  GLU A O   1 
ATOM   769  C CB  . GLU A 1 108 ? 37.951 15.564  83.592  1.00 14.58 ? 107  GLU A CB  1 
ATOM   770  C CG  . GLU A 1 108 ? 38.252 14.341  82.740  1.00 21.77 ? 107  GLU A CG  1 
ATOM   771  C CD  . GLU A 1 108 ? 39.641 13.741  82.858  1.00 39.87 ? 107  GLU A CD  1 
ATOM   772  O OE1 . GLU A 1 108 ? 40.470 14.275  83.629  1.00 27.52 ? 107  GLU A OE1 1 
ATOM   773  O OE2 . GLU A 1 108 ? 39.909 12.748  82.145  1.00 40.26 ? 107  GLU A OE2 1 
ATOM   774  N N   . PHE A 1 109 ? 36.205 17.099  85.826  1.00 10.64 ? 108  PHE A N   1 
ATOM   775  C CA  . PHE A 1 109 ? 35.858 18.283  86.606  1.00 10.38 ? 108  PHE A CA  1 
ATOM   776  C C   . PHE A 1 109 ? 34.373 18.274  86.900  1.00 13.07 ? 108  PHE A C   1 
ATOM   777  O O   . PHE A 1 109 ? 33.591 17.624  86.189  1.00 11.73 ? 108  PHE A O   1 
ATOM   778  C CB  . PHE A 1 109 ? 36.140 19.569  85.786  1.00 11.60 ? 108  PHE A CB  1 
ATOM   779  C CG  . PHE A 1 109 ? 37.506 19.685  85.156  1.00 13.24 ? 108  PHE A CG  1 
ATOM   780  C CD1 . PHE A 1 109 ? 38.597 20.133  85.899  1.00 16.43 ? 108  PHE A CD1 1 
ATOM   781  C CD2 . PHE A 1 109 ? 37.704 19.354  83.818  1.00 15.38 ? 108  PHE A CD2 1 
ATOM   782  C CE1 . PHE A 1 109 ? 39.866 20.246  85.311  1.00 18.83 ? 108  PHE A CE1 1 
ATOM   783  C CE2 . PHE A 1 109 ? 38.985 19.428  83.240  1.00 18.19 ? 108  PHE A CE2 1 
ATOM   784  C CZ  . PHE A 1 109 ? 40.054 19.883  83.989  1.00 17.06 ? 108  PHE A CZ  1 
ATOM   785  N N   . SER A 1 110 ? 33.966 19.048  87.910  1.00 12.36 ? 109  SER A N   1 
ATOM   786  C CA  . SER A 1 110 ? 32.550 19.283  88.145  1.00 11.01 ? 109  SER A CA  1 
ATOM   787  C C   . SER A 1 110 ? 32.391 20.670  88.734  1.00 14.45 ? 109  SER A C   1 
ATOM   788  O O   . SER A 1 110 ? 33.294 21.160  89.406  1.00 14.27 ? 109  SER A O   1 
ATOM   789  C CB  . SER A 1 110 ? 31.929 18.213  89.050  1.00 13.51 ? 109  SER A CB  1 
ATOM   790  O OG  . SER A 1 110 ? 32.280 18.450  90.401  1.00 16.03 ? 109  SER A OG  1 
ATOM   791  N N   . PHE A 1 111 ? 31.255 21.305  88.484  1.00 10.40 ? 110  PHE A N   1 
ATOM   792  C CA  . PHE A 1 111 ? 30.969 22.637  89.029  1.00 10.56 ? 110  PHE A CA  1 
ATOM   793  C C   . PHE A 1 111 ? 29.513 22.923  88.752  1.00 13.18 ? 110  PHE A C   1 
ATOM   794  O O   . PHE A 1 111 ? 28.840 22.132  88.073  1.00 12.67 ? 110  PHE A O   1 
ATOM   795  C CB  . PHE A 1 111 ? 31.885 23.719  88.391  1.00 12.06 ? 110  PHE A CB  1 
ATOM   796  C CG  . PHE A 1 111 ? 31.872 23.697  86.880  1.00 12.51 ? 110  PHE A CG  1 
ATOM   797  C CD1 . PHE A 1 111 ? 32.734 22.859  86.169  1.00 14.68 ? 110  PHE A CD1 1 
ATOM   798  C CD2 . PHE A 1 111 ? 31.008 24.518  86.165  1.00 14.10 ? 110  PHE A CD2 1 
ATOM   799  C CE1 . PHE A 1 111 ? 32.681 22.797  84.774  1.00 15.10 ? 110  PHE A CE1 1 
ATOM   800  C CE2 . PHE A 1 111 ? 31.014 24.511  84.763  1.00 16.97 ? 110  PHE A CE2 1 
ATOM   801  C CZ  . PHE A 1 111 ? 31.843 23.643  84.078  1.00 14.59 ? 110  PHE A CZ  1 
ATOM   802  N N   . LYS A 1 112 ? 29.022 24.045  89.271  1.00 12.69 ? 111  LYS A N   1 
ATOM   803  C CA  . LYS A 1 112 ? 27.638 24.459  89.084  1.00 11.50 ? 111  LYS A CA  1 
ATOM   804  C C   . LYS A 1 112 ? 27.594 25.972  88.990  1.00 16.79 ? 111  LYS A C   1 
ATOM   805  O O   . LYS A 1 112 ? 28.542 26.669  89.390  1.00 16.47 ? 111  LYS A O   1 
ATOM   806  C CB  . LYS A 1 112 ? 26.748 23.966  90.262  1.00 11.88 ? 111  LYS A CB  1 
ATOM   807  C CG  . LYS A 1 112 ? 27.113 24.635  91.620  1.00 14.85 ? 111  LYS A CG  1 
ATOM   808  C CD  . LYS A 1 112 ? 26.427 24.001  92.805  1.00 15.53 ? 111  LYS A CD  1 
ATOM   809  C CE  . LYS A 1 112 ? 27.038 24.620  94.049  1.00 21.94 ? 111  LYS A CE  1 
ATOM   810  N NZ  . LYS A 1 112 ? 26.811 23.789  95.247  1.00 24.97 ? 111  LYS A NZ  1 
ATOM   811  N N   . ASP A 1 113 ? 26.498 26.485  88.456  1.00 12.46 ? 112  ASP A N   1 
ATOM   812  C CA  . ASP A 1 113 ? 26.306 27.927  88.431  1.00 12.55 ? 112  ASP A CA  1 
ATOM   813  C C   . ASP A 1 113 ? 24.914 28.192  88.930  1.00 15.99 ? 112  ASP A C   1 
ATOM   814  O O   . ASP A 1 113 ? 24.316 27.287  89.510  1.00 15.34 ? 112  ASP A O   1 
ATOM   815  C CB  . ASP A 1 113 ? 26.596 28.547  87.046  1.00 14.73 ? 112  ASP A CB  1 
ATOM   816  C CG  . ASP A 1 113 ? 25.793 28.010  85.875  1.00 16.20 ? 112  ASP A CG  1 
ATOM   817  O OD1 . ASP A 1 113 ? 24.669 27.462  86.104  1.00 14.75 ? 112  ASP A OD1 1 
ATOM   818  O OD2 . ASP A 1 113 ? 26.306 28.049  84.761  1.00 15.71 ? 112  ASP A OD2 1 
ATOM   819  N N   . ASN A 1 114 ? 24.358 29.380  88.677  1.00 13.56 ? 113  ASN A N   1 
ATOM   820  C CA  . ASN A 1 114 ? 23.009 29.676  89.176  1.00 12.48 ? 113  ASN A CA  1 
ATOM   821  C C   . ASN A 1 114 ? 21.924 28.725  88.698  1.00 16.17 ? 113  ASN A C   1 
ATOM   822  O O   . ASN A 1 114 ? 21.008 28.421  89.465  1.00 14.38 ? 113  ASN A O   1 
ATOM   823  C CB  . ASN A 1 114 ? 22.616 31.108  88.822  1.00 13.80 ? 113  ASN A CB  1 
ATOM   824  C CG  . ASN A 1 114 ? 23.256 32.143  89.723  1.00 26.00 ? 113  ASN A CG  1 
ATOM   825  O OD1 . ASN A 1 114 ? 23.797 31.839  90.797  1.00 16.02 ? 113  ASN A OD1 1 
ATOM   826  N ND2 . ASN A 1 114 ? 23.155 33.395  89.338  1.00 19.18 ? 113  ASN A ND2 1 
ATOM   827  N N   . SER A 1 115 ? 22.023 28.273  87.434  1.00 12.98 ? 114  SER A N   1 
ATOM   828  C CA  . SER A 1 115 ? 20.983 27.472  86.798  1.00 12.42 ? 114  SER A CA  1 
ATOM   829  C C   . SER A 1 115 ? 21.277 25.988  86.589  1.00 15.70 ? 114  SER A C   1 
ATOM   830  O O   . SER A 1 115 ? 20.340 25.181  86.611  1.00 15.89 ? 114  SER A O   1 
ATOM   831  C CB  . SER A 1 115 ? 20.612 28.094  85.451  1.00 13.23 ? 114  SER A CB  1 
ATOM   832  O OG  . SER A 1 115 ? 19.954 29.344  85.601  1.00 16.27 ? 114  SER A OG  1 
ATOM   833  N N   . ASN A 1 116 ? 22.555 25.635  86.343  1.00 9.38  ? 115  ASN A N   1 
ATOM   834  C CA  . ASN A 1 116 ? 22.929 24.288  85.942  1.00 9.32  ? 115  ASN A CA  1 
ATOM   835  C C   . ASN A 1 116 ? 23.990 23.604  86.799  1.00 13.23 ? 115  ASN A C   1 
ATOM   836  O O   . ASN A 1 116 ? 24.751 24.266  87.510  1.00 12.75 ? 115  ASN A O   1 
ATOM   837  C CB  . ASN A 1 116 ? 23.447 24.327  84.483  1.00 10.98 ? 115  ASN A CB  1 
ATOM   838  C CG  . ASN A 1 116 ? 22.537 25.040  83.512  1.00 18.24 ? 115  ASN A CG  1 
ATOM   839  O OD1 . ASN A 1 116 ? 21.360 24.699  83.385  1.00 20.57 ? 115  ASN A OD1 1 
ATOM   840  N ND2 . ASN A 1 116 ? 23.039 26.113  82.901  1.00 15.74 ? 115  ASN A ND2 1 
ATOM   841  N N   . LEU A 1 117 ? 24.060 22.268  86.657  1.00 9.94  ? 116  LEU A N   1 
ATOM   842  C CA  . LEU A 1 117 ? 25.081 21.398  87.242  1.00 9.53  ? 116  LEU A CA  1 
ATOM   843  C C   . LEU A 1 117 ? 25.887 20.849  86.070  1.00 12.88 ? 116  LEU A C   1 
ATOM   844  O O   . LEU A 1 117 ? 25.297 20.489  85.057  1.00 12.66 ? 116  LEU A O   1 
ATOM   845  C CB  . LEU A 1 117 ? 24.459 20.227  88.015  1.00 9.48  ? 116  LEU A CB  1 
ATOM   846  C CG  . LEU A 1 117 ? 23.390 20.606  89.030  1.00 12.25 ? 116  LEU A CG  1 
ATOM   847  C CD1 . LEU A 1 117 ? 22.735 19.358  89.612  1.00 11.92 ? 116  LEU A CD1 1 
ATOM   848  C CD2 . LEU A 1 117 ? 23.987 21.479  90.156  1.00 12.32 ? 116  LEU A CD2 1 
ATOM   849  N N   . TYR A 1 118 ? 27.214 20.771  86.218  1.00 9.64  ? 117  TYR A N   1 
ATOM   850  C CA  . TYR A 1 118 ? 28.066 20.308  85.130  1.00 9.80  ? 117  TYR A CA  1 
ATOM   851  C C   . TYR A 1 118 ? 28.987 19.210  85.606  1.00 13.35 ? 117  TYR A C   1 
ATOM   852  O O   . TYR A 1 118 ? 29.635 19.357  86.635  1.00 10.64 ? 117  TYR A O   1 
ATOM   853  C CB  . TYR A 1 118 ? 28.919 21.479  84.589  1.00 10.22 ? 117  TYR A CB  1 
ATOM   854  C CG  . TYR A 1 118 ? 28.119 22.705  84.178  1.00 11.50 ? 117  TYR A CG  1 
ATOM   855  C CD1 . TYR A 1 118 ? 27.770 23.683  85.111  1.00 13.41 ? 117  TYR A CD1 1 
ATOM   856  C CD2 . TYR A 1 118 ? 27.784 22.927  82.845  1.00 12.26 ? 117  TYR A CD2 1 
ATOM   857  C CE1 . TYR A 1 118 ? 27.055 24.827  84.728  1.00 13.27 ? 117  TYR A CE1 1 
ATOM   858  C CE2 . TYR A 1 118 ? 27.072 24.062  82.452  1.00 12.89 ? 117  TYR A CE2 1 
ATOM   859  C CZ  . TYR A 1 118 ? 26.709 25.008  83.400  1.00 13.02 ? 117  TYR A CZ  1 
ATOM   860  O OH  . TYR A 1 118 ? 26.010 26.121  83.014  1.00 13.85 ? 117  TYR A OH  1 
ATOM   861  N N   . MET A 1 119 ? 29.118 18.150  84.797  1.00 10.72 ? 118  MET A N   1 
ATOM   862  C CA  . MET A 1 119 ? 30.050 17.038  85.026  1.00 9.74  ? 118  MET A CA  1 
ATOM   863  C C   . MET A 1 119 ? 30.831 16.861  83.746  1.00 13.32 ? 118  MET A C   1 
ATOM   864  O O   . MET A 1 119 ? 30.253 16.532  82.710  1.00 12.66 ? 118  MET A O   1 
ATOM   865  C CB  . MET A 1 119 ? 29.322 15.745  85.431  1.00 11.81 ? 118  MET A CB  1 
ATOM   866  C CG  . MET A 1 119 ? 28.853 15.790  86.858  1.00 14.84 ? 118  MET A CG  1 
ATOM   867  S SD  . MET A 1 119 ? 27.785 14.400  87.283  1.00 18.68 ? 118  MET A SD  1 
ATOM   868  C CE  . MET A 1 119 ? 26.250 15.030  86.713  1.00 16.15 ? 118  MET A CE  1 
ATOM   869  N N   . VAL A 1 120 ? 32.128 17.181  83.793  1.00 9.61  ? 119  VAL A N   1 
ATOM   870  C CA  . VAL A 1 120 ? 33.008 17.135  82.621  1.00 9.43  ? 119  VAL A CA  1 
ATOM   871  C C   . VAL A 1 120 ? 33.697 15.783  82.617  1.00 13.69 ? 119  VAL A C   1 
ATOM   872  O O   . VAL A 1 120 ? 34.518 15.504  83.501  1.00 12.70 ? 119  VAL A O   1 
ATOM   873  C CB  . VAL A 1 120 ? 34.004 18.326  82.638  1.00 13.01 ? 119  VAL A CB  1 
ATOM   874  C CG1 . VAL A 1 120 ? 34.921 18.283  81.415  1.00 12.73 ? 119  VAL A CG1 1 
ATOM   875  C CG2 . VAL A 1 120 ? 33.254 19.660  82.698  1.00 12.75 ? 119  VAL A CG2 1 
ATOM   876  N N   . LEU A 1 121 ? 33.364 14.952  81.606  1.00 12.68 ? 120  LEU A N   1 
ATOM   877  C CA  . LEU A 1 121 ? 33.857 13.579  81.509  1.00 11.44 ? 120  LEU A CA  1 
ATOM   878  C C   . LEU A 1 121 ? 34.824 13.390  80.362  1.00 14.30 ? 120  LEU A C   1 
ATOM   879  O O   . LEU A 1 121 ? 34.833 14.167  79.408  1.00 14.00 ? 120  LEU A O   1 
ATOM   880  C CB  . LEU A 1 121 ? 32.653 12.639  81.253  1.00 11.38 ? 120  LEU A CB  1 
ATOM   881  C CG  . LEU A 1 121 ? 31.413 12.790  82.145  1.00 16.16 ? 120  LEU A CG  1 
ATOM   882  C CD1 . LEU A 1 121 ? 30.213 12.102  81.497  1.00 17.79 ? 120  LEU A CD1 1 
ATOM   883  C CD2 . LEU A 1 121 ? 31.665 12.243  83.532  1.00 19.45 ? 120  LEU A CD2 1 
ATOM   884  N N   . GLU A 1 122 ? 35.626 12.335  80.428  1.00 12.05 ? 121  GLU A N   1 
ATOM   885  C CA  . GLU A 1 122 ? 36.470 12.063  79.275  1.00 14.16 ? 121  GLU A CA  1 
ATOM   886  C C   . GLU A 1 122 ? 35.587 11.761  78.050  1.00 16.63 ? 121  GLU A C   1 
ATOM   887  O O   . GLU A 1 122 ? 34.465 11.232  78.194  1.00 15.46 ? 121  GLU A O   1 
ATOM   888  C CB  . GLU A 1 122 ? 37.518 10.979  79.558  1.00 16.88 ? 121  GLU A CB  1 
ATOM   889  C CG  . GLU A 1 122 ? 36.979 9.612   79.864  1.00 25.66 ? 121  GLU A CG  1 
ATOM   890  C CD  . GLU A 1 122 ? 38.055 8.643   80.314  1.00 30.82 ? 121  GLU A CD  1 
ATOM   891  O OE1 . GLU A 1 122 ? 39.139 8.597   79.687  1.00 28.91 ? 121  GLU A OE1 1 
ATOM   892  O OE2 . GLU A 1 122 ? 37.804 7.924   81.304  1.00 18.00 ? 121  GLU A OE2 1 
ATOM   893  N N   . TYR A 1 123 ? 36.046 12.212  76.859  1.00 13.08 ? 122  TYR A N   1 
ATOM   894  C CA  . TYR A 1 123 ? 35.265 12.025  75.644  1.00 11.71 ? 122  TYR A CA  1 
ATOM   895  C C   . TYR A 1 123 ? 35.877 10.916  74.822  1.00 14.45 ? 122  TYR A C   1 
ATOM   896  O O   . TYR A 1 123 ? 37.064 10.971  74.507  1.00 14.23 ? 122  TYR A O   1 
ATOM   897  C CB  . TYR A 1 123 ? 35.192 13.331  74.839  1.00 12.70 ? 122  TYR A CB  1 
ATOM   898  C CG  . TYR A 1 123 ? 34.524 13.166  73.492  1.00 12.69 ? 122  TYR A CG  1 
ATOM   899  C CD1 . TYR A 1 123 ? 33.199 12.757  73.396  1.00 14.30 ? 122  TYR A CD1 1 
ATOM   900  C CD2 . TYR A 1 123 ? 35.220 13.417  72.308  1.00 13.60 ? 122  TYR A CD2 1 
ATOM   901  C CE1 . TYR A 1 123 ? 32.574 12.608  72.162  1.00 15.29 ? 122  TYR A CE1 1 
ATOM   902  C CE2 . TYR A 1 123 ? 34.603 13.264  71.061  1.00 13.16 ? 122  TYR A CE2 1 
ATOM   903  C CZ  . TYR A 1 123 ? 33.285 12.842  70.998  1.00 16.84 ? 122  TYR A CZ  1 
ATOM   904  O OH  . TYR A 1 123 ? 32.645 12.679  69.792  1.00 17.40 ? 122  TYR A OH  1 
ATOM   905  N N   . LEU A 1 124 ? 35.061 9.931   74.447  1.00 13.11 ? 123  LEU A N   1 
ATOM   906  C CA  . LEU A 1 124 ? 35.500 8.781   73.651  1.00 13.70 ? 123  LEU A CA  1 
ATOM   907  C C   . LEU A 1 124 ? 34.816 8.911   72.285  1.00 14.71 ? 123  LEU A C   1 
ATOM   908  O O   . LEU A 1 124 ? 33.618 8.631   72.188  1.00 12.62 ? 123  LEU A O   1 
ATOM   909  C CB  . LEU A 1 124 ? 35.103 7.458   74.363  1.00 14.30 ? 123  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 124 ? 35.938 7.141   75.636  1.00 20.12 ? 123  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 124 ? 35.354 7.863   76.885  1.00 22.05 ? 123  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 124 ? 35.870 5.676   75.958  1.00 21.70 ? 123  LEU A CD2 1 
ATOM   913  N N   . PRO A 1 125 ? 35.533 9.416   71.237  1.00 12.37 ? 124  PRO A N   1 
ATOM   914  C CA  . PRO A 1 125 ? 34.881 9.626   69.932  1.00 12.13 ? 124  PRO A CA  1 
ATOM   915  C C   . PRO A 1 125 ? 34.382 8.346   69.269  1.00 15.51 ? 124  PRO A C   1 
ATOM   916  O O   . PRO A 1 125 ? 33.509 8.409   68.402  1.00 15.26 ? 124  PRO A O   1 
ATOM   917  C CB  . PRO A 1 125 ? 35.935 10.362  69.093  1.00 14.02 ? 124  PRO A CB  1 
ATOM   918  C CG  . PRO A 1 125 ? 37.232 10.057  69.751  1.00 19.03 ? 124  PRO A CG  1 
ATOM   919  C CD  . PRO A 1 125 ? 36.950 9.839   71.212  1.00 15.41 ? 124  PRO A CD  1 
ATOM   920  N N   . GLY A 1 126 ? 34.874 7.205   69.737  1.00 14.64 ? 125  GLY A N   1 
ATOM   921  C CA  . GLY A 1 126 ? 34.420 5.885   69.296  1.00 14.64 ? 125  GLY A CA  1 
ATOM   922  C C   . GLY A 1 126 ? 32.920 5.681   69.513  1.00 17.05 ? 125  GLY A C   1 
ATOM   923  O O   . GLY A 1 126 ? 32.293 4.873   68.819  1.00 15.93 ? 125  GLY A O   1 
ATOM   924  N N   . GLY A 1 127 ? 32.347 6.443   70.441  1.00 13.26 ? 126  GLY A N   1 
ATOM   925  C CA  . GLY A 1 127 ? 30.922 6.427   70.719  1.00 12.56 ? 126  GLY A CA  1 
ATOM   926  C C   . GLY A 1 127 ? 30.425 5.290   71.586  1.00 13.48 ? 126  GLY A C   1 
ATOM   927  O O   . GLY A 1 127 ? 31.220 4.597   72.227  1.00 12.80 ? 126  GLY A O   1 
ATOM   928  N N   . GLU A 1 128 ? 29.100 5.080   71.561  1.00 9.84  ? 127  GLU A N   1 
ATOM   929  C CA  . GLU A 1 128 ? 28.453 4.020   72.359  1.00 8.31  ? 127  GLU A CA  1 
ATOM   930  C C   . GLU A 1 128 ? 28.480 2.691   71.626  1.00 11.63 ? 127  GLU A C   1 
ATOM   931  O O   . GLU A 1 128 ? 28.272 2.636   70.409  1.00 10.27 ? 127  GLU A O   1 
ATOM   932  C CB  . GLU A 1 128 ? 26.988 4.371   72.642  1.00 8.65  ? 127  GLU A CB  1 
ATOM   933  C CG  . GLU A 1 128 ? 26.850 5.714   73.339  1.00 15.87 ? 127  GLU A CG  1 
ATOM   934  C CD  . GLU A 1 128 ? 25.437 6.240   73.472  1.00 22.33 ? 127  GLU A CD  1 
ATOM   935  O OE1 . GLU A 1 128 ? 24.519 5.695   72.818  1.00 15.80 ? 127  GLU A OE1 1 
ATOM   936  O OE2 . GLU A 1 128 ? 25.244 7.176   74.277  1.00 15.11 ? 127  GLU A OE2 1 
ATOM   937  N N   . MET A 1 129 ? 28.637 1.590   72.399  1.00 9.36  ? 128  MET A N   1 
ATOM   938  C CA  . MET A 1 129 ? 28.550 0.227   71.871  1.00 8.45  ? 128  MET A CA  1 
ATOM   939  C C   . MET A 1 129 ? 27.227 0.093   71.128  1.00 11.71 ? 128  MET A C   1 
ATOM   940  O O   . MET A 1 129 ? 27.162 -0.580  70.104  1.00 11.05 ? 128  MET A O   1 
ATOM   941  C CB  . MET A 1 129 ? 28.549 -0.780  73.023  1.00 10.11 ? 128  MET A CB  1 
ATOM   942  C CG  . MET A 1 129 ? 28.419 -2.230  72.542  1.00 11.66 ? 128  MET A CG  1 
ATOM   943  S SD  . MET A 1 129 ? 28.097 -3.386  73.886  1.00 13.73 ? 128  MET A SD  1 
ATOM   944  C CE  . MET A 1 129 ? 29.684 -3.309  74.757  1.00 11.46 ? 128  MET A CE  1 
ATOM   945  N N   . PHE A 1 130 ? 26.177 0.745   71.663  1.00 9.12  ? 129  PHE A N   1 
ATOM   946  C CA  . PHE A 1 130 ? 24.853 0.734   71.061  1.00 9.50  ? 129  PHE A CA  1 
ATOM   947  C C   . PHE A 1 130 ? 24.878 0.943   69.533  1.00 13.28 ? 129  PHE A C   1 
ATOM   948  O O   . PHE A 1 130 ? 24.223 0.180   68.811  1.00 11.75 ? 129  PHE A O   1 
ATOM   949  C CB  . PHE A 1 130 ? 23.953 1.806   71.726  1.00 10.76 ? 129  PHE A CB  1 
ATOM   950  C CG  . PHE A 1 130 ? 22.568 1.885   71.116  1.00 11.56 ? 129  PHE A CG  1 
ATOM   951  C CD1 . PHE A 1 130 ? 21.547 1.050   71.558  1.00 13.57 ? 129  PHE A CD1 1 
ATOM   952  C CD2 . PHE A 1 130 ? 22.297 2.770   70.076  1.00 12.84 ? 129  PHE A CD2 1 
ATOM   953  C CE1 . PHE A 1 130 ? 20.277 1.089   70.956  1.00 15.16 ? 129  PHE A CE1 1 
ATOM   954  C CE2 . PHE A 1 130 ? 21.043 2.785   69.455  1.00 15.17 ? 129  PHE A CE2 1 
ATOM   955  C CZ  . PHE A 1 130 ? 20.043 1.949   69.910  1.00 13.63 ? 129  PHE A CZ  1 
ATOM   956  N N   . SER A 1 131 ? 25.558 2.018   69.036  1.00 9.39  ? 130  SER A N   1 
ATOM   957  C CA  . SER A 1 131 ? 25.462 2.340   67.607  1.00 9.40  ? 130  SER A CA  1 
ATOM   958  C C   . SER A 1 131 ? 26.139 1.296   66.754  1.00 12.39 ? 130  SER A C   1 
ATOM   959  O O   . SER A 1 131 ? 25.625 0.921   65.700  1.00 11.11 ? 130  SER A O   1 
ATOM   960  C CB  . SER A 1 131 ? 26.047 3.724   67.336  1.00 13.68 ? 130  SER A CB  1 
ATOM   961  O OG  . SER A 1 131 ? 27.414 3.782   67.707  1.00 16.06 ? 130  SER A OG  1 
ATOM   962  N N   . HIS A 1 132 ? 27.280 0.800   67.239  1.00 10.98 ? 131  HIS A N   1 
ATOM   963  C CA  . HIS A 1 132 ? 28.063 -0.219  66.534  1.00 10.50 ? 131  HIS A CA  1 
ATOM   964  C C   . HIS A 1 132 ? 27.310 -1.540  66.551  1.00 12.13 ? 131  HIS A C   1 
ATOM   965  O O   . HIS A 1 132 ? 27.257 -2.219  65.531  1.00 11.51 ? 131  HIS A O   1 
ATOM   966  C CB  . HIS A 1 132 ? 29.443 -0.353  67.182  1.00 11.53 ? 131  HIS A CB  1 
ATOM   967  C CG  . HIS A 1 132 ? 30.232 0.925   67.115  1.00 15.10 ? 131  HIS A CG  1 
ATOM   968  N ND1 . HIS A 1 132 ? 30.827 1.352   65.927  1.00 17.32 ? 131  HIS A ND1 1 
ATOM   969  C CD2 . HIS A 1 132 ? 30.484 1.841   68.084  1.00 15.97 ? 131  HIS A CD2 1 
ATOM   970  C CE1 . HIS A 1 132 ? 31.422 2.500   66.216  1.00 16.65 ? 131  HIS A CE1 1 
ATOM   971  N NE2 . HIS A 1 132 ? 31.260 2.825   67.505  1.00 16.41 ? 131  HIS A NE2 1 
ATOM   972  N N   . LEU A 1 133 ? 26.693 -1.885  67.691  1.00 9.87  ? 132  LEU A N   1 
ATOM   973  C CA  . LEU A 1 133 ? 25.912 -3.118  67.808  1.00 9.00  ? 132  LEU A CA  1 
ATOM   974  C C   . LEU A 1 133 ? 24.716 -3.101  66.842  1.00 13.38 ? 132  LEU A C   1 
ATOM   975  O O   . LEU A 1 133 ? 24.487 -4.081  66.130  1.00 12.16 ? 132  LEU A O   1 
ATOM   976  C CB  . LEU A 1 133 ? 25.460 -3.327  69.276  1.00 8.62  ? 132  LEU A CB  1 
ATOM   977  C CG  . LEU A 1 133 ? 24.575 -4.570  69.540  1.00 13.30 ? 132  LEU A CG  1 
ATOM   978  C CD1 . LEU A 1 133 ? 25.281 -5.891  69.109  1.00 11.98 ? 132  LEU A CD1 1 
ATOM   979  C CD2 . LEU A 1 133 ? 24.166 -4.621  70.999  1.00 14.41 ? 132  LEU A CD2 1 
ATOM   980  N N   . ARG A 1 134 ? 23.966 -1.993  66.805  1.00 10.44 ? 133  ARG A N   1 
ATOM   981  C CA  . ARG A 1 134 ? 22.818 -1.900  65.888  1.00 10.62 ? 133  ARG A CA  1 
ATOM   982  C C   . ARG A 1 134 ? 23.224 -1.984  64.421  1.00 14.60 ? 133  ARG A C   1 
ATOM   983  O O   . ARG A 1 134 ? 22.545 -2.666  63.645  1.00 13.44 ? 133  ARG A O   1 
ATOM   984  C CB  . ARG A 1 134 ? 21.972 -0.639  66.167  1.00 9.98  ? 133  ARG A CB  1 
ATOM   985  C CG  . ARG A 1 134 ? 21.256 -0.698  67.520  1.00 12.41 ? 133  ARG A CG  1 
ATOM   986  C CD  . ARG A 1 134 ? 20.060 -1.680  67.503  1.00 11.74 ? 133  ARG A CD  1 
ATOM   987  N NE  . ARG A 1 134 ? 19.352 -1.635  68.790  1.00 10.35 ? 133  ARG A NE  1 
ATOM   988  C CZ  . ARG A 1 134 ? 19.708 -2.338  69.863  1.00 14.39 ? 133  ARG A CZ  1 
ATOM   989  N NH1 . ARG A 1 134 ? 20.691 -3.235  69.786  1.00 13.07 ? 133  ARG A NH1 1 
ATOM   990  N NH2 . ARG A 1 134 ? 19.079 -2.164  71.011  1.00 12.04 ? 133  ARG A NH2 1 
ATOM   991  N N   . ARG A 1 135 ? 24.310 -1.288  64.033  1.00 11.57 ? 134  ARG A N   1 
ATOM   992  C CA  . ARG A 1 135 ? 24.742 -1.254  62.639  1.00 12.65 ? 134  ARG A CA  1 
ATOM   993  C C   . ARG A 1 135 ? 25.274 -2.611  62.199  1.00 14.69 ? 134  ARG A C   1 
ATOM   994  O O   . ARG A 1 135 ? 24.832 -3.152  61.177  1.00 14.39 ? 134  ARG A O   1 
ATOM   995  C CB  . ARG A 1 135 ? 25.789 -0.127  62.424  1.00 11.80 ? 134  ARG A CB  1 
ATOM   996  C CG  . ARG A 1 135 ? 26.393 -0.131  61.017  1.00 17.20 ? 134  ARG A CG  1 
ATOM   997  C CD  . ARG A 1 135 ? 27.503 0.905   60.882  1.00 23.00 ? 134  ARG A CD  1 
ATOM   998  N NE  . ARG A 1 135 ? 28.712 0.491   61.606  1.00 29.07 ? 134  ARG A NE  1 
ATOM   999  C CZ  . ARG A 1 135 ? 29.105 0.980   62.781  1.00 38.89 ? 134  ARG A CZ  1 
ATOM   1000 N NH1 . ARG A 1 135 ? 28.403 1.940   63.383  1.00 27.55 ? 134  ARG A NH1 1 
ATOM   1001 N NH2 . ARG A 1 135 ? 30.198 0.513   63.366  1.00 21.94 ? 134  ARG A NH2 1 
ATOM   1002 N N   . ILE A 1 136 ? 26.211 -3.173  62.972  1.00 12.33 ? 135  ILE A N   1 
ATOM   1003 C CA  . ILE A 1 136 ? 26.806 -4.489  62.656  1.00 13.00 ? 135  ILE A CA  1 
ATOM   1004 C C   . ILE A 1 136 ? 25.723 -5.596  62.712  1.00 17.04 ? 135  ILE A C   1 
ATOM   1005 O O   . ILE A 1 136 ? 25.736 -6.517  61.890  1.00 18.34 ? 135  ILE A O   1 
ATOM   1006 C CB  . ILE A 1 136 ? 28.069 -4.806  63.538  1.00 17.23 ? 135  ILE A CB  1 
ATOM   1007 C CG1 . ILE A 1 136 ? 29.153 -3.689  63.383  1.00 19.00 ? 135  ILE A CG1 1 
ATOM   1008 C CG2 . ILE A 1 136 ? 28.674 -6.185  63.179  1.00 19.83 ? 135  ILE A CG2 1 
ATOM   1009 C CD1 . ILE A 1 136 ? 30.220 -3.585  64.486  1.00 23.90 ? 135  ILE A CD1 1 
ATOM   1010 N N   . GLY A 1 137 ? 24.779 -5.465  63.650  1.00 12.73 ? 136  GLY A N   1 
ATOM   1011 C CA  . GLY A 1 137 ? 23.702 -6.423  63.839  1.00 11.94 ? 136  GLY A CA  1 
ATOM   1012 C C   . GLY A 1 137 ? 23.881 -7.212  65.118  1.00 14.59 ? 136  GLY A C   1 
ATOM   1013 O O   . GLY A 1 137 ? 23.021 -7.174  65.993  1.00 13.44 ? 136  GLY A O   1 
ATOM   1014 N N   . ARG A 1 138 ? 25.006 -7.920  65.240  1.00 13.96 ? 137  ARG A N   1 
ATOM   1015 C CA  . ARG A 1 138 ? 25.318 -8.706  66.431  1.00 13.56 ? 137  ARG A CA  1 
ATOM   1016 C C   . ARG A 1 138 ? 26.829 -8.918  66.538  1.00 17.84 ? 137  ARG A C   1 
ATOM   1017 O O   . ARG A 1 138 ? 27.553 -8.730  65.543  1.00 17.76 ? 137  ARG A O   1 
ATOM   1018 C CB  . ARG A 1 138 ? 24.547 -10.048 66.454  1.00 14.35 ? 137  ARG A CB  1 
ATOM   1019 C CG  . ARG A 1 138 ? 24.830 -11.031 65.308  1.00 18.81 ? 137  ARG A CG  1 
ATOM   1020 C CD  . ARG A 1 138 ? 24.258 -12.396 65.670  1.00 20.95 ? 137  ARG A CD  1 
ATOM   1021 N NE  . ARG A 1 138 ? 24.428 -13.418 64.633  1.00 31.89 ? 137  ARG A NE  1 
ATOM   1022 C CZ  . ARG A 1 138 ? 25.390 -14.344 64.602  1.00 54.37 ? 137  ARG A CZ  1 
ATOM   1023 N NH1 . ARG A 1 138 ? 26.344 -14.360 65.534  1.00 30.79 ? 137  ARG A NH1 1 
ATOM   1024 N NH2 . ARG A 1 138 ? 25.420 -15.246 63.628  1.00 49.60 ? 137  ARG A NH2 1 
ATOM   1025 N N   . PHE A 1 139 ? 27.293 -9.322  67.734  1.00 13.25 ? 138  PHE A N   1 
ATOM   1026 C CA  . PHE A 1 139 ? 28.695 -9.632  67.976  1.00 12.38 ? 138  PHE A CA  1 
ATOM   1027 C C   . PHE A 1 139 ? 28.845 -11.158 68.129  1.00 16.34 ? 138  PHE A C   1 
ATOM   1028 O O   . PHE A 1 139 ? 28.019 -11.799 68.774  1.00 16.01 ? 138  PHE A O   1 
ATOM   1029 C CB  . PHE A 1 139 ? 29.214 -8.907  69.237  1.00 12.82 ? 138  PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 139 ? 29.075 -7.393  69.275  1.00 12.47 ? 138  PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 139 ? 29.214 -6.630  68.111  1.00 13.56 ? 138  PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 139 ? 28.912 -6.723  70.486  1.00 11.55 ? 138  PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 139 ? 29.158 -5.238  68.158  1.00 13.65 ? 138  PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 139 ? 28.811 -5.322  70.525  1.00 12.81 ? 138  PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 139 ? 28.960 -4.585  69.363  1.00 11.17 ? 138  PHE A CZ  1 
HETATM 1036 N N   . SEP A 1 140 ? 29.888 -11.740 67.525  1.00 14.19 ? 139  SEP A N   1 
HETATM 1037 C CA  . SEP A 1 140 ? 30.152 -13.169 67.658  1.00 16.24 ? 139  SEP A CA  1 
HETATM 1038 C CB  . SEP A 1 140 ? 31.399 -13.460 66.793  1.00 19.74 ? 139  SEP A CB  1 
HETATM 1039 O OG  . SEP A 1 140 ? 32.540 -12.824 67.425  1.00 24.20 ? 139  SEP A OG  1 
HETATM 1040 C C   . SEP A 1 140 ? 30.462 -13.447 69.147  1.00 18.53 ? 139  SEP A C   1 
HETATM 1041 O O   . SEP A 1 140 ? 30.787 -12.513 69.881  1.00 17.50 ? 139  SEP A O   1 
HETATM 1042 P P   . SEP A 1 140 ? 33.818 -12.882 66.504  1.00 30.42 ? 139  SEP A P   1 
HETATM 1043 O O1P . SEP A 1 140 ? 33.752 -11.796 65.411  1.00 28.86 ? 139  SEP A O1P 1 
HETATM 1044 O O2P . SEP A 1 140 ? 34.957 -12.568 67.435  1.00 31.02 ? 139  SEP A O2P 1 
HETATM 1045 O O3P . SEP A 1 140 ? 34.041 -14.315 65.983  1.00 32.29 ? 139  SEP A O3P 1 
ATOM   1046 N N   . GLU A 1 141 ? 30.363 -14.707 69.585  1.00 14.85 ? 140  GLU A N   1 
ATOM   1047 C CA  . GLU A 1 141 ? 30.624 -15.032 70.998  1.00 13.46 ? 140  GLU A CA  1 
ATOM   1048 C C   . GLU A 1 141 ? 31.976 -14.543 71.552  1.00 16.80 ? 140  GLU A C   1 
ATOM   1049 O O   . GLU A 1 141 ? 31.956 -13.938 72.617  1.00 15.81 ? 140  GLU A O   1 
ATOM   1050 C CB  . GLU A 1 141 ? 30.328 -16.502 71.301  1.00 14.77 ? 140  GLU A CB  1 
ATOM   1051 C CG  . GLU A 1 141 ? 28.856 -16.799 71.053  1.00 14.46 ? 140  GLU A CG  1 
ATOM   1052 C CD  . GLU A 1 141 ? 28.301 -18.080 71.641  1.00 19.46 ? 140  GLU A CD  1 
ATOM   1053 O OE1 . GLU A 1 141 ? 28.873 -18.596 72.631  1.00 16.48 ? 140  GLU A OE1 1 
ATOM   1054 O OE2 . GLU A 1 141 ? 27.300 -18.581 71.086  1.00 17.15 ? 140  GLU A OE2 1 
ATOM   1055 N N   . PRO A 1 142 ? 33.135 -14.691 70.865  1.00 16.40 ? 141  PRO A N   1 
ATOM   1056 C CA  . PRO A 1 142 ? 34.398 -14.156 71.427  1.00 15.86 ? 141  PRO A CA  1 
ATOM   1057 C C   . PRO A 1 142 ? 34.363 -12.628 71.619  1.00 18.05 ? 141  PRO A C   1 
ATOM   1058 O O   . PRO A 1 142 ? 34.928 -12.107 72.603  1.00 15.51 ? 141  PRO A O   1 
ATOM   1059 C CB  . PRO A 1 142 ? 35.436 -14.567 70.382  1.00 17.95 ? 141  PRO A CB  1 
ATOM   1060 C CG  . PRO A 1 142 ? 34.846 -15.824 69.757  1.00 23.37 ? 141  PRO A CG  1 
ATOM   1061 C CD  . PRO A 1 142 ? 33.400 -15.425 69.605  1.00 18.98 ? 141  PRO A CD  1 
ATOM   1062 N N   . HIS A 1 143 ? 33.697 -11.914 70.679  1.00 14.50 ? 142  HIS A N   1 
ATOM   1063 C CA  . HIS A 1 143 ? 33.556 -10.448 70.665  1.00 12.80 ? 142  HIS A CA  1 
ATOM   1064 C C   . HIS A 1 143 ? 32.688 -10.024 71.870  1.00 15.17 ? 142  HIS A C   1 
ATOM   1065 O O   . HIS A 1 143 ? 33.081 -9.133  72.633  1.00 12.41 ? 142  HIS A O   1 
ATOM   1066 C CB  . HIS A 1 143 ? 32.913 -9.995  69.327  1.00 13.63 ? 142  HIS A CB  1 
ATOM   1067 C CG  . HIS A 1 143 ? 32.907 -8.511  69.063  1.00 16.17 ? 142  HIS A CG  1 
ATOM   1068 N ND1 . HIS A 1 143 ? 32.716 -8.016  67.778  1.00 17.94 ? 142  HIS A ND1 1 
ATOM   1069 C CD2 . HIS A 1 143 ? 33.053 -7.460  69.911  1.00 17.97 ? 142  HIS A CD2 1 
ATOM   1070 C CE1 . HIS A 1 143 ? 32.750 -6.694  67.881  1.00 16.98 ? 142  HIS A CE1 1 
ATOM   1071 N NE2 . HIS A 1 143 ? 32.967 -6.304  69.142  1.00 17.19 ? 142  HIS A NE2 1 
ATOM   1072 N N   . ALA A 1 144 ? 31.525 -10.687 72.055  1.00 12.86 ? 143  ALA A N   1 
ATOM   1073 C CA  . ALA A 1 144 ? 30.618 -10.373 73.173  1.00 12.45 ? 143  ALA A CA  1 
ATOM   1074 C C   . ALA A 1 144 ? 31.312 -10.718 74.491  1.00 15.73 ? 143  ALA A C   1 
ATOM   1075 O O   . ALA A 1 144 ? 31.179 -9.969  75.452  1.00 15.52 ? 143  ALA A O   1 
ATOM   1076 C CB  . ALA A 1 144 ? 29.324 -11.171 73.046  1.00 12.92 ? 143  ALA A CB  1 
ATOM   1077 N N   . ARG A 1 145 ? 32.093 -11.824 74.509  1.00 12.43 ? 144  ARG A N   1 
ATOM   1078 C CA  . ARG A 1 145 ? 32.800 -12.268 75.717  1.00 12.31 ? 144  ARG A CA  1 
ATOM   1079 C C   . ARG A 1 145 ? 33.827 -11.245 76.199  1.00 14.03 ? 144  ARG A C   1 
ATOM   1080 O O   . ARG A 1 145 ? 33.968 -11.007 77.407  1.00 14.08 ? 144  ARG A O   1 
ATOM   1081 C CB  . ARG A 1 145 ? 33.453 -13.641 75.470  1.00 13.18 ? 144  ARG A CB  1 
ATOM   1082 C CG  . ARG A 1 145 ? 34.280 -14.160 76.669  1.00 15.01 ? 144  ARG A CG  1 
ATOM   1083 C CD  . ARG A 1 145 ? 34.499 -15.657 76.603  1.00 19.04 ? 144  ARG A CD  1 
ATOM   1084 N NE  . ARG A 1 145 ? 34.981 -16.048 75.286  1.00 20.48 ? 144  ARG A NE  1 
ATOM   1085 C CZ  . ARG A 1 145 ? 34.397 -16.939 74.489  1.00 24.73 ? 144  ARG A CZ  1 
ATOM   1086 N NH1 . ARG A 1 145 ? 33.310 -17.588 74.888  1.00 16.71 ? 144  ARG A NH1 1 
ATOM   1087 N NH2 . ARG A 1 145 ? 34.903 -17.194 73.295  1.00 16.67 ? 144  ARG A NH2 1 
ATOM   1088 N N   . PHE A 1 146 ? 34.562 -10.659 75.247  1.00 12.10 ? 145  PHE A N   1 
ATOM   1089 C CA  . PHE A 1 146 ? 35.592 -9.662  75.523  1.00 12.46 ? 145  PHE A CA  1 
ATOM   1090 C C   . PHE A 1 146 ? 34.946 -8.469  76.256  1.00 15.59 ? 145  PHE A C   1 
ATOM   1091 O O   . PHE A 1 146 ? 35.463 -8.023  77.276  1.00 15.50 ? 145  PHE A O   1 
ATOM   1092 C CB  . PHE A 1 146 ? 36.226 -9.224  74.200  1.00 14.19 ? 145  PHE A CB  1 
ATOM   1093 C CG  . PHE A 1 146 ? 37.123 -8.017  74.310  1.00 15.42 ? 145  PHE A CG  1 
ATOM   1094 C CD1 . PHE A 1 146 ? 38.414 -8.133  74.822  1.00 19.36 ? 145  PHE A CD1 1 
ATOM   1095 C CD2 . PHE A 1 146 ? 36.676 -6.761  73.914  1.00 16.70 ? 145  PHE A CD2 1 
ATOM   1096 C CE1 . PHE A 1 146 ? 39.242 -7.008  74.948  1.00 20.37 ? 145  PHE A CE1 1 
ATOM   1097 C CE2 . PHE A 1 146 ? 37.522 -5.642  73.995  1.00 19.46 ? 145  PHE A CE2 1 
ATOM   1098 C CZ  . PHE A 1 146 ? 38.793 -5.773  74.523  1.00 19.27 ? 145  PHE A CZ  1 
ATOM   1099 N N   . TYR A 1 147 ? 33.788 -7.984  75.756  1.00 11.47 ? 146  TYR A N   1 
ATOM   1100 C CA  . TYR A 1 147 ? 33.095 -6.890  76.436  1.00 9.91  ? 146  TYR A CA  1 
ATOM   1101 C C   . TYR A 1 147 ? 32.556 -7.346  77.789  1.00 12.89 ? 146  TYR A C   1 
ATOM   1102 O O   . TYR A 1 147 ? 32.700 -6.626  78.787  1.00 11.75 ? 146  TYR A O   1 
ATOM   1103 C CB  . TYR A 1 147 ? 31.947 -6.356  75.574  1.00 10.92 ? 146  TYR A CB  1 
ATOM   1104 C CG  . TYR A 1 147 ? 32.400 -5.709  74.292  1.00 11.85 ? 146  TYR A CG  1 
ATOM   1105 C CD1 . TYR A 1 147 ? 33.560 -4.933  74.249  1.00 14.29 ? 146  TYR A CD1 1 
ATOM   1106 C CD2 . TYR A 1 147 ? 31.630 -5.802  73.137  1.00 12.83 ? 146  TYR A CD2 1 
ATOM   1107 C CE1 . TYR A 1 147 ? 33.976 -4.322  73.067  1.00 15.36 ? 146  TYR A CE1 1 
ATOM   1108 C CE2 . TYR A 1 147 ? 32.016 -5.172  71.962  1.00 12.97 ? 146  TYR A CE2 1 
ATOM   1109 C CZ  . TYR A 1 147 ? 33.197 -4.447  71.927  1.00 16.07 ? 146  TYR A CZ  1 
ATOM   1110 O OH  . TYR A 1 147 ? 33.598 -3.891  70.743  1.00 18.15 ? 146  TYR A OH  1 
ATOM   1111 N N   . ALA A 1 148 ? 31.889 -8.530  77.822  1.00 11.09 ? 147  ALA A N   1 
ATOM   1112 C CA  . ALA A 1 148 ? 31.302 -9.079  79.052  1.00 11.39 ? 147  ALA A CA  1 
ATOM   1113 C C   . ALA A 1 148 ? 32.343 -9.219  80.176  1.00 13.55 ? 147  ALA A C   1 
ATOM   1114 O O   . ALA A 1 148 ? 32.043 -8.862  81.314  1.00 12.48 ? 147  ALA A O   1 
ATOM   1115 C CB  . ALA A 1 148 ? 30.646 -10.424 78.770  1.00 12.06 ? 147  ALA A CB  1 
ATOM   1116 N N   . ALA A 1 149 ? 33.580 -9.646  79.845  1.00 11.57 ? 148  ALA A N   1 
ATOM   1117 C CA  . ALA A 1 149 ? 34.651 -9.793  80.835  1.00 11.33 ? 148  ALA A CA  1 
ATOM   1118 C C   . ALA A 1 149 ? 34.942 -8.455  81.508  1.00 14.51 ? 148  ALA A C   1 
ATOM   1119 O O   . ALA A 1 149 ? 35.095 -8.409  82.731  1.00 13.63 ? 148  ALA A O   1 
ATOM   1120 C CB  . ALA A 1 149 ? 35.914 -10.342 80.184  1.00 13.34 ? 148  ALA A CB  1 
ATOM   1121 N N   . GLN A 1 150 ? 34.916 -7.352  80.723  1.00 11.48 ? 149  GLN A N   1 
ATOM   1122 C CA  . GLN A 1 150 ? 35.154 -6.008  81.261  1.00 10.79 ? 149  GLN A CA  1 
ATOM   1123 C C   . GLN A 1 150 ? 34.070 -5.592  82.226  1.00 13.50 ? 149  GLN A C   1 
ATOM   1124 O O   . GLN A 1 150 ? 34.375 -5.012  83.262  1.00 11.69 ? 149  GLN A O   1 
ATOM   1125 C CB  . GLN A 1 150 ? 35.322 -4.991  80.127  1.00 11.25 ? 149  GLN A CB  1 
ATOM   1126 C CG  . GLN A 1 150 ? 36.603 -5.284  79.329  1.00 14.25 ? 149  GLN A CG  1 
ATOM   1127 C CD  . GLN A 1 150 ? 36.645 -4.473  78.064  1.00 18.63 ? 149  GLN A CD  1 
ATOM   1128 O OE1 . GLN A 1 150 ? 36.820 -3.253  78.093  1.00 16.51 ? 149  GLN A OE1 1 
ATOM   1129 N NE2 . GLN A 1 150 ? 36.548 -5.138  76.921  1.00 15.99 ? 149  GLN A NE2 1 
ATOM   1130 N N   . ILE A 1 151 ? 32.809 -5.926  81.909  1.00 9.95  ? 150  ILE A N   1 
ATOM   1131 C CA  . ILE A 1 151 ? 31.668 -5.596  82.776  1.00 9.22  ? 150  ILE A CA  1 
ATOM   1132 C C   . ILE A 1 151 ? 31.764 -6.423  84.066  1.00 11.59 ? 150  ILE A C   1 
ATOM   1133 O O   . ILE A 1 151 ? 31.514 -5.899  85.137  1.00 9.46  ? 150  ILE A O   1 
ATOM   1134 C CB  . ILE A 1 151 ? 30.324 -5.816  82.048  1.00 11.77 ? 150  ILE A CB  1 
ATOM   1135 C CG1 . ILE A 1 151 ? 30.234 -4.942  80.759  1.00 10.88 ? 150  ILE A CG1 1 
ATOM   1136 C CG2 . ILE A 1 151 ? 29.120 -5.543  83.009  1.00 12.07 ? 150  ILE A CG2 1 
ATOM   1137 C CD1 . ILE A 1 151 ? 30.497 -3.411  80.986  1.00 14.41 ? 150  ILE A CD1 1 
ATOM   1138 N N   . VAL A 1 152 ? 32.109 -7.715  83.973  1.00 10.40 ? 151  VAL A N   1 
ATOM   1139 C CA  . VAL A 1 152 ? 32.230 -8.561  85.181  1.00 10.35 ? 151  VAL A CA  1 
ATOM   1140 C C   . VAL A 1 152 ? 33.249 -7.929  86.145  1.00 13.84 ? 151  VAL A C   1 
ATOM   1141 O O   . VAL A 1 152 ? 32.964 -7.742  87.334  1.00 13.97 ? 151  VAL A O   1 
ATOM   1142 C CB  . VAL A 1 152 ? 32.599 -10.012 84.793  1.00 14.25 ? 151  VAL A CB  1 
ATOM   1143 C CG1 . VAL A 1 152 ? 32.962 -10.857 86.028  1.00 14.31 ? 151  VAL A CG1 1 
ATOM   1144 C CG2 . VAL A 1 152 ? 31.459 -10.653 84.016  1.00 14.54 ? 151  VAL A CG2 1 
ATOM   1145 N N   . LEU A 1 153 ? 34.420 -7.559  85.622  1.00 12.46 ? 152  LEU A N   1 
ATOM   1146 C CA  . LEU A 1 153 ? 35.457 -6.937  86.463  1.00 11.83 ? 152  LEU A CA  1 
ATOM   1147 C C   . LEU A 1 153 ? 34.991 -5.584  87.026  1.00 13.91 ? 152  LEU A C   1 
ATOM   1148 O O   . LEU A 1 153 ? 35.283 -5.256  88.187  1.00 13.18 ? 152  LEU A O   1 
ATOM   1149 C CB  . LEU A 1 153 ? 36.740 -6.754  85.658  1.00 11.19 ? 152  LEU A CB  1 
ATOM   1150 C CG  . LEU A 1 153 ? 37.512 -8.045  85.324  1.00 14.47 ? 152  LEU A CG  1 
ATOM   1151 C CD1 . LEU A 1 153 ? 38.641 -7.738  84.367  1.00 15.18 ? 152  LEU A CD1 1 
ATOM   1152 C CD2 . LEU A 1 153 ? 38.022 -8.721  86.607  1.00 15.29 ? 152  LEU A CD2 1 
ATOM   1153 N N   . THR A 1 154 ? 34.271 -4.806  86.204  1.00 9.82  ? 153  THR A N   1 
ATOM   1154 C CA  . THR A 1 154 ? 33.770 -3.494  86.625  1.00 9.47  ? 153  THR A CA  1 
ATOM   1155 C C   . THR A 1 154 ? 32.760 -3.645  87.774  1.00 12.21 ? 153  THR A C   1 
ATOM   1156 O O   . THR A 1 154 ? 32.834 -2.903  88.734  1.00 11.87 ? 153  THR A O   1 
ATOM   1157 C CB  . THR A 1 154 ? 33.224 -2.724  85.427  1.00 13.47 ? 153  THR A CB  1 
ATOM   1158 O OG1 . THR A 1 154 ? 34.318 -2.483  84.541  1.00 11.26 ? 153  THR A OG1 1 
ATOM   1159 C CG2 . THR A 1 154 ? 32.623 -1.377  85.833  1.00 13.29 ? 153  THR A CG2 1 
ATOM   1160 N N   . PHE A 1 155 ? 31.834 -4.598  87.672  1.00 9.99  ? 154  PHE A N   1 
ATOM   1161 C CA  . PHE A 1 155 ? 30.867 -4.837  88.730  1.00 9.57  ? 154  PHE A CA  1 
ATOM   1162 C C   . PHE A 1 155 ? 31.560 -5.406  89.968  1.00 13.55 ? 154  PHE A C   1 
ATOM   1163 O O   . PHE A 1 155 ? 31.208 -5.012  91.075  1.00 14.06 ? 154  PHE A O   1 
ATOM   1164 C CB  . PHE A 1 155 ? 29.714 -5.737  88.250  1.00 11.06 ? 154  PHE A CB  1 
ATOM   1165 C CG  . PHE A 1 155 ? 28.700 -5.089  87.328  1.00 12.18 ? 154  PHE A CG  1 
ATOM   1166 C CD1 . PHE A 1 155 ? 28.710 -3.711  87.107  1.00 13.33 ? 154  PHE A CD1 1 
ATOM   1167 C CD2 . PHE A 1 155 ? 27.702 -5.849  86.723  1.00 12.27 ? 154  PHE A CD2 1 
ATOM   1168 C CE1 . PHE A 1 155 ? 27.743 -3.103  86.300  1.00 13.63 ? 154  PHE A CE1 1 
ATOM   1169 C CE2 . PHE A 1 155 ? 26.741 -5.239  85.904  1.00 12.76 ? 154  PHE A CE2 1 
ATOM   1170 C CZ  . PHE A 1 155 ? 26.774 -3.869  85.694  1.00 11.32 ? 154  PHE A CZ  1 
ATOM   1171 N N   . GLU A 1 156 ? 32.578 -6.278  89.803  1.00 12.14 ? 155  GLU A N   1 
ATOM   1172 C CA  . GLU A 1 156 ? 33.330 -6.780  90.952  1.00 12.09 ? 155  GLU A CA  1 
ATOM   1173 C C   . GLU A 1 156 ? 33.906 -5.571  91.720  1.00 14.70 ? 155  GLU A C   1 
ATOM   1174 O O   . GLU A 1 156 ? 33.788 -5.513  92.943  1.00 13.63 ? 155  GLU A O   1 
ATOM   1175 C CB  . GLU A 1 156 ? 34.460 -7.703  90.473  1.00 13.94 ? 155  GLU A CB  1 
ATOM   1176 C CG  . GLU A 1 156 ? 35.225 -8.302  91.645  1.00 16.26 ? 155  GLU A CG  1 
ATOM   1177 C CD  . GLU A 1 156 ? 36.262 -9.332  91.260  1.00 29.55 ? 155  GLU A CD  1 
ATOM   1178 O OE1 . GLU A 1 156 ? 36.767 -9.271  90.121  1.00 20.36 ? 155  GLU A OE1 1 
ATOM   1179 O OE2 . GLU A 1 156 ? 36.610 -10.167 92.121  1.00 23.86 ? 155  GLU A OE2 1 
ATOM   1180 N N   . TYR A 1 157 ? 34.485 -4.587  90.996  1.00 11.70 ? 156  TYR A N   1 
ATOM   1181 C CA  . TYR A 1 157 ? 35.027 -3.363  91.590  1.00 11.56 ? 156  TYR A CA  1 
ATOM   1182 C C   . TYR A 1 157 ? 33.922 -2.528  92.270  1.00 14.23 ? 156  TYR A C   1 
ATOM   1183 O O   . TYR A 1 157 ? 34.050 -2.195  93.448  1.00 14.01 ? 156  TYR A O   1 
ATOM   1184 C CB  . TYR A 1 157 ? 35.765 -2.525  90.517  1.00 12.62 ? 156  TYR A CB  1 
ATOM   1185 C CG  . TYR A 1 157 ? 36.182 -1.144  90.972  1.00 12.69 ? 156  TYR A CG  1 
ATOM   1186 C CD1 . TYR A 1 157 ? 37.351 -0.951  91.708  1.00 14.97 ? 156  TYR A CD1 1 
ATOM   1187 C CD2 . TYR A 1 157 ? 35.399 -0.025  90.678  1.00 12.65 ? 156  TYR A CD2 1 
ATOM   1188 C CE1 . TYR A 1 157 ? 37.703 0.319   92.186  1.00 15.63 ? 156  TYR A CE1 1 
ATOM   1189 C CE2 . TYR A 1 157 ? 35.746 1.242   91.137  1.00 12.13 ? 156  TYR A CE2 1 
ATOM   1190 C CZ  . TYR A 1 157 ? 36.914 1.416   91.868  1.00 16.10 ? 156  TYR A CZ  1 
ATOM   1191 O OH  . TYR A 1 157 ? 37.241 2.673   92.326  1.00 15.13 ? 156  TYR A OH  1 
ATOM   1192 N N   . LEU A 1 158 ? 32.851 -2.185  91.523  1.00 10.55 ? 157  LEU A N   1 
ATOM   1193 C CA  . LEU A 1 158 ? 31.777 -1.334  92.054  1.00 9.05  ? 157  LEU A CA  1 
ATOM   1194 C C   . LEU A 1 158 ? 31.083 -1.960  93.246  1.00 13.69 ? 157  LEU A C   1 
ATOM   1195 O O   . LEU A 1 158 ? 30.908 -1.297  94.274  1.00 12.11 ? 157  LEU A O   1 
ATOM   1196 C CB  . LEU A 1 158 ? 30.731 -1.037  90.980  1.00 8.75  ? 157  LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 158 ? 31.184 -0.184  89.817  1.00 11.93 ? 157  LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 158 ? 30.046 -0.077  88.790  1.00 11.82 ? 157  LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 158 ? 31.662 1.208   90.285  1.00 12.76 ? 157  LEU A CD2 1 
ATOM   1200 N N   . HIS A 1 159 ? 30.708 -3.242  93.117  1.00 11.59 ? 158  HIS A N   1 
ATOM   1201 C CA  . HIS A 1 159 ? 30.012 -3.940  94.196  1.00 12.14 ? 158  HIS A CA  1 
ATOM   1202 C C   . HIS A 1 159 ? 30.865 -4.038  95.473  1.00 14.84 ? 158  HIS A C   1 
ATOM   1203 O O   . HIS A 1 159 ? 30.308 -3.921  96.556  1.00 14.73 ? 158  HIS A O   1 
ATOM   1204 C CB  . HIS A 1 159 ? 29.520 -5.321  93.743  1.00 12.27 ? 158  HIS A CB  1 
ATOM   1205 C CG  . HIS A 1 159 ? 28.468 -5.258  92.673  1.00 13.23 ? 158  HIS A CG  1 
ATOM   1206 N ND1 . HIS A 1 159 ? 28.001 -6.408  92.059  1.00 14.35 ? 158  HIS A ND1 1 
ATOM   1207 C CD2 . HIS A 1 159 ? 27.817 -4.186  92.147  1.00 13.02 ? 158  HIS A CD2 1 
ATOM   1208 C CE1 . HIS A 1 159 ? 27.106 -6.000  91.168  1.00 12.49 ? 158  HIS A CE1 1 
ATOM   1209 N NE2 . HIS A 1 159 ? 26.983 -4.671  91.169  1.00 12.65 ? 158  HIS A NE2 1 
ATOM   1210 N N   . SER A 1 160 ? 32.204 -4.140  95.341  1.00 12.66 ? 159  SER A N   1 
ATOM   1211 C CA  . SER A 1 160 ? 33.117 -4.210  96.501  1.00 12.39 ? 159  SER A CA  1 
ATOM   1212 C C   . SER A 1 160 ? 33.087 -2.918  97.322  1.00 15.55 ? 159  SER A C   1 
ATOM   1213 O O   . SER A 1 160 ? 33.387 -2.944  98.524  1.00 17.03 ? 159  SER A O   1 
ATOM   1214 C CB  . SER A 1 160 ? 34.547 -4.520  96.058  1.00 13.70 ? 159  SER A CB  1 
ATOM   1215 O OG  . SER A 1 160 ? 35.206 -3.383  95.524  1.00 15.76 ? 159  SER A OG  1 
ATOM   1216 N N   . LEU A 1 161 ? 32.683 -1.806  96.666  1.00 12.97 ? 160  LEU A N   1 
ATOM   1217 C CA  . LEU A 1 161 ? 32.598 -0.477  97.275  1.00 13.24 ? 160  LEU A CA  1 
ATOM   1218 C C   . LEU A 1 161 ? 31.188 -0.198  97.765  1.00 16.04 ? 160  LEU A C   1 
ATOM   1219 O O   . LEU A 1 161 ? 30.886 0.937   98.163  1.00 14.50 ? 160  LEU A O   1 
ATOM   1220 C CB  . LEU A 1 161 ? 33.044 0.591   96.269  1.00 13.07 ? 160  LEU A CB  1 
ATOM   1221 C CG  . LEU A 1 161 ? 34.468 0.455   95.674  1.00 17.16 ? 160  LEU A CG  1 
ATOM   1222 C CD1 . LEU A 1 161 ? 34.690 1.544   94.612  1.00 16.61 ? 160  LEU A CD1 1 
ATOM   1223 C CD2 . LEU A 1 161 ? 35.544 0.540   96.754  1.00 19.36 ? 160  LEU A CD2 1 
ATOM   1224 N N   . ASP A 1 162 ? 30.326 -1.242  97.758  1.00 12.52 ? 161  ASP A N   1 
ATOM   1225 C CA  . ASP A 1 162 ? 28.894 -1.166  98.131  1.00 11.80 ? 161  ASP A CA  1 
ATOM   1226 C C   . ASP A 1 162 ? 28.097 -0.309  97.147  1.00 14.67 ? 161  ASP A C   1 
ATOM   1227 O O   . ASP A 1 162 ? 27.066 0.270   97.509  1.00 13.71 ? 161  ASP A O   1 
ATOM   1228 C CB  . ASP A 1 162 ? 28.709 -0.643  99.570  1.00 12.35 ? 161  ASP A CB  1 
ATOM   1229 C CG  . ASP A 1 162 ? 29.601 -1.377  100.552 1.00 17.59 ? 161  ASP A CG  1 
ATOM   1230 O OD1 . ASP A 1 162 ? 29.429 -2.597  100.698 1.00 19.26 ? 161  ASP A OD1 1 
ATOM   1231 O OD2 . ASP A 1 162 ? 30.584 -0.766  101.028 1.00 18.53 ? 161  ASP A OD2 1 
ATOM   1232 N N   . LEU A 1 163 ? 28.560 -0.247  95.901  1.00 11.56 ? 162  LEU A N   1 
ATOM   1233 C CA  . LEU A 1 163 ? 27.842 0.528   94.903  1.00 11.26 ? 162  LEU A CA  1 
ATOM   1234 C C   . LEU A 1 163 ? 27.007 -0.367  94.007  1.00 16.86 ? 162  LEU A C   1 
ATOM   1235 O O   . LEU A 1 163 ? 27.485 -1.435  93.580  1.00 18.43 ? 162  LEU A O   1 
ATOM   1236 C CB  . LEU A 1 163 ? 28.826 1.305   94.025  1.00 10.96 ? 162  LEU A CB  1 
ATOM   1237 C CG  . LEU A 1 163 ? 29.830 2.218   94.747  1.00 14.88 ? 162  LEU A CG  1 
ATOM   1238 C CD1 . LEU A 1 163 ? 30.968 2.633   93.804  1.00 15.96 ? 162  LEU A CD1 1 
ATOM   1239 C CD2 . LEU A 1 163 ? 29.124 3.480   95.262  1.00 15.59 ? 162  LEU A CD2 1 
ATOM   1240 N N   A ILE A 1 164 ? 25.754 0.037   93.733  0.50 11.22 ? 163  ILE A N   1 
ATOM   1241 N N   B ILE A 1 164 ? 25.773 0.067   93.747  0.50 10.44 ? 163  ILE A N   1 
ATOM   1242 C CA  A ILE A 1 164 ? 24.895 -0.671  92.774  0.50 10.99 ? 163  ILE A CA  1 
ATOM   1243 C CA  B ILE A 1 164 ? 24.837 -0.580  92.837  0.50 9.94  ? 163  ILE A CA  1 
ATOM   1244 C C   A ILE A 1 164 ? 24.778 0.281   91.590  0.50 13.75 ? 163  ILE A C   1 
ATOM   1245 C C   B ILE A 1 164 ? 24.822 0.332   91.587  0.50 13.03 ? 163  ILE A C   1 
ATOM   1246 O O   A ILE A 1 164 ? 24.529 1.466   91.782  0.50 12.69 ? 163  ILE A O   1 
ATOM   1247 O O   B ILE A 1 164 ? 24.779 1.549   91.740  0.50 11.80 ? 163  ILE A O   1 
ATOM   1248 C CB  A ILE A 1 164 ? 23.525 -1.162  93.289  0.50 14.44 ? 163  ILE A CB  1 
ATOM   1249 C CB  B ILE A 1 164 ? 23.457 -0.810  93.524  0.50 13.16 ? 163  ILE A CB  1 
ATOM   1250 C CG1 A ILE A 1 164 ? 23.630 -1.830  94.672  0.50 15.57 ? 163  ILE A CG1 1 
ATOM   1251 C CG1 B ILE A 1 164 ? 22.598 -1.847  92.758  0.50 14.88 ? 163  ILE A CG1 1 
ATOM   1252 C CG2 A ILE A 1 164 ? 22.888 -2.127  92.245  0.50 16.11 ? 163  ILE A CG2 1 
ATOM   1253 C CG2 B ILE A 1 164 ? 22.690 0.500   93.838  0.50 12.54 ? 163  ILE A CG2 1 
ATOM   1254 C CD1 A ILE A 1 164 ? 22.260 -2.134  95.310  0.50 19.94 ? 163  ILE A CD1 1 
ATOM   1255 C CD1 B ILE A 1 164 ? 21.295 -2.257  93.429  0.50 22.81 ? 163  ILE A CD1 1 
ATOM   1256 N N   . TYR A 1 165 ? 24.981 -0.231  90.376  1.00 9.58  ? 164  TYR A N   1 
ATOM   1257 C CA  . TYR A 1 165 ? 25.022 0.606   89.171  1.00 8.96  ? 164  TYR A CA  1 
ATOM   1258 C C   . TYR A 1 165 ? 23.657 1.007   88.603  1.00 10.56 ? 164  TYR A C   1 
ATOM   1259 O O   . TYR A 1 165 ? 23.409 2.182   88.351  1.00 12.56 ? 164  TYR A O   1 
ATOM   1260 C CB  . TYR A 1 165 ? 25.981 -0.026  88.131  1.00 9.19  ? 164  TYR A CB  1 
ATOM   1261 C CG  . TYR A 1 165 ? 25.981 0.744   86.832  1.00 10.17 ? 164  TYR A CG  1 
ATOM   1262 C CD1 . TYR A 1 165 ? 26.421 2.066   86.783  1.00 11.28 ? 164  TYR A CD1 1 
ATOM   1263 C CD2 . TYR A 1 165 ? 25.487 0.175   85.661  1.00 11.11 ? 164  TYR A CD2 1 
ATOM   1264 C CE1 . TYR A 1 165 ? 26.364 2.807   85.604  1.00 13.57 ? 164  TYR A CE1 1 
ATOM   1265 C CE2 . TYR A 1 165 ? 25.449 0.901   84.468  1.00 10.56 ? 164  TYR A CE2 1 
ATOM   1266 C CZ  . TYR A 1 165 ? 25.866 2.224   84.451  1.00 17.34 ? 164  TYR A CZ  1 
ATOM   1267 O OH  . TYR A 1 165 ? 25.812 2.967   83.304  1.00 12.23 ? 164  TYR A OH  1 
ATOM   1268 N N   . ARG A 1 166 ? 22.809 0.009   88.351  1.00 8.83  ? 165  ARG A N   1 
ATOM   1269 C CA  . ARG A 1 166 ? 21.413 0.142   87.978  1.00 9.19  ? 165  ARG A CA  1 
ATOM   1270 C C   . ARG A 1 166 ? 21.044 0.665   86.591  1.00 11.88 ? 165  ARG A C   1 
ATOM   1271 O O   . ARG A 1 166 ? 19.864 0.953   86.380  1.00 12.14 ? 165  ARG A O   1 
ATOM   1272 C CB  . ARG A 1 166 ? 20.621 0.884   89.076  1.00 8.35  ? 165  ARG A CB  1 
ATOM   1273 C CG  . ARG A 1 166 ? 20.727 0.183   90.407  1.00 8.91  ? 165  ARG A CG  1 
ATOM   1274 C CD  . ARG A 1 166 ? 19.669 0.707   91.376  1.00 11.21 ? 165  ARG A CD  1 
ATOM   1275 N NE  . ARG A 1 166 ? 19.908 2.113   91.730  1.00 9.21  ? 165  ARG A NE  1 
ATOM   1276 C CZ  . ARG A 1 166 ? 19.215 2.758   92.664  1.00 15.68 ? 165  ARG A CZ  1 
ATOM   1277 N NH1 . ARG A 1 166 ? 18.262 2.132   93.347  1.00 11.27 ? 165  ARG A NH1 1 
ATOM   1278 N NH2 . ARG A 1 166 ? 19.496 4.018   92.950  1.00 10.45 ? 165  ARG A NH2 1 
ATOM   1279 N N   . ASP A 1 167 ? 21.994 0.740   85.628  1.00 9.48  ? 166  ASP A N   1 
ATOM   1280 C CA  . ASP A 1 167 ? 21.555 1.143   84.280  1.00 8.35  ? 166  ASP A CA  1 
ATOM   1281 C C   . ASP A 1 167 ? 22.441 0.564   83.176  1.00 11.24 ? 166  ASP A C   1 
ATOM   1282 O O   . ASP A 1 167 ? 22.815 1.263   82.240  1.00 10.85 ? 166  ASP A O   1 
ATOM   1283 C CB  . ASP A 1 167 ? 21.407 2.666   84.181  1.00 8.55  ? 166  ASP A CB  1 
ATOM   1284 C CG  . ASP A 1 167 ? 20.569 3.111   82.989  1.00 15.34 ? 166  ASP A CG  1 
ATOM   1285 O OD1 . ASP A 1 167 ? 19.694 2.317   82.535  1.00 13.28 ? 166  ASP A OD1 1 
ATOM   1286 O OD2 . ASP A 1 167 ? 20.757 4.250   82.545  1.00 14.79 ? 166  ASP A OD2 1 
ATOM   1287 N N   . LEU A 1 168 ? 22.838 -0.702  83.341  1.00 9.03  ? 167  LEU A N   1 
ATOM   1288 C CA  . LEU A 1 168 ? 23.673 -1.326  82.336  1.00 8.34  ? 167  LEU A CA  1 
ATOM   1289 C C   . LEU A 1 168 ? 22.859 -1.494  81.046  1.00 10.20 ? 167  LEU A C   1 
ATOM   1290 O O   . LEU A 1 168 ? 21.723 -1.970  81.062  1.00 10.21 ? 167  LEU A O   1 
ATOM   1291 C CB  . LEU A 1 168 ? 24.184 -2.681  82.825  1.00 8.69  ? 167  LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 168 ? 25.122 -3.413  81.866  1.00 11.57 ? 167  LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 168 ? 26.474 -2.696  81.759  1.00 12.22 ? 167  LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 168 ? 25.264 -4.840  82.300  1.00 10.67 ? 167  LEU A CD2 1 
ATOM   1295 N N   . LYS A 1 169 ? 23.474 -1.098  79.929  1.00 8.40  ? 168  LYS A N   1 
ATOM   1296 C CA  . LYS A 1 169 ? 22.935 -1.219  78.574  1.00 7.98  ? 168  LYS A CA  1 
ATOM   1297 C C   . LYS A 1 169 ? 24.004 -0.725  77.587  1.00 11.01 ? 168  LYS A C   1 
ATOM   1298 O O   . LYS A 1 169 ? 24.887 0.050   77.993  1.00 11.19 ? 168  LYS A O   1 
ATOM   1299 C CB  . LYS A 1 169 ? 21.599 -0.436  78.380  1.00 7.76  ? 168  LYS A CB  1 
ATOM   1300 C CG  . LYS A 1 169 ? 21.673 1.031   78.771  1.00 9.28  ? 168  LYS A CG  1 
ATOM   1301 C CD  . LYS A 1 169 ? 20.332 1.704   78.618  1.00 13.76 ? 168  LYS A CD  1 
ATOM   1302 C CE  . LYS A 1 169 ? 20.411 3.145   79.075  1.00 13.85 ? 168  LYS A CE  1 
ATOM   1303 N NZ  . LYS A 1 169 ? 19.065 3.773   79.093  1.00 10.73 ? 168  LYS A NZ  1 
ATOM   1304 N N   . PRO A 1 170 ? 23.928 -1.161  76.310  1.00 9.62  ? 169  PRO A N   1 
ATOM   1305 C CA  . PRO A 1 170 ? 24.923 -0.728  75.302  1.00 9.45  ? 169  PRO A CA  1 
ATOM   1306 C C   . PRO A 1 170 ? 25.037 0.785   75.142  1.00 11.94 ? 169  PRO A C   1 
ATOM   1307 O O   . PRO A 1 170 ? 26.108 1.263   74.791  1.00 10.37 ? 169  PRO A O   1 
ATOM   1308 C CB  . PRO A 1 170 ? 24.391 -1.342  73.996  1.00 11.48 ? 169  PRO A CB  1 
ATOM   1309 C CG  . PRO A 1 170 ? 23.605 -2.528  74.425  1.00 16.02 ? 169  PRO A CG  1 
ATOM   1310 C CD  . PRO A 1 170 ? 22.949 -2.105  75.721  1.00 11.42 ? 169  PRO A CD  1 
ATOM   1311 N N   . GLU A 1 171 ? 23.935 1.537   75.404  1.00 10.07 ? 170  GLU A N   1 
ATOM   1312 C CA  . GLU A 1 171 ? 23.926 2.996   75.285  1.00 8.76  ? 170  GLU A CA  1 
ATOM   1313 C C   . GLU A 1 171 ? 24.928 3.623   76.290  1.00 12.27 ? 170  GLU A C   1 
ATOM   1314 O O   . GLU A 1 171 ? 25.450 4.705   76.028  1.00 12.25 ? 170  GLU A O   1 
ATOM   1315 C CB  . GLU A 1 171 ? 22.514 3.550   75.568  1.00 9.70  ? 170  GLU A CB  1 
ATOM   1316 C CG  . GLU A 1 171 ? 21.430 3.153   74.565  1.00 11.42 ? 170  GLU A CG  1 
ATOM   1317 C CD  . GLU A 1 171 ? 20.671 1.854   74.790  1.00 11.84 ? 170  GLU A CD  1 
ATOM   1318 O OE1 . GLU A 1 171 ? 21.288 0.829   75.170  1.00 10.32 ? 170  GLU A OE1 1 
ATOM   1319 O OE2 . GLU A 1 171 ? 19.452 1.852   74.507  1.00 12.05 ? 170  GLU A OE2 1 
ATOM   1320 N N   . ASN A 1 172 ? 25.193 2.936   77.421  1.00 9.79  ? 171  ASN A N   1 
ATOM   1321 C CA  . ASN A 1 172 ? 26.054 3.461   78.494  1.00 9.96  ? 171  ASN A CA  1 
ATOM   1322 C C   . ASN A 1 172 ? 27.486 2.913   78.456  1.00 13.62 ? 171  ASN A C   1 
ATOM   1323 O O   . ASN A 1 172 ? 28.263 3.115   79.405  1.00 13.10 ? 171  ASN A O   1 
ATOM   1324 C CB  . ASN A 1 172 ? 25.381 3.202   79.823  1.00 10.81 ? 171  ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 172 ? 24.222 4.138   80.053  1.00 12.27 ? 171  ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 172 ? 24.061 5.142   79.348  1.00 11.53 ? 171  ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 172 ? 23.412 3.874   81.071  1.00 10.74 ? 171  ASN A ND2 1 
ATOM   1328 N N   . LEU A 1 173 ? 27.833 2.228   77.352  1.00 9.56  ? 172  LEU A N   1 
ATOM   1329 C CA  . LEU A 1 173 ? 29.143 1.609   77.217  1.00 8.77  ? 172  LEU A CA  1 
ATOM   1330 C C   . LEU A 1 173 ? 29.884 2.260   76.098  1.00 11.57 ? 172  LEU A C   1 
ATOM   1331 O O   . LEU A 1 173 ? 29.580 2.043   74.941  1.00 11.57 ? 172  LEU A O   1 
ATOM   1332 C CB  . LEU A 1 173 ? 29.067 0.077   77.027  1.00 8.48  ? 172  LEU A CB  1 
ATOM   1333 C CG  . LEU A 1 173 ? 28.245 -0.653  78.112  1.00 9.58  ? 172  LEU A CG  1 
ATOM   1334 C CD1 . LEU A 1 173 ? 28.234 -2.161  77.856  1.00 10.43 ? 172  LEU A CD1 1 
ATOM   1335 C CD2 . LEU A 1 173 ? 28.843 -0.425  79.501  1.00 10.42 ? 172  LEU A CD2 1 
ATOM   1336 N N   A MET A 1 174 ? 30.879 3.056   76.450  0.50 8.00  ? 173  MET A N   1 
ATOM   1337 N N   B MET A 1 174 ? 30.853 3.104   76.441  0.50 9.02  ? 173  MET A N   1 
ATOM   1338 C CA  A MET A 1 174 ? 31.673 3.786   75.466  0.50 7.02  ? 173  MET A CA  1 
ATOM   1339 C CA  B MET A 1 174 ? 31.636 3.821   75.429  0.50 8.48  ? 173  MET A CA  1 
ATOM   1340 C C   A MET A 1 174 ? 32.835 2.954   74.970  0.50 12.91 ? 173  MET A C   1 
ATOM   1341 C C   B MET A 1 174 ? 32.827 2.993   74.973  0.50 13.53 ? 173  MET A C   1 
ATOM   1342 O O   A MET A 1 174 ? 33.452 2.250   75.761  0.50 12.80 ? 173  MET A O   1 
ATOM   1343 O O   B MET A 1 174 ? 33.454 2.334   75.796  0.50 13.20 ? 173  MET A O   1 
ATOM   1344 C CB  A MET A 1 174 ? 32.208 5.089   76.070  0.50 8.68  ? 173  MET A CB  1 
ATOM   1345 C CB  B MET A 1 174 ? 32.134 5.172   75.963  0.50 10.71 ? 173  MET A CB  1 
ATOM   1346 C CG  A MET A 1 174 ? 31.132 5.958   76.690  0.50 11.24 ? 173  MET A CG  1 
ATOM   1347 C CG  B MET A 1 174 ? 31.031 6.146   76.275  0.50 14.08 ? 173  MET A CG  1 
ATOM   1348 S SD  A MET A 1 174 ? 29.710 6.248   75.605  0.50 14.41 ? 173  MET A SD  1 
ATOM   1349 S SD  B MET A 1 174 ? 30.216 6.805   74.808  0.50 18.48 ? 173  MET A SD  1 
ATOM   1350 C CE  A MET A 1 174 ? 30.450 7.326   74.408  0.50 11.40 ? 173  MET A CE  1 
ATOM   1351 C CE  B MET A 1 174 ? 28.902 7.768   75.589  0.50 14.90 ? 173  MET A CE  1 
ATOM   1352 N N   . ILE A 1 175 ? 33.191 3.102   73.687  1.00 11.69 ? 174  ILE A N   1 
ATOM   1353 C CA  . ILE A 1 175 ? 34.319 2.350   73.116  1.00 12.27 ? 174  ILE A CA  1 
ATOM   1354 C C   . ILE A 1 175 ? 35.517 3.265   72.947  1.00 15.21 ? 174  ILE A C   1 
ATOM   1355 O O   . ILE A 1 175 ? 35.409 4.296   72.282  1.00 14.79 ? 174  ILE A O   1 
ATOM   1356 C CB  . ILE A 1 175 ? 33.956 1.595   71.810  1.00 15.17 ? 174  ILE A CB  1 
ATOM   1357 C CG1 . ILE A 1 175 ? 32.687 0.697   72.009  1.00 14.68 ? 174  ILE A CG1 1 
ATOM   1358 C CG2 . ILE A 1 175 ? 35.172 0.748   71.391  1.00 13.63 ? 174  ILE A CG2 1 
ATOM   1359 C CD1 . ILE A 1 175 ? 32.219 -0.106  70.773  1.00 21.08 ? 174  ILE A CD1 1 
ATOM   1360 N N   . ASP A 1 176 ? 36.638 2.912   73.598  1.00 11.76 ? 175  ASP A N   1 
ATOM   1361 C CA  . ASP A 1 176 ? 37.851 3.722   73.532  1.00 11.99 ? 175  ASP A CA  1 
ATOM   1362 C C   . ASP A 1 176 ? 38.673 3.453   72.270  1.00 15.81 ? 175  ASP A C   1 
ATOM   1363 O O   . ASP A 1 176 ? 38.308 2.568   71.476  1.00 14.74 ? 175  ASP A O   1 
ATOM   1364 C CB  . ASP A 1 176 ? 38.641 3.676   74.849  1.00 14.09 ? 175  ASP A CB  1 
ATOM   1365 C CG  . ASP A 1 176 ? 39.358 2.383   75.186  1.00 18.21 ? 175  ASP A CG  1 
ATOM   1366 O OD1 . ASP A 1 176 ? 39.763 1.649   74.232  1.00 16.16 ? 175  ASP A OD1 1 
ATOM   1367 O OD2 . ASP A 1 176 ? 39.650 2.171   76.382  1.00 17.18 ? 175  ASP A OD2 1 
ATOM   1368 N N   . GLN A 1 177 ? 39.820 4.162   72.106  1.00 17.00 ? 176  GLN A N   1 
ATOM   1369 C CA  . GLN A 1 177 ? 40.704 4.040   70.936  1.00 18.17 ? 176  GLN A CA  1 
ATOM   1370 C C   . GLN A 1 177 ? 41.463 2.713   70.843  1.00 21.30 ? 176  GLN A C   1 
ATOM   1371 O O   . GLN A 1 177 ? 42.060 2.392   69.802  1.00 22.09 ? 176  GLN A O   1 
ATOM   1372 C CB  . GLN A 1 177 ? 41.645 5.255   70.842  1.00 20.29 ? 176  GLN A CB  1 
ATOM   1373 C CG  . GLN A 1 177 ? 40.903 6.520   70.433  1.00 34.46 ? 176  GLN A CG  1 
ATOM   1374 N N   . GLN A 1 178 ? 41.436 1.938   71.933  1.00 16.21 ? 177  GLN A N   1 
ATOM   1375 C CA  . GLN A 1 178 ? 42.039 0.615   71.994  1.00 15.45 ? 177  GLN A CA  1 
ATOM   1376 C C   . GLN A 1 178 ? 40.985 -0.490  71.854  1.00 18.36 ? 177  GLN A C   1 
ATOM   1377 O O   . GLN A 1 178 ? 41.333 -1.672  71.871  1.00 17.61 ? 177  GLN A O   1 
ATOM   1378 C CB  . GLN A 1 178 ? 42.865 0.432   73.278  1.00 16.72 ? 177  GLN A CB  1 
ATOM   1379 C CG  . GLN A 1 178 ? 44.134 1.290   73.336  1.00 37.41 ? 177  GLN A CG  1 
ATOM   1380 C CD  . GLN A 1 178 ? 43.883 2.760   73.642  1.00 62.14 ? 177  GLN A CD  1 
ATOM   1381 O OE1 . GLN A 1 178 ? 43.174 3.129   74.591  1.00 54.59 ? 177  GLN A OE1 1 
ATOM   1382 N NE2 . GLN A 1 178 ? 44.470 3.638   72.837  1.00 57.83 ? 177  GLN A NE2 1 
ATOM   1383 N N   . GLY A 1 179 ? 39.723 -0.099  71.692  1.00 16.24 ? 178  GLY A N   1 
ATOM   1384 C CA  . GLY A 1 179 ? 38.615 -1.043  71.554  1.00 15.64 ? 178  GLY A CA  1 
ATOM   1385 C C   . GLY A 1 179 ? 38.068 -1.568  72.875  1.00 17.70 ? 178  GLY A C   1 
ATOM   1386 O O   . GLY A 1 179 ? 37.203 -2.448  72.867  1.00 15.79 ? 178  GLY A O   1 
ATOM   1387 N N   . TYR A 1 180 ? 38.581 -1.056  74.023  1.00 13.50 ? 179  TYR A N   1 
ATOM   1388 C CA  . TYR A 1 180 ? 38.097 -1.420  75.361  1.00 13.02 ? 179  TYR A CA  1 
ATOM   1389 C C   . TYR A 1 180 ? 36.897 -0.552  75.715  1.00 17.55 ? 179  TYR A C   1 
ATOM   1390 O O   . TYR A 1 180 ? 36.708 0.520   75.144  1.00 18.00 ? 179  TYR A O   1 
ATOM   1391 C CB  . TYR A 1 180 ? 39.211 -1.301  76.441  1.00 13.81 ? 179  TYR A CB  1 
ATOM   1392 C CG  . TYR A 1 180 ? 40.146 -2.495  76.444  1.00 14.95 ? 179  TYR A CG  1 
ATOM   1393 C CD1 . TYR A 1 180 ? 41.052 -2.697  75.407  1.00 17.31 ? 179  TYR A CD1 1 
ATOM   1394 C CD2 . TYR A 1 180 ? 40.064 -3.468  77.440  1.00 14.72 ? 179  TYR A CD2 1 
ATOM   1395 C CE1 . TYR A 1 180 ? 41.890 -3.816  75.382  1.00 19.38 ? 179  TYR A CE1 1 
ATOM   1396 C CE2 . TYR A 1 180 ? 40.883 -4.603  77.415  1.00 15.95 ? 179  TYR A CE2 1 
ATOM   1397 C CZ  . TYR A 1 180 ? 41.791 -4.773  76.379  1.00 20.39 ? 179  TYR A CZ  1 
ATOM   1398 O OH  . TYR A 1 180 ? 42.617 -5.872  76.344  1.00 20.53 ? 179  TYR A OH  1 
ATOM   1399 N N   . ILE A 1 181 ? 36.067 -1.018  76.635  1.00 13.08 ? 180  ILE A N   1 
ATOM   1400 C CA  . ILE A 1 181 ? 34.872 -0.263  76.971  1.00 13.05 ? 180  ILE A CA  1 
ATOM   1401 C C   . ILE A 1 181 ? 35.019 0.540   78.249  1.00 16.64 ? 180  ILE A C   1 
ATOM   1402 O O   . ILE A 1 181 ? 35.908 0.257   79.061  1.00 15.82 ? 180  ILE A O   1 
ATOM   1403 C CB  . ILE A 1 181 ? 33.548 -1.055  76.836  1.00 16.80 ? 180  ILE A CB  1 
ATOM   1404 C CG1 . ILE A 1 181 ? 33.560 -2.338  77.668  1.00 18.52 ? 180  ILE A CG1 1 
ATOM   1405 C CG2 . ILE A 1 181 ? 33.225 -1.321  75.336  1.00 18.10 ? 180  ILE A CG2 1 
ATOM   1406 C CD1 . ILE A 1 181 ? 32.289 -3.160  77.621  1.00 19.60 ? 180  ILE A CD1 1 
ATOM   1407 N N   . LYS A 1 182 ? 34.189 1.586   78.395  1.00 12.56 ? 181  LYS A N   1 
ATOM   1408 C CA  . LYS A 1 182 ? 34.157 2.409   79.597  1.00 11.92 ? 181  LYS A CA  1 
ATOM   1409 C C   . LYS A 1 182 ? 32.707 2.669   79.929  1.00 14.52 ? 181  LYS A C   1 
ATOM   1410 O O   . LYS A 1 182 ? 31.948 3.147   79.075  1.00 14.38 ? 181  LYS A O   1 
ATOM   1411 C CB  . LYS A 1 182 ? 34.908 3.732   79.412  1.00 13.86 ? 181  LYS A CB  1 
ATOM   1412 C CG  . LYS A 1 182 ? 36.422 3.579   79.293  1.00 13.87 ? 181  LYS A CG  1 
ATOM   1413 C CD  . LYS A 1 182 ? 37.105 4.929   79.436  1.00 23.14 ? 181  LYS A CD  1 
ATOM   1414 C CE  . LYS A 1 182 ? 38.562 4.883   79.109  1.00 25.17 ? 181  LYS A CE  1 
ATOM   1415 N NZ  . LYS A 1 182 ? 39.305 4.035   80.064  1.00 24.59 ? 181  LYS A NZ  1 
ATOM   1416 N N   . VAL A 1 183 ? 32.315 2.335   81.172  1.00 10.42 ? 182  VAL A N   1 
ATOM   1417 C CA  . VAL A 1 183 ? 30.954 2.539   81.636  1.00 10.47 ? 182  VAL A CA  1 
ATOM   1418 C C   . VAL A 1 183 ? 30.755 4.013   81.920  1.00 12.63 ? 182  VAL A C   1 
ATOM   1419 O O   . VAL A 1 183 ? 31.537 4.624   82.657  1.00 12.43 ? 182  VAL A O   1 
ATOM   1420 C CB  . VAL A 1 183 ? 30.638 1.652   82.867  1.00 13.32 ? 182  VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 183 ? 29.187 1.812   83.331  1.00 12.36 ? 182  VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 183 ? 30.947 0.181   82.574  1.00 13.19 ? 182  VAL A CG2 1 
ATOM   1423 N N   . THR A 1 184 ? 29.681 4.573   81.354  1.00 10.05 ? 183  THR A N   1 
ATOM   1424 C CA  . THR A 1 184 ? 29.292 5.959   81.586  1.00 10.51 ? 183  THR A CA  1 
ATOM   1425 C C   . THR A 1 184 ? 27.861 6.022   82.142  1.00 14.11 ? 183  THR A C   1 
ATOM   1426 O O   . THR A 1 184 ? 27.137 5.022   82.121  1.00 16.19 ? 183  THR A O   1 
ATOM   1427 C CB  . THR A 1 184 ? 29.567 6.870   80.372  1.00 17.19 ? 183  THR A CB  1 
ATOM   1428 O OG1 . THR A 1 184 ? 29.541 8.239   80.810  1.00 17.13 ? 183  THR A OG1 1 
ATOM   1429 C CG2 . THR A 1 184 ? 28.570 6.664   79.214  1.00 13.68 ? 183  THR A CG2 1 
ATOM   1430 N N   . ASP A 1 185 ? 27.479 7.197   82.646  1.00 12.88 ? 184  ASP A N   1 
ATOM   1431 C CA  . ASP A 1 185 ? 26.172 7.504   83.215  1.00 12.87 ? 184  ASP A CA  1 
ATOM   1432 C C   . ASP A 1 185 ? 25.900 6.806   84.536  1.00 16.49 ? 184  ASP A C   1 
ATOM   1433 O O   . ASP A 1 185 ? 25.368 5.701   84.573  1.00 16.48 ? 184  ASP A O   1 
ATOM   1434 C CB  . ASP A 1 185 ? 25.034 7.283   82.202  1.00 14.32 ? 184  ASP A CB  1 
ATOM   1435 C CG  . ASP A 1 185 ? 23.762 8.042   82.540  1.00 24.34 ? 184  ASP A CG  1 
ATOM   1436 O OD1 . ASP A 1 185 ? 23.467 8.216   83.760  1.00 16.98 ? 184  ASP A OD1 1 
ATOM   1437 O OD2 . ASP A 1 185 ? 23.026 8.408   81.594  1.00 30.39 ? 184  ASP A OD2 1 
ATOM   1438 N N   . PHE A 1 186 ? 26.207 7.496   85.623  1.00 11.38 ? 185  PHE A N   1 
ATOM   1439 C CA  . PHE A 1 186 ? 25.999 6.999   86.964  1.00 10.47 ? 185  PHE A CA  1 
ATOM   1440 C C   . PHE A 1 186 ? 24.783 7.658   87.612  1.00 11.61 ? 185  PHE A C   1 
ATOM   1441 O O   . PHE A 1 186 ? 24.707 7.689   88.832  1.00 10.02 ? 185  PHE A O   1 
ATOM   1442 C CB  . PHE A 1 186 ? 27.277 7.221   87.804  1.00 11.89 ? 185  PHE A CB  1 
ATOM   1443 C CG  . PHE A 1 186 ? 28.290 6.109   87.694  1.00 12.76 ? 185  PHE A CG  1 
ATOM   1444 C CD1 . PHE A 1 186 ? 28.786 5.714   86.455  1.00 12.88 ? 185  PHE A CD1 1 
ATOM   1445 C CD2 . PHE A 1 186 ? 28.774 5.472   88.834  1.00 16.61 ? 185  PHE A CD2 1 
ATOM   1446 C CE1 . PHE A 1 186 ? 29.728 4.683   86.359  1.00 15.60 ? 185  PHE A CE1 1 
ATOM   1447 C CE2 . PHE A 1 186 ? 29.707 4.435   88.736  1.00 20.16 ? 185  PHE A CE2 1 
ATOM   1448 C CZ  . PHE A 1 186 ? 30.163 4.037   87.500  1.00 17.12 ? 185  PHE A CZ  1 
ATOM   1449 N N   . GLY A 1 187 ? 23.801 8.066   86.785  1.00 10.25 ? 186  GLY A N   1 
ATOM   1450 C CA  . GLY A 1 187 ? 22.566 8.740   87.200  1.00 9.87  ? 186  GLY A CA  1 
ATOM   1451 C C   . GLY A 1 187 ? 21.757 7.967   88.228  1.00 12.08 ? 186  GLY A C   1 
ATOM   1452 O O   . GLY A 1 187 ? 21.058 8.576   89.034  1.00 11.15 ? 186  GLY A O   1 
ATOM   1453 N N   . PHE A 1 188 ? 21.860 6.610   88.225  1.00 9.45  ? 187  PHE A N   1 
ATOM   1454 C CA  . PHE A 1 188 ? 21.124 5.774   89.186  1.00 9.48  ? 187  PHE A CA  1 
ATOM   1455 C C   . PHE A 1 188 ? 22.049 4.993   90.092  1.00 12.28 ? 187  PHE A C   1 
ATOM   1456 O O   . PHE A 1 188 ? 21.573 4.171   90.886  1.00 13.88 ? 187  PHE A O   1 
ATOM   1457 C CB  . PHE A 1 188 ? 20.095 4.848   88.501  1.00 12.14 ? 187  PHE A CB  1 
ATOM   1458 C CG  . PHE A 1 188 ? 19.126 5.600   87.625  1.00 14.54 ? 187  PHE A CG  1 
ATOM   1459 C CD1 . PHE A 1 188 ? 18.258 6.537   88.164  1.00 15.88 ? 187  PHE A CD1 1 
ATOM   1460 C CD2 . PHE A 1 188 ? 19.118 5.409   86.254  1.00 22.50 ? 187  PHE A CD2 1 
ATOM   1461 C CE1 . PHE A 1 188 ? 17.375 7.257   87.346  1.00 18.09 ? 187  PHE A CE1 1 
ATOM   1462 C CE2 . PHE A 1 188 ? 18.271 6.164   85.432  1.00 25.98 ? 187  PHE A CE2 1 
ATOM   1463 C CZ  . PHE A 1 188 ? 17.404 7.081   85.986  1.00 22.11 ? 187  PHE A CZ  1 
ATOM   1464 N N   . ALA A 1 189 ? 23.372 5.255   90.008  1.00 7.92  ? 188  ALA A N   1 
ATOM   1465 C CA  . ALA A 1 189 ? 24.316 4.567   90.901  1.00 9.00  ? 188  ALA A CA  1 
ATOM   1466 C C   . ALA A 1 189 ? 24.117 5.012   92.358  1.00 11.19 ? 188  ALA A C   1 
ATOM   1467 O O   . ALA A 1 189 ? 23.778 6.174   92.627  1.00 9.42  ? 188  ALA A O   1 
ATOM   1468 C CB  . ALA A 1 189 ? 25.747 4.787   90.471  1.00 9.79  ? 188  ALA A CB  1 
ATOM   1469 N N   . LYS A 1 190 ? 24.244 4.063   93.303  1.00 9.71  ? 189  LYS A N   1 
ATOM   1470 C CA  . LYS A 1 190 ? 23.930 4.388   94.704  1.00 9.01  ? 189  LYS A CA  1 
ATOM   1471 C C   . LYS A 1 190 ? 24.796 3.555   95.628  1.00 13.16 ? 189  LYS A C   1 
ATOM   1472 O O   . LYS A 1 190 ? 25.006 2.365   95.360  1.00 11.19 ? 189  LYS A O   1 
ATOM   1473 C CB  . LYS A 1 190 ? 22.438 4.090   94.955  1.00 13.01 ? 189  LYS A CB  1 
ATOM   1474 C CG  . LYS A 1 190 ? 21.873 4.478   96.341  1.00 16.51 ? 189  LYS A CG  1 
ATOM   1475 C CD  . LYS A 1 190 ? 20.485 3.887   96.516  1.00 16.65 ? 189  LYS A CD  1 
ATOM   1476 C CE  . LYS A 1 190 ? 19.946 4.008   97.913  1.00 22.03 ? 189  LYS A CE  1 
ATOM   1477 N NZ  . LYS A 1 190 ? 19.411 5.352   98.190  1.00 23.26 ? 189  LYS A NZ  1 
ATOM   1478 N N   . ARG A 1 191 ? 25.304 4.177   96.700  1.00 9.55  ? 190  ARG A N   1 
ATOM   1479 C CA  . ARG A 1 191 ? 26.087 3.445   97.698  1.00 10.13 ? 190  ARG A CA  1 
ATOM   1480 C C   . ARG A 1 191 ? 25.090 2.953   98.753  1.00 14.29 ? 190  ARG A C   1 
ATOM   1481 O O   . ARG A 1 191 ? 24.499 3.744   99.497  1.00 12.99 ? 190  ARG A O   1 
ATOM   1482 C CB  . ARG A 1 191 ? 27.214 4.285   98.318  1.00 10.11 ? 190  ARG A CB  1 
ATOM   1483 C CG  . ARG A 1 191 ? 28.183 3.375   99.068  1.00 12.40 ? 190  ARG A CG  1 
ATOM   1484 C CD  . ARG A 1 191 ? 29.478 4.031   99.485  1.00 10.99 ? 190  ARG A CD  1 
ATOM   1485 N NE  . ARG A 1 191 ? 30.303 2.996   100.099 1.00 12.38 ? 190  ARG A NE  1 
ATOM   1486 C CZ  . ARG A 1 191 ? 30.818 3.067   101.320 1.00 21.10 ? 190  ARG A CZ  1 
ATOM   1487 N NH1 . ARG A 1 191 ? 30.722 4.189   102.026 1.00 14.56 ? 190  ARG A NH1 1 
ATOM   1488 N NH2 . ARG A 1 191 ? 31.482 2.037   101.824 1.00 16.81 ? 190  ARG A NH2 1 
ATOM   1489 N N   . VAL A 1 192 ? 24.886 1.652   98.778  1.00 11.91 ? 191  VAL A N   1 
ATOM   1490 C CA  . VAL A 1 192 ? 23.921 1.020   99.682  1.00 12.91 ? 191  VAL A CA  1 
ATOM   1491 C C   . VAL A 1 192 ? 24.407 -0.342  100.153 1.00 17.25 ? 191  VAL A C   1 
ATOM   1492 O O   . VAL A 1 192 ? 24.764 -1.205  99.345  1.00 16.26 ? 191  VAL A O   1 
ATOM   1493 C CB  . VAL A 1 192 ? 22.477 1.021   99.061  1.00 17.64 ? 191  VAL A CB  1 
ATOM   1494 C CG1 . VAL A 1 192 ? 22.452 0.490   97.638  1.00 17.94 ? 191  VAL A CG1 1 
ATOM   1495 C CG2 . VAL A 1 192 ? 21.450 0.308   99.934  1.00 18.11 ? 191  VAL A CG2 1 
ATOM   1496 N N   . LYS A 1 193 ? 24.410 -0.518  101.478 1.00 15.91 ? 192  LYS A N   1 
ATOM   1497 C CA  . LYS A 1 193 ? 24.821 -1.761  102.108 1.00 17.14 ? 192  LYS A CA  1 
ATOM   1498 C C   . LYS A 1 193 ? 23.628 -2.714  102.268 1.00 26.23 ? 192  LYS A C   1 
ATOM   1499 O O   . LYS A 1 193 ? 23.774 -3.932  102.131 1.00 28.96 ? 192  LYS A O   1 
ATOM   1500 C CB  . LYS A 1 193 ? 25.531 -1.478  103.437 1.00 18.04 ? 192  LYS A CB  1 
ATOM   1501 C CG  . LYS A 1 193 ? 27.012 -1.129  103.224 1.00 26.33 ? 192  LYS A CG  1 
ATOM   1502 C CD  . LYS A 1 193 ? 27.807 -1.063  104.535 1.00 29.10 ? 192  LYS A CD  1 
ATOM   1503 C CE  . LYS A 1 193 ? 29.251 -0.648  104.326 1.00 45.21 ? 192  LYS A CE  1 
ATOM   1504 N NZ  . LYS A 1 193 ? 29.592 0.631   105.031 1.00 44.39 ? 192  LYS A NZ  1 
ATOM   1505 N N   . GLY A 1 194 ? 22.457 -2.162  102.526 1.00 22.53 ? 193  GLY A N   1 
ATOM   1506 C CA  . GLY A 1 194 ? 21.266 -2.989  102.666 1.00 23.47 ? 193  GLY A CA  1 
ATOM   1507 C C   . GLY A 1 194 ? 20.557 -3.201  101.345 1.00 26.88 ? 193  GLY A C   1 
ATOM   1508 O O   . GLY A 1 194 ? 21.171 -3.208  100.266 1.00 28.45 ? 193  GLY A O   1 
ATOM   1509 N N   . ARG A 1 195 ? 19.252 -3.346  101.422 1.00 18.33 ? 194  ARG A N   1 
ATOM   1510 C CA  . ARG A 1 195 ? 18.426 -3.491  100.222 1.00 16.29 ? 194  ARG A CA  1 
ATOM   1511 C C   . ARG A 1 195 ? 17.971 -2.063  99.866  1.00 16.35 ? 194  ARG A C   1 
ATOM   1512 O O   . ARG A 1 195 ? 18.090 -1.167  100.699 1.00 15.40 ? 194  ARG A O   1 
ATOM   1513 C CB  . ARG A 1 195 ? 17.203 -4.400  100.521 1.00 15.26 ? 194  ARG A CB  1 
ATOM   1514 C CG  . ARG A 1 195 ? 16.257 -3.784  101.555 1.00 20.98 ? 194  ARG A CG  1 
ATOM   1515 C CD  . ARG A 1 195 ? 15.364 -4.801  102.263 1.00 26.07 ? 194  ARG A CD  1 
ATOM   1516 N NE  . ARG A 1 195 ? 16.152 -5.674  103.128 1.00 35.09 ? 194  ARG A NE  1 
ATOM   1517 C CZ  . ARG A 1 195 ? 15.647 -6.631  103.901 1.00 48.50 ? 194  ARG A CZ  1 
ATOM   1518 N NH1 . ARG A 1 195 ? 14.335 -6.835  103.947 1.00 25.72 ? 194  ARG A NH1 1 
ATOM   1519 N NH2 . ARG A 1 195 ? 16.450 -7.391  104.635 1.00 31.07 ? 194  ARG A NH2 1 
ATOM   1520 N N   . THR A 1 196 ? 17.456 -1.865  98.653  1.00 12.71 ? 195  THR A N   1 
ATOM   1521 C CA  . THR A 1 196 ? 16.929 -0.574  98.212  1.00 12.67 ? 195  THR A CA  1 
ATOM   1522 C C   . THR A 1 196 ? 15.639 -0.801  97.419  1.00 15.71 ? 195  THR A C   1 
ATOM   1523 O O   . THR A 1 196 ? 15.366 -1.939  97.040  1.00 15.03 ? 195  THR A O   1 
ATOM   1524 C CB  . THR A 1 196 ? 17.998 0.285   97.532  1.00 17.12 ? 195  THR A CB  1 
ATOM   1525 O OG1 . THR A 1 196 ? 17.588 1.659   97.624  1.00 16.06 ? 195  THR A OG1 1 
ATOM   1526 C CG2 . THR A 1 196 ? 18.241 -0.125  96.074  1.00 13.45 ? 195  THR A CG2 1 
ATOM   1527 N N   . TRP A 1 197 ? 14.847 0.268   97.165  1.00 12.30 ? 196  TRP A N   1 
ATOM   1528 C CA  . TRP A 1 197 ? 13.519 0.089   96.572  1.00 12.73 ? 196  TRP A CA  1 
ATOM   1529 C C   . TRP A 1 197 ? 13.180 0.920   95.355  1.00 16.17 ? 196  TRP A C   1 
ATOM   1530 O O   . TRP A 1 197 ? 12.094 0.732   94.798  1.00 16.37 ? 196  TRP A O   1 
ATOM   1531 C CB  . TRP A 1 197 ? 12.451 0.395   97.649  1.00 12.05 ? 196  TRP A CB  1 
ATOM   1532 C CG  . TRP A 1 197 ? 12.536 -0.500  98.841  1.00 13.62 ? 196  TRP A CG  1 
ATOM   1533 C CD1 . TRP A 1 197 ? 11.842 -1.656  99.042  1.00 16.82 ? 196  TRP A CD1 1 
ATOM   1534 C CD2 . TRP A 1 197 ? 13.370 -0.324  99.995  1.00 13.71 ? 196  TRP A CD2 1 
ATOM   1535 N NE1 . TRP A 1 197 ? 12.215 -2.227  100.239 1.00 17.17 ? 196  TRP A NE1 1 
ATOM   1536 C CE2 . TRP A 1 197 ? 13.126 -1.414  100.857 1.00 17.64 ? 196  TRP A CE2 1 
ATOM   1537 C CE3 . TRP A 1 197 ? 14.256 0.685   100.415 1.00 15.15 ? 196  TRP A CE3 1 
ATOM   1538 C CZ2 . TRP A 1 197 ? 13.729 -1.526  102.114 1.00 18.32 ? 196  TRP A CZ2 1 
ATOM   1539 C CZ3 . TRP A 1 197 ? 14.879 0.552   101.656 1.00 16.74 ? 196  TRP A CZ3 1 
ATOM   1540 C CH2 . TRP A 1 197 ? 14.594 -0.531  102.494 1.00 18.44 ? 196  TRP A CH2 1 
HETATM 1541 N N   . TPO A 1 198 ? 14.037 1.873   94.963  1.00 12.85 ? 197  TPO A N   1 
HETATM 1542 C CA  . TPO A 1 198 ? 13.695 2.772   93.868  1.00 12.61 ? 197  TPO A CA  1 
HETATM 1543 C CB  . TPO A 1 198 ? 14.750 3.899   93.646  1.00 12.55 ? 197  TPO A CB  1 
HETATM 1544 C CG2 . TPO A 1 198 ? 14.158 5.030   92.759  1.00 13.89 ? 197  TPO A CG2 1 
HETATM 1545 O OG1 . TPO A 1 198 ? 14.971 4.509   94.939  1.00 13.94 ? 197  TPO A OG1 1 
HETATM 1546 P P   . TPO A 1 198 ? 16.422 4.411   95.464  1.00 14.25 ? 197  TPO A P   1 
HETATM 1547 O O1P . TPO A 1 198 ? 16.332 5.010   96.895  1.00 14.13 ? 197  TPO A O1P 1 
HETATM 1548 O O2P . TPO A 1 198 ? 16.748 2.922   95.457  1.00 15.22 ? 197  TPO A O2P 1 
HETATM 1549 O O3P . TPO A 1 198 ? 17.424 5.212   94.584  1.00 12.32 ? 197  TPO A O3P 1 
HETATM 1550 C C   . TPO A 1 198 ? 13.438 2.093   92.552  1.00 14.72 ? 197  TPO A C   1 
HETATM 1551 O O   . TPO A 1 198 ? 14.266 1.300   92.077  1.00 13.11 ? 197  TPO A O   1 
ATOM   1552 N N   . LEU A 1 199 ? 12.296 2.436   91.945  1.00 13.02 ? 198  LEU A N   1 
ATOM   1553 C CA  . LEU A 1 199 ? 11.961 1.939   90.610  1.00 13.64 ? 198  LEU A CA  1 
ATOM   1554 C C   . LEU A 1 199 ? 12.744 2.803   89.613  1.00 14.48 ? 198  LEU A C   1 
ATOM   1555 O O   . LEU A 1 199 ? 12.394 3.976   89.399  1.00 13.27 ? 198  LEU A O   1 
ATOM   1556 C CB  . LEU A 1 199 ? 10.426 2.026   90.369  1.00 14.28 ? 198  LEU A CB  1 
ATOM   1557 C CG  . LEU A 1 199 ? 9.945  1.695   88.932  1.00 19.40 ? 198  LEU A CG  1 
ATOM   1558 C CD1 . LEU A 1 199 ? 10.345 0.287   88.520  1.00 19.10 ? 198  LEU A CD1 1 
ATOM   1559 C CD2 . LEU A 1 199 ? 8.451  1.863   88.816  1.00 24.56 ? 198  LEU A CD2 1 
ATOM   1560 N N   . CYS A 1 200 ? 13.840 2.240   89.036  1.00 10.60 ? 199  CYS A N   1 
ATOM   1561 C CA  . CYS A 1 200 ? 14.704 2.950   88.090  1.00 9.76  ? 199  CYS A CA  1 
ATOM   1562 C C   . CYS A 1 200 ? 15.428 1.928   87.253  1.00 13.43 ? 199  CYS A C   1 
ATOM   1563 O O   . CYS A 1 200 ? 15.506 0.755   87.642  1.00 13.33 ? 199  CYS A O   1 
ATOM   1564 C CB  . CYS A 1 200 ? 15.673 3.894   88.812  1.00 10.75 ? 199  CYS A CB  1 
ATOM   1565 S SG  . CYS A 1 200 ? 16.858 3.065   89.907  1.00 14.57 ? 199  CYS A SG  1 
ATOM   1566 N N   . GLY A 1 201 ? 15.969 2.384   86.137  1.00 11.34 ? 200  GLY A N   1 
ATOM   1567 C CA  . GLY A 1 201 ? 16.698 1.558   85.183  1.00 10.57 ? 200  GLY A CA  1 
ATOM   1568 C C   . GLY A 1 201 ? 16.062 1.710   83.818  1.00 15.86 ? 200  GLY A C   1 
ATOM   1569 O O   . GLY A 1 201 ? 15.368 2.697   83.587  1.00 16.02 ? 200  GLY A O   1 
ATOM   1570 N N   . THR A 1 202 ? 16.293 0.742   82.899  1.00 11.94 ? 201  THR A N   1 
ATOM   1571 C CA  . THR A 1 202 ? 15.739 0.799   81.542  1.00 10.58 ? 201  THR A CA  1 
ATOM   1572 C C   . THR A 1 202 ? 14.863 -0.454  81.357  1.00 12.41 ? 201  THR A C   1 
ATOM   1573 O O   . THR A 1 202 ? 15.278 -1.534  81.794  1.00 13.42 ? 201  THR A O   1 
ATOM   1574 C CB  . THR A 1 202 ? 16.888 0.927   80.528  1.00 12.90 ? 201  THR A CB  1 
ATOM   1575 O OG1 . THR A 1 202 ? 17.631 2.120   80.843  1.00 12.17 ? 201  THR A OG1 1 
ATOM   1576 C CG2 . THR A 1 202 ? 16.407 0.977   79.088  1.00 11.33 ? 201  THR A CG2 1 
ATOM   1577 N N   . PRO A 1 203 ? 13.672 -0.340  80.738  1.00 9.21  ? 202  PRO A N   1 
ATOM   1578 C CA  . PRO A 1 203 ? 12.730 -1.474  80.751  1.00 8.37  ? 202  PRO A CA  1 
ATOM   1579 C C   . PRO A 1 203 ? 13.271 -2.841  80.420  1.00 11.12 ? 202  PRO A C   1 
ATOM   1580 O O   . PRO A 1 203 ? 13.037 -3.776  81.172  1.00 12.74 ? 202  PRO A O   1 
ATOM   1581 C CB  . PRO A 1 203 ? 11.650 -1.047  79.772  1.00 10.55 ? 202  PRO A CB  1 
ATOM   1582 C CG  . PRO A 1 203 ? 11.582 0.453   79.961  1.00 14.16 ? 202  PRO A CG  1 
ATOM   1583 C CD  . PRO A 1 203 ? 13.029 0.873   80.161  1.00 10.12 ? 202  PRO A CD  1 
ATOM   1584 N N   . GLU A 1 204 ? 14.011 -2.941  79.303  1.00 9.10  ? 203  GLU A N   1 
ATOM   1585 C CA  . GLU A 1 204 ? 14.528 -4.212  78.805  1.00 9.12  ? 203  GLU A CA  1 
ATOM   1586 C C   . GLU A 1 204 ? 15.492 -4.867  79.788  1.00 11.45 ? 203  GLU A C   1 
ATOM   1587 O O   . GLU A 1 204 ? 15.705 -6.065  79.708  1.00 10.40 ? 203  GLU A O   1 
ATOM   1588 C CB  . GLU A 1 204 ? 15.261 -3.987  77.466  1.00 10.35 ? 203  GLU A CB  1 
ATOM   1589 C CG  . GLU A 1 204 ? 14.344 -3.771  76.258  1.00 10.01 ? 203  GLU A CG  1 
ATOM   1590 C CD  . GLU A 1 204 ? 13.832 -2.359  76.000  1.00 11.30 ? 203  GLU A CD  1 
ATOM   1591 O OE1 . GLU A 1 204 ? 13.952 -1.491  76.899  1.00 11.57 ? 203  GLU A OE1 1 
ATOM   1592 O OE2 . GLU A 1 204 ? 13.260 -2.133  74.904  1.00 10.01 ? 203  GLU A OE2 1 
ATOM   1593 N N   . TYR A 1 205 ? 16.114 -4.063  80.662  1.00 9.34  ? 204  TYR A N   1 
ATOM   1594 C CA  . TYR A 1 205 ? 17.176 -4.507  81.560  1.00 9.71  ? 204  TYR A CA  1 
ATOM   1595 C C   . TYR A 1 205 ? 16.751 -4.710  83.006  1.00 13.65 ? 204  TYR A C   1 
ATOM   1596 O O   . TYR A 1 205 ? 17.560 -5.151  83.822  1.00 12.14 ? 204  TYR A O   1 
ATOM   1597 C CB  . TYR A 1 205 ? 18.383 -3.535  81.449  1.00 9.63  ? 204  TYR A CB  1 
ATOM   1598 C CG  . TYR A 1 205 ? 19.148 -3.765  80.158  1.00 9.88  ? 204  TYR A CG  1 
ATOM   1599 C CD1 . TYR A 1 205 ? 18.669 -3.277  78.937  1.00 10.51 ? 204  TYR A CD1 1 
ATOM   1600 C CD2 . TYR A 1 205 ? 20.318 -4.516  80.146  1.00 9.81  ? 204  TYR A CD2 1 
ATOM   1601 C CE1 . TYR A 1 205 ? 19.319 -3.579  77.730  1.00 8.95  ? 204  TYR A CE1 1 
ATOM   1602 C CE2 . TYR A 1 205 ? 20.997 -4.784  78.959  1.00 10.89 ? 204  TYR A CE2 1 
ATOM   1603 C CZ  . TYR A 1 205 ? 20.477 -4.344  77.750  1.00 13.39 ? 204  TYR A CZ  1 
ATOM   1604 O OH  . TYR A 1 205 ? 21.149 -4.659  76.594  1.00 13.09 ? 204  TYR A OH  1 
ATOM   1605 N N   . LEU A 1 206 ? 15.486 -4.455  83.312  1.00 10.86 ? 205  LEU A N   1 
ATOM   1606 C CA  . LEU A 1 206 ? 15.012 -4.543  84.686  1.00 11.06 ? 205  LEU A CA  1 
ATOM   1607 C C   . LEU A 1 206 ? 14.868 -5.971  85.155  1.00 13.39 ? 205  LEU A C   1 
ATOM   1608 O O   . LEU A 1 206 ? 14.196 -6.772  84.493  1.00 11.38 ? 205  LEU A O   1 
ATOM   1609 C CB  . LEU A 1 206 ? 13.659 -3.837  84.860  1.00 11.08 ? 205  LEU A CB  1 
ATOM   1610 C CG  . LEU A 1 206 ? 13.527 -2.364  84.517  1.00 14.11 ? 205  LEU A CG  1 
ATOM   1611 C CD1 . LEU A 1 206 ? 12.113 -1.884  84.875  1.00 15.21 ? 205  LEU A CD1 1 
ATOM   1612 C CD2 . LEU A 1 206 ? 14.571 -1.503  85.296  1.00 14.22 ? 205  LEU A CD2 1 
ATOM   1613 N N   . ALA A 1 207 ? 15.424 -6.259  86.348  1.00 12.47 ? 206  ALA A N   1 
ATOM   1614 C CA  . ALA A 1 207 ? 15.264 -7.561  86.994  1.00 13.04 ? 206  ALA A CA  1 
ATOM   1615 C C   . ALA A 1 207 ? 13.786 -7.735  87.442  1.00 13.72 ? 206  ALA A C   1 
ATOM   1616 O O   . ALA A 1 207 ? 13.092 -6.743  87.693  1.00 11.80 ? 206  ALA A O   1 
ATOM   1617 C CB  . ALA A 1 207 ? 16.206 -7.681  88.205  1.00 14.46 ? 206  ALA A CB  1 
ATOM   1618 N N   . PRO A 1 208 ? 13.259 -8.982  87.495  1.00 11.63 ? 207  PRO A N   1 
ATOM   1619 C CA  . PRO A 1 208 ? 11.848 -9.160  87.909  1.00 11.71 ? 207  PRO A CA  1 
ATOM   1620 C C   . PRO A 1 208 ? 11.550 -8.520  89.269  1.00 15.85 ? 207  PRO A C   1 
ATOM   1621 O O   . PRO A 1 208 ? 10.449 -8.005  89.475  1.00 15.36 ? 207  PRO A O   1 
ATOM   1622 C CB  . PRO A 1 208 ? 11.672 -10.682 88.004  1.00 14.69 ? 207  PRO A CB  1 
ATOM   1623 C CG  . PRO A 1 208 ? 12.825 -11.288 87.351  1.00 19.60 ? 207  PRO A CG  1 
ATOM   1624 C CD  . PRO A 1 208 ? 13.923 -10.269 87.190  1.00 12.87 ? 207  PRO A CD  1 
ATOM   1625 N N   . GLU A 1 209 ? 12.506 -8.599  90.222  1.00 12.56 ? 208  GLU A N   1 
ATOM   1626 C CA  . GLU A 1 209 ? 12.291 -8.031  91.564  1.00 11.73 ? 208  GLU A CA  1 
ATOM   1627 C C   . GLU A 1 209 ? 12.084 -6.527  91.550  1.00 14.20 ? 208  GLU A C   1 
ATOM   1628 O O   . GLU A 1 209 ? 11.392 -6.013  92.426  1.00 14.99 ? 208  GLU A O   1 
ATOM   1629 C CB  . GLU A 1 209 ? 13.356 -8.465  92.588  1.00 12.63 ? 208  GLU A CB  1 
ATOM   1630 C CG  . GLU A 1 209 ? 14.790 -8.091  92.232  1.00 15.23 ? 208  GLU A CG  1 
ATOM   1631 C CD  . GLU A 1 209 ? 15.570 -9.125  91.436  1.00 16.32 ? 208  GLU A CD  1 
ATOM   1632 O OE1 . GLU A 1 209 ? 14.956 -9.966  90.736  1.00 15.89 ? 208  GLU A OE1 1 
ATOM   1633 O OE2 . GLU A 1 209 ? 16.813 -9.110  91.548  1.00 14.12 ? 208  GLU A OE2 1 
ATOM   1634 N N   . ILE A 1 210 ? 12.665 -5.814  90.562  1.00 9.80  ? 209  ILE A N   1 
ATOM   1635 C CA  . ILE A 1 210 ? 12.435 -4.361  90.464  1.00 10.84 ? 209  ILE A CA  1 
ATOM   1636 C C   . ILE A 1 210 ? 10.988 -4.142  89.949  1.00 15.97 ? 209  ILE A C   1 
ATOM   1637 O O   . ILE A 1 210 ? 10.248 -3.316  90.493  1.00 16.15 ? 209  ILE A O   1 
ATOM   1638 C CB  . ILE A 1 210 ? 13.470 -3.648  89.552  1.00 13.37 ? 209  ILE A CB  1 
ATOM   1639 C CG1 . ILE A 1 210 ? 14.910 -3.810  90.090  1.00 14.16 ? 209  ILE A CG1 1 
ATOM   1640 C CG2 . ILE A 1 210 ? 13.094 -2.157  89.377  1.00 11.67 ? 209  ILE A CG2 1 
ATOM   1641 C CD1 . ILE A 1 210 ? 16.043 -3.353  89.067  1.00 16.04 ? 209  ILE A CD1 1 
ATOM   1642 N N   . ILE A 1 211 ? 10.608 -4.858  88.879  1.00 13.32 ? 210  ILE A N   1 
ATOM   1643 C CA  . ILE A 1 211 ? 9.253  -4.738  88.315  1.00 12.77 ? 210  ILE A CA  1 
ATOM   1644 C C   . ILE A 1 211 ? 8.186  -5.010  89.372  1.00 18.82 ? 210  ILE A C   1 
ATOM   1645 O O   . ILE A 1 211 ? 7.176  -4.294  89.431  1.00 18.14 ? 210  ILE A O   1 
ATOM   1646 C CB  . ILE A 1 211 ? 9.079  -5.662  87.075  1.00 15.87 ? 210  ILE A CB  1 
ATOM   1647 C CG1 . ILE A 1 211 ? 9.956  -5.174  85.896  1.00 14.90 ? 210  ILE A CG1 1 
ATOM   1648 C CG2 . ILE A 1 211 ? 7.599  -5.816  86.668  1.00 16.79 ? 210  ILE A CG2 1 
ATOM   1649 C CD1 . ILE A 1 211 ? 10.240 -6.259  84.844  1.00 17.92 ? 210  ILE A CD1 1 
ATOM   1650 N N   . LEU A 1 212 ? 8.433  -6.016  90.230  1.00 16.70 ? 211  LEU A N   1 
ATOM   1651 C CA  . LEU A 1 212 ? 7.487  -6.441  91.262  1.00 17.84 ? 211  LEU A CA  1 
ATOM   1652 C C   . LEU A 1 212 ? 7.508  -5.637  92.567  1.00 20.54 ? 211  LEU A C   1 
ATOM   1653 O O   . LEU A 1 212 ? 6.844  -6.004  93.555  1.00 18.33 ? 211  LEU A O   1 
ATOM   1654 C CB  . LEU A 1 212 ? 7.601  -7.943  91.486  1.00 17.82 ? 211  LEU A CB  1 
ATOM   1655 C CG  . LEU A 1 212 ? 7.323  -8.813  90.239  1.00 23.55 ? 211  LEU A CG  1 
ATOM   1656 C CD1 . LEU A 1 212 ? 7.613  -10.257 90.529  1.00 25.61 ? 211  LEU A CD1 1 
ATOM   1657 C CD2 . LEU A 1 212 ? 5.891  -8.629  89.712  1.00 26.23 ? 211  LEU A CD2 1 
ATOM   1658 N N   . SER A 1 213 ? 8.227  -4.502  92.539  1.00 17.01 ? 212  SER A N   1 
ATOM   1659 C CA  . SER A 1 213 ? 8.322  -3.528  93.619  1.00 17.55 ? 212  SER A CA  1 
ATOM   1660 C C   . SER A 1 213 ? 8.818  -4.148  94.920  1.00 21.41 ? 212  SER A C   1 
ATOM   1661 O O   . SER A 1 213 ? 8.268  -3.899  95.999  1.00 21.51 ? 212  SER A O   1 
ATOM   1662 C CB  . SER A 1 213 ? 6.982  -2.809  93.793  1.00 21.29 ? 212  SER A CB  1 
ATOM   1663 O OG  . SER A 1 213 ? 7.176  -1.557  94.423  1.00 34.01 ? 212  SER A OG  1 
ATOM   1664 N N   . LYS A 1 214 ? 9.851  -4.986  94.813  1.00 17.94 ? 213  LYS A N   1 
ATOM   1665 C CA  . LYS A 1 214 ? 10.439 -5.599  96.004  1.00 18.49 ? 213  LYS A CA  1 
ATOM   1666 C C   . LYS A 1 214 ? 11.676 -4.797  96.393  1.00 19.71 ? 213  LYS A C   1 
ATOM   1667 O O   . LYS A 1 214 ? 12.173 -3.993  95.596  1.00 20.36 ? 213  LYS A O   1 
ATOM   1668 C CB  . LYS A 1 214 ? 10.849 -7.054  95.708  1.00 21.25 ? 213  LYS A CB  1 
ATOM   1669 C CG  . LYS A 1 214 ? 9.664  -7.965  95.473  1.00 26.54 ? 213  LYS A CG  1 
ATOM   1670 C CD  . LYS A 1 214 ? 10.067 -9.237  94.775  1.00 40.31 ? 213  LYS A CD  1 
ATOM   1671 C CE  . LYS A 1 214 ? 8.877  -10.138 94.539  1.00 48.73 ? 213  LYS A CE  1 
ATOM   1672 N NZ  . LYS A 1 214 ? 9.275  -11.385 93.838  1.00 53.42 ? 213  LYS A NZ  1 
ATOM   1673 N N   . GLY A 1 215 ? 12.188 -5.050  97.589  1.00 17.77 ? 214  GLY A N   1 
ATOM   1674 C CA  . GLY A 1 215 ? 13.471 -4.500  98.015  1.00 16.76 ? 214  GLY A CA  1 
ATOM   1675 C C   . GLY A 1 215 ? 14.494 -5.346  97.278  1.00 21.14 ? 214  GLY A C   1 
ATOM   1676 O O   . GLY A 1 215 ? 14.330 -6.569  97.194  1.00 23.88 ? 214  GLY A O   1 
ATOM   1677 N N   . TYR A 1 216 ? 15.500 -4.724  96.693  1.00 14.98 ? 215  TYR A N   1 
ATOM   1678 C CA  . TYR A 1 216 ? 16.480 -5.441  95.864  1.00 13.92 ? 215  TYR A CA  1 
ATOM   1679 C C   . TYR A 1 216 ? 17.906 -5.026  96.180  1.00 16.89 ? 215  TYR A C   1 
ATOM   1680 O O   . TYR A 1 216 ? 18.145 -4.069  96.927  1.00 15.26 ? 215  TYR A O   1 
ATOM   1681 C CB  . TYR A 1 216 ? 16.157 -5.286  94.349  1.00 15.01 ? 215  TYR A CB  1 
ATOM   1682 C CG  . TYR A 1 216 ? 16.214 -3.858  93.845  1.00 13.11 ? 215  TYR A CG  1 
ATOM   1683 C CD1 . TYR A 1 216 ? 17.424 -3.284  93.445  1.00 14.37 ? 215  TYR A CD1 1 
ATOM   1684 C CD2 . TYR A 1 216 ? 15.060 -3.076  93.764  1.00 11.55 ? 215  TYR A CD2 1 
ATOM   1685 C CE1 . TYR A 1 216 ? 17.488 -1.966  93.005  1.00 13.03 ? 215  TYR A CE1 1 
ATOM   1686 C CE2 . TYR A 1 216 ? 15.106 -1.768  93.279  1.00 11.73 ? 215  TYR A CE2 1 
ATOM   1687 C CZ  . TYR A 1 216 ? 16.326 -1.216  92.914  1.00 15.48 ? 215  TYR A CZ  1 
ATOM   1688 O OH  . TYR A 1 216 ? 16.398 0.073   92.464  1.00 12.68 ? 215  TYR A OH  1 
ATOM   1689 N N   . ASN A 1 217 ? 18.872 -5.757  95.618  1.00 14.28 ? 216  ASN A N   1 
ATOM   1690 C CA  . ASN A 1 217 ? 20.267 -5.456  95.906  1.00 14.41 ? 216  ASN A CA  1 
ATOM   1691 C C   . ASN A 1 217 ? 21.102 -5.546  94.601  1.00 15.07 ? 216  ASN A C   1 
ATOM   1692 O O   . ASN A 1 217 ? 20.526 -5.556  93.505  1.00 13.64 ? 216  ASN A O   1 
ATOM   1693 C CB  . ASN A 1 217 ? 20.790 -6.415  97.019  1.00 15.94 ? 216  ASN A CB  1 
ATOM   1694 C CG  . ASN A 1 217 ? 20.707 -7.883  96.658  1.00 31.37 ? 216  ASN A CG  1 
ATOM   1695 O OD1 . ASN A 1 217 ? 20.651 -8.258  95.488  1.00 19.46 ? 216  ASN A OD1 1 
ATOM   1696 N ND2 . ASN A 1 217 ? 20.706 -8.759  97.658  1.00 27.73 ? 216  ASN A ND2 1 
ATOM   1697 N N   . LYS A 1 218 ? 22.430 -5.705  94.740  1.00 13.44 ? 217  LYS A N   1 
ATOM   1698 C CA  . LYS A 1 218 ? 23.368 -5.776  93.609  1.00 12.23 ? 217  LYS A CA  1 
ATOM   1699 C C   . LYS A 1 218 ? 23.065 -6.896  92.594  1.00 15.10 ? 217  LYS A C   1 
ATOM   1700 O O   . LYS A 1 218 ? 23.517 -6.807  91.449  1.00 14.59 ? 217  LYS A O   1 
ATOM   1701 C CB  . LYS A 1 218 ? 24.819 -5.803  94.088  1.00 14.31 ? 217  LYS A CB  1 
ATOM   1702 C CG  . LYS A 1 218 ? 25.173 -7.057  94.904  1.00 23.53 ? 217  LYS A CG  1 
ATOM   1703 C CD  . LYS A 1 218 ? 26.586 -6.978  95.468  1.00 30.02 ? 217  LYS A CD  1 
ATOM   1704 C CE  . LYS A 1 218 ? 26.897 -8.187  96.315  1.00 40.36 ? 217  LYS A CE  1 
ATOM   1705 N NZ  . LYS A 1 218 ? 28.269 -8.704  96.067  1.00 42.84 ? 217  LYS A NZ  1 
ATOM   1706 N N   . ALA A 1 219 ? 22.261 -7.922  92.984  1.00 11.78 ? 218  ALA A N   1 
ATOM   1707 C CA  . ALA A 1 219 ? 21.883 -8.990  92.059  1.00 13.13 ? 218  ALA A CA  1 
ATOM   1708 C C   . ALA A 1 219 ? 21.181 -8.449  90.814  1.00 14.49 ? 218  ALA A C   1 
ATOM   1709 O O   . ALA A 1 219 ? 21.230 -9.093  89.753  1.00 15.04 ? 218  ALA A O   1 
ATOM   1710 C CB  . ALA A 1 219 ? 21.010 -10.030 92.753  1.00 15.11 ? 218  ALA A CB  1 
ATOM   1711 N N   . VAL A 1 220 ? 20.574 -7.240  90.904  1.00 11.30 ? 219  VAL A N   1 
ATOM   1712 C CA  . VAL A 1 220 ? 19.913 -6.661  89.724  1.00 10.22 ? 219  VAL A CA  1 
ATOM   1713 C C   . VAL A 1 220 ? 20.931 -6.347  88.600  1.00 12.63 ? 219  VAL A C   1 
ATOM   1714 O O   . VAL A 1 220 ? 20.603 -6.438  87.413  1.00 12.67 ? 219  VAL A O   1 
ATOM   1715 C CB  . VAL A 1 220 ? 18.982 -5.466  90.021  1.00 12.10 ? 219  VAL A CB  1 
ATOM   1716 C CG1 . VAL A 1 220 ? 17.942 -5.839  91.091  1.00 11.55 ? 219  VAL A CG1 1 
ATOM   1717 C CG2 . VAL A 1 220 ? 19.785 -4.214  90.434  1.00 11.28 ? 219  VAL A CG2 1 
ATOM   1718 N N   . ASP A 1 221 ? 22.167 -5.976  88.994  1.00 9.55  ? 220  ASP A N   1 
ATOM   1719 C CA  . ASP A 1 221 ? 23.242 -5.694  88.059  1.00 9.23  ? 220  ASP A CA  1 
ATOM   1720 C C   . ASP A 1 221 ? 23.645 -6.982  87.337  1.00 12.98 ? 220  ASP A C   1 
ATOM   1721 O O   . ASP A 1 221 ? 23.843 -6.948  86.124  1.00 11.69 ? 220  ASP A O   1 
ATOM   1722 C CB  . ASP A 1 221 ? 24.450 -5.044  88.760  1.00 11.60 ? 220  ASP A CB  1 
ATOM   1723 C CG  . ASP A 1 221 ? 24.306 -3.557  89.095  1.00 12.25 ? 220  ASP A CG  1 
ATOM   1724 O OD1 . ASP A 1 221 ? 23.451 -2.873  88.456  1.00 10.25 ? 220  ASP A OD1 1 
ATOM   1725 O OD2 . ASP A 1 221 ? 25.141 -3.048  89.886  1.00 12.89 ? 220  ASP A OD2 1 
ATOM   1726 N N   . TRP A 1 222 ? 23.707 -8.122  88.062  1.00 10.14 ? 221  TRP A N   1 
ATOM   1727 C CA  . TRP A 1 222 ? 24.030 -9.410  87.456  1.00 11.84 ? 221  TRP A CA  1 
ATOM   1728 C C   . TRP A 1 222 ? 22.962 -9.858  86.461  1.00 13.84 ? 221  TRP A C   1 
ATOM   1729 O O   . TRP A 1 222 ? 23.311 -10.323 85.373  1.00 13.02 ? 221  TRP A O   1 
ATOM   1730 C CB  . TRP A 1 222 ? 24.368 -10.455 88.533  1.00 11.77 ? 221  TRP A CB  1 
ATOM   1731 C CG  . TRP A 1 222 ? 25.601 -10.083 89.313  1.00 12.59 ? 221  TRP A CG  1 
ATOM   1732 C CD1 . TRP A 1 222 ? 25.672 -9.825  90.652  1.00 15.98 ? 221  TRP A CD1 1 
ATOM   1733 C CD2 . TRP A 1 222 ? 26.910 -9.805  88.781  1.00 12.67 ? 221  TRP A CD2 1 
ATOM   1734 N NE1 . TRP A 1 222 ? 26.960 -9.493  91.004  1.00 15.66 ? 221  TRP A NE1 1 
ATOM   1735 C CE2 . TRP A 1 222 ? 27.744 -9.477  89.876  1.00 16.67 ? 221  TRP A CE2 1 
ATOM   1736 C CE3 . TRP A 1 222 ? 27.486 -9.890  87.494  1.00 14.34 ? 221  TRP A CE3 1 
ATOM   1737 C CZ2 . TRP A 1 222 ? 29.109 -9.188  89.722  1.00 15.82 ? 221  TRP A CZ2 1 
ATOM   1738 C CZ3 . TRP A 1 222 ? 28.844 -9.630  87.345  1.00 15.24 ? 221  TRP A CZ3 1 
ATOM   1739 C CH2 . TRP A 1 222 ? 29.650 -9.319  88.456  1.00 15.65 ? 221  TRP A CH2 1 
ATOM   1740 N N   . TRP A 1 223 ? 21.666 -9.626  86.788  1.00 12.39 ? 222  TRP A N   1 
ATOM   1741 C CA  . TRP A 1 223 ? 20.559 -9.894  85.866  1.00 11.82 ? 222  TRP A CA  1 
ATOM   1742 C C   . TRP A 1 223 ? 20.784 -9.060  84.591  1.00 13.17 ? 222  TRP A C   1 
ATOM   1743 O O   . TRP A 1 223 ? 20.714 -9.598  83.487  1.00 11.39 ? 222  TRP A O   1 
ATOM   1744 C CB  . TRP A 1 223 ? 19.210 -9.501  86.494  1.00 9.85  ? 222  TRP A CB  1 
ATOM   1745 C CG  . TRP A 1 223 ? 18.061 -9.573  85.518  1.00 9.86  ? 222  TRP A CG  1 
ATOM   1746 C CD1 . TRP A 1 223 ? 17.734 -8.639  84.576  1.00 12.27 ? 222  TRP A CD1 1 
ATOM   1747 C CD2 . TRP A 1 223 ? 17.125 -10.664 85.347  1.00 9.62  ? 222  TRP A CD2 1 
ATOM   1748 N NE1 . TRP A 1 223 ? 16.665 -9.081  83.818  1.00 11.69 ? 222  TRP A NE1 1 
ATOM   1749 C CE2 . TRP A 1 223 ? 16.271 -10.319 84.273  1.00 12.99 ? 222  TRP A CE2 1 
ATOM   1750 C CE3 . TRP A 1 223 ? 16.910 -11.885 86.016  1.00 11.45 ? 222  TRP A CE3 1 
ATOM   1751 C CZ2 . TRP A 1 223 ? 15.234 -11.166 83.832  1.00 13.18 ? 222  TRP A CZ2 1 
ATOM   1752 C CZ3 . TRP A 1 223 ? 15.873 -12.714 85.593  1.00 13.76 ? 222  TRP A CZ3 1 
ATOM   1753 C CH2 . TRP A 1 223 ? 15.062 -12.363 84.501  1.00 14.22 ? 222  TRP A CH2 1 
ATOM   1754 N N   . ALA A 1 224 ? 21.086 -7.751  84.754  1.00 9.54  ? 223  ALA A N   1 
ATOM   1755 C CA  . ALA A 1 224 ? 21.291 -6.814  83.638  1.00 8.98  ? 223  ALA A CA  1 
ATOM   1756 C C   . ALA A 1 224 ? 22.463 -7.274  82.779  1.00 11.17 ? 223  ALA A C   1 
ATOM   1757 O O   . ALA A 1 224 ? 22.378 -7.148  81.562  1.00 10.68 ? 223  ALA A O   1 
ATOM   1758 C CB  . ALA A 1 224 ? 21.506 -5.386  84.150  1.00 9.83  ? 223  ALA A CB  1 
ATOM   1759 N N   . LEU A 1 225 ? 23.492 -7.898  83.393  1.00 7.67  ? 224  LEU A N   1 
ATOM   1760 C CA  . LEU A 1 225 ? 24.610 -8.476  82.630  1.00 7.49  ? 224  LEU A CA  1 
ATOM   1761 C C   . LEU A 1 225 ? 24.113 -9.577  81.695  1.00 13.12 ? 224  LEU A C   1 
ATOM   1762 O O   . LEU A 1 225 ? 24.547 -9.635  80.537  1.00 11.72 ? 224  LEU A O   1 
ATOM   1763 C CB  . LEU A 1 225 ? 25.689 -9.032  83.561  1.00 8.74  ? 224  LEU A CB  1 
ATOM   1764 C CG  . LEU A 1 225 ? 26.865 -9.706  82.847  1.00 12.56 ? 224  LEU A CG  1 
ATOM   1765 C CD1 . LEU A 1 225 ? 27.606 -8.726  81.911  1.00 12.50 ? 224  LEU A CD1 1 
ATOM   1766 C CD2 . LEU A 1 225 ? 27.780 -10.348 83.849  1.00 12.74 ? 224  LEU A CD2 1 
ATOM   1767 N N   . GLY A 1 226 ? 23.218 -10.440 82.196  1.00 11.40 ? 225  GLY A N   1 
ATOM   1768 C CA  . GLY A 1 226 ? 22.593 -11.483 81.380  1.00 10.80 ? 225  GLY A CA  1 
ATOM   1769 C C   . GLY A 1 226 ? 21.882 -10.866 80.182  1.00 12.98 ? 225  GLY A C   1 
ATOM   1770 O O   . GLY A 1 226 ? 22.030 -11.333 79.048  1.00 10.25 ? 225  GLY A O   1 
ATOM   1771 N N   . VAL A 1 227 ? 21.130 -9.766  80.411  1.00 9.34  ? 226  VAL A N   1 
ATOM   1772 C CA  . VAL A 1 227 ? 20.413 -9.096  79.319  1.00 8.33  ? 226  VAL A CA  1 
ATOM   1773 C C   . VAL A 1 227 ? 21.418 -8.547  78.281  1.00 12.75 ? 226  VAL A C   1 
ATOM   1774 O O   . VAL A 1 227 ? 21.224 -8.721  77.071  1.00 12.84 ? 226  VAL A O   1 
ATOM   1775 C CB  . VAL A 1 227 ? 19.450 -7.973  79.836  1.00 9.26  ? 226  VAL A CB  1 
ATOM   1776 C CG1 . VAL A 1 227 ? 18.661 -7.340  78.685  1.00 9.29  ? 226  VAL A CG1 1 
ATOM   1777 C CG2 . VAL A 1 227 ? 18.481 -8.522  80.901  1.00 7.85  ? 226  VAL A CG2 1 
ATOM   1778 N N   . LEU A 1 228 ? 22.490 -7.905  78.768  1.00 9.59  ? 227  LEU A N   1 
ATOM   1779 C CA  . LEU A 1 228 ? 23.515 -7.330  77.901  1.00 8.70  ? 227  LEU A CA  1 
ATOM   1780 C C   . LEU A 1 228 ? 24.193 -8.397  77.042  1.00 11.32 ? 227  LEU A C   1 
ATOM   1781 O O   . LEU A 1 228 ? 24.327 -8.197  75.835  1.00 10.79 ? 227  LEU A O   1 
ATOM   1782 C CB  . LEU A 1 228 ? 24.586 -6.610  78.730  1.00 8.80  ? 227  LEU A CB  1 
ATOM   1783 C CG  . LEU A 1 228 ? 25.695 -5.932  77.893  1.00 12.86 ? 227  LEU A CG  1 
ATOM   1784 C CD1 . LEU A 1 228 ? 25.172 -4.700  77.148  1.00 13.39 ? 227  LEU A CD1 1 
ATOM   1785 C CD2 . LEU A 1 228 ? 26.877 -5.599  78.768  1.00 12.35 ? 227  LEU A CD2 1 
ATOM   1786 N N   . ILE A 1 229 ? 24.655 -9.509  77.660  1.00 9.31  ? 228  ILE A N   1 
ATOM   1787 C CA  . ILE A 1 229 ? 25.316 -10.584 76.916  1.00 9.25  ? 228  ILE A CA  1 
ATOM   1788 C C   . ILE A 1 229 ? 24.373 -11.126 75.842  1.00 13.03 ? 228  ILE A C   1 
ATOM   1789 O O   . ILE A 1 229 ? 24.781 -11.319 74.697  1.00 12.41 ? 228  ILE A O   1 
ATOM   1790 C CB  . ILE A 1 229 ? 25.830 -11.694 77.886  1.00 11.79 ? 228  ILE A CB  1 
ATOM   1791 C CG1 . ILE A 1 229 ? 26.914 -11.114 78.835  1.00 12.12 ? 228  ILE A CG1 1 
ATOM   1792 C CG2 . ILE A 1 229 ? 26.357 -12.899 77.104  1.00 13.31 ? 228  ILE A CG2 1 
ATOM   1793 C CD1 . ILE A 1 229 ? 27.398 -12.142 79.962  1.00 13.52 ? 228  ILE A CD1 1 
ATOM   1794 N N   . TYR A 1 230 ? 23.121 -11.395 76.225  1.00 11.77 ? 229  TYR A N   1 
ATOM   1795 C CA  . TYR A 1 230 ? 22.110 -11.878 75.277  1.00 9.85  ? 229  TYR A CA  1 
ATOM   1796 C C   . TYR A 1 230 ? 21.983 -10.885 74.097  1.00 13.08 ? 229  TYR A C   1 
ATOM   1797 O O   . TYR A 1 230 ? 22.084 -11.295 72.940  1.00 11.67 ? 229  TYR A O   1 
ATOM   1798 C CB  . TYR A 1 230 ? 20.759 -12.017 75.983  1.00 9.46  ? 229  TYR A CB  1 
ATOM   1799 C CG  . TYR A 1 230 ? 19.674 -12.628 75.119  1.00 9.08  ? 229  TYR A CG  1 
ATOM   1800 C CD1 . TYR A 1 230 ? 19.149 -11.935 74.028  1.00 10.26 ? 229  TYR A CD1 1 
ATOM   1801 C CD2 . TYR A 1 230 ? 19.174 -13.901 75.390  1.00 9.66  ? 229  TYR A CD2 1 
ATOM   1802 C CE1 . TYR A 1 230 ? 18.163 -12.500 73.215  1.00 10.65 ? 229  TYR A CE1 1 
ATOM   1803 C CE2 . TYR A 1 230 ? 18.176 -14.474 74.590  1.00 10.61 ? 229  TYR A CE2 1 
ATOM   1804 C CZ  . TYR A 1 230 ? 17.668 -13.759 73.511  1.00 11.96 ? 229  TYR A CZ  1 
ATOM   1805 O OH  . TYR A 1 230 ? 16.639 -14.266 72.747  1.00 12.18 ? 229  TYR A OH  1 
ATOM   1806 N N   . GLU A 1 231 ? 21.743 -9.602  74.386  1.00 10.92 ? 230  GLU A N   1 
ATOM   1807 C CA  . GLU A 1 231 ? 21.589 -8.599  73.324  1.00 9.58  ? 230  GLU A CA  1 
ATOM   1808 C C   . GLU A 1 231 ? 22.844 -8.505  72.442  1.00 10.85 ? 230  GLU A C   1 
ATOM   1809 O O   . GLU A 1 231 ? 22.713 -8.409  71.231  1.00 10.14 ? 230  GLU A O   1 
ATOM   1810 C CB  . GLU A 1 231 ? 21.242 -7.224  73.920  1.00 10.46 ? 230  GLU A CB  1 
ATOM   1811 C CG  . GLU A 1 231 ? 20.957 -6.182  72.845  1.00 8.05  ? 230  GLU A CG  1 
ATOM   1812 C CD  . GLU A 1 231 ? 20.417 -4.864  73.361  1.00 10.35 ? 230  GLU A CD  1 
ATOM   1813 O OE1 . GLU A 1 231 ? 19.684 -4.860  74.376  1.00 11.97 ? 230  GLU A OE1 1 
ATOM   1814 O OE2 . GLU A 1 231 ? 20.683 -3.837  72.707  1.00 11.48 ? 230  GLU A OE2 1 
ATOM   1815 N N   . MET A 1 232 ? 24.050 -8.506  73.043  1.00 9.26  ? 231  MET A N   1 
ATOM   1816 C CA  . MET A 1 232 ? 25.294 -8.438  72.262  1.00 8.62  ? 231  MET A CA  1 
ATOM   1817 C C   . MET A 1 232 ? 25.386 -9.623  71.291  1.00 13.41 ? 231  MET A C   1 
ATOM   1818 O O   . MET A 1 232 ? 25.644 -9.426  70.106  1.00 13.66 ? 231  MET A O   1 
ATOM   1819 C CB  . MET A 1 232 ? 26.524 -8.415  73.173  1.00 10.20 ? 231  MET A CB  1 
ATOM   1820 C CG  . MET A 1 232 ? 26.700 -7.088  73.899  1.00 10.95 ? 231  MET A CG  1 
ATOM   1821 S SD  . MET A 1 232 ? 28.313 -6.924  74.690  1.00 13.72 ? 231  MET A SD  1 
ATOM   1822 C CE  . MET A 1 232 ? 28.235 -8.257  75.989  1.00 12.76 ? 231  MET A CE  1 
ATOM   1823 N N   . ALA A 1 233 ? 25.159 -10.836 71.794  1.00 10.52 ? 232  ALA A N   1 
ATOM   1824 C CA  . ALA A 1 233 ? 25.294 -12.059 71.015  1.00 11.96 ? 232  ALA A CA  1 
ATOM   1825 C C   . ALA A 1 233 ? 24.127 -12.337 70.043  1.00 13.68 ? 232  ALA A C   1 
ATOM   1826 O O   . ALA A 1 233 ? 24.364 -12.928 69.000  1.00 12.85 ? 232  ALA A O   1 
ATOM   1827 C CB  . ALA A 1 233 ? 25.532 -13.258 71.939  1.00 13.73 ? 232  ALA A CB  1 
ATOM   1828 N N   . ALA A 1 234 ? 22.891 -11.902 70.368  1.00 10.96 ? 233  ALA A N   1 
ATOM   1829 C CA  . ALA A 1 234 ? 21.710 -12.103 69.514  1.00 11.85 ? 233  ALA A CA  1 
ATOM   1830 C C   . ALA A 1 234 ? 21.434 -10.956 68.541  1.00 14.38 ? 233  ALA A C   1 
ATOM   1831 O O   . ALA A 1 234 ? 20.930 -11.204 67.445  1.00 14.86 ? 233  ALA A O   1 
ATOM   1832 C CB  . ALA A 1 234 ? 20.461 -12.352 70.365  1.00 13.02 ? 233  ALA A CB  1 
ATOM   1833 N N   . GLY A 1 235 ? 21.721 -9.723  68.960  1.00 11.52 ? 234  GLY A N   1 
ATOM   1834 C CA  . GLY A 1 235 ? 21.440 -8.530  68.172  1.00 10.82 ? 234  GLY A CA  1 
ATOM   1835 C C   . GLY A 1 235 ? 20.140 -7.870  68.594  1.00 13.87 ? 234  GLY A C   1 
ATOM   1836 O O   . GLY A 1 235 ? 19.761 -6.825  68.053  1.00 12.33 ? 234  GLY A O   1 
ATOM   1837 N N   . TYR A 1 236 ? 19.398 -8.524  69.509  1.00 10.96 ? 235  TYR A N   1 
ATOM   1838 C CA  . TYR A 1 236 ? 18.138 -8.008  70.061  1.00 10.47 ? 235  TYR A CA  1 
ATOM   1839 C C   . TYR A 1 236 ? 18.033 -8.494  71.512  1.00 11.86 ? 235  TYR A C   1 
ATOM   1840 O O   . TYR A 1 236 ? 18.688 -9.483  71.890  1.00 10.62 ? 235  TYR A O   1 
ATOM   1841 C CB  . TYR A 1 236 ? 16.902 -8.478  69.236  1.00 11.67 ? 235  TYR A CB  1 
ATOM   1842 C CG  . TYR A 1 236 ? 16.870 -9.961  68.954  1.00 11.62 ? 235  TYR A CG  1 
ATOM   1843 C CD1 . TYR A 1 236 ? 16.454 -10.868 69.926  1.00 14.03 ? 235  TYR A CD1 1 
ATOM   1844 C CD2 . TYR A 1 236 ? 17.280 -10.465 67.720  1.00 12.91 ? 235  TYR A CD2 1 
ATOM   1845 C CE1 . TYR A 1 236 ? 16.455 -12.244 69.680  1.00 14.41 ? 235  TYR A CE1 1 
ATOM   1846 C CE2 . TYR A 1 236 ? 17.286 -11.832 67.465  1.00 14.82 ? 235  TYR A CE2 1 
ATOM   1847 C CZ  . TYR A 1 236 ? 16.895 -12.719 68.454  1.00 18.15 ? 235  TYR A CZ  1 
ATOM   1848 O OH  . TYR A 1 236 ? 16.837 -14.057 68.168  1.00 17.57 ? 235  TYR A OH  1 
ATOM   1849 N N   . PRO A 1 237 ? 17.284 -7.774  72.370  1.00 12.25 ? 236  PRO A N   1 
ATOM   1850 C CA  . PRO A 1 237 ? 17.219 -8.181  73.778  1.00 11.10 ? 236  PRO A CA  1 
ATOM   1851 C C   . PRO A 1 237 ? 16.381 -9.444  73.986  1.00 12.70 ? 236  PRO A C   1 
ATOM   1852 O O   . PRO A 1 237 ? 15.552 -9.800  73.152  1.00 12.42 ? 236  PRO A O   1 
ATOM   1853 C CB  . PRO A 1 237 ? 16.656 -6.941  74.504  1.00 13.53 ? 236  PRO A CB  1 
ATOM   1854 C CG  . PRO A 1 237 ? 16.043 -6.092  73.459  1.00 16.33 ? 236  PRO A CG  1 
ATOM   1855 C CD  . PRO A 1 237 ? 16.471 -6.572  72.099  1.00 12.82 ? 236  PRO A CD  1 
ATOM   1856 N N   . PRO A 1 238 ? 16.547 -10.109 75.143  1.00 10.77 ? 237  PRO A N   1 
ATOM   1857 C CA  . PRO A 1 238 ? 15.741 -11.327 75.425  1.00 11.45 ? 237  PRO A CA  1 
ATOM   1858 C C   . PRO A 1 238 ? 14.264 -11.051 75.613  1.00 12.78 ? 237  PRO A C   1 
ATOM   1859 O O   . PRO A 1 238 ? 13.438 -11.941 75.378  1.00 12.79 ? 237  PRO A O   1 
ATOM   1860 C CB  . PRO A 1 238 ? 16.366 -11.879 76.725  1.00 12.91 ? 237  PRO A CB  1 
ATOM   1861 C CG  . PRO A 1 238 ? 17.005 -10.668 77.383  1.00 14.79 ? 237  PRO A CG  1 
ATOM   1862 C CD  . PRO A 1 238 ? 17.483 -9.792  76.252  1.00 10.55 ? 237  PRO A CD  1 
ATOM   1863 N N   . PHE A 1 239 ? 13.925 -9.829  76.071  1.00 10.58 ? 238  PHE A N   1 
ATOM   1864 C CA  . PHE A 1 239 ? 12.530 -9.422  76.302  1.00 11.01 ? 238  PHE A CA  1 
ATOM   1865 C C   . PHE A 1 239 ? 12.298 -8.100  75.608  1.00 14.67 ? 238  PHE A C   1 
ATOM   1866 O O   . PHE A 1 239 ? 12.837 -7.090  76.049  1.00 14.15 ? 238  PHE A O   1 
ATOM   1867 C CB  . PHE A 1 239 ? 12.230 -9.270  77.821  1.00 11.44 ? 238  PHE A CB  1 
ATOM   1868 C CG  . PHE A 1 239 ? 12.804 -10.382 78.669  1.00 13.08 ? 238  PHE A CG  1 
ATOM   1869 C CD1 . PHE A 1 239 ? 12.214 -11.641 78.684  1.00 16.45 ? 238  PHE A CD1 1 
ATOM   1870 C CD2 . PHE A 1 239 ? 13.970 -10.190 79.396  1.00 13.33 ? 238  PHE A CD2 1 
ATOM   1871 C CE1 . PHE A 1 239 ? 12.767 -12.681 79.431  1.00 17.13 ? 238  PHE A CE1 1 
ATOM   1872 C CE2 . PHE A 1 239 ? 14.527 -11.234 80.136  1.00 16.47 ? 238  PHE A CE2 1 
ATOM   1873 C CZ  . PHE A 1 239 ? 13.924 -12.467 80.152  1.00 15.79 ? 238  PHE A CZ  1 
ATOM   1874 N N   . PHE A 1 240 ? 11.588 -8.117  74.477  1.00 11.65 ? 239  PHE A N   1 
ATOM   1875 C CA  . PHE A 1 240 ? 11.295 -6.879  73.759  1.00 10.99 ? 239  PHE A CA  1 
ATOM   1876 C C   . PHE A 1 240 ? 9.859  -6.830  73.296  1.00 13.90 ? 239  PHE A C   1 
ATOM   1877 O O   . PHE A 1 240 ? 9.233  -7.862  73.044  1.00 14.36 ? 239  PHE A O   1 
ATOM   1878 C CB  . PHE A 1 240 ? 12.281 -6.602  72.581  1.00 12.09 ? 239  PHE A CB  1 
ATOM   1879 C CG  . PHE A 1 240 ? 12.110 -7.511  71.387  1.00 13.54 ? 239  PHE A CG  1 
ATOM   1880 C CD1 . PHE A 1 240 ? 11.149 -7.237  70.412  1.00 15.79 ? 239  PHE A CD1 1 
ATOM   1881 C CD2 . PHE A 1 240 ? 12.927 -8.625  71.217  1.00 14.42 ? 239  PHE A CD2 1 
ATOM   1882 C CE1 . PHE A 1 240 ? 10.983 -8.087  69.311  1.00 16.18 ? 239  PHE A CE1 1 
ATOM   1883 C CE2 . PHE A 1 240 ? 12.763 -9.471  70.110  1.00 16.81 ? 239  PHE A CE2 1 
ATOM   1884 C CZ  . PHE A 1 240 ? 11.795 -9.192  69.162  1.00 15.91 ? 239  PHE A CZ  1 
ATOM   1885 N N   . ALA A 1 241 ? 9.339  -5.608  73.149  1.00 14.06 ? 240  ALA A N   1 
ATOM   1886 C CA  . ALA A 1 241 ? 7.967  -5.379  72.710  1.00 16.35 ? 240  ALA A CA  1 
ATOM   1887 C C   . ALA A 1 241 ? 7.856  -3.927  72.278  1.00 21.35 ? 240  ALA A C   1 
ATOM   1888 O O   . ALA A 1 241 ? 8.874  -3.229  72.270  1.00 21.26 ? 240  ALA A O   1 
ATOM   1889 C CB  . ALA A 1 241 ? 6.995  -5.686  73.849  1.00 17.49 ? 240  ALA A CB  1 
ATOM   1890 N N   . ASP A 1 242 ? 6.661  -3.469  71.865  1.00 18.44 ? 241  ASP A N   1 
ATOM   1891 C CA  . ASP A 1 242 ? 6.566  -2.061  71.465  1.00 19.06 ? 241  ASP A CA  1 
ATOM   1892 C C   . ASP A 1 242 ? 6.447  -1.117  72.651  1.00 21.42 ? 241  ASP A C   1 
ATOM   1893 O O   . ASP A 1 242 ? 6.818  0.048   72.520  1.00 21.43 ? 241  ASP A O   1 
ATOM   1894 C CB  . ASP A 1 242 ? 5.443  -1.811  70.464  1.00 21.21 ? 241  ASP A CB  1 
ATOM   1895 C CG  . ASP A 1 242 ? 5.761  -2.344  69.084  1.00 28.99 ? 241  ASP A CG  1 
ATOM   1896 O OD1 . ASP A 1 242 ? 6.888  -2.077  68.585  1.00 26.55 ? 241  ASP A OD1 1 
ATOM   1897 O OD2 . ASP A 1 242 ? 4.863  -2.953  68.469  1.00 34.82 ? 241  ASP A OD2 1 
ATOM   1898 N N   . GLN A 1 243 ? 5.892  -1.596  73.778  1.00 17.19 ? 242  GLN A N   1 
ATOM   1899 C CA  . GLN A 1 243 ? 5.696  -0.752  74.964  1.00 16.99 ? 242  GLN A CA  1 
ATOM   1900 C C   . GLN A 1 243 ? 6.311  -1.369  76.226  1.00 18.28 ? 242  GLN A C   1 
ATOM   1901 O O   . GLN A 1 243 ? 6.266  -2.598  76.366  1.00 16.94 ? 242  GLN A O   1 
ATOM   1902 C CB  . GLN A 1 243 ? 4.189  -0.493  75.217  1.00 19.35 ? 242  GLN A CB  1 
ATOM   1903 C CG  . GLN A 1 243 ? 3.426  0.185   74.071  1.00 26.37 ? 242  GLN A CG  1 
ATOM   1904 C CD  . GLN A 1 243 ? 3.939  1.568   73.724  1.00 39.23 ? 242  GLN A CD  1 
ATOM   1905 O OE1 . GLN A 1 243 ? 4.447  2.320   74.568  1.00 36.13 ? 242  GLN A OE1 1 
ATOM   1906 N NE2 . GLN A 1 243 ? 3.789  1.946   72.470  1.00 37.19 ? 242  GLN A NE2 1 
ATOM   1907 N N   . PRO A 1 244 ? 6.772  -0.534  77.199  1.00 14.53 ? 243  PRO A N   1 
ATOM   1908 C CA  . PRO A 1 244 ? 7.341  -1.082  78.447  1.00 14.17 ? 243  PRO A CA  1 
ATOM   1909 C C   . PRO A 1 244 ? 6.465  -2.071  79.220  1.00 18.30 ? 243  PRO A C   1 
ATOM   1910 O O   . PRO A 1 244 ? 6.984  -3.076  79.690  1.00 14.84 ? 243  PRO A O   1 
ATOM   1911 C CB  . PRO A 1 244 ? 7.677  0.173   79.262  1.00 15.39 ? 243  PRO A CB  1 
ATOM   1912 C CG  . PRO A 1 244 ? 7.989  1.204   78.214  1.00 19.29 ? 243  PRO A CG  1 
ATOM   1913 C CD  . PRO A 1 244 ? 6.934  0.940   77.153  1.00 15.80 ? 243  PRO A CD  1 
ATOM   1914 N N   . ILE A 1 245 ? 5.157  -1.808  79.339  1.00 16.92 ? 244  ILE A N   1 
ATOM   1915 C CA  . ILE A 1 245 ? 4.214  -2.735  80.021  1.00 18.35 ? 244  ILE A CA  1 
ATOM   1916 C C   . ILE A 1 245 ? 4.318  -4.178  79.440  1.00 20.62 ? 244  ILE A C   1 
ATOM   1917 O O   . ILE A 1 245 ? 4.354  -5.140  80.207  1.00 18.98 ? 244  ILE A O   1 
ATOM   1918 C CB  . ILE A 1 245 ? 2.745  -2.199  79.993  1.00 22.26 ? 244  ILE A CB  1 
ATOM   1919 C CG1 . ILE A 1 245 ? 1.775  -3.165  80.752  1.00 24.19 ? 244  ILE A CG1 1 
ATOM   1920 C CG2 . ILE A 1 245 ? 2.249  -1.957  78.550  1.00 24.45 ? 244  ILE A CG2 1 
ATOM   1921 C CD1 . ILE A 1 245 ? 0.438  -2.516  81.291  1.00 37.17 ? 244  ILE A CD1 1 
ATOM   1922 N N   . GLN A 1 246 ? 4.418  -4.306  78.092  1.00 19.12 ? 245  GLN A N   1 
ATOM   1923 C CA  . GLN A 1 246 ? 4.513  -5.607  77.413  1.00 17.88 ? 245  GLN A CA  1 
ATOM   1924 C C   . GLN A 1 246 ? 5.857  -6.265  77.718  1.00 18.24 ? 245  GLN A C   1 
ATOM   1925 O O   . GLN A 1 246 ? 5.925  -7.489  77.828  1.00 17.95 ? 245  GLN A O   1 
ATOM   1926 C CB  . GLN A 1 246 ? 4.329  -5.469  75.889  1.00 19.78 ? 245  GLN A CB  1 
ATOM   1927 C CG  . GLN A 1 246 ? 3.005  -4.831  75.427  1.00 36.47 ? 245  GLN A CG  1 
ATOM   1928 C CD  . GLN A 1 246 ? 3.031  -4.490  73.942  1.00 45.75 ? 245  GLN A CD  1 
ATOM   1929 O OE1 . GLN A 1 246 ? 3.808  -3.650  73.468  1.00 25.22 ? 245  GLN A OE1 1 
ATOM   1930 N NE2 . GLN A 1 246 ? 2.173  -5.135  73.167  1.00 46.90 ? 245  GLN A NE2 1 
ATOM   1931 N N   . ILE A 1 247 ? 6.926  -5.452  77.852  1.00 11.92 ? 246  ILE A N   1 
ATOM   1932 C CA  . ILE A 1 247 ? 8.277  -5.938  78.182  1.00 12.16 ? 246  ILE A CA  1 
ATOM   1933 C C   . ILE A 1 247 ? 8.234  -6.547  79.601  1.00 14.94 ? 246  ILE A C   1 
ATOM   1934 O O   . ILE A 1 247 ? 8.725  -7.662  79.818  1.00 13.44 ? 246  ILE A O   1 
ATOM   1935 C CB  . ILE A 1 247 ? 9.349  -4.794  78.063  1.00 14.63 ? 246  ILE A CB  1 
ATOM   1936 C CG1 . ILE A 1 247 ? 9.467  -4.298  76.600  1.00 15.34 ? 246  ILE A CG1 1 
ATOM   1937 C CG2 . ILE A 1 247 ? 10.732 -5.278  78.553  1.00 15.51 ? 246  ILE A CG2 1 
ATOM   1938 C CD1 . ILE A 1 247 ? 10.236 -2.965  76.436  1.00 15.39 ? 246  ILE A CD1 1 
ATOM   1939 N N   . TYR A 1 248 ? 7.653  -5.813  80.569  1.00 12.74 ? 247  TYR A N   1 
ATOM   1940 C CA  . TYR A 1 248 ? 7.550  -6.287  81.959  1.00 12.11 ? 247  TYR A CA  1 
ATOM   1941 C C   . TYR A 1 248 ? 6.828  -7.621  82.067  1.00 16.15 ? 247  TYR A C   1 
ATOM   1942 O O   . TYR A 1 248 ? 7.272  -8.478  82.837  1.00 15.11 ? 247  TYR A O   1 
ATOM   1943 C CB  . TYR A 1 248 ? 6.876  -5.249  82.870  1.00 13.31 ? 247  TYR A CB  1 
ATOM   1944 C CG  . TYR A 1 248 ? 7.500  -3.870  82.814  1.00 13.82 ? 247  TYR A CG  1 
ATOM   1945 C CD1 . TYR A 1 248 ? 8.872  -3.706  82.610  1.00 15.65 ? 247  TYR A CD1 1 
ATOM   1946 C CD2 . TYR A 1 248 ? 6.727  -2.728  82.998  1.00 15.52 ? 247  TYR A CD2 1 
ATOM   1947 C CE1 . TYR A 1 248 ? 9.444  -2.434  82.514  1.00 16.83 ? 247  TYR A CE1 1 
ATOM   1948 C CE2 . TYR A 1 248 ? 7.299  -1.451  82.950  1.00 16.34 ? 247  TYR A CE2 1 
ATOM   1949 C CZ  . TYR A 1 248 ? 8.653  -1.311  82.694  1.00 20.34 ? 247  TYR A CZ  1 
ATOM   1950 O OH  . TYR A 1 248 ? 9.210  -0.054  82.654  1.00 22.46 ? 247  TYR A OH  1 
ATOM   1951 N N   . GLU A 1 249 ? 5.724  -7.802  81.301  1.00 14.44 ? 248  GLU A N   1 
ATOM   1952 C CA  . GLU A 1 249 ? 4.960  -9.058  81.293  1.00 15.91 ? 248  GLU A CA  1 
ATOM   1953 C C   . GLU A 1 249 ? 5.892  -10.218 80.880  1.00 18.35 ? 248  GLU A C   1 
ATOM   1954 O O   . GLU A 1 249 ? 5.856  -11.274 81.505  1.00 18.61 ? 248  GLU A O   1 
ATOM   1955 C CB  . GLU A 1 249 ? 3.753  -8.984  80.330  1.00 17.44 ? 248  GLU A CB  1 
ATOM   1956 C CG  . GLU A 1 249 ? 2.638  -8.055  80.797  1.00 26.51 ? 248  GLU A CG  1 
ATOM   1957 C CD  . GLU A 1 249 ? 1.577  -7.667  79.774  1.00 50.29 ? 248  GLU A CD  1 
ATOM   1958 O OE1 . GLU A 1 249 ? 1.681  -8.079  78.593  1.00 42.63 ? 248  GLU A OE1 1 
ATOM   1959 O OE2 . GLU A 1 249 ? 0.641  -6.929  80.160  1.00 40.66 ? 248  GLU A OE2 1 
ATOM   1960 N N   . LYS A 1 250 ? 6.728  -10.004 79.842  1.00 14.27 ? 249  LYS A N   1 
ATOM   1961 C CA  . LYS A 1 250 ? 7.648  -11.034 79.352  1.00 13.53 ? 249  LYS A CA  1 
ATOM   1962 C C   . LYS A 1 250 ? 8.736  -11.363 80.381  1.00 16.17 ? 249  LYS A C   1 
ATOM   1963 O O   . LYS A 1 250 ? 9.058  -12.543 80.597  1.00 16.09 ? 249  LYS A O   1 
ATOM   1964 C CB  . LYS A 1 250 ? 8.279  -10.628 78.015  1.00 15.04 ? 249  LYS A CB  1 
ATOM   1965 C CG  . LYS A 1 250 ? 7.282  -10.600 76.870  1.00 16.59 ? 249  LYS A CG  1 
ATOM   1966 C CD  . LYS A 1 250 ? 7.973  -10.288 75.561  1.00 15.97 ? 249  LYS A CD  1 
ATOM   1967 C CE  . LYS A 1 250 ? 6.965  -10.109 74.460  1.00 23.91 ? 249  LYS A CE  1 
ATOM   1968 N NZ  . LYS A 1 250 ? 7.636  -10.047 73.146  1.00 32.30 ? 249  LYS A NZ  1 
ATOM   1969 N N   . ILE A 1 251 ? 9.260  -10.328 81.053  1.00 11.85 ? 250  ILE A N   1 
ATOM   1970 C CA  . ILE A 1 251 ? 10.307 -10.518 82.064  1.00 10.84 ? 250  ILE A CA  1 
ATOM   1971 C C   . ILE A 1 251 ? 9.824  -11.378 83.240  1.00 17.63 ? 250  ILE A C   1 
ATOM   1972 O O   . ILE A 1 251 ? 10.531 -12.301 83.666  1.00 18.05 ? 250  ILE A O   1 
ATOM   1973 C CB  . ILE A 1 251 ? 10.887 -9.168  82.539  1.00 11.97 ? 250  ILE A CB  1 
ATOM   1974 C CG1 . ILE A 1 251 ? 11.671 -8.455  81.396  1.00 10.82 ? 250  ILE A CG1 1 
ATOM   1975 C CG2 . ILE A 1 251 ? 11.750 -9.345  83.825  1.00 12.28 ? 250  ILE A CG2 1 
ATOM   1976 C CD1 . ILE A 1 251 ? 11.941 -6.939  81.649  1.00 11.74 ? 250  ILE A CD1 1 
ATOM   1977 N N   . VAL A 1 252 ? 8.630  -11.070 83.750  1.00 15.14 ? 251  VAL A N   1 
ATOM   1978 C CA  . VAL A 1 252 ? 8.051  -11.780 84.894  1.00 15.80 ? 251  VAL A CA  1 
ATOM   1979 C C   . VAL A 1 252 ? 7.489  -13.170 84.541  1.00 21.48 ? 251  VAL A C   1 
ATOM   1980 O O   . VAL A 1 252 ? 7.324  -13.987 85.452  1.00 22.21 ? 251  VAL A O   1 
ATOM   1981 C CB  . VAL A 1 252 ? 7.071  -10.914 85.748  1.00 19.91 ? 251  VAL A CB  1 
ATOM   1982 C CG1 . VAL A 1 252 ? 7.730  -9.623  86.251  1.00 18.23 ? 251  VAL A CG1 1 
ATOM   1983 C CG2 . VAL A 1 252 ? 5.779  -10.611 84.997  1.00 20.85 ? 251  VAL A CG2 1 
ATOM   1984 N N   . SER A 1 253 ? 7.161  -13.440 83.246  1.00 18.90 ? 252  SER A N   1 
ATOM   1985 C CA  . SER A 1 253 ? 6.584  -14.726 82.821  1.00 19.57 ? 252  SER A CA  1 
ATOM   1986 C C   . SER A 1 253 ? 7.440  -15.973 83.172  1.00 28.08 ? 252  SER A C   1 
ATOM   1987 O O   . SER A 1 253 ? 6.879  -17.054 83.326  1.00 31.22 ? 252  SER A O   1 
ATOM   1988 C CB  . SER A 1 253 ? 6.257  -14.718 81.330  1.00 21.39 ? 252  SER A CB  1 
ATOM   1989 O OG  . SER A 1 253 ? 7.461  -14.757 80.578  1.00 28.46 ? 252  SER A OG  1 
ATOM   1990 N N   . GLY A 1 254 ? 8.759  -15.796 83.299  1.00 27.72 ? 253  GLY A N   1 
ATOM   1991 C CA  . GLY A 1 254 ? 9.706  -16.860 83.642  1.00 29.08 ? 253  GLY A CA  1 
ATOM   1992 C C   . GLY A 1 254 ? 10.201 -17.649 82.448  1.00 34.71 ? 253  GLY A C   1 
ATOM   1993 O O   . GLY A 1 254 ? 10.727 -18.753 82.614  1.00 36.32 ? 253  GLY A O   1 
ATOM   1994 N N   . LYS A 1 255 ? 10.006 -17.105 81.226  1.00 29.55 ? 254  LYS A N   1 
ATOM   1995 C CA  . LYS A 1 255 ? 10.375 -17.769 79.975  1.00 28.44 ? 254  LYS A CA  1 
ATOM   1996 C C   . LYS A 1 255 ? 11.300 -16.916 79.142  1.00 31.84 ? 254  LYS A C   1 
ATOM   1997 O O   . LYS A 1 255 ? 11.097 -15.706 79.038  1.00 32.62 ? 254  LYS A O   1 
ATOM   1998 C CB  . LYS A 1 255 ? 9.132  -18.109 79.145  1.00 29.70 ? 254  LYS A CB  1 
ATOM   1999 C CG  . LYS A 1 255 ? 8.051  -18.906 79.883  1.00 31.07 ? 254  LYS A CG  1 
ATOM   2000 C CD  . LYS A 1 255 ? 7.029  -19.467 78.935  1.00 33.49 ? 254  LYS A CD  1 
ATOM   2001 C CE  . LYS A 1 255 ? 6.122  -18.452 78.287  1.00 29.03 ? 254  LYS A CE  1 
ATOM   2002 N NZ  . LYS A 1 255 ? 5.554  -18.994 77.025  1.00 45.75 ? 254  LYS A NZ  1 
ATOM   2003 N N   . VAL A 1 256 ? 12.322 -17.554 78.546  1.00 26.08 ? 255  VAL A N   1 
ATOM   2004 C CA  . VAL A 1 256 ? 13.316 -16.924 77.673  1.00 25.34 ? 255  VAL A CA  1 
ATOM   2005 C C   . VAL A 1 256 ? 13.576 -17.901 76.526  1.00 26.32 ? 255  VAL A C   1 
ATOM   2006 O O   . VAL A 1 256 ? 13.659 -19.111 76.758  1.00 27.08 ? 255  VAL A O   1 
ATOM   2007 C CB  . VAL A 1 256 ? 14.670 -16.584 78.384  1.00 30.70 ? 255  VAL A CB  1 
ATOM   2008 C CG1 . VAL A 1 256 ? 15.557 -15.707 77.500  1.00 30.33 ? 255  VAL A CG1 1 
ATOM   2009 C CG2 . VAL A 1 256 ? 14.467 -15.932 79.751  1.00 31.21 ? 255  VAL A CG2 1 
ATOM   2010 N N   . ARG A 1 257 ? 13.717 -17.376 75.306  1.00 18.91 ? 256  ARG A N   1 
ATOM   2011 C CA  . ARG A 1 257 ? 14.055 -18.189 74.146  1.00 18.65 ? 256  ARG A CA  1 
ATOM   2012 C C   . ARG A 1 257 ? 15.416 -17.743 73.647  1.00 22.39 ? 256  ARG A C   1 
ATOM   2013 O O   . ARG A 1 257 ? 15.681 -16.541 73.620  1.00 23.08 ? 256  ARG A O   1 
ATOM   2014 C CB  . ARG A 1 257 ? 12.993 -18.055 73.038  1.00 19.56 ? 256  ARG A CB  1 
ATOM   2015 C CG  . ARG A 1 257 ? 11.630 -18.625 73.427  1.00 28.71 ? 256  ARG A CG  1 
ATOM   2016 C CD  . ARG A 1 257 ? 10.739 -18.746 72.207  1.00 43.10 ? 256  ARG A CD  1 
ATOM   2017 N N   . PHE A 1 258 ? 16.286 -18.691 73.275  1.00 18.49 ? 257  PHE A N   1 
ATOM   2018 C CA  . PHE A 1 258 ? 17.629 -18.360 72.777  1.00 17.39 ? 257  PHE A CA  1 
ATOM   2019 C C   . PHE A 1 258 ? 17.752 -18.637 71.269  1.00 21.57 ? 257  PHE A C   1 
ATOM   2020 O O   . PHE A 1 258 ? 17.250 -19.680 70.808  1.00 22.35 ? 257  PHE A O   1 
ATOM   2021 C CB  . PHE A 1 258 ? 18.714 -19.178 73.518  1.00 18.59 ? 257  PHE A CB  1 
ATOM   2022 C CG  . PHE A 1 258 ? 18.734 -19.010 75.021  1.00 18.81 ? 257  PHE A CG  1 
ATOM   2023 C CD1 . PHE A 1 258 ? 19.283 -17.871 75.604  1.00 19.13 ? 257  PHE A CD1 1 
ATOM   2024 C CD2 . PHE A 1 258 ? 18.206 -19.995 75.855  1.00 20.88 ? 257  PHE A CD2 1 
ATOM   2025 C CE1 . PHE A 1 258 ? 19.284 -17.712 76.995  1.00 20.60 ? 257  PHE A CE1 1 
ATOM   2026 C CE2 . PHE A 1 258 ? 18.219 -19.837 77.246  1.00 23.64 ? 257  PHE A CE2 1 
ATOM   2027 C CZ  . PHE A 1 258 ? 18.755 -18.696 77.807  1.00 21.01 ? 257  PHE A CZ  1 
ATOM   2028 N N   . PRO A 1 259 ? 18.469 -17.776 70.495  1.00 17.75 ? 258  PRO A N   1 
ATOM   2029 C CA  . PRO A 1 259 ? 18.704 -18.091 69.073  1.00 17.31 ? 258  PRO A CA  1 
ATOM   2030 C C   . PRO A 1 259 ? 19.395 -19.446 68.929  1.00 22.04 ? 258  PRO A C   1 
ATOM   2031 O O   . PRO A 1 259 ? 20.176 -19.834 69.800  1.00 19.30 ? 258  PRO A O   1 
ATOM   2032 C CB  . PRO A 1 259 ? 19.625 -16.965 68.596  1.00 18.33 ? 258  PRO A CB  1 
ATOM   2033 C CG  . PRO A 1 259 ? 19.375 -15.827 69.576  1.00 21.77 ? 258  PRO A CG  1 
ATOM   2034 C CD  . PRO A 1 259 ? 19.143 -16.515 70.886  1.00 18.24 ? 258  PRO A CD  1 
ATOM   2035 N N   . SER A 1 260 ? 19.098 -20.182 67.844  1.00 20.53 ? 259  SER A N   1 
ATOM   2036 C CA  . SER A 1 260 ? 19.712 -21.500 67.641  1.00 20.68 ? 259  SER A CA  1 
ATOM   2037 C C   . SER A 1 260 ? 21.253 -21.451 67.530  1.00 23.55 ? 259  SER A C   1 
ATOM   2038 O O   . SER A 1 260 ? 21.907 -22.454 67.820  1.00 24.19 ? 259  SER A O   1 
ATOM   2039 C CB  . SER A 1 260 ? 19.097 -22.206 66.432  1.00 25.09 ? 259  SER A CB  1 
ATOM   2040 O OG  . SER A 1 260 ? 19.327 -21.470 65.244  1.00 35.12 ? 259  SER A OG  1 
ATOM   2041 N N   . HIS A 1 261 ? 21.827 -20.292 67.143  1.00 18.70 ? 260  HIS A N   1 
ATOM   2042 C CA  . HIS A 1 261 ? 23.284 -20.139 67.014  1.00 18.06 ? 260  HIS A CA  1 
ATOM   2043 C C   . HIS A 1 261 ? 24.029 -19.960 68.358  1.00 20.87 ? 260  HIS A C   1 
ATOM   2044 O O   . HIS A 1 261 ? 25.267 -19.972 68.368  1.00 19.29 ? 260  HIS A O   1 
ATOM   2045 C CB  . HIS A 1 261 ? 23.661 -19.038 66.003  1.00 17.64 ? 260  HIS A CB  1 
ATOM   2046 C CG  . HIS A 1 261 ? 23.261 -17.653 66.423  1.00 19.11 ? 260  HIS A CG  1 
ATOM   2047 N ND1 . HIS A 1 261 ? 23.987 -16.947 67.374  1.00 19.21 ? 260  HIS A ND1 1 
ATOM   2048 C CD2 . HIS A 1 261 ? 22.241 -16.874 65.989  1.00 18.94 ? 260  HIS A CD2 1 
ATOM   2049 C CE1 . HIS A 1 261 ? 23.363 -15.787 67.518  1.00 17.81 ? 260  HIS A CE1 1 
ATOM   2050 N NE2 . HIS A 1 261 ? 22.324 -15.685 66.696  1.00 17.95 ? 260  HIS A NE2 1 
ATOM   2051 N N   . PHE A 1 262 ? 23.290 -19.746 69.479  1.00 16.29 ? 261  PHE A N   1 
ATOM   2052 C CA  . PHE A 1 262 ? 23.920 -19.620 70.800  1.00 14.48 ? 261  PHE A CA  1 
ATOM   2053 C C   . PHE A 1 262 ? 24.519 -20.958 71.199  1.00 20.23 ? 261  PHE A C   1 
ATOM   2054 O O   . PHE A 1 262 ? 23.864 -22.000 71.050  1.00 21.04 ? 261  PHE A O   1 
ATOM   2055 C CB  . PHE A 1 262 ? 22.903 -19.193 71.877  1.00 14.68 ? 261  PHE A CB  1 
ATOM   2056 C CG  . PHE A 1 262 ? 22.635 -17.717 72.034  1.00 13.71 ? 261  PHE A CG  1 
ATOM   2057 C CD1 . PHE A 1 262 ? 22.923 -16.820 71.003  1.00 14.59 ? 261  PHE A CD1 1 
ATOM   2058 C CD2 . PHE A 1 262 ? 22.086 -17.217 73.216  1.00 13.24 ? 261  PHE A CD2 1 
ATOM   2059 C CE1 . PHE A 1 262 ? 22.676 -15.449 71.166  1.00 15.23 ? 261  PHE A CE1 1 
ATOM   2060 C CE2 . PHE A 1 262 ? 21.813 -15.857 73.362  1.00 15.08 ? 261  PHE A CE2 1 
ATOM   2061 C CZ  . PHE A 1 262 ? 22.120 -14.982 72.346  1.00 14.04 ? 261  PHE A CZ  1 
ATOM   2062 N N   . SER A 1 263 ? 25.761 -20.931 71.696  1.00 16.72 ? 262  SER A N   1 
ATOM   2063 C CA  . SER A 1 263 ? 26.463 -22.126 72.150  1.00 15.77 ? 262  SER A CA  1 
ATOM   2064 C C   . SER A 1 263 ? 25.801 -22.667 73.407  1.00 19.05 ? 262  SER A C   1 
ATOM   2065 O O   . SER A 1 263 ? 25.091 -21.931 74.102  1.00 17.69 ? 262  SER A O   1 
ATOM   2066 C CB  . SER A 1 263 ? 27.939 -21.815 72.414  1.00 18.71 ? 262  SER A CB  1 
ATOM   2067 O OG  . SER A 1 263 ? 28.111 -20.958 73.537  1.00 18.82 ? 262  SER A OG  1 
ATOM   2068 N N   A SER A 1 264 ? 26.045 -23.956 73.704  0.50 16.57 ? 263  SER A N   1 
ATOM   2069 N N   B SER A 1 264 ? 26.041 -23.952 73.706  0.50 16.52 ? 263  SER A N   1 
ATOM   2070 C CA  A SER A 1 264 ? 25.548 -24.622 74.904  0.50 16.69 ? 263  SER A CA  1 
ATOM   2071 C CA  B SER A 1 264 ? 25.532 -24.608 74.907  0.50 16.60 ? 263  SER A CA  1 
ATOM   2072 C C   A SER A 1 264 ? 26.035 -23.883 76.161  0.50 20.02 ? 263  SER A C   1 
ATOM   2073 C C   B SER A 1 264 ? 26.036 -23.888 76.169  0.50 20.01 ? 263  SER A C   1 
ATOM   2074 O O   A SER A 1 264 ? 25.241 -23.667 77.078  0.50 19.41 ? 263  SER A O   1 
ATOM   2075 O O   B SER A 1 264 ? 25.247 -23.674 77.091  0.50 19.43 ? 263  SER A O   1 
ATOM   2076 C CB  A SER A 1 264 ? 26.025 -26.071 74.938  0.50 21.08 ? 263  SER A CB  1 
ATOM   2077 C CB  B SER A 1 264 ? 25.950 -26.074 74.921  0.50 20.93 ? 263  SER A CB  1 
ATOM   2078 O OG  A SER A 1 264 ? 25.429 -26.764 76.021  0.50 30.07 ? 263  SER A OG  1 
ATOM   2079 O OG  B SER A 1 264 ? 25.427 -26.732 73.778  0.50 28.92 ? 263  SER A OG  1 
ATOM   2080 N N   . ASP A 1 265 ? 27.324 -23.462 76.181  1.00 16.95 ? 264  ASP A N   1 
ATOM   2081 C CA  . ASP A 1 265 ? 27.928 -22.726 77.323  1.00 17.07 ? 264  ASP A CA  1 
ATOM   2082 C C   . ASP A 1 265 ? 27.296 -21.361 77.517  1.00 18.87 ? 264  ASP A C   1 
ATOM   2083 O O   . ASP A 1 265 ? 27.055 -20.960 78.651  1.00 16.86 ? 264  ASP A O   1 
ATOM   2084 C CB  . ASP A 1 265 ? 29.443 -22.578 77.175  1.00 18.62 ? 264  ASP A CB  1 
ATOM   2085 C CG  . ASP A 1 265 ? 30.225 -23.886 77.240  1.00 23.61 ? 264  ASP A CG  1 
ATOM   2086 O OD1 . ASP A 1 265 ? 29.749 -24.835 77.904  1.00 21.18 ? 264  ASP A OD1 1 
ATOM   2087 O OD2 . ASP A 1 265 ? 31.338 -23.930 76.692  1.00 24.15 ? 264  ASP A OD2 1 
ATOM   2088 N N   . LEU A 1 266 ? 27.004 -20.652 76.407  1.00 15.18 ? 265  LEU A N   1 
ATOM   2089 C CA  . LEU A 1 266 ? 26.368 -19.337 76.489  1.00 13.04 ? 265  LEU A CA  1 
ATOM   2090 C C   . LEU A 1 266 ? 24.974 -19.477 77.084  1.00 17.02 ? 265  LEU A C   1 
ATOM   2091 O O   . LEU A 1 266 ? 24.636 -18.761 78.027  1.00 17.69 ? 265  LEU A O   1 
ATOM   2092 C CB  . LEU A 1 266 ? 26.316 -18.652 75.104  1.00 11.77 ? 265  LEU A CB  1 
ATOM   2093 C CG  . LEU A 1 266 ? 25.573 -17.287 75.044  1.00 14.49 ? 265  LEU A CG  1 
ATOM   2094 C CD1 . LEU A 1 266 ? 26.117 -16.297 76.107  1.00 15.18 ? 265  LEU A CD1 1 
ATOM   2095 C CD2 . LEU A 1 266 ? 25.746 -16.655 73.696  1.00 16.06 ? 265  LEU A CD2 1 
ATOM   2096 N N   . LYS A 1 267 ? 24.171 -20.395 76.548  1.00 14.23 ? 266  LYS A N   1 
ATOM   2097 C CA  . LYS A 1 267 ? 22.817 -20.615 77.069  1.00 14.32 ? 266  LYS A CA  1 
ATOM   2098 C C   . LYS A 1 267 ? 22.835 -20.962 78.558  1.00 19.45 ? 266  LYS A C   1 
ATOM   2099 O O   . LYS A 1 267 ? 21.998 -20.453 79.304  1.00 17.86 ? 266  LYS A O   1 
ATOM   2100 C CB  . LYS A 1 267 ? 22.085 -21.699 76.266  1.00 16.50 ? 266  LYS A CB  1 
ATOM   2101 C CG  . LYS A 1 267 ? 21.758 -21.255 74.843  1.00 13.97 ? 266  LYS A CG  1 
ATOM   2102 C CD  . LYS A 1 267 ? 20.911 -22.317 74.098  1.00 19.01 ? 266  LYS A CD  1 
ATOM   2103 C CE  . LYS A 1 267 ? 21.722 -23.518 73.665  1.00 26.00 ? 266  LYS A CE  1 
ATOM   2104 N NZ  . LYS A 1 267 ? 20.940 -24.427 72.772  1.00 32.65 ? 266  LYS A NZ  1 
ATOM   2105 N N   . ASP A 1 268 ? 23.798 -21.800 78.993  1.00 17.59 ? 267  ASP A N   1 
ATOM   2106 C CA  . ASP A 1 268 ? 23.920 -22.199 80.397  1.00 17.34 ? 267  ASP A CA  1 
ATOM   2107 C C   . ASP A 1 268 ? 24.239 -20.997 81.279  1.00 20.13 ? 267  ASP A C   1 
ATOM   2108 O O   . ASP A 1 268 ? 23.556 -20.798 82.285  1.00 20.09 ? 267  ASP A O   1 
ATOM   2109 C CB  . ASP A 1 268 ? 24.943 -23.330 80.593  1.00 19.63 ? 267  ASP A CB  1 
ATOM   2110 C CG  . ASP A 1 268 ? 24.936 -23.813 82.027  1.00 23.17 ? 267  ASP A CG  1 
ATOM   2111 O OD1 . ASP A 1 268 ? 24.056 -24.632 82.371  1.00 22.91 ? 267  ASP A OD1 1 
ATOM   2112 O OD2 . ASP A 1 268 ? 25.708 -23.263 82.840  1.00 23.08 ? 267  ASP A OD2 1 
ATOM   2113 N N   . LEU A 1 269 ? 25.208 -20.151 80.871  1.00 15.79 ? 268  LEU A N   1 
ATOM   2114 C CA  . LEU A 1 269 ? 25.538 -18.931 81.633  1.00 14.65 ? 268  LEU A CA  1 
ATOM   2115 C C   . LEU A 1 269 ? 24.309 -18.021 81.743  1.00 18.18 ? 268  LEU A C   1 
ATOM   2116 O O   . LEU A 1 269 ? 23.987 -17.562 82.834  1.00 17.85 ? 268  LEU A O   1 
ATOM   2117 C CB  . LEU A 1 269 ? 26.694 -18.162 80.968  1.00 13.87 ? 268  LEU A CB  1 
ATOM   2118 C CG  . LEU A 1 269 ? 27.051 -16.789 81.583  1.00 15.81 ? 268  LEU A CG  1 
ATOM   2119 C CD1 . LEU A 1 269 ? 27.584 -16.928 82.991  1.00 15.35 ? 268  LEU A CD1 1 
ATOM   2120 C CD2 . LEU A 1 269 ? 28.083 -16.079 80.759  1.00 14.64 ? 268  LEU A CD2 1 
ATOM   2121 N N   . LEU A 1 270 ? 23.607 -17.796 80.604  1.00 15.59 ? 269  LEU A N   1 
ATOM   2122 C CA  . LEU A 1 270 ? 22.426 -16.925 80.555  1.00 14.92 ? 269  LEU A CA  1 
ATOM   2123 C C   . LEU A 1 270 ? 21.268 -17.416 81.429  1.00 18.00 ? 269  LEU A C   1 
ATOM   2124 O O   . LEU A 1 270 ? 20.626 -16.602 82.083  1.00 16.17 ? 269  LEU A O   1 
ATOM   2125 C CB  . LEU A 1 270 ? 21.980 -16.639 79.120  1.00 14.30 ? 269  LEU A CB  1 
ATOM   2126 C CG  . LEU A 1 270 ? 22.967 -15.826 78.278  1.00 15.97 ? 269  LEU A CG  1 
ATOM   2127 C CD1 . LEU A 1 270 ? 22.507 -15.723 76.832  1.00 15.15 ? 269  LEU A CD1 1 
ATOM   2128 C CD2 . LEU A 1 270 ? 23.233 -14.432 78.882  1.00 13.91 ? 269  LEU A CD2 1 
ATOM   2129 N N   . ARG A 1 271 ? 21.056 -18.738 81.508  1.00 17.74 ? 270  ARG A N   1 
ATOM   2130 C CA  . ARG A 1 271 ? 20.033 -19.299 82.408  1.00 18.19 ? 270  ARG A CA  1 
ATOM   2131 C C   . ARG A 1 271 ? 20.366 -19.003 83.880  1.00 22.14 ? 270  ARG A C   1 
ATOM   2132 O O   . ARG A 1 271 ? 19.464 -18.818 84.699  1.00 22.10 ? 270  ARG A O   1 
ATOM   2133 C CB  . ARG A 1 271 ? 19.873 -20.805 82.199  1.00 17.15 ? 270  ARG A CB  1 
ATOM   2134 C CG  . ARG A 1 271 ? 19.162 -21.122 80.883  1.00 20.56 ? 270  ARG A CG  1 
ATOM   2135 C CD  . ARG A 1 271 ? 18.836 -22.605 80.766  1.00 26.27 ? 270  ARG A CD  1 
ATOM   2136 N NE  . ARG A 1 271 ? 18.457 -22.929 79.389  1.00 31.09 ? 270  ARG A NE  1 
ATOM   2137 C CZ  . ARG A 1 271 ? 19.230 -23.582 78.529  1.00 40.34 ? 270  ARG A CZ  1 
ATOM   2138 N NH1 . ARG A 1 271 ? 20.425 -24.026 78.902  1.00 26.08 ? 270  ARG A NH1 1 
ATOM   2139 N NH2 . ARG A 1 271 ? 18.812 -23.801 77.290  1.00 27.08 ? 270  ARG A NH2 1 
ATOM   2140 N N   . ASN A 1 272 ? 21.659 -18.947 84.201  1.00 18.87 ? 271  ASN A N   1 
ATOM   2141 C CA  . ASN A 1 272 ? 22.137 -18.651 85.543  1.00 17.79 ? 271  ASN A CA  1 
ATOM   2142 C C   . ASN A 1 272 ? 22.132 -17.151 85.895  1.00 19.05 ? 271  ASN A C   1 
ATOM   2143 O O   . ASN A 1 272 ? 22.074 -16.821 87.071  1.00 18.17 ? 271  ASN A O   1 
ATOM   2144 C CB  . ASN A 1 272 ? 23.483 -19.317 85.798  1.00 17.33 ? 271  ASN A CB  1 
ATOM   2145 C CG  . ASN A 1 272 ? 23.331 -20.801 85.979  1.00 24.00 ? 271  ASN A CG  1 
ATOM   2146 O OD1 . ASN A 1 272 ? 22.865 -21.288 87.020  1.00 22.67 ? 271  ASN A OD1 1 
ATOM   2147 N ND2 . ASN A 1 272 ? 23.668 -21.558 84.954  1.00 18.77 ? 271  ASN A ND2 1 
ATOM   2148 N N   . LEU A 1 273 ? 22.160 -16.251 84.889  1.00 15.44 ? 272  LEU A N   1 
ATOM   2149 C CA  . LEU A 1 273 ? 22.127 -14.806 85.131  1.00 14.17 ? 272  LEU A CA  1 
ATOM   2150 C C   . LEU A 1 273 ? 20.695 -14.283 85.060  1.00 16.27 ? 272  LEU A C   1 
ATOM   2151 O O   . LEU A 1 273 ? 20.284 -13.506 85.926  1.00 14.10 ? 272  LEU A O   1 
ATOM   2152 C CB  . LEU A 1 273 ? 23.043 -14.049 84.147  1.00 13.22 ? 272  LEU A CB  1 
ATOM   2153 C CG  . LEU A 1 273 ? 24.550 -14.279 84.285  1.00 16.16 ? 272  LEU A CG  1 
ATOM   2154 C CD1 . LEU A 1 273 ? 25.276 -13.690 83.056  1.00 15.18 ? 272  LEU A CD1 1 
ATOM   2155 C CD2 . LEU A 1 273 ? 25.096 -13.644 85.599  1.00 15.35 ? 272  LEU A CD2 1 
ATOM   2156 N N   . LEU A 1 274 ? 19.940 -14.711 84.017  1.00 13.57 ? 273  LEU A N   1 
ATOM   2157 C CA  . LEU A 1 274 ? 18.527 -14.383 83.813  1.00 12.50 ? 273  LEU A CA  1 
ATOM   2158 C C   . LEU A 1 274 ? 17.704 -15.395 84.642  1.00 17.39 ? 273  LEU A C   1 
ATOM   2159 O O   . LEU A 1 274 ? 16.784 -16.045 84.140  1.00 16.27 ? 273  LEU A O   1 
ATOM   2160 C CB  . LEU A 1 274 ? 18.158 -14.488 82.327  1.00 12.40 ? 273  LEU A CB  1 
ATOM   2161 C CG  . LEU A 1 274 ? 18.906 -13.550 81.373  1.00 15.09 ? 273  LEU A CG  1 
ATOM   2162 C CD1 . LEU A 1 274 ? 18.539 -13.869 79.937  1.00 14.24 ? 273  LEU A CD1 1 
ATOM   2163 C CD2 . LEU A 1 274 ? 18.596 -12.071 81.697  1.00 15.14 ? 273  LEU A CD2 1 
ATOM   2164 N N   . GLN A 1 275 ? 18.052 -15.493 85.914  1.00 15.47 ? 274  GLN A N   1 
ATOM   2165 C CA  . GLN A 1 275 ? 17.473 -16.402 86.907  1.00 16.16 ? 274  GLN A CA  1 
ATOM   2166 C C   . GLN A 1 275 ? 16.576 -15.613 87.875  1.00 19.88 ? 274  GLN A C   1 
ATOM   2167 O O   . GLN A 1 275 ? 17.058 -14.726 88.588  1.00 18.32 ? 274  GLN A O   1 
ATOM   2168 C CB  . GLN A 1 275 ? 18.621 -17.127 87.652  1.00 17.76 ? 274  GLN A CB  1 
ATOM   2169 C CG  . GLN A 1 275 ? 18.203 -17.970 88.850  1.00 21.88 ? 274  GLN A CG  1 
ATOM   2170 C CD  . GLN A 1 275 ? 17.216 -19.057 88.477  1.00 31.68 ? 274  GLN A CD  1 
ATOM   2171 O OE1 . GLN A 1 275 ? 16.003 -18.883 88.577  1.00 25.06 ? 274  GLN A OE1 1 
ATOM   2172 N NE2 . GLN A 1 275 ? 17.710 -20.178 87.990  1.00 26.20 ? 274  GLN A NE2 1 
ATOM   2173 N N   . VAL A 1 276 ? 15.277 -15.938 87.899  1.00 18.35 ? 275  VAL A N   1 
ATOM   2174 C CA  . VAL A 1 276 ? 14.294 -15.268 88.764  1.00 18.94 ? 275  VAL A CA  1 
ATOM   2175 C C   . VAL A 1 276 ? 14.570 -15.527 90.257  1.00 23.02 ? 275  VAL A C   1 
ATOM   2176 O O   . VAL A 1 276 ? 14.387 -14.637 91.089  1.00 22.59 ? 275  VAL A O   1 
ATOM   2177 C CB  . VAL A 1 276 ? 12.825 -15.600 88.348  1.00 24.51 ? 275  VAL A CB  1 
ATOM   2178 C CG1 . VAL A 1 276 ? 12.489 -17.088 88.505  1.00 24.90 ? 275  VAL A CG1 1 
ATOM   2179 C CG2 . VAL A 1 276 ? 11.817 -14.729 89.095  1.00 24.87 ? 275  VAL A CG2 1 
ATOM   2180 N N   . ASP A 1 277 ? 15.033 -16.738 90.575  1.00 21.04 ? 276  ASP A N   1 
ATOM   2181 C CA  . ASP A 1 277 ? 15.302 -17.174 91.940  1.00 21.45 ? 276  ASP A CA  1 
ATOM   2182 C C   . ASP A 1 277 ? 16.629 -16.610 92.408  1.00 24.04 ? 276  ASP A C   1 
ATOM   2183 O O   . ASP A 1 277 ? 17.682 -17.051 91.961  1.00 22.95 ? 276  ASP A O   1 
ATOM   2184 C CB  . ASP A 1 277 ? 15.291 -18.706 92.008  1.00 23.23 ? 276  ASP A CB  1 
ATOM   2185 C CG  . ASP A 1 277 ? 15.319 -19.300 93.408  1.00 30.22 ? 276  ASP A CG  1 
ATOM   2186 O OD1 . ASP A 1 277 ? 15.698 -18.579 94.360  1.00 28.79 ? 276  ASP A OD1 1 
ATOM   2187 O OD2 . ASP A 1 277 ? 14.981 -20.487 93.547  1.00 35.12 ? 276  ASP A OD2 1 
ATOM   2188 N N   . LEU A 1 278 ? 16.564 -15.663 93.347  1.00 21.11 ? 277  LEU A N   1 
ATOM   2189 C CA  . LEU A 1 278 ? 17.723 -14.970 93.913  1.00 21.05 ? 277  LEU A CA  1 
ATOM   2190 C C   . LEU A 1 278 ? 18.672 -15.873 94.676  1.00 25.39 ? 277  LEU A C   1 
ATOM   2191 O O   . LEU A 1 278 ? 19.849 -15.542 94.786  1.00 26.47 ? 277  LEU A O   1 
ATOM   2192 C CB  . LEU A 1 278 ? 17.270 -13.788 94.776  1.00 21.66 ? 277  LEU A CB  1 
ATOM   2193 C CG  . LEU A 1 278 ? 16.684 -12.602 94.015  1.00 25.94 ? 277  LEU A CG  1 
ATOM   2194 C CD1 . LEU A 1 278 ? 15.909 -11.693 94.956  1.00 26.26 ? 277  LEU A CD1 1 
ATOM   2195 C CD2 . LEU A 1 278 ? 17.770 -11.818 93.304  1.00 28.03 ? 277  LEU A CD2 1 
ATOM   2196 N N   . THR A 1 279 ? 18.190 -17.041 95.151  1.00 22.72 ? 278  THR A N   1 
ATOM   2197 C CA  . THR A 1 279 ? 19.041 -18.017 95.833  1.00 23.46 ? 278  THR A CA  1 
ATOM   2198 C C   . THR A 1 279 ? 19.828 -18.815 94.789  1.00 27.25 ? 278  THR A C   1 
ATOM   2199 O O   . THR A 1 279 ? 20.696 -19.594 95.178  1.00 28.13 ? 278  THR A O   1 
ATOM   2200 C CB  . THR A 1 279 ? 18.210 -18.976 96.743  1.00 30.32 ? 278  THR A CB  1 
ATOM   2201 O OG1 . THR A 1 279 ? 17.405 -19.839 95.923  1.00 27.34 ? 278  THR A OG1 1 
ATOM   2202 C CG2 . THR A 1 279 ? 17.346 -18.230 97.770  1.00 27.02 ? 278  THR A CG2 1 
ATOM   2203 N N   . LYS A 1 280 ? 19.525 -18.641 93.470  1.00 23.17 ? 279  LYS A N   1 
ATOM   2204 C CA  . LYS A 1 280 ? 20.192 -19.372 92.376  1.00 21.84 ? 279  LYS A CA  1 
ATOM   2205 C C   . LYS A 1 280 ? 20.942 -18.485 91.370  1.00 23.26 ? 279  LYS A C   1 
ATOM   2206 O O   . LYS A 1 280 ? 21.733 -19.008 90.576  1.00 22.30 ? 279  LYS A O   1 
ATOM   2207 C CB  . LYS A 1 280 ? 19.171 -20.241 91.607  1.00 24.96 ? 279  LYS A CB  1 
ATOM   2208 C CG  . LYS A 1 280 ? 18.553 -21.368 92.423  1.00 31.97 ? 279  LYS A CG  1 
ATOM   2209 C CD  . LYS A 1 280 ? 17.523 -22.145 91.628  1.00 38.02 ? 279  LYS A CD  1 
ATOM   2210 C CE  . LYS A 1 280 ? 16.945 -23.274 92.447  1.00 53.84 ? 279  LYS A CE  1 
ATOM   2211 N NZ  . LYS A 1 280 ? 15.961 -24.072 91.669  1.00 61.03 ? 279  LYS A NZ  1 
ATOM   2212 N N   . ARG A 1 281 ? 20.660 -17.170 91.356  1.00 18.72 ? 280  ARG A N   1 
ATOM   2213 C CA  . ARG A 1 281 ? 21.265 -16.256 90.370  1.00 16.96 ? 280  ARG A CA  1 
ATOM   2214 C C   . ARG A 1 281 ? 22.761 -16.093 90.573  1.00 21.77 ? 280  ARG A C   1 
ATOM   2215 O O   . ARG A 1 281 ? 23.192 -15.679 91.653  1.00 21.41 ? 280  ARG A O   1 
ATOM   2216 C CB  . ARG A 1 281 ? 20.594 -14.872 90.414  1.00 14.62 ? 280  ARG A CB  1 
ATOM   2217 C CG  . ARG A 1 281 ? 21.009 -13.983 89.223  1.00 14.90 ? 280  ARG A CG  1 
ATOM   2218 C CD  . ARG A 1 281 ? 20.329 -12.615 89.208  1.00 17.69 ? 280  ARG A CD  1 
ATOM   2219 N NE  . ARG A 1 281 ? 18.871 -12.744 89.231  1.00 19.02 ? 280  ARG A NE  1 
ATOM   2220 C CZ  . ARG A 1 281 ? 18.035 -11.801 89.652  1.00 16.65 ? 280  ARG A CZ  1 
ATOM   2221 N NH1 . ARG A 1 281 ? 18.500 -10.638 90.080  1.00 12.45 ? 280  ARG A NH1 1 
ATOM   2222 N NH2 . ARG A 1 281 ? 16.730 -12.032 89.686  1.00 16.41 ? 280  ARG A NH2 1 
ATOM   2223 N N   . PHE A 1 282 ? 23.549 -16.345 89.510  1.00 19.00 ? 281  PHE A N   1 
ATOM   2224 C CA  . PHE A 1 282 ? 24.993 -16.133 89.558  1.00 19.73 ? 281  PHE A CA  1 
ATOM   2225 C C   . PHE A 1 282 ? 25.312 -14.681 89.892  1.00 22.58 ? 281  PHE A C   1 
ATOM   2226 O O   . PHE A 1 282 ? 24.630 -13.756 89.417  1.00 20.56 ? 281  PHE A O   1 
ATOM   2227 C CB  . PHE A 1 282 ? 25.646 -16.517 88.210  1.00 21.67 ? 281  PHE A CB  1 
ATOM   2228 C CG  . PHE A 1 282 ? 26.026 -17.969 88.016  1.00 24.30 ? 281  PHE A CG  1 
ATOM   2229 C CD1 . PHE A 1 282 ? 25.501 -18.966 88.840  1.00 27.72 ? 281  PHE A CD1 1 
ATOM   2230 C CD2 . PHE A 1 282 ? 26.856 -18.352 86.967  1.00 26.65 ? 281  PHE A CD2 1 
ATOM   2231 C CE1 . PHE A 1 282 ? 25.852 -20.311 88.651  1.00 29.87 ? 281  PHE A CE1 1 
ATOM   2232 C CE2 . PHE A 1 282 ? 27.202 -19.694 86.778  1.00 30.30 ? 281  PHE A CE2 1 
ATOM   2233 C CZ  . PHE A 1 282 ? 26.699 -20.666 87.622  1.00 28.42 ? 281  PHE A CZ  1 
ATOM   2234 N N   . GLY A 1 283 ? 26.349 -14.513 90.695  1.00 21.50 ? 282  GLY A N   1 
ATOM   2235 C CA  . GLY A 1 283 ? 26.849 -13.228 91.161  1.00 21.94 ? 282  GLY A CA  1 
ATOM   2236 C C   . GLY A 1 283 ? 26.428 -12.970 92.591  1.00 32.68 ? 282  GLY A C   1 
ATOM   2237 O O   . GLY A 1 283 ? 27.159 -12.328 93.345  1.00 34.65 ? 282  GLY A O   1 
ATOM   2238 N N   . ASN A 1 284 ? 25.269 -13.541 92.982  1.00 32.75 ? 283  ASN A N   1 
ATOM   2239 C CA  . ASN A 1 284 ? 24.621 -13.371 94.282  1.00 34.34 ? 283  ASN A CA  1 
ATOM   2240 C C   . ASN A 1 284 ? 25.078 -14.323 95.366  1.00 40.39 ? 283  ASN A C   1 
ATOM   2241 O O   . ASN A 1 284 ? 25.120 -13.937 96.537  1.00 41.80 ? 283  ASN A O   1 
ATOM   2242 C CB  . ASN A 1 284 ? 23.086 -13.493 94.116  1.00 30.96 ? 283  ASN A CB  1 
ATOM   2243 C CG  . ASN A 1 284 ? 22.268 -12.664 95.085  1.00 47.68 ? 283  ASN A CG  1 
ATOM   2244 O OD1 . ASN A 1 284 ? 22.731 -11.656 95.642  1.00 44.37 ? 283  ASN A OD1 1 
ATOM   2245 N ND2 . ASN A 1 284 ? 21.008 -13.051 95.274  1.00 32.82 ? 283  ASN A ND2 1 
ATOM   2246 N N   . LEU A 1 285 ? 25.395 -15.565 94.967  1.00 35.54 ? 284  LEU A N   1 
ATOM   2247 C CA  . LEU A 1 285 ? 25.715 -16.712 95.810  1.00 34.58 ? 284  LEU A CA  1 
ATOM   2248 C C   . LEU A 1 285 ? 26.965 -16.636 96.675  1.00 35.48 ? 284  LEU A C   1 
ATOM   2249 O O   . LEU A 1 285 ? 27.698 -15.650 96.618  1.00 33.62 ? 284  LEU A O   1 
ATOM   2250 C CB  . LEU A 1 285 ? 25.611 -18.023 95.001  1.00 35.12 ? 284  LEU A CB  1 
ATOM   2251 C CG  . LEU A 1 285 ? 24.467 -18.069 93.955  1.00 39.61 ? 284  LEU A CG  1 
ATOM   2252 C CD1 . LEU A 1 285 ? 24.417 -19.389 93.235  1.00 39.82 ? 284  LEU A CD1 1 
ATOM   2253 C CD2 . LEU A 1 285 ? 23.113 -17.729 94.579  1.00 42.13 ? 284  LEU A CD2 1 
ATOM   2254 N N   . LYS A 1 286 ? 27.169 -17.668 97.531  1.00 32.38 ? 285  LYS A N   1 
ATOM   2255 C CA  . LYS A 1 286 ? 28.301 -17.775 98.452  1.00 32.67 ? 285  LYS A CA  1 
ATOM   2256 C C   . LYS A 1 286 ? 29.647 -17.535 97.765  1.00 36.14 ? 285  LYS A C   1 
ATOM   2257 O O   . LYS A 1 286 ? 30.468 -16.793 98.301  1.00 35.83 ? 285  LYS A O   1 
ATOM   2258 C CB  . LYS A 1 286 ? 28.288 -19.129 99.189  1.00 36.01 ? 285  LYS A CB  1 
ATOM   2259 N N   . ASN A 1 287 ? 29.858 -18.121 96.567  1.00 32.95 ? 286  ASN A N   1 
ATOM   2260 C CA  . ASN A 1 287 ? 31.115 -17.957 95.823  1.00 32.30 ? 286  ASN A CA  1 
ATOM   2261 C C   . ASN A 1 287 ? 31.216 -16.631 95.049  1.00 34.05 ? 286  ASN A C   1 
ATOM   2262 O O   . ASN A 1 287 ? 32.272 -16.336 94.483  1.00 35.36 ? 286  ASN A O   1 
ATOM   2263 C CB  . ASN A 1 287 ? 31.398 -19.166 94.924  1.00 35.08 ? 286  ASN A CB  1 
ATOM   2264 C CG  . ASN A 1 287 ? 31.406 -20.500 95.637  1.00 64.67 ? 286  ASN A CG  1 
ATOM   2265 O OD1 . ASN A 1 287 ? 30.724 -21.449 95.234  1.00 61.75 ? 286  ASN A OD1 1 
ATOM   2266 N ND2 . ASN A 1 287 ? 32.163 -20.605 96.719  1.00 58.87 ? 286  ASN A ND2 1 
ATOM   2267 N N   . GLY A 1 288 ? 30.124 -15.861 95.040  1.00 26.74 ? 287  GLY A N   1 
ATOM   2268 C CA  . GLY A 1 288 ? 30.034 -14.542 94.424  1.00 24.60 ? 287  GLY A CA  1 
ATOM   2269 C C   . GLY A 1 288 ? 30.343 -14.513 92.943  1.00 26.07 ? 287  GLY A C   1 
ATOM   2270 O O   . GLY A 1 288 ? 29.848 -15.354 92.190  1.00 24.18 ? 287  GLY A O   1 
ATOM   2271 N N   . VAL A 1 289 ? 31.202 -13.558 92.534  1.00 21.44 ? 288  VAL A N   1 
ATOM   2272 C CA  . VAL A 1 289 ? 31.606 -13.332 91.139  1.00 20.03 ? 288  VAL A CA  1 
ATOM   2273 C C   . VAL A 1 289 ? 32.387 -14.514 90.517  1.00 21.56 ? 288  VAL A C   1 
ATOM   2274 O O   . VAL A 1 289 ? 32.418 -14.673 89.293  1.00 20.04 ? 288  VAL A O   1 
ATOM   2275 C CB  . VAL A 1 289 ? 32.316 -11.952 90.968  1.00 22.83 ? 288  VAL A CB  1 
ATOM   2276 C CG1 . VAL A 1 289 ? 33.727 -11.960 91.554  1.00 24.15 ? 288  VAL A CG1 1 
ATOM   2277 C CG2 . VAL A 1 289 ? 32.342 -11.509 89.508  1.00 21.53 ? 288  VAL A CG2 1 
ATOM   2278 N N   . ASN A 1 290 ? 33.023 -15.337 91.358  1.00 19.57 ? 289  ASN A N   1 
ATOM   2279 C CA  . ASN A 1 290 ? 33.772 -16.488 90.863  1.00 20.78 ? 289  ASN A CA  1 
ATOM   2280 C C   . ASN A 1 290 ? 32.883 -17.507 90.156  1.00 22.76 ? 289  ASN A C   1 
ATOM   2281 O O   . ASN A 1 290 ? 33.369 -18.217 89.282  1.00 22.92 ? 289  ASN A O   1 
ATOM   2282 C CB  . ASN A 1 290 ? 34.605 -17.118 91.964  1.00 25.83 ? 289  ASN A CB  1 
ATOM   2283 C CG  . ASN A 1 290 ? 35.649 -16.168 92.477  1.00 59.85 ? 289  ASN A CG  1 
ATOM   2284 O OD1 . ASN A 1 290 ? 35.393 -15.363 93.380  1.00 55.33 ? 289  ASN A OD1 1 
ATOM   2285 N ND2 . ASN A 1 290 ? 36.813 -16.171 91.843  1.00 55.63 ? 289  ASN A ND2 1 
ATOM   2286 N N   . ASP A 1 291 ? 31.581 -17.549 90.493  1.00 18.61 ? 290  ASP A N   1 
ATOM   2287 C CA  . ASP A 1 291 ? 30.635 -18.437 89.809  1.00 18.46 ? 290  ASP A CA  1 
ATOM   2288 C C   . ASP A 1 291 ? 30.570 -18.021 88.322  1.00 20.63 ? 290  ASP A C   1 
ATOM   2289 O O   . ASP A 1 291 ? 30.472 -18.877 87.445  1.00 19.63 ? 290  ASP A O   1 
ATOM   2290 C CB  . ASP A 1 291 ? 29.237 -18.349 90.445  1.00 19.58 ? 290  ASP A CB  1 
ATOM   2291 C CG  . ASP A 1 291 ? 29.056 -19.222 91.677  1.00 26.45 ? 290  ASP A CG  1 
ATOM   2292 O OD1 . ASP A 1 291 ? 29.808 -20.208 91.822  1.00 28.61 ? 290  ASP A OD1 1 
ATOM   2293 O OD2 . ASP A 1 291 ? 28.137 -18.941 92.473  1.00 30.43 ? 290  ASP A OD2 1 
ATOM   2294 N N   . ILE A 1 292 ? 30.711 -16.714 88.056  1.00 15.62 ? 291  ILE A N   1 
ATOM   2295 C CA  . ILE A 1 292 ? 30.713 -16.169 86.689  1.00 14.91 ? 291  ILE A CA  1 
ATOM   2296 C C   . ILE A 1 292 ? 32.091 -16.356 86.043  1.00 18.84 ? 291  ILE A C   1 
ATOM   2297 O O   . ILE A 1 292 ? 32.180 -16.880 84.942  1.00 17.47 ? 291  ILE A O   1 
ATOM   2298 C CB  . ILE A 1 292 ? 30.214 -14.699 86.674  1.00 17.19 ? 291  ILE A CB  1 
ATOM   2299 C CG1 . ILE A 1 292 ? 28.781 -14.618 87.251  1.00 16.89 ? 291  ILE A CG1 1 
ATOM   2300 C CG2 . ILE A 1 292 ? 30.257 -14.100 85.248  1.00 18.43 ? 291  ILE A CG2 1 
ATOM   2301 C CD1 . ILE A 1 292 ? 28.217 -13.191 87.484  1.00 18.42 ? 291  ILE A CD1 1 
ATOM   2302 N N   . LYS A 1 293 ? 33.168 -15.925 86.725  1.00 17.49 ? 292  LYS A N   1 
ATOM   2303 C CA  . LYS A 1 293 ? 34.526 -16.031 86.174  1.00 17.28 ? 292  LYS A CA  1 
ATOM   2304 C C   . LYS A 1 293 ? 34.952 -17.428 85.822  1.00 20.78 ? 292  LYS A C   1 
ATOM   2305 O O   . LYS A 1 293 ? 35.712 -17.607 84.862  1.00 19.70 ? 292  LYS A O   1 
ATOM   2306 C CB  . LYS A 1 293 ? 35.555 -15.417 87.125  1.00 19.72 ? 292  LYS A CB  1 
ATOM   2307 C CG  . LYS A 1 293 ? 35.422 -13.920 87.296  1.00 18.74 ? 292  LYS A CG  1 
ATOM   2308 C CD  . LYS A 1 293 ? 36.693 -13.445 88.057  1.00 21.59 ? 292  LYS A CD  1 
ATOM   2309 C CE  . LYS A 1 293 ? 36.685 -11.985 88.365  1.00 28.34 ? 292  LYS A CE  1 
ATOM   2310 N NZ  . LYS A 1 293 ? 37.851 -11.615 89.224  1.00 28.52 ? 292  LYS A NZ  1 
ATOM   2311 N N   . ASN A 1 294 ? 34.521 -18.422 86.638  1.00 17.87 ? 293  ASN A N   1 
ATOM   2312 C CA  . ASN A 1 294 ? 34.883 -19.825 86.468  1.00 17.98 ? 293  ASN A CA  1 
ATOM   2313 C C   . ASN A 1 294 ? 33.922 -20.606 85.562  1.00 21.36 ? 293  ASN A C   1 
ATOM   2314 O O   . ASN A 1 294 ? 34.168 -21.787 85.322  1.00 20.13 ? 293  ASN A O   1 
ATOM   2315 C CB  . ASN A 1 294 ? 35.091 -20.493 87.836  1.00 22.46 ? 293  ASN A CB  1 
ATOM   2316 C CG  . ASN A 1 294 ? 36.249 -19.878 88.615  1.00 38.04 ? 293  ASN A CG  1 
ATOM   2317 O OD1 . ASN A 1 294 ? 37.220 -19.372 88.045  1.00 33.86 ? 293  ASN A OD1 1 
ATOM   2318 N ND2 . ASN A 1 294 ? 36.204 -19.933 89.932  1.00 29.55 ? 293  ASN A ND2 1 
ATOM   2319 N N   . HIS A 1 295 ? 32.867 -19.926 84.992  1.00 17.17 ? 294  HIS A N   1 
ATOM   2320 C CA  . HIS A 1 295 ? 31.917 -20.588 84.090  1.00 15.81 ? 294  HIS A CA  1 
ATOM   2321 C C   . HIS A 1 295 ? 32.624 -21.025 82.792  1.00 19.78 ? 294  HIS A C   1 
ATOM   2322 O O   . HIS A 1 295 ? 33.515 -20.328 82.299  1.00 17.96 ? 294  HIS A O   1 
ATOM   2323 C CB  . HIS A 1 295 ? 30.709 -19.682 83.752  1.00 15.19 ? 294  HIS A CB  1 
ATOM   2324 C CG  . HIS A 1 295 ? 29.605 -20.414 83.035  1.00 18.10 ? 294  HIS A CG  1 
ATOM   2325 N ND1 . HIS A 1 295 ? 29.650 -20.630 81.664  1.00 19.42 ? 294  HIS A ND1 1 
ATOM   2326 C CD2 . HIS A 1 295 ? 28.490 -20.999 83.529  1.00 19.22 ? 294  HIS A CD2 1 
ATOM   2327 C CE1 . HIS A 1 295 ? 28.561 -21.327 81.376  1.00 18.91 ? 294  HIS A CE1 1 
ATOM   2328 N NE2 . HIS A 1 295 ? 27.841 -21.586 82.471  1.00 18.63 ? 294  HIS A NE2 1 
ATOM   2329 N N   . LYS A 1 296 ? 32.198 -22.161 82.226  1.00 18.33 ? 295  LYS A N   1 
ATOM   2330 C CA  . LYS A 1 296 ? 32.764 -22.719 80.987  1.00 18.14 ? 295  LYS A CA  1 
ATOM   2331 C C   . LYS A 1 296 ? 32.812 -21.684 79.856  1.00 19.54 ? 295  LYS A C   1 
ATOM   2332 O O   . LYS A 1 296 ? 33.776 -21.674 79.083  1.00 18.35 ? 295  LYS A O   1 
ATOM   2333 C CB  . LYS A 1 296 ? 31.962 -23.948 80.529  1.00 20.61 ? 295  LYS A CB  1 
ATOM   2334 C CG  . LYS A 1 296 ? 32.382 -25.254 81.196  1.00 35.04 ? 295  LYS A CG  1 
ATOM   2335 N N   . TRP A 1 297 ? 31.791 -20.797 79.758  1.00 17.82 ? 296  TRP A N   1 
ATOM   2336 C CA  . TRP A 1 297 ? 31.799 -19.784 78.691  1.00 17.11 ? 296  TRP A CA  1 
ATOM   2337 C C   . TRP A 1 297 ? 33.022 -18.862 78.750  1.00 19.62 ? 296  TRP A C   1 
ATOM   2338 O O   . TRP A 1 297 ? 33.472 -18.403 77.708  1.00 19.33 ? 296  TRP A O   1 
ATOM   2339 C CB  . TRP A 1 297 ? 30.515 -18.952 78.671  1.00 15.75 ? 296  TRP A CB  1 
ATOM   2340 C CG  . TRP A 1 297 ? 30.301 -18.212 77.373  1.00 16.48 ? 296  TRP A CG  1 
ATOM   2341 C CD1 . TRP A 1 297 ? 30.045 -18.760 76.150  1.00 19.45 ? 296  TRP A CD1 1 
ATOM   2342 C CD2 . TRP A 1 297 ? 30.240 -16.782 77.193  1.00 15.65 ? 296  TRP A CD2 1 
ATOM   2343 N NE1 . TRP A 1 297 ? 29.863 -17.764 75.209  1.00 17.51 ? 296  TRP A NE1 1 
ATOM   2344 C CE2 . TRP A 1 297 ? 29.941 -16.543 75.829  1.00 18.28 ? 296  TRP A CE2 1 
ATOM   2345 C CE3 . TRP A 1 297 ? 30.403 -15.683 78.052  1.00 16.07 ? 296  TRP A CE3 1 
ATOM   2346 C CZ2 . TRP A 1 297 ? 29.811 -15.249 75.304  1.00 17.00 ? 296  TRP A CZ2 1 
ATOM   2347 C CZ3 . TRP A 1 297 ? 30.268 -14.401 77.536  1.00 16.57 ? 296  TRP A CZ3 1 
ATOM   2348 C CH2 . TRP A 1 297 ? 29.956 -14.192 76.181  1.00 17.00 ? 296  TRP A CH2 1 
ATOM   2349 N N   . PHE A 1 298 ? 33.582 -18.631 79.953  1.00 15.87 ? 297  PHE A N   1 
ATOM   2350 C CA  . PHE A 1 298 ? 34.761 -17.776 80.113  1.00 14.82 ? 297  PHE A CA  1 
ATOM   2351 C C   . PHE A 1 298 ? 36.068 -18.587 80.270  1.00 19.04 ? 297  PHE A C   1 
ATOM   2352 O O   . PHE A 1 298 ? 37.076 -18.036 80.729  1.00 18.12 ? 297  PHE A O   1 
ATOM   2353 C CB  . PHE A 1 298 ? 34.581 -16.848 81.331  1.00 14.18 ? 297  PHE A CB  1 
ATOM   2354 C CG  . PHE A 1 298 ? 33.574 -15.743 81.174  1.00 14.03 ? 297  PHE A CG  1 
ATOM   2355 C CD1 . PHE A 1 298 ? 33.860 -14.627 80.396  1.00 15.04 ? 297  PHE A CD1 1 
ATOM   2356 C CD2 . PHE A 1 298 ? 32.358 -15.788 81.849  1.00 14.72 ? 297  PHE A CD2 1 
ATOM   2357 C CE1 . PHE A 1 298 ? 32.938 -13.583 80.271  1.00 15.00 ? 297  PHE A CE1 1 
ATOM   2358 C CE2 . PHE A 1 298 ? 31.452 -14.717 81.764  1.00 17.63 ? 297  PHE A CE2 1 
ATOM   2359 C CZ  . PHE A 1 298 ? 31.746 -13.631 80.964  1.00 15.00 ? 297  PHE A CZ  1 
ATOM   2360 N N   . ALA A 1 299 ? 36.069 -19.880 79.907  1.00 16.62 ? 298  ALA A N   1 
ATOM   2361 C CA  . ALA A 1 299 ? 37.265 -20.716 80.065  1.00 17.76 ? 298  ALA A CA  1 
ATOM   2362 C C   . ALA A 1 299 ? 38.531 -20.161 79.386  1.00 21.61 ? 298  ALA A C   1 
ATOM   2363 O O   . ALA A 1 299 ? 39.625 -20.349 79.913  1.00 21.74 ? 298  ALA A O   1 
ATOM   2364 C CB  . ALA A 1 299 ? 36.993 -22.137 79.601  1.00 19.07 ? 298  ALA A CB  1 
ATOM   2365 N N   . THR A 1 300 ? 38.376 -19.479 78.236  1.00 18.66 ? 299  THR A N   1 
ATOM   2366 C CA  . THR A 1 300 ? 39.518 -18.900 77.486  1.00 19.00 ? 299  THR A CA  1 
ATOM   2367 C C   . THR A 1 300 ? 39.853 -17.493 77.981  1.00 21.28 ? 299  THR A C   1 
ATOM   2368 O O   . THR A 1 300 ? 40.819 -16.889 77.510  1.00 21.92 ? 299  THR A O   1 
ATOM   2369 C CB  . THR A 1 300 ? 39.229 -18.872 75.973  1.00 25.12 ? 299  THR A CB  1 
ATOM   2370 O OG1 . THR A 1 300 ? 38.120 -18.006 75.743  1.00 22.11 ? 299  THR A OG1 1 
ATOM   2371 C CG2 . THR A 1 300 ? 38.983 -20.271 75.390  1.00 28.23 ? 299  THR A CG2 1 
ATOM   2372 N N   . THR A 1 301 ? 39.044 -16.951 78.896  1.00 16.61 ? 300  THR A N   1 
ATOM   2373 C CA  . THR A 1 301 ? 39.281 -15.590 79.364  1.00 16.79 ? 300  THR A CA  1 
ATOM   2374 C C   . THR A 1 301 ? 40.388 -15.510 80.409  1.00 22.64 ? 300  THR A C   1 
ATOM   2375 O O   . THR A 1 301 ? 40.270 -16.135 81.474  1.00 21.53 ? 300  THR A O   1 
ATOM   2376 C CB  . THR A 1 301 ? 37.982 -14.945 79.873  1.00 18.82 ? 300  THR A CB  1 
ATOM   2377 O OG1 . THR A 1 301 ? 36.968 -14.992 78.850  1.00 18.99 ? 300  THR A OG1 1 
ATOM   2378 C CG2 . THR A 1 301 ? 38.196 -13.500 80.344  1.00 17.23 ? 300  THR A CG2 1 
ATOM   2379 N N   . ASP A 1 302 ? 41.431 -14.690 80.118  1.00 19.86 ? 301  ASP A N   1 
ATOM   2380 C CA  . ASP A 1 302 ? 42.514 -14.405 81.053  1.00 20.55 ? 301  ASP A CA  1 
ATOM   2381 C C   . ASP A 1 302 ? 42.111 -13.102 81.733  1.00 23.13 ? 301  ASP A C   1 
ATOM   2382 O O   . ASP A 1 302 ? 42.316 -12.022 81.183  1.00 21.20 ? 301  ASP A O   1 
ATOM   2383 C CB  . ASP A 1 302 ? 43.869 -14.250 80.338  1.00 23.27 ? 301  ASP A CB  1 
ATOM   2384 C CG  . ASP A 1 302 ? 45.062 -14.176 81.282  1.00 29.81 ? 301  ASP A CG  1 
ATOM   2385 O OD1 . ASP A 1 302 ? 44.996 -13.412 82.274  1.00 28.40 ? 301  ASP A OD1 1 
ATOM   2386 O OD2 . ASP A 1 302 ? 46.073 -14.861 81.017  1.00 38.49 ? 301  ASP A OD2 1 
ATOM   2387 N N   . TRP A 1 303 ? 41.485 -13.220 82.909  1.00 21.56 ? 302  TRP A N   1 
ATOM   2388 C CA  . TRP A 1 303 ? 40.963 -12.084 83.684  1.00 19.37 ? 302  TRP A CA  1 
ATOM   2389 C C   . TRP A 1 303 ? 41.982 -10.987 83.974  1.00 23.32 ? 302  TRP A C   1 
ATOM   2390 O O   . TRP A 1 303 ? 41.657 -9.809  83.857  1.00 22.27 ? 302  TRP A O   1 
ATOM   2391 C CB  . TRP A 1 303 ? 40.267 -12.602 84.955  1.00 17.34 ? 302  TRP A CB  1 
ATOM   2392 C CG  . TRP A 1 303 ? 39.060 -13.421 84.615  1.00 17.33 ? 302  TRP A CG  1 
ATOM   2393 C CD1 . TRP A 1 303 ? 39.002 -14.777 84.467  1.00 21.11 ? 302  TRP A CD1 1 
ATOM   2394 C CD2 . TRP A 1 303 ? 37.777 -12.917 84.220  1.00 15.55 ? 302  TRP A CD2 1 
ATOM   2395 N NE1 . TRP A 1 303 ? 37.739 -15.157 84.062  1.00 19.57 ? 302  TRP A NE1 1 
ATOM   2396 C CE2 . TRP A 1 303 ? 36.975 -14.031 83.877  1.00 19.40 ? 302  TRP A CE2 1 
ATOM   2397 C CE3 . TRP A 1 303 ? 37.213 -11.625 84.148  1.00 15.69 ? 302  TRP A CE3 1 
ATOM   2398 C CZ2 . TRP A 1 303 ? 35.648 -13.896 83.458  1.00 17.38 ? 302  TRP A CZ2 1 
ATOM   2399 C CZ3 . TRP A 1 303 ? 35.897 -11.491 83.721  1.00 16.07 ? 302  TRP A CZ3 1 
ATOM   2400 C CH2 . TRP A 1 303 ? 35.109 -12.621 83.448  1.00 16.77 ? 302  TRP A CH2 1 
ATOM   2401 N N   . ILE A 1 304 ? 43.231 -11.373 84.294  1.00 22.22 ? 303  ILE A N   1 
ATOM   2402 C CA  . ILE A 1 304 ? 44.310 -10.421 84.570  1.00 22.03 ? 303  ILE A CA  1 
ATOM   2403 C C   . ILE A 1 304 ? 44.715 -9.689  83.288  1.00 23.17 ? 303  ILE A C   1 
ATOM   2404 O O   . ILE A 1 304 ? 44.894 -8.481  83.318  1.00 20.58 ? 303  ILE A O   1 
ATOM   2405 C CB  . ILE A 1 304 ? 45.510 -11.139 85.278  1.00 26.91 ? 303  ILE A CB  1 
ATOM   2406 C CG1 . ILE A 1 304 ? 45.105 -11.624 86.693  1.00 28.92 ? 303  ILE A CG1 1 
ATOM   2407 C CG2 . ILE A 1 304 ? 46.804 -10.290 85.294  1.00 26.40 ? 303  ILE A CG2 1 
ATOM   2408 C CD1 . ILE A 1 304 ? 44.877 -10.515 87.826  1.00 41.29 ? 303  ILE A CD1 1 
ATOM   2409 N N   . ALA A 1 305 ? 44.864 -10.422 82.168  1.00 20.93 ? 304  ALA A N   1 
ATOM   2410 C CA  . ALA A 1 305 ? 45.240 -9.823  80.876  1.00 20.74 ? 304  ALA A CA  1 
ATOM   2411 C C   . ALA A 1 305 ? 44.180 -8.798  80.428  1.00 21.84 ? 304  ALA A C   1 
ATOM   2412 O O   . ALA A 1 305 ? 44.548 -7.751  79.898  1.00 21.49 ? 304  ALA A O   1 
ATOM   2413 C CB  . ALA A 1 305 ? 45.421 -10.896 79.820  1.00 21.74 ? 304  ALA A CB  1 
ATOM   2414 N N   . ILE A 1 306 ? 42.882 -9.084  80.670  1.00 17.40 ? 305  ILE A N   1 
ATOM   2415 C CA  . ILE A 1 306 ? 41.776 -8.141  80.361  1.00 15.87 ? 305  ILE A CA  1 
ATOM   2416 C C   . ILE A 1 306 ? 41.966 -6.872  81.211  1.00 20.72 ? 305  ILE A C   1 
ATOM   2417 O O   . ILE A 1 306 ? 41.939 -5.755  80.677  1.00 20.80 ? 305  ILE A O   1 
ATOM   2418 C CB  . ILE A 1 306 ? 40.362 -8.783  80.583  1.00 18.15 ? 305  ILE A CB  1 
ATOM   2419 C CG1 . ILE A 1 306 ? 40.058 -9.905  79.547  1.00 18.14 ? 305  ILE A CG1 1 
ATOM   2420 C CG2 . ILE A 1 306 ? 39.218 -7.701  80.609  1.00 16.46 ? 305  ILE A CG2 1 
ATOM   2421 C CD1 . ILE A 1 306 ? 39.695 -9.424  78.085  1.00 23.19 ? 305  ILE A CD1 1 
ATOM   2422 N N   . TYR A 1 307 ? 42.143 -7.049  82.530  1.00 18.91 ? 306  TYR A N   1 
ATOM   2423 C CA  . TYR A 1 307 ? 42.324 -5.919  83.450  1.00 19.27 ? 306  TYR A CA  1 
ATOM   2424 C C   . TYR A 1 307 ? 43.522 -5.052  83.039  1.00 22.67 ? 306  TYR A C   1 
ATOM   2425 O O   . TYR A 1 307 ? 43.413 -3.823  82.997  1.00 21.21 ? 306  TYR A O   1 
ATOM   2426 C CB  . TYR A 1 307 ? 42.456 -6.393  84.914  1.00 20.81 ? 306  TYR A CB  1 
ATOM   2427 C CG  . TYR A 1 307 ? 42.870 -5.264  85.832  1.00 23.62 ? 306  TYR A CG  1 
ATOM   2428 C CD1 . TYR A 1 307 ? 41.953 -4.296  86.236  1.00 24.25 ? 306  TYR A CD1 1 
ATOM   2429 C CD2 . TYR A 1 307 ? 44.201 -5.111  86.224  1.00 25.61 ? 306  TYR A CD2 1 
ATOM   2430 C CE1 . TYR A 1 307 ? 42.342 -3.217  87.024  1.00 24.21 ? 306  TYR A CE1 1 
ATOM   2431 C CE2 . TYR A 1 307 ? 44.605 -4.024  86.994  1.00 26.25 ? 306  TYR A CE2 1 
ATOM   2432 C CZ  . TYR A 1 307 ? 43.670 -3.084  87.396  1.00 30.78 ? 306  TYR A CZ  1 
ATOM   2433 O OH  . TYR A 1 307 ? 44.062 -2.018  88.156  1.00 30.06 ? 306  TYR A OH  1 
ATOM   2434 N N   . GLN A 1 308 ? 44.648 -5.710  82.689  1.00 20.56 ? 307  GLN A N   1 
ATOM   2435 C CA  . GLN A 1 308 ? 45.890 -5.049  82.265  1.00 20.16 ? 307  GLN A CA  1 
ATOM   2436 C C   . GLN A 1 308 ? 45.823 -4.484  80.829  1.00 25.35 ? 307  GLN A C   1 
ATOM   2437 O O   . GLN A 1 308 ? 46.808 -3.887  80.366  1.00 27.19 ? 307  GLN A O   1 
ATOM   2438 C CB  . GLN A 1 308 ? 47.083 -6.011  82.420  1.00 21.42 ? 307  GLN A CB  1 
ATOM   2439 C CG  . GLN A 1 308 ? 47.399 -6.335  83.882  1.00 27.39 ? 307  GLN A CG  1 
ATOM   2440 C CD  . GLN A 1 308 ? 48.570 -7.289  84.043  1.00 40.32 ? 307  GLN A CD  1 
ATOM   2441 O OE1 . GLN A 1 308 ? 48.997 -7.964  83.104  1.00 33.32 ? 307  GLN A OE1 1 
ATOM   2442 N NE2 . GLN A 1 308 ? 49.082 -7.408  85.260  1.00 33.83 ? 307  GLN A NE2 1 
ATOM   2443 N N   A ARG A 1 309 ? 44.675 -4.686  80.131  0.50 21.43 ? 308  ARG A N   1 
ATOM   2444 N N   B ARG A 1 309 ? 44.676 -4.668  80.142  0.50 21.07 ? 308  ARG A N   1 
ATOM   2445 C CA  A ARG A 1 309 ? 44.372 -4.232  78.757  0.50 21.19 ? 308  ARG A CA  1 
ATOM   2446 C CA  B ARG A 1 309 ? 44.412 -4.197  78.774  0.50 20.69 ? 308  ARG A CA  1 
ATOM   2447 C C   A ARG A 1 309 ? 45.332 -4.825  77.713  0.50 25.23 ? 308  ARG A C   1 
ATOM   2448 C C   B ARG A 1 309 ? 45.448 -4.764  77.785  0.50 24.68 ? 308  ARG A C   1 
ATOM   2449 O O   A ARG A 1 309 ? 45.601 -4.200  76.678  0.50 26.29 ? 308  ARG A O   1 
ATOM   2450 O O   B ARG A 1 309 ? 45.924 -4.048  76.893  0.50 25.22 ? 308  ARG A O   1 
ATOM   2451 C CB  A ARG A 1 309 ? 44.358 -2.693  78.667  0.50 22.24 ? 308  ARG A CB  1 
ATOM   2452 C CB  B ARG A 1 309 ? 44.377 -2.653  78.718  0.50 20.93 ? 308  ARG A CB  1 
ATOM   2453 C CG  A ARG A 1 309 ? 43.523 -2.015  79.736  0.50 32.13 ? 308  ARG A CG  1 
ATOM   2454 C CG  B ARG A 1 309 ? 43.552 -1.984  79.823  0.50 27.91 ? 308  ARG A CG  1 
ATOM   2455 C CD  A ARG A 1 309 ? 43.991 -0.587  79.914  0.50 38.43 ? 308  ARG A CD  1 
ATOM   2456 C CD  B ARG A 1 309 ? 43.781 -0.481  79.831  0.50 27.62 ? 308  ARG A CD  1 
ATOM   2457 N NE  A ARG A 1 309 ? 42.908 0.277   80.369  0.50 40.40 ? 308  ARG A NE  1 
ATOM   2458 N NE  B ARG A 1 309 ? 43.417 0.101   78.541  0.50 26.27 ? 308  ARG A NE  1 
ATOM   2459 C CZ  A ARG A 1 309 ? 41.957 0.768   79.582  0.50 42.44 ? 308  ARG A CZ  1 
ATOM   2460 C CZ  B ARG A 1 309 ? 42.191 0.497   78.225  0.50 33.26 ? 308  ARG A CZ  1 
ATOM   2461 N NH1 A ARG A 1 309 ? 41.948 0.488   78.283  0.50 27.71 ? 308  ARG A NH1 1 
ATOM   2462 N NH1 B ARG A 1 309 ? 41.213 0.428   79.121  0.50 19.94 ? 308  ARG A NH1 1 
ATOM   2463 N NH2 A ARG A 1 309 ? 41.009 1.540   80.085  0.50 21.43 ? 308  ARG A NH2 1 
ATOM   2464 N NH2 B ARG A 1 309 ? 41.936 0.983   77.018  0.50 13.08 ? 308  ARG A NH2 1 
ATOM   2465 N N   . LYS A 1 310 ? 45.824 -6.043  77.982  1.00 20.33 ? 309  LYS A N   1 
ATOM   2466 C CA  . LYS A 1 310 ? 46.800 -6.746  77.133  1.00 20.63 ? 309  LYS A CA  1 
ATOM   2467 C C   . LYS A 1 310 ? 46.185 -7.584  76.016  1.00 24.95 ? 309  LYS A C   1 
ATOM   2468 O O   . LYS A 1 310 ? 46.878 -7.926  75.058  1.00 26.71 ? 309  LYS A O   1 
ATOM   2469 C CB  . LYS A 1 310 ? 47.762 -7.576  77.997  1.00 23.35 ? 309  LYS A CB  1 
ATOM   2470 C CG  . LYS A 1 310 ? 48.805 -6.725  78.719  1.00 37.03 ? 309  LYS A CG  1 
ATOM   2471 C CD  . LYS A 1 310 ? 49.593 -7.535  79.741  1.00 48.23 ? 309  LYS A CD  1 
ATOM   2472 C CE  . LYS A 1 310 ? 50.601 -6.686  80.485  1.00 57.04 ? 309  LYS A CE  1 
ATOM   2473 N NZ  . LYS A 1 310 ? 51.350 -7.486  81.496  1.00 61.10 ? 309  LYS A NZ  1 
ATOM   2474 N N   . VAL A 1 311 ? 44.893 -7.900  76.123  1.00 20.54 ? 310  VAL A N   1 
ATOM   2475 C CA  . VAL A 1 311 ? 44.139 -8.674  75.126  1.00 19.24 ? 310  VAL A CA  1 
ATOM   2476 C C   . VAL A 1 311 ? 43.860 -7.772  73.897  1.00 24.55 ? 310  VAL A C   1 
ATOM   2477 O O   . VAL A 1 311 ? 43.474 -6.613  74.056  1.00 24.63 ? 310  VAL A O   1 
ATOM   2478 C CB  . VAL A 1 311 ? 42.831 -9.263  75.751  1.00 21.56 ? 310  VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 311 ? 41.957 -9.965  74.707  1.00 21.12 ? 310  VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 311 ? 43.150 -10.222 76.898  1.00 21.74 ? 310  VAL A CG2 1 
ATOM   2481 N N   . GLU A 1 312 ? 44.102 -8.291  72.682  1.00 24.26 ? 311  GLU A N   1 
ATOM   2482 C CA  . GLU A 1 312 ? 43.831 -7.522  71.460  1.00 23.86 ? 311  GLU A CA  1 
ATOM   2483 C C   . GLU A 1 312 ? 42.324 -7.378  71.289  1.00 24.55 ? 311  GLU A C   1 
ATOM   2484 O O   . GLU A 1 312 ? 41.595 -8.370  71.399  1.00 24.04 ? 311  GLU A O   1 
ATOM   2485 C CB  . GLU A 1 312 ? 44.466 -8.197  70.229  1.00 26.32 ? 311  GLU A CB  1 
ATOM   2486 N N   . ALA A 1 313 ? 41.841 -6.138  71.117  1.00 21.33 ? 312  ALA A N   1 
ATOM   2487 C CA  . ALA A 1 313 ? 40.398 -5.915  70.971  1.00 20.69 ? 312  ALA A CA  1 
ATOM   2488 C C   . ALA A 1 313 ? 39.862 -6.499  69.653  1.00 23.41 ? 312  ALA A C   1 
ATOM   2489 O O   . ALA A 1 313 ? 40.544 -6.421  68.626  1.00 22.33 ? 312  ALA A O   1 
ATOM   2490 C CB  . ALA A 1 313 ? 40.078 -4.430  71.054  1.00 21.64 ? 312  ALA A CB  1 
ATOM   2491 N N   . PRO A 1 314 ? 38.653 -7.087  69.649  1.00 21.14 ? 313  PRO A N   1 
ATOM   2492 C CA  . PRO A 1 314 ? 38.111 -7.644  68.393  1.00 22.08 ? 313  PRO A CA  1 
ATOM   2493 C C   . PRO A 1 314 ? 37.710 -6.581  67.363  1.00 25.04 ? 313  PRO A C   1 
ATOM   2494 O O   . PRO A 1 314 ? 37.565 -6.901  66.177  1.00 25.00 ? 313  PRO A O   1 
ATOM   2495 C CB  . PRO A 1 314 ? 36.872 -8.409  68.859  1.00 23.87 ? 313  PRO A CB  1 
ATOM   2496 C CG  . PRO A 1 314 ? 36.476 -7.756  70.124  1.00 28.39 ? 313  PRO A CG  1 
ATOM   2497 C CD  . PRO A 1 314 ? 37.727 -7.299  70.775  1.00 23.73 ? 313  PRO A CD  1 
ATOM   2498 N N   . PHE A 1 315 ? 37.536 -5.322  67.819  1.00 19.67 ? 314  PHE A N   1 
ATOM   2499 C CA  . PHE A 1 315 ? 37.066 -4.211  67.000  1.00 18.82 ? 314  PHE A CA  1 
ATOM   2500 C C   . PHE A 1 315 ? 37.596 -2.865  67.502  1.00 22.56 ? 314  PHE A C   1 
ATOM   2501 O O   . PHE A 1 315 ? 37.471 -2.546  68.681  1.00 22.08 ? 314  PHE A O   1 
ATOM   2502 C CB  . PHE A 1 315 ? 35.525 -4.213  67.016  1.00 19.79 ? 314  PHE A CB  1 
ATOM   2503 C CG  . PHE A 1 315 ? 34.836 -2.999  66.446  1.00 20.90 ? 314  PHE A CG  1 
ATOM   2504 C CD1 . PHE A 1 315 ? 34.873 -2.735  65.079  1.00 25.20 ? 314  PHE A CD1 1 
ATOM   2505 C CD2 . PHE A 1 315 ? 34.107 -2.142  67.267  1.00 21.06 ? 314  PHE A CD2 1 
ATOM   2506 C CE1 . PHE A 1 315 ? 34.207 -1.624  64.546  1.00 26.09 ? 314  PHE A CE1 1 
ATOM   2507 C CE2 . PHE A 1 315 ? 33.459 -1.017  66.738  1.00 24.53 ? 314  PHE A CE2 1 
ATOM   2508 C CZ  . PHE A 1 315 ? 33.515 -0.762  65.385  1.00 24.52 ? 314  PHE A CZ  1 
ATOM   2509 N N   . ILE A 1 316 ? 38.189 -2.082  66.606  1.00 19.34 ? 315  ILE A N   1 
ATOM   2510 C CA  . ILE A 1 316 ? 38.674 -0.749  66.968  1.00 20.79 ? 315  ILE A CA  1 
ATOM   2511 C C   . ILE A 1 316 ? 37.870 0.221   66.106  1.00 24.02 ? 315  ILE A C   1 
ATOM   2512 O O   . ILE A 1 316 ? 37.952 0.129   64.868  1.00 21.70 ? 315  ILE A O   1 
ATOM   2513 C CB  . ILE A 1 316 ? 40.190 -0.544  66.720  1.00 26.42 ? 315  ILE A CB  1 
ATOM   2514 C CG1 . ILE A 1 316 ? 41.083 -1.728  67.225  1.00 28.33 ? 315  ILE A CG1 1 
ATOM   2515 C CG2 . ILE A 1 316 ? 40.646 0.855   67.212  1.00 27.64 ? 315  ILE A CG2 1 
ATOM   2516 C CD1 . ILE A 1 316 ? 41.491 -1.737  68.647  1.00 33.94 ? 315  ILE A CD1 1 
ATOM   2517 N N   . PRO A 1 317 ? 37.131 1.187   66.696  1.00 20.74 ? 316  PRO A N   1 
ATOM   2518 C CA  . PRO A 1 317 ? 36.380 2.131   65.850  1.00 20.47 ? 316  PRO A CA  1 
ATOM   2519 C C   . PRO A 1 317 ? 37.353 2.942   65.011  1.00 24.33 ? 316  PRO A C   1 
ATOM   2520 O O   . PRO A 1 317 ? 38.478 3.165   65.441  1.00 24.16 ? 316  PRO A O   1 
ATOM   2521 C CB  . PRO A 1 317 ? 35.651 3.021   66.866  1.00 21.35 ? 316  PRO A CB  1 
ATOM   2522 C CG  . PRO A 1 317 ? 35.554 2.164   68.105  1.00 24.89 ? 316  PRO A CG  1 
ATOM   2523 C CD  . PRO A 1 317 ? 36.897 1.469   68.128  1.00 22.00 ? 316  PRO A CD  1 
ATOM   2524 N N   . LYS A 1 318 ? 36.939 3.344   63.807  1.00 21.59 ? 317  LYS A N   1 
ATOM   2525 C CA  . LYS A 1 318 ? 37.793 4.157   62.948  1.00 22.33 ? 317  LYS A CA  1 
ATOM   2526 C C   . LYS A 1 318 ? 38.036 5.461   63.682  1.00 25.18 ? 317  LYS A C   1 
ATOM   2527 O O   . LYS A 1 318 ? 37.102 6.040   64.236  1.00 23.96 ? 317  LYS A O   1 
ATOM   2528 C CB  . LYS A 1 318 ? 37.123 4.406   61.584  1.00 25.96 ? 317  LYS A CB  1 
ATOM   2529 N N   . PHE A 1 319 ? 39.306 5.832   63.802  1.00 22.35 ? 318  PHE A N   1 
ATOM   2530 C CA  . PHE A 1 319 ? 39.703 7.043   64.498  1.00 22.83 ? 318  PHE A CA  1 
ATOM   2531 C C   . PHE A 1 319 ? 39.809 8.163   63.477  1.00 25.13 ? 318  PHE A C   1 
ATOM   2532 O O   . PHE A 1 319 ? 40.497 8.024   62.458  1.00 24.42 ? 318  PHE A O   1 
ATOM   2533 C CB  . PHE A 1 319 ? 41.006 6.848   65.279  1.00 24.64 ? 318  PHE A CB  1 
ATOM   2534 C CG  . PHE A 1 319 ? 41.333 8.047   66.140  1.00 25.95 ? 318  PHE A CG  1 
ATOM   2535 C CD1 . PHE A 1 319 ? 40.533 8.382   67.235  1.00 27.75 ? 318  PHE A CD1 1 
ATOM   2536 C CD2 . PHE A 1 319 ? 42.403 8.877   65.825  1.00 27.41 ? 318  PHE A CD2 1 
ATOM   2537 C CE1 . PHE A 1 319 ? 40.825 9.507   68.015  1.00 28.38 ? 318  PHE A CE1 1 
ATOM   2538 C CE2 . PHE A 1 319 ? 42.695 9.997   66.608  1.00 29.87 ? 318  PHE A CE2 1 
ATOM   2539 C CZ  . PHE A 1 319 ? 41.902 10.302  67.696  1.00 27.90 ? 318  PHE A CZ  1 
ATOM   2540 N N   . LYS A 1 320 ? 39.051 9.233   63.727  1.00 20.51 ? 319  LYS A N   1 
ATOM   2541 C CA  . LYS A 1 320 ? 38.897 10.391  62.856  1.00 20.84 ? 319  LYS A CA  1 
ATOM   2542 C C   . LYS A 1 320 ? 39.267 11.717  63.558  1.00 24.50 ? 319  LYS A C   1 
ATOM   2543 O O   . LYS A 1 320 ? 38.923 12.791  63.065  1.00 24.31 ? 319  LYS A O   1 
ATOM   2544 C CB  . LYS A 1 320 ? 37.435 10.442  62.348  1.00 22.06 ? 319  LYS A CB  1 
ATOM   2545 C CG  . LYS A 1 320 ? 37.047 9.261   61.429  1.00 29.50 ? 319  LYS A CG  1 
ATOM   2546 C CD  . LYS A 1 320 ? 35.544 9.160   61.218  1.00 38.06 ? 319  LYS A CD  1 
ATOM   2547 C CE  . LYS A 1 320 ? 35.093 7.735   60.993  1.00 41.52 ? 319  LYS A CE  1 
ATOM   2548 N NZ  . LYS A 1 320 ? 33.694 7.502   61.469  1.00 44.26 ? 319  LYS A NZ  1 
ATOM   2549 N N   . GLY A 1 321 ? 39.958 11.628  64.682  1.00 20.75 ? 320  GLY A N   1 
ATOM   2550 C CA  . GLY A 1 321 ? 40.356 12.809  65.450  1.00 20.63 ? 320  GLY A CA  1 
ATOM   2551 C C   . GLY A 1 321 ? 39.733 12.857  66.836  1.00 20.50 ? 320  GLY A C   1 
ATOM   2552 O O   . GLY A 1 321 ? 38.692 12.243  67.070  1.00 17.57 ? 320  GLY A O   1 
ATOM   2553 N N   . PRO A 1 322 ? 40.358 13.584  67.797  1.00 19.18 ? 321  PRO A N   1 
ATOM   2554 C CA  . PRO A 1 322 ? 39.845 13.591  69.175  1.00 18.01 ? 321  PRO A CA  1 
ATOM   2555 C C   . PRO A 1 322 ? 38.526 14.304  69.405  1.00 18.76 ? 321  PRO A C   1 
ATOM   2556 O O   . PRO A 1 322 ? 37.897 14.053  70.434  1.00 18.92 ? 321  PRO A O   1 
ATOM   2557 C CB  . PRO A 1 322 ? 40.984 14.236  69.976  1.00 20.40 ? 321  PRO A CB  1 
ATOM   2558 C CG  . PRO A 1 322 ? 41.687 15.089  68.990  1.00 24.98 ? 321  PRO A CG  1 
ATOM   2559 C CD  . PRO A 1 322 ? 41.610 14.361  67.681  1.00 21.29 ? 321  PRO A CD  1 
ATOM   2560 N N   . GLY A 1 323 ? 38.157 15.189  68.480  1.00 16.29 ? 322  GLY A N   1 
ATOM   2561 C CA  . GLY A 1 323 ? 36.902 15.946  68.520  1.00 15.95 ? 322  GLY A CA  1 
ATOM   2562 C C   . GLY A 1 323 ? 35.878 15.502  67.483  1.00 18.10 ? 322  GLY A C   1 
ATOM   2563 O O   . GLY A 1 323 ? 34.847 16.160  67.313  1.00 17.11 ? 322  GLY A O   1 
ATOM   2564 N N   . ASP A 1 324 ? 36.138 14.376  66.791  1.00 15.45 ? 323  ASP A N   1 
ATOM   2565 C CA  . ASP A 1 324 ? 35.222 13.837  65.769  1.00 16.18 ? 323  ASP A CA  1 
ATOM   2566 C C   . ASP A 1 324 ? 33.905 13.455  66.434  1.00 19.52 ? 323  ASP A C   1 
ATOM   2567 O O   . ASP A 1 324 ? 33.942 12.929  67.546  1.00 19.79 ? 323  ASP A O   1 
ATOM   2568 C CB  . ASP A 1 324 ? 35.832 12.603  65.089  1.00 18.04 ? 323  ASP A CB  1 
ATOM   2569 C CG  . ASP A 1 324 ? 34.864 11.908  64.140  1.00 26.14 ? 323  ASP A CG  1 
ATOM   2570 O OD1 . ASP A 1 324 ? 34.501 12.519  63.118  1.00 25.24 ? 323  ASP A OD1 1 
ATOM   2571 O OD2 . ASP A 1 324 ? 34.460 10.759  64.440  1.00 30.74 ? 323  ASP A OD2 1 
ATOM   2572 N N   . THR A 1 325 ? 32.748 13.739  65.782  1.00 15.07 ? 324  THR A N   1 
ATOM   2573 C CA  . THR A 1 325 ? 31.440 13.402  66.368  1.00 14.18 ? 324  THR A CA  1 
ATOM   2574 C C   . THR A 1 325 ? 30.617 12.470  65.463  1.00 17.75 ? 324  THR A C   1 
ATOM   2575 O O   . THR A 1 325 ? 29.408 12.334  65.693  1.00 17.24 ? 324  THR A O   1 
ATOM   2576 C CB  . THR A 1 325 ? 30.601 14.679  66.671  1.00 19.38 ? 324  THR A CB  1 
ATOM   2577 O OG1 . THR A 1 325 ? 30.343 15.370  65.446  1.00 20.91 ? 324  THR A OG1 1 
ATOM   2578 C CG2 . THR A 1 325 ? 31.289 15.625  67.658  1.00 17.10 ? 324  THR A CG2 1 
ATOM   2579 N N   . SER A 1 326 ? 31.263 11.823  64.480  1.00 17.11 ? 325  SER A N   1 
ATOM   2580 C CA  . SER A 1 326 ? 30.589 10.953  63.495  1.00 17.35 ? 325  SER A CA  1 
ATOM   2581 C C   . SER A 1 326 ? 29.850 9.755   64.083  1.00 20.41 ? 325  SER A C   1 
ATOM   2582 O O   . SER A 1 326 ? 28.993 9.181   63.394  1.00 18.75 ? 325  SER A O   1 
ATOM   2583 C CB  . SER A 1 326 ? 31.541 10.546  62.373  1.00 19.96 ? 325  SER A CB  1 
ATOM   2584 O OG  . SER A 1 326 ? 32.517 9.621   62.811  1.00 30.34 ? 325  SER A OG  1 
ATOM   2585 N N   . ASN A 1 327 ? 30.175 9.372   65.348  1.00 16.68 ? 326  ASN A N   1 
ATOM   2586 C CA  . ASN A 1 327 ? 29.523 8.246   66.042  1.00 16.12 ? 326  ASN A CA  1 
ATOM   2587 C C   . ASN A 1 327 ? 28.334 8.671   66.876  1.00 18.92 ? 326  ASN A C   1 
ATOM   2588 O O   . ASN A 1 327 ? 27.692 7.840   67.525  1.00 17.63 ? 326  ASN A O   1 
ATOM   2589 C CB  . ASN A 1 327 ? 30.530 7.413   66.846  1.00 17.77 ? 326  ASN A CB  1 
ATOM   2590 C CG  . ASN A 1 327 ? 31.454 6.631   65.938  1.00 23.96 ? 326  ASN A CG  1 
ATOM   2591 O OD1 . ASN A 1 327 ? 31.006 5.866   65.078  1.00 17.30 ? 326  ASN A OD1 1 
ATOM   2592 N ND2 . ASN A 1 327 ? 32.759 6.840   66.066  1.00 17.22 ? 326  ASN A ND2 1 
ATOM   2593 N N   . PHE A 1 328 ? 27.969 9.938   66.775  1.00 13.85 ? 327  PHE A N   1 
ATOM   2594 C CA  . PHE A 1 328 ? 26.824 10.469  67.492  1.00 13.42 ? 327  PHE A CA  1 
ATOM   2595 C C   . PHE A 1 328 ? 25.827 11.068  66.496  1.00 16.67 ? 327  PHE A C   1 
ATOM   2596 O O   . PHE A 1 328 ? 26.232 11.593  65.456  1.00 16.18 ? 327  PHE A O   1 
ATOM   2597 C CB  . PHE A 1 328 ? 27.271 11.533  68.515  1.00 14.97 ? 327  PHE A CB  1 
ATOM   2598 C CG  . PHE A 1 328 ? 28.164 10.944  69.591  1.00 15.74 ? 327  PHE A CG  1 
ATOM   2599 C CD1 . PHE A 1 328 ? 29.540 10.854  69.403  1.00 19.75 ? 327  PHE A CD1 1 
ATOM   2600 C CD2 . PHE A 1 328 ? 27.620 10.426  70.761  1.00 17.99 ? 327  PHE A CD2 1 
ATOM   2601 C CE1 . PHE A 1 328 ? 30.361 10.272  70.378  1.00 20.26 ? 327  PHE A CE1 1 
ATOM   2602 C CE2 . PHE A 1 328 ? 28.445 9.846   71.737  1.00 20.28 ? 327  PHE A CE2 1 
ATOM   2603 C CZ  . PHE A 1 328 ? 29.805 9.785   71.539  1.00 17.53 ? 327  PHE A CZ  1 
ATOM   2604 N N   . ASP A 1 329 ? 24.541 11.059  66.854  1.00 14.77 ? 328  ASP A N   1 
ATOM   2605 C CA  . ASP A 1 329 ? 23.499 11.642  66.008  1.00 16.16 ? 328  ASP A CA  1 
ATOM   2606 C C   . ASP A 1 329 ? 23.511 13.163  66.165  1.00 21.33 ? 328  ASP A C   1 
ATOM   2607 O O   . ASP A 1 329 ? 24.204 13.697  67.046  1.00 21.49 ? 328  ASP A O   1 
ATOM   2608 C CB  . ASP A 1 329 ? 22.112 11.102  66.428  1.00 16.85 ? 328  ASP A CB  1 
ATOM   2609 C CG  . ASP A 1 329 ? 21.810 9.656   66.049  1.00 22.24 ? 328  ASP A CG  1 
ATOM   2610 O OD1 . ASP A 1 329 ? 22.622 9.043   65.305  1.00 20.62 ? 328  ASP A OD1 1 
ATOM   2611 O OD2 . ASP A 1 329 ? 20.776 9.132   66.508  1.00 24.81 ? 328  ASP A OD2 1 
ATOM   2612 N N   . ASP A 1 330 ? 22.751 13.858  65.321  1.00 18.06 ? 329  ASP A N   1 
ATOM   2613 C CA  . ASP A 1 330 ? 22.635 15.317  65.399  1.00 18.68 ? 329  ASP A CA  1 
ATOM   2614 C C   . ASP A 1 330 ? 21.457 15.662  66.292  1.00 23.13 ? 329  ASP A C   1 
ATOM   2615 O O   . ASP A 1 330 ? 20.398 15.033  66.198  1.00 21.89 ? 329  ASP A O   1 
ATOM   2616 C CB  . ASP A 1 330 ? 22.469 15.931  63.998  1.00 21.03 ? 329  ASP A CB  1 
ATOM   2617 C CG  . ASP A 1 330 ? 23.633 15.630  63.075  1.00 29.94 ? 329  ASP A CG  1 
ATOM   2618 O OD1 . ASP A 1 330 ? 24.801 15.645  63.556  1.00 27.67 ? 329  ASP A OD1 1 
ATOM   2619 O OD2 . ASP A 1 330 ? 23.386 15.384  61.873  1.00 34.52 ? 329  ASP A OD2 1 
ATOM   2620 N N   . TYR A 1 331 ? 21.645 16.657  67.159  1.00 20.33 ? 330  TYR A N   1 
ATOM   2621 C CA  . TYR A 1 331 ? 20.602 17.093  68.091  1.00 20.44 ? 330  TYR A CA  1 
ATOM   2622 C C   . TYR A 1 331 ? 20.377 18.581  67.957  1.00 24.77 ? 330  TYR A C   1 
ATOM   2623 O O   . TYR A 1 331 ? 21.287 19.297  67.547  1.00 24.14 ? 330  TYR A O   1 
ATOM   2624 C CB  . TYR A 1 331 ? 20.972 16.702  69.542  1.00 21.23 ? 330  TYR A CB  1 
ATOM   2625 C CG  . TYR A 1 331 ? 21.018 15.207  69.751  1.00 21.11 ? 330  TYR A CG  1 
ATOM   2626 C CD1 . TYR A 1 331 ? 19.860 14.488  70.033  1.00 22.73 ? 330  TYR A CD1 1 
ATOM   2627 C CD2 . TYR A 1 331 ? 22.205 14.495  69.588  1.00 20.32 ? 330  TYR A CD2 1 
ATOM   2628 C CE1 . TYR A 1 331 ? 19.889 13.106  70.191  1.00 21.51 ? 330  TYR A CE1 1 
ATOM   2629 C CE2 . TYR A 1 331 ? 22.242 13.110  69.727  1.00 21.00 ? 330  TYR A CE2 1 
ATOM   2630 C CZ  . TYR A 1 331 ? 21.079 12.420  70.033  1.00 27.15 ? 330  TYR A CZ  1 
ATOM   2631 O OH  . TYR A 1 331 ? 21.096 11.057  70.187  1.00 27.47 ? 330  TYR A OH  1 
ATOM   2632 N N   . GLU A 1 332 ? 19.165 19.055  68.286  1.00 24.10 ? 331  GLU A N   1 
ATOM   2633 C CA  . GLU A 1 332 ? 18.867 20.491  68.227  1.00 24.88 ? 331  GLU A CA  1 
ATOM   2634 C C   . GLU A 1 332 ? 19.804 21.208  69.211  1.00 25.54 ? 331  GLU A C   1 
ATOM   2635 O O   . GLU A 1 332 ? 19.937 20.773  70.360  1.00 25.09 ? 331  GLU A O   1 
ATOM   2636 C CB  . GLU A 1 332 ? 17.398 20.763  68.611  1.00 26.69 ? 331  GLU A CB  1 
ATOM   2637 N N   . GLU A 1 333 ? 20.480 22.251  68.738  1.00 22.58 ? 332  GLU A N   1 
ATOM   2638 C CA  . GLU A 1 333 ? 21.412 23.061  69.525  1.00 22.25 ? 332  GLU A CA  1 
ATOM   2639 C C   . GLU A 1 333 ? 20.646 24.117  70.305  1.00 27.17 ? 332  GLU A C   1 
ATOM   2640 O O   . GLU A 1 333 ? 20.058 25.027  69.711  1.00 28.31 ? 332  GLU A O   1 
ATOM   2641 C CB  . GLU A 1 333 ? 22.485 23.708  68.623  1.00 24.19 ? 332  GLU A CB  1 
ATOM   2642 C CG  . GLU A 1 333 ? 23.395 22.695  67.933  1.00 27.80 ? 332  GLU A CG  1 
ATOM   2643 C CD  . GLU A 1 333 ? 24.277 21.882  68.861  1.00 32.63 ? 332  GLU A CD  1 
ATOM   2644 O OE1 . GLU A 1 333 ? 24.480 22.317  70.015  1.00 20.27 ? 332  GLU A OE1 1 
ATOM   2645 O OE2 . GLU A 1 333 ? 24.739 20.793  68.453  1.00 23.16 ? 332  GLU A OE2 1 
ATOM   2646 N N   . GLU A 1 334 ? 20.634 23.970  71.628  1.00 23.82 ? 333  GLU A N   1 
ATOM   2647 C CA  . GLU A 1 334 ? 19.914 24.858  72.552  1.00 23.14 ? 333  GLU A CA  1 
ATOM   2648 C C   . GLU A 1 334 ? 20.878 25.697  73.372  1.00 24.34 ? 333  GLU A C   1 
ATOM   2649 O O   . GLU A 1 334 ? 22.006 25.271  73.617  1.00 22.68 ? 333  GLU A O   1 
ATOM   2650 C CB  . GLU A 1 334 ? 19.040 24.020  73.485  1.00 23.84 ? 333  GLU A CB  1 
ATOM   2651 C CG  . GLU A 1 334 ? 17.926 23.294  72.754  1.00 36.01 ? 333  GLU A CG  1 
ATOM   2652 C CD  . GLU A 1 334 ? 17.006 22.529  73.679  1.00 55.65 ? 333  GLU A CD  1 
ATOM   2653 O OE1 . GLU A 1 334 ? 17.476 21.561  74.318  1.00 44.40 ? 333  GLU A OE1 1 
ATOM   2654 O OE2 . GLU A 1 334 ? 15.823 22.924  73.794  1.00 60.36 ? 333  GLU A OE2 1 
ATOM   2655 N N   . GLU A 1 335 ? 20.427 26.877  73.834  1.00 21.34 ? 334  GLU A N   1 
ATOM   2656 C CA  . GLU A 1 335 ? 21.283 27.753  74.641  1.00 20.95 ? 334  GLU A CA  1 
ATOM   2657 C C   . GLU A 1 335 ? 21.642 27.122  75.995  1.00 23.13 ? 334  GLU A C   1 
ATOM   2658 O O   . GLU A 1 335 ? 20.945 26.207  76.471  1.00 21.58 ? 334  GLU A O   1 
ATOM   2659 C CB  . GLU A 1 335 ? 20.597 29.119  74.870  1.00 23.07 ? 334  GLU A CB  1 
ATOM   2660 C CG  . GLU A 1 335 ? 19.277 29.021  75.614  1.00 31.41 ? 334  GLU A CG  1 
ATOM   2661 C CD  . GLU A 1 335 ? 18.665 30.324  76.084  1.00 43.72 ? 334  GLU A CD  1 
ATOM   2662 O OE1 . GLU A 1 335 ? 19.347 31.373  76.026  1.00 39.62 ? 334  GLU A OE1 1 
ATOM   2663 O OE2 . GLU A 1 335 ? 17.507 30.285  76.554  1.00 40.56 ? 334  GLU A OE2 1 
ATOM   2664 N N   . ILE A 1 336 ? 22.721 27.626  76.613  1.00 20.66 ? 335  ILE A N   1 
ATOM   2665 C CA  . ILE A 1 336 ? 23.109 27.259  77.970  1.00 19.26 ? 335  ILE A CA  1 
ATOM   2666 C C   . ILE A 1 336 ? 22.741 28.514  78.745  1.00 25.26 ? 335  ILE A C   1 
ATOM   2667 O O   . ILE A 1 336 ? 23.514 29.481  78.785  1.00 26.38 ? 335  ILE A O   1 
ATOM   2668 C CB  . ILE A 1 336 ? 24.596 26.814  78.160  1.00 21.76 ? 335  ILE A CB  1 
ATOM   2669 C CG1 . ILE A 1 336 ? 24.926 25.557  77.316  1.00 21.51 ? 335  ILE A CG1 1 
ATOM   2670 C CG2 . ILE A 1 336 ? 24.898 26.559  79.656  1.00 21.01 ? 335  ILE A CG2 1 
ATOM   2671 C CD1 . ILE A 1 336 ? 26.422 25.269  77.171  1.00 26.17 ? 335  ILE A CD1 1 
ATOM   2672 N N   . ARG A 1 337 ? 21.498 28.558  79.233  1.00 22.22 ? 336  ARG A N   1 
ATOM   2673 C CA  . ARG A 1 337 ? 21.016 29.740  79.942  1.00 21.94 ? 336  ARG A CA  1 
ATOM   2674 C C   . ARG A 1 337 ? 21.445 29.737  81.400  1.00 24.38 ? 336  ARG A C   1 
ATOM   2675 O O   . ARG A 1 337 ? 21.331 28.707  82.076  1.00 22.69 ? 336  ARG A O   1 
ATOM   2676 C CB  . ARG A 1 337 ? 19.499 29.886  79.819  1.00 23.74 ? 336  ARG A CB  1 
ATOM   2677 C CG  . ARG A 1 337 ? 19.086 31.346  79.819  1.00 32.81 ? 336  ARG A CG  1 
ATOM   2678 C CD  . ARG A 1 337 ? 17.584 31.531  79.826  1.00 37.47 ? 336  ARG A CD  1 
ATOM   2679 N NE  . ARG A 1 337 ? 17.004 31.128  81.105  1.00 44.86 ? 336  ARG A NE  1 
ATOM   2680 C CZ  . ARG A 1 337 ? 16.922 31.908  82.177  1.00 54.38 ? 336  ARG A CZ  1 
ATOM   2681 N NH1 . ARG A 1 337 ? 17.377 33.155  82.138  1.00 36.16 ? 336  ARG A NH1 1 
ATOM   2682 N NH2 . ARG A 1 337 ? 16.389 31.446  83.298  1.00 43.10 ? 336  ARG A NH2 1 
ATOM   2683 N N   . VAL A 1 338 ? 22.004 30.878  81.863  1.00 20.98 ? 337  VAL A N   1 
ATOM   2684 C CA  . VAL A 1 338 ? 22.439 31.028  83.248  1.00 20.45 ? 337  VAL A CA  1 
ATOM   2685 C C   . VAL A 1 338 ? 21.674 32.206  83.832  1.00 24.10 ? 337  VAL A C   1 
ATOM   2686 O O   . VAL A 1 338 ? 21.942 33.362  83.474  1.00 23.54 ? 337  VAL A O   1 
ATOM   2687 C CB  . VAL A 1 338 ? 23.979 31.199  83.432  1.00 24.06 ? 337  VAL A CB  1 
ATOM   2688 C CG1 . VAL A 1 338 ? 24.349 31.248  84.921  1.00 23.32 ? 337  VAL A CG1 1 
ATOM   2689 C CG2 . VAL A 1 338 ? 24.763 30.104  82.712  1.00 23.57 ? 337  VAL A CG2 1 
HETATM 2690 N N   . SEP A 1 339 ? 20.739 31.923  84.734  1.00 19.85 ? 338  SEP A N   1 
HETATM 2691 C CA  . SEP A 1 339 ? 19.952 32.988  85.343  1.00 20.65 ? 338  SEP A CA  1 
HETATM 2692 C CB  . SEP A 1 339 ? 18.869 32.366  86.227  1.00 21.97 ? 338  SEP A CB  1 
HETATM 2693 O OG  . SEP A 1 339 ? 18.163 33.416  86.878  1.00 23.08 ? 338  SEP A OG  1 
HETATM 2694 C C   . SEP A 1 339 ? 20.831 33.911  86.204  1.00 23.02 ? 338  SEP A C   1 
HETATM 2695 O O   . SEP A 1 339 ? 21.911 33.511  86.630  1.00 19.49 ? 338  SEP A O   1 
HETATM 2696 P P   . SEP A 1 339 ? 16.874 33.926  86.127  1.00 26.48 ? 338  SEP A P   1 
HETATM 2697 O O1P . SEP A 1 339 ? 16.079 32.824  85.504  1.00 26.85 ? 338  SEP A O1P 1 
HETATM 2698 O O2P . SEP A 1 339 ? 16.005 34.599  87.216  1.00 26.91 ? 338  SEP A O2P 1 
HETATM 2699 O O3P . SEP A 1 339 ? 17.301 34.924  85.055  1.00 29.57 ? 338  SEP A O3P 1 
ATOM   2700 N N   . ILE A 1 340 ? 20.356 35.135  86.453  1.00 21.87 ? 339  ILE A N   1 
ATOM   2701 C CA  . ILE A 1 340 ? 21.064 36.092  87.313  1.00 23.11 ? 339  ILE A CA  1 
ATOM   2702 C C   . ILE A 1 340 ? 20.773 35.770  88.789  1.00 24.64 ? 339  ILE A C   1 
ATOM   2703 O O   . ILE A 1 340 ? 21.403 36.349  89.675  1.00 23.66 ? 339  ILE A O   1 
ATOM   2704 C CB  . ILE A 1 340 ? 20.728 37.578  86.972  1.00 27.82 ? 339  ILE A CB  1 
ATOM   2705 C CG1 . ILE A 1 340 ? 19.225 37.890  87.163  1.00 29.71 ? 339  ILE A CG1 1 
ATOM   2706 C CG2 . ILE A 1 340 ? 21.227 37.971  85.584  1.00 29.64 ? 339  ILE A CG2 1 
ATOM   2707 C CD1 . ILE A 1 340 ? 18.939 38.854  88.296  1.00 45.83 ? 339  ILE A CD1 1 
ATOM   2708 N N   . ASN A 1 341 ? 19.795 34.855  89.039  1.00 21.35 ? 340  ASN A N   1 
ATOM   2709 C CA  . ASN A 1 341 ? 19.370 34.446  90.370  1.00 19.97 ? 340  ASN A CA  1 
ATOM   2710 C C   . ASN A 1 341 ? 19.729 32.997  90.608  1.00 19.95 ? 340  ASN A C   1 
ATOM   2711 O O   . ASN A 1 341 ? 19.497 32.159  89.733  1.00 18.01 ? 340  ASN A O   1 
ATOM   2712 C CB  . ASN A 1 341 ? 17.861 34.624  90.536  1.00 20.80 ? 340  ASN A CB  1 
ATOM   2713 C CG  . ASN A 1 341 ? 17.435 36.057  90.377  1.00 32.47 ? 340  ASN A CG  1 
ATOM   2714 O OD1 . ASN A 1 341 ? 17.793 36.915  91.181  1.00 29.72 ? 340  ASN A OD1 1 
ATOM   2715 N ND2 . ASN A 1 341 ? 16.731 36.349  89.291  1.00 23.61 ? 340  ASN A ND2 1 
ATOM   2716 N N   . GLU A 1 342 ? 20.271 32.696  91.794  1.00 16.86 ? 341  GLU A N   1 
ATOM   2717 C CA  . GLU A 1 342 ? 20.632 31.324  92.121  1.00 15.57 ? 341  GLU A CA  1 
ATOM   2718 C C   . GLU A 1 342 ? 19.385 30.483  92.311  1.00 19.31 ? 341  GLU A C   1 
ATOM   2719 O O   . GLU A 1 342 ? 18.470 30.887  93.041  1.00 19.28 ? 341  GLU A O   1 
ATOM   2720 C CB  . GLU A 1 342 ? 21.530 31.251  93.361  1.00 16.80 ? 341  GLU A CB  1 
ATOM   2721 C CG  . GLU A 1 342 ? 22.058 29.850  93.615  1.00 21.77 ? 341  GLU A CG  1 
ATOM   2722 C CD  . GLU A 1 342 ? 22.847 29.664  94.894  1.00 34.51 ? 341  GLU A CD  1 
ATOM   2723 O OE1 . GLU A 1 342 ? 22.459 30.248  95.930  1.00 28.04 ? 341  GLU A OE1 1 
ATOM   2724 O OE2 . GLU A 1 342 ? 23.809 28.868  94.875  1.00 24.49 ? 341  GLU A OE2 1 
ATOM   2725 N N   . LYS A 1 343 ? 19.332 29.333  91.612  1.00 15.99 ? 342  LYS A N   1 
ATOM   2726 C CA  . LYS A 1 343 ? 18.201 28.414  91.740  1.00 15.64 ? 342  LYS A CA  1 
ATOM   2727 C C   . LYS A 1 343 ? 18.630 27.229  92.574  1.00 18.06 ? 342  LYS A C   1 
ATOM   2728 O O   . LYS A 1 343 ? 19.770 26.758  92.433  1.00 16.73 ? 342  LYS A O   1 
ATOM   2729 C CB  . LYS A 1 343 ? 17.730 27.895  90.361  1.00 16.95 ? 342  LYS A CB  1 
ATOM   2730 C CG  . LYS A 1 343 ? 17.519 28.967  89.283  1.00 17.02 ? 342  LYS A CG  1 
ATOM   2731 C CD  . LYS A 1 343 ? 16.470 30.024  89.702  1.00 21.23 ? 342  LYS A CD  1 
ATOM   2732 C CE  . LYS A 1 343 ? 16.272 31.086  88.652  1.00 27.00 ? 342  LYS A CE  1 
ATOM   2733 N NZ  . LYS A 1 343 ? 15.703 30.518  87.399  1.00 30.17 ? 342  LYS A NZ  1 
ATOM   2734 N N   . CYS A 1 344 ? 17.706 26.709  93.406  1.00 14.96 ? 343  CYS A N   1 
ATOM   2735 C CA  . CYS A 1 344 ? 17.904 25.476  94.165  1.00 14.60 ? 343  CYS A CA  1 
ATOM   2736 C C   . CYS A 1 344 ? 19.220 25.447  94.970  1.00 19.80 ? 343  CYS A C   1 
ATOM   2737 O O   . CYS A 1 344 ? 19.911 24.422  94.994  1.00 17.11 ? 343  CYS A O   1 
ATOM   2738 C CB  . CYS A 1 344 ? 17.780 24.261  93.239  1.00 14.73 ? 343  CYS A CB  1 
ATOM   2739 S SG  . CYS A 1 344 ? 16.380 24.338  92.083  1.00 18.70 ? 343  CYS A SG  1 
ATOM   2740 N N   . GLY A 1 345 ? 19.531 26.559  95.642  1.00 17.65 ? 344  GLY A N   1 
ATOM   2741 C CA  . GLY A 1 345 ? 20.766 26.693  96.409  1.00 17.99 ? 344  GLY A CA  1 
ATOM   2742 C C   . GLY A 1 345 ? 20.976 25.604  97.444  1.00 19.35 ? 344  GLY A C   1 
ATOM   2743 O O   . GLY A 1 345 ? 22.024 24.951  97.446  1.00 17.99 ? 344  GLY A O   1 
ATOM   2744 N N   . LYS A 1 346 ? 19.955 25.372  98.304  1.00 15.96 ? 345  LYS A N   1 
ATOM   2745 C CA  . LYS A 1 346 ? 20.032 24.344  99.350  1.00 16.07 ? 345  LYS A CA  1 
ATOM   2746 C C   . LYS A 1 346 ? 20.093 22.919  98.797  1.00 15.84 ? 345  LYS A C   1 
ATOM   2747 O O   . LYS A 1 346 ? 20.887 22.115  99.275  1.00 14.91 ? 345  LYS A O   1 
ATOM   2748 C CB  . LYS A 1 346 ? 18.855 24.472  100.342 1.00 20.70 ? 345  LYS A CB  1 
ATOM   2749 C CG  . LYS A 1 346 ? 18.947 25.711  101.230 1.00 34.44 ? 345  LYS A CG  1 
ATOM   2750 N N   . GLU A 1 347 ? 19.233 22.594  97.814  1.00 12.63 ? 346  GLU A N   1 
ATOM   2751 C CA  . GLU A 1 347 ? 19.143 21.239  97.262  1.00 12.94 ? 346  GLU A CA  1 
ATOM   2752 C C   . GLU A 1 347 ? 20.481 20.727  96.773  1.00 14.72 ? 346  GLU A C   1 
ATOM   2753 O O   . GLU A 1 347 ? 20.784 19.553  96.974  1.00 14.15 ? 346  GLU A O   1 
ATOM   2754 C CB  . GLU A 1 347 ? 18.136 21.155  96.103  1.00 14.85 ? 346  GLU A CB  1 
ATOM   2755 C CG  . GLU A 1 347 ? 16.686 21.353  96.515  1.00 20.97 ? 346  GLU A CG  1 
ATOM   2756 C CD  . GLU A 1 347 ? 16.179 22.786  96.538  1.00 27.99 ? 346  GLU A CD  1 
ATOM   2757 O OE1 . GLU A 1 347 ? 16.992 23.729  96.659  1.00 18.44 ? 346  GLU A OE1 1 
ATOM   2758 O OE2 . GLU A 1 347 ? 14.943 22.958  96.493  1.00 28.32 ? 346  GLU A OE2 1 
ATOM   2759 N N   . PHE A 1 348 ? 21.283 21.602  96.125  1.00 11.85 ? 347  PHE A N   1 
ATOM   2760 C CA  . PHE A 1 348 ? 22.546 21.199  95.510  1.00 10.99 ? 347  PHE A CA  1 
ATOM   2761 C C   . PHE A 1 348 ? 23.779 21.821  96.171  1.00 13.64 ? 347  PHE A C   1 
ATOM   2762 O O   . PHE A 1 348 ? 24.850 21.811  95.559  1.00 11.95 ? 347  PHE A O   1 
ATOM   2763 C CB  . PHE A 1 348 ? 22.522 21.484  93.974  1.00 11.59 ? 347  PHE A CB  1 
ATOM   2764 C CG  . PHE A 1 348 ? 21.375 20.782  93.275  1.00 12.23 ? 347  PHE A CG  1 
ATOM   2765 C CD1 . PHE A 1 348 ? 21.416 19.411  93.034  1.00 12.85 ? 347  PHE A CD1 1 
ATOM   2766 C CD2 . PHE A 1 348 ? 20.231 21.485  92.902  1.00 13.35 ? 347  PHE A CD2 1 
ATOM   2767 C CE1 . PHE A 1 348 ? 20.337 18.755  92.413  1.00 12.65 ? 347  PHE A CE1 1 
ATOM   2768 C CE2 . PHE A 1 348 ? 19.147 20.830  92.296  1.00 15.51 ? 347  PHE A CE2 1 
ATOM   2769 C CZ  . PHE A 1 348 ? 19.210 19.472  92.053  1.00 12.88 ? 347  PHE A CZ  1 
ATOM   2770 N N   . SER A 1 349 ? 23.656 22.292  97.425  1.00 12.77 ? 348  SER A N   1 
ATOM   2771 C CA  . SER A 1 349 ? 24.798 22.888  98.146  1.00 13.64 ? 348  SER A CA  1 
ATOM   2772 C C   . SER A 1 349 ? 26.067 21.987  98.133  1.00 16.28 ? 348  SER A C   1 
ATOM   2773 O O   . SER A 1 349 ? 27.174 22.494  97.976  1.00 15.95 ? 348  SER A O   1 
ATOM   2774 C CB  . SER A 1 349 ? 24.410 23.202  99.587  1.00 18.19 ? 348  SER A CB  1 
ATOM   2775 O OG  . SER A 1 349 ? 24.089 22.010  100.283 1.00 26.61 ? 348  SER A OG  1 
ATOM   2776 N N   . GLU A 1 350 ? 25.903 20.650  98.262  1.00 12.92 ? 349  GLU A N   1 
ATOM   2777 C CA  . GLU A 1 350 ? 27.069 19.749  98.294  1.00 12.42 ? 349  GLU A CA  1 
ATOM   2778 C C   . GLU A 1 350 ? 27.662 19.406  96.908  1.00 13.23 ? 349  GLU A C   1 
ATOM   2779 O O   . GLU A 1 350 ? 28.719 18.765  96.815  1.00 13.18 ? 349  GLU A O   1 
ATOM   2780 C CB  . GLU A 1 350 ? 26.735 18.476  99.078  1.00 13.96 ? 349  GLU A CB  1 
ATOM   2781 C CG  . GLU A 1 350 ? 26.026 17.422  98.259  1.00 19.83 ? 349  GLU A CG  1 
ATOM   2782 C CD  . GLU A 1 350 ? 25.948 16.077  98.956  1.00 32.67 ? 349  GLU A CD  1 
ATOM   2783 O OE1 . GLU A 1 350 ? 25.499 16.053  100.128 1.00 18.27 ? 349  GLU A OE1 1 
ATOM   2784 O OE2 . GLU A 1 350 ? 26.382 15.065  98.351  1.00 14.53 ? 349  GLU A OE2 1 
ATOM   2785 N N   . PHE A 1 351 ? 26.963 19.792  95.831  1.00 10.30 ? 350  PHE A N   1 
ATOM   2786 C CA  . PHE A 1 351 ? 27.456 19.475  94.485  1.00 10.77 ? 350  PHE A CA  1 
ATOM   2787 C C   . PHE A 1 351 ? 28.709 20.280  94.194  1.00 13.35 ? 350  PHE A C   1 
ATOM   2788 O O   . PHE A 1 351 ? 28.654 21.517  94.360  1.00 16.50 ? 350  PHE A O   1 
ATOM   2789 C CB  . PHE A 1 351 ? 26.373 19.679  93.414  1.00 11.58 ? 350  PHE A CB  1 
ATOM   2790 C CG  . PHE A 1 351 ? 26.734 19.160  92.041  1.00 13.08 ? 350  PHE A CG  1 
ATOM   2791 C CD1 . PHE A 1 351 ? 27.631 19.852  91.224  1.00 15.01 ? 350  PHE A CD1 1 
ATOM   2792 C CD2 . PHE A 1 351 ? 26.157 17.995  91.546  1.00 14.10 ? 350  PHE A CD2 1 
ATOM   2793 C CE1 . PHE A 1 351 ? 27.972 19.364  89.948  1.00 14.61 ? 350  PHE A CE1 1 
ATOM   2794 C CE2 . PHE A 1 351 ? 26.490 17.518  90.262  1.00 15.96 ? 350  PHE A CE2 1 
ATOM   2795 C CZ  . PHE A 1 351 ? 27.403 18.196  89.480  1.00 14.03 ? 350  PHE A CZ  1 
ATOM   2796 O OXT . PHE A 1 351 ? 29.724 19.658  93.802  1.00 15.51 ? 350  PHE A OXT 1 
ATOM   2797 N N   . THR B 2 1   ? 10.912 -13.987 61.575  1.00 11.69 ? 5    THR I N   1 
ATOM   2798 C CA  . THR B 2 1   ? 12.074 -14.248 62.440  1.00 12.36 ? 5    THR I CA  1 
ATOM   2799 C C   . THR B 2 1   ? 12.030 -13.275 63.612  1.00 15.10 ? 5    THR I C   1 
ATOM   2800 O O   . THR B 2 1   ? 11.429 -12.203 63.485  1.00 13.33 ? 5    THR I O   1 
ATOM   2801 C CB  . THR B 2 1   ? 13.403 -14.052 61.646  1.00 17.08 ? 5    THR I CB  1 
ATOM   2802 O OG1 . THR B 2 1   ? 13.555 -12.673 61.284  1.00 15.78 ? 5    THR I OG1 1 
ATOM   2803 C CG2 . THR B 2 1   ? 13.489 -14.933 60.380  1.00 16.05 ? 5    THR I CG2 1 
ATOM   2804 N N   . THR B 2 2   ? 12.709 -13.610 64.737  1.00 12.51 ? 6    THR I N   1 
ATOM   2805 C CA  . THR B 2 2   ? 12.756 -12.700 65.890  1.00 11.99 ? 6    THR I CA  1 
ATOM   2806 C C   . THR B 2 2   ? 13.432 -11.395 65.472  1.00 14.57 ? 6    THR I C   1 
ATOM   2807 O O   . THR B 2 2   ? 12.971 -10.334 65.869  1.00 14.54 ? 6    THR I O   1 
ATOM   2808 C CB  . THR B 2 2   ? 13.427 -13.375 67.102  1.00 20.44 ? 6    THR I CB  1 
ATOM   2809 O OG1 . THR B 2 2   ? 12.807 -14.637 67.303  1.00 18.22 ? 6    THR I OG1 1 
ATOM   2810 C CG2 . THR B 2 2   ? 13.270 -12.569 68.370  1.00 17.28 ? 6    THR I CG2 1 
ATOM   2811 N N   . TYR B 2 3   ? 14.500 -11.475 64.652  1.00 12.34 ? 7    TYR I N   1 
ATOM   2812 C CA  . TYR B 2 3   ? 15.201 -10.301 64.140  1.00 12.43 ? 7    TYR I CA  1 
ATOM   2813 C C   . TYR B 2 3   ? 14.229 -9.363  63.397  1.00 13.78 ? 7    TYR I C   1 
ATOM   2814 O O   . TYR B 2 3   ? 14.187 -8.162  63.697  1.00 12.89 ? 7    TYR I O   1 
ATOM   2815 C CB  . TYR B 2 3   ? 16.355 -10.741 63.208  1.00 12.72 ? 7    TYR I CB  1 
ATOM   2816 C CG  . TYR B 2 3   ? 16.942 -9.598  62.408  1.00 13.95 ? 7    TYR I CG  1 
ATOM   2817 C CD1 . TYR B 2 3   ? 17.799 -8.675  63.002  1.00 16.61 ? 7    TYR I CD1 1 
ATOM   2818 C CD2 . TYR B 2 3   ? 16.550 -9.370  61.091  1.00 14.22 ? 7    TYR I CD2 1 
ATOM   2819 C CE1 . TYR B 2 3   ? 18.331 -7.609  62.274  1.00 16.78 ? 7    TYR I CE1 1 
ATOM   2820 C CE2 . TYR B 2 3   ? 17.056 -8.290  60.358  1.00 15.34 ? 7    TYR I CE2 1 
ATOM   2821 C CZ  . TYR B 2 3   ? 17.924 -7.399  60.962  1.00 21.44 ? 7    TYR I CZ  1 
ATOM   2822 O OH  . TYR B 2 3   ? 18.406 -6.335  60.237  1.00 20.11 ? 7    TYR I OH  1 
ATOM   2823 N N   . ALA B 2 4   ? 13.443 -9.903  62.428  1.00 9.45  ? 8    ALA I N   1 
ATOM   2824 C CA  . ALA B 2 4   ? 12.469 -9.104  61.677  1.00 10.06 ? 8    ALA I CA  1 
ATOM   2825 C C   . ALA B 2 4   ? 11.488 -8.434  62.650  1.00 12.54 ? 8    ALA I C   1 
ATOM   2826 O O   . ALA B 2 4   ? 11.125 -7.280  62.445  1.00 10.68 ? 8    ALA I O   1 
ATOM   2827 C CB  . ALA B 2 4   ? 11.707 -9.982  60.685  1.00 10.62 ? 8    ALA I CB  1 
ATOM   2828 N N   . ASP B 2 5   ? 11.034 -9.166  63.698  1.00 10.64 ? 9    ASP I N   1 
ATOM   2829 C CA  . ASP B 2 5   ? 10.118 -8.615  64.692  1.00 10.02 ? 9    ASP I CA  1 
ATOM   2830 C C   . ASP B 2 5   ? 10.777 -7.490  65.497  1.00 13.02 ? 9    ASP I C   1 
ATOM   2831 O O   . ASP B 2 5   ? 10.148 -6.462  65.767  1.00 12.04 ? 9    ASP I O   1 
ATOM   2832 C CB  . ASP B 2 5   ? 9.550  -9.744  65.587  1.00 11.82 ? 9    ASP I CB  1 
ATOM   2833 C CG  . ASP B 2 5   ? 8.699  -10.751 64.830  1.00 16.15 ? 9    ASP I CG  1 
ATOM   2834 O OD1 . ASP B 2 5   ? 8.090  -10.367 63.803  1.00 15.27 ? 9    ASP I OD1 1 
ATOM   2835 O OD2 . ASP B 2 5   ? 8.546  -11.891 65.323  1.00 16.36 ? 9    ASP I OD2 1 
ATOM   2836 N N   . PHE B 2 6   ? 12.039 -7.666  65.878  1.00 9.43  ? 10   PHE I N   1 
ATOM   2837 C CA  . PHE B 2 6   ? 12.722 -6.604  66.597  1.00 9.84  ? 10   PHE I CA  1 
ATOM   2838 C C   . PHE B 2 6   ? 12.879 -5.338  65.726  1.00 13.31 ? 10   PHE I C   1 
ATOM   2839 O O   . PHE B 2 6   ? 12.609 -4.222  66.187  1.00 10.84 ? 10   PHE I O   1 
ATOM   2840 C CB  . PHE B 2 6   ? 14.082 -7.085  67.076  1.00 11.37 ? 10   PHE I CB  1 
ATOM   2841 C CG  . PHE B 2 6   ? 14.842 -6.018  67.810  1.00 11.10 ? 10   PHE I CG  1 
ATOM   2842 C CD1 . PHE B 2 6   ? 14.347 -5.485  69.004  1.00 13.05 ? 10   PHE I CD1 1 
ATOM   2843 C CD2 . PHE B 2 6   ? 16.042 -5.527  67.306  1.00 12.82 ? 10   PHE I CD2 1 
ATOM   2844 C CE1 . PHE B 2 6   ? 15.058 -4.504  69.697  1.00 13.34 ? 10   PHE I CE1 1 
ATOM   2845 C CE2 . PHE B 2 6   ? 16.754 -4.538  68.002  1.00 14.57 ? 10   PHE I CE2 1 
ATOM   2846 C CZ  . PHE B 2 6   ? 16.252 -4.034  69.191  1.00 11.78 ? 10   PHE I CZ  1 
ATOM   2847 N N   . ILE B 2 7   ? 13.331 -5.518  64.478  1.00 9.82  ? 11   ILE I N   1 
ATOM   2848 C CA  . ILE B 2 7   ? 13.581 -4.412  63.541  1.00 11.05 ? 11   ILE I CA  1 
ATOM   2849 C C   . ILE B 2 7   ? 12.321 -3.620  63.199  1.00 15.23 ? 11   ILE I C   1 
ATOM   2850 O O   . ILE B 2 7   ? 12.389 -2.400  63.051  1.00 16.15 ? 11   ILE I O   1 
ATOM   2851 C CB  . ILE B 2 7   ? 14.362 -4.914  62.311  1.00 15.28 ? 11   ILE I CB  1 
ATOM   2852 C CG1 . ILE B 2 7   ? 15.772 -5.404  62.715  1.00 15.87 ? 11   ILE I CG1 1 
ATOM   2853 C CG2 . ILE B 2 7   ? 14.433 -3.859  61.195  1.00 19.16 ? 11   ILE I CG2 1 
ATOM   2854 C CD1 . ILE B 2 7   ? 16.824 -4.284  63.340  1.00 19.19 ? 11   ILE I CD1 1 
ATOM   2855 N N   . ALA B 2 8   ? 11.168 -4.301  63.149  1.00 12.29 ? 12   ALA I N   1 
ATOM   2856 C CA  . ALA B 2 8   ? 9.893  -3.655  62.865  1.00 11.09 ? 12   ALA I CA  1 
ATOM   2857 C C   . ALA B 2 8   ? 9.298  -2.969  64.115  1.00 15.56 ? 12   ALA I C   1 
ATOM   2858 O O   . ALA B 2 8   ? 8.318  -2.231  63.983  1.00 15.06 ? 12   ALA I O   1 
ATOM   2859 C CB  . ALA B 2 8   ? 8.906  -4.691  62.334  1.00 11.96 ? 12   ALA I CB  1 
ATOM   2860 N N   . SER B 2 9   ? 9.874  -3.219  65.310  1.00 12.73 ? 13   SER I N   1 
ATOM   2861 C CA  . SER B 2 9   ? 9.392  -2.653  66.587  1.00 12.67 ? 13   SER I CA  1 
ATOM   2862 C C   . SER B 2 9   ? 9.807  -1.193  66.760  1.00 16.54 ? 13   SER I C   1 
ATOM   2863 O O   . SER B 2 9   ? 10.741 -0.744  66.095  1.00 15.57 ? 13   SER I O   1 
ATOM   2864 C CB  . SER B 2 9   ? 9.908  -3.479  67.766  1.00 11.84 ? 13   SER I CB  1 
ATOM   2865 O OG  . SER B 2 9   ? 11.236 -3.111  68.115  1.00 14.18 ? 13   SER I OG  1 
ATOM   2866 N N   . GLY B 2 10  ? 9.137  -0.488  67.674  1.00 14.48 ? 14   GLY I N   1 
ATOM   2867 C CA  . GLY B 2 10  ? 9.451  0.907   67.973  1.00 14.88 ? 14   GLY I CA  1 
ATOM   2868 C C   . GLY B 2 10  ? 10.573 1.101   68.982  1.00 17.21 ? 14   GLY I C   1 
ATOM   2869 O O   . GLY B 2 10  ? 10.789 2.225   69.442  1.00 16.27 ? 14   GLY I O   1 
ATOM   2870 N N   . ARG B 2 11  ? 11.293 0.017   69.366  1.00 12.04 ? 15   ARG I N   1 
ATOM   2871 C CA  . ARG B 2 11  ? 12.341 0.139   70.401  1.00 12.04 ? 15   ARG I CA  1 
ATOM   2872 C C   . ARG B 2 11  ? 13.731 -0.284  69.931  1.00 14.67 ? 15   ARG I C   1 
ATOM   2873 O O   . ARG B 2 11  ? 14.471 -0.944  70.672  1.00 13.07 ? 15   ARG I O   1 
ATOM   2874 C CB  . ARG B 2 11  ? 11.901 -0.581  71.690  1.00 13.02 ? 15   ARG I CB  1 
ATOM   2875 C CG  . ARG B 2 11  ? 10.644 0.087   72.298  1.00 13.08 ? 15   ARG I CG  1 
ATOM   2876 C CD  . ARG B 2 11  ? 10.211 -0.493  73.620  1.00 15.00 ? 15   ARG I CD  1 
ATOM   2877 N NE  . ARG B 2 11  ? 11.212 -0.253  74.660  1.00 13.16 ? 15   ARG I NE  1 
ATOM   2878 C CZ  . ARG B 2 11  ? 11.261 0.817   75.446  1.00 19.17 ? 15   ARG I CZ  1 
ATOM   2879 N NH1 . ARG B 2 11  ? 10.348 1.779   75.331  1.00 14.13 ? 15   ARG I NH1 1 
ATOM   2880 N NH2 . ARG B 2 11  ? 12.222 0.935   76.357  1.00 13.73 ? 15   ARG I NH2 1 
ATOM   2881 N N   . THR B 2 12  ? 14.090 0.121   68.698  1.00 10.96 ? 16   THR I N   1 
ATOM   2882 C CA  . THR B 2 12  ? 15.412 -0.208  68.145  1.00 10.64 ? 16   THR I CA  1 
ATOM   2883 C C   . THR B 2 12  ? 16.420 0.931   68.310  1.00 12.41 ? 16   THR I C   1 
ATOM   2884 O O   . THR B 2 12  ? 17.615 0.740   68.054  1.00 12.36 ? 16   THR I O   1 
ATOM   2885 C CB  . THR B 2 12  ? 15.313 -0.662  66.672  1.00 14.51 ? 16   THR I CB  1 
ATOM   2886 O OG1 . THR B 2 12  ? 14.935 0.437   65.852  1.00 15.97 ? 16   THR I OG1 1 
ATOM   2887 C CG2 . THR B 2 12  ? 14.351 -1.816  66.496  1.00 15.35 ? 16   THR I CG2 1 
ATOM   2888 N N   . GLY B 2 13  ? 15.922 2.120   68.658  1.00 10.14 ? 17   GLY I N   1 
ATOM   2889 C CA  . GLY B 2 13  ? 16.753 3.296   68.888  1.00 10.18 ? 17   GLY I CA  1 
ATOM   2890 C C   . GLY B 2 13  ? 17.235 3.340   70.327  1.00 12.02 ? 17   GLY I C   1 
ATOM   2891 O O   . GLY B 2 13  ? 16.967 2.402   71.099  1.00 10.48 ? 17   GLY I O   1 
ATOM   2892 N N   . ARG B 2 14  ? 17.947 4.437   70.716  1.00 9.97  ? 18   ARG I N   1 
ATOM   2893 C CA  . ARG B 2 14  ? 18.445 4.553   72.088  1.00 9.58  ? 18   ARG I CA  1 
ATOM   2894 C C   . ARG B 2 14  ? 17.265 4.524   73.061  1.00 12.45 ? 18   ARG I C   1 
ATOM   2895 O O   . ARG B 2 14  ? 16.263 5.212   72.849  1.00 12.48 ? 18   ARG I O   1 
ATOM   2896 C CB  . ARG B 2 14  ? 19.261 5.840   72.331  1.00 9.16  ? 18   ARG I CB  1 
ATOM   2897 C CG  . ARG B 2 14  ? 20.545 5.949   71.520  1.00 11.93 ? 18   ARG I CG  1 
ATOM   2898 C CD  . ARG B 2 14  ? 21.283 7.214   71.884  1.00 14.51 ? 18   ARG I CD  1 
ATOM   2899 N NE  . ARG B 2 14  ? 22.084 7.086   73.108  1.00 22.80 ? 18   ARG I NE  1 
ATOM   2900 C CZ  . ARG B 2 14  ? 21.755 7.574   74.301  1.00 32.26 ? 18   ARG I CZ  1 
ATOM   2901 N NH1 . ARG B 2 14  ? 20.605 8.219   74.470  1.00 21.93 ? 18   ARG I NH1 1 
ATOM   2902 N NH2 . ARG B 2 14  ? 22.572 7.419   75.337  1.00 23.31 ? 18   ARG I NH2 1 
ATOM   2903 N N   . ARG B 2 15  ? 17.383 3.728   74.104  1.00 9.85  ? 19   ARG I N   1 
ATOM   2904 C CA  . ARG B 2 15  ? 16.328 3.572   75.094  1.00 10.59 ? 19   ARG I CA  1 
ATOM   2905 C C   . ARG B 2 15  ? 16.486 4.478   76.320  1.00 14.80 ? 19   ARG I C   1 
ATOM   2906 O O   . ARG B 2 15  ? 17.554 4.531   76.931  1.00 13.83 ? 19   ARG I O   1 
ATOM   2907 C CB  . ARG B 2 15  ? 16.234 2.100   75.504  1.00 10.25 ? 19   ARG I CB  1 
ATOM   2908 C CG  . ARG B 2 15  ? 15.832 1.209   74.317  1.00 12.56 ? 19   ARG I CG  1 
ATOM   2909 C CD  . ARG B 2 15  ? 16.249 -0.231  74.511  1.00 12.69 ? 19   ARG I CD  1 
ATOM   2910 N NE  . ARG B 2 15  ? 17.717 -0.358  74.536  1.00 10.90 ? 19   ARG I NE  1 
ATOM   2911 C CZ  . ARG B 2 15  ? 18.383 -1.493  74.351  1.00 14.80 ? 19   ARG I CZ  1 
ATOM   2912 N NH1 . ARG B 2 15  ? 17.731 -2.619  74.069  1.00 10.08 ? 19   ARG I NH1 1 
ATOM   2913 N NH2 . ARG B 2 15  ? 19.711 -1.512  74.435  1.00 13.09 ? 19   ARG I NH2 1 
ATOM   2914 N N   . ASN B 2 16  ? 15.400 5.163   76.696  1.00 12.73 ? 20   ASN I N   1 
ATOM   2915 C CA  . ASN B 2 16  ? 15.400 6.042   77.861  1.00 14.38 ? 20   ASN I CA  1 
ATOM   2916 C C   . ASN B 2 16  ? 15.236 5.261   79.159  1.00 15.11 ? 20   ASN I C   1 
ATOM   2917 O O   . ASN B 2 16  ? 14.527 4.236   79.229  1.00 14.11 ? 20   ASN I O   1 
ATOM   2918 C CB  . ASN B 2 16  ? 14.256 7.074   77.745  1.00 17.13 ? 20   ASN I CB  1 
ATOM   2919 C CG  . ASN B 2 16  ? 14.412 8.029   76.589  1.00 36.43 ? 20   ASN I CG  1 
ATOM   2920 O OD1 . ASN B 2 16  ? 15.515 8.293   76.123  1.00 27.33 ? 20   ASN I OD1 1 
ATOM   2921 N ND2 . ASN B 2 16  ? 13.312 8.602   76.129  1.00 33.87 ? 20   ASN I ND2 1 
ATOM   2922 N N   . ALA B 2 17  ? 15.837 5.792   80.218  1.00 13.64 ? 21   ALA I N   1 
ATOM   2923 C CA  . ALA B 2 17  ? 15.617 5.235   81.546  1.00 13.77 ? 21   ALA I CA  1 
ATOM   2924 C C   . ALA B 2 17  ? 14.188 5.559   81.972  1.00 17.49 ? 21   ALA I C   1 
ATOM   2925 O O   . ALA B 2 17  ? 13.565 6.510   81.467  1.00 16.01 ? 21   ALA I O   1 
ATOM   2926 C CB  . ALA B 2 17  ? 16.580 5.866   82.543  1.00 14.88 ? 21   ALA I CB  1 
ATOM   2927 N N   . ILE B 2 18  ? 13.660 4.754   82.875  1.00 16.46 ? 22   ILE I N   1 
ATOM   2928 C CA  . ILE B 2 18  ? 12.364 5.010   83.496  1.00 20.69 ? 22   ILE I CA  1 
ATOM   2929 C C   . ILE B 2 18  ? 12.644 5.739   84.803  1.00 31.71 ? 22   ILE I C   1 
ATOM   2930 O O   . ILE B 2 18  ? 13.634 5.419   85.481  1.00 32.42 ? 22   ILE I O   1 
ATOM   2931 C CB  . ILE B 2 18  ? 11.500 3.746   83.707  1.00 24.33 ? 22   ILE I CB  1 
ATOM   2932 C CG1 . ILE B 2 18  ? 12.250 2.661   84.537  1.00 25.61 ? 22   ILE I CG1 1 
ATOM   2933 C CG2 . ILE B 2 18  ? 11.032 3.213   82.368  1.00 26.54 ? 22   ILE I CG2 1 
ATOM   2934 C CD1 . ILE B 2 18  ? 11.443 1.922   85.515  1.00 29.52 ? 22   ILE I CD1 1 
HETATM 2935 O O   . HOH C 3 .   ? 46.389 -2.390  89.506  1.00 47.75 ? 2001 HOH A O   1 
HETATM 2936 O O   . HOH C 3 .   ? 42.799 -12.632 95.672  1.00 45.49 ? 2002 HOH A O   1 
HETATM 2937 O O   . HOH C 3 .   ? 44.187 -12.761 92.625  1.00 44.85 ? 2003 HOH A O   1 
HETATM 2938 O O   . HOH C 3 .   ? 40.000 -7.178  99.808  1.00 29.16 ? 2004 HOH A O   1 
HETATM 2939 O O   . HOH C 3 .   ? 43.867 -8.141  101.722 1.00 40.11 ? 2005 HOH A O   1 
HETATM 2940 O O   . HOH C 3 .   ? 45.937 -4.080  99.707  1.00 34.78 ? 2006 HOH A O   1 
HETATM 2941 O O   . HOH C 3 .   ? 46.746 0.114   90.460  1.00 38.08 ? 2007 HOH A O   1 
HETATM 2942 O O   . HOH C 3 .   ? 43.798 -0.869  94.263  1.00 39.13 ? 2008 HOH A O   1 
HETATM 2943 O O   . HOH C 3 .   ? 37.900 -8.723  98.744  1.00 30.39 ? 2009 HOH A O   1 
HETATM 2944 O O   . HOH C 3 .   ? 38.621 -5.108  100.870 1.00 27.49 ? 2010 HOH A O   1 
HETATM 2945 O O   . HOH C 3 .   ? 41.301 -8.237  102.145 1.00 35.63 ? 2011 HOH A O   1 
HETATM 2946 O O   . HOH C 3 .   ? 45.506 -6.239  101.563 1.00 32.55 ? 2012 HOH A O   1 
HETATM 2947 O O   . HOH C 3 .   ? 36.958 -2.803  97.529  1.00 21.83 ? 2013 HOH A O   1 
HETATM 2948 O O   . HOH C 3 .   ? 43.077 0.835   92.186  1.00 31.90 ? 2014 HOH A O   1 
HETATM 2949 O O   . HOH C 3 .   ? 40.571 -1.362  102.615 1.00 31.02 ? 2015 HOH A O   1 
HETATM 2950 O O   . HOH C 3 .   ? 38.985 0.552   103.629 1.00 27.94 ? 2016 HOH A O   1 
HETATM 2951 O O   . HOH C 3 .   ? 39.651 -3.801  102.959 1.00 30.33 ? 2017 HOH A O   1 
HETATM 2952 O O   . HOH C 3 .   ? 42.951 -1.077  103.968 1.00 52.23 ? 2018 HOH A O   1 
HETATM 2953 O O   . HOH C 3 .   ? 36.725 -0.511  104.746 1.00 45.15 ? 2019 HOH A O   1 
HETATM 2954 O O   . HOH C 3 .   ? 39.204 3.062   94.130  1.00 16.04 ? 2020 HOH A O   1 
HETATM 2955 O O   . HOH C 3 .   ? 39.747 2.917   104.703 1.00 28.25 ? 2021 HOH A O   1 
HETATM 2956 O O   . HOH C 3 .   ? 42.458 11.069  97.918  1.00 39.18 ? 2022 HOH A O   1 
HETATM 2957 O O   . HOH C 3 .   ? 32.445 -4.818  100.271 1.00 39.16 ? 2023 HOH A O   1 
HETATM 2958 O O   . HOH C 3 .   ? 32.479 -2.103  104.192 1.00 45.01 ? 2024 HOH A O   1 
HETATM 2959 O O   . HOH C 3 .   ? 41.529 6.976   93.968  1.00 38.80 ? 2025 HOH A O   1 
HETATM 2960 O O   . HOH C 3 .   ? 36.130 6.649   105.632 1.00 42.40 ? 2026 HOH A O   1 
HETATM 2961 O O   . HOH C 3 .   ? 38.768 9.828   105.206 1.00 39.80 ? 2027 HOH A O   1 
HETATM 2962 O O   . HOH C 3 .   ? 41.016 13.559  102.279 1.00 46.47 ? 2028 HOH A O   1 
HETATM 2963 O O   . HOH C 3 .   ? 37.708 3.919   106.694 1.00 44.90 ? 2029 HOH A O   1 
HETATM 2964 O O   . HOH C 3 .   ? 36.720 -3.285  104.282 1.00 35.80 ? 2030 HOH A O   1 
HETATM 2965 O O   . HOH C 3 .   ? 40.216 5.486   103.484 1.00 21.37 ? 2031 HOH A O   1 
HETATM 2966 O O   . HOH C 3 .   ? 42.180 2.528   106.119 1.00 51.06 ? 2032 HOH A O   1 
HETATM 2967 O O   . HOH C 3 .   ? 32.430 6.401   108.113 1.00 48.49 ? 2033 HOH A O   1 
HETATM 2968 O O   . HOH C 3 .   ? 40.581 12.860  99.247  1.00 42.21 ? 2034 HOH A O   1 
HETATM 2969 O O   . HOH C 3 .   ? 42.032 8.496   97.585  1.00 27.64 ? 2035 HOH A O   1 
HETATM 2970 O O   . HOH C 3 .   ? 41.954 2.938   93.298  1.00 30.29 ? 2036 HOH A O   1 
HETATM 2971 O O   . HOH C 3 .   ? 30.803 18.332  101.083 1.00 58.09 ? 2037 HOH A O   1 
HETATM 2972 O O   . HOH C 3 .   ? 36.585 16.187  90.691  1.00 32.46 ? 2038 HOH A O   1 
HETATM 2973 O O   . HOH C 3 .   ? 30.383 27.606  94.846  1.00 45.48 ? 2039 HOH A O   1 
HETATM 2974 O O   . HOH C 3 .   ? 34.464 30.006  89.790  1.00 38.56 ? 2040 HOH A O   1 
HETATM 2975 O O   . HOH C 3 .   ? 39.358 5.751   94.088  1.00 15.61 ? 2041 HOH A O   1 
HETATM 2976 O O   . HOH C 3 .   ? 38.504 7.346   104.408 1.00 28.49 ? 2042 HOH A O   1 
HETATM 2977 O O   . HOH C 3 .   ? 28.096 31.714  86.282  1.00 24.33 ? 2043 HOH A O   1 
HETATM 2978 O O   . HOH C 3 .   ? 27.751 30.895  90.296  1.00 33.99 ? 2044 HOH A O   1 
HETATM 2979 O O   . HOH C 3 .   ? 38.748 11.911  103.464 1.00 23.55 ? 2045 HOH A O   1 
HETATM 2980 O O   . HOH C 3 .   ? 41.031 29.195  79.601  1.00 31.13 ? 2046 HOH A O   1 
HETATM 2981 O O   . HOH C 3 .   ? 29.438 8.010   104.387 1.00 20.47 ? 2047 HOH A O   1 
HETATM 2982 O O   . HOH C 3 .   ? 28.175 28.768  76.847  1.00 42.34 ? 2048 HOH A O   1 
HETATM 2983 O O   . HOH C 3 .   ? 31.291 13.764  103.672 1.00 29.68 ? 2049 HOH A O   1 
HETATM 2984 O O   . HOH C 3 .   ? 33.556 6.138   105.142 1.00 44.47 ? 2050 HOH A O   1 
HETATM 2985 O O   . HOH C 3 .   ? 22.488 12.965  79.994  1.00 64.57 ? 2051 HOH A O   1 
HETATM 2986 O O   . HOH C 3 .   ? 38.405 14.164  97.346  1.00 36.70 ? 2052 HOH A O   1 
HETATM 2987 O O   . HOH C 3 .   ? 34.134 17.408  103.139 1.00 51.27 ? 2053 HOH A O   1 
HETATM 2988 O O   . HOH C 3 .   ? 36.891 17.821  105.940 1.00 33.62 ? 2054 HOH A O   1 
HETATM 2989 O O   . HOH C 3 .   ? 18.063 19.756  80.081  1.00 22.49 ? 2055 HOH A O   1 
HETATM 2990 O O   . HOH C 3 .   ? 32.880 18.542  99.271  1.00 36.63 ? 2056 HOH A O   1 
HETATM 2991 O O   . HOH C 3 .   ? 34.197 16.812  91.394  1.00 26.29 ? 2057 HOH A O   1 
HETATM 2992 O O   . HOH C 3 .   ? 37.822 20.224  95.352  1.00 32.70 ? 2058 HOH A O   1 
HETATM 2993 O O   . HOH C 3 .   ? 38.276 22.819  94.477  1.00 30.18 ? 2059 HOH A O   1 
HETATM 2994 O O   . HOH C 3 .   ? 28.582 23.919  99.689  1.00 38.41 ? 2060 HOH A O   1 
HETATM 2995 O O   . HOH C 3 .   ? 30.856 25.113  95.868  1.00 26.61 ? 2061 HOH A O   1 
HETATM 2996 O O   . HOH C 3 .   ? 42.649 18.520  69.286  1.00 21.41 ? 2062 HOH A O   1 
HETATM 2997 O O   . HOH C 3 .   ? 44.316 21.127  66.550  1.00 32.99 ? 2063 HOH A O   1 
HETATM 2998 O O   . HOH C 3 .   ? 41.148 18.432  66.995  1.00 37.22 ? 2064 HOH A O   1 
HETATM 2999 O O   . HOH C 3 .   ? 31.485 20.577  91.947  1.00 15.11 ? 2065 HOH A O   1 
HETATM 3000 O O   . HOH C 3 .   ? 37.694 26.393  90.780  1.00 38.24 ? 2066 HOH A O   1 
HETATM 3001 O O   . HOH C 3 .   ? 33.211 27.406  89.201  1.00 17.18 ? 2067 HOH A O   1 
HETATM 3002 O O   . HOH C 3 .   ? 30.697 25.028  91.511  1.00 17.92 ? 2068 HOH A O   1 
HETATM 3003 O O   . HOH C 3 .   ? 35.894 26.222  95.695  1.00 36.64 ? 2069 HOH A O   1 
HETATM 3004 O O   . HOH C 3 .   ? 47.749 13.907  75.188  1.00 30.00 ? 2070 HOH A O   1 
HETATM 3005 O O   . HOH C 3 .   ? 40.329 23.705  86.691  1.00 43.03 ? 2071 HOH A O   1 
HETATM 3006 O O   . HOH C 3 .   ? 40.702 22.327  89.341  1.00 31.72 ? 2072 HOH A O   1 
HETATM 3007 O O   . HOH C 3 .   ? 38.210 17.729  89.350  1.00 22.55 ? 2073 HOH A O   1 
HETATM 3008 O O   . HOH C 3 .   ? 42.638 11.391  74.852  1.00 45.33 ? 2074 HOH A O   1 
HETATM 3009 O O   . HOH C 3 .   ? 30.507 28.045  85.494  1.00 17.48 ? 2075 HOH A O   1 
HETATM 3010 O O   . HOH C 3 .   ? 30.084 30.593  88.870  1.00 25.96 ? 2076 HOH A O   1 
HETATM 3011 O O   . HOH C 3 .   ? 12.767 25.828  81.958  1.00 50.07 ? 2077 HOH A O   1 
HETATM 3012 O O   . HOH C 3 .   ? 32.099 28.749  77.747  1.00 38.34 ? 2078 HOH A O   1 
HETATM 3013 O O   . HOH C 3 .   ? 10.974 25.241  88.009  1.00 32.41 ? 2079 HOH A O   1 
HETATM 3014 O O   . HOH C 3 .   ? 11.197 28.320  91.993  1.00 30.77 ? 2080 HOH A O   1 
HETATM 3015 O O   . HOH C 3 .   ? 12.469 30.792  91.374  1.00 39.28 ? 2081 HOH A O   1 
HETATM 3016 O O   . HOH C 3 .   ? 12.852 17.590  79.563  1.00 38.39 ? 2082 HOH A O   1 
HETATM 3017 O O   . HOH C 3 .   ? 35.197 31.550  77.379  1.00 35.60 ? 2083 HOH A O   1 
HETATM 3018 O O   . HOH C 3 .   ? 38.932 30.944  79.858  1.00 44.02 ? 2084 HOH A O   1 
HETATM 3019 O O   . HOH C 3 .   ? 37.595 30.350  85.068  1.00 39.22 ? 2085 HOH A O   1 
HETATM 3020 O O   . HOH C 3 .   ? 12.634 15.784  95.640  1.00 39.96 ? 2086 HOH A O   1 
HETATM 3021 O O   . HOH C 3 .   ? 11.620 19.231  95.608  1.00 36.12 ? 2087 HOH A O   1 
HETATM 3022 O O   . HOH C 3 .   ? 8.955  20.397  91.917  1.00 24.55 ? 2088 HOH A O   1 
HETATM 3023 O O   . HOH C 3 .   ? 8.650  25.045  91.619  1.00 26.56 ? 2089 HOH A O   1 
HETATM 3024 O O   . HOH C 3 .   ? 4.720  26.674  88.776  1.00 31.07 ? 2090 HOH A O   1 
HETATM 3025 O O   . HOH C 3 .   ? 8.991  27.167  89.956  1.00 47.42 ? 2091 HOH A O   1 
HETATM 3026 O O   . HOH C 3 .   ? 10.629 14.213  96.440  1.00 51.13 ? 2092 HOH A O   1 
HETATM 3027 O O   . HOH C 3 .   ? 9.642  20.701  94.508  1.00 50.47 ? 2093 HOH A O   1 
HETATM 3028 O O   . HOH C 3 .   ? 7.522  29.367  90.309  1.00 58.43 ? 2094 HOH A O   1 
HETATM 3029 O O   . HOH C 3 .   ? 40.656 26.521  79.830  1.00 17.67 ? 2095 HOH A O   1 
HETATM 3030 O O   . HOH C 3 .   ? 40.147 24.073  84.159  1.00 29.04 ? 2096 HOH A O   1 
HETATM 3031 O O   . HOH C 3 .   ? 37.891 27.459  88.333  1.00 52.37 ? 2097 HOH A O   1 
HETATM 3032 O O   . HOH C 3 .   ? 40.454 26.159  87.812  1.00 40.45 ? 2098 HOH A O   1 
HETATM 3033 O O   . HOH C 3 .   ? 40.683 30.194  84.291  1.00 38.84 ? 2099 HOH A O   1 
HETATM 3034 O O   . HOH C 3 .   ? 14.421 11.191  96.647  1.00 37.05 ? 2100 HOH A O   1 
HETATM 3035 O O   . HOH C 3 .   ? 8.839  6.013   89.541  1.00 54.06 ? 2101 HOH A O   1 
HETATM 3036 O O   . HOH C 3 .   ? 15.825 15.124  98.276  1.00 22.64 ? 2102 HOH A O   1 
HETATM 3037 O O   . HOH C 3 .   ? 16.117 12.197  102.987 1.00 38.49 ? 2103 HOH A O   1 
HETATM 3038 O O   . HOH C 3 .   ? 16.969 16.177  101.909 1.00 51.27 ? 2104 HOH A O   1 
HETATM 3039 O O   . HOH C 3 .   ? 31.086 25.365  76.804  1.00 38.96 ? 2105 HOH A O   1 
HETATM 3040 O O   . HOH C 3 .   ? 31.761 28.350  73.289  1.00 37.67 ? 2106 HOH A O   1 
HETATM 3041 O O   . HOH C 3 .   ? 26.620 27.954  74.762  1.00 35.60 ? 2107 HOH A O   1 
HETATM 3042 O O   . HOH C 3 .   ? 21.853 21.661  73.236  1.00 21.49 ? 2108 HOH A O   1 
HETATM 3043 O O   . HOH C 3 .   ? 31.091 23.270  66.275  1.00 49.43 ? 2109 HOH A O   1 
HETATM 3044 O O   . HOH C 3 .   ? 44.672 1.772   90.221  1.00 42.59 ? 2110 HOH A O   1 
HETATM 3045 O O   . HOH C 3 .   ? 3.943  -12.639 74.825  1.00 41.47 ? 2111 HOH A O   1 
HETATM 3046 O O   . HOH C 3 .   ? 24.228 17.956  67.635  1.00 18.65 ? 2112 HOH A O   1 
HETATM 3047 O O   . HOH C 3 .   ? 26.536 14.908  67.687  1.00 26.13 ? 2113 HOH A O   1 
HETATM 3048 O O   . HOH C 3 .   ? 24.188 18.959  64.279  1.00 30.95 ? 2114 HOH A O   1 
HETATM 3049 O O   . HOH C 3 .   ? 23.355 10.607  71.917  1.00 30.65 ? 2115 HOH A O   1 
HETATM 3050 O O   . HOH C 3 .   ? 22.132 13.157  77.395  1.00 37.37 ? 2116 HOH A O   1 
HETATM 3051 O O   . HOH C 3 .   ? 20.612 11.420  73.091  1.00 36.55 ? 2117 HOH A O   1 
HETATM 3052 O O   . HOH C 3 .   ? 19.573 20.123  73.482  1.00 34.51 ? 2118 HOH A O   1 
HETATM 3053 O O   . HOH C 3 .   ? 28.899 31.403  82.362  1.00 33.63 ? 2119 HOH A O   1 
HETATM 3054 O O   . HOH C 3 .   ? 18.382 12.065  79.080  1.00 34.02 ? 2120 HOH A O   1 
HETATM 3055 O O   . HOH C 3 .   ? 17.557 18.023  77.993  1.00 34.16 ? 2121 HOH A O   1 
HETATM 3056 O O   . HOH C 3 .   ? 16.886 16.764  84.361  1.00 19.64 ? 2122 HOH A O   1 
HETATM 3057 O O   . HOH C 3 .   ? 11.912 15.242  77.943  1.00 38.06 ? 2123 HOH A O   1 
HETATM 3058 O O   . HOH C 3 .   ? 18.300 14.625  85.593  1.00 22.53 ? 2124 HOH A O   1 
HETATM 3059 O O   . HOH C 3 .   ? 18.009 22.559  76.783  1.00 46.73 ? 2125 HOH A O   1 
HETATM 3060 O O   . HOH C 3 .   ? 20.621 20.696  80.309  1.00 18.86 ? 2126 HOH A O   1 
HETATM 3061 O O   . HOH C 3 .   ? 20.442 23.290  81.058  1.00 18.32 ? 2127 HOH A O   1 
HETATM 3062 O O   . HOH C 3 .   ? 19.997 26.120  79.567  1.00 22.32 ? 2128 HOH A O   1 
HETATM 3063 O O   . HOH C 3 .   ? 30.085 11.372  74.984  1.00 28.28 ? 2129 HOH A O   1 
HETATM 3064 O O   . HOH C 3 .   ? 23.131 6.955   68.609  1.00 24.33 ? 2130 HOH A O   1 
HETATM 3065 O O   . HOH C 3 .   ? 27.415 10.975  75.315  1.00 37.32 ? 2131 HOH A O   1 
HETATM 3066 O O   . HOH C 3 .   ? 20.865 3.011   65.449  1.00 31.79 ? 2132 HOH A O   1 
HETATM 3067 O O   . HOH C 3 .   ? 18.511 -1.488  64.398  1.00 19.91 ? 2133 HOH A O   1 
HETATM 3068 O O   . HOH C 3 .   ? 27.375 -1.628  57.383  1.00 41.97 ? 2134 HOH A O   1 
HETATM 3069 O O   . HOH C 3 .   ? 33.240 -3.897  62.025  1.00 49.50 ? 2135 HOH A O   1 
HETATM 3070 O O   . HOH C 3 .   ? 34.070 0.432   61.508  1.00 33.72 ? 2136 HOH A O   1 
HETATM 3071 O O   . HOH C 3 .   ? 31.640 -6.010  60.509  1.00 38.69 ? 2137 HOH A O   1 
HETATM 3072 O O   . HOH C 3 .   ? 21.750 -8.803  61.704  1.00 26.85 ? 2138 HOH A O   1 
HETATM 3073 O O   . HOH C 3 .   ? 23.358 -10.768 62.248  1.00 46.36 ? 2139 HOH A O   1 
HETATM 3074 O O   . HOH C 3 .   ? 43.591 21.020  69.416  1.00 28.15 ? 2140 HOH A O   1 
HETATM 3075 O O   . HOH C 3 .   ? 39.863 20.781  67.533  1.00 31.85 ? 2141 HOH A O   1 
HETATM 3076 O O   . HOH C 3 .   ? 31.861 -7.611  62.669  1.00 49.38 ? 2142 HOH A O   1 
HETATM 3077 O O   . HOH C 3 .   ? 41.540 26.241  82.540  1.00 22.01 ? 2143 HOH A O   1 
HETATM 3078 O O   . HOH C 3 .   ? 38.942 -11.844 75.268  1.00 44.57 ? 2144 HOH A O   1 
HETATM 3079 O O   . HOH C 3 .   ? 35.082 -21.271 75.139  1.00 26.22 ? 2145 HOH A O   1 
HETATM 3080 O O   . HOH C 3 .   ? 35.722 -20.658 72.375  1.00 29.29 ? 2146 HOH A O   1 
HETATM 3081 O O   . HOH C 3 .   ? 41.841 17.381  71.661  1.00 16.82 ? 2147 HOH A O   1 
HETATM 3082 O O   . HOH C 3 .   ? 40.506 -6.636  88.883  1.00 42.51 ? 2148 HOH A O   1 
HETATM 3083 O O   . HOH C 3 .   ? 46.521 15.150  77.207  1.00 49.53 ? 2149 HOH A O   1 
HETATM 3084 O O   . HOH C 3 .   ? 42.057 14.723  80.388  1.00 36.25 ? 2150 HOH A O   1 
HETATM 3085 O O   . HOH C 3 .   ? 31.410 -9.135  93.290  1.00 29.87 ? 2151 HOH A O   1 
HETATM 3086 O O   . HOH C 3 .   ? 34.745 -8.460  96.226  1.00 30.13 ? 2152 HOH A O   1 
HETATM 3087 O O   . HOH C 3 .   ? 38.223 -10.457 96.506  1.00 41.13 ? 2153 HOH A O   1 
HETATM 3088 O O   . HOH C 3 .   ? 38.732 13.398  77.158  1.00 15.47 ? 2154 HOH A O   1 
HETATM 3089 O O   . HOH C 3 .   ? 40.329 13.042  74.999  1.00 50.57 ? 2155 HOH A O   1 
HETATM 3090 O O   . HOH C 3 .   ? 37.057 20.803  68.130  1.00 24.46 ? 2156 HOH A O   1 
HETATM 3091 O O   . HOH C 3 .   ? 35.504 -7.137  98.586  1.00 31.15 ? 2157 HOH A O   1 
HETATM 3092 O O   . HOH C 3 .   ? 19.089 8.388   81.724  1.00 30.04 ? 2158 HOH A O   1 
HETATM 3093 O O   . HOH C 3 .   ? 22.036 12.365  85.658  1.00 20.60 ? 2159 HOH A O   1 
HETATM 3094 O O   . HOH C 3 .   ? 43.018 3.113   65.252  1.00 43.37 ? 2160 HOH A O   1 
HETATM 3095 O O   . HOH C 3 .   ? 43.825 6.317   68.177  1.00 37.11 ? 2161 HOH A O   1 
HETATM 3096 O O   . HOH C 3 .   ? 45.293 6.845   65.462  1.00 34.14 ? 2162 HOH A O   1 
HETATM 3097 O O   . HOH C 3 .   ? 18.399 18.732  83.038  1.00 15.66 ? 2163 HOH A O   1 
HETATM 3098 O O   . HOH C 3 .   ? 14.364 25.298  84.046  1.00 24.30 ? 2164 HOH A O   1 
HETATM 3099 O O   . HOH C 3 .   ? 17.781 26.033  86.577  1.00 14.21 ? 2165 HOH A O   1 
HETATM 3100 O O   . HOH C 3 .   ? 17.581 23.987  80.661  1.00 26.76 ? 2166 HOH A O   1 
HETATM 3101 O O   . HOH C 3 .   ? 44.692 -4.015  69.292  1.00 42.30 ? 2167 HOH A O   1 
HETATM 3102 O O   . HOH C 3 .   ? 22.463 24.902  93.821  1.00 19.74 ? 2168 HOH A O   1 
HETATM 3103 O O   . HOH C 3 .   ? 24.901 27.418  92.703  1.00 23.92 ? 2169 HOH A O   1 
HETATM 3104 O O   . HOH C 3 .   ? 11.802 23.053  89.649  1.00 17.86 ? 2170 HOH A O   1 
HETATM 3105 O O   . HOH C 3 .   ? 13.370 29.421  85.263  1.00 42.02 ? 2171 HOH A O   1 
HETATM 3106 O O   . HOH C 3 .   ? 13.507 26.977  91.412  1.00 22.73 ? 2172 HOH A O   1 
HETATM 3107 O O   . HOH C 3 .   ? 12.958 30.576  88.347  1.00 33.50 ? 2173 HOH A O   1 
HETATM 3108 O O   . HOH C 3 .   ? 14.804 19.060  78.368  1.00 50.01 ? 2174 HOH A O   1 
HETATM 3109 O O   . HOH C 3 .   ? 16.944 21.954  79.250  1.00 35.13 ? 2175 HOH A O   1 
HETATM 3110 O O   . HOH C 3 .   ? 11.416 17.305  94.006  1.00 37.80 ? 2176 HOH A O   1 
HETATM 3111 O O   . HOH C 3 .   ? 19.957 -6.930  107.530 1.00 31.94 ? 2177 HOH A O   1 
HETATM 3112 O O   . HOH C 3 .   ? 8.374  13.748  88.949  1.00 28.17 ? 2178 HOH A O   1 
HETATM 3113 O O   . HOH C 3 .   ? 5.297  22.532  86.328  1.00 24.03 ? 2179 HOH A O   1 
HETATM 3114 O O   . HOH C 3 .   ? 9.244  22.576  90.500  1.00 21.29 ? 2180 HOH A O   1 
HETATM 3115 O O   . HOH C 3 .   ? 7.119  25.302  87.842  1.00 33.84 ? 2181 HOH A O   1 
HETATM 3116 O O   . HOH C 3 .   ? 7.439  2.257   92.780  1.00 51.38 ? 2182 HOH A O   1 
HETATM 3117 O O   . HOH C 3 .   ? 7.106  4.567   91.441  1.00 44.67 ? 2183 HOH A O   1 
HETATM 3118 O O   . HOH C 3 .   ? 12.799 10.257  93.598  1.00 38.31 ? 2184 HOH A O   1 
HETATM 3119 O O   . HOH C 3 .   ? 14.492 14.682  94.247  1.00 20.81 ? 2185 HOH A O   1 
HETATM 3120 O O   . HOH C 3 .   ? 16.626 11.222  93.600  1.00 13.20 ? 2186 HOH A O   1 
HETATM 3121 O O   . HOH C 3 .   ? 7.754  8.431   89.427  1.00 54.19 ? 2187 HOH A O   1 
HETATM 3122 O O   . HOH C 3 .   ? 19.205 10.663  87.807  1.00 15.13 ? 2188 HOH A O   1 
HETATM 3123 O O   . HOH C 3 .   ? 14.077 7.711   90.298  1.00 19.89 ? 2189 HOH A O   1 
HETATM 3124 O O   . HOH C 3 .   ? 15.790 13.381  96.136  1.00 19.90 ? 2190 HOH A O   1 
HETATM 3125 O O   . HOH C 3 .   ? 23.589 11.707  97.697  1.00 13.34 ? 2191 HOH A O   1 
HETATM 3126 O O   . HOH C 3 .   ? 18.466 15.355  98.403  1.00 22.98 ? 2192 HOH A O   1 
HETATM 3127 O O   . HOH C 3 .   ? 18.703 14.096  101.699 1.00 24.38 ? 2193 HOH A O   1 
HETATM 3128 O O   . HOH C 3 .   ? 21.539 8.900   98.413  1.00 25.97 ? 2194 HOH A O   1 
HETATM 3129 O O   . HOH C 3 .   ? 4.522  -10.149 93.650  1.00 43.21 ? 2195 HOH A O   1 
HETATM 3130 O O   . HOH C 3 .   ? 16.067 10.787  100.509 1.00 42.94 ? 2196 HOH A O   1 
HETATM 3131 O O   . HOH C 3 .   ? 21.651 7.645   91.994  1.00 13.50 ? 2197 HOH A O   1 
HETATM 3132 O O   . HOH C 3 .   ? 16.089 9.300   95.370  1.00 22.77 ? 2198 HOH A O   1 
HETATM 3133 O O   . HOH C 3 .   ? 8.934  -13.214 89.697  1.00 40.57 ? 2199 HOH A O   1 
HETATM 3134 O O   . HOH C 3 .   ? 12.557 -10.680 96.485  1.00 39.77 ? 2200 HOH A O   1 
HETATM 3135 O O   . HOH C 3 .   ? 20.041 13.228  87.249  1.00 17.61 ? 2201 HOH A O   1 
HETATM 3136 O O   . HOH C 3 .   ? 27.235 15.059  95.622  1.00 11.11 ? 2202 HOH A O   1 
HETATM 3137 O O   . HOH C 3 .   ? 24.896 7.022   97.281  1.00 15.28 ? 2203 HOH A O   1 
HETATM 3138 O O   . HOH C 3 .   ? 19.455 7.434   96.360  1.00 21.93 ? 2204 HOH A O   1 
HETATM 3139 O O   . HOH C 3 .   ? 27.904 10.394  84.017  1.00 27.92 ? 2205 HOH A O   1 
HETATM 3140 O O   . HOH C 3 .   ? 10.621 -14.774 71.165  1.00 38.31 ? 2206 HOH A O   1 
HETATM 3141 O O   . HOH C 3 .   ? 29.923 15.175  96.177  1.00 12.57 ? 2207 HOH A O   1 
HETATM 3142 O O   . HOH C 3 .   ? 25.677 12.445  99.215  1.00 11.41 ? 2208 HOH A O   1 
HETATM 3143 O O   . HOH C 3 .   ? 29.463 14.413  101.818 1.00 21.43 ? 2209 HOH A O   1 
HETATM 3144 O O   . HOH C 3 .   ? 18.151 -17.244 64.955  1.00 26.18 ? 2210 HOH A O   1 
HETATM 3145 O O   . HOH C 3 .   ? 36.095 9.516   87.889  1.00 13.88 ? 2211 HOH A O   1 
HETATM 3146 O O   . HOH C 3 .   ? 7.245  -6.693  69.164  1.00 36.23 ? 2212 HOH A O   1 
HETATM 3147 O O   . HOH C 3 .   ? 38.476 9.459   91.698  1.00 21.57 ? 2213 HOH A O   1 
HETATM 3148 O O   . HOH C 3 .   ? 38.077 12.834  91.319  1.00 35.06 ? 2214 HOH A O   1 
HETATM 3149 O O   . HOH C 3 .   ? 38.253 13.202  94.840  1.00 31.19 ? 2215 HOH A O   1 
HETATM 3150 O O   . HOH C 3 .   ? 5.531  4.031   79.128  1.00 42.05 ? 2216 HOH A O   1 
HETATM 3151 O O   . HOH C 3 .   ? 3.195  -2.925  84.634  1.00 35.12 ? 2217 HOH A O   1 
HETATM 3152 O O   . HOH C 3 .   ? 4.192  -7.208  84.590  1.00 36.64 ? 2218 HOH A O   1 
HETATM 3153 O O   . HOH C 3 .   ? 7.944  3.822   80.480  1.00 31.32 ? 2219 HOH A O   1 
HETATM 3154 O O   . HOH C 3 .   ? 7.608  3.924   85.314  1.00 42.00 ? 2220 HOH A O   1 
HETATM 3155 O O   . HOH C 3 .   ? 8.550  5.702   82.384  1.00 39.06 ? 2221 HOH A O   1 
HETATM 3156 O O   . HOH C 3 .   ? 38.743 10.093  88.792  1.00 37.17 ? 2222 HOH A O   1 
HETATM 3157 O O   . HOH C 3 .   ? 3.530  -11.525 77.094  1.00 39.84 ? 2223 HOH A O   1 
HETATM 3158 O O   . HOH C 3 .   ? 3.103  -13.781 84.577  1.00 30.92 ? 2224 HOH A O   1 
HETATM 3159 O O   . HOH C 3 .   ? 1.117  -12.035 81.441  1.00 32.70 ? 2225 HOH A O   1 
HETATM 3160 O O   . HOH C 3 .   ? 1.207  -11.897 78.747  1.00 41.50 ? 2226 HOH A O   1 
HETATM 3161 O O   . HOH C 3 .   ? 9.199  -16.935 75.418  1.00 42.96 ? 2227 HOH A O   1 
HETATM 3162 O O   . HOH C 3 .   ? 41.340 0.763   90.064  1.00 38.37 ? 2228 HOH A O   1 
HETATM 3163 O O   . HOH C 3 .   ? 42.010 3.147   86.474  1.00 37.79 ? 2229 HOH A O   1 
HETATM 3164 O O   . HOH C 3 .   ? 40.470 6.598   86.583  1.00 35.09 ? 2230 HOH A O   1 
HETATM 3165 O O   . HOH C 3 .   ? 45.253 4.054   89.154  1.00 49.23 ? 2231 HOH A O   1 
HETATM 3166 O O   . HOH C 3 .   ? 8.895  -17.214 87.584  1.00 27.86 ? 2232 HOH A O   1 
HETATM 3167 O O   . HOH C 3 .   ? 4.349  -16.848 88.103  1.00 38.31 ? 2233 HOH A O   1 
HETATM 3168 O O   . HOH C 3 .   ? 4.624  -12.556 88.698  1.00 52.44 ? 2234 HOH A O   1 
HETATM 3169 O O   . HOH C 3 .   ? 6.072  -14.066 74.960  1.00 39.55 ? 2235 HOH A O   1 
HETATM 3170 O O   . HOH C 3 .   ? 3.142  -10.492 87.803  1.00 40.26 ? 2236 HOH A O   1 
HETATM 3171 O O   . HOH C 3 .   ? 37.928 5.638   86.403  1.00 16.24 ? 2237 HOH A O   1 
HETATM 3172 O O   . HOH C 3 .   ? 13.259 -24.161 75.722  1.00 42.32 ? 2238 HOH A O   1 
HETATM 3173 O O   . HOH C 3 .   ? 38.625 1.358   78.661  1.00 15.94 ? 2239 HOH A O   1 
HETATM 3174 O O   . HOH C 3 .   ? 17.380 -23.482 73.183  1.00 45.29 ? 2240 HOH A O   1 
HETATM 3175 O O   . HOH C 3 .   ? 21.573 -18.875 62.695  1.00 38.09 ? 2241 HOH A O   1 
HETATM 3176 O O   . HOH C 3 .   ? 38.790 5.746   82.327  1.00 19.86 ? 2242 HOH A O   1 
HETATM 3177 O O   . HOH C 3 .   ? 31.738 6.843   84.504  1.00 18.79 ? 2243 HOH A O   1 
HETATM 3178 O O   . HOH C 3 .   ? 35.644 7.080   86.972  1.00 18.99 ? 2244 HOH A O   1 
HETATM 3179 O O   . HOH C 3 .   ? 28.674 -24.000 69.514  1.00 52.90 ? 2245 HOH A O   1 
HETATM 3180 O O   . HOH C 3 .   ? 28.904 -25.553 82.561  1.00 30.53 ? 2246 HOH A O   1 
HETATM 3181 O O   . HOH C 3 .   ? 31.475 -22.853 70.643  1.00 47.48 ? 2247 HOH A O   1 
HETATM 3182 O O   . HOH C 3 .   ? 20.529 -23.764 84.504  1.00 54.31 ? 2248 HOH A O   1 
HETATM 3183 O O   . HOH C 3 .   ? 29.076 -23.530 86.164  1.00 25.37 ? 2249 HOH A O   1 
HETATM 3184 O O   . HOH C 3 .   ? 29.344 -25.749 87.784  1.00 45.38 ? 2250 HOH A O   1 
HETATM 3185 O O   . HOH C 3 .   ? 36.504 13.959  89.690  1.00 33.71 ? 2251 HOH A O   1 
HETATM 3186 O O   . HOH C 3 .   ? 41.081 16.139  85.800  1.00 39.64 ? 2252 HOH A O   1 
HETATM 3187 O O   . HOH C 3 .   ? 40.436 12.974  79.301  1.00 20.17 ? 2253 HOH A O   1 
HETATM 3188 O O   . HOH C 3 .   ? 30.645 28.015  88.277  1.00 16.58 ? 2254 HOH A O   1 
HETATM 3189 O O   . HOH C 3 .   ? 29.570 27.515  92.321  1.00 26.46 ? 2255 HOH A O   1 
HETATM 3190 O O   . HOH C 3 .   ? 24.198 25.312  95.836  1.00 17.80 ? 2256 HOH A O   1 
HETATM 3191 O O   . HOH C 3 .   ? 27.943 25.171  97.260  1.00 25.97 ? 2257 HOH A O   1 
HETATM 3192 O O   . HOH C 3 .   ? 25.739 29.801  91.612  1.00 38.25 ? 2258 HOH A O   1 
HETATM 3193 O O   . HOH C 3 .   ? 28.347 29.700  84.460  1.00 15.91 ? 2259 HOH A O   1 
HETATM 3194 O O   . HOH C 3 .   ? 26.023 31.825  88.005  1.00 17.95 ? 2260 HOH A O   1 
HETATM 3195 O O   . HOH C 3 .   ? 24.799 33.297  92.796  1.00 37.94 ? 2261 HOH A O   1 
HETATM 3196 O O   . HOH C 3 .   ? 23.615 35.589  91.431  1.00 53.27 ? 2262 HOH A O   1 
HETATM 3197 O O   . HOH C 3 .   ? 17.436 28.640  85.774  1.00 18.77 ? 2263 HOH A O   1 
HETATM 3198 O O   . HOH C 3 .   ? 37.664 -21.788 83.741  1.00 25.44 ? 2264 HOH A O   1 
HETATM 3199 O O   . HOH C 3 .   ? 41.814 -13.634 88.817  1.00 35.77 ? 2265 HOH A O   1 
HETATM 3200 O O   . HOH C 3 .   ? 19.507 26.530  82.300  1.00 25.30 ? 2266 HOH A O   1 
HETATM 3201 O O   . HOH C 3 .   ? 32.594 -25.673 84.867  1.00 54.97 ? 2267 HOH A O   1 
HETATM 3202 O O   . HOH C 3 .   ? 36.351 -23.501 75.741  1.00 37.86 ? 2268 HOH A O   1 
HETATM 3203 O O   . HOH C 3 .   ? 44.213 -13.794 76.255  1.00 36.08 ? 2269 HOH A O   1 
HETATM 3204 O O   . HOH C 3 .   ? 32.144 9.849   77.802  1.00 27.29 ? 2270 HOH A O   1 
HETATM 3205 O O   . HOH C 3 .   ? 40.318 8.843   77.258  1.00 36.07 ? 2271 HOH A O   1 
HETATM 3206 O O   . HOH C 3 .   ? 41.173 10.479  79.021  1.00 47.16 ? 2272 HOH A O   1 
HETATM 3207 O O   . HOH C 3 .   ? 41.469 6.891   80.546  1.00 36.22 ? 2273 HOH A O   1 
HETATM 3208 O O   . HOH C 3 .   ? 38.832 12.816  72.637  1.00 21.37 ? 2274 HOH A O   1 
HETATM 3209 O O   . HOH C 3 .   ? 39.579 10.673  75.516  1.00 38.84 ? 2275 HOH A O   1 
HETATM 3210 O O   . HOH C 3 .   ? 32.388 10.339  67.001  1.00 17.65 ? 2276 HOH A O   1 
HETATM 3211 O O   . HOH C 3 .   ? 36.509 -2.991  61.645  1.00 63.92 ? 2277 HOH A O   1 
HETATM 3212 O O   . HOH C 3 .   ? 32.219 9.928   74.852  1.00 21.16 ? 2278 HOH A O   1 
HETATM 3213 O O   . HOH C 3 .   ? 44.215 5.372   63.508  1.00 40.54 ? 2279 HOH A O   1 
HETATM 3214 O O   . HOH C 3 .   ? 37.065 6.408   71.427  1.00 13.68 ? 2280 HOH A O   1 
HETATM 3215 O O   . HOH C 3 .   ? 36.385 6.939   66.772  1.00 22.97 ? 2281 HOH A O   1 
HETATM 3216 O O   . HOH C 3 .   ? 37.942 6.008   68.899  1.00 24.27 ? 2282 HOH A O   1 
HETATM 3217 O O   . HOH C 3 .   ? 31.270 14.113  61.335  1.00 38.18 ? 2283 HOH A O   1 
HETATM 3218 O O   . HOH C 3 .   ? 27.407 6.051   69.493  1.00 13.65 ? 2284 HOH A O   1 
HETATM 3219 O O   . HOH C 3 .   ? 24.767 5.566   70.208  1.00 20.47 ? 2285 HOH A O   1 
HETATM 3220 O O   . HOH C 3 .   ? 25.116 7.170   77.520  1.00 20.17 ? 2286 HOH A O   1 
HETATM 3221 O O   . HOH C 3 .   ? 24.588 9.800   74.044  1.00 47.50 ? 2287 HOH A O   1 
HETATM 3222 O O   . HOH C 3 .   ? 19.502 18.782  63.904  1.00 36.38 ? 2288 HOH A O   1 
HETATM 3223 O O   . HOH C 3 .   ? 16.704 14.189  68.420  1.00 41.49 ? 2289 HOH A O   1 
HETATM 3224 O O   . HOH C 3 .   ? 15.842 26.448  75.762  1.00 53.43 ? 2290 HOH A O   1 
HETATM 3225 O O   . HOH C 3 .   ? 25.443 31.792  76.442  1.00 63.31 ? 2291 HOH A O   1 
HETATM 3226 O O   . HOH C 3 .   ? 23.548 2.716   64.912  1.00 16.09 ? 2292 HOH A O   1 
HETATM 3227 O O   . HOH C 3 .   ? 28.606 4.521   65.330  1.00 21.11 ? 2293 HOH A O   1 
HETATM 3228 O O   . HOH C 3 .   ? 16.252 28.418  96.811  1.00 39.46 ? 2294 HOH A O   1 
HETATM 3229 O O   . HOH C 3 .   ? 14.817 32.967  91.470  1.00 37.19 ? 2295 HOH A O   1 
HETATM 3230 O O   . HOH C 3 .   ? 14.444 30.609  93.249  1.00 40.74 ? 2296 HOH A O   1 
HETATM 3231 O O   . HOH C 3 .   ? 21.655 -4.930  67.517  1.00 12.96 ? 2297 HOH A O   1 
HETATM 3232 O O   . HOH C 3 .   ? 14.196 27.234  95.647  1.00 40.30 ? 2298 HOH A O   1 
HETATM 3233 O O   . HOH C 3 .   ? 12.100 23.968  94.140  1.00 36.57 ? 2299 HOH A O   1 
HETATM 3234 O O   . HOH C 3 .   ? 20.148 -3.769  64.270  1.00 17.87 ? 2300 HOH A O   1 
HETATM 3235 O O   . HOH C 3 .   ? 22.260 -4.140  60.487  1.00 15.67 ? 2301 HOH A O   1 
HETATM 3236 O O   . HOH C 3 .   ? 17.133 -0.274  71.139  1.00 12.69 ? 2302 HOH A O   1 
HETATM 3237 O O   . HOH C 3 .   ? 15.039 25.793  100.023 1.00 34.61 ? 2303 HOH A O   1 
HETATM 3238 O O   . HOH C 3 .   ? 16.976 18.897  99.490  1.00 33.55 ? 2304 HOH A O   1 
HETATM 3239 O O   . HOH C 3 .   ? 14.464 18.766  98.359  1.00 48.69 ? 2305 HOH A O   1 
HETATM 3240 O O   . HOH C 3 .   ? 25.666 -3.375  58.558  1.00 26.71 ? 2306 HOH A O   1 
HETATM 3241 O O   . HOH C 3 .   ? 29.927 -1.679  60.010  1.00 31.33 ? 2307 HOH A O   1 
HETATM 3242 O O   . HOH C 3 .   ? 32.090 -1.499  61.849  1.00 27.96 ? 2308 HOH A O   1 
HETATM 3243 O O   . HOH C 3 .   ? 26.373 16.173  104.525 1.00 33.45 ? 2309 HOH A O   1 
HETATM 3244 O O   . HOH C 3 .   ? 27.212 -6.531  59.669  1.00 35.39 ? 2310 HOH A O   1 
HETATM 3245 O O   . HOH C 3 .   ? 22.966 -6.838  60.237  1.00 33.05 ? 2311 HOH A O   1 
HETATM 3246 O O   . HOH C 3 .   ? 25.855 -9.104  62.348  1.00 37.19 ? 2312 HOH A O   1 
HETATM 3247 O O   . HOH C 3 .   ? 20.792 -7.920  64.463  1.00 29.91 ? 2313 HOH A O   1 
HETATM 3248 O O   . HOH C 3 .   ? 29.932 -9.177  64.283  1.00 28.37 ? 2314 HOH A O   1 
HETATM 3249 O O   . HOH C 3 .   ? 21.961 -13.681 63.411  1.00 39.89 ? 2315 HOH A O   1 
HETATM 3250 O O   . HOH C 3 .   ? 26.615 -14.229 68.482  1.00 19.38 ? 2316 HOH A O   1 
HETATM 3251 O O   . HOH C 3 .   ? 29.697 -15.483 65.050  1.00 46.48 ? 2317 HOH A O   1 
HETATM 3252 O O   . HOH C 3 .   ? 31.787 -9.924  66.091  1.00 14.79 ? 2318 HOH A O   1 
HETATM 3253 O O   . HOH C 3 .   ? 37.189 -11.780 68.453  1.00 38.84 ? 2319 HOH A O   1 
HETATM 3254 O O   . HOH C 3 .   ? 32.459 -15.337 63.995  1.00 49.26 ? 2320 HOH A O   1 
HETATM 3255 O O   . HOH C 3 .   ? 33.185 -16.893 66.341  1.00 33.09 ? 2321 HOH A O   1 
HETATM 3256 O O   . HOH C 3 .   ? 30.101 -16.874 67.666  1.00 28.91 ? 2322 HOH A O   1 
HETATM 3257 O O   . HOH C 3 .   ? 31.691 -19.487 73.018  1.00 28.36 ? 2323 HOH A O   1 
HETATM 3258 O O   . HOH C 3 .   ? 26.225 -17.056 68.924  1.00 20.27 ? 2324 HOH A O   1 
HETATM 3259 O O   . HOH C 3 .   ? 37.252 -12.989 73.501  1.00 37.18 ? 2325 HOH A O   1 
HETATM 3260 O O   . HOH C 3 .   ? 37.319 -10.942 71.066  1.00 36.66 ? 2326 HOH A O   1 
HETATM 3261 O O   . HOH C 3 .   ? 32.702 -5.924  64.624  1.00 37.73 ? 2327 HOH A O   1 
HETATM 3262 O O   . HOH C 3 .   ? 35.916 -19.136 76.604  1.00 20.76 ? 2328 HOH A O   1 
HETATM 3263 O O   . HOH C 3 .   ? 37.235 -15.748 73.530  1.00 38.04 ? 2329 HOH A O   1 
HETATM 3264 O O   . HOH C 3 .   ? 33.667 -18.969 71.305  1.00 29.04 ? 2330 HOH A O   1 
HETATM 3265 O O   . HOH C 3 .   ? 37.924 -19.542 71.510  1.00 36.13 ? 2331 HOH A O   1 
HETATM 3266 O O   . HOH C 3 .   ? 36.178 -3.507  70.735  1.00 25.14 ? 2332 HOH A O   1 
HETATM 3267 O O   . HOH C 3 .   ? 37.841 -6.331  89.788  1.00 30.91 ? 2333 HOH A O   1 
HETATM 3268 O O   . HOH C 3 .   ? 32.891 -7.419  94.585  1.00 22.11 ? 2334 HOH A O   1 
HETATM 3269 O O   . HOH C 3 .   ? 37.412 -12.689 92.088  1.00 30.84 ? 2335 HOH A O   1 
HETATM 3270 O O   . HOH C 3 .   ? 36.182 -10.226 94.785  1.00 28.17 ? 2336 HOH A O   1 
HETATM 3271 O O   . HOH C 3 .   ? 26.981 -3.685  95.902  1.00 28.10 ? 2337 HOH A O   1 
HETATM 3272 O O   . HOH C 3 .   ? 30.595 -7.256  96.536  1.00 25.65 ? 2338 HOH A O   1 
HETATM 3273 O O   . HOH C 3 .   ? 28.621 -8.761  93.319  1.00 22.15 ? 2339 HOH A O   1 
HETATM 3274 O O   . HOH C 3 .   ? 36.438 -4.671  99.544  1.00 22.80 ? 2340 HOH A O   1 
HETATM 3275 O O   . HOH C 3 .   ? 27.356 -4.047  99.606  1.00 29.63 ? 2341 HOH A O   1 
HETATM 3276 O O   . HOH C 3 .   ? 23.485 4.652   86.840  1.00 11.99 ? 2342 HOH A O   1 
HETATM 3277 O O   . HOH C 3 .   ? 22.180 -2.481  85.781  1.00 10.64 ? 2343 HOH A O   1 
HETATM 3278 O O   . HOH C 3 .   ? 18.100 -1.213  84.019  1.00 13.21 ? 2344 HOH A O   1 
HETATM 3279 O O   . HOH C 3 .   ? 17.907 -0.657  87.641  1.00 17.13 ? 2345 HOH A O   1 
HETATM 3280 O O   . HOH C 3 .   ? 19.357 -2.539  86.326  1.00 14.69 ? 2346 HOH A O   1 
HETATM 3281 O O   . HOH C 3 .   ? 19.586 -0.378  81.818  1.00 14.32 ? 2347 HOH A O   1 
HETATM 3282 O O   . HOH C 3 .   ? 19.796 6.024   80.763  1.00 15.74 ? 2348 HOH A O   1 
HETATM 3283 O O   . HOH C 3 .   ? 21.787 6.066   84.569  1.00 25.77 ? 2349 HOH A O   1 
HETATM 3284 O O   . HOH C 3 .   ? 22.164 6.933   79.502  1.00 27.61 ? 2350 HOH A O   1 
HETATM 3285 O O   . HOH C 3 .   ? 41.658 4.255   78.328  1.00 37.05 ? 2351 HOH A O   1 
HETATM 3286 O O   . HOH C 3 .   ? 39.030 7.506   73.034  1.00 25.41 ? 2352 HOH A O   1 
HETATM 3287 O O   . HOH C 3 .   ? 41.082 6.109   74.097  1.00 37.54 ? 2353 HOH A O   1 
HETATM 3288 O O   . HOH C 3 .   ? 44.527 1.055   69.134  1.00 35.35 ? 2354 HOH A O   1 
HETATM 3289 O O   . HOH C 3 .   ? 42.176 4.233   67.598  1.00 31.97 ? 2355 HOH A O   1 
HETATM 3290 O O   . HOH C 3 .   ? 43.328 -3.517  71.386  1.00 24.57 ? 2356 HOH A O   1 
HETATM 3291 O O   . HOH C 3 .   ? 26.999 10.375  81.374  1.00 31.69 ? 2357 HOH A O   1 
HETATM 3292 O O   . HOH C 3 .   ? 30.052 8.778   83.536  1.00 16.25 ? 2358 HOH A O   1 
HETATM 3293 O O   . HOH C 3 .   ? 29.708 9.884   78.728  1.00 36.39 ? 2359 HOH A O   1 
HETATM 3294 O O   . HOH C 3 .   ? 21.135 10.061  81.260  1.00 30.46 ? 2360 HOH A O   1 
HETATM 3295 O O   . HOH C 3 .   ? 17.050 7.596   97.308  1.00 27.98 ? 2361 HOH A O   1 
HETATM 3296 O O   . HOH C 3 .   ? 21.594 6.677   99.276  1.00 25.55 ? 2362 HOH A O   1 
HETATM 3297 O O   . HOH C 3 .   ? 24.310 6.310   99.993  1.00 14.08 ? 2363 HOH A O   1 
HETATM 3298 O O   . HOH C 3 .   ? 31.915 4.163   104.576 1.00 30.20 ? 2364 HOH A O   1 
HETATM 3299 O O   . HOH C 3 .   ? 32.434 1.274   104.318 1.00 21.32 ? 2365 HOH A O   1 
HETATM 3300 O O   . HOH C 3 .   ? 25.546 -3.097  97.622  1.00 20.85 ? 2366 HOH A O   1 
HETATM 3301 O O   . HOH C 3 .   ? 25.913 -5.171  101.525 1.00 32.10 ? 2367 HOH A O   1 
HETATM 3302 O O   . HOH C 3 .   ? 23.102 -4.189  97.763  1.00 35.57 ? 2368 HOH A O   1 
HETATM 3303 O O   . HOH C 3 .   ? 19.039 -6.164  103.189 1.00 39.09 ? 2369 HOH A O   1 
HETATM 3304 O O   . HOH C 3 .   ? 18.962 1.012   102.176 1.00 20.87 ? 2370 HOH A O   1 
HETATM 3305 O O   . HOH C 3 .   ? 16.656 -4.796  106.383 1.00 39.70 ? 2371 HOH A O   1 
HETATM 3306 O O   . HOH C 3 .   ? 11.420 -4.921  103.772 1.00 33.37 ? 2372 HOH A O   1 
HETATM 3307 O O   . HOH C 3 .   ? 19.168 -9.256  105.988 1.00 43.49 ? 2373 HOH A O   1 
HETATM 3308 O O   . HOH C 3 .   ? 14.528 3.399   98.100  1.00 16.71 ? 2374 HOH A O   1 
HETATM 3309 O O   . HOH C 3 .   ? 17.898 2.671   100.247 1.00 15.65 ? 2375 HOH A O   1 
HETATM 3310 O O   . HOH C 3 .   ? 10.602 -0.968  91.923  1.00 19.18 ? 2376 HOH A O   1 
HETATM 3311 O O   . HOH C 3 .   ? 11.262 -1.847  94.397  1.00 24.53 ? 2377 HOH A O   1 
HETATM 3312 O O   . HOH C 3 .   ? 9.446  2.027   94.907  1.00 41.74 ? 2378 HOH A O   1 
HETATM 3313 O O   . HOH C 3 .   ? 11.792 -5.238  101.302 1.00 44.45 ? 2379 HOH A O   1 
HETATM 3314 O O   . HOH C 3 .   ? 11.849 4.014   96.671  1.00 21.93 ? 2380 HOH A O   1 
HETATM 3315 O O   . HOH C 3 .   ? 14.098 7.781   94.428  1.00 40.80 ? 2381 HOH A O   1 
HETATM 3316 O O   . HOH C 3 .   ? 10.310 4.159   93.100  1.00 24.25 ? 2382 HOH A O   1 
HETATM 3317 O O   . HOH C 3 .   ? 13.033 6.636   87.896  1.00 47.27 ? 2383 HOH A O   1 
HETATM 3318 O O   . HOH C 3 .   ? 10.359 6.165   87.391  1.00 56.01 ? 2384 HOH A O   1 
HETATM 3319 O O   . HOH C 3 .   ? 15.170 -7.464  77.399  1.00 9.30  ? 2385 HOH A O   1 
HETATM 3320 O O   . HOH C 3 .   ? 15.113 -7.686  81.975  1.00 12.62 ? 2386 HOH A O   1 
HETATM 3321 O O   . HOH C 3 .   ? 14.920 -2.913  72.815  1.00 13.42 ? 2387 HOH A O   1 
HETATM 3322 O O   . HOH C 3 .   ? 11.600 -3.632  73.533  1.00 21.66 ? 2388 HOH A O   1 
HETATM 3323 O O   . HOH C 3 .   ? 18.234 -5.060  86.475  1.00 11.06 ? 2389 HOH A O   1 
HETATM 3324 O O   . HOH C 3 .   ? 13.396 -12.175 91.429  1.00 19.47 ? 2390 HOH A O   1 
HETATM 3325 O O   . HOH C 3 .   ? 17.973 -8.178  93.982  1.00 14.10 ? 2391 HOH A O   1 
HETATM 3326 O O   . HOH C 3 .   ? 4.846  -7.485  93.843  1.00 48.29 ? 2392 HOH A O   1 
HETATM 3327 O O   . HOH C 3 .   ? 8.318  -1.012  97.087  1.00 30.23 ? 2393 HOH A O   1 
HETATM 3328 O O   . HOH C 3 .   ? 8.441  -2.837  98.588  1.00 27.77 ? 2394 HOH A O   1 
HETATM 3329 O O   . HOH C 3 .   ? 8.058  -0.161  92.183  1.00 27.62 ? 2395 HOH A O   1 
HETATM 3330 O O   . HOH C 3 .   ? 10.635 -11.717 91.346  1.00 37.99 ? 2396 HOH A O   1 
HETATM 3331 O O   . HOH C 3 .   ? 10.891 -6.762  99.369  1.00 23.20 ? 2397 HOH A O   1 
HETATM 3332 O O   . HOH C 3 .   ? 14.698 -8.846  96.081  1.00 32.28 ? 2398 HOH A O   1 
HETATM 3333 O O   . HOH C 3 .   ? 14.571 -7.624  100.158 1.00 48.02 ? 2399 HOH A O   1 
HETATM 3334 O O   . HOH C 3 .   ? 17.050 -7.661  98.836  1.00 45.11 ? 2400 HOH A O   1 
HETATM 3335 O O   . HOH C 3 .   ? 17.267 -9.179  96.611  1.00 33.41 ? 2401 HOH A O   1 
HETATM 3336 O O   . HOH C 3 .   ? 23.729 -7.764  99.282  1.00 49.31 ? 2402 HOH A O   1 
HETATM 3337 O O   . HOH C 3 .   ? 13.559 -14.565 71.764  1.00 21.09 ? 2403 HOH A O   1 
HETATM 3338 O O   . HOH C 3 .   ? 15.269 -15.707 69.921  1.00 23.76 ? 2404 HOH A O   1 
HETATM 3339 O O   . HOH C 3 .   ? 20.614 -13.662 66.211  1.00 20.45 ? 2405 HOH A O   1 
HETATM 3340 O O   . HOH C 3 .   ? 19.869 -10.365 64.985  1.00 25.55 ? 2406 HOH A O   1 
HETATM 3341 O O   . HOH C 3 .   ? 19.121 -5.915  65.499  1.00 24.57 ? 2407 HOH A O   1 
HETATM 3342 O O   . HOH C 3 .   ? 17.989 -14.802 65.937  1.00 18.95 ? 2408 HOH A O   1 
HETATM 3343 O O   . HOH C 3 .   ? 13.930 -11.812 72.247  1.00 18.00 ? 2409 HOH A O   1 
HETATM 3344 O O   . HOH C 3 .   ? 13.276 -14.586 74.710  1.00 21.76 ? 2410 HOH A O   1 
HETATM 3345 O O   . HOH C 3 .   ? 10.679 -12.609 75.756  1.00 39.35 ? 2411 HOH A O   1 
HETATM 3346 O O   . HOH C 3 .   ? 11.108 -10.897 73.578  1.00 17.35 ? 2412 HOH A O   1 
HETATM 3347 O O   . HOH C 3 .   ? 11.332 -3.922  70.709  1.00 25.59 ? 2413 HOH A O   1 
HETATM 3348 O O   . HOH C 3 .   ? 5.190  -5.694  70.640  1.00 42.72 ? 2414 HOH A O   1 
HETATM 3349 O O   . HOH C 3 .   ? 6.847  1.396   70.004  1.00 24.48 ? 2415 HOH A O   1 
HETATM 3350 O O   . HOH C 3 .   ? 8.096  2.251   73.545  1.00 19.71 ? 2416 HOH A O   1 
HETATM 3351 O O   . HOH C 3 .   ? 5.902  -3.869  66.199  1.00 28.85 ? 2417 HOH A O   1 
HETATM 3352 O O   . HOH C 3 .   ? 0.200  -2.223  66.866  1.00 46.36 ? 2418 HOH A O   1 
HETATM 3353 O O   . HOH C 3 .   ? 6.815  4.024   75.141  1.00 32.86 ? 2419 HOH A O   1 
HETATM 3354 O O   . HOH C 3 .   ? 2.289  0.364   70.617  1.00 31.58 ? 2420 HOH A O   1 
HETATM 3355 O O   . HOH C 3 .   ? 4.030  0.883   79.012  1.00 29.48 ? 2421 HOH A O   1 
HETATM 3356 O O   . HOH C 3 .   ? 3.212  -5.218  83.010  1.00 36.36 ? 2422 HOH A O   1 
HETATM 3357 O O   . HOH C 3 .   ? 7.513  2.051   82.618  1.00 33.39 ? 2423 HOH A O   1 
HETATM 3358 O O   . HOH C 3 .   ? 3.850  -8.880  76.554  1.00 19.89 ? 2424 HOH A O   1 
HETATM 3359 O O   . HOH C 3 .   ? 3.431  -11.825 82.749  1.00 28.00 ? 2425 HOH A O   1 
HETATM 3360 O O   . HOH C 3 .   ? 3.810  -12.958 79.220  1.00 49.14 ? 2426 HOH A O   1 
HETATM 3361 O O   . HOH C 3 .   ? 0.499  -6.006  82.829  1.00 38.86 ? 2427 HOH A O   1 
HETATM 3362 O O   . HOH C 3 .   ? 9.293  -14.211 77.737  1.00 36.67 ? 2428 HOH A O   1 
HETATM 3363 O O   . HOH C 3 .   ? 11.238 -14.600 82.198  1.00 28.23 ? 2429 HOH A O   1 
HETATM 3364 O O   . HOH C 3 .   ? 9.521  -10.876 70.981  1.00 39.49 ? 2430 HOH A O   1 
HETATM 3365 O O   . HOH C 3 .   ? 11.436 -13.979 85.613  1.00 30.55 ? 2431 HOH A O   1 
HETATM 3366 O O   . HOH C 3 .   ? 8.999  -14.528 87.322  1.00 31.78 ? 2432 HOH A O   1 
HETATM 3367 O O   . HOH C 3 .   ? 4.626  -14.451 86.730  1.00 28.41 ? 2433 HOH A O   1 
HETATM 3368 O O   . HOH C 3 .   ? 6.574  -17.631 86.043  1.00 40.25 ? 2434 HOH A O   1 
HETATM 3369 O O   . HOH C 3 .   ? 6.577  -14.475 77.392  1.00 28.85 ? 2435 HOH A O   1 
HETATM 3370 O O   . HOH C 3 .   ? 6.330  -21.387 75.761  1.00 33.73 ? 2436 HOH A O   1 
HETATM 3371 O O   . HOH C 3 .   ? 15.270 -22.294 76.545  1.00 41.80 ? 2437 HOH A O   1 
HETATM 3372 O O   . HOH C 3 .   ? 10.442 -20.524 76.397  1.00 43.97 ? 2438 HOH A O   1 
HETATM 3373 O O   . HOH C 3 .   ? 15.665 -21.435 73.752  1.00 26.93 ? 2439 HOH A O   1 
HETATM 3374 O O   . HOH C 3 .   ? 14.638 -20.428 69.895  1.00 41.40 ? 2440 HOH A O   1 
HETATM 3375 O O   . HOH C 3 .   ? 18.431 -22.373 71.025  1.00 45.29 ? 2441 HOH A O   1 
HETATM 3376 O O   . HOH C 3 .   ? 21.119 -22.510 70.594  1.00 43.14 ? 2442 HOH A O   1 
HETATM 3377 O O   . HOH C 3 .   ? 20.145 -19.116 64.990  1.00 31.00 ? 2443 HOH A O   1 
HETATM 3378 O O   . HOH C 3 .   ? 16.776 -19.278 66.535  1.00 38.08 ? 2444 HOH A O   1 
HETATM 3379 O O   . HOH C 3 .   ? 24.950 -23.786 66.411  1.00 55.59 ? 2445 HOH A O   1 
HETATM 3380 O O   . HOH C 3 .   ? 20.429 -23.216 60.997  1.00 44.65 ? 2446 HOH A O   1 
HETATM 3381 O O   . HOH C 3 .   ? 24.727 -24.226 69.537  1.00 40.46 ? 2447 HOH A O   1 
HETATM 3382 O O   . HOH C 3 .   ? 27.479 -25.398 71.746  1.00 26.46 ? 2448 HOH A O   1 
HETATM 3383 O O   . HOH C 3 .   ? 29.180 -24.571 74.243  1.00 24.78 ? 2449 HOH A O   1 
HETATM 3384 O O   . HOH C 3 .   ? 23.141 -25.203 77.546  1.00 25.07 ? 2450 HOH A O   1 
HETATM 3385 O O   . HOH C 3 .   ? 22.434 -26.913 75.314  1.00 43.20 ? 2451 HOH A O   1 
HETATM 3386 O O   . HOH C 3 .   ? 25.845 -26.687 79.061  1.00 41.16 ? 2452 HOH A O   1 
HETATM 3387 O O   . HOH C 3 .   ? 22.880 -26.638 72.717  1.00 54.30 ? 2453 HOH A O   1 
HETATM 3388 O O   . HOH C 3 .   ? 30.233 -27.407 77.646  1.00 39.60 ? 2454 HOH A O   1 
HETATM 3389 O O   . HOH C 3 .   ? 27.981 -25.050 79.947  1.00 32.85 ? 2455 HOH A O   1 
HETATM 3390 O O   . HOH C 3 .   ? 33.268 -25.707 76.772  1.00 34.64 ? 2456 HOH A O   1 
HETATM 3391 O O   . HOH C 3 .   ? 32.281 -21.741 75.464  1.00 28.55 ? 2457 HOH A O   1 
HETATM 3392 O O   . HOH C 3 .   ? 31.403 -23.125 73.292  1.00 53.24 ? 2458 HOH A O   1 
HETATM 3393 O O   . HOH C 3 .   ? 18.547 -25.513 74.261  1.00 46.40 ? 2459 HOH A O   1 
HETATM 3394 O O   . HOH C 3 .   ? 21.558 -24.834 81.443  1.00 35.81 ? 2460 HOH A O   1 
HETATM 3395 O O   . HOH C 3 .   ? 23.186 -24.460 84.934  1.00 33.74 ? 2461 HOH A O   1 
HETATM 3396 O O   . HOH C 3 .   ? 26.583 -23.823 85.488  1.00 29.04 ? 2462 HOH A O   1 
HETATM 3397 O O   . HOH C 3 .   ? 16.974 -19.495 84.336  1.00 30.55 ? 2463 HOH A O   1 
HETATM 3398 O O   . HOH C 3 .   ? 20.151 -26.044 76.331  1.00 65.29 ? 2464 HOH A O   1 
HETATM 3399 O O   . HOH C 3 .   ? 20.658 -20.522 88.260  1.00 36.94 ? 2465 HOH A O   1 
HETATM 3400 O O   . HOH C 3 .   ? 24.809 -24.236 87.407  1.00 53.18 ? 2466 HOH A O   1 
HETATM 3401 O O   . HOH C 3 .   ? 23.303 -22.928 89.093  1.00 47.30 ? 2467 HOH A O   1 
HETATM 3402 O O   . HOH C 3 .   ? 13.568 -15.461 83.991  1.00 44.32 ? 2468 HOH A O   1 
HETATM 3403 O O   . HOH C 3 .   ? 14.598 -17.696 85.723  1.00 24.52 ? 2469 HOH A O   1 
HETATM 3404 O O   . HOH C 3 .   ? 13.906 -20.517 88.941  1.00 31.89 ? 2470 HOH A O   1 
HETATM 3405 O O   . HOH C 3 .   ? 16.957 -23.101 87.559  1.00 50.93 ? 2471 HOH A O   1 
HETATM 3406 O O   . HOH C 3 .   ? 13.954 -21.978 91.723  1.00 35.68 ? 2472 HOH A O   1 
HETATM 3407 O O   . HOH C 3 .   ? 13.787 -21.521 95.697  1.00 47.81 ? 2473 HOH A O   1 
HETATM 3408 O O   . HOH C 3 .   ? 14.144 -15.187 94.776  1.00 26.75 ? 2474 HOH A O   1 
HETATM 3409 O O   . HOH C 3 .   ? 18.021 -22.672 96.199  1.00 41.70 ? 2475 HOH A O   1 
HETATM 3410 O O   . HOH C 3 .   ? 23.377 -12.027 91.447  1.00 24.98 ? 2476 HOH A O   1 
HETATM 3411 O O   . HOH C 3 .   ? 27.458 -16.378 92.592  1.00 24.20 ? 2477 HOH A O   1 
HETATM 3412 O O   . HOH C 3 .   ? 28.300 -20.050 95.044  1.00 33.61 ? 2478 HOH A O   1 
HETATM 3413 O O   . HOH C 3 .   ? 32.208 -11.549 94.677  1.00 33.16 ? 2479 HOH A O   1 
HETATM 3414 O O   . HOH C 3 .   ? 32.560 -20.519 92.195  1.00 43.60 ? 2480 HOH A O   1 
HETATM 3415 O O   . HOH C 3 .   ? 30.321 -21.609 87.614  1.00 27.16 ? 2481 HOH A O   1 
HETATM 3416 O O   . HOH C 3 .   ? 35.982 -19.757 83.210  1.00 18.02 ? 2482 HOH A O   1 
HETATM 3417 O O   . HOH C 3 .   ? 38.799 -18.378 85.792  1.00 32.18 ? 2483 HOH A O   1 
HETATM 3418 O O   . HOH C 3 .   ? 38.672 -17.874 82.968  1.00 18.44 ? 2484 HOH A O   1 
HETATM 3419 O O   . HOH C 3 .   ? 40.333 -11.496 88.163  1.00 23.24 ? 2485 HOH A O   1 
HETATM 3420 O O   . HOH C 3 .   ? 35.458 -23.836 82.889  1.00 28.70 ? 2486 HOH A O   1 
HETATM 3421 O O   . HOH C 3 .   ? 34.614 -21.401 91.252  1.00 44.97 ? 2487 HOH A O   1 
HETATM 3422 O O   . HOH C 3 .   ? 30.651 -24.065 83.838  1.00 21.46 ? 2488 HOH A O   1 
HETATM 3423 O O   . HOH C 3 .   ? 34.861 -23.906 77.862  1.00 29.39 ? 2489 HOH A O   1 
HETATM 3424 O O   . HOH C 3 .   ? 39.979 -21.824 82.293  1.00 34.68 ? 2490 HOH A O   1 
HETATM 3425 O O   . HOH C 3 .   ? 43.214 -17.847 76.621  1.00 39.31 ? 2491 HOH A O   1 
HETATM 3426 O O   . HOH C 3 .   ? 41.504 -13.339 77.572  1.00 41.35 ? 2492 HOH A O   1 
HETATM 3427 O O   . HOH C 3 .   ? 47.630 -12.588 82.504  1.00 40.81 ? 2493 HOH A O   1 
HETATM 3428 O O   . HOH C 3 .   ? 47.847 -17.034 81.073  1.00 38.38 ? 2494 HOH A O   1 
HETATM 3429 O O   . HOH C 3 .   ? 47.351 -15.717 78.781  1.00 48.75 ? 2495 HOH A O   1 
HETATM 3430 O O   . HOH C 3 .   ? 41.709 -9.280  87.403  1.00 53.68 ? 2496 HOH A O   1 
HETATM 3431 O O   . HOH C 3 .   ? 45.023 -1.328  83.385  1.00 35.59 ? 2497 HOH A O   1 
HETATM 3432 O O   . HOH C 3 .   ? 43.014 0.406   88.349  1.00 34.34 ? 2498 HOH A O   1 
HETATM 3433 O O   . HOH C 3 .   ? 45.302 -3.608  73.164  1.00 35.77 ? 2499 HOH A O   1 
HETATM 3434 O O   . HOH C 3 .   ? 42.966 2.675   81.788  1.00 47.03 ? 2500 HOH A O   1 
HETATM 3435 O O   . HOH C 3 .   ? 47.114 -5.837  72.614  1.00 43.21 ? 2501 HOH A O   1 
HETATM 3436 O O   . HOH C 3 .   ? 45.096 -11.042 72.567  1.00 26.92 ? 2502 HOH A O   1 
HETATM 3437 O O   . HOH C 3 .   ? 39.728 -10.483 72.128  1.00 45.03 ? 2503 HOH A O   1 
HETATM 3438 O O   . HOH C 3 .   ? 36.692 -6.225  63.472  1.00 57.31 ? 2504 HOH A O   1 
HETATM 3439 O O   . HOH C 3 .   ? 38.055 -10.316 65.882  1.00 58.75 ? 2505 HOH A O   1 
HETATM 3440 O O   . HOH C 3 .   ? 38.768 -3.391  64.064  1.00 27.92 ? 2506 HOH A O   1 
HETATM 3441 O O   . HOH C 3 .   ? 36.817 -0.044  62.387  1.00 34.16 ? 2507 HOH A O   1 
HETATM 3442 O O   . HOH C 3 .   ? 40.564 1.120   63.529  1.00 46.08 ? 2508 HOH A O   1 
HETATM 3443 O O   . HOH C 3 .   ? 39.460 4.422   67.564  1.00 24.58 ? 2509 HOH A O   1 
HETATM 3444 O O   . HOH C 3 .   ? 33.792 2.669   63.253  1.00 21.37 ? 2510 HOH A O   1 
HETATM 3445 O O   . HOH C 3 .   ? 34.491 5.611   64.313  1.00 41.83 ? 2511 HOH A O   1 
HETATM 3446 O O   . HOH C 3 .   ? 41.252 3.783   63.106  1.00 41.30 ? 2512 HOH A O   1 
HETATM 3447 O O   . HOH C 3 .   ? 37.573 9.836   66.050  1.00 23.67 ? 2513 HOH A O   1 
HETATM 3448 O O   . HOH C 3 .   ? 39.318 16.252  66.000  1.00 21.58 ? 2514 HOH A O   1 
HETATM 3449 O O   . HOH C 3 .   ? 34.662 18.658  66.422  1.00 36.54 ? 2515 HOH A O   1 
HETATM 3450 O O   . HOH C 3 .   ? 33.000 15.492  63.356  1.00 28.02 ? 2516 HOH A O   1 
HETATM 3451 O O   . HOH C 3 .   ? 33.833 12.555  60.479  1.00 43.31 ? 2517 HOH A O   1 
HETATM 3452 O O   . HOH C 3 .   ? 28.862 14.723  63.338  1.00 30.99 ? 2518 HOH A O   1 
HETATM 3453 O O   . HOH C 3 .   ? 31.317 17.705  64.501  1.00 33.47 ? 2519 HOH A O   1 
HETATM 3454 O O   . HOH C 3 .   ? 27.828 10.577  61.256  1.00 36.24 ? 2520 HOH A O   1 
HETATM 3455 O O   . HOH C 3 .   ? 26.482 6.284   64.804  1.00 33.27 ? 2521 HOH A O   1 
HETATM 3456 O O   . HOH C 3 .   ? 24.702 7.419   66.402  1.00 29.48 ? 2522 HOH A O   1 
HETATM 3457 O O   . HOH C 3 .   ? 26.479 13.470  63.522  1.00 32.26 ? 2523 HOH A O   1 
HETATM 3458 O O   . HOH C 3 .   ? 23.565 9.716   69.450  1.00 22.94 ? 2524 HOH A O   1 
HETATM 3459 O O   . HOH C 3 .   ? 24.096 9.194   62.872  1.00 28.17 ? 2525 HOH A O   1 
HETATM 3460 O O   . HOH C 3 .   ? 20.587 6.668   67.672  1.00 25.36 ? 2526 HOH A O   1 
HETATM 3461 O O   . HOH C 3 .   ? 18.860 10.589  67.500  1.00 37.01 ? 2527 HOH A O   1 
HETATM 3462 O O   . HOH C 3 .   ? 21.146 12.484  63.336  1.00 25.31 ? 2528 HOH A O   1 
HETATM 3463 O O   . HOH C 3 .   ? 18.407 16.414  64.522  1.00 47.70 ? 2529 HOH A O   1 
HETATM 3464 O O   . HOH C 3 .   ? 18.497 13.085  66.698  1.00 24.53 ? 2530 HOH A O   1 
HETATM 3465 O O   . HOH C 3 .   ? 20.971 16.263  60.384  1.00 37.45 ? 2531 HOH A O   1 
HETATM 3466 O O   . HOH C 3 .   ? 21.885 19.720  65.012  1.00 36.94 ? 2532 HOH A O   1 
HETATM 3467 O O   . HOH C 3 .   ? 18.529 9.168   69.883  1.00 34.83 ? 2533 HOH A O   1 
HETATM 3468 O O   . HOH C 3 .   ? 17.112 17.085  69.174  1.00 41.51 ? 2534 HOH A O   1 
HETATM 3469 O O   . HOH C 3 .   ? 18.140 19.241  71.536  1.00 52.70 ? 2535 HOH A O   1 
HETATM 3470 O O   . HOH C 3 .   ? 20.236 23.330  65.893  1.00 35.56 ? 2536 HOH A O   1 
HETATM 3471 O O   . HOH C 3 .   ? 19.711 25.997  66.900  1.00 36.60 ? 2537 HOH A O   1 
HETATM 3472 O O   . HOH C 3 .   ? 25.252 20.834  65.800  1.00 35.79 ? 2538 HOH A O   1 
HETATM 3473 O O   . HOH C 3 .   ? 17.903 27.559  72.820  1.00 30.35 ? 2539 HOH A O   1 
HETATM 3474 O O   . HOH C 3 .   ? 18.348 25.563  77.038  1.00 39.30 ? 2540 HOH A O   1 
HETATM 3475 O O   . HOH C 3 .   ? 16.722 33.593  76.785  1.00 47.43 ? 2541 HOH A O   1 
HETATM 3476 O O   . HOH C 3 .   ? 22.194 32.257  77.149  1.00 39.47 ? 2542 HOH A O   1 
HETATM 3477 O O   . HOH C 3 .   ? 16.521 28.083  77.735  1.00 57.67 ? 2543 HOH A O   1 
HETATM 3478 O O   . HOH C 3 .   ? 24.336 29.604  75.259  1.00 32.24 ? 2544 HOH A O   1 
HETATM 3479 O O   . HOH C 3 .   ? 26.166 30.537  78.752  1.00 46.28 ? 2545 HOH A O   1 
HETATM 3480 O O   . HOH C 3 .   ? 13.636 32.318  84.621  1.00 42.51 ? 2546 HOH A O   1 
HETATM 3481 O O   . HOH C 3 .   ? 22.753 33.169  80.212  1.00 34.23 ? 2547 HOH A O   1 
HETATM 3482 O O   . HOH C 3 .   ? 20.605 35.422  82.337  1.00 38.94 ? 2548 HOH A O   1 
HETATM 3483 O O   . HOH C 3 .   ? 24.405 34.884  84.781  1.00 38.05 ? 2549 HOH A O   1 
HETATM 3484 O O   . HOH C 3 .   ? 20.839 34.848  93.608  1.00 30.39 ? 2550 HOH A O   1 
HETATM 3485 O O   . HOH C 3 .   ? 18.486 29.275  95.549  1.00 22.28 ? 2551 HOH A O   1 
HETATM 3486 O O   . HOH C 3 .   ? 16.429 32.607  93.473  1.00 43.13 ? 2552 HOH A O   1 
HETATM 3487 O O   . HOH C 3 .   ? 20.137 30.646  97.137  1.00 29.51 ? 2553 HOH A O   1 
HETATM 3488 O O   . HOH C 3 .   ? 23.813 29.904  98.018  1.00 32.38 ? 2554 HOH A O   1 
HETATM 3489 O O   . HOH C 3 .   ? 26.379 30.947  94.595  1.00 37.94 ? 2555 HOH A O   1 
HETATM 3490 O O   . HOH C 3 .   ? 15.124 27.982  93.281  1.00 18.15 ? 2556 HOH A O   1 
HETATM 3491 O O   . HOH C 3 .   ? 13.062 24.338  91.635  1.00 21.35 ? 2557 HOH A O   1 
HETATM 3492 O O   . HOH C 3 .   ? 17.079 26.372  97.945  1.00 29.20 ? 2558 HOH A O   1 
HETATM 3493 O O   . HOH C 3 .   ? 21.977 22.399  101.907 1.00 35.14 ? 2559 HOH A O   1 
HETATM 3494 O O   . HOH C 3 .   ? 19.478 17.861  98.753  1.00 18.70 ? 2560 HOH A O   1 
HETATM 3495 O O   . HOH C 3 .   ? 23.277 19.286  98.660  1.00 12.36 ? 2561 HOH A O   1 
HETATM 3496 O O   . HOH C 3 .   ? 13.245 20.927  96.658  1.00 35.79 ? 2562 HOH A O   1 
HETATM 3497 O O   . HOH C 3 .   ? 13.420 24.967  96.361  1.00 34.46 ? 2563 HOH A O   1 
HETATM 3498 O O   . HOH C 3 .   ? 30.280 17.379  98.497  1.00 20.12 ? 2564 HOH A O   1 
HETATM 3499 O O   . HOH C 3 .   ? 25.351 17.520  102.282 1.00 25.58 ? 2565 HOH A O   1 
HETATM 3500 O O   . HOH C 3 .   ? 29.096 15.080  99.215  1.00 21.29 ? 2566 HOH A O   1 
HETATM 3501 O O   . HOH C 3 .   ? 30.363 23.458  93.624  1.00 18.40 ? 2567 HOH A O   1 
HETATM 3502 O O   . HOH D 3 .   ? 8.654  -13.797 63.273  1.00 14.68 ? 2001 HOH I O   1 
HETATM 3503 O O   . HOH D 3 .   ? 14.128 -16.210 64.561  1.00 20.28 ? 2002 HOH I O   1 
HETATM 3504 O O   . HOH D 3 .   ? 16.143 -13.952 64.167  1.00 15.34 ? 2003 HOH I O   1 
HETATM 3505 O O   . HOH D 3 .   ? 14.810 -17.275 67.231  1.00 41.37 ? 2004 HOH I O   1 
HETATM 3506 O O   . HOH D 3 .   ? 19.790 -4.458  61.451  1.00 16.54 ? 2005 HOH I O   1 
HETATM 3507 O O   . HOH D 3 .   ? 7.564  -6.075  65.976  1.00 20.43 ? 2006 HOH I O   1 
HETATM 3508 O O   . HOH D 3 .   ? 5.878  -12.316 65.466  1.00 35.60 ? 2007 HOH I O   1 
HETATM 3509 O O   . HOH D 3 .   ? 9.422  -12.853 67.563  1.00 26.63 ? 2008 HOH I O   1 
HETATM 3510 O O   . HOH D 3 .   ? 14.388 -0.588  63.289  1.00 17.53 ? 2009 HOH I O   1 
HETATM 3511 O O   . HOH D 3 .   ? 12.469 1.303   66.535  1.00 14.02 ? 2010 HOH I O   1 
HETATM 3512 O O   . HOH D 3 .   ? 13.407 3.515   69.220  1.00 16.06 ? 2011 HOH I O   1 
HETATM 3513 O O   . HOH D 3 .   ? 9.857  3.735   72.034  1.00 28.85 ? 2012 HOH I O   1 
HETATM 3514 O O   . HOH D 3 .   ? 9.639  4.238   76.506  1.00 27.38 ? 2013 HOH I O   1 
HETATM 3515 O O   . HOH D 3 .   ? 12.445 3.359   77.905  1.00 16.98 ? 2014 HOH I O   1 
HETATM 3516 O O   . HOH D 3 .   ? 18.908 1.061   65.476  1.00 20.45 ? 2015 HOH I O   1 
HETATM 3517 O O   . HOH D 3 .   ? 11.570 3.879   66.147  1.00 34.41 ? 2016 HOH I O   1 
HETATM 3518 O O   . HOH D 3 .   ? 14.153 5.095   66.628  1.00 38.18 ? 2017 HOH I O   1 
HETATM 3519 O O   . HOH D 3 .   ? 12.809 3.401   72.966  1.00 28.52 ? 2018 HOH I O   1 
HETATM 3520 O O   . HOH D 3 .   ? 10.148 4.451   79.074  1.00 24.54 ? 2019 HOH I O   1 
HETATM 3521 O O   . HOH D 3 .   ? 18.268 6.622   68.817  1.00 21.59 ? 2020 HOH I O   1 
HETATM 3522 O O   . HOH D 3 .   ? 14.161 5.048   71.299  1.00 34.67 ? 2021 HOH I O   1 
HETATM 3523 O O   . HOH D 3 .   ? 16.176 7.884   73.556  1.00 28.88 ? 2022 HOH I O   1 
HETATM 3524 O O   . HOH D 3 .   ? 18.415 9.400   72.593  1.00 27.13 ? 2023 HOH I O   1 
HETATM 3525 O O   . HOH D 3 .   ? 21.545 8.685   77.632  1.00 37.67 ? 2024 HOH I O   1 
HETATM 3526 O O   . HOH D 3 .   ? 22.833 10.860  76.101  1.00 43.11 ? 2025 HOH I O   1 
HETATM 3527 O O   . HOH D 3 .   ? 12.829 4.851   75.267  1.00 18.87 ? 2026 HOH I O   1 
HETATM 3528 O O   . HOH D 3 .   ? 18.446 8.347   77.433  1.00 39.75 ? 2027 HOH I O   1 
HETATM 3529 O O   . HOH D 3 .   ? 17.189 8.177   79.854  1.00 20.88 ? 2028 HOH I O   1 
HETATM 3530 O O   . HOH D 3 .   ? 11.215 6.868   79.844  1.00 19.35 ? 2029 HOH I O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 14  ? 0.5107 0.6316 0.5784 0.1444  -0.0937 -0.0440 13  GLU A N   
2    C CA  . GLU A 14  ? 0.5079 0.6103 0.5580 0.1441  -0.0978 -0.0366 13  GLU A CA  
3    C C   . GLU A 14  ? 0.5230 0.6014 0.5581 0.1426  -0.0946 -0.0303 13  GLU A C   
4    O O   . GLU A 14  ? 0.5122 0.5896 0.5506 0.1386  -0.0877 -0.0311 13  GLU A O   
5    C CB  . GLU A 14  ? 0.5164 0.6247 0.5651 0.1344  -0.0954 -0.0347 13  GLU A CB  
6    C CG  . GLU A 14  ? 0.6137 0.7163 0.6589 0.1230  -0.0861 -0.0313 13  GLU A CG  
7    C CD  . GLU A 14  ? 0.8500 0.9661 0.9018 0.1136  -0.0820 -0.0328 13  GLU A CD  
8    O OE1 . GLU A 14  ? 0.7760 0.8921 0.8226 0.1120  -0.0854 -0.0311 13  GLU A OE1 
9    O OE2 . GLU A 14  ? 0.7621 0.8878 0.8233 0.1077  -0.0752 -0.0357 13  GLU A OE2 
10   N N   . SER A 15  ? 0.4610 0.5200 0.4792 0.1453  -0.0994 -0.0241 14  SER A N   
11   C CA  . SER A 15  ? 0.4467 0.4819 0.4491 0.1432  -0.0968 -0.0179 14  SER A CA  
12   C C   . SER A 15  ? 0.4527 0.4847 0.4505 0.1306  -0.0888 -0.0140 14  SER A C   
13   O O   . SER A 15  ? 0.4119 0.4573 0.4161 0.1248  -0.0869 -0.0154 14  SER A O   
14   C CB  . SER A 15  ? 0.4844 0.5009 0.4698 0.1494  -0.1044 -0.0127 14  SER A CB  
15   O OG  . SER A 15  ? 0.4897 0.5080 0.4693 0.1448  -0.1062 -0.0099 14  SER A OG  
16   N N   . VAL A 16  ? 0.4142 0.4280 0.4008 0.1268  -0.0845 -0.0094 15  VAL A N   
17   C CA  . VAL A 16  ? 0.4002 0.4090 0.3816 0.1157  -0.0774 -0.0056 15  VAL A CA  
18   C C   . VAL A 16  ? 0.4373 0.4436 0.4102 0.1120  -0.0795 -0.0020 15  VAL A C   
19   O O   . VAL A 16  ? 0.4068 0.4229 0.3846 0.1046  -0.0754 -0.0025 15  VAL A O   
20   C CB  . VAL A 16  ? 0.4603 0.4493 0.4305 0.1133  -0.0735 -0.0017 15  VAL A CB  
21   C CG1 . VAL A 16  ? 0.4496 0.4328 0.4133 0.1025  -0.0673 0.0024  15  VAL A CG1 
22   C CG2 . VAL A 16  ? 0.4540 0.4472 0.4336 0.1151  -0.0702 -0.0057 15  VAL A CG2 
23   N N   . LYS A 17  ? 0.4239 0.4169 0.3836 0.1176  -0.0861 0.0014  16  LYS A N   
24   C CA  . LYS A 17  ? 0.4175 0.4065 0.3669 0.1150  -0.0888 0.0048  16  LYS A CA  
25   C C   . LYS A 17  ? 0.4286 0.4381 0.3895 0.1144  -0.0910 0.0007  16  LYS A C   
26   O O   . LYS A 17  ? 0.4111 0.4231 0.3693 0.1073  -0.0884 0.0021  16  LYS A O   
27   C CB  . LYS A 17  ? 0.4788 0.4498 0.4119 0.1223  -0.0963 0.0089  16  LYS A CB  
28   C CG  . LYS A 17  ? 0.6244 0.5713 0.5401 0.1188  -0.0932 0.0149  16  LYS A CG  
29   N N   . GLU A 18  ? 0.3594 0.3839 0.3333 0.1218  -0.0956 -0.0049 17  GLU A N   
30   C CA  . GLU A 18  ? 0.3382 0.3835 0.3243 0.1215  -0.0980 -0.0097 17  GLU A CA  
31   C C   . GLU A 18  ? 0.3407 0.3982 0.3370 0.1115  -0.0897 -0.0118 17  GLU A C   
32   O O   . GLU A 18  ? 0.3023 0.3667 0.2993 0.1059  -0.0888 -0.0120 17  GLU A O   
33   C CB  . GLU A 18  ? 0.3531 0.4130 0.3528 0.1308  -0.1034 -0.0160 17  GLU A CB  
34   C CG  . GLU A 18  ? 0.4872 0.5408 0.4793 0.1414  -0.1138 -0.0152 17  GLU A CG  
35   C CD  . GLU A 18  ? 0.6827 0.7481 0.6882 0.1517  -0.1185 -0.0214 17  GLU A CD  
36   O OE1 . GLU A 18  ? 0.4020 0.4642 0.4116 0.1536  -0.1149 -0.0226 17  GLU A OE1 
37   O OE2 . GLU A 18  ? 0.7356 0.8147 0.7483 0.1575  -0.1256 -0.0254 17  GLU A OE2 
38   N N   . PHE A 19  ? 0.2944 0.3533 0.2976 0.1095  -0.0838 -0.0132 18  PHE A N   
39   C CA  . PHE A 19  ? 0.2787 0.3467 0.2904 0.1004  -0.0758 -0.0148 18  PHE A CA  
40   C C   . PHE A 19  ? 0.3048 0.3628 0.3060 0.0921  -0.0718 -0.0097 18  PHE A C   
41   O O   . PHE A 19  ? 0.2963 0.3637 0.3024 0.0857  -0.0689 -0.0110 18  PHE A O   
42   C CB  . PHE A 19  ? 0.3017 0.3686 0.3188 0.1004  -0.0709 -0.0162 18  PHE A CB  
43   C CG  . PHE A 19  ? 0.3247 0.3964 0.3466 0.0908  -0.0628 -0.0163 18  PHE A CG  
44   C CD1 . PHE A 19  ? 0.3721 0.4618 0.4072 0.0871  -0.0601 -0.0210 18  PHE A CD1 
45   C CD2 . PHE A 19  ? 0.3494 0.4075 0.3623 0.0853  -0.0581 -0.0116 18  PHE A CD2 
46   C CE1 . PHE A 19  ? 0.3841 0.4765 0.4220 0.0784  -0.0531 -0.0206 18  PHE A CE1 
47   C CE2 . PHE A 19  ? 0.3916 0.4538 0.4085 0.0770  -0.0514 -0.0116 18  PHE A CE2 
48   C CZ  . PHE A 19  ? 0.3703 0.4490 0.3992 0.0738  -0.0492 -0.0159 18  PHE A CZ  
49   N N   . LEU A 20  ? 0.2592 0.2981 0.2461 0.0919  -0.0715 -0.0044 19  LEU A N   
50   C CA  . LEU A 20  ? 0.2521 0.2817 0.2295 0.0839  -0.0671 0.0000  19  LEU A CA  
51   C C   . LEU A 20  ? 0.2869 0.3178 0.2585 0.0821  -0.0700 0.0010  19  LEU A C   
52   O O   . LEU A 20  ? 0.2665 0.2983 0.2369 0.0746  -0.0656 0.0020  19  LEU A O   
53   C CB  . LEU A 20  ? 0.2541 0.2637 0.2182 0.0833  -0.0653 0.0049  19  LEU A CB  
54   C CG  . LEU A 20  ? 0.3047 0.3119 0.2733 0.0818  -0.0602 0.0043  19  LEU A CG  
55   C CD1 . LEU A 20  ? 0.3214 0.3083 0.2760 0.0813  -0.0591 0.0089  19  LEU A CD1 
56   C CD2 . LEU A 20  ? 0.2832 0.3000 0.2606 0.0735  -0.0532 0.0029  19  LEU A CD2 
57   N N   . ALA A 21  ? 0.2495 0.2806 0.2175 0.0892  -0.0778 0.0005  20  ALA A N   
58   C CA  . ALA A 21  ? 0.2468 0.2796 0.2088 0.0882  -0.0816 0.0011  20  ALA A CA  
59   C C   . ALA A 21  ? 0.2810 0.3328 0.2565 0.0839  -0.0797 -0.0037 20  ALA A C   
60   O O   . ALA A 21  ? 0.2708 0.3232 0.2429 0.0775  -0.0773 -0.0029 20  ALA A O   
61   C CB  . ALA A 21  ? 0.2703 0.3000 0.2263 0.0976  -0.0910 0.0012  20  ALA A CB  
62   N N   . LYS A 22  ? 0.2425 0.3099 0.2334 0.0868  -0.0804 -0.0090 21  LYS A N   
63   C CA  . LYS A 22  ? 0.2388 0.3243 0.2429 0.0821  -0.0781 -0.0139 21  LYS A CA  
64   C C   . LYS A 22  ? 0.2605 0.3446 0.2664 0.0729  -0.0695 -0.0126 21  LYS A C   
65   O O   . LYS A 22  ? 0.2436 0.3343 0.2523 0.0669  -0.0671 -0.0140 21  LYS A O   
66   C CB  . LYS A 22  ? 0.2839 0.3856 0.3037 0.0868  -0.0797 -0.0198 21  LYS A CB  
67   N N   . ALA A 23  ? 0.2116 0.2863 0.2151 0.0721  -0.0651 -0.0101 22  ALA A N   
68   C CA  . ALA A 23  ? 0.1942 0.2670 0.1991 0.0643  -0.0575 -0.0088 22  ALA A CA  
69   C C   . ALA A 23  ? 0.2191 0.2836 0.2140 0.0587  -0.0557 -0.0054 22  ALA A C   
70   O O   . ALA A 23  ? 0.2141 0.2833 0.2129 0.0524  -0.0514 -0.0063 22  ALA A O   
71   C CB  . ALA A 23  ? 0.1994 0.2629 0.2023 0.0651  -0.0543 -0.0067 22  ALA A CB  
72   N N   . LYS A 24  ? 0.1948 0.2469 0.1766 0.0612  -0.0590 -0.0018 23  LYS A N   
73   C CA  . LYS A 24  ? 0.1907 0.2346 0.1621 0.0561  -0.0570 0.0012  23  LYS A CA  
74   C C   . LYS A 24  ? 0.2555 0.3093 0.2296 0.0538  -0.0589 -0.0016 23  LYS A C   
75   O O   . LYS A 24  ? 0.2250 0.2796 0.1990 0.0475  -0.0546 -0.0016 23  LYS A O   
76   C CB  . LYS A 24  ? 0.2348 0.2623 0.1904 0.0589  -0.0599 0.0057  23  LYS A CB  
77   C CG  . LYS A 24  ? 0.3900 0.4083 0.3349 0.0525  -0.0560 0.0088  23  LYS A CG  
78   C CD  . LYS A 24  ? 0.4677 0.4690 0.4003 0.0519  -0.0539 0.0133  23  LYS A CD  
79   C CE  . LYS A 24  ? 0.4609 0.4584 0.3910 0.0440  -0.0469 0.0146  23  LYS A CE  
80   N NZ  . LYS A 24  ? 0.4430 0.4245 0.3607 0.0424  -0.0446 0.0187  23  LYS A NZ  
81   N N   . GLU A 25  ? 0.2398 0.3017 0.2170 0.0591  -0.0654 -0.0043 24  GLU A N   
82   C CA  . GLU A 25  ? 0.2282 0.3010 0.2088 0.0572  -0.0678 -0.0077 24  GLU A CA  
83   C C   . GLU A 25  ? 0.2609 0.3454 0.2541 0.0508  -0.0623 -0.0112 24  GLU A C   
84   O O   . GLU A 25  ? 0.2390 0.3248 0.2307 0.0452  -0.0600 -0.0119 24  GLU A O   
85   C CB  . GLU A 25  ? 0.2553 0.3367 0.2396 0.0646  -0.0759 -0.0106 24  GLU A CB  
86   C CG  . GLU A 25  ? 0.4284 0.5229 0.4179 0.0627  -0.0789 -0.0149 24  GLU A CG  
87   C CD  . GLU A 25  ? 0.6951 0.7991 0.6888 0.0704  -0.0874 -0.0182 24  GLU A CD  
88   O OE1 . GLU A 25  ? 0.6447 0.7608 0.6518 0.0734  -0.0880 -0.0222 24  GLU A OE1 
89   O OE2 . GLU A 25  ? 0.6019 0.7011 0.5852 0.0735  -0.0936 -0.0169 24  GLU A OE2 
90   N N   . ASP A 26  ? 0.2115 0.3035 0.2162 0.0515  -0.0599 -0.0135 25  ASP A N   
91   C CA  . ASP A 26  ? 0.1893 0.2908 0.2046 0.0454  -0.0545 -0.0165 25  ASP A CA  
92   C C   . ASP A 26  ? 0.2008 0.2931 0.2111 0.0391  -0.0483 -0.0133 25  ASP A C   
93   O O   . ASP A 26  ? 0.1755 0.2716 0.1884 0.0334  -0.0454 -0.0149 25  ASP A O   
94   C CB  . ASP A 26  ? 0.2063 0.3154 0.2324 0.0474  -0.0529 -0.0189 25  ASP A CB  
95   C CG  . ASP A 26  ? 0.3893 0.5101 0.4234 0.0537  -0.0583 -0.0231 25  ASP A CG  
96   O OD1 . ASP A 26  ? 0.3896 0.5149 0.4223 0.0563  -0.0639 -0.0247 25  ASP A OD1 
97   O OD2 . ASP A 26  ? 0.4495 0.5753 0.4913 0.0561  -0.0570 -0.0250 25  ASP A OD2 
98   N N   . PHE A 27  ? 0.1576 0.2377 0.1609 0.0400  -0.0463 -0.0092 26  PHE A N   
99   C CA  . PHE A 27  ? 0.1422 0.2141 0.1413 0.0346  -0.0407 -0.0065 26  PHE A CA  
100  C C   . PHE A 27  ? 0.1978 0.2658 0.1894 0.0313  -0.0405 -0.0058 26  PHE A C   
101  O O   . PHE A 27  ? 0.1767 0.2456 0.1705 0.0260  -0.0364 -0.0065 26  PHE A O   
102  C CB  . PHE A 27  ? 0.1570 0.2169 0.1494 0.0365  -0.0393 -0.0026 26  PHE A CB  
103  C CG  . PHE A 27  ? 0.1587 0.2104 0.1464 0.0314  -0.0342 0.0000  26  PHE A CG  
104  C CD1 . PHE A 27  ? 0.1589 0.2129 0.1532 0.0277  -0.0294 -0.0005 26  PHE A CD1 
105  C CD2 . PHE A 27  ? 0.1691 0.2112 0.1456 0.0303  -0.0342 0.0026  26  PHE A CD2 
106  C CE1 . PHE A 27  ? 0.1577 0.2053 0.1486 0.0236  -0.0252 0.0014  26  PHE A CE1 
107  C CE2 . PHE A 27  ? 0.1910 0.2271 0.1643 0.0256  -0.0293 0.0042  26  PHE A CE2 
108  C CZ  . PHE A 27  ? 0.1709 0.2103 0.1520 0.0225  -0.0250 0.0035  26  PHE A CZ  
109  N N   . LEU A 28  ? 0.1768 0.2395 0.1587 0.0343  -0.0450 -0.0044 27  LEU A N   
110  C CA  . LEU A 28  ? 0.1781 0.2365 0.1515 0.0310  -0.0446 -0.0038 27  LEU A CA  
111  C C   . LEU A 28  ? 0.2271 0.2953 0.2063 0.0273  -0.0444 -0.0077 27  LEU A C   
112  O O   . LEU A 28  ? 0.2161 0.2815 0.1923 0.0225  -0.0409 -0.0078 27  LEU A O   
113  C CB  . LEU A 28  ? 0.1809 0.2308 0.1412 0.0347  -0.0495 -0.0013 27  LEU A CB  
114  C CG  . LEU A 28  ? 0.2268 0.2630 0.1776 0.0365  -0.0486 0.0033  27  LEU A CG  
115  C CD1 . LEU A 28  ? 0.2559 0.2832 0.1928 0.0403  -0.0540 0.0058  27  LEU A CD1 
116  C CD2 . LEU A 28  ? 0.2617 0.2910 0.2095 0.0306  -0.0417 0.0051  27  LEU A CD2 
117  N N   . LYS A 29  ? 0.2006 0.2805 0.1884 0.0293  -0.0479 -0.0113 28  LYS A N   
118  C CA  . LYS A 29  ? 0.2021 0.2918 0.1961 0.0253  -0.0477 -0.0156 28  LYS A CA  
119  C C   . LYS A 29  ? 0.2191 0.3086 0.2185 0.0194  -0.0410 -0.0161 28  LYS A C   
120  O O   . LYS A 29  ? 0.2177 0.3060 0.2150 0.0149  -0.0388 -0.0172 28  LYS A O   
121  C CB  . LYS A 29  ? 0.2394 0.3429 0.2437 0.0280  -0.0518 -0.0198 28  LYS A CB  
122  C CG  . LYS A 29  ? 0.4310 0.5372 0.4308 0.0333  -0.0594 -0.0207 28  LYS A CG  
123  N N   . LYS A 30  ? 0.1675 0.2567 0.1726 0.0197  -0.0379 -0.0149 29  LYS A N   
124  C CA  . LYS A 30  ? 0.1494 0.2376 0.1591 0.0149  -0.0322 -0.0150 29  LYS A CA  
125  C C   . LYS A 30  ? 0.1874 0.2649 0.1901 0.0127  -0.0285 -0.0119 29  LYS A C   
126  O O   . LYS A 30  ? 0.1611 0.2375 0.1651 0.0084  -0.0250 -0.0128 29  LYS A O   
127  C CB  . LYS A 30  ? 0.1615 0.2530 0.1786 0.0162  -0.0306 -0.0149 29  LYS A CB  
128  C CG  . LYS A 30  ? 0.2652 0.3693 0.2912 0.0173  -0.0331 -0.0189 29  LYS A CG  
129  C CD  . LYS A 30  ? 0.3430 0.4502 0.3758 0.0182  -0.0308 -0.0190 29  LYS A CD  
130  C CE  . LYS A 30  ? 0.4429 0.5637 0.4857 0.0172  -0.0314 -0.0238 29  LYS A CE  
131  N N   . TRP A 31  ? 0.1451 0.2145 0.1401 0.0156  -0.0294 -0.0086 30  TRP A N   
132  C CA  . TRP A 31  ? 0.1679 0.2277 0.1560 0.0135  -0.0259 -0.0060 30  TRP A CA  
133  C C   . TRP A 31  ? 0.1984 0.2570 0.1814 0.0104  -0.0253 -0.0075 30  TRP A C   
134  O O   . TRP A 31  ? 0.1861 0.2411 0.1685 0.0070  -0.0212 -0.0075 30  TRP A O   
135  C CB  . TRP A 31  ? 0.1694 0.2211 0.1493 0.0169  -0.0275 -0.0026 30  TRP A CB  
136  C CG  . TRP A 31  ? 0.1909 0.2332 0.1626 0.0145  -0.0242 -0.0003 30  TRP A CG  
137  C CD1 . TRP A 31  ? 0.2341 0.2707 0.1953 0.0138  -0.0249 0.0006  30  TRP A CD1 
138  C CD2 . TRP A 31  ? 0.1837 0.2219 0.1572 0.0121  -0.0194 0.0010  30  TRP A CD2 
139  N NE1 . TRP A 31  ? 0.2247 0.2543 0.1814 0.0108  -0.0204 0.0021  30  TRP A NE1 
140  C CE2 . TRP A 31  ? 0.2325 0.2636 0.1973 0.0098  -0.0171 0.0023  30  TRP A CE2 
141  C CE3 . TRP A 31  ? 0.1871 0.2276 0.1687 0.0115  -0.0169 0.0010  30  TRP A CE3 
142  C CZ2 . TRP A 31  ? 0.2301 0.2572 0.1953 0.0071  -0.0124 0.0032  30  TRP A CZ2 
143  C CZ3 . TRP A 31  ? 0.2067 0.2427 0.1880 0.0091  -0.0128 0.0022  30  TRP A CZ3 
144  C CH2 . TRP A 31  ? 0.2180 0.2480 0.1919 0.0070  -0.0106 0.0031  30  TRP A CH2 
145  N N   . GLU A 32  ? 0.1820 0.2438 0.1614 0.0117  -0.0297 -0.0091 31  GLU A N   
146  C CA  . GLU A 32  ? 0.2005 0.2612 0.1739 0.0089  -0.0297 -0.0108 31  GLU A CA  
147  C C   . GLU A 32  ? 0.2549 0.3220 0.2352 0.0049  -0.0281 -0.0147 31  GLU A C   
148  O O   . GLU A 32  ? 0.2344 0.2987 0.2109 0.0017  -0.0259 -0.0161 31  GLU A O   
149  C CB  . GLU A 32  ? 0.2269 0.2873 0.1920 0.0120  -0.0355 -0.0106 31  GLU A CB  
150  C CG  . GLU A 32  ? 0.3804 0.4301 0.3342 0.0145  -0.0362 -0.0064 31  GLU A CG  
151  C CD  . GLU A 32  ? 0.6552 0.6958 0.6011 0.0109  -0.0311 -0.0046 31  GLU A CD  
152  O OE1 . GLU A 32  ? 0.5912 0.6326 0.5363 0.0070  -0.0284 -0.0069 31  GLU A OE1 
153  O OE2 . GLU A 32  ? 0.5721 0.6046 0.5125 0.0119  -0.0297 -0.0011 31  GLU A OE2 
154  N N   . ASN A 33  ? 0.2176 0.2930 0.2077 0.0049  -0.0289 -0.0168 32  ASN A N   
155  C CA  . ASN A 33  ? 0.2116 0.2922 0.2081 0.0005  -0.0270 -0.0204 32  ASN A CA  
156  C C   . ASN A 33  ? 0.2155 0.2982 0.2208 -0.0006 -0.0239 -0.0201 32  ASN A C   
157  O O   . ASN A 33  ? 0.2042 0.2949 0.2165 -0.0006 -0.0252 -0.0221 32  ASN A O   
158  C CB  . ASN A 33  ? 0.2677 0.3572 0.2660 0.0002  -0.0314 -0.0243 32  ASN A CB  
159  C CG  . ASN A 33  ? 0.4936 0.5798 0.4825 -0.0004 -0.0333 -0.0251 32  ASN A CG  
160  O OD1 . ASN A 33  ? 0.3950 0.4764 0.3805 -0.0041 -0.0300 -0.0261 32  ASN A OD1 
161  N ND2 . ASN A 33  ? 0.3642 0.4527 0.3483 0.0032  -0.0388 -0.0249 32  ASN A ND2 
162  N N   . PRO A 34  ? 0.1681 0.2436 0.1727 -0.0016 -0.0197 -0.0178 33  PRO A N   
163  C CA  . PRO A 34  ? 0.1548 0.2312 0.1661 -0.0024 -0.0171 -0.0170 33  PRO A CA  
164  C C   . PRO A 34  ? 0.2053 0.2856 0.2224 -0.0066 -0.0155 -0.0199 33  PRO A C   
165  O O   . PRO A 34  ? 0.1973 0.2766 0.2131 -0.0097 -0.0147 -0.0222 33  PRO A O   
166  C CB  . PRO A 34  ? 0.1746 0.2424 0.1830 -0.0026 -0.0137 -0.0143 33  PRO A CB  
167  C CG  . PRO A 34  ? 0.2213 0.2846 0.2217 -0.0009 -0.0146 -0.0130 33  PRO A CG  
168  C CD  . PRO A 34  ? 0.1711 0.2381 0.1689 -0.0019 -0.0173 -0.0159 33  PRO A CD  
169  N N   . ALA A 35  ? 0.1745 0.2586 0.1975 -0.0068 -0.0147 -0.0198 34  ALA A N   
170  C CA  . ALA A 35  ? 0.1719 0.2587 0.2000 -0.0111 -0.0125 -0.0218 34  ALA A CA  
171  C C   . ALA A 35  ? 0.2037 0.2811 0.2296 -0.0131 -0.0089 -0.0200 34  ALA A C   
172  O O   . ALA A 35  ? 0.1903 0.2623 0.2141 -0.0107 -0.0080 -0.0170 34  ALA A O   
173  C CB  . ALA A 35  ? 0.1813 0.2741 0.2149 -0.0104 -0.0123 -0.0218 34  ALA A CB  
174  N N   . GLN A 36  ? 0.1761 0.2515 0.2024 -0.0175 -0.0071 -0.0221 35  GLN A N   
175  C CA  . GLN A 36  ? 0.1715 0.2376 0.1956 -0.0189 -0.0043 -0.0208 35  GLN A CA  
176  C C   . GLN A 36  ? 0.2116 0.2762 0.2375 -0.0238 -0.0024 -0.0225 35  GLN A C   
177  O O   . GLN A 36  ? 0.1984 0.2682 0.2259 -0.0270 -0.0030 -0.0258 35  GLN A O   
178  C CB  . GLN A 36  ? 0.2012 0.2633 0.2210 -0.0185 -0.0045 -0.0220 35  GLN A CB  
179  C CG  . GLN A 36  ? 0.3043 0.3573 0.3220 -0.0185 -0.0020 -0.0211 35  GLN A CG  
180  C CD  . GLN A 36  ? 0.3643 0.4146 0.3778 -0.0176 -0.0019 -0.0225 35  GLN A CD  
181  O OE1 . GLN A 36  ? 0.2952 0.3493 0.3064 -0.0182 -0.0035 -0.0247 35  GLN A OE1 
182  N NE2 . GLN A 36  ? 0.3231 0.3672 0.3357 -0.0163 0.0001  -0.0217 35  GLN A NE2 
183  N N   . ASN A 37  ? 0.1654 0.2224 0.1904 -0.0244 -0.0002 -0.0203 36  ASN A N   
184  C CA  . ASN A 37  ? 0.1648 0.2170 0.1894 -0.0292 0.0019  -0.0212 36  ASN A CA  
185  C C   . ASN A 37  ? 0.2067 0.2669 0.2348 -0.0330 0.0023  -0.0231 36  ASN A C   
186  O O   . ASN A 37  ? 0.2070 0.2691 0.2357 -0.0377 0.0028  -0.0264 36  ASN A O   
187  C CB  . ASN A 37  ? 0.1953 0.2428 0.2173 -0.0316 0.0023  -0.0240 36  ASN A CB  
188  C CG  . ASN A 37  ? 0.2954 0.3341 0.3152 -0.0359 0.0044  -0.0245 36  ASN A CG  
189  O OD1 . ASN A 37  ? 0.2318 0.2635 0.2501 -0.0353 0.0055  -0.0216 36  ASN A OD1 
190  N ND2 . ASN A 37  ? 0.2255 0.2639 0.2445 -0.0403 0.0049  -0.0281 36  ASN A ND2 
191  N N   . THR A 38  ? 0.1513 0.2166 0.1820 -0.0312 0.0021  -0.0215 37  THR A N   
192  C CA  . THR A 38  ? 0.1454 0.2201 0.1805 -0.0342 0.0026  -0.0237 37  THR A CA  
193  C C   . THR A 38  ? 0.1934 0.2642 0.2274 -0.0388 0.0058  -0.0229 37  THR A C   
194  O O   . THR A 38  ? 0.1902 0.2691 0.2280 -0.0419 0.0070  -0.0251 37  THR A O   
195  C CB  . THR A 38  ? 0.2039 0.2881 0.2429 -0.0296 0.0004  -0.0237 37  THR A CB  
196  O OG1 . THR A 38  ? 0.1725 0.2519 0.2097 -0.0260 0.0008  -0.0199 37  THR A OG1 
197  C CG2 . THR A 38  ? 0.2106 0.2985 0.2494 -0.0259 -0.0030 -0.0248 37  THR A CG2 
198  N N   . ALA A 39  ? 0.1609 0.2194 0.1897 -0.0393 0.0072  -0.0200 38  ALA A N   
199  C CA  . ALA A 39  ? 0.1659 0.2181 0.1915 -0.0439 0.0101  -0.0187 38  ALA A CA  
200  C C   . ALA A 39  ? 0.2042 0.2418 0.2235 -0.0439 0.0104  -0.0163 38  ALA A C   
201  O O   . ALA A 39  ? 0.1872 0.2214 0.2060 -0.0408 0.0088  -0.0165 38  ALA A O   
202  C CB  . ALA A 39  ? 0.1697 0.2245 0.1959 -0.0420 0.0106  -0.0163 38  ALA A CB  
203  N N   . HIS A 40  ? 0.1688 0.1975 0.1832 -0.0475 0.0124  -0.0144 39  HIS A N   
204  C CA  . HIS A 40  ? 0.1838 0.1976 0.1918 -0.0469 0.0123  -0.0119 39  HIS A CA  
205  C C   . HIS A 40  ? 0.2005 0.2079 0.2039 -0.0468 0.0129  -0.0080 39  HIS A C   
206  O O   . HIS A 40  ? 0.1711 0.1834 0.1746 -0.0503 0.0148  -0.0081 39  HIS A O   
207  C CB  . HIS A 40  ? 0.2139 0.2202 0.2182 -0.0529 0.0140  -0.0140 39  HIS A CB  
208  C CG  . HIS A 40  ? 0.2694 0.2598 0.2673 -0.0513 0.0134  -0.0119 39  HIS A CG  
209  N ND1 . HIS A 40  ? 0.3019 0.2804 0.2929 -0.0521 0.0138  -0.0082 39  HIS A ND1 
210  C CD2 . HIS A 40  ? 0.3052 0.2901 0.3028 -0.0489 0.0122  -0.0133 39  HIS A CD2 
211  C CE1 . HIS A 40  ? 0.3092 0.2753 0.2962 -0.0496 0.0126  -0.0075 39  HIS A CE1 
212  N NE2 . HIS A 40  ? 0.3127 0.2824 0.3038 -0.0477 0.0118  -0.0106 39  HIS A NE2 
213  N N   . LEU A 41  ? 0.1648 0.1612 0.1639 -0.0429 0.0113  -0.0049 40  LEU A N   
214  C CA  . LEU A 41  ? 0.1818 0.1712 0.1755 -0.0423 0.0111  -0.0010 40  LEU A CA  
215  C C   . LEU A 41  ? 0.2200 0.2032 0.2071 -0.0496 0.0141  -0.0004 40  LEU A C   
216  O O   . LEU A 41  ? 0.2193 0.2033 0.2036 -0.0507 0.0150  0.0016  40  LEU A O   
217  C CB  . LEU A 41  ? 0.1953 0.1730 0.1854 -0.0373 0.0085  0.0017  40  LEU A CB  
218  C CG  . LEU A 41  ? 0.2673 0.2388 0.2525 -0.0348 0.0070  0.0057  40  LEU A CG  
219  C CD1 . LEU A 41  ? 0.2596 0.2423 0.2496 -0.0318 0.0064  0.0063  40  LEU A CD1 
220  C CD2 . LEU A 41  ? 0.3009 0.2614 0.2834 -0.0297 0.0040  0.0076  40  LEU A CD2 
221  N N   . ASP A 42  ? 0.2110 0.1884 0.1952 -0.0549 0.0158  -0.0023 41  ASP A N   
222  C CA  . ASP A 42  ? 0.2188 0.1887 0.1956 -0.0628 0.0191  -0.0018 41  ASP A CA  
223  C C   . ASP A 42  ? 0.2700 0.2531 0.2508 -0.0684 0.0224  -0.0044 41  ASP A C   
224  O O   . ASP A 42  ? 0.2697 0.2482 0.2447 -0.0758 0.0259  -0.0044 41  ASP A O   
225  C CB  . ASP A 42  ? 0.2636 0.2221 0.2358 -0.0668 0.0199  -0.0032 41  ASP A CB  
226  C CG  . ASP A 42  ? 0.4657 0.4338 0.4447 -0.0700 0.0210  -0.0084 41  ASP A CG  
227  O OD1 . ASP A 42  ? 0.4584 0.4424 0.4463 -0.0677 0.0204  -0.0108 41  ASP A OD1 
228  O OD2 . ASP A 42  ? 0.6219 0.5810 0.5969 -0.0743 0.0222  -0.0100 41  ASP A OD2 
229  N N   . GLN A 43  ? 0.2086 0.2076 0.1989 -0.0649 0.0215  -0.0067 42  GLN A N   
230  C CA  . GLN A 43  ? 0.1992 0.2125 0.1950 -0.0687 0.0242  -0.0097 42  GLN A CA  
231  C C   . GLN A 43  ? 0.2336 0.2496 0.2282 -0.0664 0.0245  -0.0073 42  GLN A C   
232  O O   . GLN A 43  ? 0.2007 0.2279 0.1993 -0.0692 0.0270  -0.0098 42  GLN A O   
233  C CB  . GLN A 43  ? 0.1968 0.2253 0.2030 -0.0659 0.0226  -0.0139 42  GLN A CB  
234  C CG  . GLN A 43  ? 0.2405 0.2672 0.2474 -0.0695 0.0227  -0.0170 42  GLN A CG  
235  C CD  . GLN A 43  ? 0.4075 0.4464 0.4228 -0.0658 0.0202  -0.0204 42  GLN A CD  
236  O OE1 . GLN A 43  ? 0.2492 0.2956 0.2690 -0.0595 0.0178  -0.0197 42  GLN A OE1 
237  N NE2 . GLN A 43  ? 0.3827 0.4232 0.3995 -0.0698 0.0205  -0.0240 42  GLN A NE2 
238  N N   . PHE A 44  ? 0.1955 0.2010 0.1844 -0.0617 0.0221  -0.0029 43  PHE A N   
239  C CA  . PHE A 44  ? 0.1844 0.1909 0.1713 -0.0589 0.0217  -0.0003 43  PHE A CA  
240  C C   . PHE A 44  ? 0.2625 0.2534 0.2377 -0.0606 0.0218  0.0041  43  PHE A C   
241  O O   . PHE A 44  ? 0.2761 0.2539 0.2454 -0.0604 0.0203  0.0062  43  PHE A O   
242  C CB  . PHE A 44  ? 0.1826 0.1944 0.1754 -0.0504 0.0179  0.0005  43  PHE A CB  
243  C CG  . PHE A 44  ? 0.1607 0.1860 0.1634 -0.0480 0.0172  -0.0032 43  PHE A CG  
244  C CD1 . PHE A 44  ? 0.1848 0.2230 0.1935 -0.0473 0.0180  -0.0055 43  PHE A CD1 
245  C CD2 . PHE A 44  ? 0.1650 0.1897 0.1706 -0.0461 0.0154  -0.0045 43  PHE A CD2 
246  C CE1 . PHE A 44  ? 0.1755 0.2252 0.1924 -0.0448 0.0168  -0.0087 43  PHE A CE1 
247  C CE2 . PHE A 44  ? 0.1730 0.2094 0.1863 -0.0442 0.0144  -0.0077 43  PHE A CE2 
248  C CZ  . PHE A 44  ? 0.1513 0.2000 0.1701 -0.0434 0.0149  -0.0097 43  PHE A CZ  
249  N N   . GLU A 45  ? 0.2234 0.2156 0.1949 -0.0621 0.0234  0.0054  44  GLU A N   
250  C CA  . GLU A 45  ? 0.2424 0.2204 0.2018 -0.0635 0.0232  0.0098  44  GLU A CA  
251  C C   . GLU A 45  ? 0.2926 0.2727 0.2535 -0.0563 0.0196  0.0119  44  GLU A C   
252  O O   . GLU A 45  ? 0.2543 0.2471 0.2222 -0.0543 0.0202  0.0098  44  GLU A O   
253  C CB  . GLU A 45  ? 0.2751 0.2539 0.2287 -0.0716 0.0282  0.0091  44  GLU A CB  
254  C CG  . GLU A 45  ? 0.4357 0.4011 0.3759 -0.0731 0.0281  0.0136  44  GLU A CG  
255  C CD  . GLU A 45  ? 0.7123 0.6809 0.6473 -0.0807 0.0334  0.0125  44  GLU A CD  
256  O OE1 . GLU A 45  ? 0.4471 0.4296 0.3903 -0.0846 0.0374  0.0077  44  GLU A OE1 
257  O OE2 . GLU A 45  ? 0.7281 0.6855 0.6508 -0.0825 0.0336  0.0162  44  GLU A OE2 
258  N N   . ARG A 46  ? 0.2642 0.2320 0.2187 -0.0523 0.0158  0.0158  45  ARG A N   
259  C CA  . ARG A 46  ? 0.2643 0.2331 0.2198 -0.0457 0.0121  0.0178  45  ARG A CA  
260  C C   . ARG A 46  ? 0.2916 0.2592 0.2398 -0.0483 0.0135  0.0195  45  ARG A C   
261  O O   . ARG A 46  ? 0.2931 0.2495 0.2299 -0.0531 0.0149  0.0219  45  ARG A O   
262  C CB  . ARG A 46  ? 0.2837 0.2401 0.2351 -0.0409 0.0075  0.0209  45  ARG A CB  
263  C CG  . ARG A 46  ? 0.3915 0.3486 0.3438 -0.0344 0.0034  0.0228  45  ARG A CG  
264  C CD  . ARG A 46  ? 0.4146 0.3582 0.3610 -0.0306 -0.0010 0.0259  45  ARG A CD  
265  N NE  . ARG A 46  ? 0.4205 0.3660 0.3683 -0.0248 -0.0051 0.0273  45  ARG A NE  
266  C CZ  . ARG A 46  ? 0.4714 0.4143 0.4225 -0.0185 -0.0095 0.0277  45  ARG A CZ  
267  N NH1 . ARG A 46  ? 0.3124 0.2501 0.2654 -0.0170 -0.0102 0.0270  45  ARG A NH1 
268  N NH2 . ARG A 46  ? 0.2841 0.2303 0.2372 -0.0139 -0.0130 0.0285  45  ARG A NH2 
269  N N   . ILE A 47  ? 0.2304 0.2086 0.1841 -0.0453 0.0133  0.0182  46  ILE A N   
270  C CA  . ILE A 47  ? 0.2415 0.2195 0.1885 -0.0475 0.0147  0.0193  46  ILE A CA  
271  C C   . ILE A 47  ? 0.2950 0.2683 0.2387 -0.0419 0.0100  0.0222  46  ILE A C   
272  O O   . ILE A 47  ? 0.3267 0.2892 0.2592 -0.0433 0.0088  0.0255  46  ILE A O   
273  C CB  . ILE A 47  ? 0.2720 0.2645 0.2258 -0.0498 0.0188  0.0152  46  ILE A CB  
274  C CG1 . ILE A 47  ? 0.2729 0.2720 0.2312 -0.0554 0.0233  0.0116  46  ILE A CG1 
275  C CG2 . ILE A 47  ? 0.2859 0.2775 0.2320 -0.0523 0.0206  0.0159  46  ILE A CG2 
276  C CD1 . ILE A 47  ? 0.3340 0.3229 0.2816 -0.0640 0.0271  0.0127  46  ILE A CD1 
277  N N   . LYS A 48  ? 0.2343 0.2157 0.1873 -0.0359 0.0073  0.0209  47  LYS A N   
278  C CA  . LYS A 48  ? 0.2207 0.2002 0.1724 -0.0310 0.0031  0.0228  47  LYS A CA  
279  C C   . LYS A 48  ? 0.2561 0.2432 0.2187 -0.0252 0.0006  0.0212  47  LYS A C   
280  O O   . LYS A 48  ? 0.2171 0.2133 0.1879 -0.0250 0.0027  0.0184  47  LYS A O   
281  C CB  . LYS A 48  ? 0.2366 0.2207 0.1852 -0.0328 0.0050  0.0221  47  LYS A CB  
282  C CG  . LYS A 48  ? 0.3022 0.2818 0.2452 -0.0298 0.0011  0.0244  47  LYS A CG  
283  C CD  . LYS A 48  ? 0.3314 0.3151 0.2704 -0.0326 0.0038  0.0232  47  LYS A CD  
284  C CE  . LYS A 48  ? 0.3273 0.3051 0.2579 -0.0310 0.0002  0.0256  47  LYS A CE  
285  N NZ  . LYS A 48  ? 0.2843 0.2663 0.2221 -0.0250 -0.0042 0.0251  47  LYS A NZ  
286  N N   . THR A 49  ? 0.2360 0.2197 0.1985 -0.0204 -0.0038 0.0229  48  THR A N   
287  C CA  . THR A 49  ? 0.2124 0.2033 0.1847 -0.0155 -0.0058 0.0213  48  THR A CA  
288  C C   . THR A 49  ? 0.2703 0.2691 0.2452 -0.0149 -0.0052 0.0198  48  THR A C   
289  O O   . THR A 49  ? 0.2718 0.2679 0.2409 -0.0151 -0.0065 0.0211  48  THR A O   
290  C CB  . THR A 49  ? 0.2392 0.2245 0.2114 -0.0110 -0.0106 0.0230  48  THR A CB  
291  O OG1 . THR A 49  ? 0.2325 0.2096 0.2019 -0.0116 -0.0109 0.0240  48  THR A OG1 
292  C CG2 . THR A 49  ? 0.2326 0.2256 0.2148 -0.0067 -0.0120 0.0210  48  THR A CG2 
293  N N   . LEU A 50  ? 0.2248 0.2326 0.2077 -0.0141 -0.0032 0.0172  49  LEU A N   
294  C CA  . LEU A 50  ? 0.2346 0.2491 0.2202 -0.0132 -0.0024 0.0155  49  LEU A CA  
295  C C   . LEU A 50  ? 0.3077 0.3245 0.2983 -0.0091 -0.0053 0.0152  49  LEU A C   
296  O O   . LEU A 50  ? 0.3144 0.3344 0.3055 -0.0083 -0.0054 0.0143  49  LEU A O   
297  C CB  . LEU A 50  ? 0.2332 0.2555 0.2241 -0.0143 0.0010  0.0127  49  LEU A CB  
298  C CG  . LEU A 50  ? 0.3103 0.3333 0.2986 -0.0189 0.0045  0.0118  49  LEU A CG  
299  C CD1 . LEU A 50  ? 0.3058 0.3371 0.3016 -0.0188 0.0065  0.0089  49  LEU A CD1 
300  C CD2 . LEU A 50  ? 0.3514 0.3748 0.3343 -0.0217 0.0066  0.0114  49  LEU A CD2 
301  N N   . GLY A 51  ? 0.2580 0.2735 0.2523 -0.0067 -0.0073 0.0156  50  GLY A N   
302  C CA  . GLY A 51  ? 0.2404 0.2588 0.2400 -0.0034 -0.0094 0.0149  50  GLY A CA  
303  C C   . GLY A 51  ? 0.3010 0.3173 0.3039 -0.0011 -0.0114 0.0152  50  GLY A C   
304  O O   . GLY A 51  ? 0.2866 0.3003 0.2892 -0.0019 -0.0104 0.0154  50  GLY A O   
305  N N   . THR A 52  ? 0.2589 0.2763 0.2649 0.0017  -0.0141 0.0150  51  THR A N   
306  C CA  . THR A 52  ? 0.2587 0.2750 0.2688 0.0044  -0.0161 0.0146  51  THR A CA  
307  C C   . THR A 52  ? 0.3424 0.3641 0.3587 0.0067  -0.0176 0.0129  51  THR A C   
308  O O   . THR A 52  ? 0.3569 0.3799 0.3722 0.0070  -0.0195 0.0130  51  THR A O   
309  C CB  . THR A 52  ? 0.4282 0.4367 0.4330 0.0055  -0.0192 0.0167  51  THR A CB  
310  O OG1 . THR A 52  ? 0.5518 0.5545 0.5498 0.0025  -0.0174 0.0183  51  THR A OG1 
311  C CG2 . THR A 52  ? 0.3937 0.4007 0.4030 0.0088  -0.0210 0.0159  51  THR A CG2 
312  N N   . GLY A 53  ? 0.2446 0.2697 0.2671 0.0079  -0.0165 0.0112  52  GLY A N   
313  C CA  . GLY A 53  ? 0.2208 0.2515 0.2498 0.0094  -0.0171 0.0090  52  GLY A CA  
314  C C   . GLY A 53  ? 0.2190 0.2515 0.2533 0.0107  -0.0159 0.0072  52  GLY A C   
315  O O   . GLY A 53  ? 0.1903 0.2188 0.2228 0.0108  -0.0152 0.0078  52  GLY A O   
316  N N   . SER A 54  ? 0.1767 0.2150 0.2172 0.0113  -0.0153 0.0048  53  SER A N   
317  C CA  . SER A 54  ? 0.1746 0.2150 0.2200 0.0124  -0.0137 0.0027  53  SER A CA  
318  C C   . SER A 54  ? 0.2198 0.2586 0.2627 0.0105  -0.0103 0.0028  53  SER A C   
319  O O   . SER A 54  ? 0.1546 0.1921 0.1987 0.0113  -0.0096 0.0018  53  SER A O   
320  C CB  . SER A 54  ? 0.2310 0.2785 0.2833 0.0126  -0.0130 -0.0002 53  SER A CB  
321  O OG  . SER A 54  ? 0.3668 0.4165 0.4178 0.0096  -0.0108 -0.0002 53  SER A OG  
322  N N   . TYR A 55  ? 0.2679 0.3066 0.3071 0.0081  -0.0088 0.0041  54  TYR A N   
323  C CA  . TYR A 55  ? 0.2882 0.3260 0.3251 0.0066  -0.0063 0.0042  54  TYR A CA  
324  C C   . TYR A 55  ? 0.3380 0.3715 0.3713 0.0062  -0.0066 0.0053  54  TYR A C   
325  O O   . TYR A 55  ? 0.3556 0.3890 0.3878 0.0052  -0.0049 0.0049  54  TYR A O   
326  C CB  . TYR A 55  ? 0.3298 0.3693 0.3647 0.0050  -0.0048 0.0045  54  TYR A CB  
327  C CG  . TYR A 55  ? 0.3687 0.4114 0.4064 0.0045  -0.0035 0.0029  54  TYR A CG  
328  C CD1 . TYR A 55  ? 0.4023 0.4460 0.4406 0.0038  -0.0012 0.0017  54  TYR A CD1 
329  C CD2 . TYR A 55  ? 0.3830 0.4276 0.4226 0.0043  -0.0045 0.0026  54  TYR A CD2 
330  C CE1 . TYR A 55  ? 0.4191 0.4654 0.4594 0.0026  0.0005  0.0002  54  TYR A CE1 
331  C CE2 . TYR A 55  ? 0.3710 0.4187 0.4134 0.0031  -0.0029 0.0008  54  TYR A CE2 
332  C CZ  . TYR A 55  ? 0.4904 0.5387 0.5330 0.0021  -0.0002 -0.0003 54  TYR A CZ  
333  O OH  . TYR A 55  ? 0.5237 0.5747 0.5683 0.0002  0.0018  -0.0020 54  TYR A OH  
334  N N   . GLY A 56  ? 0.2651 0.2948 0.2963 0.0069  -0.0088 0.0067  55  GLY A N   
335  C CA  . GLY A 56  ? 0.2582 0.2826 0.2852 0.0059  -0.0089 0.0079  55  GLY A CA  
336  C C   . GLY A 56  ? 0.2994 0.3209 0.3213 0.0045  -0.0097 0.0100  55  GLY A C   
337  O O   . GLY A 56  ? 0.3000 0.3231 0.3217 0.0050  -0.0110 0.0106  55  GLY A O   
338  N N   . ARG A 57  ? 0.2141 0.2317 0.2317 0.0023  -0.0088 0.0109  56  ARG A N   
339  C CA  . ARG A 57  ? 0.2112 0.2257 0.2230 0.0001  -0.0089 0.0127  56  ARG A CA  
340  C C   . ARG A 57  ? 0.2229 0.2410 0.2340 -0.0029 -0.0060 0.0120  56  ARG A C   
341  O O   . ARG A 57  ? 0.1776 0.1981 0.1913 -0.0035 -0.0046 0.0105  56  ARG A O   
342  C CB  . ARG A 57  ? 0.2269 0.2328 0.2333 -0.0007 -0.0099 0.0143  56  ARG A CB  
343  C CG  . ARG A 57  ? 0.3509 0.3520 0.3571 0.0027  -0.0135 0.0152  56  ARG A CG  
344  C CD  . ARG A 57  ? 0.3643 0.3552 0.3636 0.0016  -0.0143 0.0171  56  ARG A CD  
345  N NE  . ARG A 57  ? 0.2789 0.2667 0.2802 0.0023  -0.0137 0.0158  56  ARG A NE  
346  C CZ  . ARG A 57  ? 0.3886 0.3663 0.3842 0.0015  -0.0143 0.0170  56  ARG A CZ  
347  N NH1 . ARG A 57  ? 0.3421 0.3117 0.3291 -0.0003 -0.0154 0.0199  56  ARG A NH1 
348  N NH2 . ARG A 57  ? 0.2484 0.2232 0.2462 0.0024  -0.0139 0.0154  56  ARG A NH2 
349  N N   . VAL A 58  ? 0.1831 0.2015 0.1905 -0.0048 -0.0053 0.0128  57  VAL A N   
350  C CA  . VAL A 58  ? 0.1813 0.2035 0.1882 -0.0077 -0.0026 0.0117  57  VAL A CA  
351  C C   . VAL A 58  ? 0.2041 0.2208 0.2042 -0.0110 -0.0018 0.0131  57  VAL A C   
352  O O   . VAL A 58  ? 0.1923 0.2052 0.1878 -0.0109 -0.0032 0.0148  57  VAL A O   
353  C CB  . VAL A 58  ? 0.2311 0.2598 0.2405 -0.0068 -0.0018 0.0104  57  VAL A CB  
354  C CG1 . VAL A 58  ? 0.2303 0.2635 0.2400 -0.0093 0.0008  0.0088  57  VAL A CG1 
355  C CG2 . VAL A 58  ? 0.2327 0.2649 0.2472 -0.0040 -0.0024 0.0094  57  VAL A CG2 
356  N N   . MET A 59  ? 0.1668 0.1827 0.1657 -0.0144 0.0003  0.0124  58  MET A N   
357  C CA  . MET A 59  ? 0.2148 0.2244 0.2065 -0.0185 0.0016  0.0137  58  MET A CA  
358  C C   . MET A 59  ? 0.2223 0.2383 0.2146 -0.0226 0.0053  0.0116  58  MET A C   
359  O O   . MET A 59  ? 0.2037 0.2261 0.2015 -0.0232 0.0067  0.0091  58  MET A O   
360  C CB  . MET A 59  ? 0.2839 0.2863 0.2737 -0.0195 0.0012  0.0143  58  MET A CB  
361  C CG  . MET A 59  ? 0.3909 0.3837 0.3717 -0.0237 0.0022  0.0162  58  MET A CG  
362  S SD  . MET A 59  ? 0.5062 0.4882 0.4797 -0.0206 -0.0020 0.0200  58  MET A SD  
363  C CE  . MET A 59  ? 0.4654 0.4427 0.4429 -0.0161 -0.0049 0.0198  58  MET A CE  
364  N N   . LEU A 60  ? 0.1590 0.1733 0.1455 -0.0257 0.0069  0.0123  59  LEU A N   
365  C CA  . LEU A 60  ? 0.1479 0.1682 0.1349 -0.0302 0.0110  0.0099  59  LEU A CA  
366  C C   . LEU A 60  ? 0.1857 0.2007 0.1694 -0.0350 0.0128  0.0099  59  LEU A C   
367  O O   . LEU A 60  ? 0.1777 0.1815 0.1533 -0.0366 0.0119  0.0128  59  LEU A O   
368  C CB  . LEU A 60  ? 0.1534 0.1729 0.1341 -0.0328 0.0128  0.0103  59  LEU A CB  
369  C CG  . LEU A 60  ? 0.1991 0.2251 0.1802 -0.0381 0.0176  0.0073  59  LEU A CG  
370  C CD1 . LEU A 60  ? 0.1895 0.2288 0.1815 -0.0358 0.0186  0.0032  59  LEU A CD1 
371  C CD2 . LEU A 60  ? 0.2364 0.2603 0.2100 -0.0411 0.0198  0.0079  59  LEU A CD2 
372  N N   . VAL A 61  ? 0.1504 0.1731 0.1400 -0.0371 0.0149  0.0068  60  VAL A N   
373  C CA  . VAL A 61  ? 0.1515 0.1703 0.1387 -0.0424 0.0170  0.0061  60  VAL A CA  
374  C C   . VAL A 61  ? 0.1982 0.2269 0.1886 -0.0476 0.0213  0.0024  60  VAL A C   
375  O O   . VAL A 61  ? 0.1601 0.1999 0.1570 -0.0454 0.0218  -0.0002 60  VAL A O   
376  C CB  . VAL A 61  ? 0.1985 0.2166 0.1902 -0.0403 0.0151  0.0053  60  VAL A CB  
377  C CG1 . VAL A 61  ? 0.1916 0.2004 0.1807 -0.0355 0.0113  0.0084  60  VAL A CG1 
378  C CG2 . VAL A 61  ? 0.1901 0.2212 0.1918 -0.0376 0.0147  0.0018  60  VAL A CG2 
379  N N   . LYS A 62  ? 0.1769 0.2014 0.1630 -0.0543 0.0243  0.0018  61  LYS A N   
380  C CA  . LYS A 62  ? 0.1610 0.1954 0.1509 -0.0601 0.0287  -0.0024 61  LYS A CA  
381  C C   . LYS A 62  ? 0.2085 0.2442 0.2023 -0.0627 0.0289  -0.0047 61  LYS A C   
382  O O   . LYS A 62  ? 0.1960 0.2196 0.1834 -0.0649 0.0283  -0.0025 61  LYS A O   
383  C CB  . LYS A 62  ? 0.2033 0.2317 0.1836 -0.0673 0.0329  -0.0015 61  LYS A CB  
384  C CG  . LYS A 62  ? 0.3079 0.3491 0.2932 -0.0731 0.0380  -0.0065 61  LYS A CG  
385  C CD  . LYS A 62  ? 0.3444 0.3803 0.3197 -0.0792 0.0422  -0.0054 61  LYS A CD  
386  C CE  . LYS A 62  ? 0.4096 0.4595 0.3907 -0.0849 0.0478  -0.0109 61  LYS A CE  
387  N NZ  . LYS A 62  ? 0.3856 0.4297 0.3557 -0.0923 0.0528  -0.0101 61  LYS A NZ  
388  N N   . HIS A 63  ? 0.1540 0.2041 0.1581 -0.0621 0.0293  -0.0092 62  HIS A N   
389  C CA  . HIS A 63  ? 0.1615 0.2156 0.1704 -0.0648 0.0295  -0.0123 62  HIS A CA  
390  C C   . HIS A 63  ? 0.2330 0.2884 0.2395 -0.0745 0.0347  -0.0150 62  HIS A C   
391  O O   . HIS A 63  ? 0.2345 0.3018 0.2459 -0.0769 0.0377  -0.0185 62  HIS A O   
392  C CB  . HIS A 63  ? 0.1660 0.2355 0.1864 -0.0599 0.0274  -0.0161 62  HIS A CB  
393  C CG  . HIS A 63  ? 0.2098 0.2848 0.2359 -0.0611 0.0263  -0.0194 62  HIS A CG  
394  N ND1 . HIS A 63  ? 0.2462 0.3363 0.2809 -0.0634 0.0276  -0.0248 62  HIS A ND1 
395  C CD2 . HIS A 63  ? 0.2263 0.2944 0.2508 -0.0598 0.0239  -0.0183 62  HIS A CD2 
396  C CE1 . HIS A 63  ? 0.2351 0.3265 0.2726 -0.0638 0.0257  -0.0266 62  HIS A CE1 
397  N NE2 . HIS A 63  ? 0.2289 0.3072 0.2602 -0.0617 0.0236  -0.0229 62  HIS A NE2 
398  N N   . MET A 64  ? 0.2344 0.2777 0.2334 -0.0800 0.0360  -0.0136 63  MET A N   
399  C CA  . MET A 64  ? 0.2618 0.3046 0.2571 -0.0902 0.0414  -0.0159 63  MET A CA  
400  C C   . MET A 64  ? 0.3232 0.3840 0.3296 -0.0945 0.0441  -0.0226 63  MET A C   
401  O O   . MET A 64  ? 0.3131 0.3805 0.3198 -0.1009 0.0489  -0.0254 63  MET A O   
402  C CB  . MET A 64  ? 0.3201 0.3454 0.3051 -0.0952 0.0420  -0.0132 63  MET A CB  
403  C CG  . MET A 64  ? 0.3781 0.3855 0.3499 -0.0944 0.0413  -0.0072 63  MET A CG  
404  S SD  . MET A 64  ? 0.4266 0.4265 0.3988 -0.0833 0.0344  -0.0031 63  MET A SD  
405  C CE  . MET A 64  ? 0.3910 0.3778 0.3592 -0.0859 0.0335  -0.0031 63  MET A CE  
406  N N   . GLU A 65  ? 0.2806 0.3498 0.2959 -0.0912 0.0410  -0.0256 64  GLU A N   
407  C CA  . GLU A 65  ? 0.2840 0.3707 0.3103 -0.0948 0.0425  -0.0323 64  GLU A CA  
408  C C   . GLU A 65  ? 0.2926 0.3969 0.3282 -0.0925 0.0438  -0.0361 64  GLU A C   
409  O O   . GLU A 65  ? 0.2957 0.4146 0.3394 -0.0973 0.0465  -0.0419 64  GLU A O   
410  C CB  . GLU A 65  ? 0.3041 0.3952 0.3369 -0.0902 0.0379  -0.0341 64  GLU A CB  
411  C CG  . GLU A 65  ? 0.4531 0.5563 0.4935 -0.0963 0.0394  -0.0404 64  GLU A CG  
412  N N   . THR A 66  ? 0.2211 0.3246 0.2561 -0.0851 0.0415  -0.0331 65  THR A N   
413  C CA  . THR A 66  ? 0.2073 0.3259 0.2507 -0.0817 0.0422  -0.0365 65  THR A CA  
414  C C   . THR A 66  ? 0.2236 0.3374 0.2601 -0.0830 0.0456  -0.0342 65  THR A C   
415  O O   . THR A 66  ? 0.2192 0.3453 0.2616 -0.0834 0.0482  -0.0381 65  THR A O   
416  C CB  . THR A 66  ? 0.2772 0.4016 0.3273 -0.0712 0.0364  -0.0362 65  THR A CB  
417  O OG1 . THR A 66  ? 0.2395 0.3497 0.2818 -0.0659 0.0334  -0.0301 65  THR A OG1 
418  C CG2 . THR A 66  ? 0.2990 0.4312 0.3567 -0.0696 0.0329  -0.0394 65  THR A CG2 
419  N N   . GLY A 67  ? 0.1668 0.2630 0.1913 -0.0830 0.0450  -0.0281 66  GLY A N   
420  C CA  . GLY A 67  ? 0.1598 0.2499 0.1766 -0.0830 0.0469  -0.0253 66  GLY A CA  
421  C C   . GLY A 67  ? 0.1775 0.2705 0.1978 -0.0732 0.0428  -0.0238 66  GLY A C   
422  O O   . GLY A 67  ? 0.1681 0.2580 0.1835 -0.0721 0.0438  -0.0221 66  GLY A O   
423  N N   . ASN A 68  ? 0.1516 0.2499 0.1798 -0.0663 0.0381  -0.0245 67  ASN A N   
424  C CA  . ASN A 68  ? 0.1380 0.2379 0.1689 -0.0575 0.0343  -0.0231 67  ASN A CA  
425  C C   . ASN A 68  ? 0.1575 0.2417 0.1789 -0.0547 0.0317  -0.0169 67  ASN A C   
426  O O   . ASN A 68  ? 0.1729 0.2464 0.1888 -0.0566 0.0307  -0.0140 67  ASN A O   
427  C CB  . ASN A 68  ? 0.1449 0.2527 0.1849 -0.0515 0.0300  -0.0250 67  ASN A CB  
428  C CG  . ASN A 68  ? 0.3844 0.5096 0.4356 -0.0510 0.0307  -0.0312 67  ASN A CG  
429  O OD1 . ASN A 68  ? 0.3780 0.5117 0.4327 -0.0512 0.0333  -0.0342 67  ASN A OD1 
430  N ND2 . ASN A 68  ? 0.2025 0.3335 0.2597 -0.0495 0.0279  -0.0333 67  ASN A ND2 
431  N N   . HIS A 69  ? 0.1137 0.1970 0.1339 -0.0497 0.0303  -0.0153 68  HIS A N   
432  C CA  . HIS A 69  ? 0.1156 0.1866 0.1289 -0.0460 0.0271  -0.0102 68  HIS A CA  
433  C C   . HIS A 69  ? 0.1601 0.2334 0.1792 -0.0387 0.0226  -0.0098 68  HIS A C   
434  O O   . HIS A 69  ? 0.1547 0.2384 0.1815 -0.0352 0.0219  -0.0129 68  HIS A O   
435  C CB  . HIS A 69  ? 0.1187 0.1868 0.1265 -0.0454 0.0282  -0.0088 68  HIS A CB  
436  C CG  . HIS A 69  ? 0.1589 0.2196 0.1571 -0.0523 0.0318  -0.0073 68  HIS A CG  
437  N ND1 . HIS A 69  ? 0.1802 0.2483 0.1789 -0.0579 0.0369  -0.0110 68  HIS A ND1 
438  C CD2 . HIS A 69  ? 0.1902 0.2366 0.1776 -0.0544 0.0309  -0.0028 68  HIS A CD2 
439  C CE1 . HIS A 69  ? 0.1932 0.2506 0.1805 -0.0637 0.0392  -0.0082 68  HIS A CE1 
440  N NE2 . HIS A 69  ? 0.1964 0.2401 0.1763 -0.0616 0.0355  -0.0031 68  HIS A NE2 
441  N N   . TYR A 70  ? 0.1010 0.1645 0.1162 -0.0363 0.0197  -0.0061 69  TYR A N   
442  C CA  . TYR A 70  ? 0.0987 0.1630 0.1181 -0.0300 0.0158  -0.0054 69  TYR A CA  
443  C C   . TYR A 70  ? 0.1275 0.1816 0.1414 -0.0271 0.0134  -0.0013 69  TYR A C   
444  O O   . TYR A 70  ? 0.1201 0.1655 0.1271 -0.0298 0.0140  0.0011  69  TYR A O   
445  C CB  . TYR A 70  ? 0.1109 0.1758 0.1332 -0.0305 0.0147  -0.0064 69  TYR A CB  
446  C CG  . TYR A 70  ? 0.1394 0.2153 0.1681 -0.0330 0.0162  -0.0108 69  TYR A CG  
447  C CD1 . TYR A 70  ? 0.1711 0.2578 0.2069 -0.0291 0.0150  -0.0137 69  TYR A CD1 
448  C CD2 . TYR A 70  ? 0.1510 0.2265 0.1786 -0.0393 0.0187  -0.0124 69  TYR A CD2 
449  C CE1 . TYR A 70  ? 0.1818 0.2798 0.2243 -0.0308 0.0158  -0.0182 69  TYR A CE1 
450  C CE2 . TYR A 70  ? 0.1405 0.2275 0.1749 -0.0419 0.0199  -0.0170 69  TYR A CE2 
451  C CZ  . TYR A 70  ? 0.1875 0.2863 0.2297 -0.0374 0.0183  -0.0200 69  TYR A CZ  
452  O OH  . TYR A 70  ? 0.2019 0.3129 0.2515 -0.0395 0.0190  -0.0249 69  TYR A OH  
453  N N   . ALA A 71  ? 0.0975 0.1525 0.1144 -0.0217 0.0106  -0.0007 70  ALA A N   
454  C CA  . ALA A 71  ? 0.1187 0.1660 0.1322 -0.0188 0.0082  0.0025  70  ALA A CA  
455  C C   . ALA A 71  ? 0.1609 0.2055 0.1761 -0.0175 0.0065  0.0029  70  ALA A C   
456  O O   . ALA A 71  ? 0.1464 0.1963 0.1662 -0.0152 0.0057  0.0013  70  ALA A O   
457  C CB  . ALA A 71  ? 0.1245 0.1746 0.1401 -0.0145 0.0069  0.0024  70  ALA A CB  
458  N N   . MET A 72  ? 0.1282 0.1646 0.1393 -0.0190 0.0061  0.0048  71  MET A N   
459  C CA  . MET A 72  ? 0.1177 0.1511 0.1301 -0.0179 0.0048  0.0048  71  MET A CA  
460  C C   . MET A 72  ? 0.1419 0.1715 0.1545 -0.0137 0.0024  0.0065  71  MET A C   
461  O O   . MET A 72  ? 0.1386 0.1616 0.1473 -0.0133 0.0013  0.0086  71  MET A O   
462  C CB  . MET A 72  ? 0.1510 0.1772 0.1591 -0.0219 0.0058  0.0053  71  MET A CB  
463  C CG  . MET A 72  ? 0.2118 0.2347 0.2212 -0.0210 0.0048  0.0046  71  MET A CG  
464  S SD  . MET A 72  ? 0.2808 0.2941 0.2845 -0.0261 0.0063  0.0049  71  MET A SD  
465  C CE  . MET A 72  ? 0.2381 0.2409 0.2354 -0.0247 0.0047  0.0084  71  MET A CE  
466  N N   . LYS A 73  ? 0.1353 0.1690 0.1521 -0.0108 0.0015  0.0055  72  LYS A N   
467  C CA  . LYS A 73  ? 0.1415 0.1727 0.1593 -0.0074 -0.0003 0.0064  72  LYS A CA  
468  C C   . LYS A 73  ? 0.1830 0.2092 0.2004 -0.0074 -0.0007 0.0063  72  LYS A C   
469  O O   . LYS A 73  ? 0.1793 0.2068 0.1977 -0.0088 0.0001  0.0046  72  LYS A O   
470  C CB  . LYS A 73  ? 0.1823 0.2192 0.2035 -0.0051 -0.0005 0.0053  72  LYS A CB  
471  C CG  . LYS A 73  ? 0.3137 0.3494 0.3363 -0.0024 -0.0016 0.0058  72  LYS A CG  
472  C CD  . LYS A 73  ? 0.3212 0.3608 0.3450 -0.0008 -0.0016 0.0055  72  LYS A CD  
473  C CE  . LYS A 73  ? 0.2999 0.3385 0.3250 0.0009  -0.0020 0.0056  72  LYS A CE  
474  N NZ  . LYS A 73  ? 0.2902 0.3306 0.3151 0.0019  -0.0018 0.0055  72  LYS A NZ  
475  N N   . ILE A 74  ? 0.1411 0.1613 0.1568 -0.0060 -0.0022 0.0078  73  ILE A N   
476  C CA  . ILE A 74  ? 0.1474 0.1618 0.1628 -0.0052 -0.0029 0.0075  73  ILE A CA  
477  C C   . ILE A 74  ? 0.1834 0.1990 0.2026 -0.0013 -0.0043 0.0069  73  ILE A C   
478  O O   . ILE A 74  ? 0.1665 0.1819 0.1860 0.0006  -0.0059 0.0081  73  ILE A O   
479  C CB  . ILE A 74  ? 0.1966 0.2018 0.2064 -0.0063 -0.0039 0.0094  73  ILE A CB  
480  C CG1 . ILE A 74  ? 0.1993 0.2032 0.2046 -0.0110 -0.0019 0.0099  73  ILE A CG1 
481  C CG2 . ILE A 74  ? 0.2191 0.2176 0.2287 -0.0050 -0.0046 0.0086  73  ILE A CG2 
482  C CD1 . ILE A 74  ? 0.2345 0.2284 0.2323 -0.0124 -0.0029 0.0127  73  ILE A CD1 
483  N N   . LEU A 75  ? 0.1503 0.1672 0.1723 -0.0006 -0.0035 0.0049  74  LEU A N   
484  C CA  . LEU A 75  ? 0.1314 0.1504 0.1575 0.0024  -0.0040 0.0036  74  LEU A CA  
485  C C   . LEU A 75  ? 0.1698 0.1836 0.1963 0.0039  -0.0044 0.0024  74  LEU A C   
486  O O   . LEU A 75  ? 0.1628 0.1738 0.1876 0.0021  -0.0034 0.0013  74  LEU A O   
487  C CB  . LEU A 75  ? 0.1340 0.1591 0.1623 0.0022  -0.0023 0.0020  74  LEU A CB  
488  C CG  . LEU A 75  ? 0.1979 0.2277 0.2257 0.0013  -0.0019 0.0028  74  LEU A CG  
489  C CD1 . LEU A 75  ? 0.1892 0.2229 0.2181 0.0016  -0.0007 0.0015  74  LEU A CD1 
490  C CD2 . LEU A 75  ? 0.2947 0.3250 0.3229 0.0024  -0.0030 0.0043  74  LEU A CD2 
491  N N   . ASP A 76  ? 0.1180 0.1307 0.1472 0.0072  -0.0062 0.0022  75  ASP A N   
492  C CA  . ASP A 76  ? 0.1052 0.1135 0.1360 0.0097  -0.0069 0.0005  75  ASP A CA  
493  C C   . ASP A 76  ? 0.1365 0.1507 0.1720 0.0104  -0.0047 -0.0028 75  ASP A C   
494  O O   . ASP A 76  ? 0.1343 0.1547 0.1741 0.0116  -0.0044 -0.0037 75  ASP A O   
495  C CB  . ASP A 76  ? 0.1276 0.1328 0.1597 0.0135  -0.0102 0.0014  75  ASP A CB  
496  C CG  . ASP A 76  ? 0.2032 0.2040 0.2377 0.0172  -0.0114 -0.0008 75  ASP A CG  
497  O OD1 . ASP A 76  ? 0.1950 0.1987 0.2331 0.0176  -0.0093 -0.0039 75  ASP A OD1 
498  O OD2 . ASP A 76  ? 0.2477 0.2424 0.2807 0.0201  -0.0147 0.0006  75  ASP A OD2 
499  N N   . LYS A 77  ? 0.1292 0.1412 0.1635 0.0091  -0.0030 -0.0047 76  LYS A N   
500  C CA  . LYS A 77  ? 0.1208 0.1374 0.1579 0.0091  -0.0006 -0.0080 76  LYS A CA  
501  C C   . LYS A 77  ? 0.1529 0.1731 0.1960 0.0126  -0.0006 -0.0102 76  LYS A C   
502  O O   . LYS A 77  ? 0.1434 0.1702 0.1890 0.0120  0.0013  -0.0115 76  LYS A O   
503  C CB  . LYS A 77  ? 0.1398 0.1515 0.1746 0.0080  0.0005  -0.0101 76  LYS A CB  
504  C CG  . LYS A 77  ? 0.1834 0.1945 0.2137 0.0039  0.0013  -0.0093 76  LYS A CG  
505  C CD  . LYS A 77  ? 0.2113 0.2186 0.2401 0.0029  0.0025  -0.0123 76  LYS A CD  
506  C CE  . LYS A 77  ? 0.2530 0.2566 0.2774 -0.0010 0.0026  -0.0119 76  LYS A CE  
507  N NZ  . LYS A 77  ? 0.1633 0.1615 0.1862 -0.0018 0.0036  -0.0151 76  LYS A NZ  
508  N N   . GLN A 78  ? 0.1353 0.1512 0.1806 0.0161  -0.0029 -0.0107 77  GLN A N   
509  C CA  . GLN A 78  ? 0.1259 0.1464 0.1782 0.0200  -0.0032 -0.0135 77  GLN A CA  
510  C C   . GLN A 78  ? 0.1588 0.1865 0.2147 0.0201  -0.0039 -0.0126 77  GLN A C   
511  O O   . GLN A 78  ? 0.1411 0.1761 0.2028 0.0209  -0.0023 -0.0155 77  GLN A O   
512  C CB  . GLN A 78  ? 0.1410 0.1546 0.1946 0.0244  -0.0063 -0.0141 77  GLN A CB  
513  C CG  . GLN A 78  ? 0.1438 0.1502 0.1946 0.0243  -0.0051 -0.0161 77  GLN A CG  
514  C CD  . GLN A 78  ? 0.2387 0.2363 0.2896 0.0290  -0.0083 -0.0165 77  GLN A CD  
515  O OE1 . GLN A 78  ? 0.2608 0.2535 0.3095 0.0309  -0.0120 -0.0134 77  GLN A OE1 
516  N NE2 . GLN A 78  ? 0.2343 0.2291 0.2871 0.0311  -0.0071 -0.0204 77  GLN A NE2 
517  N N   . LYS A 79  ? 0.1395 0.1653 0.1917 0.0189  -0.0059 -0.0088 78  LYS A N   
518  C CA  . LYS A 79  ? 0.1231 0.1549 0.1778 0.0187  -0.0067 -0.0079 78  LYS A CA  
519  C C   . LYS A 79  ? 0.1519 0.1892 0.2061 0.0152  -0.0033 -0.0083 78  LYS A C   
520  O O   . LYS A 79  ? 0.1361 0.1797 0.1945 0.0150  -0.0023 -0.0098 78  LYS A O   
521  C CB  . LYS A 79  ? 0.1206 0.1482 0.1708 0.0185  -0.0097 -0.0041 78  LYS A CB  
522  C CG  . LYS A 79  ? 0.2018 0.2235 0.2519 0.0224  -0.0136 -0.0035 78  LYS A CG  
523  C CD  . LYS A 79  ? 0.2472 0.2654 0.2924 0.0220  -0.0167 0.0002  78  LYS A CD  
524  C CE  . LYS A 79  ? 0.2963 0.3072 0.3399 0.0261  -0.0210 0.0011  78  LYS A CE  
525  N NZ  . LYS A 79  ? 0.3974 0.4047 0.4355 0.0258  -0.0242 0.0045  78  LYS A NZ  
526  N N   . VAL A 80  ? 0.1181 0.1529 0.1672 0.0125  -0.0016 -0.0073 79  VAL A N   
527  C CA  . VAL A 80  ? 0.1006 0.1390 0.1477 0.0096  0.0012  -0.0075 79  VAL A CA  
528  C C   . VAL A 80  ? 0.1555 0.1982 0.2063 0.0097  0.0040  -0.0111 79  VAL A C   
529  O O   . VAL A 80  ? 0.1433 0.1903 0.1948 0.0080  0.0058  -0.0116 79  VAL A O   
530  C CB  . VAL A 80  ? 0.1281 0.1634 0.1695 0.0073  0.0018  -0.0063 79  VAL A CB  
531  C CG1 . VAL A 80  ? 0.1209 0.1590 0.1597 0.0051  0.0042  -0.0068 79  VAL A CG1 
532  C CG2 . VAL A 80  ? 0.1269 0.1596 0.1651 0.0066  -0.0001 -0.0032 79  VAL A CG2 
533  N N   . VAL A 81  ? 0.1109 0.1523 0.1641 0.0115  0.0045  -0.0139 80  VAL A N   
534  C CA  . VAL A 81  ? 0.1135 0.1594 0.1706 0.0116  0.0076  -0.0179 80  VAL A CA  
535  C C   . VAL A 81  ? 0.1637 0.2163 0.2279 0.0129  0.0076  -0.0196 80  VAL A C   
536  O O   . VAL A 81  ? 0.1361 0.1939 0.2015 0.0105  0.0108  -0.0214 80  VAL A O   
537  C CB  . VAL A 81  ? 0.1577 0.2000 0.2158 0.0137  0.0078  -0.0208 80  VAL A CB  
538  C CG1 . VAL A 81  ? 0.1663 0.2138 0.2295 0.0145  0.0110  -0.0257 80  VAL A CG1 
539  C CG2 . VAL A 81  ? 0.1490 0.1861 0.2001 0.0113  0.0084  -0.0198 80  VAL A CG2 
540  N N   . LYS A 82  ? 0.1306 0.1828 0.1987 0.0161  0.0041  -0.0190 81  LYS A N   
541  C CA  . LYS A 82  ? 0.1364 0.1957 0.2120 0.0176  0.0034  -0.0210 81  LYS A CA  
542  C C   . LYS A 82  ? 0.1524 0.2154 0.2267 0.0141  0.0044  -0.0193 81  LYS A C   
543  O O   . LYS A 82  ? 0.1593 0.2295 0.2391 0.0132  0.0061  -0.0220 81  LYS A O   
544  C CB  . LYS A 82  ? 0.1683 0.2256 0.2472 0.0221  -0.0016 -0.0203 81  LYS A CB  
545  C CG  . LYS A 82  ? 0.2169 0.2722 0.2998 0.0266  -0.0025 -0.0233 81  LYS A CG  
546  C CD  . LYS A 82  ? 0.2611 0.3137 0.3465 0.0315  -0.0080 -0.0224 81  LYS A CD  
547  C CE  . LYS A 82  ? 0.2472 0.2958 0.3356 0.0365  -0.0095 -0.0251 81  LYS A CE  
548  N NZ  . LYS A 82  ? 0.2139 0.2720 0.3124 0.0386  -0.0071 -0.0312 81  LYS A NZ  
549  N N   . LEU A 83  ? 0.1263 0.1844 0.1934 0.0121  0.0034  -0.0153 82  LEU A N   
550  C CA  . LEU A 83  ? 0.1315 0.1912 0.1962 0.0091  0.0041  -0.0134 82  LEU A CA  
551  C C   . LEU A 83  ? 0.1656 0.2256 0.2261 0.0054  0.0082  -0.0138 82  LEU A C   
552  O O   . LEU A 83  ? 0.1521 0.2120 0.2094 0.0028  0.0090  -0.0122 82  LEU A O   
553  C CB  . LEU A 83  ? 0.1488 0.2030 0.2077 0.0091  0.0014  -0.0093 82  LEU A CB  
554  C CG  . LEU A 83  ? 0.2634 0.3173 0.3244 0.0114  -0.0026 -0.0080 82  LEU A CG  
555  C CD1 . LEU A 83  ? 0.2942 0.3430 0.3486 0.0104  -0.0042 -0.0043 82  LEU A CD1 
556  C CD2 . LEU A 83  ? 0.3434 0.4035 0.4092 0.0108  -0.0028 -0.0096 82  LEU A CD2 
557  N N   . LYS A 84  ? 0.1343 0.1942 0.1942 0.0051  0.0107  -0.0160 83  LYS A N   
558  C CA  . LYS A 84  ? 0.1434 0.2026 0.1978 0.0017  0.0145  -0.0164 83  LYS A CA  
559  C C   . LYS A 84  ? 0.1648 0.2186 0.2110 0.0003  0.0134  -0.0124 83  LYS A C   
560  O O   . LYS A 84  ? 0.1598 0.2124 0.2009 -0.0024 0.0152  -0.0114 83  LYS A O   
561  C CB  . LYS A 84  ? 0.1576 0.2219 0.2144 -0.0013 0.0180  -0.0187 83  LYS A CB  
562  C CG  . LYS A 84  ? 0.2919 0.3633 0.3578 0.0000  0.0197  -0.0236 83  LYS A CG  
563  C CD  . LYS A 84  ? 0.3778 0.4548 0.4457 -0.0041 0.0240  -0.0263 83  LYS A CD  
564  C CE  . LYS A 84  ? 0.5548 0.6382 0.6307 -0.0038 0.0227  -0.0277 83  LYS A CE  
565  N NZ  . LYS A 84  ? 0.6755 0.7549 0.7477 -0.0041 0.0194  -0.0235 83  LYS A NZ  
566  N N   . GLN A 85  ? 0.0965 0.1467 0.1411 0.0022  0.0104  -0.0104 84  GLN A N   
567  C CA  . GLN A 85  ? 0.0937 0.1402 0.1320 0.0013  0.0091  -0.0072 84  GLN A CA  
568  C C   . GLN A 85  ? 0.1362 0.1801 0.1704 0.0011  0.0091  -0.0073 84  GLN A C   
569  O O   . GLN A 85  ? 0.1323 0.1742 0.1632 0.0011  0.0074  -0.0053 84  GLN A O   
570  C CB  . GLN A 85  ? 0.1108 0.1562 0.1500 0.0026  0.0060  -0.0048 84  GLN A CB  
571  C CG  . GLN A 85  ? 0.1095 0.1575 0.1521 0.0026  0.0056  -0.0047 84  GLN A CG  
572  C CD  . GLN A 85  ? 0.1497 0.1976 0.1888 0.0001  0.0076  -0.0043 84  GLN A CD  
573  O OE1 . GLN A 85  ? 0.1499 0.1947 0.1835 -0.0006 0.0073  -0.0022 84  GLN A OE1 
574  N NE2 . GLN A 85  ? 0.1437 0.1949 0.1859 -0.0014 0.0096  -0.0063 84  GLN A NE2 
575  N N   . ILE A 86  ? 0.0830 0.1274 0.1176 0.0008  0.0111  -0.0101 85  ILE A N   
576  C CA  . ILE A 86  ? 0.0905 0.1326 0.1211 0.0003  0.0110  -0.0105 85  ILE A CA  
577  C C   . ILE A 86  ? 0.1388 0.1796 0.1625 -0.0013 0.0107  -0.0087 85  ILE A C   
578  O O   . ILE A 86  ? 0.1253 0.1649 0.1467 -0.0011 0.0086  -0.0073 85  ILE A O   
579  C CB  . ILE A 86  ? 0.1314 0.1741 0.1631 0.0002  0.0134  -0.0143 85  ILE A CB  
580  C CG1 . ILE A 86  ? 0.1213 0.1648 0.1602 0.0028  0.0131  -0.0164 85  ILE A CG1 
581  C CG2 . ILE A 86  ? 0.1412 0.1813 0.1681 -0.0007 0.0131  -0.0150 85  ILE A CG2 
582  C CD1 . ILE A 86  ? 0.1475 0.1933 0.1890 0.0029  0.0164  -0.0209 85  ILE A CD1 
583  N N   . GLU A 87  ? 0.0973 0.1384 0.1175 -0.0029 0.0129  -0.0088 86  GLU A N   
584  C CA  . GLU A 87  ? 0.0904 0.1291 0.1030 -0.0039 0.0122  -0.0069 86  GLU A CA  
585  C C   . GLU A 87  ? 0.0956 0.1334 0.1077 -0.0028 0.0095  -0.0039 86  GLU A C   
586  O O   . GLU A 87  ? 0.1042 0.1409 0.1124 -0.0022 0.0075  -0.0027 86  GLU A O   
587  C CB  . GLU A 87  ? 0.1223 0.1599 0.1303 -0.0062 0.0153  -0.0073 86  GLU A CB  
588  C CG  . GLU A 87  ? 0.2047 0.2386 0.2031 -0.0073 0.0148  -0.0061 86  GLU A CG  
589  C CD  . GLU A 87  ? 0.2292 0.2631 0.2243 -0.0076 0.0147  -0.0079 86  GLU A CD  
590  O OE1 . GLU A 87  ? 0.2571 0.2927 0.2548 -0.0084 0.0171  -0.0110 86  GLU A OE1 
591  O OE2 . GLU A 87  ? 0.1598 0.1919 0.1496 -0.0069 0.0119  -0.0065 86  GLU A OE2 
592  N N   . HIS A 88  ? 0.0767 0.1154 0.0931 -0.0023 0.0094  -0.0031 87  HIS A N   
593  C CA  . HIS A 88  ? 0.0904 0.1283 0.1065 -0.0012 0.0072  -0.0007 87  HIS A CA  
594  C C   . HIS A 88  ? 0.1300 0.1688 0.1478 0.0001  0.0049  -0.0003 87  HIS A C   
595  O O   . HIS A 88  ? 0.1075 0.1460 0.1234 0.0009  0.0031  0.0011  87  HIS A O   
596  C CB  . HIS A 88  ? 0.0984 0.1373 0.1186 -0.0013 0.0076  -0.0005 87  HIS A CB  
597  C CG  . HIS A 88  ? 0.1272 0.1648 0.1448 -0.0033 0.0098  -0.0005 87  HIS A CG  
598  N ND1 . HIS A 88  ? 0.1397 0.1793 0.1616 -0.0041 0.0107  -0.0012 87  HIS A ND1 
599  C CD2 . HIS A 88  ? 0.1566 0.1908 0.1673 -0.0049 0.0112  0.0001  87  HIS A CD2 
600  C CE1 . HIS A 88  ? 0.1479 0.1854 0.1657 -0.0066 0.0130  -0.0012 87  HIS A CE1 
601  N NE2 . HIS A 88  ? 0.1547 0.1882 0.1651 -0.0071 0.0134  -0.0002 87  HIS A NE2 
602  N N   . THR A 89  ? 0.0903 0.1300 0.1118 0.0003  0.0050  -0.0018 88  THR A N   
603  C CA  . THR A 89  ? 0.0863 0.1262 0.1091 0.0007  0.0032  -0.0015 88  THR A CA  
604  C C   . THR A 89  ? 0.1086 0.1490 0.1279 0.0000  0.0026  -0.0022 88  THR A C   
605  O O   . THR A 89  ? 0.1081 0.1499 0.1273 0.0000  0.0011  -0.0017 88  THR A O   
606  C CB  . THR A 89  ? 0.1523 0.1912 0.1788 0.0010  0.0034  -0.0026 88  THR A CB  
607  O OG1 . THR A 89  ? 0.1222 0.1612 0.1520 0.0020  0.0033  -0.0021 88  THR A OG1 
608  C CG2 . THR A 89  ? 0.1377 0.1753 0.1642 0.0005  0.0021  -0.0022 88  THR A CG2 
609  N N   . LEU A 90  ? 0.0905 0.1304 0.1073 -0.0007 0.0039  -0.0037 89  LEU A N   
610  C CA  . LEU A 90  ? 0.0951 0.1356 0.1079 -0.0013 0.0029  -0.0045 89  LEU A CA  
611  C C   . LEU A 90  ? 0.1322 0.1731 0.1413 -0.0003 0.0011  -0.0027 89  LEU A C   
612  O O   . LEU A 90  ? 0.1239 0.1670 0.1324 0.0001  -0.0010 -0.0029 89  LEU A O   
613  C CB  . LEU A 90  ? 0.1076 0.1471 0.1175 -0.0025 0.0047  -0.0066 89  LEU A CB  
614  C CG  . LEU A 90  ? 0.1284 0.1672 0.1420 -0.0029 0.0063  -0.0090 89  LEU A CG  
615  C CD1 . LEU A 90  ? 0.1239 0.1620 0.1342 -0.0040 0.0086  -0.0115 89  LEU A CD1 
616  C CD2 . LEU A 90  ? 0.1232 0.1619 0.1386 -0.0035 0.0048  -0.0099 89  LEU A CD2 
617  N N   . ASN A 91  ? 0.1010 0.1398 0.1083 0.0002  0.0019  -0.0011 90  ASN A N   
618  C CA  . ASN A 91  ? 0.1006 0.1382 0.1040 0.0016  0.0001  0.0008  90  ASN A CA  
619  C C   . ASN A 91  ? 0.1311 0.1714 0.1383 0.0031  -0.0019 0.0013  90  ASN A C   
620  O O   . ASN A 91  ? 0.1053 0.1474 0.1112 0.0045  -0.0042 0.0014  90  ASN A O   
621  C CB  . ASN A 91  ? 0.1108 0.1449 0.1121 0.0013  0.0016  0.0023  90  ASN A CB  
622  C CG  . ASN A 91  ? 0.1780 0.2087 0.1737 -0.0005 0.0038  0.0021  90  ASN A CG  
623  O OD1 . ASN A 91  ? 0.1314 0.1614 0.1227 -0.0011 0.0038  0.0013  90  ASN A OD1 
624  N ND2 . ASN A 91  ? 0.1514 0.1800 0.1470 -0.0019 0.0060  0.0026  90  ASN A ND2 
625  N N   . GLU A 92  ? 0.0912 0.1322 0.1031 0.0027  -0.0010 0.0016  91  GLU A N   
626  C CA  . GLU A 92  ? 0.0911 0.1344 0.1061 0.0036  -0.0022 0.0020  91  GLU A CA  
627  C C   . GLU A 92  ? 0.1294 0.1766 0.1459 0.0033  -0.0034 0.0006  91  GLU A C   
628  O O   . GLU A 92  ? 0.1228 0.1728 0.1397 0.0047  -0.0050 0.0005  91  GLU A O   
629  C CB  . GLU A 92  ? 0.1095 0.1523 0.1283 0.0028  -0.0011 0.0023  91  GLU A CB  
630  C CG  . GLU A 92  ? 0.1375 0.1823 0.1585 0.0029  -0.0018 0.0026  91  GLU A CG  
631  C CD  . GLU A 92  ? 0.1780 0.2214 0.2011 0.0024  -0.0013 0.0033  91  GLU A CD  
632  O OE1 . GLU A 92  ? 0.1950 0.2365 0.2191 0.0020  -0.0006 0.0032  91  GLU A OE1 
633  O OE2 . GLU A 92  ? 0.2396 0.2837 0.2632 0.0025  -0.0016 0.0039  91  GLU A OE2 
634  N N   . LYS A 93  ? 0.1052 0.1528 0.1229 0.0016  -0.0027 -0.0008 92  LYS A N   
635  C CA  . LYS A 93  ? 0.1017 0.1531 0.1210 0.0004  -0.0036 -0.0025 92  LYS A CA  
636  C C   . LYS A 93  ? 0.1211 0.1754 0.1380 0.0014  -0.0056 -0.0036 92  LYS A C   
637  O O   . LYS A 93  ? 0.1249 0.1842 0.1439 0.0018  -0.0072 -0.0047 92  LYS A O   
638  C CB  . LYS A 93  ? 0.1207 0.1703 0.1412 -0.0019 -0.0022 -0.0038 92  LYS A CB  
639  C CG  . LYS A 93  ? 0.1290 0.1820 0.1510 -0.0041 -0.0027 -0.0059 92  LYS A CG  
640  C CD  . LYS A 93  ? 0.1799 0.2331 0.1994 -0.0049 -0.0032 -0.0079 92  LYS A CD  
641  C CE  . LYS A 93  ? 0.1792 0.2374 0.2000 -0.0068 -0.0044 -0.0104 92  LYS A CE  
642  N NZ  . LYS A 93  ? 0.1549 0.2126 0.1729 -0.0079 -0.0047 -0.0125 92  LYS A NZ  
643  N N   . ARG A 94  ? 0.0951 0.1465 0.1074 0.0018  -0.0057 -0.0034 93  ARG A N   
644  C CA  . ARG A 94  ? 0.1034 0.1564 0.1118 0.0030  -0.0081 -0.0040 93  ARG A CA  
645  C C   . ARG A 94  ? 0.1443 0.1984 0.1519 0.0063  -0.0106 -0.0028 93  ARG A C   
646  O O   . ARG A 94  ? 0.1390 0.1976 0.1470 0.0078  -0.0134 -0.0040 93  ARG A O   
647  C CB  . ARG A 94  ? 0.0901 0.1385 0.0921 0.0025  -0.0072 -0.0037 93  ARG A CB  
648  C CG  . ARG A 94  ? 0.1022 0.1516 0.0989 0.0035  -0.0102 -0.0045 93  ARG A CG  
649  C CD  . ARG A 94  ? 0.1483 0.1929 0.1377 0.0021  -0.0088 -0.0045 93  ARG A CD  
650  N NE  . ARG A 94  ? 0.1776 0.2225 0.1606 0.0030  -0.0119 -0.0050 93  ARG A NE  
651  C CZ  . ARG A 94  ? 0.2503 0.2905 0.2247 0.0021  -0.0112 -0.0047 93  ARG A CZ  
652  N NH1 . ARG A 94  ? 0.1540 0.1899 0.1266 0.0000  -0.0071 -0.0043 93  ARG A NH1 
653  N NH2 . ARG A 94  ? 0.1782 0.2183 0.1460 0.0030  -0.0146 -0.0050 93  ARG A NH2 
654  N N   . ILE A 95  ? 0.1105 0.1608 0.1173 0.0074  -0.0096 -0.0006 94  ILE A N   
655  C CA  . ILE A 95  ? 0.1059 0.1561 0.1117 0.0107  -0.0118 0.0004  94  ILE A CA  
656  C C   . ILE A 95  ? 0.1424 0.1992 0.1548 0.0114  -0.0125 -0.0012 94  ILE A C   
657  O O   . ILE A 95  ? 0.1287 0.1896 0.1421 0.0141  -0.0153 -0.0023 94  ILE A O   
658  C CB  . ILE A 95  ? 0.1408 0.1845 0.1436 0.0112  -0.0103 0.0027  94  ILE A CB  
659  C CG1 . ILE A 95  ? 0.1414 0.1787 0.1367 0.0102  -0.0095 0.0040  94  ILE A CG1 
660  C CG2 . ILE A 95  ? 0.1437 0.1868 0.1463 0.0146  -0.0123 0.0034  94  ILE A CG2 
661  C CD1 . ILE A 95  ? 0.1411 0.1728 0.1346 0.0088  -0.0067 0.0057  94  ILE A CD1 
662  N N   . LEU A 96  ? 0.1171 0.1751 0.1339 0.0091  -0.0101 -0.0014 95  LEU A N   
663  C CA  . LEU A 96  ? 0.1158 0.1796 0.1381 0.0089  -0.0099 -0.0029 95  LEU A CA  
664  C C   . LEU A 96  ? 0.1407 0.2120 0.1663 0.0083  -0.0114 -0.0057 95  LEU A C   
665  O O   . LEU A 96  ? 0.1494 0.2268 0.1788 0.0098  -0.0125 -0.0074 95  LEU A O   
666  C CB  . LEU A 96  ? 0.1261 0.1884 0.1506 0.0059  -0.0072 -0.0023 95  LEU A CB  
667  C CG  . LEU A 96  ? 0.1845 0.2426 0.2080 0.0068  -0.0062 -0.0004 95  LEU A CG  
668  C CD1 . LEU A 96  ? 0.1949 0.2512 0.2199 0.0040  -0.0041 0.0002  95  LEU A CD1 
669  C CD2 . LEU A 96  ? 0.1811 0.2420 0.2060 0.0092  -0.0070 -0.0009 95  LEU A CD2 
670  N N   . GLN A 97  ? 0.1107 0.1822 0.1353 0.0060  -0.0114 -0.0067 96  GLN A N   
671  C CA  . GLN A 97  ? 0.0904 0.1695 0.1184 0.0049  -0.0128 -0.0098 96  GLN A CA  
672  C C   . GLN A 97  ? 0.1486 0.2316 0.1756 0.0088  -0.0168 -0.0108 96  GLN A C   
673  O O   . GLN A 97  ? 0.1451 0.2365 0.1764 0.0088  -0.0186 -0.0138 96  GLN A O   
674  C CB  . GLN A 97  ? 0.1061 0.1840 0.1332 0.0010  -0.0116 -0.0110 96  GLN A CB  
675  C CG  . GLN A 97  ? 0.1197 0.1923 0.1408 0.0015  -0.0123 -0.0102 96  GLN A CG  
676  C CD  . GLN A 97  ? 0.1694 0.2457 0.1881 0.0033  -0.0158 -0.0117 96  GLN A CD  
677  O OE1 . GLN A 97  ? 0.1755 0.2591 0.1978 0.0022  -0.0174 -0.0147 96  GLN A OE1 
678  N NE2 . GLN A 97  ? 0.1191 0.1901 0.1311 0.0056  -0.0171 -0.0098 96  GLN A NE2 
679  N N   . ALA A 98  ? 0.1191 0.1958 0.1401 0.0121  -0.0183 -0.0083 97  ALA A N   
680  C CA  . ALA A 98  ? 0.1268 0.2047 0.1447 0.0164  -0.0226 -0.0085 97  ALA A CA  
681  C C   . ALA A 98  ? 0.1674 0.2463 0.1869 0.0212  -0.0246 -0.0082 97  ALA A C   
682  O O   . ALA A 98  ? 0.1659 0.2481 0.1849 0.0252  -0.0288 -0.0093 97  ALA A O   
683  C CB  . ALA A 98  ? 0.1462 0.2154 0.1549 0.0166  -0.0231 -0.0061 97  ALA A CB  
684  N N   . VAL A 99  ? 0.1246 0.2004 0.1454 0.0210  -0.0220 -0.0068 98  VAL A N   
685  C CA  . VAL A 99  ? 0.1164 0.1918 0.1381 0.0254  -0.0234 -0.0066 98  VAL A CA  
686  C C   . VAL A 99  ? 0.1582 0.2445 0.1890 0.0262  -0.0235 -0.0102 98  VAL A C   
687  O O   . VAL A 99  ? 0.1691 0.2617 0.2050 0.0220  -0.0211 -0.0122 98  VAL A O   
688  C CB  . VAL A 99  ? 0.1445 0.2108 0.1623 0.0252  -0.0209 -0.0037 98  VAL A CB  
689  C CG1 . VAL A 99  ? 0.1506 0.2070 0.1596 0.0248  -0.0210 -0.0006 98  VAL A CG1 
690  C CG2 . VAL A 99  ? 0.1258 0.1934 0.1477 0.0208  -0.0168 -0.0038 98  VAL A CG2 
691  N N   . ASN A 100 ? 0.1412 0.2291 0.1734 0.0313  -0.0259 -0.0112 99  ASN A N   
692  C CA  . ASN A 100 ? 0.1363 0.2349 0.1773 0.0328  -0.0259 -0.0151 99  ASN A CA  
693  C C   . ASN A 100 ? 0.1705 0.2654 0.2104 0.0385  -0.0273 -0.0147 99  ASN A C   
694  O O   . ASN A 100 ? 0.1618 0.2542 0.1986 0.0440  -0.0317 -0.0145 99  ASN A O   
695  C CB  . ASN A 100 ? 0.1952 0.3050 0.2414 0.0344  -0.0295 -0.0189 99  ASN A CB  
696  C CG  . ASN A 100 ? 0.3176 0.4400 0.3738 0.0363  -0.0296 -0.0236 99  ASN A CG  
697  O OD1 . ASN A 100 ? 0.2468 0.3717 0.3070 0.0339  -0.0255 -0.0247 99  ASN A OD1 
698  N ND2 . ASN A 100 ? 0.3484 0.4791 0.4087 0.0409  -0.0343 -0.0268 99  ASN A ND2 
699  N N   . PHE A 101 ? 0.1363 0.2297 0.1778 0.0371  -0.0237 -0.0147 100 PHE A N   
700  C CA  . PHE A 101 ? 0.1365 0.2257 0.1770 0.0420  -0.0245 -0.0147 100 PHE A CA  
701  C C   . PHE A 101 ? 0.1745 0.2687 0.2204 0.0397  -0.0204 -0.0170 100 PHE A C   
702  O O   . PHE A 101 ? 0.1510 0.2453 0.1971 0.0339  -0.0167 -0.0161 100 PHE A O   
703  C CB  . PHE A 101 ? 0.1589 0.2334 0.1894 0.0429  -0.0250 -0.0102 100 PHE A CB  
704  C CG  . PHE A 101 ? 0.1685 0.2369 0.1962 0.0490  -0.0273 -0.0102 100 PHE A CG  
705  C CD1 . PHE A 101 ? 0.1848 0.2537 0.2118 0.0555  -0.0324 -0.0113 100 PHE A CD1 
706  C CD2 . PHE A 101 ? 0.1763 0.2379 0.2018 0.0485  -0.0247 -0.0093 100 PHE A CD2 
707  C CE1 . PHE A 101 ? 0.2041 0.2660 0.2279 0.0616  -0.0348 -0.0112 100 PHE A CE1 
708  C CE2 . PHE A 101 ? 0.2007 0.2558 0.2233 0.0541  -0.0267 -0.0096 100 PHE A CE2 
709  C CZ  . PHE A 101 ? 0.1951 0.2499 0.2167 0.0607  -0.0317 -0.0104 100 PHE A CZ  
710  N N   . PRO A 102 ? 0.1415 0.2403 0.1919 0.0444  -0.0212 -0.0202 101 PRO A N   
711  C CA  . PRO A 102 ? 0.1357 0.2404 0.1912 0.0418  -0.0169 -0.0229 101 PRO A CA  
712  C C   . PRO A 102 ? 0.1673 0.2630 0.2174 0.0377  -0.0133 -0.0199 101 PRO A C   
713  O O   . PRO A 102 ? 0.1673 0.2673 0.2199 0.0332  -0.0094 -0.0212 101 PRO A O   
714  C CB  . PRO A 102 ? 0.1640 0.2726 0.2238 0.0486  -0.0188 -0.0266 101 PRO A CB  
715  C CG  . PRO A 102 ? 0.2163 0.3248 0.2755 0.0547  -0.0245 -0.0267 101 PRO A CG  
716  C CD  . PRO A 102 ? 0.1701 0.2692 0.2211 0.0523  -0.0260 -0.0218 101 PRO A CD  
717  N N   . PHE A 103 ? 0.1196 0.2029 0.1618 0.0387  -0.0145 -0.0160 102 PHE A N   
718  C CA  . PHE A 103 ? 0.1084 0.1836 0.1459 0.0353  -0.0116 -0.0134 102 PHE A CA  
719  C C   . PHE A 103 ? 0.1295 0.1997 0.1629 0.0304  -0.0106 -0.0098 102 PHE A C   
720  O O   . PHE A 103 ? 0.1192 0.1812 0.1478 0.0287  -0.0095 -0.0072 102 PHE A O   
721  C CB  . PHE A 103 ? 0.1273 0.1929 0.1598 0.0393  -0.0127 -0.0125 102 PHE A CB  
722  C CG  . PHE A 103 ? 0.1346 0.2044 0.1711 0.0453  -0.0143 -0.0163 102 PHE A CG  
723  C CD1 . PHE A 103 ? 0.1470 0.2274 0.1906 0.0449  -0.0119 -0.0206 102 PHE A CD1 
724  C CD2 . PHE A 103 ? 0.1451 0.2080 0.1779 0.0514  -0.0181 -0.0158 102 PHE A CD2 
725  C CE1 . PHE A 103 ? 0.1522 0.2380 0.2008 0.0508  -0.0134 -0.0249 102 PHE A CE1 
726  C CE2 . PHE A 103 ? 0.1694 0.2362 0.2063 0.0578  -0.0200 -0.0196 102 PHE A CE2 
727  C CZ  . PHE A 103 ? 0.1450 0.2239 0.1905 0.0576  -0.0176 -0.0244 102 PHE A CZ  
728  N N   . LEU A 104 ? 0.1087 0.1843 0.1445 0.0282  -0.0110 -0.0101 103 LEU A N   
729  C CA  . LEU A 104 ? 0.1098 0.1816 0.1427 0.0237  -0.0098 -0.0074 103 LEU A CA  
730  C C   . LEU A 104 ? 0.1547 0.2335 0.1919 0.0192  -0.0073 -0.0089 103 LEU A C   
731  O O   . LEU A 104 ? 0.1515 0.2392 0.1939 0.0195  -0.0076 -0.0120 103 LEU A O   
732  C CB  . LEU A 104 ? 0.1148 0.1848 0.1451 0.0248  -0.0125 -0.0061 103 LEU A CB  
733  C CG  . LEU A 104 ? 0.1500 0.2114 0.1741 0.0286  -0.0150 -0.0040 103 LEU A CG  
734  C CD1 . LEU A 104 ? 0.1384 0.1988 0.1594 0.0292  -0.0175 -0.0031 103 LEU A CD1 
735  C CD2 . LEU A 104 ? 0.1400 0.1922 0.1591 0.0266  -0.0130 -0.0013 103 LEU A CD2 
736  N N   . VAL A 105 ? 0.1176 0.1923 0.1525 0.0151  -0.0050 -0.0069 104 VAL A N   
737  C CA  . VAL A 105 ? 0.1152 0.1938 0.1522 0.0104  -0.0028 -0.0077 104 VAL A CA  
738  C C   . VAL A 105 ? 0.1664 0.2481 0.2049 0.0094  -0.0040 -0.0083 104 VAL A C   
739  O O   . VAL A 105 ? 0.1682 0.2452 0.2037 0.0105  -0.0057 -0.0065 104 VAL A O   
740  C CB  . VAL A 105 ? 0.1461 0.2182 0.1794 0.0071  -0.0010 -0.0051 104 VAL A CB  
741  C CG1 . VAL A 105 ? 0.1402 0.2137 0.1739 0.0025  0.0008  -0.0052 104 VAL A CG1 
742  C CG2 . VAL A 105 ? 0.1511 0.2217 0.1830 0.0075  0.0003  -0.0052 104 VAL A CG2 
743  N N   A LYS A 106 ? 0.1268 0.2165 0.1698 0.0072  -0.0031 -0.0111 105 LYS A N   
744  N N   B LYS A 106 ? 0.1218 0.2114 0.1647 0.0071  -0.0030 -0.0111 105 LYS A N   
745  C CA  A LYS A 106 ? 0.1246 0.2182 0.1694 0.0058  -0.0042 -0.0124 105 LYS A CA  
746  C CA  B LYS A 106 ? 0.1169 0.2104 0.1617 0.0056  -0.0041 -0.0124 105 LYS A CA  
747  C C   A LYS A 106 ? 0.1686 0.2574 0.2108 0.0010  -0.0025 -0.0108 105 LYS A C   
748  C C   B LYS A 106 ? 0.1649 0.2534 0.2069 0.0010  -0.0025 -0.0107 105 LYS A C   
749  O O   A LYS A 106 ? 0.1619 0.2489 0.2032 -0.0026 0.0001  -0.0103 105 LYS A O   
750  O O   B LYS A 106 ? 0.1585 0.2447 0.1994 -0.0025 0.0001  -0.0101 105 LYS A O   
751  C CB  A LYS A 106 ? 0.1509 0.2561 0.2024 0.0051  -0.0039 -0.0168 105 LYS A CB  
752  C CB  B LYS A 106 ? 0.1362 0.2412 0.1876 0.0044  -0.0035 -0.0168 105 LYS A CB  
753  C CG  A LYS A 106 ? 0.2756 0.3864 0.3297 0.0038  -0.0056 -0.0189 105 LYS A CG  
754  C CG  B LYS A 106 ? 0.1903 0.3023 0.2460 0.0098  -0.0061 -0.0194 105 LYS A CG  
755  C CD  A LYS A 106 ? 0.3545 0.4782 0.4163 0.0030  -0.0053 -0.0239 105 LYS A CD  
756  C CD  B LYS A 106 ? 0.3169 0.4419 0.3803 0.0082  -0.0056 -0.0243 105 LYS A CD  
757  N N   . LEU A 107 ? 0.1239 0.2105 0.1645 0.0010  -0.0041 -0.0102 106 LEU A N   
758  C CA  . LEU A 107 ? 0.1179 0.2000 0.1564 -0.0029 -0.0028 -0.0094 106 LEU A CA  
759  C C   . LEU A 107 ? 0.1498 0.2393 0.1921 -0.0064 -0.0021 -0.0127 106 LEU A C   
760  O O   . LEU A 107 ? 0.1493 0.2449 0.1942 -0.0050 -0.0043 -0.0150 106 LEU A O   
761  C CB  . LEU A 107 ? 0.1280 0.2055 0.1633 -0.0013 -0.0045 -0.0081 106 LEU A CB  
762  C CG  . LEU A 107 ? 0.1843 0.2572 0.2178 -0.0048 -0.0033 -0.0078 106 LEU A CG  
763  C CD1 . LEU A 107 ? 0.1966 0.2624 0.2279 -0.0062 -0.0014 -0.0054 106 LEU A CD1 
764  C CD2 . LEU A 107 ? 0.2252 0.2951 0.2559 -0.0034 -0.0047 -0.0075 106 LEU A CD2 
765  N N   . GLU A 108 ? 0.1216 0.2107 0.1641 -0.0110 0.0008  -0.0131 107 GLU A N   
766  C CA  . GLU A 108 ? 0.1209 0.2169 0.1670 -0.0154 0.0022  -0.0166 107 GLU A CA  
767  C C   . GLU A 108 ? 0.1566 0.2491 0.2009 -0.0188 0.0022  -0.0170 107 GLU A C   
768  O O   . GLU A 108 ? 0.1574 0.2569 0.2052 -0.0207 0.0016  -0.0203 107 GLU A O   
769  C CB  . GLU A 108 ? 0.1372 0.2336 0.1831 -0.0195 0.0058  -0.0169 107 GLU A CB  
770  C CG  . GLU A 108 ? 0.2260 0.3269 0.2741 -0.0165 0.0061  -0.0174 107 GLU A CG  
771  C CD  . GLU A 108 ? 0.4485 0.5625 0.5040 -0.0152 0.0057  -0.0219 107 GLU A CD  
772  O OE1 . GLU A 108 ? 0.2883 0.4093 0.3479 -0.0170 0.0050  -0.0250 107 GLU A OE1 
773  O OE2 . GLU A 108 ? 0.4517 0.5691 0.5090 -0.0125 0.0062  -0.0227 107 GLU A OE2 
774  N N   . PHE A 109 ? 0.0944 0.1762 0.1335 -0.0194 0.0028  -0.0139 108 PHE A N   
775  C CA  . PHE A 109 ? 0.0937 0.1703 0.1304 -0.0220 0.0029  -0.0142 108 PHE A CA  
776  C C   . PHE A 109 ? 0.1322 0.1996 0.1649 -0.0191 0.0021  -0.0111 108 PHE A C   
777  O O   . PHE A 109 ? 0.1169 0.1808 0.1481 -0.0166 0.0021  -0.0085 108 PHE A O   
778  C CB  . PHE A 109 ? 0.1113 0.1836 0.1460 -0.0280 0.0059  -0.0145 108 PHE A CB  
779  C CG  . PHE A 109 ? 0.1281 0.2088 0.1664 -0.0323 0.0079  -0.0175 108 PHE A CG  
780  C CD1 . PHE A 109 ? 0.1643 0.2531 0.2067 -0.0353 0.0078  -0.0216 108 PHE A CD1 
781  C CD2 . PHE A 109 ? 0.1552 0.2363 0.1928 -0.0335 0.0101  -0.0166 108 PHE A CD2 
782  C CE1 . PHE A 109 ? 0.1903 0.2881 0.2370 -0.0397 0.0101  -0.0250 108 PHE A CE1 
783  C CE2 . PHE A 109 ? 0.1866 0.2765 0.2280 -0.0377 0.0126  -0.0199 108 PHE A CE2 
784  C CZ  . PHE A 109 ? 0.1677 0.2663 0.2141 -0.0409 0.0126  -0.0242 108 PHE A CZ  
785  N N   . SER A 110 ? 0.1250 0.1886 0.1560 -0.0197 0.0016  -0.0118 109 SER A N   
786  C CA  . SER A 110 ? 0.1117 0.1669 0.1395 -0.0177 0.0015  -0.0096 109 SER A CA  
787  C C   . SER A 110 ? 0.1577 0.2076 0.1836 -0.0205 0.0022  -0.0110 109 SER A C   
788  O O   . SER A 110 ? 0.1538 0.2077 0.1808 -0.0233 0.0022  -0.0139 109 SER A O   
789  C CB  . SER A 110 ? 0.1429 0.1996 0.1706 -0.0133 -0.0003 -0.0089 109 SER A CB  
790  O OG  . SER A 110 ? 0.1742 0.2333 0.2015 -0.0136 -0.0013 -0.0112 109 SER A OG  
791  N N   . PHE A 111 ? 0.1103 0.1514 0.1336 -0.0198 0.0028  -0.0093 110 PHE A N   
792  C CA  . PHE A 111 ? 0.1152 0.1498 0.1363 -0.0218 0.0034  -0.0107 110 PHE A CA  
793  C C   . PHE A 111 ? 0.1516 0.1781 0.1711 -0.0188 0.0033  -0.0087 110 PHE A C   
794  O O   . PHE A 111 ? 0.1449 0.1716 0.1650 -0.0160 0.0027  -0.0063 110 PHE A O   
795  C CB  . PHE A 111 ? 0.1357 0.1673 0.1552 -0.0272 0.0050  -0.0117 110 PHE A CB  
796  C CG  . PHE A 111 ? 0.1432 0.1713 0.1609 -0.0283 0.0059  -0.0090 110 PHE A CG  
797  C CD1 . PHE A 111 ? 0.1674 0.2031 0.1872 -0.0293 0.0064  -0.0089 110 PHE A CD1 
798  C CD2 . PHE A 111 ? 0.1684 0.1854 0.1818 -0.0281 0.0061  -0.0067 110 PHE A CD2 
799  C CE1 . PHE A 111 ? 0.1747 0.2070 0.1919 -0.0304 0.0074  -0.0065 110 PHE A CE1 
800  C CE2 . PHE A 111 ? 0.2072 0.2203 0.2175 -0.0293 0.0067  -0.0041 110 PHE A CE2 
801  C CZ  . PHE A 111 ? 0.1738 0.1946 0.1858 -0.0307 0.0076  -0.0040 110 PHE A CZ  
802  N N   . LYS A 112 ? 0.1482 0.1679 0.1659 -0.0193 0.0037  -0.0100 111 LYS A N   
803  C CA  . LYS A 112 ? 0.1359 0.1483 0.1528 -0.0161 0.0033  -0.0089 111 LYS A CA  
804  C C   . LYS A 112 ? 0.2073 0.2098 0.2210 -0.0181 0.0039  -0.0098 111 LYS A C   
805  O O   . LYS A 112 ? 0.2039 0.2057 0.2161 -0.0223 0.0049  -0.0119 111 LYS A O   
806  C CB  . LYS A 112 ? 0.1389 0.1545 0.1579 -0.0127 0.0032  -0.0103 111 LYS A CB  
807  C CG  . LYS A 112 ? 0.1769 0.1925 0.1949 -0.0145 0.0039  -0.0139 111 LYS A CG  
808  C CD  . LYS A 112 ? 0.1839 0.2035 0.2028 -0.0121 0.0042  -0.0153 111 LYS A CD  
809  C CE  . LYS A 112 ? 0.2655 0.2857 0.2824 -0.0146 0.0047  -0.0188 111 LYS A CE  
810  N NZ  . LYS A 112 ? 0.3025 0.3279 0.3185 -0.0133 0.0048  -0.0200 111 LYS A NZ  
811  N N   . ASP A 113 ? 0.1553 0.1500 0.1680 -0.0152 0.0031  -0.0084 112 ASP A N   
812  C CA  . ASP A 113 ? 0.1613 0.1449 0.1704 -0.0161 0.0033  -0.0092 112 ASP A CA  
813  C C   . ASP A 113 ? 0.2052 0.1857 0.2165 -0.0110 0.0025  -0.0103 112 ASP A C   
814  O O   . ASP A 113 ? 0.1931 0.1813 0.2085 -0.0081 0.0025  -0.0110 112 ASP A O   
815  C CB  . ASP A 113 ? 0.1937 0.1684 0.1976 -0.0183 0.0030  -0.0062 112 ASP A CB  
816  C CG  . ASP A 113 ? 0.2129 0.1861 0.2165 -0.0148 0.0011  -0.0027 112 ASP A CG  
817  O OD1 . ASP A 113 ? 0.1921 0.1685 0.1997 -0.0097 -0.0002 -0.0027 112 ASP A OD1 
818  O OD2 . ASP A 113 ? 0.2091 0.1791 0.2086 -0.0174 0.0012  -0.0002 112 ASP A OD2 
819  N N   . ASN A 114 ? 0.1792 0.1485 0.1877 -0.0096 0.0018  -0.0105 113 ASN A N   
820  C CA  . ASN A 114 ? 0.1651 0.1323 0.1768 -0.0042 0.0011  -0.0123 113 ASN A CA  
821  C C   . ASN A 114 ? 0.2084 0.1814 0.2247 0.0006  -0.0004 -0.0107 113 ASN A C   
822  O O   . ASN A 114 ? 0.1824 0.1604 0.2034 0.0039  0.0000  -0.0131 113 ASN A O   
823  C CB  . ASN A 114 ? 0.1878 0.1410 0.1955 -0.0028 0.0000  -0.0125 113 ASN A CB  
824  C CG  . ASN A 114 ? 0.3453 0.2927 0.3500 -0.0063 0.0018  -0.0159 113 ASN A CG  
825  O OD1 . ASN A 114 ? 0.2159 0.1706 0.2222 -0.0089 0.0037  -0.0187 113 ASN A OD1 
826  N ND2 . ASN A 114 ? 0.2652 0.1987 0.2649 -0.0062 0.0011  -0.0157 113 ASN A ND2 
827  N N   . SER A 115 ? 0.1687 0.1411 0.1833 0.0006  -0.0020 -0.0069 114 SER A N   
828  C CA  . SER A 115 ? 0.1590 0.1356 0.1773 0.0048  -0.0039 -0.0054 114 SER A CA  
829  C C   . SER A 115 ? 0.1963 0.1832 0.2168 0.0036  -0.0034 -0.0039 114 SER A C   
830  O O   . SER A 115 ? 0.1952 0.1881 0.2203 0.0067  -0.0040 -0.0042 114 SER A O   
831  C CB  . SER A 115 ? 0.1739 0.1408 0.1880 0.0067  -0.0068 -0.0023 114 SER A CB  
832  O OG  . SER A 115 ? 0.2160 0.1730 0.2290 0.0099  -0.0082 -0.0036 114 SER A OG  
833  N N   . ASN A 116 ? 0.1168 0.1056 0.1342 -0.0009 -0.0023 -0.0026 115 ASN A N   
834  C CA  . ASN A 116 ? 0.1128 0.1097 0.1315 -0.0017 -0.0021 -0.0011 115 ASN A CA  
835  C C   . ASN A 116 ? 0.1595 0.1639 0.1791 -0.0047 -0.0002 -0.0025 115 ASN A C   
836  O O   . ASN A 116 ? 0.1544 0.1577 0.1725 -0.0074 0.0009  -0.0044 115 ASN A O   
837  C CB  . ASN A 116 ? 0.1367 0.1295 0.1510 -0.0035 -0.0030 0.0021  115 ASN A CB  
838  C CG  . ASN A 116 ? 0.2325 0.2165 0.2441 -0.0008 -0.0055 0.0041  115 ASN A CG  
839  O OD1 . ASN A 116 ? 0.2601 0.2460 0.2753 0.0035  -0.0073 0.0041  115 ASN A OD1 
840  N ND2 . ASN A 116 ? 0.2062 0.1803 0.2115 -0.0031 -0.0057 0.0055  115 ASN A ND2 
841  N N   . LEU A 117 ? 0.1148 0.1266 0.1364 -0.0041 -0.0003 -0.0015 116 LEU A N   
842  C CA  . LEU A 117 ? 0.1070 0.1259 0.1291 -0.0060 0.0006  -0.0023 116 LEU A CA  
843  C C   . LEU A 117 ? 0.1493 0.1699 0.1701 -0.0077 0.0004  -0.0003 116 LEU A C   
844  O O   . LEU A 117 ? 0.1472 0.1662 0.1676 -0.0062 -0.0005 0.0017  116 LEU A O   
845  C CB  . LEU A 117 ? 0.1036 0.1282 0.1282 -0.0037 0.0008  -0.0028 116 LEU A CB  
846  C CG  . LEU A 117 ? 0.1385 0.1621 0.1647 -0.0019 0.0014  -0.0048 116 LEU A CG  
847  C CD1 . LEU A 117 ? 0.1321 0.1607 0.1599 -0.0004 0.0019  -0.0049 116 LEU A CD1 
848  C CD2 . LEU A 117 ? 0.1403 0.1627 0.1650 -0.0038 0.0024  -0.0074 116 LEU A CD2 
849  N N   . TYR A 118 ? 0.1071 0.1316 0.1275 -0.0107 0.0013  -0.0012 117 TYR A N   
850  C CA  . TYR A 118 ? 0.1086 0.1355 0.1281 -0.0125 0.0017  -0.0001 117 TYR A CA  
851  C C   . TYR A 118 ? 0.1498 0.1855 0.1719 -0.0124 0.0017  -0.0013 117 TYR A C   
852  O O   . TYR A 118 ? 0.1139 0.1532 0.1372 -0.0134 0.0018  -0.0035 117 TYR A O   
853  C CB  . TYR A 118 ? 0.1164 0.1390 0.1329 -0.0169 0.0029  -0.0004 117 TYR A CB  
854  C CG  . TYR A 118 ? 0.1375 0.1494 0.1502 -0.0170 0.0025  0.0009  117 TYR A CG  
855  C CD1 . TYR A 118 ? 0.1633 0.1705 0.1757 -0.0169 0.0025  -0.0008 117 TYR A CD1 
856  C CD2 . TYR A 118 ? 0.1505 0.1562 0.1592 -0.0172 0.0020  0.0036  117 TYR A CD2 
857  C CE1 . TYR A 118 ? 0.1662 0.1628 0.1751 -0.0163 0.0018  0.0002  117 TYR A CE1 
858  C CE2 . TYR A 118 ? 0.1634 0.1583 0.1679 -0.0167 0.0010  0.0049  117 TYR A CE2 
859  C CZ  . TYR A 118 ? 0.1665 0.1567 0.1714 -0.0160 0.0009  0.0032  117 TYR A CZ  
860  O OH  . TYR A 118 ? 0.1823 0.1611 0.1830 -0.0149 -0.0004 0.0044  117 TYR A OH  
861  N N   . MET A 119 ? 0.1152 0.1541 0.1379 -0.0113 0.0015  -0.0001 118 MET A N   
862  C CA  . MET A 119 ? 0.0995 0.1462 0.1245 -0.0106 0.0013  -0.0013 118 MET A CA  
863  C C   . MET A 119 ? 0.1442 0.1929 0.1690 -0.0125 0.0024  -0.0010 118 MET A C   
864  O O   . MET A 119 ? 0.1374 0.1831 0.1604 -0.0118 0.0025  0.0009  118 MET A O   
865  C CB  . MET A 119 ? 0.1250 0.1730 0.1507 -0.0067 0.0002  -0.0004 118 MET A CB  
866  C CG  . MET A 119 ? 0.1635 0.2112 0.1892 -0.0055 -0.0004 -0.0012 118 MET A CG  
867  S SD  . MET A 119 ? 0.2126 0.2597 0.2376 -0.0021 -0.0011 0.0001  118 MET A SD  
868  C CE  . MET A 119 ? 0.1823 0.2239 0.2074 -0.0018 -0.0006 0.0013  118 MET A CE  
869  N N   . VAL A 120 ? 0.0949 0.1488 0.1214 -0.0154 0.0035  -0.0033 119 VAL A N   
870  C CA  . VAL A 120 ? 0.0917 0.1485 0.1181 -0.0182 0.0053  -0.0038 119 VAL A CA  
871  C C   . VAL A 120 ? 0.1416 0.2068 0.1718 -0.0155 0.0048  -0.0053 119 VAL A C   
872  O O   . VAL A 120 ? 0.1255 0.1976 0.1595 -0.0147 0.0039  -0.0078 119 VAL A O   
873  C CB  . VAL A 120 ? 0.1368 0.1945 0.1631 -0.0236 0.0073  -0.0059 119 VAL A CB  
874  C CG1 . VAL A 120 ? 0.1322 0.1934 0.1583 -0.0272 0.0099  -0.0068 119 VAL A CG1 
875  C CG2 . VAL A 120 ? 0.1385 0.1859 0.1602 -0.0257 0.0075  -0.0043 119 VAL A CG2 
876  N N   . LEU A 121 ? 0.1295 0.1937 0.1585 -0.0140 0.0051  -0.0039 120 LEU A N   
877  C CA  . LEU A 121 ? 0.1108 0.1813 0.1428 -0.0107 0.0044  -0.0052 120 LEU A CA  
878  C C   . LEU A 121 ? 0.1450 0.2204 0.1781 -0.0129 0.0068  -0.0070 120 LEU A C   
879  O O   . LEU A 121 ? 0.1433 0.2155 0.1731 -0.0170 0.0089  -0.0062 120 LEU A O   
880  C CB  . LEU A 121 ? 0.1126 0.1778 0.1421 -0.0072 0.0031  -0.0027 120 LEU A CB  
881  C CG  . LEU A 121 ? 0.1755 0.2351 0.2034 -0.0055 0.0015  -0.0007 120 LEU A CG  
882  C CD1 . LEU A 121 ? 0.1985 0.2533 0.2241 -0.0036 0.0010  0.0015  120 LEU A CD1 
883  C CD2 . LEU A 121 ? 0.2155 0.2782 0.2453 -0.0029 -0.0001 -0.0018 120 LEU A CD2 
884  N N   . GLU A 122 ? 0.1125 0.1955 0.1498 -0.0102 0.0063  -0.0094 121 GLU A N   
885  C CA  . GLU A 122 ? 0.1371 0.2253 0.1757 -0.0120 0.0089  -0.0115 121 GLU A CA  
886  C C   . GLU A 122 ? 0.1725 0.2537 0.2057 -0.0123 0.0099  -0.0089 121 GLU A C   
887  O O   . GLU A 122 ? 0.1607 0.2357 0.1912 -0.0092 0.0079  -0.0063 121 GLU A O   
888  C CB  . GLU A 122 ? 0.1661 0.2642 0.2110 -0.0083 0.0081  -0.0151 121 GLU A CB  
889  C CG  . GLU A 122 ? 0.2783 0.3739 0.3228 -0.0023 0.0055  -0.0140 121 GLU A CG  
890  C CD  . GLU A 122 ? 0.3387 0.4432 0.3891 0.0021  0.0039  -0.0176 121 GLU A CD  
891  O OE1 . GLU A 122 ? 0.3101 0.4232 0.3651 0.0010  0.0059  -0.0213 121 GLU A OE1 
892  O OE2 . GLU A 122 ? 0.1771 0.2795 0.2273 0.0067  0.0006  -0.0167 121 GLU A OE2 
893  N N   . TYR A 123 ? 0.1283 0.2099 0.1590 -0.0166 0.0131  -0.0096 122 TYR A N   
894  C CA  . TYR A 123 ? 0.1151 0.1900 0.1397 -0.0173 0.0138  -0.0073 122 TYR A CA  
895  C C   . TYR A 123 ? 0.1474 0.2278 0.1736 -0.0159 0.0154  -0.0099 122 TYR A C   
896  O O   . TYR A 123 ? 0.1408 0.2293 0.1705 -0.0182 0.0181  -0.0134 122 TYR A O   
897  C CB  . TYR A 123 ? 0.1318 0.2007 0.1501 -0.0231 0.0160  -0.0056 122 TYR A CB  
898  C CG  . TYR A 123 ? 0.1363 0.1987 0.1473 -0.0241 0.0166  -0.0034 122 TYR A CG  
899  C CD1 . TYR A 123 ? 0.1599 0.2155 0.1679 -0.0208 0.0136  -0.0004 122 TYR A CD1 
900  C CD2 . TYR A 123 ? 0.1489 0.2121 0.1558 -0.0288 0.0203  -0.0045 122 TYR A CD2 
901  C CE1 . TYR A 123 ? 0.1766 0.2266 0.1779 -0.0216 0.0136  0.0014  122 TYR A CE1 
902  C CE2 . TYR A 123 ? 0.1480 0.2048 0.1472 -0.0298 0.0205  -0.0024 122 TYR A CE2 
903  C CZ  . TYR A 123 ? 0.1977 0.2480 0.1942 -0.0260 0.0169  0.0005  122 TYR A CZ  
904  O OH  . TYR A 123 ? 0.2093 0.2536 0.1981 -0.0268 0.0166  0.0024  122 TYR A OH  
905  N N   . LEU A 124 ? 0.1325 0.2090 0.1565 -0.0125 0.0139  -0.0085 123 LEU A N   
906  C CA  . LEU A 124 ? 0.1385 0.2187 0.1634 -0.0107 0.0152  -0.0110 123 LEU A CA  
907  C C   . LEU A 124 ? 0.1561 0.2297 0.1732 -0.0134 0.0164  -0.0090 123 LEU A C   
908  O O   . LEU A 124 ? 0.1332 0.1997 0.1465 -0.0117 0.0140  -0.0062 123 LEU A O   
909  C CB  . LEU A 124 ? 0.1453 0.2251 0.1730 -0.0045 0.0122  -0.0111 123 LEU A CB  
910  C CG  . LEU A 124 ? 0.2144 0.3010 0.2490 -0.0011 0.0106  -0.0134 123 LEU A CG  
911  C CD1 . LEU A 124 ? 0.2401 0.3232 0.2745 -0.0011 0.0082  -0.0108 123 LEU A CD1 
912  C CD2 . LEU A 124 ? 0.2341 0.3203 0.2703 0.0046  0.0085  -0.0143 123 LEU A CD2 
913  N N   . PRO A 125 ? 0.1267 0.2024 0.1408 -0.0182 0.0202  -0.0105 124 PRO A N   
914  C CA  . PRO A 125 ? 0.1291 0.1976 0.1342 -0.0211 0.0210  -0.0083 124 PRO A CA  
915  C C   . PRO A 125 ? 0.1730 0.2400 0.1763 -0.0179 0.0202  -0.0090 124 PRO A C   
916  O O   . PRO A 125 ? 0.1747 0.2347 0.1706 -0.0191 0.0194  -0.0066 124 PRO A O   
917  C CB  . PRO A 125 ? 0.1529 0.2246 0.1552 -0.0271 0.0258  -0.0104 124 PRO A CB  
918  C CG  . PRO A 125 ? 0.2092 0.2928 0.2211 -0.0263 0.0277  -0.0151 124 PRO A CG  
919  C CD  . PRO A 125 ? 0.1607 0.2456 0.1792 -0.0214 0.0237  -0.0144 124 PRO A CD  
920  N N   . GLY A 126 ? 0.1578 0.2308 0.1676 -0.0136 0.0200  -0.0121 125 GLY A N   
921  C CA  . GLY A 126 ? 0.1588 0.2299 0.1676 -0.0101 0.0190  -0.0130 125 GLY A CA  
922  C C   . GLY A 126 ? 0.1933 0.2560 0.1986 -0.0084 0.0152  -0.0092 125 GLY A C   
923  O O   . GLY A 126 ? 0.1816 0.2406 0.1832 -0.0074 0.0145  -0.0093 125 GLY A O   
924  N N   . GLY A 127 ? 0.1459 0.2058 0.1522 -0.0082 0.0129  -0.0063 126 GLY A N   
925  C CA  . GLY A 127 ? 0.1400 0.1932 0.1441 -0.0070 0.0097  -0.0031 126 GLY A CA  
926  C C   . GLY A 127 ? 0.1507 0.2032 0.1583 -0.0027 0.0075  -0.0034 126 GLY A C   
927  O O   . GLY A 127 ? 0.1392 0.1959 0.1513 0.0000  0.0079  -0.0056 126 GLY A O   
928  N N   . GLU A 128 ? 0.1071 0.1543 0.1124 -0.0022 0.0052  -0.0012 127 GLU A N   
929  C CA  . GLU A 128 ? 0.0877 0.1330 0.0952 0.0009  0.0035  -0.0012 127 GLU A CA  
930  C C   . GLU A 128 ? 0.1308 0.1748 0.1364 0.0021  0.0040  -0.0033 127 GLU A C   
931  O O   . GLU A 128 ? 0.1154 0.1580 0.1168 0.0002  0.0046  -0.0038 127 GLU A O   
932  C CB  . GLU A 128 ? 0.0937 0.1348 0.1003 0.0004  0.0011  0.0013  127 GLU A CB  
933  C CG  . GLU A 128 ? 0.1845 0.2259 0.1925 -0.0006 0.0005  0.0032  127 GLU A CG  
934  C CD  . GLU A 128 ? 0.2676 0.3057 0.2752 -0.0009 -0.0017 0.0052  127 GLU A CD  
935  O OE1 . GLU A 128 ? 0.1861 0.2222 0.1919 -0.0010 -0.0029 0.0053  127 GLU A OE1 
936  O OE2 . GLU A 128 ? 0.1755 0.2136 0.1851 -0.0009 -0.0022 0.0064  127 GLU A OE2 
937  N N   . MET A 129 ? 0.1016 0.1447 0.1095 0.0053  0.0035  -0.0045 128 MET A N   
938  C CA  . MET A 129 ? 0.0916 0.1318 0.0976 0.0068  0.0037  -0.0065 128 MET A CA  
939  C C   . MET A 129 ? 0.1357 0.1714 0.1377 0.0044  0.0026  -0.0053 128 MET A C   
940  O O   . MET A 129 ? 0.1290 0.1631 0.1277 0.0038  0.0032  -0.0071 128 MET A O   
941  C CB  . MET A 129 ? 0.1132 0.1502 0.1207 0.0102  0.0025  -0.0066 128 MET A CB  
942  C CG  . MET A 129 ? 0.1354 0.1675 0.1402 0.0118  0.0026  -0.0086 128 MET A CG  
943  S SD  . MET A 129 ? 0.1640 0.1892 0.1682 0.0149  0.0010  -0.0078 128 MET A SD  
944  C CE  . MET A 129 ? 0.1323 0.1625 0.1407 0.0195  0.0007  -0.0091 128 MET A CE  
945  N N   . PHE A 130 ? 0.1032 0.1375 0.1058 0.0032  0.0008  -0.0027 129 PHE A N   
946  C CA  . PHE A 130 ? 0.1098 0.1414 0.1100 0.0012  -0.0008 -0.0018 129 PHE A CA  
947  C C   . PHE A 130 ? 0.1591 0.1908 0.1546 -0.0009 -0.0005 -0.0026 129 PHE A C   
948  O O   . PHE A 130 ? 0.1415 0.1707 0.1342 -0.0017 -0.0013 -0.0037 129 PHE A O   
949  C CB  . PHE A 130 ? 0.1248 0.1569 0.1272 0.0004  -0.0024 0.0007  129 PHE A CB  
950  C CG  . PHE A 130 ? 0.1358 0.1665 0.1369 -0.0012 -0.0046 0.0012  129 PHE A CG  
951  C CD1 . PHE A 130 ? 0.1613 0.1905 0.1640 -0.0015 -0.0054 0.0007  129 PHE A CD1 
952  C CD2 . PHE A 130 ? 0.1530 0.1839 0.1510 -0.0026 -0.0059 0.0022  129 PHE A CD2 
953  C CE1 . PHE A 130 ? 0.1814 0.2108 0.1839 -0.0030 -0.0075 0.0005  129 PHE A CE1 
954  C CE2 . PHE A 130 ? 0.1831 0.2133 0.1801 -0.0036 -0.0085 0.0024  129 PHE A CE2 
955  C CZ  . PHE A 130 ? 0.1625 0.1928 0.1624 -0.0038 -0.0094 0.0013  129 PHE A CZ  
956  N N   . SER A 131 ? 0.1096 0.1435 0.1036 -0.0022 0.0004  -0.0019 130 SER A N   
957  C CA  . SER A 131 ? 0.1122 0.1450 0.1000 -0.0047 0.0005  -0.0020 130 SER A CA  
958  C C   . SER A 131 ? 0.1509 0.1839 0.1360 -0.0047 0.0026  -0.0052 130 SER A C   
959  O O   . SER A 131 ? 0.1371 0.1679 0.1172 -0.0062 0.0019  -0.0060 130 SER A O   
960  C CB  . SER A 131 ? 0.1667 0.2006 0.1525 -0.0066 0.0013  -0.0003 130 SER A CB  
961  O OG  . SER A 131 ? 0.1945 0.2325 0.1831 -0.0062 0.0044  -0.0020 130 SER A OG  
962  N N   . HIS A 132 ? 0.1309 0.1668 0.1195 -0.0027 0.0050  -0.0074 131 HIS A N   
963  C CA  . HIS A 132 ? 0.1249 0.1617 0.1121 -0.0019 0.0074  -0.0111 131 HIS A CA  
964  C C   . HIS A 132 ? 0.1474 0.1795 0.1338 -0.0004 0.0060  -0.0124 131 HIS A C   
965  O O   . HIS A 132 ? 0.1416 0.1719 0.1238 -0.0013 0.0068  -0.0148 131 HIS A O   
966  C CB  . HIS A 132 ? 0.1346 0.1764 0.1271 0.0006  0.0096  -0.0133 131 HIS A CB  
967  C CG  . HIS A 132 ? 0.1779 0.2247 0.1713 -0.0016 0.0114  -0.0126 131 HIS A CG  
968  N ND1 . HIS A 132 ? 0.2068 0.2557 0.1958 -0.0049 0.0143  -0.0141 131 HIS A ND1 
969  C CD2 . HIS A 132 ? 0.1868 0.2360 0.1841 -0.0016 0.0109  -0.0107 131 HIS A CD2 
970  C CE1 . HIS A 132 ? 0.1966 0.2489 0.1870 -0.0069 0.0155  -0.0130 131 HIS A CE1 
971  N NE2 . HIS A 132 ? 0.1917 0.2445 0.1874 -0.0049 0.0135  -0.0111 131 HIS A NE2 
972  N N   . LEU A 133 ? 0.1184 0.1482 0.1083 0.0013  0.0042  -0.0109 132 LEU A N   
973  C CA  . LEU A 133 ? 0.1096 0.1341 0.0984 0.0019  0.0031  -0.0119 132 LEU A CA  
974  C C   . LEU A 133 ? 0.1672 0.1895 0.1517 -0.0013 0.0015  -0.0117 132 LEU A C   
975  O O   . LEU A 133 ? 0.1539 0.1730 0.1351 -0.0019 0.0017  -0.0141 132 LEU A O   
976  C CB  . LEU A 133 ? 0.1043 0.1266 0.0968 0.0035  0.0018  -0.0100 132 LEU A CB  
977  C CG  . LEU A 133 ? 0.1663 0.1821 0.1571 0.0033  0.0010  -0.0107 132 LEU A CG  
978  C CD1 . LEU A 133 ? 0.1517 0.1634 0.1400 0.0055  0.0024  -0.0141 132 LEU A CD1 
979  C CD2 . LEU A 133 ? 0.1801 0.1938 0.1736 0.0042  0.0002  -0.0086 132 LEU A CD2 
980  N N   . ARG A 134 ? 0.1293 0.1533 0.1139 -0.0032 -0.0005 -0.0089 133 ARG A N   
981  C CA  . ARG A 134 ? 0.1333 0.1561 0.1142 -0.0058 -0.0028 -0.0087 133 ARG A CA  
982  C C   . ARG A 134 ? 0.1860 0.2085 0.1603 -0.0075 -0.0020 -0.0105 133 ARG A C   
983  O O   . ARG A 134 ? 0.1732 0.1935 0.1440 -0.0090 -0.0031 -0.0123 133 ARG A O   
984  C CB  . ARG A 134 ? 0.1239 0.1486 0.1065 -0.0065 -0.0055 -0.0056 133 ARG A CB  
985  C CG  . ARG A 134 ? 0.1526 0.1777 0.1414 -0.0055 -0.0064 -0.0044 133 ARG A CG  
986  C CD  . ARG A 134 ? 0.1445 0.1678 0.1339 -0.0069 -0.0078 -0.0059 133 ARG A CD  
987  N NE  . ARG A 134 ? 0.1249 0.1489 0.1197 -0.0066 -0.0082 -0.0049 133 ARG A NE  
988  C CZ  . ARG A 134 ? 0.1762 0.1978 0.1728 -0.0056 -0.0063 -0.0051 133 ARG A CZ  
989  N NH1 . ARG A 134 ? 0.1615 0.1796 0.1554 -0.0042 -0.0043 -0.0065 133 ARG A NH1 
990  N NH2 . ARG A 134 ? 0.1449 0.1672 0.1454 -0.0057 -0.0063 -0.0040 133 ARG A NH2 
991  N N   . ARG A 135 ? 0.1475 0.1723 0.1199 -0.0076 0.0002  -0.0104 134 ARG A N   
992  C CA  . ARG A 135 ? 0.1637 0.1882 0.1289 -0.0098 0.0016  -0.0121 134 ARG A CA  
993  C C   . ARG A 135 ? 0.1903 0.2136 0.1543 -0.0090 0.0040  -0.0164 134 ARG A C   
994  O O   . ARG A 135 ? 0.1892 0.2101 0.1475 -0.0108 0.0035  -0.0183 134 ARG A O   
995  C CB  . ARG A 135 ? 0.1525 0.1798 0.1161 -0.0109 0.0040  -0.0110 134 ARG A CB  
996  C CG  . ARG A 135 ? 0.2237 0.2508 0.1792 -0.0136 0.0065  -0.0130 134 ARG A CG  
997  C CD  . ARG A 135 ? 0.2965 0.3266 0.2508 -0.0154 0.0097  -0.0124 134 ARG A CD  
998  N NE  . ARG A 135 ? 0.3693 0.4045 0.3309 -0.0131 0.0131  -0.0151 134 ARG A NE  
999  C CZ  . ARG A 135 ? 0.4902 0.5284 0.4589 -0.0113 0.0131  -0.0138 134 ARG A CZ  
1000 N NH1 . ARG A 135 ? 0.3470 0.3833 0.3165 -0.0117 0.0103  -0.0097 134 ARG A NH1 
1001 N NH2 . ARG A 135 ? 0.2718 0.3150 0.2469 -0.0089 0.0157  -0.0167 134 ARG A NH2 
1002 N N   . ILE A 136 ? 0.1582 0.1829 0.1273 -0.0060 0.0064  -0.0182 135 ILE A N   
1003 C CA  . ILE A 136 ? 0.1675 0.1905 0.1360 -0.0042 0.0086  -0.0226 135 ILE A CA  
1004 C C   . ILE A 136 ? 0.2210 0.2381 0.1883 -0.0043 0.0065  -0.0235 135 ILE A C   
1005 O O   . ILE A 136 ? 0.2398 0.2539 0.2029 -0.0048 0.0074  -0.0269 135 ILE A O   
1006 C CB  . ILE A 136 ? 0.2180 0.2440 0.1928 -0.0001 0.0109  -0.0242 135 ILE A CB  
1007 C CG1 . ILE A 136 ? 0.2375 0.2704 0.2138 -0.0010 0.0134  -0.0240 135 ILE A CG1 
1008 C CG2 . ILE A 136 ? 0.2519 0.2755 0.2262 0.0025  0.0129  -0.0291 135 ILE A CG2 
1009 C CD1 . ILE A 136 ? 0.2955 0.3332 0.2795 0.0026  0.0145  -0.0246 135 ILE A CD1 
1010 N N   . GLY A 137 ? 0.1659 0.1814 0.1365 -0.0043 0.0038  -0.0206 136 GLY A N   
1011 C CA  . GLY A 137 ? 0.1577 0.1681 0.1277 -0.0052 0.0021  -0.0213 136 GLY A CA  
1012 C C   . GLY A 137 ? 0.1912 0.1979 0.1652 -0.0023 0.0026  -0.0212 136 GLY A C   
1013 O O   . GLY A 137 ? 0.1762 0.1815 0.1528 -0.0031 0.0010  -0.0190 136 GLY A O   
1014 N N   . ARG A 138 ? 0.1837 0.1888 0.1581 0.0010  0.0047  -0.0236 137 ARG A N   
1015 C CA  . ARG A 138 ? 0.1793 0.1797 0.1562 0.0045  0.0048  -0.0235 137 ARG A CA  
1016 C C   . ARG A 138 ? 0.2320 0.2346 0.2111 0.0091  0.0067  -0.0257 137 ARG A C   
1017 O O   . ARG A 138 ? 0.2299 0.2368 0.2080 0.0090  0.0087  -0.0284 137 ARG A O   
1018 C CB  . ARG A 138 ? 0.1936 0.1848 0.1670 0.0035  0.0044  -0.0251 137 ARG A CB  
1019 C CG  . ARG A 138 ? 0.2530 0.2402 0.2217 0.0035  0.0058  -0.0296 137 ARG A CG  
1020 C CD  . ARG A 138 ? 0.2846 0.2612 0.2502 0.0032  0.0055  -0.0310 137 ARG A CD  
1021 N NE  . ARG A 138 ? 0.4266 0.3979 0.3873 0.0030  0.0067  -0.0356 137 ARG A NE  
1022 C CZ  . ARG A 138 ? 0.7133 0.6795 0.6728 0.0074  0.0082  -0.0388 137 ARG A CZ  
1023 N NH1 . ARG A 138 ? 0.4135 0.3797 0.3766 0.0128  0.0083  -0.0378 137 ARG A NH1 
1024 N NH2 . ARG A 138 ? 0.6562 0.6173 0.6110 0.0068  0.0094  -0.0433 137 ARG A NH2 
1025 N N   . PHE A 139 ? 0.1739 0.1738 0.1558 0.0130  0.0062  -0.0248 138 PHE A N   
1026 C CA  . PHE A 139 ? 0.1611 0.1633 0.1460 0.0182  0.0073  -0.0273 138 PHE A CA  
1027 C C   . PHE A 139 ? 0.2155 0.2080 0.1976 0.0217  0.0071  -0.0298 138 PHE A C   
1028 O O   . PHE A 139 ? 0.2152 0.1989 0.1943 0.0209  0.0057  -0.0280 138 PHE A O   
1029 C CB  . PHE A 139 ? 0.1634 0.1701 0.1535 0.0206  0.0061  -0.0245 138 PHE A CB  
1030 C CG  . PHE A 139 ? 0.1555 0.1702 0.1482 0.0174  0.0062  -0.0217 138 PHE A CG  
1031 C CD1 . PHE A 139 ? 0.1676 0.1882 0.1595 0.0143  0.0079  -0.0228 138 PHE A CD1 
1032 C CD2 . PHE A 139 ? 0.1423 0.1584 0.1379 0.0177  0.0046  -0.0183 138 PHE A CD2 
1033 C CE1 . PHE A 139 ? 0.1663 0.1928 0.1598 0.0116  0.0079  -0.0202 138 PHE A CE1 
1034 C CE2 . PHE A 139 ? 0.1554 0.1781 0.1533 0.0150  0.0047  -0.0160 138 PHE A CE2 
1035 C CZ  . PHE A 139 ? 0.1334 0.1609 0.1302 0.0120  0.0062  -0.0169 138 PHE A CZ  
1036 N N   . SEP A 140 ? 0.1876 0.1812 0.1703 0.0254  0.0087  -0.0343 139 SEP A N   
1037 C CA  . SEP A 140 ? 0.2178 0.2015 0.1978 0.0297  0.0084  -0.0371 139 SEP A CA  
1038 C CB  . SEP A 140 ? 0.2595 0.2487 0.2420 0.0335  0.0107  -0.0427 139 SEP A CB  
1039 O OG  . SEP A 140 ? 0.3104 0.3090 0.3002 0.0376  0.0106  -0.0428 139 SEP A OG  
1040 C C   . SEP A 140 ? 0.2477 0.2270 0.2295 0.0343  0.0059  -0.0344 139 SEP A C   
1041 O O   . SEP A 140 ? 0.2308 0.2173 0.2170 0.0349  0.0050  -0.0318 139 SEP A O   
1042 P P   . SEP A 140 ? 0.3849 0.3924 0.3787 0.0405  0.0136  -0.0488 139 SEP A P   
1043 O O1P . SEP A 140 ? 0.3621 0.3791 0.3555 0.0343  0.0166  -0.0492 139 SEP A O1P 
1044 O O2P . SEP A 140 ? 0.3873 0.4024 0.3890 0.0460  0.0124  -0.0492 139 SEP A O2P 
1045 O O3P . SEP A 140 ? 0.4125 0.4113 0.4031 0.0445  0.0142  -0.0537 139 SEP A O3P 
1046 N N   . GLU A 141 ? 0.2068 0.1735 0.1841 0.0375  0.0047  -0.0351 140 GLU A N   
1047 C CA  . GLU A 141 ? 0.1912 0.1519 0.1682 0.0419  0.0020  -0.0322 140 GLU A CA  
1048 C C   . GLU A 141 ? 0.2281 0.1981 0.2120 0.0480  0.0009  -0.0331 140 GLU A C   
1049 O O   . GLU A 141 ? 0.2144 0.1866 0.1999 0.0482  -0.0009 -0.0294 140 GLU A O   
1050 C CB  . GLU A 141 ? 0.2159 0.1599 0.1856 0.0442  0.0009  -0.0328 140 GLU A CB  
1051 C CG  . GLU A 141 ? 0.2167 0.1526 0.1802 0.0368  0.0018  -0.0311 140 GLU A CG  
1052 C CD  . GLU A 141 ? 0.2887 0.2069 0.2439 0.0370  0.0009  -0.0301 140 GLU A CD  
1053 O OE1 . GLU A 141 ? 0.2542 0.1648 0.2072 0.0425  -0.0013 -0.0287 140 GLU A OE1 
1054 O OE2 . GLU A 141 ? 0.2632 0.1749 0.2137 0.0315  0.0021  -0.0309 140 GLU A OE2 
1055 N N   . PRO A 142 ? 0.2191 0.1962 0.2078 0.0524  0.0021  -0.0381 141 PRO A N   
1056 C CA  . PRO A 142 ? 0.2061 0.1939 0.2026 0.0578  0.0010  -0.0393 141 PRO A CA  
1057 C C   . PRO A 142 ? 0.2280 0.2284 0.2293 0.0532  0.0017  -0.0366 141 PRO A C   
1058 O O   . PRO A 142 ? 0.1927 0.1983 0.1983 0.0559  -0.0003 -0.0350 141 PRO A O   
1059 C CB  . PRO A 142 ? 0.2291 0.2232 0.2298 0.0616  0.0033  -0.0459 141 PRO A CB  
1060 C CG  . PRO A 142 ? 0.3048 0.2851 0.2981 0.0616  0.0039  -0.0479 141 PRO A CG  
1061 C CD  . PRO A 142 ? 0.2527 0.2283 0.2400 0.0532  0.0046  -0.0435 141 PRO A CD  
1062 N N   . HIS A 143 ? 0.1821 0.1867 0.1823 0.0464  0.0044  -0.0361 142 HIS A N   
1063 C CA  . HIS A 143 ? 0.1560 0.1708 0.1595 0.0415  0.0054  -0.0337 142 HIS A CA  
1064 C C   . HIS A 143 ? 0.1883 0.1985 0.1898 0.0395  0.0029  -0.0281 142 HIS A C   
1065 O O   . HIS A 143 ? 0.1496 0.1665 0.1553 0.0398  0.0020  -0.0263 142 HIS A O   
1066 C CB  . HIS A 143 ? 0.1668 0.1837 0.1672 0.0352  0.0082  -0.0343 142 HIS A CB  
1067 C CG  . HIS A 143 ? 0.1949 0.2216 0.1979 0.0304  0.0095  -0.0325 142 HIS A CG  
1068 N ND1 . HIS A 143 ? 0.2170 0.2472 0.2174 0.0258  0.0121  -0.0338 142 HIS A ND1 
1069 C CD2 . HIS A 143 ? 0.2147 0.2469 0.2214 0.0297  0.0085  -0.0295 142 HIS A CD2 
1070 C CE1 . HIS A 143 ? 0.2019 0.2390 0.2044 0.0224  0.0126  -0.0313 142 HIS A CE1 
1071 N NE2 . HIS A 143 ? 0.2025 0.2413 0.2091 0.0246  0.0106  -0.0289 142 HIS A NE2 
1072 N N   . ALA A 144 ? 0.1648 0.1637 0.1600 0.0373  0.0020  -0.0258 143 ALA A N   
1073 C CA  . ALA A 144 ? 0.1620 0.1562 0.1549 0.0350  0.0002  -0.0210 143 ALA A CA  
1074 C C   . ALA A 144 ? 0.2043 0.1956 0.1978 0.0405  -0.0024 -0.0198 143 ALA A C   
1075 O O   . ALA A 144 ? 0.2003 0.1944 0.1952 0.0396  -0.0036 -0.0167 143 ALA A O   
1076 C CB  . ALA A 144 ? 0.1739 0.1569 0.1602 0.0314  0.0003  -0.0197 143 ALA A CB  
1077 N N   . ARG A 145 ? 0.1646 0.1506 0.1571 0.0465  -0.0035 -0.0226 144 ARG A N   
1078 C CA  . ARG A 145 ? 0.1645 0.1466 0.1567 0.0528  -0.0067 -0.0216 144 ARG A CA  
1079 C C   . ARG A 145 ? 0.1793 0.1747 0.1792 0.0552  -0.0077 -0.0221 144 ARG A C   
1080 O O   . ARG A 145 ? 0.1804 0.1749 0.1798 0.0570  -0.0104 -0.0194 144 ARG A O   
1081 C CB  . ARG A 145 ? 0.1791 0.1529 0.1689 0.0593  -0.0078 -0.0250 144 ARG A CB  
1082 C CG  . ARG A 145 ? 0.2040 0.1732 0.1930 0.0669  -0.0120 -0.0243 144 ARG A CG  
1083 C CD  . ARG A 145 ? 0.2617 0.2168 0.2449 0.0726  -0.0136 -0.0262 144 ARG A CD  
1084 N NE  . ARG A 145 ? 0.2773 0.2365 0.2643 0.0742  -0.0111 -0.0318 144 ARG A NE  
1085 C CZ  . ARG A 145 ? 0.3364 0.2854 0.3178 0.0724  -0.0093 -0.0335 144 ARG A CZ  
1086 N NH1 . ARG A 145 ? 0.2432 0.1767 0.2149 0.0690  -0.0097 -0.0300 144 ARG A NH1 
1087 N NH2 . ARG A 145 ? 0.2314 0.1855 0.2164 0.0738  -0.0068 -0.0389 144 ARG A NH2 
1088 N N   . PHE A 146 ? 0.1484 0.1562 0.1551 0.0548  -0.0054 -0.0259 145 PHE A N   
1089 C CA  . PHE A 146 ? 0.1456 0.1673 0.1604 0.0561  -0.0057 -0.0272 145 PHE A CA  
1090 C C   . PHE A 146 ? 0.1844 0.2089 0.1990 0.0511  -0.0060 -0.0228 145 PHE A C   
1091 O O   . PHE A 146 ? 0.1810 0.2095 0.1983 0.0533  -0.0083 -0.0217 145 PHE A O   
1092 C CB  . PHE A 146 ? 0.1620 0.1948 0.1822 0.0543  -0.0019 -0.0318 145 PHE A CB  
1093 C CG  . PHE A 146 ? 0.1700 0.2176 0.1982 0.0533  -0.0011 -0.0331 145 PHE A CG  
1094 C CD1 . PHE A 146 ? 0.2148 0.2707 0.2501 0.0593  -0.0029 -0.0365 145 PHE A CD1 
1095 C CD2 . PHE A 146 ? 0.1843 0.2375 0.2128 0.0463  0.0014  -0.0312 145 PHE A CD2 
1096 C CE1 . PHE A 146 ? 0.2204 0.2903 0.2632 0.0576  -0.0019 -0.0381 145 PHE A CE1 
1097 C CE2 . PHE A 146 ? 0.2128 0.2786 0.2480 0.0447  0.0025  -0.0326 145 PHE A CE2 
1098 C CZ  . PHE A 146 ? 0.2051 0.2795 0.2475 0.0500  0.0010  -0.0361 145 PHE A CZ  
1099 N N   . TYR A 147 ? 0.1342 0.1561 0.1453 0.0445  -0.0039 -0.0203 146 TYR A N   
1100 C CA  . TYR A 147 ? 0.1139 0.1377 0.1248 0.0401  -0.0042 -0.0164 146 TYR A CA  
1101 C C   . TYR A 147 ? 0.1564 0.1708 0.1624 0.0416  -0.0069 -0.0129 146 TYR A C   
1102 O O   . TYR A 147 ? 0.1404 0.1581 0.1479 0.0415  -0.0083 -0.0110 146 TYR A O   
1103 C CB  . TYR A 147 ? 0.1278 0.1507 0.1363 0.0337  -0.0019 -0.0150 146 TYR A CB  
1104 C CG  . TYR A 147 ? 0.1358 0.1672 0.1474 0.0313  0.0008  -0.0176 146 TYR A CG  
1105 C CD1 . TYR A 147 ? 0.1611 0.2033 0.1787 0.0322  0.0017  -0.0197 146 TYR A CD1 
1106 C CD2 . TYR A 147 ? 0.1502 0.1791 0.1584 0.0274  0.0026  -0.0180 146 TYR A CD2 
1107 C CE1 . TYR A 147 ? 0.1716 0.2209 0.1910 0.0292  0.0047  -0.0221 146 TYR A CE1 
1108 C CE2 . TYR A 147 ? 0.1493 0.1850 0.1587 0.0248  0.0051  -0.0200 146 TYR A CE2 
1109 C CZ  . TYR A 147 ? 0.1834 0.2290 0.1982 0.0255  0.0064  -0.0220 146 TYR A CZ  
1110 O OH  . TYR A 147 ? 0.2077 0.2592 0.2226 0.0224  0.0094  -0.0242 146 TYR A OH  
1111 N N   . ALA A 148 ? 0.1400 0.1421 0.1394 0.0422  -0.0074 -0.0121 147 ALA A N   
1112 C CA  . ALA A 148 ? 0.1495 0.1408 0.1424 0.0428  -0.0094 -0.0087 147 ALA A CA  
1113 C C   . ALA A 148 ? 0.1765 0.1684 0.1700 0.0488  -0.0128 -0.0085 147 ALA A C   
1114 O O   . ALA A 148 ? 0.1646 0.1543 0.1554 0.0480  -0.0143 -0.0054 147 ALA A O   
1115 C CB  . ALA A 148 ? 0.1649 0.1427 0.1506 0.0428  -0.0091 -0.0087 147 ALA A CB  
1116 N N   . ALA A 149 ? 0.1485 0.1447 0.1463 0.0549  -0.0141 -0.0121 148 ALA A N   
1117 C CA  . ALA A 149 ? 0.1444 0.1424 0.1437 0.0614  -0.0180 -0.0125 148 ALA A CA  
1118 C C   . ALA A 149 ? 0.1793 0.1885 0.1836 0.0593  -0.0185 -0.0115 148 ALA A C   
1119 O O   . ALA A 149 ? 0.1700 0.1765 0.1714 0.0614  -0.0216 -0.0093 148 ALA A O   
1120 C CB  . ALA A 149 ? 0.1659 0.1697 0.1711 0.0679  -0.0189 -0.0176 148 ALA A CB  
1121 N N   . GLN A 150 ? 0.1351 0.1554 0.1456 0.0545  -0.0153 -0.0128 149 GLN A N   
1122 C CA  . GLN A 150 ? 0.1215 0.1519 0.1367 0.0518  -0.0153 -0.0121 149 GLN A CA  
1123 C C   . GLN A 150 ? 0.1600 0.1837 0.1693 0.0479  -0.0157 -0.0076 149 GLN A C   
1124 O O   . GLN A 150 ? 0.1358 0.1626 0.1457 0.0485  -0.0177 -0.0065 149 GLN A O   
1125 C CB  . GLN A 150 ? 0.1215 0.1628 0.1430 0.0473  -0.0117 -0.0143 149 GLN A CB  
1126 C CG  . GLN A 150 ? 0.1543 0.2045 0.1825 0.0511  -0.0111 -0.0195 149 GLN A CG  
1127 C CD  . GLN A 150 ? 0.2058 0.2640 0.2378 0.0461  -0.0069 -0.0214 149 GLN A CD  
1128 O OE1 . GLN A 150 ? 0.1752 0.2413 0.2107 0.0421  -0.0056 -0.0212 149 GLN A OE1 
1129 N NE2 . GLN A 150 ? 0.1736 0.2295 0.2044 0.0461  -0.0047 -0.0236 149 GLN A NE2 
1130 N N   . ILE A 151 ? 0.1197 0.1347 0.1236 0.0439  -0.0137 -0.0054 150 ILE A N   
1131 C CA  . ILE A 151 ? 0.1142 0.1233 0.1129 0.0399  -0.0134 -0.0016 150 ILE A CA  
1132 C C   . ILE A 151 ? 0.1498 0.1492 0.1414 0.0435  -0.0165 0.0005  150 ILE A C   
1133 O O   . ILE A 151 ? 0.1238 0.1227 0.1129 0.0421  -0.0174 0.0027  150 ILE A O   
1134 C CB  . ILE A 151 ? 0.1494 0.1528 0.1451 0.0348  -0.0107 -0.0005 150 ILE A CB  
1135 C CG1 . ILE A 151 ? 0.1331 0.1455 0.1346 0.0315  -0.0081 -0.0023 150 ILE A CG1 
1136 C CG2 . ILE A 151 ? 0.1566 0.1545 0.1475 0.0307  -0.0101 0.0028  150 ILE A CG2 
1137 C CD1 . ILE A 151 ? 0.1727 0.1952 0.1796 0.0292  -0.0077 -0.0020 150 ILE A CD1 
1138 N N   . VAL A 152 ? 0.1390 0.1298 0.1264 0.0480  -0.0182 -0.0001 151 VAL A N   
1139 C CA  . VAL A 152 ? 0.1449 0.1245 0.1238 0.0518  -0.0216 0.0022  151 VAL A CA  
1140 C C   . VAL A 152 ? 0.1856 0.1728 0.1674 0.0555  -0.0251 0.0020  151 VAL A C   
1141 O O   . VAL A 152 ? 0.1907 0.1735 0.1667 0.0547  -0.0266 0.0049  151 VAL A O   
1142 C CB  . VAL A 152 ? 0.1993 0.1685 0.1738 0.0570  -0.0232 0.0011  151 VAL A CB  
1143 C CG1 . VAL A 152 ? 0.2070 0.1645 0.1724 0.0622  -0.0276 0.0034  151 VAL A CG1 
1144 C CG2 . VAL A 152 ? 0.2074 0.1677 0.1775 0.0523  -0.0198 0.0016  151 VAL A CG2 
1145 N N   . LEU A 153 ? 0.1611 0.1604 0.1521 0.0592  -0.0260 -0.0017 152 LEU A N   
1146 C CA  . LEU A 153 ? 0.1487 0.1570 0.1438 0.0626  -0.0295 -0.0028 152 LEU A CA  
1147 C C   . LEU A 153 ? 0.1724 0.1870 0.1690 0.0568  -0.0279 -0.0012 152 LEU A C   
1148 O O   . LEU A 153 ? 0.1638 0.1790 0.1580 0.0580  -0.0308 0.0000  152 LEU A O   
1149 C CB  . LEU A 153 ? 0.1325 0.1542 0.1385 0.0665  -0.0299 -0.0078 152 LEU A CB  
1150 C CG  . LEU A 153 ? 0.1754 0.1930 0.1813 0.0742  -0.0326 -0.0103 152 LEU A CG  
1151 C CD1 . LEU A 153 ? 0.1754 0.2081 0.1931 0.0765  -0.0316 -0.0159 152 LEU A CD1 
1152 C CD2 . LEU A 153 ? 0.1904 0.2006 0.1901 0.0809  -0.0386 -0.0087 152 LEU A CD2 
1153 N N   . THR A 154 ? 0.1180 0.1369 0.1182 0.0507  -0.0235 -0.0013 153 THR A N   
1154 C CA  . THR A 154 ? 0.1113 0.1355 0.1132 0.0454  -0.0218 -0.0001 153 THR A CA  
1155 C C   . THR A 154 ? 0.1524 0.1663 0.1451 0.0431  -0.0221 0.0038  153 THR A C   
1156 O O   . THR A 154 ? 0.1474 0.1642 0.1395 0.0420  -0.0231 0.0045  153 THR A O   
1157 C CB  . THR A 154 ? 0.1585 0.1881 0.1654 0.0402  -0.0177 -0.0010 153 THR A CB  
1158 O OG1 . THR A 154 ? 0.1244 0.1642 0.1392 0.0420  -0.0173 -0.0046 153 THR A OG1 
1159 C CG2 . THR A 154 ? 0.1544 0.1880 0.1627 0.0351  -0.0160 0.0003  153 THR A CG2 
1160 N N   . PHE A 155 ? 0.1305 0.1329 0.1163 0.0420  -0.0210 0.0058  154 PHE A N   
1161 C CA  . PHE A 155 ? 0.1316 0.1240 0.1082 0.0393  -0.0206 0.0091  154 PHE A CA  
1162 C C   . PHE A 155 ? 0.1864 0.1727 0.1558 0.0440  -0.0250 0.0105  154 PHE A C   
1163 O O   . PHE A 155 ? 0.1954 0.1792 0.1596 0.0420  -0.0253 0.0125  154 PHE A O   
1164 C CB  . PHE A 155 ? 0.1558 0.1376 0.1269 0.0362  -0.0180 0.0105  154 PHE A CB  
1165 C CG  . PHE A 155 ? 0.1667 0.1533 0.1429 0.0305  -0.0140 0.0099  154 PHE A CG  
1166 C CD1 . PHE A 155 ? 0.1750 0.1727 0.1586 0.0281  -0.0128 0.0088  154 PHE A CD1 
1167 C CD2 . PHE A 155 ? 0.1713 0.1506 0.1443 0.0275  -0.0117 0.0103  154 PHE A CD2 
1168 C CE1 . PHE A 155 ? 0.1764 0.1777 0.1640 0.0235  -0.0097 0.0084  154 PHE A CE1 
1169 C CE2 . PHE A 155 ? 0.1742 0.1585 0.1520 0.0227  -0.0087 0.0096  154 PHE A CE2 
1170 C CZ  . PHE A 155 ? 0.1500 0.1451 0.1350 0.0210  -0.0079 0.0088  154 PHE A CZ  
1171 N N   . GLU A 156 ? 0.1693 0.1536 0.1385 0.0506  -0.0286 0.0093  155 GLU A N   
1172 C CA  . GLU A 156 ? 0.1725 0.1516 0.1352 0.0560  -0.0336 0.0104  155 GLU A CA  
1173 C C   . GLU A 156 ? 0.2003 0.1907 0.1675 0.0556  -0.0353 0.0095  155 GLU A C   
1174 O O   . GLU A 156 ? 0.1912 0.1763 0.1504 0.0555  -0.0374 0.0119  155 GLU A O   
1175 C CB  . GLU A 156 ? 0.1952 0.1740 0.1604 0.0639  -0.0374 0.0081  155 GLU A CB  
1176 C CG  . GLU A 156 ? 0.2292 0.2016 0.1870 0.0704  -0.0435 0.0094  155 GLU A CG  
1177 C CD  . GLU A 156 ? 0.3977 0.3680 0.3570 0.0791  -0.0477 0.0072  155 GLU A CD  
1178 O OE1 . GLU A 156 ? 0.2746 0.2545 0.2445 0.0806  -0.0461 0.0032  155 GLU A OE1 
1179 O OE2 . GLU A 156 ? 0.3324 0.2918 0.2823 0.0846  -0.0527 0.0092  155 GLU A OE2 
1180 N N   . TYR A 157 ? 0.1534 0.1588 0.1325 0.0548  -0.0341 0.0061  156 TYR A N   
1181 C CA  . TYR A 157 ? 0.1461 0.1627 0.1304 0.0535  -0.0351 0.0047  156 TYR A CA  
1182 C C   . TYR A 157 ? 0.1824 0.1963 0.1622 0.0471  -0.0321 0.0071  156 TYR A C   
1183 O O   . TYR A 157 ? 0.1815 0.1945 0.1564 0.0471  -0.0344 0.0081  156 TYR A O   
1184 C CB  . TYR A 157 ? 0.1502 0.1817 0.1474 0.0528  -0.0333 0.0006  156 TYR A CB  
1185 C CG  . TYR A 157 ? 0.1455 0.1882 0.1483 0.0499  -0.0333 -0.0010 156 TYR A CG  
1186 C CD1 . TYR A 157 ? 0.1710 0.2212 0.1765 0.0538  -0.0377 -0.0031 156 TYR A CD1 
1187 C CD2 . TYR A 157 ? 0.1433 0.1889 0.1484 0.0433  -0.0290 -0.0005 156 TYR A CD2 
1188 C CE1 . TYR A 157 ? 0.1747 0.2344 0.1846 0.0506  -0.0376 -0.0048 156 TYR A CE1 
1189 C CE2 . TYR A 157 ? 0.1325 0.1866 0.1417 0.0405  -0.0289 -0.0020 156 TYR A CE2 
1190 C CZ  . TYR A 157 ? 0.1795 0.2409 0.1913 0.0438  -0.0330 -0.0043 156 TYR A CZ  
1191 O OH  . TYR A 157 ? 0.1633 0.2327 0.1788 0.0404  -0.0327 -0.0060 156 TYR A OH  
1192 N N   . LEU A 158 ? 0.1355 0.1485 0.1170 0.0417  -0.0273 0.0077  157 LEU A N   
1193 C CA  . LEU A 158 ? 0.1176 0.1296 0.0968 0.0358  -0.0242 0.0092  157 LEU A CA  
1194 C C   . LEU A 158 ? 0.1843 0.1844 0.1516 0.0350  -0.0247 0.0124  157 LEU A C   
1195 O O   . LEU A 158 ? 0.1653 0.1659 0.1291 0.0330  -0.0248 0.0129  157 LEU A O   
1196 C CB  . LEU A 158 ? 0.1123 0.1249 0.0954 0.0312  -0.0196 0.0092  157 LEU A CB  
1197 C CG  . LEU A 158 ? 0.1455 0.1688 0.1389 0.0304  -0.0182 0.0065  157 LEU A CG  
1198 C CD1 . LEU A 158 ? 0.1440 0.1658 0.1392 0.0263  -0.0144 0.0070  157 LEU A CD1 
1199 C CD2 . LEU A 158 ? 0.1515 0.1839 0.1496 0.0287  -0.0184 0.0051  157 LEU A CD2 
1200 N N   . HIS A 159 ? 0.1638 0.1525 0.1239 0.0363  -0.0249 0.0142  158 HIS A N   
1201 C CA  . HIS A 159 ? 0.1794 0.1551 0.1267 0.0349  -0.0249 0.0175  158 HIS A CA  
1202 C C   . HIS A 159 ? 0.2169 0.1900 0.1570 0.0388  -0.0298 0.0185  158 HIS A C   
1203 O O   . HIS A 159 ? 0.2205 0.1876 0.1517 0.0359  -0.0291 0.0205  158 HIS A O   
1204 C CB  . HIS A 159 ? 0.1875 0.1506 0.1282 0.0353  -0.0241 0.0191  158 HIS A CB  
1205 C CG  . HIS A 159 ? 0.1974 0.1620 0.1432 0.0305  -0.0193 0.0183  158 HIS A CG  
1206 N ND1 . HIS A 159 ? 0.2163 0.1712 0.1579 0.0302  -0.0182 0.0191  158 HIS A ND1 
1207 C CD2 . HIS A 159 ? 0.1889 0.1629 0.1429 0.0260  -0.0158 0.0169  158 HIS A CD2 
1208 C CE1 . HIS A 159 ? 0.1889 0.1488 0.1370 0.0255  -0.0142 0.0178  158 HIS A CE1 
1209 N NE2 . HIS A 159 ? 0.1846 0.1559 0.1402 0.0233  -0.0129 0.0166  158 HIS A NE2 
1210 N N   . SER A 160 ? 0.1857 0.1647 0.1304 0.0451  -0.0345 0.0166  159 SER A N   
1211 C CA  . SER A 160 ? 0.1845 0.1626 0.1235 0.0496  -0.0401 0.0171  159 SER A CA  
1212 C C   . SER A 160 ? 0.2214 0.2075 0.1619 0.0460  -0.0396 0.0163  159 SER A C   
1213 O O   . SER A 160 ? 0.2442 0.2265 0.1762 0.0475  -0.0430 0.0176  159 SER A O   
1214 C CB  . SER A 160 ? 0.1963 0.1817 0.1425 0.0572  -0.0451 0.0144  159 SER A CB  
1215 O OG  . SER A 160 ? 0.2122 0.2144 0.1720 0.0564  -0.0445 0.0105  159 SER A OG  
1216 N N   . LEU A 161 ? 0.1820 0.1782 0.1325 0.0413  -0.0352 0.0142  160 LEU A N   
1217 C CA  . LEU A 161 ? 0.1819 0.1859 0.1351 0.0375  -0.0340 0.0128  160 LEU A CA  
1218 C C   . LEU A 161 ? 0.2217 0.2192 0.1687 0.0314  -0.0292 0.0147  160 LEU A C   
1219 O O   . LEU A 161 ? 0.1995 0.2026 0.1490 0.0277  -0.0272 0.0134  160 LEU A O   
1220 C CB  . LEU A 161 ? 0.1705 0.1883 0.1377 0.0363  -0.0323 0.0093  160 LEU A CB  
1221 C CG  . LEU A 161 ? 0.2164 0.2436 0.1921 0.0415  -0.0360 0.0064  160 LEU A CG  
1222 C CD1 . LEU A 161 ? 0.2013 0.2404 0.1893 0.0385  -0.0329 0.0033  160 LEU A CD1 
1223 C CD2 . LEU A 161 ? 0.2438 0.2747 0.2172 0.0454  -0.0417 0.0053  160 LEU A CD2 
1224 N N   . ASP A 162 ? 0.1838 0.1693 0.1225 0.0302  -0.0274 0.0175  161 ASP A N   
1225 C CA  . ASP A 162 ? 0.1786 0.1579 0.1117 0.0241  -0.0223 0.0189  161 ASP A CA  
1226 C C   . ASP A 162 ? 0.2087 0.1960 0.1527 0.0200  -0.0175 0.0169  161 ASP A C   
1227 O O   . ASP A 162 ? 0.1967 0.1841 0.1399 0.0151  -0.0136 0.0167  161 ASP A O   
1228 C CB  . ASP A 162 ? 0.1892 0.1663 0.1138 0.0217  -0.0223 0.0195  161 ASP A CB  
1229 C CG  . ASP A 162 ? 0.2617 0.2315 0.1752 0.0262  -0.0280 0.0215  161 ASP A CG  
1230 O OD1 . ASP A 162 ? 0.2903 0.2477 0.1939 0.0276  -0.0290 0.0243  161 ASP A OD1 
1231 O OD2 . ASP A 162 ? 0.2704 0.2473 0.1862 0.0291  -0.0320 0.0199  161 ASP A OD2 
1232 N N   . LEU A 163 ? 0.1639 0.1576 0.1175 0.0221  -0.0180 0.0154  162 LEU A N   
1233 C CA  . LEU A 163 ? 0.1548 0.1551 0.1177 0.0186  -0.0142 0.0138  162 LEU A CA  
1234 C C   . LEU A 163 ? 0.2277 0.2225 0.1903 0.0172  -0.0118 0.0147  162 LEU A C   
1235 O O   . LEU A 163 ? 0.2501 0.2399 0.2102 0.0205  -0.0138 0.0155  162 LEU A O   
1236 C CB  . LEU A 163 ? 0.1439 0.1551 0.1174 0.0208  -0.0156 0.0114  162 LEU A CB  
1237 C CG  . LEU A 163 ? 0.1905 0.2088 0.1661 0.0221  -0.0182 0.0097  162 LEU A CG  
1238 C CD1 . LEU A 163 ? 0.1977 0.2257 0.1829 0.0244  -0.0198 0.0072  162 LEU A CD1 
1239 C CD2 . LEU A 163 ? 0.1981 0.2194 0.1750 0.0177  -0.0154 0.0088  162 LEU A CD2 
1240 N N   A ILE A 164 ? 0.1552 0.1509 0.1203 0.0126  -0.0077 0.0144  163 ILE A N   
1241 N N   B ILE A 164 ? 0.1453 0.1411 0.1104 0.0126  -0.0077 0.0144  163 ILE A N   
1242 C CA  A ILE A 164 ? 0.1530 0.1453 0.1192 0.0107  -0.0054 0.0146  163 ILE A CA  
1243 C CA  B ILE A 164 ? 0.1396 0.1322 0.1059 0.0104  -0.0052 0.0146  163 ILE A CA  
1244 C C   A ILE A 164 ? 0.1811 0.1830 0.1583 0.0100  -0.0044 0.0126  163 ILE A C   
1245 C C   B ILE A 164 ? 0.1718 0.1741 0.1493 0.0101  -0.0044 0.0126  163 ILE A C   
1246 O O   A ILE A 164 ? 0.1641 0.1722 0.1458 0.0084  -0.0032 0.0115  163 ILE A O   
1247 O O   B ILE A 164 ? 0.1524 0.1614 0.1347 0.0090  -0.0038 0.0114  163 ILE A O   
1248 C CB  A ILE A 164 ? 0.2009 0.1864 0.1613 0.0058  -0.0018 0.0156  163 ILE A CB  
1249 C CB  B ILE A 164 ? 0.1840 0.1712 0.1449 0.0053  -0.0014 0.0153  163 ILE A CB  
1250 C CG1 A ILE A 164 ? 0.2226 0.1984 0.1706 0.0056  -0.0024 0.0178  163 ILE A CG1 
1251 C CG1 B ILE A 164 ? 0.2080 0.1897 0.1678 0.0030  0.0007  0.0157  163 ILE A CG1 
1252 C CG2 A ILE A 164 ? 0.2232 0.2046 0.1843 0.0045  -0.0003 0.0157  163 ILE A CG2 
1253 C CG2 B ILE A 164 ? 0.1718 0.1665 0.1382 0.0020  0.0013  0.0136  163 ILE A CG2 
1254 C CD1 A ILE A 164 ? 0.2818 0.2520 0.2239 -0.0003 0.0021  0.0183  163 ILE A CD1 
1255 C CD1 B ILE A 164 ? 0.3121 0.2882 0.2662 -0.0025 0.0046  0.0162  163 ILE A CD1 
1256 N N   . TYR A 165 ? 0.1270 0.1294 0.1076 0.0114  -0.0048 0.0122  164 TYR A N   
1257 C CA  . TYR A 165 ? 0.1135 0.1239 0.1029 0.0111  -0.0043 0.0106  164 TYR A CA  
1258 C C   . TYR A 165 ? 0.1320 0.1442 0.1251 0.0073  -0.0015 0.0100  164 TYR A C   
1259 O O   . TYR A 165 ? 0.1535 0.1718 0.1521 0.0062  -0.0009 0.0091  164 TYR A O   
1260 C CB  . TYR A 165 ? 0.1155 0.1267 0.1069 0.0145  -0.0061 0.0099  164 TYR A CB  
1261 C CG  . TYR A 165 ? 0.1231 0.1413 0.1219 0.0135  -0.0052 0.0084  164 TYR A CG  
1262 C CD1 . TYR A 165 ? 0.1330 0.1586 0.1368 0.0131  -0.0053 0.0075  164 TYR A CD1 
1263 C CD2 . TYR A 165 ? 0.1353 0.1520 0.1351 0.0127  -0.0043 0.0081  164 TYR A CD2 
1264 C CE1 . TYR A 165 ? 0.1587 0.1891 0.1676 0.0119  -0.0045 0.0066  164 TYR A CE1 
1265 C CE2 . TYR A 165 ? 0.1246 0.1470 0.1297 0.0117  -0.0037 0.0070  164 TYR A CE2 
1266 C CZ  . TYR A 165 ? 0.2069 0.2356 0.2162 0.0112  -0.0038 0.0065  164 TYR A CZ  
1267 O OH  . TYR A 165 ? 0.1397 0.1724 0.1526 0.0100  -0.0032 0.0058  164 TYR A OH  
1268 N N   . ARG A 166 ? 0.1129 0.1195 0.1030 0.0054  -0.0002 0.0105  165 ARG A N   
1269 C CA  . ARG A 166 ? 0.1161 0.1240 0.1090 0.0016  0.0023  0.0097  165 ARG A CA  
1270 C C   . ARG A 166 ? 0.1459 0.1596 0.1458 0.0012  0.0022  0.0085  165 ARG A C   
1271 O O   . ARG A 166 ? 0.1473 0.1634 0.1505 -0.0015 0.0037  0.0075  165 ARG A O   
1272 C CB  . ARG A 166 ? 0.1049 0.1146 0.0977 -0.0010 0.0043  0.0094  165 ARG A CB  
1273 C CG  . ARG A 166 ? 0.1174 0.1198 0.1013 -0.0017 0.0049  0.0108  165 ARG A CG  
1274 C CD  . ARG A 166 ? 0.1462 0.1499 0.1297 -0.0054 0.0080  0.0099  165 ARG A CD  
1275 N NE  . ARG A 166 ? 0.1170 0.1276 0.1052 -0.0044 0.0077  0.0088  165 ARG A NE  
1276 C CZ  . ARG A 166 ? 0.1984 0.2108 0.1864 -0.0068 0.0101  0.0076  165 ARG A CZ  
1277 N NH1 . ARG A 166 ? 0.1454 0.1541 0.1289 -0.0106 0.0132  0.0074  165 ARG A NH1 
1278 N NH2 . ARG A 166 ? 0.1291 0.1468 0.1211 -0.0057 0.0096  0.0064  165 ARG A NH2 
1279 N N   . ASP A 167 ? 0.1140 0.1299 0.1161 0.0038  0.0004  0.0082  166 ASP A N   
1280 C CA  . ASP A 167 ? 0.0968 0.1168 0.1037 0.0030  0.0004  0.0073  166 ASP A CA  
1281 C C   . ASP A 167 ? 0.1337 0.1532 0.1403 0.0050  -0.0008 0.0069  166 ASP A C   
1282 O O   . ASP A 167 ? 0.1261 0.1500 0.1360 0.0055  -0.0014 0.0063  166 ASP A O   
1283 C CB  . ASP A 167 ? 0.0955 0.1217 0.1076 0.0027  0.0002  0.0068  166 ASP A CB  
1284 C CG  . ASP A 167 ? 0.1792 0.2085 0.1952 0.0015  -0.0001 0.0061  166 ASP A CG  
1285 O OD1 . ASP A 167 ? 0.1537 0.1814 0.1694 -0.0001 0.0004  0.0056  166 ASP A OD1 
1286 O OD2 . ASP A 167 ? 0.1700 0.2028 0.1890 0.0021  -0.0008 0.0061  166 ASP A OD2 
1287 N N   . LEU A 168 ? 0.1093 0.1227 0.1111 0.0063  -0.0011 0.0071  167 LEU A N   
1288 C CA  . LEU A 168 ? 0.1008 0.1137 0.1024 0.0085  -0.0019 0.0062  167 LEU A CA  
1289 C C   . LEU A 168 ? 0.1236 0.1372 0.1268 0.0063  -0.0013 0.0052  167 LEU A C   
1290 O O   . LEU A 168 ? 0.1250 0.1357 0.1270 0.0035  -0.0004 0.0051  167 LEU A O   
1291 C CB  . LEU A 168 ? 0.1098 0.1148 0.1056 0.0109  -0.0026 0.0065  167 LEU A CB  
1292 C CG  . LEU A 168 ? 0.1466 0.1508 0.1423 0.0139  -0.0034 0.0050  167 LEU A CG  
1293 C CD1 . LEU A 168 ? 0.1511 0.1625 0.1509 0.0171  -0.0045 0.0041  167 LEU A CD1 
1294 C CD2 . LEU A 168 ? 0.1406 0.1348 0.1299 0.0158  -0.0040 0.0054  167 LEU A CD2 
1295 N N   . LYS A 169 ? 0.0986 0.1164 0.1041 0.0072  -0.0018 0.0042  168 LYS A N   
1296 C CA  . LYS A 169 ? 0.0928 0.1115 0.0989 0.0055  -0.0017 0.0032  168 LYS A CA  
1297 C C   . LYS A 169 ? 0.1293 0.1522 0.1367 0.0070  -0.0018 0.0022  168 LYS A C   
1298 O O   . LYS A 169 ? 0.1297 0.1563 0.1390 0.0083  -0.0019 0.0025  168 LYS A O   
1299 C CB  . LYS A 169 ? 0.0882 0.1097 0.0970 0.0026  -0.0017 0.0035  168 LYS A CB  
1300 C CG  . LYS A 169 ? 0.1047 0.1311 0.1169 0.0027  -0.0021 0.0044  168 LYS A CG  
1301 C CD  . LYS A 169 ? 0.1596 0.1885 0.1747 0.0007  -0.0025 0.0044  168 LYS A CD  
1302 C CE  . LYS A 169 ? 0.1587 0.1910 0.1767 0.0012  -0.0029 0.0052  168 LYS A CE  
1303 N NZ  . LYS A 169 ? 0.1172 0.1520 0.1387 0.0000  -0.0035 0.0048  168 LYS A NZ  
1304 N N   . PRO A 170 ? 0.1123 0.1348 0.1184 0.0063  -0.0017 0.0009  169 PRO A N   
1305 C CA  . PRO A 170 ? 0.1087 0.1351 0.1152 0.0069  -0.0013 -0.0002 169 PRO A CA  
1306 C C   . PRO A 170 ? 0.1380 0.1692 0.1466 0.0057  -0.0014 0.0009  169 PRO A C   
1307 O O   . PRO A 170 ? 0.1166 0.1514 0.1259 0.0062  -0.0005 0.0001  169 PRO A O   
1308 C CB  . PRO A 170 ? 0.1360 0.1604 0.1398 0.0053  -0.0012 -0.0016 169 PRO A CB  
1309 C CG  . PRO A 170 ? 0.1961 0.2146 0.1980 0.0050  -0.0014 -0.0019 169 PRO A CG  
1310 C CD  . PRO A 170 ? 0.1373 0.1556 0.1410 0.0044  -0.0017 0.0001  169 PRO A CD  
1311 N N   . GLU A 171 ? 0.1138 0.1452 0.1236 0.0039  -0.0023 0.0024  170 GLU A N   
1312 C CA  . GLU A 171 ? 0.0959 0.1302 0.1070 0.0029  -0.0026 0.0036  170 GLU A CA  
1313 C C   . GLU A 171 ? 0.1387 0.1754 0.1519 0.0041  -0.0020 0.0038  170 GLU A C   
1314 O O   . GLU A 171 ? 0.1376 0.1766 0.1512 0.0032  -0.0017 0.0042  170 GLU A O   
1315 C CB  . GLU A 171 ? 0.1073 0.1412 0.1200 0.0018  -0.0040 0.0047  170 GLU A CB  
1316 C CG  . GLU A 171 ? 0.1298 0.1627 0.1414 0.0005  -0.0052 0.0042  170 GLU A CG  
1317 C CD  . GLU A 171 ? 0.1359 0.1667 0.1474 -0.0001 -0.0050 0.0031  170 GLU A CD  
1318 O OE1 . GLU A 171 ? 0.1181 0.1462 0.1279 0.0007  -0.0038 0.0024  170 GLU A OE1 
1319 O OE2 . GLU A 171 ? 0.1379 0.1694 0.1507 -0.0015 -0.0063 0.0027  170 GLU A OE2 
1320 N N   . ASN A 172 ? 0.1074 0.1431 0.1213 0.0058  -0.0019 0.0036  171 ASN A N   
1321 C CA  . ASN A 172 ? 0.1082 0.1464 0.1239 0.0070  -0.0018 0.0037  171 ASN A CA  
1322 C C   . ASN A 172 ? 0.1536 0.1942 0.1698 0.0092  -0.0015 0.0020  171 ASN A C   
1323 O O   . ASN A 172 ? 0.1456 0.1886 0.1634 0.0107  -0.0019 0.0017  171 ASN A O   
1324 C CB  . ASN A 172 ? 0.1199 0.1555 0.1353 0.0074  -0.0023 0.0046  171 ASN A CB  
1325 C CG  . ASN A 172 ? 0.1380 0.1736 0.1548 0.0055  -0.0023 0.0056  171 ASN A CG  
1326 O OD1 . ASN A 172 ? 0.1276 0.1650 0.1456 0.0044  -0.0025 0.0059  171 ASN A OD1 
1327 N ND2 . ASN A 172 ? 0.1193 0.1529 0.1358 0.0051  -0.0021 0.0060  171 ASN A ND2 
1328 N N   . LEU A 173 ? 0.1025 0.1432 0.1176 0.0096  -0.0008 0.0006  172 LEU A N   
1329 C CA  . LEU A 173 ? 0.0910 0.1347 0.1075 0.0122  -0.0004 -0.0017 172 LEU A CA  
1330 C C   . LEU A 173 ? 0.1245 0.1731 0.1420 0.0104  0.0013  -0.0032 172 LEU A C   
1331 O O   . LEU A 173 ? 0.1258 0.1730 0.1408 0.0089  0.0022  -0.0037 172 LEU A O   
1332 C CB  . LEU A 173 ? 0.0898 0.1287 0.1039 0.0147  -0.0008 -0.0028 172 LEU A CB  
1333 C CG  . LEU A 173 ? 0.1068 0.1390 0.1183 0.0156  -0.0021 -0.0010 172 LEU A CG  
1334 C CD1 . LEU A 173 ? 0.1207 0.1468 0.1290 0.0178  -0.0023 -0.0021 172 LEU A CD1 
1335 C CD2 . LEU A 173 ? 0.1167 0.1501 0.1292 0.0178  -0.0034 -0.0004 172 LEU A CD2 
1336 N N   A MET A 174 ? 0.0762 0.1306 0.0969 0.0101  0.0018  -0.0042 173 MET A N   
1337 N N   B MET A 174 ? 0.0892 0.1436 0.1099 0.0100  0.0019  -0.0041 173 MET A N   
1338 C CA  A MET A 174 ? 0.0620 0.1214 0.0835 0.0076  0.0040  -0.0058 173 MET A CA  
1339 C CA  B MET A 174 ? 0.0805 0.1398 0.1018 0.0074  0.0041  -0.0057 173 MET A CA  
1340 C C   A MET A 174 ? 0.1341 0.1984 0.1580 0.0098  0.0053  -0.0094 173 MET A C   
1341 C C   B MET A 174 ? 0.1420 0.2063 0.1658 0.0096  0.0053  -0.0093 173 MET A C   
1342 O O   A MET A 174 ? 0.1310 0.1974 0.1580 0.0137  0.0040  -0.0109 173 MET A O   
1343 O O   B MET A 174 ? 0.1360 0.2025 0.1630 0.0135  0.0040  -0.0108 173 MET A O   
1344 C CB  A MET A 174 ? 0.0807 0.1442 0.1047 0.0055  0.0044  -0.0055 173 MET A CB  
1345 C CB  B MET A 174 ? 0.1067 0.1698 0.1302 0.0051  0.0045  -0.0053 173 MET A CB  
1346 C CG  A MET A 174 ? 0.1152 0.1742 0.1376 0.0039  0.0031  -0.0024 173 MET A CG  
1347 C CG  B MET A 174 ? 0.1517 0.2101 0.1730 0.0029  0.0036  -0.0022 173 MET A CG  
1348 S SD  A MET A 174 ? 0.1593 0.2117 0.1765 0.0016  0.0029  0.0001  173 MET A SD  
1349 S SD  B MET A 174 ? 0.2107 0.2647 0.2267 -0.0008 0.0044  -0.0005 173 MET A SD  
1350 C CE  A MET A 174 ? 0.1213 0.1756 0.1362 -0.0025 0.0053  -0.0004 173 MET A CE  
1351 C CE  B MET A 174 ? 0.1673 0.2162 0.1825 -0.0013 0.0023  0.0026  173 MET A CE  
1352 N N   . ILE A 175 ? 0.1185 0.1849 0.1408 0.0073  0.0078  -0.0110 174 ILE A N   
1353 C CA  . ILE A 175 ? 0.1230 0.1951 0.1481 0.0092  0.0097  -0.0152 174 ILE A CA  
1354 C C   . ILE A 175 ? 0.1559 0.2370 0.1850 0.0066  0.0122  -0.0177 174 ILE A C   
1355 O O   . ILE A 175 ? 0.1518 0.2326 0.1778 0.0017  0.0142  -0.0166 174 ILE A O   
1356 C CB  . ILE A 175 ? 0.1624 0.2310 0.1830 0.0086  0.0111  -0.0163 174 ILE A CB  
1357 C CG1 . ILE A 175 ? 0.1605 0.2201 0.1773 0.0104  0.0086  -0.0140 174 ILE A CG1 
1358 C CG2 . ILE A 175 ? 0.1395 0.2144 0.1640 0.0115  0.0130  -0.0213 174 ILE A CG2 
1359 C CD1 . ILE A 175 ? 0.2445 0.3001 0.2565 0.0097  0.0096  -0.0153 174 ILE A CD1 
1360 N N   . ASP A 176 ? 0.1074 0.1961 0.1431 0.0100  0.0118  -0.0209 175 ASP A N   
1361 C CA  . ASP A 176 ? 0.1053 0.2041 0.1461 0.0074  0.0143  -0.0241 175 ASP A CA  
1362 C C   . ASP A 176 ? 0.1513 0.2563 0.1932 0.0058  0.0183  -0.0283 175 ASP A C   
1363 O O   . ASP A 176 ? 0.1402 0.2411 0.1787 0.0073  0.0189  -0.0289 175 ASP A O   
1364 C CB  . ASP A 176 ? 0.1274 0.2328 0.1753 0.0111  0.0117  -0.0257 175 ASP A CB  
1365 C CG  . ASP A 176 ? 0.1766 0.2860 0.2294 0.0179  0.0098  -0.0292 175 ASP A CG  
1366 O OD1 . ASP A 176 ? 0.1496 0.2614 0.2032 0.0192  0.0120  -0.0325 175 ASP A OD1 
1367 O OD2 . ASP A 176 ? 0.1619 0.2729 0.2179 0.0219  0.0064  -0.0292 175 ASP A OD2 
1368 N N   . GLN A 177 ? 0.1612 0.2764 0.2081 0.0027  0.0213  -0.0318 176 GLN A N   
1369 C CA  . GLN A 177 ? 0.1732 0.2958 0.2216 0.0002  0.0260  -0.0365 176 GLN A CA  
1370 C C   . GLN A 177 ? 0.2086 0.3376 0.2632 0.0064  0.0259  -0.0417 176 GLN A C   
1371 O O   . GLN A 177 ? 0.2166 0.3508 0.2719 0.0052  0.0299  -0.0459 176 GLN A O   
1372 C CB  . GLN A 177 ? 0.1960 0.3274 0.2477 -0.0059 0.0296  -0.0387 176 GLN A CB  
1373 C CG  . GLN A 177 ? 0.3811 0.5041 0.4240 -0.0129 0.0310  -0.0341 176 GLN A CG  
1374 N N   . GLN A 178 ? 0.1431 0.2712 0.2017 0.0133  0.0213  -0.0414 177 GLN A N   
1375 C CA  . GLN A 178 ? 0.1306 0.2623 0.1942 0.0205  0.0200  -0.0457 177 GLN A CA  
1376 C C   . GLN A 178 ? 0.1740 0.2928 0.2308 0.0242  0.0177  -0.0429 177 GLN A C   
1377 O O   . GLN A 178 ? 0.1637 0.2824 0.2229 0.0304  0.0164  -0.0459 177 GLN A O   
1378 C CB  . GLN A 178 ? 0.1414 0.2805 0.2135 0.0260  0.0162  -0.0477 177 GLN A CB  
1379 C CG  . GLN A 178 ? 0.3952 0.5498 0.4763 0.0230  0.0186  -0.0524 177 GLN A CG  
1380 C CD  . GLN A 178 ? 0.7093 0.8637 0.7881 0.0157  0.0197  -0.0492 177 GLN A CD  
1381 O OE1 . GLN A 178 ? 0.6172 0.7644 0.6926 0.0160  0.0162  -0.0445 177 GLN A OE1 
1382 N NE2 . GLN A 178 ? 0.6517 0.8135 0.7319 0.0088  0.0249  -0.0518 177 GLN A NE2 
1383 N N   . GLY A 179 ? 0.1535 0.2618 0.2019 0.0204  0.0172  -0.0376 178 GLY A N   
1384 C CA  . GLY A 179 ? 0.1519 0.2483 0.1938 0.0227  0.0152  -0.0349 178 GLY A CA  
1385 C C   . GLY A 179 ? 0.1806 0.2701 0.2219 0.0272  0.0105  -0.0317 178 GLY A C   
1386 O O   . GLY A 179 ? 0.1613 0.2410 0.1976 0.0291  0.0088  -0.0298 178 GLY A O   
1387 N N   . TYR A 180 ? 0.1241 0.2187 0.1703 0.0287  0.0083  -0.0313 179 TYR A N   
1388 C CA  . TYR A 180 ? 0.1207 0.2087 0.1653 0.0324  0.0039  -0.0281 179 TYR A CA  
1389 C C   . TYR A 180 ? 0.1820 0.2635 0.2214 0.0276  0.0035  -0.0229 179 TYR A C   
1390 O O   . TYR A 180 ? 0.1871 0.2710 0.2258 0.0222  0.0059  -0.0220 179 TYR A O   
1391 C CB  . TYR A 180 ? 0.1255 0.2220 0.1771 0.0364  0.0013  -0.0303 179 TYR A CB  
1392 C CG  . TYR A 180 ? 0.1374 0.2371 0.1934 0.0436  -0.0002 -0.0347 179 TYR A CG  
1393 C CD1 . TYR A 180 ? 0.1627 0.2713 0.2239 0.0441  0.0029  -0.0401 179 TYR A CD1 
1394 C CD2 . TYR A 180 ? 0.1375 0.2302 0.1915 0.0500  -0.0048 -0.0334 179 TYR A CD2 
1395 C CE1 . TYR A 180 ? 0.1864 0.2979 0.2522 0.0514  0.0014  -0.0446 179 TYR A CE1 
1396 C CE2 . TYR A 180 ? 0.1515 0.2456 0.2088 0.0574  -0.0067 -0.0373 179 TYR A CE2 
1397 C CZ  . TYR A 180 ? 0.2024 0.3062 0.2660 0.0583  -0.0036 -0.0431 179 TYR A CZ  
1398 O OH  . TYR A 180 ? 0.2022 0.3079 0.2700 0.0661  -0.0055 -0.0476 179 TYR A OH  
1399 N N   . ILE A 181 ? 0.1296 0.2024 0.1651 0.0296  0.0005  -0.0196 180 ILE A N   
1400 C CA  . ILE A 181 ? 0.1325 0.1997 0.1638 0.0255  0.0003  -0.0152 180 ILE A CA  
1401 C C   . ILE A 181 ? 0.1765 0.2461 0.2097 0.0253  -0.0015 -0.0137 180 ILE A C   
1402 O O   . ILE A 181 ? 0.1636 0.2374 0.2003 0.0292  -0.0036 -0.0154 180 ILE A O   
1403 C CB  . ILE A 181 ? 0.1856 0.2419 0.2107 0.0252  -0.0003 -0.0126 180 ILE A CB  
1404 C CG1 . ILE A 181 ? 0.2103 0.2601 0.2333 0.0303  -0.0029 -0.0124 180 ILE A CG1 
1405 C CG2 . ILE A 181 ? 0.2034 0.2584 0.2261 0.0229  0.0021  -0.0139 180 ILE A CG2 
1406 C CD1 . ILE A 181 ? 0.2297 0.2685 0.2464 0.0294  -0.0033 -0.0101 180 ILE A CD1 
1407 N N   . LYS A 182 ? 0.1261 0.1937 0.1573 0.0209  -0.0009 -0.0108 181 LYS A N   
1408 C CA  . LYS A 182 ? 0.1174 0.1862 0.1495 0.0202  -0.0024 -0.0093 181 LYS A CA  
1409 C C   . LYS A 182 ? 0.1544 0.2153 0.1818 0.0179  -0.0027 -0.0057 181 LYS A C   
1410 O O   . LYS A 182 ? 0.1540 0.2126 0.1796 0.0146  -0.0011 -0.0045 181 LYS A O   
1411 C CB  . LYS A 182 ? 0.1379 0.2147 0.1739 0.0167  -0.0007 -0.0108 181 LYS A CB  
1412 C CG  . LYS A 182 ? 0.1326 0.2195 0.1749 0.0186  -0.0004 -0.0151 181 LYS A CG  
1413 C CD  . LYS A 182 ? 0.2464 0.3407 0.2923 0.0145  0.0010  -0.0164 181 LYS A CD  
1414 C CE  . LYS A 182 ? 0.2659 0.3718 0.3187 0.0152  0.0021  -0.0213 181 LYS A CE  
1415 N NZ  . LYS A 182 ? 0.2557 0.3658 0.3126 0.0213  -0.0014 -0.0234 181 LYS A NZ  
1416 N N   . VAL A 183 ? 0.1046 0.1613 0.1299 0.0198  -0.0048 -0.0040 182 VAL A N   
1417 C CA  . VAL A 183 ? 0.1087 0.1588 0.1303 0.0177  -0.0048 -0.0011 182 VAL A CA  
1418 C C   . VAL A 183 ? 0.1345 0.1876 0.1577 0.0144  -0.0041 -0.0004 182 VAL A C   
1419 O O   . VAL A 183 ? 0.1297 0.1874 0.1553 0.0147  -0.0048 -0.0014 182 VAL A O   
1420 C CB  . VAL A 183 ? 0.1480 0.1922 0.1657 0.0203  -0.0068 0.0003  182 VAL A CB  
1421 C CG1 . VAL A 183 ? 0.1390 0.1773 0.1533 0.0176  -0.0061 0.0027  182 VAL A CG1 
1422 C CG2 . VAL A 183 ? 0.1486 0.1885 0.1640 0.0240  -0.0077 -0.0005 182 VAL A CG2 
1423 N N   . THR A 184 ? 0.1032 0.1535 0.1252 0.0115  -0.0029 0.0011  183 THR A N   
1424 C CA  . THR A 184 ? 0.1084 0.1596 0.1313 0.0087  -0.0024 0.0019  183 THR A CA  
1425 C C   . THR A 184 ? 0.1563 0.2025 0.1772 0.0079  -0.0027 0.0037  183 THR A C   
1426 O O   . THR A 184 ? 0.1847 0.2270 0.2036 0.0087  -0.0028 0.0044  183 THR A O   
1427 C CB  . THR A 184 ? 0.1920 0.2454 0.2157 0.0059  -0.0010 0.0015  183 THR A CB  
1428 O OG1 . THR A 184 ? 0.1908 0.2449 0.2153 0.0037  -0.0007 0.0019  183 THR A OG1 
1429 C CG2 . THR A 184 ? 0.1496 0.1992 0.1709 0.0048  -0.0006 0.0026  183 THR A CG2 
1430 N N   . ASP A 185 ? 0.1404 0.1868 0.1622 0.0062  -0.0024 0.0042  184 ASP A N   
1431 C CA  . ASP A 185 ? 0.1415 0.1848 0.1627 0.0054  -0.0023 0.0052  184 ASP A CA  
1432 C C   . ASP A 185 ? 0.1886 0.2299 0.2079 0.0065  -0.0026 0.0054  184 ASP A C   
1433 O O   . ASP A 185 ? 0.1903 0.2284 0.2074 0.0071  -0.0026 0.0060  184 ASP A O   
1434 C CB  . ASP A 185 ? 0.1607 0.2018 0.1818 0.0047  -0.0022 0.0059  184 ASP A CB  
1435 C CG  . ASP A 185 ? 0.2875 0.3274 0.3098 0.0037  -0.0021 0.0063  184 ASP A CG  
1436 O OD1 . ASP A 185 ? 0.1943 0.2339 0.2168 0.0038  -0.0017 0.0061  184 ASP A OD1 
1437 O OD2 . ASP A 185 ? 0.3641 0.4034 0.3872 0.0031  -0.0026 0.0067  184 ASP A OD2 
1438 N N   . PHE A 186 ? 0.1236 0.1661 0.1429 0.0063  -0.0028 0.0050  185 PHE A N   
1439 C CA  . PHE A 186 ? 0.1138 0.1541 0.1300 0.0070  -0.0030 0.0053  185 PHE A CA  
1440 C C   . PHE A 186 ? 0.1287 0.1675 0.1450 0.0052  -0.0017 0.0053  185 PHE A C   
1441 O O   . PHE A 186 ? 0.1098 0.1475 0.1235 0.0050  -0.0014 0.0051  185 PHE A O   
1442 C CB  . PHE A 186 ? 0.1310 0.1740 0.1467 0.0082  -0.0044 0.0044  185 PHE A CB  
1443 C CG  . PHE A 186 ? 0.1423 0.1858 0.1568 0.0110  -0.0061 0.0042  185 PHE A CG  
1444 C CD1 . PHE A 186 ? 0.1424 0.1879 0.1593 0.0118  -0.0060 0.0037  185 PHE A CD1 
1445 C CD2 . PHE A 186 ? 0.1929 0.2347 0.2035 0.0131  -0.0079 0.0044  185 PHE A CD2 
1446 C CE1 . PHE A 186 ? 0.1768 0.2229 0.1932 0.0150  -0.0076 0.0030  185 PHE A CE1 
1447 C CE2 . PHE A 186 ? 0.2381 0.2800 0.2478 0.0166  -0.0099 0.0041  185 PHE A CE2 
1448 C CZ  . PHE A 186 ? 0.1978 0.2420 0.2108 0.0176  -0.0097 0.0033  185 PHE A CZ  
1449 N N   . GLY A 187 ? 0.1105 0.1493 0.1295 0.0042  -0.0009 0.0054  186 GLY A N   
1450 C CA  . GLY A 187 ? 0.1053 0.1438 0.1260 0.0030  0.0003  0.0048  186 GLY A CA  
1451 C C   . GLY A 187 ? 0.1348 0.1712 0.1528 0.0022  0.0017  0.0047  186 GLY A C   
1452 O O   . GLY A 187 ? 0.1226 0.1596 0.1415 0.0012  0.0030  0.0036  186 GLY A O   
1453 N N   . PHE A 188 ? 0.1037 0.1372 0.1182 0.0023  0.0016  0.0057  187 PHE A N   
1454 C CA  . PHE A 188 ? 0.1065 0.1366 0.1169 0.0009  0.0033  0.0058  187 PHE A CA  
1455 C C   . PHE A 188 ? 0.1455 0.1717 0.1493 0.0020  0.0023  0.0070  187 PHE A C   
1456 O O   . PHE A 188 ? 0.1691 0.1906 0.1675 0.0006  0.0036  0.0076  187 PHE A O   
1457 C CB  . PHE A 188 ? 0.1406 0.1692 0.1516 -0.0006 0.0043  0.0059  187 PHE A CB  
1458 C CG  . PHE A 188 ? 0.1673 0.2002 0.1848 -0.0013 0.0046  0.0046  187 PHE A CG  
1459 C CD1 . PHE A 188 ? 0.1820 0.2181 0.2031 -0.0022 0.0059  0.0030  187 PHE A CD1 
1460 C CD2 . PHE A 188 ? 0.2670 0.3008 0.2869 -0.0007 0.0032  0.0048  187 PHE A CD2 
1461 C CE1 . PHE A 188 ? 0.2067 0.2467 0.2341 -0.0019 0.0054  0.0017  187 PHE A CE1 
1462 C CE2 . PHE A 188 ? 0.3082 0.3457 0.3335 -0.0008 0.0026  0.0038  187 PHE A CE2 
1463 C CZ  . PHE A 188 ? 0.2568 0.2974 0.2860 -0.0011 0.0035  0.0024  187 PHE A CZ  
1464 N N   . ALA A 189 ? 0.0897 0.1176 0.0937 0.0043  0.0001  0.0071  188 ALA A N   
1465 C CA  . ALA A 189 ? 0.1064 0.1312 0.1045 0.0061  -0.0016 0.0079  188 ALA A CA  
1466 C C   . ALA A 189 ? 0.1359 0.1595 0.1298 0.0049  -0.0009 0.0077  188 ALA A C   
1467 O O   . ALA A 189 ? 0.1112 0.1384 0.1084 0.0035  0.0003  0.0063  188 ALA A O   
1468 C CB  . ALA A 189 ? 0.1143 0.1430 0.1148 0.0089  -0.0041 0.0074  188 ALA A CB  
1469 N N   . LYS A 190 ? 0.1219 0.1395 0.1077 0.0053  -0.0015 0.0091  189 LYS A N   
1470 C CA  . LYS A 190 ? 0.1156 0.1311 0.0958 0.0035  -0.0004 0.0089  189 LYS A CA  
1471 C C   . LYS A 190 ? 0.1730 0.1829 0.1441 0.0057  -0.0032 0.0105  189 LYS A C   
1472 O O   . LYS A 190 ? 0.1513 0.1555 0.1183 0.0073  -0.0045 0.0122  189 LYS A O   
1473 C CB  . LYS A 190 ? 0.1678 0.1802 0.1461 -0.0003 0.0035  0.0089  189 LYS A CB  
1474 C CG  . LYS A 190 ? 0.2146 0.2254 0.1875 -0.0030 0.0059  0.0081  189 LYS A CG  
1475 C CD  . LYS A 190 ? 0.2181 0.2257 0.1887 -0.0070 0.0100  0.0080  189 LYS A CD  
1476 C CE  . LYS A 190 ? 0.2897 0.2944 0.2530 -0.0101 0.0128  0.0074  189 LYS A CE  
1477 N NZ  . LYS A 190 ? 0.3008 0.3126 0.2705 -0.0113 0.0150  0.0043  189 LYS A NZ  
1478 N N   . ARG A 191 ? 0.1279 0.1391 0.0958 0.0058  -0.0044 0.0099  190 ARG A N   
1479 C CA  . ARG A 191 ? 0.1403 0.1460 0.0986 0.0081  -0.0076 0.0115  190 ARG A CA  
1480 C C   . ARG A 191 ? 0.1991 0.1966 0.1472 0.0046  -0.0048 0.0128  190 ARG A C   
1481 O O   . ARG A 191 ? 0.1824 0.1817 0.1295 0.0016  -0.0022 0.0114  190 ARG A O   
1482 C CB  . ARG A 191 ? 0.1378 0.1491 0.0971 0.0100  -0.0109 0.0099  190 ARG A CB  
1483 C CG  . ARG A 191 ? 0.1714 0.1777 0.1221 0.0137  -0.0155 0.0116  190 ARG A CG  
1484 C CD  . ARG A 191 ? 0.1503 0.1637 0.1035 0.0163  -0.0197 0.0097  190 ARG A CD  
1485 N NE  . ARG A 191 ? 0.1725 0.1805 0.1175 0.0207  -0.0246 0.0114  190 ARG A NE  
1486 C CZ  . ARG A 191 ? 0.2861 0.2925 0.2232 0.0217  -0.0279 0.0116  190 ARG A CZ  
1487 N NH1 . ARG A 191 ? 0.2016 0.2125 0.1390 0.0186  -0.0268 0.0096  190 ARG A NH1 
1488 N NH2 . ARG A 191 ? 0.2366 0.2367 0.1654 0.0261  -0.0328 0.0136  190 ARG A NH2 
1489 N N   . VAL A 192 ? 0.1746 0.1630 0.1150 0.0049  -0.0050 0.0153  191 VAL A N   
1490 C CA  . VAL A 192 ? 0.1938 0.1732 0.1235 0.0010  -0.0019 0.0168  191 VAL A CA  
1491 C C   . VAL A 192 ? 0.2570 0.2244 0.1742 0.0031  -0.0048 0.0201  191 VAL A C   
1492 O O   . VAL A 192 ? 0.2452 0.2093 0.1634 0.0060  -0.0068 0.0212  191 VAL A O   
1493 C CB  . VAL A 192 ? 0.2515 0.2323 0.1864 -0.0037 0.0036  0.0157  191 VAL A CB  
1494 C CG1 . VAL A 192 ? 0.2525 0.2346 0.1946 -0.0022 0.0030  0.0158  191 VAL A CG1 
1495 C CG2 . VAL A 192 ? 0.2640 0.2360 0.1882 -0.0087 0.0075  0.0168  191 VAL A CG2 
1496 N N   . LYS A 193 ? 0.2465 0.2069 0.1512 0.0018  -0.0052 0.0215  192 LYS A N   
1497 C CA  . LYS A 193 ? 0.2714 0.2184 0.1616 0.0038  -0.0082 0.0250  192 LYS A CA  
1498 C C   . LYS A 193 ? 0.3932 0.3290 0.2744 -0.0016 -0.0034 0.0269  192 LYS A C   
1499 O O   . LYS A 193 ? 0.4343 0.3587 0.3073 -0.0002 -0.0050 0.0297  192 LYS A O   
1500 C CB  . LYS A 193 ? 0.2869 0.2314 0.1672 0.0053  -0.0117 0.0258  192 LYS A CB  
1501 C CG  . LYS A 193 ? 0.3873 0.3392 0.2738 0.0121  -0.0183 0.0248  192 LYS A CG  
1502 C CD  . LYS A 193 ? 0.4273 0.3757 0.3026 0.0144  -0.0231 0.0258  192 LYS A CD  
1503 C CE  . LYS A 193 ? 0.6256 0.5835 0.5086 0.0207  -0.0295 0.0240  192 LYS A CE  
1504 N NZ  . LYS A 193 ? 0.6112 0.5785 0.4971 0.0193  -0.0301 0.0211  192 LYS A NZ  
1505 N N   . GLY A 194 ? 0.3445 0.2838 0.2277 -0.0078 0.0026  0.0251  193 GLY A N   
1506 C CA  . GLY A 194 ? 0.3618 0.2923 0.2377 -0.0138 0.0078  0.0262  193 GLY A CA  
1507 C C   . GLY A 194 ? 0.3996 0.3347 0.2869 -0.0154 0.0105  0.0246  193 GLY A C   
1508 O O   . GLY A 194 ? 0.4149 0.3547 0.3113 -0.0108 0.0073  0.0242  193 GLY A O   
1509 N N   . ARG A 195 ? 0.2916 0.2262 0.1786 -0.0220 0.0166  0.0234  194 ARG A N   
1510 C CA  . ARG A 195 ? 0.2604 0.2004 0.1584 -0.0242 0.0194  0.0214  194 ARG A CA  
1511 C C   . ARG A 195 ? 0.2508 0.2066 0.1638 -0.0245 0.0212  0.0174  194 ARG A C   
1512 O O   . ARG A 195 ? 0.2376 0.1975 0.1499 -0.0245 0.0216  0.0163  194 ARG A O   
1513 C CB  . ARG A 195 ? 0.2525 0.1844 0.1429 -0.0317 0.0251  0.0217  194 ARG A CB  
1514 C CG  . ARG A 195 ? 0.3246 0.2600 0.2126 -0.0377 0.0307  0.0195  194 ARG A CG  
1515 C CD  . ARG A 195 ? 0.3973 0.3211 0.2721 -0.0453 0.0359  0.0207  194 ARG A CD  
1516 N NE  . ARG A 195 ? 0.5233 0.4305 0.3794 -0.0441 0.0330  0.0254  194 ARG A NE  
1517 C CZ  . ARG A 195 ? 0.7032 0.5963 0.5433 -0.0501 0.0366  0.0276  194 ARG A CZ  
1518 N NH1 . ARG A 195 ? 0.4138 0.3085 0.2550 -0.0585 0.0439  0.0252  194 ARG A NH1 
1519 N NH2 . ARG A 195 ? 0.4936 0.3708 0.3163 -0.0479 0.0329  0.0322  194 ARG A NH2 
1520 N N   . THR A 196 ? 0.1979 0.1616 0.1234 -0.0246 0.0221  0.0153  195 THR A N   
1521 C CA  . THR A 196 ? 0.1882 0.1655 0.1275 -0.0246 0.0235  0.0117  195 THR A CA  
1522 C C   . THR A 196 ? 0.2226 0.2046 0.1698 -0.0287 0.0273  0.0093  195 THR A C   
1523 O O   . THR A 196 ? 0.2178 0.1927 0.1606 -0.0308 0.0280  0.0106  195 THR A O   
1524 C CB  . THR A 196 ? 0.2396 0.2238 0.1871 -0.0185 0.0188  0.0115  195 THR A CB  
1525 O OG1 . THR A 196 ? 0.2198 0.2142 0.1763 -0.0188 0.0203  0.0084  195 THR A OG1 
1526 C CG2 . THR A 196 ? 0.1902 0.1761 0.1447 -0.0159 0.0164  0.0118  195 THR A CG2 
1527 N N   . TRP A 197 ? 0.1717 0.1652 0.1304 -0.0296 0.0294  0.0057  196 TRP A N   
1528 C CA  . TRP A 197 ? 0.1727 0.1718 0.1391 -0.0337 0.0330  0.0029  196 TRP A CA  
1529 C C   . TRP A 197 ? 0.2077 0.2179 0.1887 -0.0309 0.0313  0.0004  196 TRP A C   
1530 O O   . TRP A 197 ? 0.2063 0.2217 0.1941 -0.0339 0.0336  -0.0022 196 TRP A O   
1531 C CB  . TRP A 197 ? 0.1636 0.1657 0.1288 -0.0391 0.0387  0.0000  196 TRP A CB  
1532 C CG  . TRP A 197 ? 0.1925 0.1829 0.1421 -0.0432 0.0414  0.0023  196 TRP A CG  
1533 C CD1 . TRP A 197 ? 0.2378 0.2211 0.1801 -0.0492 0.0452  0.0028  196 TRP A CD1 
1534 C CD2 . TRP A 197 ? 0.1996 0.1835 0.1380 -0.0419 0.0403  0.0045  196 TRP A CD2 
1535 N NE1 . TRP A 197 ? 0.2516 0.2230 0.1778 -0.0516 0.0464  0.0056  196 TRP A NE1 
1536 C CE2 . TRP A 197 ? 0.2581 0.2301 0.1818 -0.0471 0.0434  0.0066  196 TRP A CE2 
1537 C CE3 . TRP A 197 ? 0.2166 0.2034 0.1556 -0.0373 0.0371  0.0046  196 TRP A CE3 
1538 C CZ2 . TRP A 197 ? 0.2747 0.2377 0.1839 -0.0474 0.0431  0.0090  196 TRP A CZ2 
1539 C CZ3 . TRP A 197 ? 0.2439 0.2227 0.1694 -0.0377 0.0367  0.0067  196 TRP A CZ3 
1540 C CH2 . TRP A 197 ? 0.2742 0.2413 0.1849 -0.0425 0.0396  0.0090  196 TRP A CH2 
1541 N N   . TPO A 198 ? 0.1629 0.1769 0.1486 -0.0257 0.0274  0.0008  197 TPO A N   
1542 C CA  . TPO A 198 ? 0.1525 0.1760 0.1507 -0.0231 0.0258  -0.0014 197 TPO A CA  
1543 C CB  . TPO A 198 ? 0.1499 0.1760 0.1511 -0.0180 0.0220  -0.0007 197 TPO A CB  
1544 C CG2 . TPO A 198 ? 0.1599 0.1949 0.1730 -0.0161 0.0211  -0.0032 197 TPO A CG2 
1545 O OG1 . TPO A 198 ? 0.1691 0.1944 0.1660 -0.0185 0.0235  -0.0012 197 TPO A OG1 
1546 P P   . TPO A 198 ? 0.1778 0.1973 0.1665 -0.0158 0.0205  0.0016  197 TPO A P   
1547 O O1P . TPO A 198 ? 0.1779 0.1970 0.1618 -0.0175 0.0228  0.0003  197 TPO A O1P 
1548 O O2P . TPO A 198 ? 0.1959 0.2065 0.1757 -0.0168 0.0199  0.0045  197 TPO A O2P 
1549 O O3P . TPO A 198 ? 0.1503 0.1732 0.1447 -0.0113 0.0164  0.0021  197 TPO A O3P 
1550 C C   . TPO A 198 ? 0.1777 0.2017 0.1800 -0.0231 0.0242  -0.0011 197 TPO A C   
1551 O O   . TPO A 198 ? 0.1611 0.1787 0.1583 -0.0215 0.0218  0.0015  197 TPO A O   
1552 N N   . LEU A 199 ? 0.1502 0.1824 0.1621 -0.0245 0.0254  -0.0042 198 LEU A N   
1553 C CA  . LEU A 199 ? 0.1559 0.1900 0.1726 -0.0243 0.0236  -0.0045 198 LEU A CA  
1554 C C   . LEU A 199 ? 0.1639 0.2008 0.1853 -0.0190 0.0191  -0.0035 198 LEU A C   
1555 O O   . LEU A 199 ? 0.1438 0.1876 0.1727 -0.0169 0.0182  -0.0054 198 LEU A O   
1556 C CB  . LEU A 199 ? 0.1581 0.2008 0.1836 -0.0277 0.0261  -0.0086 198 LEU A CB  
1557 C CG  . LEU A 199 ? 0.2195 0.2662 0.2514 -0.0274 0.0237  -0.0097 198 LEU A CG  
1558 C CD1 . LEU A 199 ? 0.2211 0.2591 0.2454 -0.0296 0.0235  -0.0075 198 LEU A CD1 
1559 C CD2 . LEU A 199 ? 0.2784 0.3351 0.3199 -0.0304 0.0259  -0.0142 198 LEU A CD2 
1560 N N   . CYS A 200 ? 0.1184 0.1494 0.1348 -0.0168 0.0164  -0.0007 199 CYS A N   
1561 C CA  . CYS A 200 ? 0.1062 0.1391 0.1256 -0.0125 0.0126  0.0003  199 CYS A CA  
1562 C C   . CYS A 200 ? 0.1559 0.1834 0.1711 -0.0116 0.0108  0.0021  199 CYS A C   
1563 O O   . CYS A 200 ? 0.1591 0.1799 0.1677 -0.0136 0.0121  0.0031  199 CYS A O   
1564 C CB  . CYS A 200 ? 0.1195 0.1520 0.1371 -0.0098 0.0117  0.0013  199 CYS A CB  
1565 S SG  . CYS A 200 ? 0.1743 0.1983 0.1811 -0.0095 0.0118  0.0039  199 CYS A SG  
1566 N N   . GLY A 201 ? 0.1276 0.1575 0.1460 -0.0088 0.0080  0.0025  200 GLY A N   
1567 C CA  . GLY A 201 ? 0.1200 0.1461 0.1354 -0.0076 0.0063  0.0037  200 GLY A CA  
1568 C C   . GLY A 201 ? 0.1839 0.2142 0.2044 -0.0078 0.0049  0.0024  200 GLY A C   
1569 O O   . GLY A 201 ? 0.1821 0.2182 0.2085 -0.0076 0.0043  0.0012  200 GLY A O   
1570 N N   . THR A 202 ? 0.1363 0.1632 0.1542 -0.0081 0.0040  0.0026  201 THR A N   
1571 C CA  . THR A 202 ? 0.1167 0.1471 0.1383 -0.0084 0.0024  0.0014  201 THR A CA  
1572 C C   . THR A 202 ? 0.1410 0.1691 0.1613 -0.0120 0.0037  0.0000  201 THR A C   
1573 O O   . THR A 202 ? 0.1582 0.1791 0.1725 -0.0129 0.0050  0.0007  201 THR A O   
1574 C CB  . THR A 202 ? 0.1470 0.1763 0.1667 -0.0056 0.0003  0.0025  201 THR A CB  
1575 O OG1 . THR A 202 ? 0.1367 0.1682 0.1576 -0.0033 -0.0004 0.0035  201 THR A OG1 
1576 C CG2 . THR A 202 ? 0.1256 0.1576 0.1473 -0.0060 -0.0016 0.0015  201 THR A CG2 
1577 N N   . PRO A 203 ? 0.0970 0.1305 0.1225 -0.0140 0.0032  -0.0022 202 PRO A N   
1578 C CA  . PRO A 203 ? 0.0870 0.1190 0.1120 -0.0185 0.0050  -0.0041 202 PRO A CA  
1579 C C   . PRO A 203 ? 0.1271 0.1504 0.1449 -0.0196 0.0055  -0.0035 202 PRO A C   
1580 O O   . PRO A 203 ? 0.1510 0.1684 0.1645 -0.0227 0.0081  -0.0035 202 PRO A O   
1581 C CB  . PRO A 203 ? 0.1096 0.1498 0.1417 -0.0193 0.0029  -0.0066 202 PRO A CB  
1582 C CG  . PRO A 203 ? 0.1514 0.1979 0.1889 -0.0160 0.0014  -0.0063 202 PRO A CG  
1583 C CD  . PRO A 203 ? 0.1035 0.1450 0.1361 -0.0126 0.0009  -0.0033 202 PRO A CD  
1584 N N   . GLU A 204 ? 0.1026 0.1245 0.1187 -0.0171 0.0032  -0.0031 203 GLU A N   
1585 C CA  . GLU A 204 ? 0.1075 0.1215 0.1175 -0.0176 0.0034  -0.0031 203 GLU A CA  
1586 C C   . GLU A 204 ? 0.1423 0.1474 0.1454 -0.0162 0.0048  -0.0011 203 GLU A C   
1587 O O   . GLU A 204 ? 0.1337 0.1305 0.1311 -0.0171 0.0056  -0.0013 203 GLU A O   
1588 C CB  . GLU A 204 ? 0.1227 0.1380 0.1324 -0.0147 0.0009  -0.0032 203 GLU A CB  
1589 C CG  . GLU A 204 ? 0.1152 0.1364 0.1288 -0.0165 -0.0010 -0.0053 203 GLU A CG  
1590 C CD  . GLU A 204 ? 0.1265 0.1565 0.1464 -0.0151 -0.0032 -0.0052 203 GLU A CD  
1591 O OE1 . GLU A 204 ? 0.1284 0.1606 0.1508 -0.0136 -0.0026 -0.0039 203 GLU A OE1 
1592 O OE2 . GLU A 204 ? 0.1080 0.1421 0.1300 -0.0156 -0.0056 -0.0066 203 GLU A OE2 
1593 N N   . TYR A 205 ? 0.1150 0.1215 0.1184 -0.0135 0.0048  0.0007  204 TYR A N   
1594 C CA  . TYR A 205 ? 0.1242 0.1235 0.1215 -0.0111 0.0051  0.0027  204 TYR A CA  
1595 C C   . TYR A 205 ? 0.1765 0.1719 0.1703 -0.0134 0.0074  0.0037  204 TYR A C   
1596 O O   . TYR A 205 ? 0.1618 0.1502 0.1493 -0.0114 0.0073  0.0055  204 TYR A O   
1597 C CB  . TYR A 205 ? 0.1210 0.1244 0.1204 -0.0064 0.0032  0.0038  204 TYR A CB  
1598 C CG  . TYR A 205 ? 0.1241 0.1278 0.1235 -0.0040 0.0017  0.0030  204 TYR A CG  
1599 C CD1 . TYR A 205 ? 0.1288 0.1382 0.1323 -0.0050 0.0007  0.0017  204 TYR A CD1 
1600 C CD2 . TYR A 205 ? 0.1264 0.1247 0.1216 -0.0008 0.0011  0.0034  204 TYR A CD2 
1601 C CE1 . TYR A 205 ? 0.1095 0.1186 0.1119 -0.0035 -0.0002 0.0008  204 TYR A CE1 
1602 C CE2 . TYR A 205 ? 0.1399 0.1388 0.1351 0.0011  0.0002  0.0021  204 TYR A CE2 
1603 C CZ  . TYR A 205 ? 0.1687 0.1727 0.1672 -0.0006 -0.0002 0.0008  204 TYR A CZ  
1604 O OH  . TYR A 205 ? 0.1653 0.1694 0.1628 0.0009  -0.0007 -0.0006 204 TYR A OH  
1605 N N   . LEU A 206 ? 0.1386 0.1382 0.1359 -0.0176 0.0093  0.0023  205 LEU A N   
1606 C CA  . LEU A 206 ? 0.1431 0.1399 0.1371 -0.0204 0.0121  0.0029  205 LEU A CA  
1607 C C   . LEU A 206 ? 0.1796 0.1647 0.1645 -0.0236 0.0140  0.0036  205 LEU A C   
1608 O O   . LEU A 206 ? 0.1549 0.1379 0.1397 -0.0271 0.0149  0.0020  205 LEU A O   
1609 C CB  . LEU A 206 ? 0.1378 0.1438 0.1393 -0.0241 0.0140  0.0005  205 LEU A CB  
1610 C CG  . LEU A 206 ? 0.1696 0.1864 0.1800 -0.0213 0.0123  -0.0004 205 LEU A CG  
1611 C CD1 . LEU A 206 ? 0.1787 0.2034 0.1959 -0.0249 0.0145  -0.0032 205 LEU A CD1 
1612 C CD2 . LEU A 206 ? 0.1718 0.1882 0.1804 -0.0174 0.0114  0.0016  205 LEU A CD2 
1613 N N   . ALA A 207 ? 0.1732 0.1505 0.1501 -0.0229 0.0147  0.0060  206 ALA A N   
1614 C CA  . ALA A 207 ? 0.1883 0.1525 0.1546 -0.0262 0.0168  0.0072  206 ALA A CA  
1615 C C   . ALA A 207 ? 0.1961 0.1620 0.1632 -0.0337 0.0211  0.0053  206 ALA A C   
1616 O O   . ALA A 207 ? 0.1656 0.1423 0.1404 -0.0352 0.0225  0.0036  206 ALA A O   
1617 C CB  . ALA A 207 ? 0.2121 0.1680 0.1692 -0.0232 0.0159  0.0103  206 ALA A CB  
1618 N N   . PRO A 208 ? 0.1753 0.1312 0.1353 -0.0387 0.0235  0.0051  207 PRO A N   
1619 C CA  . PRO A 208 ? 0.1750 0.1336 0.1364 -0.0466 0.0282  0.0027  207 PRO A CA  
1620 C C   . PRO A 208 ? 0.2273 0.1882 0.1869 -0.0486 0.0310  0.0033  207 PRO A C   
1621 O O   . PRO A 208 ? 0.2154 0.1861 0.1821 -0.0531 0.0342  0.0003  207 PRO A O   
1622 C CB  . PRO A 208 ? 0.2216 0.1649 0.1718 -0.0513 0.0302  0.0035  207 PRO A CB  
1623 C CG  . PRO A 208 ? 0.2883 0.2227 0.2336 -0.0455 0.0263  0.0054  207 PRO A CG  
1624 C CD  . PRO A 208 ? 0.1990 0.1406 0.1494 -0.0374 0.0222  0.0067  207 PRO A CD  
1625 N N   . GLU A 209 ? 0.1919 0.1435 0.1416 -0.0454 0.0300  0.0069  208 GLU A N   
1626 C CA  . GLU A 209 ? 0.1823 0.1348 0.1285 -0.0474 0.0327  0.0075  208 GLU A CA  
1627 C C   . GLU A 209 ? 0.2042 0.1726 0.1626 -0.0450 0.0322  0.0053  208 GLU A C   
1628 O O   . GLU A 209 ? 0.2124 0.1854 0.1718 -0.0485 0.0358  0.0038  208 GLU A O   
1629 C CB  . GLU A 209 ? 0.2029 0.1418 0.1350 -0.0445 0.0311  0.0118  208 GLU A CB  
1630 C CG  . GLU A 209 ? 0.2354 0.1746 0.1686 -0.0357 0.0254  0.0138  208 GLU A CG  
1631 C CD  . GLU A 209 ? 0.2539 0.1835 0.1826 -0.0321 0.0222  0.0152  208 GLU A CD  
1632 O OE1 . GLU A 209 ? 0.2499 0.1755 0.1783 -0.0358 0.0237  0.0139  208 GLU A OE1 
1633 O OE2 . GLU A 209 ? 0.2284 0.1544 0.1539 -0.0256 0.0181  0.0173  208 GLU A OE2 
1634 N N   . ILE A 210 ? 0.1430 0.1192 0.1103 -0.0392 0.0280  0.0049  209 ILE A N   
1635 C CA  . ILE A 210 ? 0.1477 0.1378 0.1262 -0.0368 0.0274  0.0028  209 ILE A CA  
1636 C C   . ILE A 210 ? 0.2059 0.2064 0.1946 -0.0413 0.0300  -0.0013 209 ILE A C   
1637 O O   . ILE A 210 ? 0.2033 0.2123 0.1979 -0.0430 0.0324  -0.0038 209 ILE A O   
1638 C CB  . ILE A 210 ? 0.1766 0.1710 0.1605 -0.0299 0.0225  0.0037  209 ILE A CB  
1639 C CG1 . ILE A 210 ? 0.1921 0.1783 0.1676 -0.0253 0.0198  0.0071  209 ILE A CG1 
1640 C CG2 . ILE A 210 ? 0.1470 0.1543 0.1421 -0.0280 0.0219  0.0015  209 ILE A CG2 
1641 C CD1 . ILE A 210 ? 0.2133 0.2030 0.1934 -0.0191 0.0153  0.0077  209 ILE A CD1 
1642 N N   . ILE A 211 ? 0.1716 0.1718 0.1628 -0.0430 0.0293  -0.0025 210 ILE A N   
1643 C CA  . ILE A 211 ? 0.1578 0.1684 0.1590 -0.0472 0.0310  -0.0068 210 ILE A CA  
1644 C C   . ILE A 211 ? 0.2346 0.2462 0.2344 -0.0543 0.0368  -0.0090 210 ILE A C   
1645 O O   . ILE A 211 ? 0.2184 0.2423 0.2284 -0.0561 0.0386  -0.0129 210 ILE A O   
1646 C CB  . ILE A 211 ? 0.1977 0.2059 0.1995 -0.0486 0.0294  -0.0076 210 ILE A CB  
1647 C CG1 . ILE A 211 ? 0.1833 0.1939 0.1887 -0.0419 0.0241  -0.0065 210 ILE A CG1 
1648 C CG2 . ILE A 211 ? 0.2034 0.2210 0.2137 -0.0544 0.0318  -0.0123 210 ILE A CG2 
1649 C CD1 . ILE A 211 ? 0.2251 0.2289 0.2267 -0.0423 0.0224  -0.0062 210 ILE A CD1 
1650 N N   . LEU A 212 ? 0.2165 0.2147 0.2032 -0.0580 0.0396  -0.0066 211 LEU A N   
1651 C CA  . LEU A 212 ? 0.2330 0.2295 0.2155 -0.0659 0.0457  -0.0083 211 LEU A CA  
1652 C C   . LEU A 212 ? 0.2671 0.2658 0.2474 -0.0658 0.0483  -0.0081 211 LEU A C   
1653 O O   . LEU A 212 ? 0.2420 0.2379 0.2166 -0.0725 0.0538  -0.0092 211 LEU A O   
1654 C CB  . LEU A 212 ? 0.2427 0.2229 0.2114 -0.0709 0.0478  -0.0060 211 LEU A CB  
1655 C CG  . LEU A 212 ? 0.3151 0.2936 0.2863 -0.0727 0.0464  -0.0074 211 LEU A CG  
1656 C CD1 . LEU A 212 ? 0.3524 0.3123 0.3084 -0.0766 0.0480  -0.0047 211 LEU A CD1 
1657 C CD2 . LEU A 212 ? 0.3399 0.3329 0.3240 -0.0782 0.0490  -0.0131 211 LEU A CD2 
1658 N N   . SER A 213 ? 0.2190 0.2233 0.2040 -0.0588 0.0447  -0.0072 212 SER A N   
1659 C CA  . SER A 213 ? 0.2246 0.2327 0.2095 -0.0575 0.0462  -0.0075 212 SER A CA  
1660 C C   . SER A 213 ? 0.2834 0.2779 0.2521 -0.0602 0.0487  -0.0042 212 SER A C   
1661 O O   . SER A 213 ? 0.2852 0.2810 0.2510 -0.0644 0.0533  -0.0057 212 SER A O   
1662 C CB  . SER A 213 ? 0.2632 0.2856 0.2599 -0.0611 0.0502  -0.0130 212 SER A CB  
1663 O OG  . SER A 213 ? 0.4211 0.4498 0.4216 -0.0574 0.0499  -0.0139 212 SER A OG  
1664 N N   . LYS A 214 ? 0.2476 0.2286 0.2054 -0.0577 0.0455  0.0002  213 LYS A N   
1665 C CA  . LYS A 214 ? 0.2648 0.2316 0.2061 -0.0591 0.0466  0.0039  213 LYS A CA  
1666 C C   . LYS A 214 ? 0.2810 0.2475 0.2204 -0.0519 0.0421  0.0064  213 LYS A C   
1667 O O   . LYS A 214 ? 0.2830 0.2581 0.2326 -0.0460 0.0381  0.0057  213 LYS A O   
1668 C CB  . LYS A 214 ? 0.3089 0.2600 0.2387 -0.0603 0.0454  0.0072  213 LYS A CB  
1669 C CG  . LYS A 214 ? 0.3768 0.3257 0.3059 -0.0687 0.0504  0.0049  213 LYS A CG  
1670 C CD  . LYS A 214 ? 0.5580 0.4937 0.4797 -0.0685 0.0482  0.0072  213 LYS A CD  
1671 C CE  . LYS A 214 ? 0.6656 0.5991 0.5867 -0.0776 0.0533  0.0047  213 LYS A CE  
1672 N NZ  . LYS A 214 ? 0.7321 0.6519 0.6456 -0.0775 0.0512  0.0067  213 LYS A NZ  
1673 N N   . GLY A 215 ? 0.2644 0.2207 0.1901 -0.0524 0.0426  0.0092  214 GLY A N   
1674 C CA  . GLY A 215 ? 0.2535 0.2078 0.1755 -0.0458 0.0379  0.0118  214 GLY A CA  
1675 C C   . GLY A 215 ? 0.3134 0.2588 0.2312 -0.0409 0.0327  0.0150  214 GLY A C   
1676 O O   . GLY A 215 ? 0.3549 0.2886 0.2639 -0.0437 0.0337  0.0167  214 GLY A O   
1677 N N   . TYR A 216 ? 0.2312 0.1821 0.1557 -0.0339 0.0277  0.0154  215 TYR A N   
1678 C CA  . TYR A 216 ? 0.2204 0.1652 0.1433 -0.0288 0.0230  0.0175  215 TYR A CA  
1679 C C   . TYR A 216 ? 0.2588 0.2032 0.1796 -0.0218 0.0178  0.0194  215 TYR A C   
1680 O O   . TYR A 216 ? 0.2361 0.1859 0.1577 -0.0209 0.0176  0.0189  215 TYR A O   
1681 C CB  . TYR A 216 ? 0.2268 0.1806 0.1629 -0.0278 0.0224  0.0151  215 TYR A CB  
1682 C CG  . TYR A 216 ? 0.1934 0.1620 0.1429 -0.0250 0.0212  0.0127  215 TYR A CG  
1683 C CD1 . TYR A 216 ? 0.2070 0.1790 0.1600 -0.0186 0.0167  0.0135  215 TYR A CD1 
1684 C CD2 . TYR A 216 ? 0.1672 0.1460 0.1257 -0.0286 0.0245  0.0095  215 TYR A CD2 
1685 C CE1 . TYR A 216 ? 0.1824 0.1664 0.1464 -0.0165 0.0157  0.0115  215 TYR A CE1 
1686 C CE2 . TYR A 216 ? 0.1617 0.1524 0.1315 -0.0256 0.0231  0.0075  215 TYR A CE2 
1687 C CZ  . TYR A 216 ? 0.2079 0.2004 0.1798 -0.0198 0.0188  0.0087  215 TYR A CZ  
1688 O OH  . TYR A 216 ? 0.1659 0.1684 0.1476 -0.0173 0.0176  0.0070  215 TYR A OH  
1689 N N   . ASN A 217 ? 0.2288 0.1669 0.1468 -0.0169 0.0137  0.0212  216 ASN A N   
1690 C CA  . ASN A 217 ? 0.2308 0.1692 0.1473 -0.0102 0.0085  0.0226  216 ASN A CA  
1691 C C   . ASN A 217 ? 0.2350 0.1778 0.1599 -0.0048 0.0049  0.0218  216 ASN A C   
1692 O O   . ASN A 217 ? 0.2125 0.1602 0.1454 -0.0065 0.0065  0.0200  216 ASN A O   
1693 C CB  . ASN A 217 ? 0.2609 0.1840 0.1608 -0.0092 0.0066  0.0261  216 ASN A CB  
1694 C CG  . ASN A 217 ? 0.4639 0.3729 0.3552 -0.0095 0.0064  0.0280  216 ASN A CG  
1695 O OD1 . ASN A 217 ? 0.3102 0.2210 0.2082 -0.0086 0.0062  0.0268  216 ASN A OD1 
1696 N ND2 . ASN A 217 ? 0.4282 0.3219 0.3036 -0.0110 0.0063  0.0311  216 ASN A ND2 
1697 N N   . LYS A 218 ? 0.2158 0.1566 0.1382 0.0015  0.0001  0.0230  217 LYS A N   
1698 C CA  . LYS A 218 ? 0.1964 0.1419 0.1264 0.0069  -0.0032 0.0219  217 LYS A CA  
1699 C C   . LYS A 218 ? 0.2352 0.1740 0.1644 0.0065  -0.0025 0.0217  217 LYS A C   
1700 O O   . LYS A 218 ? 0.2240 0.1689 0.1614 0.0093  -0.0038 0.0200  217 LYS A O   
1701 C CB  . LYS A 218 ? 0.2239 0.1687 0.1511 0.0136  -0.0085 0.0227  217 LYS A CB  
1702 C CG  . LYS A 218 ? 0.3507 0.2798 0.2636 0.0158  -0.0110 0.0257  217 LYS A CG  
1703 C CD  . LYS A 218 ? 0.4332 0.3633 0.3442 0.0228  -0.0167 0.0262  217 LYS A CD  
1704 C CE  . LYS A 218 ? 0.5748 0.4883 0.4705 0.0255  -0.0198 0.0295  217 LYS A CE  
1705 N NZ  . LYS A 218 ? 0.6061 0.5188 0.5027 0.0341  -0.0258 0.0291  217 LYS A NZ  
1706 N N   . ALA A 219 ? 0.2007 0.1270 0.1199 0.0024  -0.0001 0.0233  218 ALA A N   
1707 C CA  . ALA A 219 ? 0.2206 0.1398 0.1385 0.0012  0.0009  0.0229  218 ALA A CA  
1708 C C   . ALA A 219 ? 0.2299 0.1605 0.1602 -0.0016 0.0032  0.0199  218 ALA A C   
1709 O O   . ALA A 219 ? 0.2368 0.1654 0.1692 -0.0007 0.0028  0.0187  218 ALA A O   
1710 C CB  . ALA A 219 ? 0.2548 0.1592 0.1600 -0.0043 0.0038  0.0248  218 ALA A CB  
1711 N N   . VAL A 220 ? 0.1829 0.1253 0.1211 -0.0045 0.0053  0.0184  219 VAL A N   
1712 C CA  . VAL A 220 ? 0.1619 0.1150 0.1115 -0.0065 0.0068  0.0157  219 VAL A CA  
1713 C C   . VAL A 220 ? 0.1878 0.1474 0.1447 -0.0011 0.0036  0.0146  219 VAL A C   
1714 O O   . VAL A 220 ? 0.1853 0.1485 0.1476 -0.0019 0.0040  0.0129  219 VAL A O   
1715 C CB  . VAL A 220 ? 0.1798 0.1434 0.1364 -0.0103 0.0094  0.0142  219 VAL A CB  
1716 C CG1 . VAL A 220 ? 0.1771 0.1350 0.1268 -0.0162 0.0133  0.0147  219 VAL A CG1 
1717 C CG2 . VAL A 220 ? 0.1653 0.1371 0.1263 -0.0066 0.0074  0.0143  219 VAL A CG2 
1718 N N   . ASP A 221 ? 0.1483 0.1097 0.1049 0.0041  0.0005  0.0154  220 ASP A N   
1719 C CA  . ASP A 221 ? 0.1401 0.1077 0.1030 0.0089  -0.0021 0.0141  220 ASP A CA  
1720 C C   . ASP A 221 ? 0.1914 0.1510 0.1507 0.0114  -0.0033 0.0138  220 ASP A C   
1721 O O   . ASP A 221 ? 0.1716 0.1360 0.1367 0.0124  -0.0034 0.0119  220 ASP A O   
1722 C CB  . ASP A 221 ? 0.1684 0.1403 0.1321 0.0134  -0.0050 0.0145  220 ASP A CB  
1723 C CG  . ASP A 221 ? 0.1710 0.1534 0.1410 0.0118  -0.0042 0.0138  220 ASP A CG  
1724 O OD1 . ASP A 221 ? 0.1416 0.1300 0.1177 0.0085  -0.0020 0.0127  220 ASP A OD1 
1725 O OD2 . ASP A 221 ? 0.1786 0.1634 0.1478 0.0144  -0.0063 0.0142  220 ASP A OD2 
1726 N N   . TRP A 222 ? 0.1633 0.1097 0.1122 0.0121  -0.0039 0.0157  221 TRP A N   
1727 C CA  . TRP A 222 ? 0.1896 0.1262 0.1338 0.0145  -0.0050 0.0154  221 TRP A CA  
1728 C C   . TRP A 222 ? 0.2149 0.1501 0.1607 0.0096  -0.0020 0.0138  221 TRP A C   
1729 O O   . TRP A 222 ? 0.2037 0.1389 0.1521 0.0116  -0.0027 0.0120  221 TRP A O   
1730 C CB  . TRP A 222 ? 0.1981 0.1196 0.1297 0.0167  -0.0068 0.0181  221 TRP A CB  
1731 C CG  . TRP A 222 ? 0.2079 0.1318 0.1388 0.0229  -0.0108 0.0190  221 TRP A CG  
1732 C CD1 . TRP A 222 ? 0.2541 0.1747 0.1784 0.0228  -0.0119 0.0213  221 TRP A CD1 
1733 C CD2 . TRP A 222 ? 0.2037 0.1359 0.1419 0.0296  -0.0142 0.0170  221 TRP A CD2 
1734 N NE1 . TRP A 222 ? 0.2478 0.1732 0.1741 0.0293  -0.0162 0.0211  221 TRP A NE1 
1735 C CE2 . TRP A 222 ? 0.2550 0.1880 0.1903 0.0335  -0.0176 0.0183  221 TRP A CE2 
1736 C CE3 . TRP A 222 ? 0.2202 0.1586 0.1662 0.0325  -0.0146 0.0140  221 TRP A CE3 
1737 C CZ2 . TRP A 222 ? 0.2395 0.1806 0.1809 0.0402  -0.0214 0.0164  221 TRP A CZ2 
1738 C CZ3 . TRP A 222 ? 0.2271 0.1731 0.1788 0.0390  -0.0179 0.0122  221 TRP A CZ3 
1739 C CH2 . TRP A 222 ? 0.2326 0.1799 0.1822 0.0429  -0.0213 0.0134  221 TRP A CH2 
1740 N N   . TRP A 223 ? 0.1965 0.1323 0.1420 0.0029  0.0013  0.0141  222 TRP A N   
1741 C CA  . TRP A 223 ? 0.1878 0.1249 0.1365 -0.0023 0.0039  0.0122  222 TRP A CA  
1742 C C   . TRP A 223 ? 0.1971 0.1470 0.1565 -0.0006 0.0031  0.0098  222 TRP A C   
1743 O O   . TRP A 223 ? 0.1744 0.1233 0.1351 -0.0007 0.0030  0.0080  222 TRP A O   
1744 C CB  . TRP A 223 ? 0.1619 0.1014 0.1109 -0.0091 0.0074  0.0122  222 TRP A CB  
1745 C CG  . TRP A 223 ? 0.1586 0.1029 0.1133 -0.0142 0.0096  0.0096  222 TRP A CG  
1746 C CD1 . TRP A 223 ? 0.1813 0.1384 0.1464 -0.0144 0.0093  0.0075  222 TRP A CD1 
1747 C CD2 . TRP A 223 ? 0.1599 0.0958 0.1096 -0.0198 0.0122  0.0087  222 TRP A CD2 
1748 N NE1 . TRP A 223 ? 0.1730 0.1310 0.1403 -0.0192 0.0110  0.0053  222 TRP A NE1 
1749 C CE2 . TRP A 223 ? 0.1965 0.1421 0.1550 -0.0229 0.0129  0.0058  222 TRP A CE2 
1750 C CE3 . TRP A 223 ? 0.1921 0.1127 0.1302 -0.0227 0.0138  0.0102  222 TRP A CE3 
1751 C CZ2 . TRP A 223 ? 0.2007 0.1424 0.1577 -0.0289 0.0152  0.0038  222 TRP A CZ2 
1752 C CZ3 . TRP A 223 ? 0.2236 0.1394 0.1598 -0.0292 0.0166  0.0084  222 TRP A CZ3 
1753 C CH2 . TRP A 223 ? 0.2224 0.1493 0.1685 -0.0322 0.0172  0.0050  222 TRP A CH2 
1754 N N   . ALA A 224 ? 0.1450 0.1060 0.1112 0.0009  0.0023  0.0098  223 ALA A N   
1755 C CA  . ALA A 224 ? 0.1312 0.1036 0.1064 0.0021  0.0016  0.0080  223 ALA A CA  
1756 C C   . ALA A 224 ? 0.1590 0.1307 0.1346 0.0069  -0.0003 0.0069  223 ALA A C   
1757 O O   . ALA A 224 ? 0.1499 0.1262 0.1296 0.0064  -0.0002 0.0051  223 ALA A O   
1758 C CB  . ALA A 224 ? 0.1369 0.1189 0.1175 0.0029  0.0012  0.0085  223 ALA A CB  
1759 N N   . LEU A 225 ? 0.1185 0.0837 0.0891 0.0114  -0.0022 0.0079  224 LEU A N   
1760 C CA  . LEU A 225 ? 0.1165 0.0807 0.0875 0.0164  -0.0039 0.0062  224 LEU A CA  
1761 C C   . LEU A 225 ? 0.1911 0.1481 0.1591 0.0147  -0.0028 0.0047  224 LEU A C   
1762 O O   . LEU A 225 ? 0.1709 0.1318 0.1425 0.0163  -0.0029 0.0023  224 LEU A O   
1763 C CB  . LEU A 225 ? 0.1360 0.0939 0.1020 0.0219  -0.0065 0.0074  224 LEU A CB  
1764 C CG  . LEU A 225 ? 0.1844 0.1414 0.1515 0.0278  -0.0084 0.0052  224 LEU A CG  
1765 C CD1 . LEU A 225 ? 0.1757 0.1468 0.1524 0.0292  -0.0083 0.0026  224 LEU A CD1 
1766 C CD2 . LEU A 225 ? 0.1909 0.1406 0.1525 0.0335  -0.0116 0.0064  224 LEU A CD2 
1767 N N   . GLY A 226 ? 0.1753 0.1216 0.1363 0.0111  -0.0015 0.0059  225 GLY A N   
1768 C CA  . GLY A 226 ? 0.1712 0.1101 0.1289 0.0084  -0.0002 0.0042  225 GLY A CA  
1769 C C   . GLY A 226 ? 0.1932 0.1420 0.1580 0.0047  0.0010  0.0020  225 GLY A C   
1770 O O   . GLY A 226 ? 0.1586 0.1070 0.1240 0.0052  0.0010  -0.0004 225 GLY A O   
1771 N N   . VAL A 227 ? 0.1423 0.1003 0.1123 0.0013  0.0019  0.0027  226 VAL A N   
1772 C CA  . VAL A 227 ? 0.1243 0.0915 0.1007 -0.0017 0.0024  0.0008  226 VAL A CA  
1773 C C   . VAL A 227 ? 0.1765 0.1509 0.1572 0.0022  0.0010  -0.0005 226 VAL A C   
1774 O O   . VAL A 227 ? 0.1766 0.1529 0.1584 0.0011  0.0010  -0.0026 226 VAL A O   
1775 C CB  . VAL A 227 ? 0.1317 0.1072 0.1131 -0.0052 0.0032  0.0016  226 VAL A CB  
1776 C CG1 . VAL A 227 ? 0.1271 0.1113 0.1146 -0.0077 0.0030  -0.0002 226 VAL A CG1 
1777 C CG2 . VAL A 227 ? 0.1173 0.0865 0.0946 -0.0095 0.0053  0.0025  226 VAL A CG2 
1778 N N   . LEU A 228 ? 0.1345 0.1127 0.1170 0.0064  -0.0001 0.0005  227 LEU A N   
1779 C CA  . LEU A 228 ? 0.1194 0.1049 0.1061 0.0095  -0.0009 -0.0009 227 LEU A CA  
1780 C C   . LEU A 228 ? 0.1552 0.1359 0.1392 0.0122  -0.0010 -0.0033 227 LEU A C   
1781 O O   . LEU A 228 ? 0.1462 0.1314 0.1322 0.0117  -0.0006 -0.0053 227 LEU A O   
1782 C CB  . LEU A 228 ? 0.1185 0.1084 0.1074 0.0133  -0.0020 0.0002  227 LEU A CB  
1783 C CG  . LEU A 228 ? 0.1655 0.1639 0.1591 0.0158  -0.0022 -0.0015 227 LEU A CG  
1784 C CD1 . LEU A 228 ? 0.1683 0.1746 0.1660 0.0125  -0.0016 -0.0014 227 LEU A CD1 
1785 C CD2 . LEU A 228 ? 0.1576 0.1589 0.1528 0.0199  -0.0035 -0.0011 227 LEU A CD2 
1786 N N   . ILE A 229 ? 0.1346 0.1056 0.1134 0.0151  -0.0016 -0.0031 228 ILE A N   
1787 C CA  . ILE A 229 ? 0.1366 0.1021 0.1128 0.0183  -0.0017 -0.0057 228 ILE A CA  
1788 C C   . ILE A 229 ? 0.1862 0.1486 0.1604 0.0139  -0.0004 -0.0076 228 ILE A C   
1789 O O   . ILE A 229 ? 0.1772 0.1420 0.1524 0.0149  0.0001  -0.0105 228 ILE A O   
1790 C CB  . ILE A 229 ? 0.1748 0.1284 0.1447 0.0224  -0.0031 -0.0048 228 ILE A CB  
1791 C CG1 . ILE A 229 ? 0.1766 0.1349 0.1490 0.0274  -0.0051 -0.0035 228 ILE A CG1 
1792 C CG2 . ILE A 229 ? 0.1977 0.1438 0.1644 0.0256  -0.0032 -0.0078 228 ILE A CG2 
1793 C CD1 . ILE A 229 ? 0.2009 0.1468 0.1661 0.0319  -0.0073 -0.0019 228 ILE A CD1 
1794 N N   . TYR A 230 ? 0.1727 0.1303 0.1441 0.0090  0.0004  -0.0064 229 TYR A N   
1795 C CA  . TYR A 230 ? 0.1496 0.1052 0.1197 0.0042  0.0015  -0.0084 229 TYR A CA  
1796 C C   . TYR A 230 ? 0.1847 0.1519 0.1603 0.0028  0.0013  -0.0098 229 TYR A C   
1797 O O   . TYR A 230 ? 0.1673 0.1343 0.1418 0.0025  0.0016  -0.0125 229 TYR A O   
1798 C CB  . TYR A 230 ? 0.1464 0.0985 0.1147 -0.0015 0.0025  -0.0069 229 TYR A CB  
1799 C CG  . TYR A 230 ? 0.1427 0.0926 0.1097 -0.0069 0.0034  -0.0094 229 TYR A CG  
1800 C CD1 . TYR A 230 ? 0.1526 0.1124 0.1246 -0.0092 0.0029  -0.0111 229 TYR A CD1 
1801 C CD2 . TYR A 230 ? 0.1564 0.0939 0.1168 -0.0097 0.0046  -0.0100 229 TYR A CD2 
1802 C CE1 . TYR A 230 ? 0.1584 0.1169 0.1294 -0.0141 0.0033  -0.0137 229 TYR A CE1 
1803 C CE2 . TYR A 230 ? 0.1693 0.1052 0.1288 -0.0152 0.0055  -0.0127 229 TYR A CE2 
1804 C CZ  . TYR A 230 ? 0.1807 0.1278 0.1459 -0.0172 0.0047  -0.0146 229 TYR A CZ  
1805 O OH  . TYR A 230 ? 0.1837 0.1304 0.1484 -0.0227 0.0051  -0.0175 229 TYR A OH  
1806 N N   . GLU A 231 ? 0.1526 0.1290 0.1332 0.0018  0.0009  -0.0080 230 GLU A N   
1807 C CA  . GLU A 231 ? 0.1311 0.1171 0.1157 0.0006  0.0004  -0.0088 230 GLU A CA  
1808 C C   . GLU A 231 ? 0.1462 0.1351 0.1309 0.0041  0.0006  -0.0106 230 GLU A C   
1809 O O   . GLU A 231 ? 0.1364 0.1280 0.1206 0.0025  0.0006  -0.0124 230 GLU A O   
1810 C CB  . GLU A 231 ? 0.1381 0.1318 0.1275 -0.0003 -0.0002 -0.0064 230 GLU A CB  
1811 C CG  . GLU A 231 ? 0.1040 0.1057 0.0962 -0.0017 -0.0011 -0.0068 230 GLU A CG  
1812 C CD  . GLU A 231 ? 0.1295 0.1376 0.1262 -0.0026 -0.0019 -0.0047 230 GLU A CD  
1813 O OE1 . GLU A 231 ? 0.1498 0.1570 0.1479 -0.0040 -0.0016 -0.0036 230 GLU A OE1 
1814 O OE2 . GLU A 231 ? 0.1415 0.1551 0.1398 -0.0022 -0.0027 -0.0042 230 GLU A OE2 
1815 N N   . MET A 232 ? 0.1258 0.1147 0.1114 0.0086  0.0006  -0.0102 231 MET A N   
1816 C CA  . MET A 232 ? 0.1159 0.1088 0.1026 0.0119  0.0012  -0.0125 231 MET A CA  
1817 C C   . MET A 232 ? 0.1799 0.1670 0.1626 0.0122  0.0020  -0.0159 231 MET A C   
1818 O O   . MET A 232 ? 0.1818 0.1730 0.1643 0.0114  0.0029  -0.0182 231 MET A O   
1819 C CB  . MET A 232 ? 0.1349 0.1289 0.1237 0.0169  0.0007  -0.0122 231 MET A CB  
1820 C CG  . MET A 232 ? 0.1405 0.1420 0.1337 0.0166  0.0002  -0.0097 231 MET A CG  
1821 S SD  . MET A 232 ? 0.1730 0.1788 0.1697 0.0223  -0.0005 -0.0104 231 MET A SD  
1822 C CE  . MET A 232 ? 0.1664 0.1601 0.1582 0.0258  -0.0023 -0.0091 231 MET A CE  
1823 N N   . ALA A 233 ? 0.1480 0.1248 0.1267 0.0131  0.0018  -0.0163 232 ALA A N   
1824 C CA  . ALA A 233 ? 0.1702 0.1396 0.1446 0.0139  0.0025  -0.0197 232 ALA A CA  
1825 C C   . ALA A 233 ? 0.1935 0.1611 0.1650 0.0084  0.0030  -0.0211 232 ALA A C   
1826 O O   . ALA A 233 ? 0.1845 0.1502 0.1535 0.0085  0.0038  -0.0246 232 ALA A O   
1827 C CB  . ALA A 233 ? 0.1980 0.1554 0.1681 0.0172  0.0019  -0.0194 232 ALA A CB  
1828 N N   . ALA A 234 ? 0.1584 0.1273 0.1306 0.0036  0.0024  -0.0189 233 ALA A N   
1829 C CA  . ALA A 234 ? 0.1703 0.1391 0.1409 -0.0017 0.0022  -0.0205 233 ALA A CA  
1830 C C   . ALA A 234 ? 0.1980 0.1772 0.1713 -0.0038 0.0014  -0.0205 233 ALA A C   
1831 O O   . ALA A 234 ? 0.2047 0.1842 0.1756 -0.0066 0.0011  -0.0229 233 ALA A O   
1832 C CB  . ALA A 234 ? 0.1865 0.1514 0.1567 -0.0059 0.0020  -0.0188 233 ALA A CB  
1833 N N   . GLY A 235 ? 0.1578 0.1445 0.1354 -0.0025 0.0009  -0.0178 234 GLY A N   
1834 C CA  . GLY A 235 ? 0.1455 0.1407 0.1249 -0.0042 -0.0002 -0.0171 234 GLY A CA  
1835 C C   . GLY A 235 ? 0.1819 0.1805 0.1645 -0.0074 -0.0019 -0.0151 234 GLY A C   
1836 O O   . GLY A 235 ? 0.1599 0.1647 0.1440 -0.0086 -0.0034 -0.0142 234 GLY A O   
1837 N N   . TYR A 236 ? 0.1465 0.1405 0.1295 -0.0091 -0.0016 -0.0147 235 TYR A N   
1838 C CA  . TYR A 236 ? 0.1377 0.1355 0.1246 -0.0121 -0.0026 -0.0135 235 TYR A CA  
1839 C C   . TYR A 236 ? 0.1570 0.1496 0.1440 -0.0121 -0.0012 -0.0120 235 TYR A C   
1840 O O   . TYR A 236 ? 0.1454 0.1298 0.1284 -0.0104 0.0001  -0.0124 235 TYR A O   
1841 C CB  . TYR A 236 ? 0.1529 0.1513 0.1392 -0.0166 -0.0038 -0.0160 235 TYR A CB  
1842 C CG  . TYR A 236 ? 0.1568 0.1465 0.1381 -0.0184 -0.0025 -0.0187 235 TYR A CG  
1843 C CD1 . TYR A 236 ? 0.1901 0.1727 0.1702 -0.0204 -0.0008 -0.0187 235 TYR A CD1 
1844 C CD2 . TYR A 236 ? 0.1753 0.1629 0.1523 -0.0183 -0.0026 -0.0214 235 TYR A CD2 
1845 C CE1 . TYR A 236 ? 0.2001 0.1728 0.1746 -0.0221 0.0005  -0.0212 235 TYR A CE1 
1846 C CE2 . TYR A 236 ? 0.2041 0.1827 0.1762 -0.0197 -0.0014 -0.0242 235 TYR A CE2 
1847 C CZ  . TYR A 236 ? 0.2494 0.2201 0.2202 -0.0214 0.0001  -0.0240 235 TYR A CZ  
1848 O OH  . TYR A 236 ? 0.2472 0.2079 0.2124 -0.0232 0.0013  -0.0268 235 TYR A OH  
1849 N N   . PRO A 237 ? 0.1590 0.1560 0.1504 -0.0135 -0.0014 -0.0103 236 PRO A N   
1850 C CA  . PRO A 237 ? 0.1465 0.1383 0.1369 -0.0138 0.0003  -0.0088 236 PRO A CA  
1851 C C   . PRO A 237 ? 0.1704 0.1547 0.1573 -0.0181 0.0017  -0.0104 236 PRO A C   
1852 O O   . PRO A 237 ? 0.1662 0.1519 0.1537 -0.0216 0.0013  -0.0128 236 PRO A O   
1853 C CB  . PRO A 237 ? 0.1728 0.1724 0.1690 -0.0142 -0.0001 -0.0071 236 PRO A CB  
1854 C CG  . PRO A 237 ? 0.2041 0.2120 0.2043 -0.0151 -0.0022 -0.0081 236 PRO A CG  
1855 C CD  . PRO A 237 ? 0.1614 0.1676 0.1581 -0.0147 -0.0032 -0.0098 236 PRO A CD  
1856 N N   . PRO A 238 ? 0.1501 0.1262 0.1331 -0.0182 0.0034  -0.0090 237 PRO A N   
1857 C CA  . PRO A 238 ? 0.1631 0.1304 0.1416 -0.0230 0.0053  -0.0103 237 PRO A CA  
1858 C C   . PRO A 238 ? 0.1762 0.1499 0.1594 -0.0289 0.0061  -0.0115 237 PRO A C   
1859 O O   . PRO A 238 ? 0.1784 0.1480 0.1596 -0.0340 0.0074  -0.0138 237 PRO A O   
1860 C CB  . PRO A 238 ? 0.1870 0.1441 0.1594 -0.0212 0.0066  -0.0077 237 PRO A CB  
1861 C CG  . PRO A 238 ? 0.2071 0.1713 0.1835 -0.0170 0.0056  -0.0052 237 PRO A CG  
1862 C CD  . PRO A 238 ? 0.1485 0.1222 0.1301 -0.0141 0.0036  -0.0061 237 PRO A CD  
1863 N N   . PHE A 239 ? 0.1429 0.1265 0.1326 -0.0283 0.0056  -0.0104 238 PHE A N   
1864 C CA  . PHE A 239 ? 0.1436 0.1353 0.1395 -0.0331 0.0064  -0.0120 238 PHE A CA  
1865 C C   . PHE A 239 ? 0.1832 0.1873 0.1869 -0.0308 0.0035  -0.0124 238 PHE A C   
1866 O O   . PHE A 239 ? 0.1746 0.1824 0.1805 -0.0270 0.0028  -0.0102 238 PHE A O   
1867 C CB  . PHE A 239 ? 0.1497 0.1399 0.1453 -0.0348 0.0091  -0.0103 238 PHE A CB  
1868 C CG  . PHE A 239 ? 0.1784 0.1543 0.1642 -0.0353 0.0113  -0.0085 238 PHE A CG  
1869 C CD1 . PHE A 239 ? 0.2259 0.1930 0.2063 -0.0407 0.0135  -0.0101 238 PHE A CD1 
1870 C CD2 . PHE A 239 ? 0.1847 0.1555 0.1662 -0.0303 0.0108  -0.0054 238 PHE A CD2 
1871 C CE1 . PHE A 239 ? 0.2429 0.1949 0.2130 -0.0408 0.0151  -0.0081 238 PHE A CE1 
1872 C CE2 . PHE A 239 ? 0.2323 0.1893 0.2042 -0.0300 0.0120  -0.0036 238 PHE A CE2 
1873 C CZ  . PHE A 239 ? 0.2290 0.1760 0.1948 -0.0350 0.0141  -0.0048 238 PHE A CZ  
1874 N N   . PHE A 240 ? 0.1421 0.1517 0.1489 -0.0328 0.0016  -0.0151 239 PHE A N   
1875 C CA  . PHE A 240 ? 0.1280 0.1483 0.1411 -0.0305 -0.0017 -0.0153 239 PHE A CA  
1876 C C   . PHE A 240 ? 0.1600 0.1887 0.1794 -0.0344 -0.0031 -0.0187 239 PHE A C   
1877 O O   . PHE A 240 ? 0.1670 0.1934 0.1851 -0.0391 -0.0020 -0.0214 239 PHE A O   
1878 C CB  . PHE A 240 ? 0.1435 0.1628 0.1531 -0.0266 -0.0042 -0.0145 239 PHE A CB  
1879 C CG  . PHE A 240 ? 0.1640 0.1805 0.1700 -0.0288 -0.0052 -0.0172 239 PHE A CG  
1880 C CD1 . PHE A 240 ? 0.1889 0.2128 0.1984 -0.0308 -0.0081 -0.0196 239 PHE A CD1 
1881 C CD2 . PHE A 240 ? 0.1808 0.1873 0.1797 -0.0286 -0.0035 -0.0176 239 PHE A CD2 
1882 C CE1 . PHE A 240 ? 0.1959 0.2172 0.2015 -0.0332 -0.0091 -0.0224 239 PHE A CE1 
1883 C CE2 . PHE A 240 ? 0.2134 0.2169 0.2086 -0.0309 -0.0042 -0.0205 239 PHE A CE2 
1884 C CZ  . PHE A 240 ? 0.1983 0.2094 0.1967 -0.0333 -0.0069 -0.0229 239 PHE A CZ  
1885 N N   . ALA A 241 ? 0.1564 0.1951 0.1828 -0.0324 -0.0056 -0.0187 240 ALA A N   
1886 C CA  . ALA A 241 ? 0.1794 0.2283 0.2135 -0.0350 -0.0078 -0.0221 240 ALA A CA  
1887 C C   . ALA A 241 ? 0.2385 0.2953 0.2775 -0.0303 -0.0118 -0.0211 240 ALA A C   
1888 O O   . ALA A 241 ? 0.2396 0.2930 0.2752 -0.0260 -0.0124 -0.0178 240 ALA A O   
1889 C CB  . ALA A 241 ? 0.1910 0.2432 0.2302 -0.0395 -0.0043 -0.0242 240 ALA A CB  
1890 N N   . ASP A 242 ? 0.1955 0.2627 0.2424 -0.0310 -0.0149 -0.0240 241 ASP A N   
1891 C CA  . ASP A 242 ? 0.2002 0.2733 0.2508 -0.0259 -0.0191 -0.0228 241 ASP A CA  
1892 C C   . ASP A 242 ? 0.2270 0.3036 0.2832 -0.0237 -0.0175 -0.0217 241 ASP A C   
1893 O O   . ASP A 242 ? 0.2268 0.3041 0.2834 -0.0189 -0.0200 -0.0194 241 ASP A O   
1894 C CB  . ASP A 242 ? 0.2223 0.3048 0.2786 -0.0261 -0.0242 -0.0260 241 ASP A CB  
1895 C CG  . ASP A 242 ? 0.3246 0.4032 0.3737 -0.0267 -0.0271 -0.0262 241 ASP A CG  
1896 O OD1 . ASP A 242 ? 0.2988 0.3701 0.3399 -0.0239 -0.0276 -0.0229 241 ASP A OD1 
1897 O OD2 . ASP A 242 ? 0.3958 0.4795 0.4477 -0.0300 -0.0291 -0.0300 241 ASP A OD2 
1898 N N   . GLN A 243 ? 0.1714 0.2500 0.2316 -0.0273 -0.0133 -0.0236 242 GLN A N   
1899 C CA  . GLN A 243 ? 0.1660 0.2482 0.2315 -0.0256 -0.0113 -0.0232 242 GLN A CA  
1900 C C   . GLN A 243 ? 0.1865 0.2611 0.2469 -0.0281 -0.0057 -0.0215 242 GLN A C   
1901 O O   . GLN A 243 ? 0.1725 0.2421 0.2289 -0.0328 -0.0028 -0.0224 242 GLN A O   
1902 C CB  . GLN A 243 ? 0.1877 0.2826 0.2648 -0.0274 -0.0117 -0.0279 242 GLN A CB  
1903 C CG  . GLN A 243 ? 0.2716 0.3753 0.3549 -0.0243 -0.0180 -0.0300 242 GLN A CG  
1904 C CD  . GLN A 243 ? 0.4351 0.5378 0.5175 -0.0175 -0.0221 -0.0269 242 GLN A CD  
1905 O OE1 . GLN A 243 ? 0.3968 0.4969 0.4789 -0.0148 -0.0202 -0.0247 242 GLN A OE1 
1906 N NE2 . GLN A 243 ? 0.4091 0.5134 0.4907 -0.0147 -0.0279 -0.0267 242 GLN A NE2 
1907 N N   . PRO A 244 ? 0.1392 0.2128 0.1999 -0.0253 -0.0041 -0.0194 243 PRO A N   
1908 C CA  . PRO A 244 ? 0.1389 0.2052 0.1941 -0.0275 0.0007  -0.0178 243 PRO A CA  
1909 C C   . PRO A 244 ? 0.1906 0.2577 0.2469 -0.0338 0.0051  -0.0206 243 PRO A C   
1910 O O   . PRO A 244 ? 0.1527 0.2102 0.2010 -0.0367 0.0081  -0.0191 243 PRO A O   
1911 C CB  . PRO A 244 ? 0.1529 0.2212 0.2105 -0.0235 0.0009  -0.0162 243 PRO A CB  
1912 C CG  . PRO A 244 ? 0.2011 0.2717 0.2603 -0.0185 -0.0040 -0.0150 243 PRO A CG  
1913 C CD  . PRO A 244 ? 0.1527 0.2303 0.2172 -0.0199 -0.0070 -0.0182 243 PRO A CD  
1914 N N   . ILE A 245 ? 0.1664 0.2443 0.2323 -0.0361 0.0055  -0.0247 244 ILE A N   
1915 C CA  . ILE A 245 ? 0.1833 0.2631 0.2508 -0.0433 0.0102  -0.0280 244 ILE A CA  
1916 C C   . ILE A 245 ? 0.2170 0.2888 0.2776 -0.0480 0.0110  -0.0282 244 ILE A C   
1917 O O   . ILE A 245 ? 0.2010 0.2650 0.2552 -0.0531 0.0156  -0.0279 244 ILE A O   
1918 C CB  . ILE A 245 ? 0.2232 0.3185 0.3041 -0.0447 0.0099  -0.0334 244 ILE A CB  
1919 C CG1 . ILE A 245 ? 0.2463 0.3440 0.3290 -0.0532 0.0156  -0.0373 244 ILE A CG1 
1920 C CG2 . ILE A 245 ? 0.2464 0.3493 0.3334 -0.0424 0.0039  -0.0355 244 ILE A CG2 
1921 C CD1 . ILE A 245 ? 0.4008 0.5144 0.4970 -0.0548 0.0174  -0.0428 244 ILE A CD1 
1922 N N   . GLN A 246 ? 0.1977 0.2703 0.2584 -0.0463 0.0066  -0.0286 245 GLN A N   
1923 C CA  . GLN A 246 ? 0.1865 0.2519 0.2409 -0.0503 0.0069  -0.0293 245 GLN A CA  
1924 C C   . GLN A 246 ? 0.2002 0.2504 0.2425 -0.0490 0.0086  -0.0250 245 GLN A C   
1925 O O   . GLN A 246 ? 0.2019 0.2428 0.2373 -0.0535 0.0112  -0.0252 245 GLN A O   
1926 C CB  . GLN A 246 ? 0.2081 0.2784 0.2652 -0.0483 0.0015  -0.0308 245 GLN A CB  
1927 C CG  . GLN A 246 ? 0.4101 0.4960 0.4795 -0.0487 -0.0015 -0.0353 245 GLN A CG  
1928 C CD  . GLN A 246 ? 0.5263 0.6156 0.5964 -0.0452 -0.0077 -0.0357 245 GLN A CD  
1929 O OE1 . GLN A 246 ? 0.2679 0.3550 0.3352 -0.0392 -0.0111 -0.0323 245 GLN A OE1 
1930 N NE2 . GLN A 246 ? 0.5380 0.6327 0.6114 -0.0493 -0.0094 -0.0398 245 GLN A NE2 
1931 N N   . ILE A 247 ? 0.1220 0.1693 0.1616 -0.0428 0.0069  -0.0212 246 ILE A N   
1932 C CA  . ILE A 247 ? 0.1326 0.1673 0.1620 -0.0405 0.0079  -0.0174 246 ILE A CA  
1933 C C   . ILE A 247 ? 0.1719 0.1995 0.1963 -0.0441 0.0127  -0.0164 246 ILE A C   
1934 O O   . ILE A 247 ? 0.1598 0.1757 0.1753 -0.0461 0.0145  -0.0152 246 ILE A O   
1935 C CB  . ILE A 247 ? 0.1637 0.1992 0.1930 -0.0336 0.0052  -0.0142 246 ILE A CB  
1936 C CG1 . ILE A 247 ? 0.1704 0.2105 0.2020 -0.0306 0.0008  -0.0147 246 ILE A CG1 
1937 C CG2 . ILE A 247 ? 0.1817 0.2058 0.2017 -0.0312 0.0064  -0.0107 246 ILE A CG2 
1938 C CD1 . ILE A 247 ? 0.1697 0.2125 0.2027 -0.0249 -0.0018 -0.0121 246 ILE A CD1 
1939 N N   . TYR A 248 ? 0.1401 0.1743 0.1696 -0.0450 0.0147  -0.0171 247 TYR A N   
1940 C CA  . TYR A 248 ? 0.1360 0.1640 0.1602 -0.0488 0.0195  -0.0163 247 TYR A CA  
1941 C C   . TYR A 248 ? 0.1903 0.2127 0.2105 -0.0563 0.0229  -0.0183 247 TYR A C   
1942 O O   . TYR A 248 ? 0.1848 0.1946 0.1946 -0.0586 0.0258  -0.0161 247 TYR A O   
1943 C CB  . TYR A 248 ? 0.1455 0.1833 0.1770 -0.0490 0.0213  -0.0177 247 TYR A CB  
1944 C CG  . TYR A 248 ? 0.1488 0.1919 0.1844 -0.0421 0.0182  -0.0160 247 TYR A CG  
1945 C CD1 . TYR A 248 ? 0.1765 0.2122 0.2058 -0.0369 0.0157  -0.0121 247 TYR A CD1 
1946 C CD2 . TYR A 248 ? 0.1630 0.2180 0.2087 -0.0408 0.0178  -0.0184 247 TYR A CD2 
1947 C CE1 . TYR A 248 ? 0.1888 0.2291 0.2217 -0.0313 0.0130  -0.0107 247 TYR A CE1 
1948 C CE2 . TYR A 248 ? 0.1712 0.2296 0.2199 -0.0347 0.0149  -0.0168 247 TYR A CE2 
1949 C CZ  . TYR A 248 ? 0.2267 0.2774 0.2687 -0.0303 0.0126  -0.0129 247 TYR A CZ  
1950 O OH  . TYR A 248 ? 0.2518 0.3053 0.2963 -0.0251 0.0102  -0.0115 247 TYR A OH  
1951 N N   . GLU A 249 ? 0.1632 0.1944 0.1910 -0.0603 0.0226  -0.0227 248 GLU A N   
1952 C CA  . GLU A 249 ? 0.1844 0.2110 0.2090 -0.0683 0.0259  -0.0253 248 GLU A CA  
1953 C C   . GLU A 249 ? 0.2247 0.2352 0.2374 -0.0680 0.0253  -0.0228 248 GLU A C   
1954 O O   . GLU A 249 ? 0.2349 0.2337 0.2386 -0.0731 0.0290  -0.0221 248 GLU A O   
1955 C CB  . GLU A 249 ? 0.1956 0.2357 0.2313 -0.0716 0.0243  -0.0306 248 GLU A CB  
1956 C CG  . GLU A 249 ? 0.3010 0.3572 0.3492 -0.0729 0.0255  -0.0343 248 GLU A CG  
1957 C CD  . GLU A 249 ? 0.5928 0.6646 0.6536 -0.0734 0.0221  -0.0393 248 GLU A CD  
1958 O OE1 . GLU A 249 ? 0.4964 0.5670 0.5563 -0.0728 0.0184  -0.0400 248 GLU A OE1 
1959 O OE2 . GLU A 249 ? 0.4625 0.5480 0.5344 -0.0740 0.0229  -0.0428 248 GLU A OE2 
1960 N N   . LYS A 250 ? 0.1735 0.1831 0.1857 -0.0620 0.0208  -0.0214 249 LYS A N   
1961 C CA  . LYS A 250 ? 0.1721 0.1678 0.1742 -0.0608 0.0200  -0.0196 249 LYS A CA  
1962 C C   . LYS A 250 ? 0.2136 0.1958 0.2051 -0.0580 0.0214  -0.0152 249 LYS A C   
1963 O O   . LYS A 250 ? 0.2206 0.1885 0.2021 -0.0602 0.0231  -0.0142 249 LYS A O   
1964 C CB  . LYS A 250 ? 0.1892 0.1886 0.1937 -0.0551 0.0152  -0.0196 249 LYS A CB  
1965 C CG  . LYS A 250 ? 0.2030 0.2125 0.2150 -0.0581 0.0131  -0.0239 249 LYS A CG  
1966 C CD  . LYS A 250 ? 0.1947 0.2057 0.2065 -0.0529 0.0087  -0.0236 249 LYS A CD  
1967 C CE  . LYS A 250 ? 0.2892 0.3111 0.3082 -0.0554 0.0059  -0.0277 249 LYS A CE  
1968 N NZ  . LYS A 250 ? 0.3967 0.4175 0.4129 -0.0515 0.0021  -0.0275 249 LYS A NZ  
1969 N N   . ILE A 251 ? 0.1566 0.1431 0.1503 -0.0532 0.0207  -0.0127 250 ILE A N   
1970 C CA  . ILE A 251 ? 0.1507 0.1261 0.1352 -0.0500 0.0215  -0.0087 250 ILE A CA  
1971 C C   . ILE A 251 ? 0.2429 0.2081 0.2190 -0.0562 0.0260  -0.0081 250 ILE A C   
1972 O O   . ILE A 251 ? 0.2569 0.2070 0.2217 -0.0556 0.0264  -0.0054 250 ILE A O   
1973 C CB  . ILE A 251 ? 0.1609 0.1440 0.1499 -0.0444 0.0198  -0.0067 250 ILE A CB  
1974 C CG1 . ILE A 251 ? 0.1428 0.1319 0.1367 -0.0380 0.0154  -0.0064 250 ILE A CG1 
1975 C CG2 . ILE A 251 ? 0.1713 0.1442 0.1511 -0.0423 0.0209  -0.0030 250 ILE A CG2 
1976 C CD1 . ILE A 251 ? 0.1487 0.1479 0.1494 -0.0337 0.0138  -0.0055 250 ILE A CD1 
1977 N N   . VAL A 252 ? 0.2068 0.1802 0.1884 -0.0620 0.0293  -0.0105 251 VAL A N   
1978 C CA  . VAL A 252 ? 0.2204 0.1856 0.1944 -0.0690 0.0344  -0.0103 251 VAL A CA  
1979 C C   . VAL A 252 ? 0.2977 0.2528 0.2654 -0.0761 0.0368  -0.0121 251 VAL A C   
1980 O O   . VAL A 252 ? 0.3147 0.2574 0.2719 -0.0814 0.0407  -0.0107 251 VAL A O   
1981 C CB  . VAL A 252 ? 0.2659 0.2433 0.2474 -0.0727 0.0378  -0.0124 251 VAL A CB  
1982 C CG1 . VAL A 252 ? 0.2412 0.2251 0.2263 -0.0658 0.0356  -0.0103 251 VAL A CG1 
1983 C CG2 . VAL A 252 ? 0.2682 0.2610 0.2628 -0.0769 0.0383  -0.0178 251 VAL A CG2 
1984 N N   . SER A 253 ? 0.2616 0.2215 0.2351 -0.0768 0.0347  -0.0152 252 SER A N   
1985 C CA  . SER A 253 ? 0.2747 0.2259 0.2430 -0.0839 0.0369  -0.0175 252 SER A CA  
1986 C C   . SER A 253 ? 0.3954 0.3241 0.3475 -0.0837 0.0375  -0.0141 252 SER A C   
1987 O O   . SER A 253 ? 0.4410 0.3592 0.3860 -0.0912 0.0410  -0.0153 252 SER A O   
1988 C CB  . SER A 253 ? 0.2919 0.2520 0.2687 -0.0834 0.0336  -0.0213 252 SER A CB  
1989 O OG  . SER A 253 ? 0.3846 0.3390 0.3578 -0.0757 0.0293  -0.0190 252 SER A OG  
1990 N N   . GLY A 254 ? 0.3949 0.3166 0.3417 -0.0752 0.0343  -0.0101 253 GLY A N   
1991 C CA  . GLY A 254 ? 0.4239 0.3251 0.3561 -0.0729 0.0338  -0.0066 253 GLY A CA  
1992 C C   . GLY A 254 ? 0.4983 0.3925 0.4282 -0.0703 0.0312  -0.0080 253 GLY A C   
1993 O O   . GLY A 254 ? 0.5287 0.4047 0.4465 -0.0699 0.0313  -0.0063 253 GLY A O   
1994 N N   . LYS A 255 ? 0.4246 0.3327 0.3656 -0.0686 0.0287  -0.0112 254 LYS A N   
1995 C CA  . LYS A 255 ? 0.4123 0.3161 0.3522 -0.0668 0.0263  -0.0133 254 LYS A CA  
1996 C C   . LYS A 255 ? 0.4499 0.3632 0.3965 -0.0581 0.0220  -0.0129 254 LYS A C   
1997 O O   . LYS A 255 ? 0.4513 0.3802 0.4078 -0.0562 0.0207  -0.0132 254 LYS A O   
1998 C CB  . LYS A 255 ? 0.4242 0.3346 0.3697 -0.0746 0.0278  -0.0183 254 LYS A CB  
1999 C CG  . LYS A 255 ? 0.4456 0.3489 0.3860 -0.0848 0.0328  -0.0196 254 LYS A CG  
2000 C CD  . LYS A 255 ? 0.4735 0.3809 0.4180 -0.0922 0.0337  -0.0249 254 LYS A CD  
2001 C CE  . LYS A 255 ? 0.4044 0.3343 0.3643 -0.0936 0.0321  -0.0287 254 LYS A CE  
2002 N NZ  . LYS A 255 ? 0.6140 0.5471 0.5771 -0.0975 0.0308  -0.0336 254 LYS A NZ  
2003 N N   . VAL A 256 ? 0.3822 0.2858 0.3230 -0.0530 0.0199  -0.0126 255 VAL A N   
2004 C CA  . VAL A 256 ? 0.3689 0.2797 0.3145 -0.0452 0.0163  -0.0126 255 VAL A CA  
2005 C C   . VAL A 256 ? 0.3850 0.2883 0.3267 -0.0450 0.0155  -0.0155 255 VAL A C   
2006 O O   . VAL A 256 ? 0.4032 0.2903 0.3352 -0.0468 0.0169  -0.0156 255 VAL A O   
2007 C CB  . VAL A 256 ? 0.4390 0.3459 0.3814 -0.0371 0.0145  -0.0088 255 VAL A CB  
2008 C CG1 . VAL A 256 ? 0.4284 0.3463 0.3777 -0.0304 0.0115  -0.0093 255 VAL A CG1 
2009 C CG2 . VAL A 256 ? 0.4447 0.3539 0.3872 -0.0379 0.0158  -0.0057 255 VAL A CG2 
2010 N N   . ARG A 257 ? 0.2854 0.1993 0.2336 -0.0427 0.0132  -0.0179 256 ARG A N   
2011 C CA  . ARG A 257 ? 0.2852 0.1933 0.2299 -0.0419 0.0124  -0.0210 256 ARG A CA  
2012 C C   . ARG A 257 ? 0.3313 0.2421 0.2771 -0.0334 0.0100  -0.0202 256 ARG A C   
2013 O O   . ARG A 257 ? 0.3336 0.2569 0.2863 -0.0303 0.0086  -0.0188 256 ARG A O   
2014 C CB  . ARG A 257 ? 0.2916 0.2095 0.2419 -0.0475 0.0119  -0.0251 256 ARG A CB  
2015 C CG  . ARG A 257 ? 0.4085 0.3242 0.3583 -0.0566 0.0144  -0.0269 256 ARG A CG  
2016 C CD  . ARG A 257 ? 0.5867 0.5102 0.5408 -0.0616 0.0134  -0.0317 256 ARG A CD  
2017 N N   . PHE A 258 ? 0.2881 0.1872 0.2273 -0.0297 0.0098  -0.0213 257 PHE A N   
2018 C CA  . PHE A 258 ? 0.2726 0.1748 0.2132 -0.0217 0.0080  -0.0214 257 PHE A CA  
2019 C C   . PHE A 258 ? 0.3247 0.2293 0.2657 -0.0217 0.0075  -0.0257 257 PHE A C   
2020 O O   . PHE A 258 ? 0.3393 0.2347 0.2751 -0.0257 0.0085  -0.0286 257 PHE A O   
2021 C CB  . PHE A 258 ? 0.2950 0.1829 0.2284 -0.0158 0.0078  -0.0197 257 PHE A CB  
2022 C CG  . PHE A 258 ? 0.3001 0.1836 0.2309 -0.0152 0.0080  -0.0154 257 PHE A CG  
2023 C CD1 . PHE A 258 ? 0.2987 0.1927 0.2353 -0.0111 0.0068  -0.0127 257 PHE A CD1 
2024 C CD2 . PHE A 258 ? 0.3343 0.2026 0.2564 -0.0190 0.0096  -0.0141 257 PHE A CD2 
2025 C CE1 . PHE A 258 ? 0.3198 0.2097 0.2534 -0.0108 0.0069  -0.0088 257 PHE A CE1 
2026 C CE2 . PHE A 258 ? 0.3721 0.2357 0.2905 -0.0188 0.0099  -0.0100 257 PHE A CE2 
2027 C CZ  . PHE A 258 ? 0.3331 0.2078 0.2574 -0.0146 0.0085  -0.0075 257 PHE A CZ  
2028 N N   . PRO A 259 ? 0.2708 0.1865 0.2169 -0.0175 0.0062  -0.0263 258 PRO A N   
2029 C CA  . PRO A 259 ? 0.2653 0.1822 0.2102 -0.0172 0.0060  -0.0305 258 PRO A CA  
2030 C C   . PRO A 259 ? 0.3326 0.2347 0.2702 -0.0143 0.0069  -0.0329 258 PRO A C   
2031 O O   . PRO A 259 ? 0.3015 0.1954 0.2363 -0.0094 0.0069  -0.0310 258 PRO A O   
2032 C CB  . PRO A 259 ? 0.2724 0.2015 0.2225 -0.0123 0.0049  -0.0299 258 PRO A CB  
2033 C CG  . PRO A 259 ? 0.3114 0.2487 0.2670 -0.0124 0.0042  -0.0256 258 PRO A CG  
2034 C CD  . PRO A 259 ? 0.2714 0.1981 0.2234 -0.0130 0.0051  -0.0234 258 PRO A CD  
2035 N N   . SER A 260 ? 0.3160 0.2141 0.2500 -0.0171 0.0074  -0.0373 259 SER A N   
2036 C CA  . SER A 260 ? 0.3253 0.2084 0.2521 -0.0143 0.0083  -0.0402 259 SER A CA  
2037 C C   . SER A 260 ? 0.3612 0.2448 0.2889 -0.0053 0.0080  -0.0408 259 SER A C   
2038 O O   . SER A 260 ? 0.3754 0.2458 0.2978 -0.0010 0.0083  -0.0419 259 SER A O   
2039 C CB  . SER A 260 ? 0.3835 0.2633 0.3066 -0.0193 0.0090  -0.0452 259 SER A CB  
2040 O OG  . SER A 260 ? 0.5050 0.3976 0.4318 -0.0187 0.0083  -0.0475 259 SER A OG  
2041 N N   . HIS A 261 ? 0.2927 0.1911 0.2270 -0.0025 0.0075  -0.0402 260 HIS A N   
2042 C CA  . HIS A 261 ? 0.2827 0.1842 0.2193 0.0054  0.0075  -0.0413 260 HIS A CA  
2043 C C   . HIS A 261 ? 0.3184 0.2179 0.2568 0.0111  0.0064  -0.0375 260 HIS A C   
2044 O O   . HIS A 261 ? 0.2970 0.1984 0.2376 0.0181  0.0062  -0.0388 260 HIS A O   
2045 C CB  . HIS A 261 ? 0.2705 0.1876 0.2123 0.0055  0.0078  -0.0426 260 HIS A CB  
2046 C CG  . HIS A 261 ? 0.2831 0.2124 0.2307 0.0033  0.0067  -0.0384 260 HIS A CG  
2047 N ND1 . HIS A 261 ? 0.2813 0.2154 0.2334 0.0076  0.0061  -0.0351 260 HIS A ND1 
2048 C CD2 . HIS A 261 ? 0.2777 0.2149 0.2271 -0.0024 0.0060  -0.0373 260 HIS A CD2 
2049 C CE1 . HIS A 261 ? 0.2588 0.2027 0.2150 0.0042  0.0053  -0.0321 260 HIS A CE1 
2050 N NE2 . HIS A 261 ? 0.2604 0.2065 0.2152 -0.0015 0.0051  -0.0333 260 HIS A NE2 
2051 N N   . PHE A 262 ? 0.2614 0.1583 0.1992 0.0081  0.0057  -0.0331 261 PHE A N   
2052 C CA  . PHE A 262 ? 0.2393 0.1332 0.1775 0.0130  0.0044  -0.0294 261 PHE A CA  
2053 C C   . PHE A 262 ? 0.3201 0.1973 0.2511 0.0179  0.0039  -0.0305 261 PHE A C   
2054 O O   . PHE A 262 ? 0.3372 0.2010 0.2611 0.0144  0.0048  -0.0318 261 PHE A O   
2055 C CB  . PHE A 262 ? 0.2422 0.1357 0.1799 0.0079  0.0043  -0.0249 261 PHE A CB  
2056 C CG  . PHE A 262 ? 0.2220 0.1314 0.1674 0.0060  0.0040  -0.0225 261 PHE A CG  
2057 C CD1 . PHE A 262 ? 0.2268 0.1495 0.1781 0.0063  0.0040  -0.0243 261 PHE A CD1 
2058 C CD2 . PHE A 262 ? 0.2156 0.1257 0.1616 0.0038  0.0037  -0.0184 261 PHE A CD2 
2059 C CE1 . PHE A 262 ? 0.2285 0.1642 0.1860 0.0047  0.0035  -0.0219 261 PHE A CE1 
2060 C CE2 . PHE A 262 ? 0.2321 0.1559 0.1850 0.0022  0.0034  -0.0165 261 PHE A CE2 
2061 C CZ  . PHE A 262 ? 0.2129 0.1491 0.1715 0.0029  0.0031  -0.0181 261 PHE A CZ  
2062 N N   . SER A 263 ? 0.2750 0.1526 0.2079 0.0261  0.0023  -0.0301 262 SER A N   
2063 C CA  . SER A 263 ? 0.2703 0.1323 0.1968 0.0325  0.0010  -0.0309 262 SER A CA  
2064 C C   . SER A 263 ? 0.3194 0.1666 0.2377 0.0301  0.0002  -0.0264 262 SER A C   
2065 O O   . SER A 263 ? 0.3001 0.1524 0.2196 0.0252  0.0004  -0.0226 262 SER A O   
2066 C CB  . SER A 263 ? 0.3032 0.1722 0.2354 0.0420  -0.0010 -0.0317 262 SER A CB  
2067 O OG  . SER A 263 ? 0.3015 0.1768 0.2367 0.0431  -0.0027 -0.0272 262 SER A OG  
2068 N N   A SER A 264 ? 0.2973 0.1257 0.2066 0.0335  -0.0007 -0.0270 263 SER A N   
2069 N N   B SER A 264 ? 0.2967 0.1250 0.2059 0.0335  -0.0007 -0.0270 263 SER A N   
2070 C CA  A SER A 264 ? 0.3080 0.1191 0.2071 0.0317  -0.0015 -0.0227 263 SER A CA  
2071 C CA  B SER A 264 ? 0.3068 0.1181 0.2059 0.0316  -0.0015 -0.0227 263 SER A CA  
2072 C C   A SER A 264 ? 0.3479 0.1640 0.2488 0.0356  -0.0039 -0.0180 263 SER A C   
2073 C C   B SER A 264 ? 0.3479 0.1638 0.2487 0.0356  -0.0039 -0.0180 263 SER A C   
2074 O O   A SER A 264 ? 0.3427 0.1552 0.2394 0.0302  -0.0033 -0.0138 263 SER A O   
2075 O O   B SER A 264 ? 0.3431 0.1555 0.2397 0.0302  -0.0034 -0.0138 263 SER A O   
2076 C CB  A SER A 264 ? 0.3739 0.1638 0.2631 0.0369  -0.0027 -0.0244 263 SER A CB  
2077 C CB  B SER A 264 ? 0.3721 0.1619 0.2611 0.0363  -0.0026 -0.0244 263 SER A CB  
2078 O OG  A SER A 264 ? 0.4980 0.2692 0.3754 0.0338  -0.0030 -0.0202 263 SER A OG  
2079 O OG  B SER A 264 ? 0.4756 0.2608 0.3626 0.0319  -0.0001 -0.0289 263 SER A OG  
2080 N N   . ASP A 265 ? 0.3037 0.1291 0.2113 0.0445  -0.0064 -0.0191 264 ASP A N   
2081 C CA  . ASP A 265 ? 0.3023 0.1339 0.2125 0.0488  -0.0092 -0.0153 264 ASP A CA  
2082 C C   . ASP A 265 ? 0.3173 0.1651 0.2345 0.0425  -0.0076 -0.0130 264 ASP A C   
2083 O O   . ASP A 265 ? 0.2932 0.1399 0.2077 0.0412  -0.0085 -0.0087 264 ASP A O   
2084 C CB  . ASP A 265 ? 0.3169 0.1566 0.2341 0.0593  -0.0120 -0.0181 264 ASP A CB  
2085 C CG  . ASP A 265 ? 0.3877 0.2112 0.2983 0.0677  -0.0147 -0.0201 264 ASP A CG  
2086 O OD1 . ASP A 265 ? 0.3678 0.1709 0.2662 0.0668  -0.0156 -0.0173 264 ASP A OD1 
2087 O OD2 . ASP A 265 ? 0.3897 0.2207 0.3073 0.0754  -0.0159 -0.0244 264 ASP A OD2 
2088 N N   . LEU A 266 ? 0.2631 0.1253 0.1884 0.0386  -0.0052 -0.0158 265 LEU A N   
2089 C CA  . LEU A 266 ? 0.2288 0.1059 0.1608 0.0329  -0.0039 -0.0139 265 LEU A CA  
2090 C C   . LEU A 266 ? 0.2837 0.1533 0.2097 0.0246  -0.0022 -0.0109 265 LEU A C   
2091 O O   . LEU A 266 ? 0.2905 0.1642 0.2173 0.0225  -0.0024 -0.0073 265 LEU A O   
2092 C CB  . LEU A 266 ? 0.2051 0.0968 0.1452 0.0305  -0.0020 -0.0175 265 LEU A CB  
2093 C CG  . LEU A 266 ? 0.2326 0.1388 0.1792 0.0246  -0.0009 -0.0157 265 LEU A CG  
2094 C CD1 . LEU A 266 ? 0.2373 0.1514 0.1879 0.0275  -0.0025 -0.0125 265 LEU A CD1 
2095 C CD2 . LEU A 266 ? 0.2461 0.1650 0.1992 0.0236  0.0003  -0.0191 265 LEU A CD2 
2096 N N   . LYS A 267 ? 0.2538 0.1129 0.1740 0.0198  -0.0004 -0.0126 266 LYS A N   
2097 C CA  . LYS A 267 ? 0.2590 0.1113 0.1739 0.0112  0.0017  -0.0104 266 LYS A CA  
2098 C C   . LYS A 267 ? 0.3309 0.1709 0.2373 0.0120  0.0008  -0.0059 266 LYS A C   
2099 O O   . LYS A 267 ? 0.3099 0.1526 0.2160 0.0064  0.0022  -0.0032 266 LYS A O   
2100 C CB  . LYS A 267 ? 0.2921 0.1335 0.2015 0.0062  0.0036  -0.0135 266 LYS A CB  
2101 C CG  . LYS A 267 ? 0.2532 0.1075 0.1701 0.0033  0.0047  -0.0176 266 LYS A CG  
2102 C CD  . LYS A 267 ? 0.3225 0.1663 0.2336 -0.0027 0.0066  -0.0209 266 LYS A CD  
2103 C CE  . LYS A 267 ? 0.4180 0.2474 0.3226 0.0027  0.0060  -0.0236 266 LYS A CE  
2104 N NZ  . LYS A 267 ? 0.5065 0.3276 0.4065 -0.0034 0.0079  -0.0276 266 LYS A NZ  
2105 N N   . ASP A 268 ? 0.3140 0.1408 0.2135 0.0193  -0.0017 -0.0053 267 ASP A N   
2106 C CA  . ASP A 268 ? 0.3187 0.1319 0.2083 0.0209  -0.0033 -0.0008 267 ASP A CA  
2107 C C   . ASP A 268 ? 0.3479 0.1739 0.2429 0.0227  -0.0047 0.0022  267 ASP A C   
2108 O O   . ASP A 268 ? 0.3503 0.1727 0.2402 0.0179  -0.0036 0.0057  267 ASP A O   
2109 C CB  . ASP A 268 ? 0.3560 0.1525 0.2373 0.0295  -0.0065 -0.0010 267 ASP A CB  
2110 C CG  . ASP A 268 ? 0.4105 0.1905 0.2792 0.0303  -0.0082 0.0041  267 ASP A CG  
2111 O OD1 . ASP A 268 ? 0.4166 0.1800 0.2740 0.0239  -0.0060 0.0057  267 ASP A OD1 
2112 O OD2 . ASP A 268 ? 0.4073 0.1923 0.2774 0.0361  -0.0114 0.0064  267 ASP A OD2 
2113 N N   . LEU A 269 ? 0.2842 0.1259 0.1897 0.0288  -0.0066 0.0005  268 LEU A N   
2114 C CA  . LEU A 269 ? 0.2635 0.1184 0.1749 0.0302  -0.0078 0.0028  268 LEU A CA  
2115 C C   . LEU A 269 ? 0.3037 0.1680 0.2190 0.0213  -0.0046 0.0039  268 LEU A C   
2116 O O   . LEU A 269 ? 0.3005 0.1648 0.2131 0.0192  -0.0045 0.0072  268 LEU A O   
2117 C CB  . LEU A 269 ? 0.2443 0.1154 0.1671 0.0366  -0.0096 -0.0001 268 LEU A CB  
2118 C CG  . LEU A 269 ? 0.2614 0.1477 0.1917 0.0374  -0.0106 0.0016  268 LEU A CG  
2119 C CD1 . LEU A 269 ? 0.2602 0.1392 0.1840 0.0417  -0.0138 0.0050  268 LEU A CD1 
2120 C CD2 . LEU A 269 ? 0.2377 0.1396 0.1789 0.0422  -0.0114 -0.0018 268 LEU A CD2 
2121 N N   . LEU A 270 ? 0.2663 0.1385 0.1877 0.0164  -0.0021 0.0010  269 LEU A N   
2122 C CA  . LEU A 270 ? 0.2528 0.1351 0.1791 0.0087  0.0005  0.0014  269 LEU A CA  
2123 C C   . LEU A 270 ? 0.2980 0.1697 0.2163 0.0016  0.0029  0.0036  269 LEU A C   
2124 O O   . LEU A 270 ? 0.2715 0.1504 0.1925 -0.0024 0.0043  0.0052  269 LEU A O   
2125 C CB  . LEU A 270 ? 0.2392 0.1314 0.1729 0.0057  0.0019  -0.0023 269 LEU A CB  
2126 C CG  . LEU A 270 ? 0.2529 0.1586 0.1954 0.0109  0.0004  -0.0043 269 LEU A CG  
2127 C CD1 . LEU A 270 ? 0.2387 0.1512 0.1857 0.0077  0.0016  -0.0078 269 LEU A CD1 
2128 C CD2 . LEU A 270 ? 0.2201 0.1389 0.1694 0.0121  -0.0004 -0.0023 269 LEU A CD2 
2129 N N   . ARG A 271 ? 0.3040 0.1582 0.2120 0.0001  0.0036  0.0036  270 ARG A N   
2130 C CA  . ARG A 271 ? 0.3167 0.1590 0.2154 -0.0071 0.0062  0.0059  270 ARG A CA  
2131 C C   . ARG A 271 ? 0.3702 0.2083 0.2629 -0.0051 0.0052  0.0102  270 ARG A C   
2132 O O   . ARG A 271 ? 0.3712 0.2079 0.2605 -0.0116 0.0079  0.0120  270 ARG A O   
2133 C CB  . ARG A 271 ? 0.3139 0.1363 0.2013 -0.0087 0.0070  0.0052  270 ARG A CB  
2134 C CG  . ARG A 271 ? 0.3544 0.1804 0.2464 -0.0137 0.0090  0.0008  270 ARG A CG  
2135 C CD  . ARG A 271 ? 0.4376 0.2428 0.3178 -0.0169 0.0103  0.0000  270 ARG A CD  
2136 N NE  . ARG A 271 ? 0.4959 0.3048 0.3807 -0.0197 0.0113  -0.0048 270 ARG A NE  
2137 C CZ  . ARG A 271 ? 0.6155 0.4185 0.4989 -0.0142 0.0096  -0.0075 270 ARG A CZ  
2138 N NH1 . ARG A 271 ? 0.4398 0.2330 0.3181 -0.0053 0.0067  -0.0060 270 ARG A NH1 
2139 N NH2 . ARG A 271 ? 0.4447 0.2520 0.3321 -0.0174 0.0107  -0.0119 270 ARG A NH2 
2140 N N   . ASN A 272 ? 0.3295 0.1662 0.2212 0.0039  0.0012  0.0114  271 ASN A N   
2141 C CA  . ASN A 272 ? 0.3188 0.1521 0.2049 0.0069  -0.0007 0.0153  271 ASN A CA  
2142 C C   . ASN A 272 ? 0.3252 0.1772 0.2214 0.0065  -0.0006 0.0157  271 ASN A C   
2143 O O   . ASN A 272 ? 0.3164 0.1663 0.2076 0.0057  -0.0008 0.0186  271 ASN A O   
2144 C CB  . ASN A 272 ? 0.3184 0.1415 0.1987 0.0166  -0.0055 0.0163  271 ASN A CB  
2145 C CG  . ASN A 272 ? 0.4154 0.2153 0.2814 0.0161  -0.0055 0.0174  271 ASN A CG  
2146 O OD1 . ASN A 272 ? 0.4076 0.1930 0.2609 0.0125  -0.0046 0.0210  271 ASN A OD1 
2147 N ND2 . ASN A 272 ? 0.3504 0.1455 0.2173 0.0192  -0.0061 0.0143  271 ASN A ND2 
2148 N N   . LEU A 273 ? 0.2694 0.1386 0.1787 0.0068  -0.0003 0.0127  272 LEU A N   
2149 C CA  . LEU A 273 ? 0.2446 0.1306 0.1634 0.0064  -0.0001 0.0129  272 LEU A CA  
2150 C C   . LEU A 273 ? 0.2676 0.1602 0.1902 -0.0022 0.0038  0.0122  272 LEU A C   
2151 O O   . LEU A 273 ? 0.2381 0.1360 0.1617 -0.0048 0.0050  0.0136  272 LEU A O   
2152 C CB  . LEU A 273 ? 0.2241 0.1242 0.1540 0.0117  -0.0022 0.0104  272 LEU A CB  
2153 C CG  . LEU A 273 ? 0.2621 0.1605 0.1914 0.0206  -0.0061 0.0104  272 LEU A CG  
2154 C CD1 . LEU A 273 ? 0.2415 0.1535 0.1817 0.0241  -0.0068 0.0070  272 LEU A CD1 
2155 C CD2 . LEU A 273 ? 0.2518 0.1523 0.1793 0.0234  -0.0083 0.0131  272 LEU A CD2 
2156 N N   . LEU A 274 ? 0.2324 0.1254 0.1576 -0.0065 0.0058  0.0095  273 LEU A N   
2157 C CA  . LEU A 274 ? 0.2154 0.1148 0.1449 -0.0145 0.0092  0.0081  273 LEU A CA  
2158 C C   . LEU A 274 ? 0.2859 0.1705 0.2043 -0.0207 0.0121  0.0094  273 LEU A C   
2159 O O   . LEU A 274 ? 0.2734 0.1543 0.1906 -0.0268 0.0146  0.0075  273 LEU A O   
2160 C CB  . LEU A 274 ? 0.2098 0.1153 0.1459 -0.0161 0.0094  0.0045  273 LEU A CB  
2161 C CG  . LEU A 274 ? 0.2362 0.1551 0.1819 -0.0110 0.0070  0.0030  273 LEU A CG  
2162 C CD1 . LEU A 274 ? 0.2233 0.1451 0.1726 -0.0128 0.0072  -0.0004 273 LEU A CD1 
2163 C CD2 . LEU A 274 ? 0.2292 0.1627 0.1834 -0.0117 0.0072  0.0036  273 LEU A CD2 
2164 N N   . GLN A 275 ? 0.2671 0.1435 0.1770 -0.0195 0.0118  0.0128  274 GLN A N   
2165 C CA  . GLN A 275 ? 0.2855 0.1459 0.1824 -0.0248 0.0144  0.0150  274 GLN A CA  
2166 C C   . GLN A 275 ? 0.3299 0.1974 0.2282 -0.0307 0.0177  0.0157  274 GLN A C   
2167 O O   . GLN A 275 ? 0.3073 0.1813 0.2075 -0.0273 0.0163  0.0173  274 GLN A O   
2168 C CB  . GLN A 275 ? 0.3152 0.1597 0.1998 -0.0182 0.0110  0.0184  274 GLN A CB  
2169 C CG  . GLN A 275 ? 0.3788 0.2050 0.2475 -0.0228 0.0130  0.0217  274 GLN A CG  
2170 C CD  . GLN A 275 ? 0.5090 0.3233 0.3712 -0.0307 0.0169  0.0204  274 GLN A CD  
2171 O OE1 . GLN A 275 ? 0.4228 0.2420 0.2874 -0.0396 0.0215  0.0189  274 GLN A OE1 
2172 N NE2 . GLN A 275 ? 0.4470 0.2465 0.3019 -0.0277 0.0150  0.0204  274 GLN A NE2 
2173 N N   . VAL A 276 ? 0.3110 0.1776 0.2086 -0.0398 0.0223  0.0140  275 VAL A N   
2174 C CA  . VAL A 276 ? 0.3154 0.1894 0.2150 -0.0462 0.0263  0.0138  275 VAL A CA  
2175 C C   . VAL A 276 ? 0.3760 0.2372 0.2617 -0.0467 0.0271  0.0178  275 VAL A C   
2176 O O   . VAL A 276 ? 0.3672 0.2362 0.2550 -0.0476 0.0284  0.0184  275 VAL A O   
2177 C CB  . VAL A 276 ? 0.3835 0.2610 0.2869 -0.0559 0.0311  0.0103  275 VAL A CB  
2178 C CG1 . VAL A 276 ? 0.3995 0.2574 0.2892 -0.0616 0.0336  0.0110  275 VAL A CG1 
2179 C CG2 . VAL A 276 ? 0.3822 0.2716 0.2913 -0.0616 0.0351  0.0089  275 VAL A CG2 
2180 N N   . ASP A 277 ? 0.3625 0.2036 0.2335 -0.0460 0.0262  0.0205  276 ASP A N   
2181 C CA  . ASP A 277 ? 0.3781 0.2037 0.2331 -0.0466 0.0266  0.0248  276 ASP A CA  
2182 C C   . ASP A 277 ? 0.4106 0.2378 0.2649 -0.0368 0.0211  0.0274  276 ASP A C   
2183 O O   . ASP A 277 ? 0.3994 0.2207 0.2520 -0.0290 0.0164  0.0282  276 ASP A O   
2184 C CB  . ASP A 277 ? 0.4138 0.2159 0.2529 -0.0491 0.0272  0.0267  276 ASP A CB  
2185 C CG  . ASP A 277 ? 0.5150 0.2982 0.3349 -0.0519 0.0284  0.0312  276 ASP A CG  
2186 O OD1 . ASP A 277 ? 0.4964 0.2834 0.3142 -0.0493 0.0272  0.0334  276 ASP A OD1 
2187 O OD2 . ASP A 277 ? 0.5880 0.3521 0.3944 -0.0567 0.0305  0.0325  276 ASP A OD2 
2188 N N   . LEU A 278 ? 0.3705 0.2057 0.2258 -0.0374 0.0219  0.0283  277 LEU A N   
2189 C CA  . LEU A 278 ? 0.3685 0.2074 0.2240 -0.0292 0.0171  0.0303  277 LEU A CA  
2190 C C   . LEU A 278 ? 0.4353 0.2550 0.2743 -0.0242 0.0131  0.0346  277 LEU A C   
2191 O O   . LEU A 278 ? 0.4476 0.2700 0.2882 -0.0155 0.0077  0.0356  277 LEU A O   
2192 C CB  . LEU A 278 ? 0.3708 0.2218 0.2303 -0.0323 0.0196  0.0299  277 LEU A CB  
2193 C CG  . LEU A 278 ? 0.4118 0.2842 0.2897 -0.0337 0.0215  0.0258  277 LEU A CG  
2194 C CD1 . LEU A 278 ? 0.4126 0.2933 0.2921 -0.0389 0.0255  0.0249  277 LEU A CD1 
2195 C CD2 . LEU A 278 ? 0.4308 0.3147 0.3197 -0.0251 0.0164  0.0249  277 LEU A CD2 
2196 N N   . THR A 279 ? 0.4135 0.2133 0.2366 -0.0293 0.0155  0.0369  278 THR A N   
2197 C CA  . THR A 279 ? 0.4357 0.2144 0.2414 -0.0243 0.0113  0.0412  278 THR A CA  
2198 C C   . THR A 279 ? 0.4851 0.2576 0.2928 -0.0172 0.0070  0.0404  278 THR A C   
2199 O O   . THR A 279 ? 0.5055 0.2620 0.3012 -0.0109 0.0024  0.0434  278 THR A O   
2200 C CB  . THR A 279 ? 0.5359 0.2939 0.3222 -0.0331 0.0157  0.0442  278 THR A CB  
2201 O OG1 . THR A 279 ? 0.5005 0.2516 0.2866 -0.0393 0.0196  0.0423  278 THR A OG1 
2202 C CG2 . THR A 279 ? 0.4927 0.2571 0.2769 -0.0411 0.0209  0.0444  278 THR A CG2 
2203 N N   . LYS A 280 ? 0.4244 0.2091 0.2467 -0.0180 0.0084  0.0362  279 LYS A N   
2204 C CA  . LYS A 280 ? 0.4082 0.1882 0.2333 -0.0119 0.0052  0.0346  279 LYS A CA  
2205 C C   . LYS A 280 ? 0.4137 0.2137 0.2566 -0.0050 0.0022  0.0312  279 LYS A C   
2206 O O   . LYS A 280 ? 0.4017 0.1988 0.2468 0.0016  -0.0012 0.0299  279 LYS A O   
2207 C CB  . LYS A 280 ? 0.4508 0.2232 0.2742 -0.0197 0.0097  0.0325  279 LYS A CB  
2208 C CG  . LYS A 280 ? 0.5538 0.3028 0.3579 -0.0264 0.0126  0.0356  279 LYS A CG  
2209 C CD  . LYS A 280 ? 0.6324 0.3758 0.4363 -0.0349 0.0173  0.0328  279 LYS A CD  
2210 C CE  . LYS A 280 ? 0.8476 0.5666 0.6314 -0.0421 0.0205  0.0360  279 LYS A CE  
2211 N NZ  . LYS A 280 ? 0.9407 0.6539 0.7242 -0.0509 0.0251  0.0329  279 LYS A NZ  
2212 N N   . ARG A 281 ? 0.3454 0.1652 0.2008 -0.0068 0.0037  0.0296  280 ARG A N   
2213 C CA  . ARG A 281 ? 0.3114 0.1500 0.1831 -0.0016 0.0015  0.0265  280 ARG A CA  
2214 C C   . ARG A 281 ? 0.3716 0.2115 0.2440 0.0087  -0.0044 0.0274  280 ARG A C   
2215 O O   . ARG A 281 ? 0.3687 0.2082 0.2365 0.0109  -0.0064 0.0298  280 ARG A O   
2216 C CB  . ARG A 281 ? 0.2716 0.1290 0.1549 -0.0059 0.0043  0.0249  280 ARG A CB  
2217 C CG  . ARG A 281 ? 0.2639 0.1390 0.1631 -0.0022 0.0029  0.0216  280 ARG A CG  
2218 C CD  . ARG A 281 ? 0.2898 0.1822 0.2001 -0.0061 0.0053  0.0201  280 ARG A CD  
2219 N NE  . ARG A 281 ? 0.3069 0.1990 0.2168 -0.0149 0.0102  0.0191  280 ARG A NE  
2220 C CZ  . ARG A 281 ? 0.2715 0.1739 0.1870 -0.0195 0.0130  0.0183  280 ARG A CZ  
2221 N NH1 . ARG A 281 ? 0.2131 0.1259 0.1341 -0.0163 0.0116  0.0185  280 ARG A NH1 
2222 N NH2 . ARG A 281 ? 0.2686 0.1709 0.1840 -0.0274 0.0175  0.0169  280 ARG A NH2 
2223 N N   . PHE A 282 ? 0.3332 0.1764 0.2123 0.0147  -0.0070 0.0249  281 PHE A N   
2224 C CA  . PHE A 282 ? 0.3397 0.1874 0.2224 0.0245  -0.0123 0.0246  281 PHE A CA  
2225 C C   . PHE A 282 ? 0.3665 0.2322 0.2590 0.0253  -0.0129 0.0242  281 PHE A C   
2226 O O   . PHE A 282 ? 0.3334 0.2124 0.2356 0.0203  -0.0096 0.0224  281 PHE A O   
2227 C CB  . PHE A 282 ? 0.3604 0.2119 0.2509 0.0295  -0.0137 0.0210  281 PHE A CB  
2228 C CG  . PHE A 282 ? 0.4032 0.2363 0.2839 0.0336  -0.0157 0.0212  281 PHE A CG  
2229 C CD1 . PHE A 282 ? 0.4587 0.2712 0.3234 0.0307  -0.0152 0.0246  281 PHE A CD1 
2230 C CD2 . PHE A 282 ? 0.4300 0.2659 0.3169 0.0400  -0.0177 0.0178  281 PHE A CD2 
2231 C CE1 . PHE A 282 ? 0.4954 0.2893 0.3503 0.0347  -0.0172 0.0248  281 PHE A CE1 
2232 C CE2 . PHE A 282 ? 0.4851 0.3034 0.3629 0.0442  -0.0195 0.0176  281 PHE A CE2 
2233 C CZ  . PHE A 282 ? 0.4736 0.2706 0.3354 0.0417  -0.0195 0.0212  281 PHE A CZ  
2234 N N   . GLY A 283 ? 0.3538 0.2194 0.2437 0.0317  -0.0174 0.0256  282 GLY A N   
2235 C CA  . GLY A 283 ? 0.3518 0.2324 0.2494 0.0333  -0.0188 0.0252  282 GLY A CA  
2236 C C   . GLY A 283 ? 0.4931 0.3680 0.3808 0.0300  -0.0185 0.0286  282 GLY A C   
2237 O O   . GLY A 283 ? 0.5159 0.3966 0.4042 0.0336  -0.0216 0.0292  282 GLY A O   
2238 N N   . ASN A 284 ? 0.5011 0.3642 0.3790 0.0229  -0.0145 0.0306  283 ASN A N   
2239 C CA  . ASN A 284 ? 0.5269 0.3836 0.3942 0.0178  -0.0126 0.0335  283 ASN A CA  
2240 C C   . ASN A 284 ? 0.6156 0.4534 0.4655 0.0209  -0.0161 0.0374  283 ASN A C   
2241 O O   . ASN A 284 ? 0.6367 0.4726 0.4791 0.0200  -0.0169 0.0397  283 ASN A O   
2242 C CB  . ASN A 284 ? 0.4853 0.3398 0.3514 0.0077  -0.0060 0.0331  283 ASN A CB  
2243 C CG  . ASN A 284 ? 0.6959 0.5553 0.5603 0.0013  -0.0023 0.0337  283 ASN A CG  
2244 O OD1 . ASN A 284 ? 0.6494 0.5187 0.5179 0.0036  -0.0039 0.0336  283 ASN A OD1 
2245 N ND2 . ASN A 284 ? 0.5115 0.3647 0.3706 -0.0073 0.0032  0.0340  283 ASN A ND2 
2246 N N   . LEU A 285 ? 0.5614 0.3846 0.4042 0.0244  -0.0183 0.0382  284 LEU A N   
2247 C CA  . LEU A 285 ? 0.5628 0.3639 0.3871 0.0273  -0.0215 0.0422  284 LEU A CA  
2248 C C   . LEU A 285 ? 0.5766 0.3757 0.3957 0.0363  -0.0287 0.0441  284 LEU A C   
2249 O O   . LEU A 285 ? 0.5434 0.3598 0.3744 0.0405  -0.0313 0.0419  284 LEU A O   
2250 C CB  . LEU A 285 ? 0.5763 0.3626 0.3957 0.0283  -0.0213 0.0419  284 LEU A CB  
2251 C CG  . LEU A 285 ? 0.6291 0.4200 0.4560 0.0200  -0.0149 0.0390  284 LEU A CG  
2252 C CD1 . LEU A 285 ? 0.6391 0.4142 0.4599 0.0209  -0.0149 0.0386  284 LEU A CD1 
2253 C CD2 . LEU A 285 ? 0.6626 0.4532 0.4851 0.0089  -0.0086 0.0402  284 LEU A CD2 
2254 N N   . LYS A 286 ? 0.5509 0.3283 0.3513 0.0386  -0.0320 0.0482  285 LYS A N   
2255 C CA  . LYS A 286 ? 0.5590 0.3311 0.3514 0.0473  -0.0396 0.0505  285 LYS A CA  
2256 C C   . LYS A 286 ? 0.5935 0.3792 0.4003 0.0581  -0.0455 0.0469  285 LYS A C   
2257 O O   . LYS A 286 ? 0.5844 0.3812 0.3957 0.0630  -0.0499 0.0464  285 LYS A O   
2258 C CB  . LYS A 286 ? 0.6182 0.3621 0.3879 0.0489  -0.0423 0.0553  285 LYS A CB  
2259 N N   . ASN A 287 ? 0.5505 0.3363 0.3650 0.0614  -0.0453 0.0441  286 ASN A N   
2260 C CA  . ASN A 287 ? 0.5332 0.3322 0.3618 0.0712  -0.0501 0.0400  286 ASN A CA  
2261 C C   . ASN A 287 ? 0.5398 0.3650 0.3888 0.0690  -0.0472 0.0356  286 ASN A C   
2262 O O   . ASN A 287 ? 0.5479 0.3864 0.4094 0.0762  -0.0505 0.0319  286 ASN A O   
2263 C CB  . ASN A 287 ? 0.5728 0.3601 0.4000 0.0763  -0.0514 0.0386  286 ASN A CB  
2264 C CG  . ASN A 287 ? 0.9636 0.7235 0.7702 0.0794  -0.0549 0.0429  286 ASN A CG  
2265 O OD1 . ASN A 287 ? 0.9347 0.6784 0.7330 0.0757  -0.0518 0.0438  286 ASN A OD1 
2266 N ND2 . ASN A 287 ? 0.8954 0.6488 0.6927 0.0861  -0.0616 0.0457  286 ASN A ND2 
2267 N N   . GLY A 288 ? 0.4440 0.2760 0.2959 0.0593  -0.0409 0.0358  287 GLY A N   
2268 C CA  . GLY A 288 ? 0.4038 0.2583 0.2727 0.0561  -0.0378 0.0323  287 GLY A CA  
2269 C C   . GLY A 288 ? 0.4141 0.2792 0.2971 0.0582  -0.0365 0.0280  287 GLY A C   
2270 O O   . GLY A 288 ? 0.3940 0.2502 0.2746 0.0565  -0.0341 0.0275  287 GLY A O   
2271 N N   . VAL A 289 ? 0.3444 0.2285 0.2416 0.0618  -0.0381 0.0246  288 VAL A N   
2272 C CA  . VAL A 289 ? 0.3176 0.2143 0.2290 0.0636  -0.0367 0.0202  288 VAL A CA  
2273 C C   . VAL A 289 ? 0.3400 0.2289 0.2504 0.0713  -0.0399 0.0183  288 VAL A C   
2274 O O   . VAL A 289 ? 0.3165 0.2103 0.2347 0.0713  -0.0376 0.0150  288 VAL A O   
2275 C CB  . VAL A 289 ? 0.3412 0.2594 0.2667 0.0645  -0.0372 0.0172  288 VAL A CB  
2276 C CG1 . VAL A 289 ? 0.3559 0.2785 0.2832 0.0732  -0.0436 0.0161  288 VAL A CG1 
2277 C CG2 . VAL A 289 ? 0.3162 0.2471 0.2548 0.0628  -0.0338 0.0132  288 VAL A CG2 
2278 N N   . ASN A 290 ? 0.3224 0.1986 0.2226 0.0781  -0.0453 0.0203  289 ASN A N   
2279 C CA  . ASN A 290 ? 0.3411 0.2087 0.2398 0.0863  -0.0488 0.0185  289 ASN A CA  
2280 C C   . ASN A 290 ? 0.3735 0.2259 0.2653 0.0824  -0.0450 0.0190  289 ASN A C   
2281 O O   . ASN A 290 ? 0.3751 0.2253 0.2703 0.0875  -0.0458 0.0158  289 ASN A O   
2282 C CB  . ASN A 290 ? 0.4121 0.2686 0.3007 0.0947  -0.0561 0.0208  289 ASN A CB  
2283 C CG  . ASN A 290 ? 0.8342 0.7080 0.7320 0.0995  -0.0604 0.0191  289 ASN A CG  
2284 O OD1 . ASN A 290 ? 0.7764 0.6542 0.6715 0.0955  -0.0604 0.0214  289 ASN A OD1 
2285 N ND2 . ASN A 290 ? 0.7726 0.6584 0.6825 0.1074  -0.0635 0.0142  289 ASN A ND2 
2286 N N   . ASP A 291 ? 0.3270 0.1701 0.2099 0.0732  -0.0406 0.0223  290 ASP A N   
2287 C CA  . ASP A 291 ? 0.3314 0.1615 0.2085 0.0681  -0.0365 0.0224  290 ASP A CA  
2288 C C   . ASP A 291 ? 0.3491 0.1941 0.2408 0.0662  -0.0329 0.0175  290 ASP A C   
2289 O O   . ASP A 291 ? 0.3392 0.1768 0.2299 0.0670  -0.0317 0.0154  290 ASP A O   
2290 C CB  . ASP A 291 ? 0.3516 0.1734 0.2191 0.0576  -0.0319 0.0261  290 ASP A CB  
2291 C CG  . ASP A 291 ? 0.4522 0.2519 0.3008 0.0579  -0.0341 0.0310  290 ASP A CG  
2292 O OD1 . ASP A 291 ? 0.4869 0.2727 0.3276 0.0656  -0.0388 0.0317  290 ASP A OD1 
2293 O OD2 . ASP A 291 ? 0.5066 0.3022 0.3476 0.0502  -0.0310 0.0341  290 ASP A OD2 
2294 N N   . ILE A 292 ? 0.2745 0.1400 0.1790 0.0643  -0.0314 0.0157  291 ILE A N   
2295 C CA  . ILE A 292 ? 0.2560 0.1366 0.1739 0.0625  -0.0283 0.0114  291 ILE A CA  
2296 C C   . ILE A 292 ? 0.3005 0.1887 0.2267 0.0715  -0.0315 0.0072  291 ILE A C   
2297 O O   . ILE A 292 ? 0.2822 0.1700 0.2117 0.0726  -0.0300 0.0039  291 ILE A O   
2298 C CB  . ILE A 292 ? 0.2764 0.1737 0.2031 0.0561  -0.0252 0.0114  291 ILE A CB  
2299 C CG1 . ILE A 292 ? 0.2776 0.1675 0.1967 0.0473  -0.0216 0.0148  291 ILE A CG1 
2300 C CG2 . ILE A 292 ? 0.2830 0.1950 0.2222 0.0543  -0.0223 0.0073  291 ILE A CG2 
2301 C CD1 . ILE A 292 ? 0.2899 0.1941 0.2160 0.0416  -0.0191 0.0152  291 ILE A CD1 
2302 N N   . LYS A 293 ? 0.2796 0.1754 0.2094 0.0779  -0.0359 0.0070  292 LYS A N   
2303 C CA  . LYS A 293 ? 0.2705 0.1760 0.2098 0.0866  -0.0390 0.0024  292 LYS A CA  
2304 C C   . LYS A 293 ? 0.3213 0.2129 0.2552 0.0935  -0.0413 0.0008  292 LYS A C   
2305 O O   . LYS A 293 ? 0.3021 0.2017 0.2449 0.0981  -0.0412 -0.0042 292 LYS A O   
2306 C CB  . LYS A 293 ? 0.2971 0.2120 0.2401 0.0921  -0.0439 0.0025  292 LYS A CB  
2307 C CG  . LYS A 293 ? 0.2764 0.2082 0.2277 0.0865  -0.0416 0.0025  292 LYS A CG  
2308 C CD  . LYS A 293 ? 0.3071 0.2495 0.2638 0.0933  -0.0470 0.0011  292 LYS A CD  
2309 C CE  . LYS A 293 ? 0.3850 0.3430 0.3490 0.0883  -0.0455 0.0011  292 LYS A CE  
2310 N NZ  . LYS A 293 ? 0.3831 0.3498 0.3508 0.0945  -0.0511 -0.0001 292 LYS A NZ  
2311 N N   . ASN A 294 ? 0.2966 0.1669 0.2155 0.0944  -0.0435 0.0048  293 ASN A N   
2312 C CA  . ASN A 294 ? 0.3062 0.1595 0.2174 0.1013  -0.0464 0.0040  293 ASN A CA  
2313 C C   . ASN A 294 ? 0.3547 0.1961 0.2608 0.0957  -0.0416 0.0033  293 ASN A C   
2314 O O   . ASN A 294 ? 0.3464 0.1726 0.2459 0.1009  -0.0434 0.0023  293 ASN A O   
2315 C CB  . ASN A 294 ? 0.3735 0.2093 0.2704 0.1062  -0.0520 0.0086  293 ASN A CB  
2316 C CG  . ASN A 294 ? 0.5649 0.4128 0.4677 0.1138  -0.0578 0.0081  293 ASN A CG  
2317 O OD1 . ASN A 294 ? 0.5009 0.3672 0.4183 0.1187  -0.0589 0.0031  293 ASN A OD1 
2318 N ND2 . ASN A 294 ? 0.4645 0.3025 0.3558 0.1148  -0.0618 0.0129  293 ASN A ND2 
2319 N N   . HIS A 295 ? 0.2978 0.1468 0.2077 0.0854  -0.0358 0.0035  294 HIS A N   
2320 C CA  . HIS A 295 ? 0.2850 0.1248 0.1911 0.0794  -0.0313 0.0024  294 HIS A CA  
2321 C C   . HIS A 295 ? 0.3310 0.1757 0.2450 0.0846  -0.0309 -0.0036 294 HIS A C   
2322 O O   . HIS A 295 ? 0.2977 0.1604 0.2242 0.0885  -0.0315 -0.0072 294 HIS A O   
2323 C CB  . HIS A 295 ? 0.2727 0.1219 0.1826 0.0683  -0.0259 0.0033  294 HIS A CB  
2324 C CG  . HIS A 295 ? 0.3150 0.1533 0.2193 0.0614  -0.0219 0.0027  294 HIS A CG  
2325 N ND1 . HIS A 295 ? 0.3280 0.1713 0.2386 0.0612  -0.0196 -0.0020 294 HIS A ND1 
2326 C CD2 . HIS A 295 ? 0.3383 0.1610 0.2310 0.0546  -0.0198 0.0059  294 HIS A CD2 
2327 C CE1 . HIS A 295 ? 0.3282 0.1591 0.2312 0.0544  -0.0167 -0.0015 294 HIS A CE1 
2328 N NE2 . HIS A 295 ? 0.3323 0.1507 0.2247 0.0502  -0.0166 0.0031  294 HIS A NE2 
2329 N N   . LYS A 296 ? 0.3203 0.1493 0.2269 0.0838  -0.0295 -0.0048 295 LYS A N   
2330 C CA  . LYS A 296 ? 0.3153 0.1465 0.2275 0.0882  -0.0287 -0.0106 295 LYS A CA  
2331 C C   . LYS A 296 ? 0.3210 0.1742 0.2470 0.0844  -0.0249 -0.0146 295 LYS A C   
2332 O O   . LYS A 296 ? 0.2996 0.1629 0.2345 0.0903  -0.0252 -0.0197 295 LYS A O   
2333 C CB  . LYS A 296 ? 0.3570 0.1679 0.2583 0.0848  -0.0266 -0.0110 295 LYS A CB  
2334 C CG  . LYS A 296 ? 0.5516 0.3394 0.4404 0.0922  -0.0308 -0.0095 295 LYS A CG  
2335 N N   . TRP A 297 ? 0.2961 0.1571 0.2240 0.0748  -0.0213 -0.0124 296 TRP A N   
2336 C CA  . TRP A 297 ? 0.2766 0.1572 0.2163 0.0711  -0.0180 -0.0157 296 TRP A CA  
2337 C C   . TRP A 297 ? 0.2986 0.1974 0.2496 0.0767  -0.0198 -0.0177 296 TRP A C   
2338 O O   . TRP A 297 ? 0.2875 0.1997 0.2474 0.0767  -0.0176 -0.0220 296 TRP A O   
2339 C CB  . TRP A 297 ? 0.2577 0.1432 0.1974 0.0607  -0.0147 -0.0128 296 TRP A CB  
2340 C CG  . TRP A 297 ? 0.2593 0.1594 0.2075 0.0563  -0.0113 -0.0161 296 TRP A CG  
2341 C CD1 . TRP A 297 ? 0.2977 0.1957 0.2456 0.0544  -0.0089 -0.0199 296 TRP A CD1 
2342 C CD2 . TRP A 297 ? 0.2400 0.1577 0.1969 0.0527  -0.0099 -0.0156 296 TRP A CD2 
2343 N NE1 . TRP A 297 ? 0.2655 0.1788 0.2210 0.0501  -0.0064 -0.0216 296 TRP A NE1 
2344 C CE2 . TRP A 297 ? 0.2696 0.1944 0.2304 0.0488  -0.0069 -0.0189 296 TRP A CE2 
2345 C CE3 . TRP A 297 ? 0.2408 0.1679 0.2018 0.0522  -0.0110 -0.0128 296 TRP A CE3 
2346 C CZ2 . TRP A 297 ? 0.2458 0.1861 0.2139 0.0448  -0.0052 -0.0190 296 TRP A CZ2 
2347 C CZ3 . TRP A 297 ? 0.2395 0.1820 0.2082 0.0482  -0.0091 -0.0132 296 TRP A CZ3 
2348 C CH2 . TRP A 297 ? 0.2419 0.1903 0.2138 0.0445  -0.0063 -0.0161 296 TRP A CH2 
2349 N N   . PHE A 298 ? 0.2513 0.1502 0.2014 0.0812  -0.0237 -0.0150 297 PHE A N   
2350 C CA  . PHE A 298 ? 0.2287 0.1448 0.1896 0.0863  -0.0257 -0.0171 297 PHE A CA  
2351 C C   . PHE A 298 ? 0.2824 0.1961 0.2450 0.0977  -0.0301 -0.0205 297 PHE A C   
2352 O O   . PHE A 298 ? 0.2641 0.1899 0.2343 0.1029  -0.0330 -0.0218 297 PHE A O   
2353 C CB  . PHE A 298 ? 0.2193 0.1398 0.1795 0.0839  -0.0275 -0.0126 297 PHE A CB  
2354 C CG  . PHE A 298 ? 0.2140 0.1426 0.1765 0.0743  -0.0236 -0.0104 297 PHE A CG  
2355 C CD1 . PHE A 298 ? 0.2172 0.1638 0.1906 0.0717  -0.0210 -0.0130 297 PHE A CD1 
2356 C CD2 . PHE A 298 ? 0.2292 0.1474 0.1829 0.0680  -0.0225 -0.0057 297 PHE A CD2 
2357 C CE1 . PHE A 298 ? 0.2139 0.1670 0.1890 0.0635  -0.0180 -0.0109 297 PHE A CE1 
2358 C CE2 . PHE A 298 ? 0.2621 0.1887 0.2189 0.0599  -0.0193 -0.0040 297 PHE A CE2 
2359 C CZ  . PHE A 298 ? 0.2197 0.1633 0.1871 0.0581  -0.0173 -0.0066 297 PHE A CZ  
2360 N N   . ALA A 299 ? 0.2589 0.1575 0.2151 0.1016  -0.0307 -0.0222 298 ALA A N   
2361 C CA  . ALA A 299 ? 0.2741 0.1690 0.2316 0.1132  -0.0352 -0.0255 298 ALA A CA  
2362 C C   . ALA A 299 ? 0.3107 0.2270 0.2835 0.1185  -0.0351 -0.0320 298 ALA A C   
2363 O O   . ALA A 299 ? 0.3096 0.2297 0.2867 0.1277  -0.0398 -0.0339 298 ALA A O   
2364 C CB  . ALA A 299 ? 0.3003 0.1755 0.2487 0.1158  -0.0351 -0.0270 298 ALA A CB  
2365 N N   . THR A 300 ? 0.2661 0.1962 0.2468 0.1125  -0.0297 -0.0352 299 THR A N   
2366 C CA  . THR A 300 ? 0.2587 0.2095 0.2536 0.1159  -0.0283 -0.0416 299 THR A CA  
2367 C C   . THR A 300 ? 0.2789 0.2476 0.2821 0.1128  -0.0284 -0.0402 299 THR A C   
2368 O O   . THR A 300 ? 0.2771 0.2638 0.2920 0.1147  -0.0272 -0.0451 299 THR A O   
2369 C CB  . THR A 300 ? 0.3336 0.2894 0.3314 0.1107  -0.0223 -0.0459 299 THR A CB  
2370 O OG1 . THR A 300 ? 0.2956 0.2537 0.2908 0.0999  -0.0187 -0.0420 299 THR A OG1 
2371 C CG2 . THR A 300 ? 0.3810 0.3200 0.3714 0.1139  -0.0219 -0.0483 299 THR A CG2 
2372 N N   . THR A 301 ? 0.2234 0.1873 0.2204 0.1074  -0.0293 -0.0339 300 THR A N   
2373 C CA  . THR A 301 ? 0.2181 0.1978 0.2221 0.1040  -0.0292 -0.0326 300 THR A CA  
2374 C C   . THR A 301 ? 0.2887 0.2744 0.2972 0.1120  -0.0349 -0.0333 300 THR A C   
2375 O O   . THR A 301 ? 0.2821 0.2543 0.2818 0.1162  -0.0397 -0.0296 300 THR A O   
2376 C CB  . THR A 301 ? 0.2481 0.2220 0.2449 0.0949  -0.0276 -0.0264 300 THR A CB  
2377 O OG1 . THR A 301 ? 0.2525 0.2226 0.2463 0.0877  -0.0227 -0.0262 300 THR A OG1 
2378 C CG2 . THR A 301 ? 0.2205 0.2098 0.2242 0.0911  -0.0273 -0.0252 300 THR A CG2 
2379 N N   . ASP A 302 ? 0.2424 0.2483 0.2639 0.1135  -0.0343 -0.0380 301 ASP A N   
2380 C CA  . ASP A 302 ? 0.2458 0.2614 0.2736 0.1201  -0.0395 -0.0394 301 ASP A CA  
2381 C C   . ASP A 302 ? 0.2759 0.2987 0.3041 0.1128  -0.0389 -0.0353 301 ASP A C   
2382 O O   . ASP A 302 ? 0.2435 0.2818 0.2802 0.1073  -0.0350 -0.0375 301 ASP A O   
2383 C CB  . ASP A 302 ? 0.2690 0.3036 0.3115 0.1251  -0.0388 -0.0474 301 ASP A CB  
2384 C CG  . ASP A 302 ? 0.3461 0.3906 0.3958 0.1335  -0.0451 -0.0497 301 ASP A CG  
2385 O OD1 . ASP A 302 ? 0.3275 0.3752 0.3762 0.1312  -0.0477 -0.0462 301 ASP A OD1 
2386 O OD2 . ASP A 302 ? 0.4520 0.5017 0.5088 0.1425  -0.0475 -0.0556 301 ASP A OD2 
2387 N N   . TRP A 303 ? 0.2636 0.2739 0.2815 0.1123  -0.0423 -0.0294 302 TRP A N   
2388 C CA  . TRP A 303 ? 0.2352 0.2493 0.2515 0.1056  -0.0418 -0.0252 302 TRP A CA  
2389 C C   . TRP A 303 ? 0.2748 0.3087 0.3026 0.1061  -0.0430 -0.0284 302 TRP A C   
2390 O O   . TRP A 303 ? 0.2573 0.3001 0.2886 0.0986  -0.0396 -0.0275 302 TRP A O   
2391 C CB  . TRP A 303 ? 0.2201 0.2164 0.2225 0.1064  -0.0457 -0.0191 302 TRP A CB  
2392 C CG  . TRP A 303 ? 0.2296 0.2079 0.2209 0.1027  -0.0430 -0.0158 302 TRP A CG  
2393 C CD1 . TRP A 303 ? 0.2852 0.2478 0.2691 0.1078  -0.0447 -0.0158 302 TRP A CD1 
2394 C CD2 . TRP A 303 ? 0.2092 0.1846 0.1971 0.0928  -0.0377 -0.0129 302 TRP A CD2 
2395 N NE1 . TRP A 303 ? 0.2727 0.2226 0.2482 0.1011  -0.0407 -0.0129 302 TRP A NE1 
2396 C CE2 . TRP A 303 ? 0.2668 0.2251 0.2452 0.0920  -0.0364 -0.0113 302 TRP A CE2 
2397 C CE3 . TRP A 303 ? 0.2064 0.1917 0.1982 0.0847  -0.0341 -0.0115 302 TRP A CE3 
2398 C CZ2 . TRP A 303 ? 0.2448 0.1972 0.2185 0.0834  -0.0318 -0.0088 302 TRP A CZ2 
2399 C CZ3 . TRP A 303 ? 0.2148 0.1938 0.2018 0.0769  -0.0298 -0.0089 302 TRP A CZ3 
2400 C CH2 . TRP A 303 ? 0.2321 0.1950 0.2101 0.0762  -0.0288 -0.0075 302 TRP A CH2 
2401 N N   . ILE A 304 ? 0.2563 0.2975 0.2906 0.1151  -0.0479 -0.0325 303 ILE A N   
2402 C CA  . ILE A 304 ? 0.2431 0.3044 0.2896 0.1160  -0.0493 -0.0364 303 ILE A CA  
2403 C C   . ILE A 304 ? 0.2481 0.3260 0.3064 0.1112  -0.0431 -0.0417 303 ILE A C   
2404 O O   . ILE A 304 ? 0.2089 0.2997 0.2733 0.1053  -0.0408 -0.0424 303 ILE A O   
2405 C CB  . ILE A 304 ? 0.3026 0.3669 0.3528 0.1277  -0.0569 -0.0397 303 ILE A CB  
2406 C CG1 . ILE A 304 ? 0.3379 0.3860 0.3748 0.1312  -0.0633 -0.0336 303 ILE A CG1 
2407 C CG2 . ILE A 304 ? 0.2829 0.3712 0.3488 0.1293  -0.0580 -0.0459 303 ILE A CG2 
2408 C CD1 . ILE A 304 ? 0.4940 0.5463 0.5283 0.1260  -0.0649 -0.0300 303 ILE A CD1 
2409 N N   . ALA A 305 ? 0.2191 0.2962 0.2799 0.1134  -0.0402 -0.0455 304 ALA A N   
2410 C CA  . ALA A 305 ? 0.2086 0.3002 0.2791 0.1087  -0.0339 -0.0506 304 ALA A CA  
2411 C C   . ALA A 305 ? 0.2245 0.3146 0.2908 0.0973  -0.0283 -0.0466 304 ALA A C   
2412 O O   . ALA A 305 ? 0.2128 0.3170 0.2866 0.0917  -0.0244 -0.0492 304 ALA A O   
2413 C CB  . ALA A 305 ? 0.2223 0.3100 0.2937 0.1130  -0.0319 -0.0547 304 ALA A CB  
2414 N N   . ILE A 306 ? 0.1779 0.2511 0.2322 0.0939  -0.0281 -0.0404 305 ILE A N   
2415 C CA  . ILE A 306 ? 0.1608 0.2317 0.2107 0.0840  -0.0238 -0.0364 305 ILE A CA  
2416 C C   . ILE A 306 ? 0.2180 0.2981 0.2713 0.0803  -0.0248 -0.0348 305 ILE A C   
2417 O O   . ILE A 306 ? 0.2145 0.3038 0.2720 0.0736  -0.0207 -0.0356 305 ILE A O   
2418 C CB  . ILE A 306 ? 0.2003 0.2519 0.2374 0.0817  -0.0239 -0.0306 305 ILE A CB  
2419 C CG1 . ILE A 306 ? 0.2043 0.2470 0.2379 0.0833  -0.0218 -0.0324 305 ILE A CG1 
2420 C CG2 . ILE A 306 ? 0.1806 0.2309 0.2140 0.0723  -0.0207 -0.0262 305 ILE A CG2 
2421 C CD1 . ILE A 306 ? 0.2656 0.3139 0.3017 0.0766  -0.0158 -0.0345 305 ILE A CD1 
2422 N N   . TYR A 307 ? 0.1973 0.2736 0.2476 0.0846  -0.0302 -0.0326 306 TYR A N   
2423 C CA  . TYR A 307 ? 0.1985 0.2824 0.2511 0.0815  -0.0316 -0.0313 306 TYR A CA  
2424 C C   . TYR A 307 ? 0.2307 0.3345 0.2962 0.0806  -0.0301 -0.0370 306 TYR A C   
2425 O O   . TYR A 307 ? 0.2089 0.3200 0.2771 0.0737  -0.0273 -0.0366 306 TYR A O   
2426 C CB  . TYR A 307 ? 0.2224 0.2992 0.2692 0.0873  -0.0382 -0.0286 306 TYR A CB  
2427 C CG  . TYR A 307 ? 0.2534 0.3402 0.3039 0.0849  -0.0401 -0.0286 306 TYR A CG  
2428 C CD1 . TYR A 307 ? 0.2641 0.3477 0.3097 0.0773  -0.0378 -0.0245 306 TYR A CD1 
2429 C CD2 . TYR A 307 ? 0.2709 0.3716 0.3307 0.0900  -0.0439 -0.0333 306 TYR A CD2 
2430 C CE1 . TYR A 307 ? 0.2593 0.3521 0.3084 0.0748  -0.0391 -0.0250 306 TYR A CE1 
2431 C CE2 . TYR A 307 ? 0.2743 0.3851 0.3379 0.0871  -0.0453 -0.0338 306 TYR A CE2 
2432 C CZ  . TYR A 307 ? 0.3351 0.4413 0.3930 0.0794  -0.0428 -0.0296 306 TYR A CZ  
2433 O OH  . TYR A 307 ? 0.3219 0.4372 0.3831 0.0764  -0.0442 -0.0304 306 TYR A OH  
2434 N N   . GLN A 308 ? 0.1984 0.3107 0.2720 0.0874  -0.0317 -0.0427 307 GLN A N   
2435 C CA  . GLN A 308 ? 0.1822 0.3146 0.2691 0.0871  -0.0301 -0.0493 307 GLN A CA  
2436 C C   . GLN A 308 ? 0.2444 0.3836 0.3353 0.0799  -0.0226 -0.0519 307 GLN A C   
2437 O O   . GLN A 308 ? 0.2587 0.4143 0.3601 0.0782  -0.0201 -0.0574 307 GLN A O   
2438 C CB  . GLN A 308 ? 0.1934 0.3328 0.2879 0.0975  -0.0346 -0.0548 307 GLN A CB  
2439 C CG  . GLN A 308 ? 0.2709 0.4071 0.3629 0.1043  -0.0426 -0.0530 307 GLN A CG  
2440 C CD  . GLN A 308 ? 0.4299 0.5728 0.5294 0.1155  -0.0479 -0.0585 307 GLN A CD  
2441 O OE1 . GLN A 308 ? 0.3383 0.4844 0.4431 0.1193  -0.0458 -0.0631 307 GLN A OE1 
2442 N NE2 . GLN A 308 ? 0.3473 0.4915 0.4467 0.1216  -0.0552 -0.0581 307 GLN A NE2 
2443 N N   A ARG A 309 ? 0.2019 0.3283 0.2840 0.0757  -0.0191 -0.0480 308 ARG A N   
2444 N N   B ARG A 309 ? 0.1973 0.3239 0.2795 0.0757  -0.0191 -0.0480 308 ARG A N   
2445 C CA  A ARG A 309 ? 0.1979 0.3269 0.2804 0.0688  -0.0125 -0.0492 308 ARG A CA  
2446 C CA  B ARG A 309 ? 0.1913 0.3209 0.2741 0.0688  -0.0125 -0.0494 308 ARG A CA  
2447 C C   A ARG A 309 ? 0.2433 0.3818 0.3335 0.0722  -0.0098 -0.0562 308 ARG A C   
2448 C C   B ARG A 309 ? 0.2354 0.3756 0.3267 0.0724  -0.0100 -0.0566 308 ARG A C   
2449 O O   A ARG A 309 ? 0.2526 0.3999 0.3466 0.0665  -0.0043 -0.0592 308 ARG A O   
2450 O O   B ARG A 309 ? 0.2367 0.3881 0.3335 0.0670  -0.0049 -0.0602 308 ARG A O   
2451 C CB  A ARG A 309 ? 0.2076 0.3449 0.2924 0.0601  -0.0090 -0.0485 308 ARG A CB  
2452 C CB  B ARG A 309 ? 0.1908 0.3285 0.2759 0.0600  -0.0092 -0.0485 308 ARG A CB  
2453 C CG  A ARG A 309 ? 0.3375 0.4672 0.4160 0.0570  -0.0115 -0.0426 308 ARG A CG  
2454 C CG  B ARG A 309 ? 0.2840 0.4140 0.3627 0.0571  -0.0118 -0.0425 308 ARG A CG  
2455 C CD  A ARG A 309 ? 0.4118 0.5528 0.4956 0.0508  -0.0096 -0.0438 308 ARG A CD  
2456 C CD  B ARG A 309 ? 0.2759 0.4153 0.3584 0.0496  -0.0090 -0.0429 308 ARG A CD  
2457 N NE  A ARG A 309 ? 0.4420 0.5745 0.5186 0.0451  -0.0092 -0.0381 308 ARG A NE  
2458 N NE  B ARG A 309 ? 0.2593 0.3988 0.3401 0.0426  -0.0030 -0.0430 308 ARG A NE  
2459 C CZ  A ARG A 309 ? 0.4719 0.5977 0.5429 0.0391  -0.0053 -0.0351 308 ARG A CZ  
2460 C CZ  B ARG A 309 ? 0.3542 0.4829 0.4267 0.0377  -0.0012 -0.0380 308 ARG A CZ  
2461 N NH1 A ARG A 309 ? 0.2853 0.4115 0.3561 0.0374  -0.0014 -0.0369 308 ARG A NH1 
2462 N NH1 B ARG A 309 ? 0.1913 0.3093 0.2572 0.0383  -0.0043 -0.0329 308 ARG A NH1 
2463 N NH2 A ARG A 309 ? 0.2101 0.3288 0.2754 0.0349  -0.0055 -0.0305 308 ARG A NH2 
2464 N NH2 B ARG A 309 ? 0.0992 0.2281 0.1698 0.0319  0.0036  -0.0382 308 ARG A NH2 
2465 N N   . LYS A 310 ? 0.1815 0.3176 0.2734 0.0815  -0.0137 -0.0588 309 LYS A N   
2466 C CA  . LYS A 310 ? 0.1795 0.3247 0.2796 0.0865  -0.0120 -0.0661 309 LYS A CA  
2467 C C   . LYS A 310 ? 0.2398 0.3746 0.3337 0.0863  -0.0085 -0.0664 309 LYS A C   
2468 O O   . LYS A 310 ? 0.2572 0.4004 0.3573 0.0878  -0.0051 -0.0726 309 LYS A O   
2469 C CB  . LYS A 310 ? 0.2106 0.3597 0.3169 0.0976  -0.0185 -0.0696 309 LYS A CB  
2470 C CG  . LYS A 310 ? 0.3744 0.5411 0.4916 0.0979  -0.0207 -0.0729 309 LYS A CG  
2471 C CD  . LYS A 310 ? 0.5142 0.6826 0.6356 0.1093  -0.0286 -0.0750 309 LYS A CD  
2472 C CE  . LYS A 310 ? 0.6163 0.8027 0.7484 0.1094  -0.0313 -0.0785 309 LYS A CE  
2473 N NZ  . LYS A 310 ? 0.6660 0.8538 0.8016 0.1210  -0.0398 -0.0805 309 LYS A NZ  
2474 N N   . VAL A 311 ? 0.1936 0.3111 0.2757 0.0839  -0.0091 -0.0601 310 VAL A N   
2475 C CA  . VAL A 311 ? 0.1834 0.2894 0.2581 0.0827  -0.0062 -0.0597 310 VAL A CA  
2476 C C   . VAL A 311 ? 0.2487 0.3609 0.3233 0.0734  0.0005  -0.0605 310 VAL A C   
2477 O O   . VAL A 311 ? 0.2492 0.3641 0.3226 0.0665  0.0019  -0.0571 310 VAL A O   
2478 C CB  . VAL A 311 ? 0.2236 0.3097 0.2860 0.0827  -0.0093 -0.0528 310 VAL A CB  
2479 C CG1 . VAL A 311 ? 0.2243 0.2991 0.2791 0.0802  -0.0061 -0.0523 310 VAL A CG1 
2480 C CG2 . VAL A 311 ? 0.2289 0.3074 0.2897 0.0919  -0.0157 -0.0520 310 VAL A CG2 
2481 N N   . GLU A 312 ? 0.2441 0.3581 0.3195 0.0735  0.0045  -0.0652 311 GLU A N   
2482 C CA  . GLU A 312 ? 0.2383 0.3565 0.3118 0.0648  0.0107  -0.0658 311 GLU A CA  
2483 C C   . GLU A 312 ? 0.2558 0.3593 0.3176 0.0591  0.0108  -0.0591 311 GLU A C   
2484 O O   . GLU A 312 ? 0.2560 0.3462 0.3112 0.0622  0.0086  -0.0571 311 GLU A O   
2485 C CB  . GLU A 312 ? 0.2667 0.3901 0.3432 0.0666  0.0149  -0.0729 311 GLU A CB  
2486 N N   . ALA A 313 ? 0.2150 0.3209 0.2744 0.0511  0.0130  -0.0556 312 ALA A N   
2487 C CA  . ALA A 313 ? 0.2144 0.3078 0.2638 0.0459  0.0128  -0.0496 312 ALA A CA  
2488 C C   . ALA A 313 ? 0.2530 0.3404 0.2962 0.0436  0.0159  -0.0510 312 ALA A C   
2489 O O   . ALA A 313 ? 0.2359 0.3312 0.2815 0.0420  0.0201  -0.0558 312 ALA A O   
2490 C CB  . ALA A 313 ? 0.2254 0.3228 0.2740 0.0387  0.0142  -0.0460 312 ALA A CB  
2491 N N   . PRO A 314 ? 0.2314 0.3053 0.2664 0.0430  0.0141  -0.0473 313 PRO A N   
2492 C CA  . PRO A 314 ? 0.2473 0.3156 0.2761 0.0405  0.0168  -0.0489 313 PRO A CA  
2493 C C   . PRO A 314 ? 0.2850 0.3565 0.3098 0.0324  0.0203  -0.0477 313 PRO A C   
2494 O O   . PRO A 314 ? 0.2865 0.3565 0.3069 0.0301  0.0232  -0.0502 313 PRO A O   
2495 C CB  . PRO A 314 ? 0.2772 0.3308 0.2989 0.0412  0.0135  -0.0448 313 PRO A CB  
2496 C CG  . PRO A 314 ? 0.3346 0.3870 0.3571 0.0408  0.0104  -0.0396 313 PRO A CG  
2497 C CD  . PRO A 314 ? 0.2691 0.3326 0.3000 0.0442  0.0099  -0.0419 313 PRO A CD  
2498 N N   . PHE A 315 ? 0.2154 0.2907 0.2411 0.0283  0.0199  -0.0439 314 PHE A N   
2499 C CA  . PHE A 315 ? 0.2059 0.2822 0.2267 0.0209  0.0224  -0.0416 314 PHE A CA  
2500 C C   . PHE A 315 ? 0.2492 0.3337 0.2743 0.0179  0.0231  -0.0401 314 PHE A C   
2501 O O   . PHE A 315 ? 0.2423 0.3263 0.2704 0.0197  0.0200  -0.0373 314 PHE A O   
2502 C CB  . PHE A 315 ? 0.2246 0.2897 0.2378 0.0184  0.0198  -0.0364 314 PHE A CB  
2503 C CG  . PHE A 315 ? 0.2406 0.3050 0.2485 0.0118  0.0206  -0.0328 314 PHE A CG  
2504 C CD1 . PHE A 315 ? 0.2965 0.3618 0.2990 0.0074  0.0238  -0.0344 314 PHE A CD1 
2505 C CD2 . PHE A 315 ? 0.2435 0.3053 0.2512 0.0101  0.0180  -0.0278 314 PHE A CD2 
2506 C CE1 . PHE A 315 ? 0.3106 0.3737 0.3071 0.0018  0.0239  -0.0307 314 PHE A CE1 
2507 C CE2 . PHE A 315 ? 0.2896 0.3500 0.2924 0.0048  0.0183  -0.0246 314 PHE A CE2 
2508 C CZ  . PHE A 315 ? 0.2913 0.3519 0.2882 0.0008  0.0210  -0.0258 314 PHE A CZ  
2509 N N   . ILE A 316 ? 0.2063 0.2976 0.2309 0.0130  0.0273  -0.0422 315 ILE A N   
2510 C CA  . ILE A 316 ? 0.2214 0.3195 0.2491 0.0091  0.0284  -0.0410 315 ILE A CA  
2511 C C   . ILE A 316 ? 0.2672 0.3598 0.2857 0.0020  0.0299  -0.0372 315 ILE A C   
2512 O O   . ILE A 316 ? 0.2397 0.3321 0.2529 -0.0012 0.0333  -0.0392 315 ILE A O   
2513 C CB  . ILE A 316 ? 0.2856 0.3973 0.3209 0.0087  0.0325  -0.0470 315 ILE A CB  
2514 C CG1 . ILE A 316 ? 0.3049 0.4226 0.3491 0.0167  0.0313  -0.0523 315 ILE A CG1 
2515 C CG2 . ILE A 316 ? 0.2980 0.4160 0.3364 0.0041  0.0335  -0.0456 315 ILE A CG2 
2516 C CD1 . ILE A 316 ? 0.3720 0.4935 0.4239 0.0215  0.0273  -0.0518 315 ILE A CD1 
2517 N N   . PRO A 317 ? 0.2279 0.3160 0.2440 -0.0004 0.0275  -0.0320 316 PRO A N   
2518 C CA  . PRO A 317 ? 0.2295 0.3117 0.2365 -0.0065 0.0284  -0.0284 316 PRO A CA  
2519 C C   . PRO A 317 ? 0.2768 0.3653 0.2824 -0.0120 0.0334  -0.0309 316 PRO A C   
2520 O O   . PRO A 317 ? 0.2690 0.3669 0.2821 -0.0118 0.0356  -0.0342 316 PRO A O   
2521 C CB  . PRO A 317 ? 0.2420 0.3200 0.2493 -0.0069 0.0249  -0.0233 316 PRO A CB  
2522 C CG  . PRO A 317 ? 0.2846 0.3628 0.2983 -0.0008 0.0215  -0.0235 316 PRO A CG  
2523 C CD  . PRO A 317 ? 0.2425 0.3299 0.2633 0.0023  0.0238  -0.0291 316 PRO A CD  
2524 N N   . LYS A 318 ? 0.2471 0.3305 0.2428 -0.0169 0.0354  -0.0295 317 LYS A N   
2525 C CA  . LYS A 318 ? 0.2562 0.3440 0.2484 -0.0232 0.0406  -0.0315 317 LYS A CA  
2526 C C   . LYS A 318 ? 0.2912 0.3800 0.2854 -0.0264 0.0405  -0.0288 317 LYS A C   
2527 O O   . LYS A 318 ? 0.2791 0.3606 0.2707 -0.0261 0.0365  -0.0238 317 LYS A O   
2528 C CB  . LYS A 318 ? 0.3092 0.3888 0.2882 -0.0279 0.0417  -0.0294 317 LYS A CB  
2529 N N   . PHE A 319 ? 0.2499 0.3490 0.2502 -0.0288 0.0446  -0.0329 318 PHE A N   
2530 C CA  . PHE A 319 ? 0.2545 0.3557 0.2573 -0.0324 0.0450  -0.0314 318 PHE A CA  
2531 C C   . PHE A 319 ? 0.2886 0.3853 0.2809 -0.0408 0.0491  -0.0297 318 PHE A C   
2532 O O   . PHE A 319 ? 0.2792 0.3801 0.2685 -0.0448 0.0543  -0.0334 318 PHE A O   
2533 C CB  . PHE A 319 ? 0.2683 0.3837 0.2842 -0.0305 0.0468  -0.0369 318 PHE A CB  
2534 C CG  . PHE A 319 ? 0.2833 0.4006 0.3022 -0.0338 0.0465  -0.0354 318 PHE A CG  
2535 C CD1 . PHE A 319 ? 0.3079 0.4190 0.3276 -0.0309 0.0413  -0.0309 318 PHE A CD1 
2536 C CD2 . PHE A 319 ? 0.2987 0.4236 0.3192 -0.0405 0.0518  -0.0386 318 PHE A CD2 
2537 C CE1 . PHE A 319 ? 0.3147 0.4270 0.3367 -0.0341 0.0412  -0.0298 318 PHE A CE1 
2538 C CE2 . PHE A 319 ? 0.3286 0.4546 0.3515 -0.0441 0.0516  -0.0375 318 PHE A CE2 
2539 C CZ  . PHE A 319 ? 0.3057 0.4252 0.3292 -0.0407 0.0462  -0.0331 318 PHE A CZ  
2540 N N   . LYS A 320 ? 0.2355 0.3224 0.2214 -0.0434 0.0466  -0.0241 319 LYS A N   
2541 C CA  . LYS A 320 ? 0.2466 0.3250 0.2201 -0.0509 0.0490  -0.0209 319 LYS A CA  
2542 C C   . LYS A 320 ? 0.2929 0.3705 0.2675 -0.0552 0.0497  -0.0193 319 LYS A C   
2543 O O   . LYS A 320 ? 0.2976 0.3650 0.2613 -0.0605 0.0503  -0.0153 319 LYS A O   
2544 C CB  . LYS A 320 ? 0.2703 0.3350 0.2329 -0.0494 0.0444  -0.0152 319 LYS A CB  
2545 C CG  . LYS A 320 ? 0.3660 0.4300 0.3249 -0.0469 0.0442  -0.0168 319 LYS A CG  
2546 C CD  . LYS A 320 ? 0.4805 0.5334 0.4322 -0.0441 0.0385  -0.0118 319 LYS A CD  
2547 C CE  . LYS A 320 ? 0.5230 0.5776 0.4771 -0.0390 0.0367  -0.0140 319 LYS A CE  
2548 N NZ  . LYS A 320 ? 0.5600 0.6077 0.5140 -0.0345 0.0303  -0.0101 319 LYS A NZ  
2549 N N   . GLY A 321 ? 0.2379 0.3256 0.2250 -0.0528 0.0494  -0.0224 320 GLY A N   
2550 C CA  . GLY A 321 ? 0.2356 0.3235 0.2248 -0.0566 0.0500  -0.0216 320 GLY A CA  
2551 C C   . GLY A 321 ? 0.2323 0.3186 0.2279 -0.0510 0.0443  -0.0192 320 GLY A C   
2552 O O   . GLY A 321 ? 0.1974 0.2782 0.1922 -0.0452 0.0397  -0.0164 320 GLY A O   
2553 N N   . PRO A 322 ? 0.2118 0.3030 0.2138 -0.0528 0.0446  -0.0205 321 PRO A N   
2554 C CA  . PRO A 322 ? 0.1952 0.2858 0.2034 -0.0475 0.0395  -0.0188 321 PRO A CA  
2555 C C   . PRO A 322 ? 0.2121 0.2884 0.2125 -0.0467 0.0356  -0.0128 321 PRO A C   
2556 O O   . PRO A 322 ? 0.2128 0.2882 0.2177 -0.0414 0.0313  -0.0114 321 PRO A O   
2557 C CB  . PRO A 322 ? 0.2196 0.3198 0.2357 -0.0508 0.0416  -0.0226 321 PRO A CB  
2558 C CG  . PRO A 322 ? 0.2798 0.3795 0.2899 -0.0597 0.0474  -0.0238 321 PRO A CG  
2559 C CD  . PRO A 322 ? 0.2353 0.3341 0.2397 -0.0601 0.0500  -0.0244 321 PRO A CD  
2560 N N   . GLY A 323 ? 0.1881 0.2539 0.1771 -0.0520 0.0372  -0.0095 322 GLY A N   
2561 C CA  . GLY A 323 ? 0.1912 0.2429 0.1721 -0.0512 0.0334  -0.0039 322 GLY A CA  
2562 C C   . GLY A 323 ? 0.2240 0.2674 0.1961 -0.0493 0.0314  -0.0007 322 GLY A C   
2563 O O   . GLY A 323 ? 0.2180 0.2497 0.1825 -0.0488 0.0283  0.0038  322 GLY A O   
2564 N N   . ASP A 324 ? 0.1882 0.2375 0.1614 -0.0479 0.0329  -0.0032 323 ASP A N   
2565 C CA  . ASP A 324 ? 0.2024 0.2449 0.1675 -0.0462 0.0311  -0.0009 323 ASP A CA  
2566 C C   . ASP A 324 ? 0.2452 0.2835 0.2129 -0.0398 0.0252  0.0019  323 ASP A C   
2567 O O   . ASP A 324 ? 0.2433 0.2879 0.2209 -0.0355 0.0236  0.0003  323 ASP A O   
2568 C CB  . ASP A 324 ? 0.2222 0.2732 0.1899 -0.0455 0.0339  -0.0051 323 ASP A CB  
2569 C CG  . ASP A 324 ? 0.3293 0.3742 0.2897 -0.0433 0.0316  -0.0033 323 ASP A CG  
2570 O OD1 . ASP A 324 ? 0.3249 0.3608 0.2733 -0.0473 0.0320  -0.0005 323 ASP A OD1 
2571 O OD2 . ASP A 324 ? 0.3845 0.4329 0.3506 -0.0379 0.0293  -0.0046 323 ASP A OD2 
2572 N N   . THR A 325 ? 0.1953 0.2232 0.1541 -0.0392 0.0219  0.0060  324 THR A N   
2573 C CA  . THR A 325 ? 0.1840 0.2088 0.1458 -0.0334 0.0165  0.0082  324 THR A CA  
2574 C C   . THR A 325 ? 0.2314 0.2541 0.1890 -0.0312 0.0143  0.0087  324 THR A C   
2575 O O   . THR A 325 ? 0.2261 0.2450 0.1841 -0.0275 0.0098  0.0108  324 THR A O   
2576 C CB  . THR A 325 ? 0.2548 0.2696 0.2121 -0.0335 0.0133  0.0123  324 THR A CB  
2577 O OG1 . THR A 325 ? 0.2815 0.2867 0.2262 -0.0369 0.0131  0.0152  324 THR A OG1 
2578 C CG2 . THR A 325 ? 0.2241 0.2401 0.1855 -0.0355 0.0150  0.0118  324 THR A CG2 
2579 N N   . SER A 326 ? 0.2234 0.2492 0.1775 -0.0335 0.0176  0.0063  325 SER A N   
2580 C CA  . SER A 326 ? 0.2289 0.2525 0.1778 -0.0322 0.0160  0.0063  325 SER A CA  
2581 C C   . SER A 326 ? 0.2640 0.2911 0.2204 -0.0267 0.0129  0.0051  325 SER A C   
2582 O O   . SER A 326 ? 0.2454 0.2694 0.1977 -0.0255 0.0104  0.0056  325 SER A O   
2583 C CB  . SER A 326 ? 0.2628 0.2892 0.2063 -0.0362 0.0208  0.0033  325 SER A CB  
2584 O OG  . SER A 326 ? 0.3876 0.4245 0.3406 -0.0348 0.0241  -0.0015 325 SER A OG  
2585 N N   . ASN A 327 ? 0.2112 0.2445 0.1782 -0.0236 0.0131  0.0033  326 ASN A N   
2586 C CA  . ASN A 327 ? 0.2010 0.2367 0.1748 -0.0188 0.0105  0.0024  326 ASN A CA  
2587 C C   . ASN A 327 ? 0.2369 0.2689 0.2131 -0.0163 0.0063  0.0053  326 ASN A C   
2588 O O   . ASN A 327 ? 0.2185 0.2518 0.1997 -0.0129 0.0043  0.0048  326 ASN A O   
2589 C CB  . ASN A 327 ? 0.2164 0.2601 0.1988 -0.0166 0.0128  -0.0013 326 ASN A CB  
2590 C CG  . ASN A 327 ? 0.2938 0.3418 0.2748 -0.0177 0.0164  -0.0051 326 ASN A CG  
2591 O OD1 . ASN A 327 ? 0.2116 0.2572 0.1883 -0.0174 0.0160  -0.0058 326 ASN A OD1 
2592 N ND2 . ASN A 327 ? 0.2049 0.2596 0.1896 -0.0193 0.0202  -0.0079 326 ASN A ND2 
2593 N N   . PHE A 328 ? 0.1760 0.2026 0.1478 -0.0180 0.0050  0.0083  327 PHE A N   
2594 C CA  . PHE A 328 ? 0.1709 0.1940 0.1449 -0.0155 0.0011  0.0107  327 PHE A CA  
2595 C C   . PHE A 328 ? 0.2172 0.2330 0.1831 -0.0161 -0.0023 0.0136  327 PHE A C   
2596 O O   . PHE A 328 ? 0.2154 0.2269 0.1725 -0.0194 -0.0011 0.0146  327 PHE A O   
2597 C CB  . PHE A 328 ? 0.1895 0.2125 0.1669 -0.0161 0.0019  0.0115  327 PHE A CB  
2598 C CG  . PHE A 328 ? 0.1939 0.2245 0.1795 -0.0150 0.0042  0.0087  327 PHE A CG  
2599 C CD1 . PHE A 328 ? 0.2429 0.2784 0.2292 -0.0175 0.0080  0.0063  327 PHE A CD1 
2600 C CD2 . PHE A 328 ? 0.2193 0.2523 0.2118 -0.0114 0.0024  0.0083  327 PHE A CD2 
2601 C CE1 . PHE A 328 ? 0.2442 0.2871 0.2384 -0.0157 0.0094  0.0036  327 PHE A CE1 
2602 C CE2 . PHE A 328 ? 0.2442 0.2833 0.2430 -0.0101 0.0040  0.0060  327 PHE A CE2 
2603 C CZ  . PHE A 328 ? 0.2075 0.2515 0.2072 -0.0119 0.0071  0.0037  327 PHE A CZ  
2604 N N   . ASP A 329 ? 0.1928 0.2071 0.1614 -0.0130 -0.0064 0.0147  328 ASP A N   
2605 C CA  . ASP A 329 ? 0.2146 0.2226 0.1767 -0.0125 -0.0106 0.0172  328 ASP A CA  
2606 C C   . ASP A 329 ? 0.2836 0.2850 0.2418 -0.0131 -0.0116 0.0200  328 ASP A C   
2607 O O   . ASP A 329 ? 0.2841 0.2865 0.2460 -0.0139 -0.0091 0.0197  328 ASP A O   
2608 C CB  . ASP A 329 ? 0.2205 0.2310 0.1887 -0.0087 -0.0146 0.0168  328 ASP A CB  
2609 C CG  . ASP A 329 ? 0.2868 0.3016 0.2567 -0.0084 -0.0146 0.0143  328 ASP A CG  
2610 O OD1 . ASP A 329 ? 0.2675 0.2828 0.2330 -0.0106 -0.0119 0.0130  328 ASP A OD1 
2611 O OD2 . ASP A 329 ? 0.3165 0.3341 0.2922 -0.0061 -0.0170 0.0134  328 ASP A OD2 
2612 N N   . ASP A 330 ? 0.2473 0.2413 0.1978 -0.0126 -0.0155 0.0227  329 ASP A N   
2613 C CA  . ASP A 330 ? 0.2596 0.2452 0.2052 -0.0127 -0.0171 0.0256  329 ASP A CA  
2614 C C   . ASP A 330 ? 0.3131 0.2995 0.2664 -0.0079 -0.0212 0.0258  329 ASP A C   
2615 O O   . ASP A 330 ? 0.2948 0.2848 0.2521 -0.0048 -0.0246 0.0249  329 ASP A O   
2616 C CB  . ASP A 330 ? 0.2971 0.2730 0.2290 -0.0145 -0.0195 0.0286  329 ASP A CB  
2617 C CG  . ASP A 330 ? 0.4130 0.3882 0.3365 -0.0199 -0.0149 0.0282  329 ASP A CG  
2618 O OD1 . ASP A 330 ? 0.3820 0.3608 0.3085 -0.0231 -0.0096 0.0265  329 ASP A OD1 
2619 O OD2 . ASP A 330 ? 0.4753 0.4468 0.3895 -0.0210 -0.0165 0.0291  329 ASP A OD2 
2620 N N   . TYR A 331 ? 0.2778 0.2611 0.2334 -0.0075 -0.0205 0.0265  330 TYR A N   
2621 C CA  . TYR A 331 ? 0.2765 0.2606 0.2396 -0.0030 -0.0237 0.0261  330 TYR A CA  
2622 C C   . TYR A 331 ? 0.3371 0.3103 0.2938 -0.0021 -0.0263 0.0289  330 TYR A C   
2623 O O   . TYR A 331 ? 0.3344 0.3003 0.2826 -0.0059 -0.0240 0.0307  330 TYR A O   
2624 C CB  . TYR A 331 ? 0.2804 0.2722 0.2539 -0.0027 -0.0203 0.0235  330 TYR A CB  
2625 C CG  . TYR A 331 ? 0.2738 0.2749 0.2534 -0.0027 -0.0186 0.0210  330 TYR A CG  
2626 C CD1 . TYR A 331 ? 0.2905 0.2966 0.2766 0.0004  -0.0211 0.0196  330 TYR A CD1 
2627 C CD2 . TYR A 331 ? 0.2630 0.2675 0.2415 -0.0059 -0.0145 0.0198  330 TYR A CD2 
2628 C CE1 . TYR A 331 ? 0.2713 0.2842 0.2617 0.0000  -0.0195 0.0174  330 TYR A CE1 
2629 C CE2 . TYR A 331 ? 0.2678 0.2792 0.2509 -0.0055 -0.0133 0.0176  330 TYR A CE2 
2630 C CZ  . TYR A 331 ? 0.3427 0.3576 0.3312 -0.0027 -0.0158 0.0166  330 TYR A CZ  
2631 O OH  . TYR A 331 ? 0.3438 0.3639 0.3359 -0.0026 -0.0144 0.0145  330 TYR A OH  
2632 N N   . GLU A 332 ? 0.3276 0.2995 0.2884 0.0029  -0.0309 0.0290  331 GLU A N   
2633 C CA  . GLU A 332 ? 0.3431 0.3038 0.2982 0.0048  -0.0338 0.0314  331 GLU A CA  
2634 C C   . GLU A 332 ? 0.3519 0.3102 0.3084 0.0021  -0.0294 0.0309  331 GLU A C   
2635 O O   . GLU A 332 ? 0.3400 0.3069 0.3065 0.0025  -0.0267 0.0281  331 GLU A O   
2636 C CB  . GLU A 332 ? 0.3631 0.3255 0.3254 0.0113  -0.0392 0.0304  331 GLU A CB  
2637 N N   . GLU A 333 ? 0.3218 0.2686 0.2677 -0.0010 -0.0286 0.0335  332 GLU A N   
2638 C CA  . GLU A 333 ? 0.3189 0.2621 0.2645 -0.0043 -0.0246 0.0331  332 GLU A CA  
2639 C C   . GLU A 333 ? 0.3822 0.3193 0.3307 0.0001  -0.0275 0.0330  332 GLU A C   
2640 O O   . GLU A 333 ? 0.4031 0.3286 0.3440 0.0026  -0.0318 0.0357  332 GLU A O   
2641 C CB  . GLU A 333 ? 0.3512 0.2842 0.2835 -0.0105 -0.0219 0.0358  332 GLU A CB  
2642 C CG  . GLU A 333 ? 0.3954 0.3353 0.3256 -0.0153 -0.0180 0.0350  332 GLU A CG  
2643 C CD  . GLU A 333 ? 0.4488 0.4016 0.3893 -0.0175 -0.0131 0.0313  332 GLU A CD  
2644 O OE1 . GLU A 333 ? 0.2895 0.2441 0.2364 -0.0171 -0.0117 0.0297  332 GLU A OE1 
2645 O OE2 . GLU A 333 ? 0.3257 0.2866 0.2678 -0.0192 -0.0108 0.0299  332 GLU A OE2 
2646 N N   . GLU A 334 ? 0.3337 0.2786 0.2929 0.0013  -0.0255 0.0299  333 GLU A N   
2647 C CA  . GLU A 334 ? 0.3246 0.2660 0.2885 0.0056  -0.0275 0.0287  333 GLU A CA  
2648 C C   . GLU A 334 ? 0.3417 0.2787 0.3044 0.0018  -0.0236 0.0279  333 GLU A C   
2649 O O   . GLU A 334 ? 0.3187 0.2610 0.2820 -0.0034 -0.0190 0.0269  333 GLU A O   
2650 C CB  . GLU A 334 ? 0.3248 0.2790 0.3019 0.0098  -0.0280 0.0253  333 GLU A CB  
2651 C CG  . GLU A 334 ? 0.4767 0.4354 0.4561 0.0138  -0.0323 0.0255  333 GLU A CG  
2652 C CD  . GLU A 334 ? 0.7171 0.6880 0.7093 0.0173  -0.0325 0.0219  333 GLU A CD  
2653 O OE1 . GLU A 334 ? 0.5698 0.5499 0.5674 0.0147  -0.0286 0.0200  333 GLU A OE1 
2654 O OE2 . GLU A 334 ? 0.7752 0.7461 0.7719 0.0226  -0.0364 0.0209  333 GLU A OE2 
2655 N N   . GLU A 335 ? 0.3072 0.2349 0.2687 0.0045  -0.0255 0.0279  334 GLU A N   
2656 C CA  . GLU A 335 ? 0.3045 0.2271 0.2645 0.0008  -0.0219 0.0268  334 GLU A CA  
2657 C C   . GLU A 335 ? 0.3241 0.2597 0.2951 -0.0001 -0.0183 0.0228  334 GLU A C   
2658 O O   . GLU A 335 ? 0.2978 0.2444 0.2779 0.0034  -0.0191 0.0208  334 GLU A O   
2659 C CB  . GLU A 335 ? 0.3369 0.2462 0.2936 0.0047  -0.0251 0.0273  334 GLU A CB  
2660 C CG  . GLU A 335 ? 0.4370 0.3522 0.4042 0.0123  -0.0283 0.0245  334 GLU A CG  
2661 C CD  . GLU A 335 ? 0.5971 0.5011 0.5632 0.0166  -0.0307 0.0238  334 GLU A CD  
2662 O OE1 . GLU A 335 ? 0.5524 0.4432 0.5097 0.0132  -0.0295 0.0251  334 GLU A OE1 
2663 O OE2 . GLU A 335 ? 0.5526 0.4614 0.5272 0.0232  -0.0336 0.0213  334 GLU A OE2 
2664 N N   . ILE A 336 ? 0.2938 0.2278 0.2634 -0.0051 -0.0145 0.0215  335 ILE A N   
2665 C CA  . ILE A 336 ? 0.2698 0.2140 0.2482 -0.0060 -0.0115 0.0178  335 ILE A CA  
2666 C C   . ILE A 336 ? 0.3489 0.2842 0.3268 -0.0042 -0.0122 0.0164  335 ILE A C   
2667 O O   . ILE A 336 ? 0.3682 0.2945 0.3398 -0.0085 -0.0104 0.0166  335 ILE A O   
2668 C CB  . ILE A 336 ? 0.2991 0.2501 0.2775 -0.0126 -0.0071 0.0166  335 ILE A CB  
2669 C CG1 . ILE A 336 ? 0.2931 0.2523 0.2719 -0.0137 -0.0064 0.0177  335 ILE A CG1 
2670 C CG2 . ILE A 336 ? 0.2839 0.2440 0.2706 -0.0127 -0.0050 0.0128  335 ILE A CG2 
2671 C CD1 . ILE A 336 ? 0.3509 0.3151 0.3283 -0.0201 -0.0024 0.0168  335 ILE A CD1 
2672 N N   . ARG A 337 ? 0.3079 0.2446 0.2917 0.0021  -0.0150 0.0150  336 ARG A N   
2673 C CA  . ARG A 337 ? 0.3072 0.2353 0.2910 0.0048  -0.0159 0.0133  336 ARG A CA  
2674 C C   . ARG A 337 ? 0.3338 0.2688 0.3237 0.0030  -0.0125 0.0092  336 ARG A C   
2675 O O   . ARG A 337 ? 0.3057 0.2535 0.3031 0.0037  -0.0111 0.0072  336 ARG A O   
2676 C CB  . ARG A 337 ? 0.3290 0.2560 0.3169 0.0127  -0.0203 0.0129  336 ARG A CB  
2677 C CG  . ARG A 337 ? 0.4507 0.3624 0.4335 0.0157  -0.0226 0.0130  336 ARG A CG  
2678 C CD  . ARG A 337 ? 0.5078 0.4197 0.4963 0.0241  -0.0271 0.0117  336 ARG A CD  
2679 N NE  . ARG A 337 ? 0.5935 0.5174 0.5936 0.0267  -0.0252 0.0069  336 ARG A NE  
2680 C CZ  . ARG A 337 ? 0.7142 0.6352 0.7168 0.0278  -0.0236 0.0033  336 ARG A CZ  
2681 N NH1 . ARG A 337 ? 0.4911 0.3970 0.4857 0.0265  -0.0237 0.0040  336 ARG A NH1 
2682 N NH2 . ARG A 337 ? 0.5642 0.4967 0.5766 0.0297  -0.0216 -0.0010 336 ARG A NH2 
2683 N N   . VAL A 338 ? 0.2955 0.2210 0.2809 0.0002  -0.0110 0.0081  337 VAL A N   
2684 C CA  . VAL A 338 ? 0.2856 0.2161 0.2754 -0.0018 -0.0080 0.0041  337 VAL A CA  
2685 C C   . VAL A 338 ? 0.3352 0.2559 0.3248 0.0021  -0.0093 0.0019  337 VAL A C   
2686 O O   . VAL A 338 ? 0.3354 0.2417 0.3173 0.0006  -0.0098 0.0030  337 VAL A O   
2687 C CB  . VAL A 338 ? 0.3324 0.2632 0.3184 -0.0097 -0.0045 0.0036  337 VAL A CB  
2688 C CG1 . VAL A 338 ? 0.3191 0.2566 0.3102 -0.0112 -0.0021 -0.0008 337 VAL A CG1 
2689 C CG2 . VAL A 338 ? 0.3232 0.2630 0.3092 -0.0132 -0.0033 0.0056  337 VAL A CG2 
2690 N N   . SEP A 339 ? 0.2762 0.2042 0.2740 0.0070  -0.0096 -0.0013 338 SEP A N   
2691 C CA  . SEP A 339 ? 0.2886 0.2087 0.2874 0.0114  -0.0107 -0.0042 338 SEP A CA  
2692 C CB  . SEP A 339 ? 0.2980 0.2298 0.3070 0.0165  -0.0105 -0.0078 338 SEP A CB  
2693 O OG  . SEP A 339 ? 0.3139 0.2387 0.3243 0.0207  -0.0110 -0.0113 338 SEP A OG  
2694 C C   . SEP A 339 ? 0.3221 0.2357 0.3170 0.0067  -0.0078 -0.0068 338 SEP A C   
2695 O O   . SEP A 339 ? 0.2755 0.1953 0.2700 0.0007  -0.0049 -0.0074 338 SEP A O   
2696 P P   . SEP A 339 ? 0.3587 0.2769 0.3705 0.0285  -0.0156 -0.0107 338 SEP A P   
2697 O O1P . SEP A 339 ? 0.3577 0.2869 0.3756 0.0319  -0.0178 -0.0092 338 SEP A O1P 
2698 O O2P . SEP A 339 ? 0.3622 0.2803 0.3801 0.0335  -0.0149 -0.0163 338 SEP A O2P 
2699 O O3P . SEP A 339 ? 0.4072 0.3078 0.4083 0.0277  -0.0183 -0.0066 338 SEP A O3P 
2700 N N   . ILE A 340 ? 0.3125 0.2137 0.3049 0.0096  -0.0088 -0.0085 339 ILE A N   
2701 C CA  . ILE A 340 ? 0.3317 0.2257 0.3205 0.0054  -0.0062 -0.0116 339 ILE A CA  
2702 C C   . ILE A 340 ? 0.3449 0.2500 0.3414 0.0066  -0.0039 -0.0170 339 ILE A C   
2703 O O   . ILE A 340 ? 0.3340 0.2365 0.3285 0.0027  -0.0014 -0.0202 339 ILE A O   
2704 C CB  . ILE A 340 ? 0.4004 0.2745 0.3819 0.0078  -0.0082 -0.0114 339 ILE A CB  
2705 C CG1 . ILE A 340 ? 0.4232 0.2955 0.4103 0.0174  -0.0112 -0.0136 339 ILE A CG1 
2706 C CG2 . ILE A 340 ? 0.4313 0.2926 0.4024 0.0049  -0.0100 -0.0060 339 ILE A CG2 
2707 C CD1 . ILE A 340 ? 0.6288 0.4954 0.6173 0.0193  -0.0098 -0.0191 339 ILE A CD1 
2708 N N   . ASN A 341 ? 0.2964 0.2135 0.3012 0.0117  -0.0045 -0.0180 340 ASN A N   
2709 C CA  . ASN A 341 ? 0.2731 0.2008 0.2848 0.0130  -0.0021 -0.0228 340 ASN A CA  
2710 C C   . ASN A 341 ? 0.2666 0.2095 0.2820 0.0103  -0.0006 -0.0218 340 ASN A C   
2711 O O   . ASN A 341 ? 0.2398 0.1876 0.2569 0.0115  -0.0023 -0.0184 340 ASN A O   
2712 C CB  . ASN A 341 ? 0.2811 0.2099 0.2994 0.0209  -0.0037 -0.0254 340 ASN A CB  
2713 C CG  . ASN A 341 ? 0.4351 0.3485 0.4500 0.0247  -0.0055 -0.0268 340 ASN A CG  
2714 O OD1 . ASN A 341 ? 0.4035 0.3102 0.4156 0.0228  -0.0035 -0.0302 340 ASN A OD1 
2715 N ND2 . ASN A 341 ? 0.3255 0.2319 0.3398 0.0299  -0.0096 -0.0241 340 ASN A ND2 
2716 N N   . GLU A 342 ? 0.2247 0.1747 0.2410 0.0068  0.0023  -0.0249 341 GLU A N   
2717 C CA  . GLU A 342 ? 0.2031 0.1663 0.2221 0.0046  0.0035  -0.0240 341 GLU A CA  
2718 C C   . GLU A 342 ? 0.2454 0.2173 0.2711 0.0093  0.0034  -0.0249 341 GLU A C   
2719 O O   . GLU A 342 ? 0.2437 0.2159 0.2730 0.0126  0.0044  -0.0288 341 GLU A O   
2720 C CB  . GLU A 342 ? 0.2178 0.1855 0.2351 -0.0001 0.0059  -0.0270 341 GLU A CB  
2721 C CG  . GLU A 342 ? 0.2763 0.2559 0.2949 -0.0023 0.0065  -0.0255 341 GLU A CG  
2722 C CD  . GLU A 342 ? 0.4365 0.4214 0.4534 -0.0060 0.0083  -0.0284 341 GLU A CD  
2723 O OE1 . GLU A 342 ? 0.3552 0.3383 0.3717 -0.0055 0.0098  -0.0325 341 GLU A OE1 
2724 O OE2 . GLU A 342 ? 0.3079 0.2990 0.3237 -0.0091 0.0080  -0.0267 341 GLU A OE2 
2725 N N   . LYS A 343 ? 0.2004 0.1792 0.2280 0.0094  0.0024  -0.0216 342 LYS A N   
2726 C CA  . LYS A 343 ? 0.1909 0.1786 0.2248 0.0129  0.0026  -0.0223 342 LYS A CA  
2727 C C   . LYS A 343 ? 0.2182 0.2157 0.2523 0.0097  0.0049  -0.0227 342 LYS A C   
2728 O O   . LYS A 343 ? 0.2021 0.2009 0.2325 0.0059  0.0049  -0.0204 342 LYS A O   
2729 C CB  . LYS A 343 ? 0.2067 0.1949 0.2422 0.0154  -0.0003 -0.0186 342 LYS A CB  
2730 C CG  . LYS A 343 ? 0.2122 0.1892 0.2451 0.0181  -0.0034 -0.0167 342 LYS A CG  
2731 C CD  . LYS A 343 ? 0.2661 0.2382 0.3023 0.0232  -0.0041 -0.0205 342 LYS A CD  
2732 C CE  . LYS A 343 ? 0.3447 0.3040 0.3771 0.0264  -0.0077 -0.0184 342 LYS A CE  
2733 N NZ  . LYS A 343 ? 0.3838 0.3450 0.4176 0.0292  -0.0112 -0.0150 342 LYS A NZ  
2734 N N   . CYS A 344 ? 0.1752 0.1795 0.2135 0.0114  0.0069  -0.0255 343 CYS A N   
2735 C CA  . CYS A 344 ? 0.1681 0.1808 0.2059 0.0088  0.0089  -0.0255 343 CYS A CA  
2736 C C   . CYS A 344 ? 0.2360 0.2484 0.2680 0.0045  0.0098  -0.0257 343 CYS A C   
2737 O O   . CYS A 344 ? 0.2011 0.2179 0.2309 0.0022  0.0096  -0.0234 343 CYS A O   
2738 C CB  . CYS A 344 ? 0.1677 0.1851 0.2071 0.0090  0.0075  -0.0218 343 CYS A CB  
2739 S SG  . CYS A 344 ? 0.2156 0.2335 0.2616 0.0140  0.0054  -0.0214 343 CYS A SG  
2740 N N   . GLY A 345 ? 0.2112 0.2185 0.2409 0.0035  0.0106  -0.0287 344 GLY A N   
2741 C CA  . GLY A 345 ? 0.2172 0.2244 0.2418 -0.0006 0.0111  -0.0294 344 GLY A CA  
2742 C C   . GLY A 345 ? 0.2328 0.2472 0.2551 -0.0025 0.0125  -0.0299 344 GLY A C   
2743 O O   . GLY A 345 ? 0.2156 0.2329 0.2351 -0.0049 0.0114  -0.0278 344 GLY A O   
2744 N N   . LYS A 346 ? 0.1884 0.2058 0.2121 -0.0012 0.0150  -0.0327 345 LYS A N   
2745 C CA  . LYS A 346 ? 0.1892 0.2121 0.2092 -0.0031 0.0166  -0.0331 345 LYS A CA  
2746 C C   . LYS A 346 ? 0.1848 0.2121 0.2051 -0.0031 0.0155  -0.0290 345 LYS A C   
2747 O O   . LYS A 346 ? 0.1738 0.2033 0.1892 -0.0051 0.0149  -0.0275 345 LYS A O   
2748 C CB  . LYS A 346 ? 0.2469 0.2716 0.2680 -0.0022 0.0201  -0.0373 345 LYS A CB  
2749 C CG  . LYS A 346 ? 0.4229 0.4437 0.4419 -0.0029 0.0216  -0.0420 345 LYS A CG  
2750 N N   . GLU A 347 ? 0.1420 0.1704 0.1676 -0.0006 0.0152  -0.0274 346 GLU A N   
2751 C CA  . GLU A 347 ? 0.1446 0.1767 0.1705 -0.0006 0.0145  -0.0240 346 GLU A CA  
2752 C C   . GLU A 347 ? 0.1683 0.2001 0.1909 -0.0021 0.0119  -0.0205 346 GLU A C   
2753 O O   . GLU A 347 ? 0.1612 0.1956 0.1809 -0.0029 0.0117  -0.0186 346 GLU A O   
2754 C CB  . GLU A 347 ? 0.1663 0.1992 0.1986 0.0022  0.0138  -0.0230 346 GLU A CB  
2755 C CG  . GLU A 347 ? 0.2412 0.2769 0.2785 0.0039  0.0164  -0.0265 346 GLU A CG  
2756 C CD  . GLU A 347 ? 0.3301 0.3625 0.3711 0.0066  0.0164  -0.0300 346 GLU A CD  
2757 O OE1 . GLU A 347 ? 0.2119 0.2388 0.2498 0.0060  0.0154  -0.0303 346 GLU A OE1 
2758 O OE2 . GLU A 347 ? 0.3311 0.3665 0.3783 0.0091  0.0176  -0.0327 346 GLU A OE2 
2759 N N   . PHE A 348 ? 0.1330 0.1615 0.1559 -0.0024 0.0101  -0.0200 347 PHE A N   
2760 C CA  . PHE A 348 ? 0.1225 0.1517 0.1436 -0.0038 0.0079  -0.0173 347 PHE A CA  
2761 C C   . PHE A 348 ? 0.1572 0.1860 0.1749 -0.0064 0.0073  -0.0189 347 PHE A C   
2762 O O   . PHE A 348 ? 0.1357 0.1652 0.1532 -0.0077 0.0057  -0.0175 347 PHE A O   
2763 C CB  . PHE A 348 ? 0.1298 0.1565 0.1539 -0.0027 0.0064  -0.0149 347 PHE A CB  
2764 C CG  . PHE A 348 ? 0.1363 0.1645 0.1639 -0.0002 0.0064  -0.0134 347 PHE A CG  
2765 C CD1 . PHE A 348 ? 0.1430 0.1751 0.1702 -0.0002 0.0061  -0.0112 347 PHE A CD1 
2766 C CD2 . PHE A 348 ? 0.1500 0.1758 0.1813 0.0022  0.0066  -0.0146 347 PHE A CD2 
2767 C CE1 . PHE A 348 ? 0.1389 0.1725 0.1693 0.0015  0.0062  -0.0103 347 PHE A CE1 
2768 C CE2 . PHE A 348 ? 0.1752 0.2036 0.2104 0.0044  0.0064  -0.0138 347 PHE A CE2 
2769 C CZ  . PHE A 348 ? 0.1407 0.1731 0.1754 0.0037  0.0063  -0.0117 347 PHE A CZ  
2770 N N   . SER A 349 ? 0.1473 0.1756 0.1624 -0.0073 0.0087  -0.0221 348 SER A N   
2771 C CA  . SER A 349 ? 0.1594 0.1877 0.1711 -0.0101 0.0079  -0.0241 348 SER A CA  
2772 C C   . SER A 349 ? 0.1918 0.2251 0.2016 -0.0113 0.0056  -0.0223 348 SER A C   
2773 O O   . SER A 349 ? 0.1873 0.2214 0.1972 -0.0135 0.0043  -0.0231 348 SER A O   
2774 C CB  . SER A 349 ? 0.2184 0.2462 0.2264 -0.0109 0.0097  -0.0277 348 SER A CB  
2775 O OG  . SER A 349 ? 0.3249 0.3562 0.3298 -0.0104 0.0102  -0.0267 348 SER A OG  
2776 N N   . GLU A 350 ? 0.1487 0.1851 0.1571 -0.0098 0.0050  -0.0201 349 GLU A N   
2777 C CA  . GLU A 350 ? 0.1415 0.1823 0.1482 -0.0100 0.0024  -0.0186 349 GLU A CA  
2778 C C   . GLU A 350 ? 0.1497 0.1924 0.1605 -0.0094 0.0011  -0.0161 349 GLU A C   
2779 O O   . GLU A 350 ? 0.1477 0.1948 0.1584 -0.0094 -0.0010 -0.0155 349 GLU A O   
2780 C CB  . GLU A 350 ? 0.1622 0.2041 0.1643 -0.0087 0.0022  -0.0172 349 GLU A CB  
2781 C CG  . GLU A 350 ? 0.2361 0.2774 0.2398 -0.0067 0.0027  -0.0141 349 GLU A CG  
2782 C CD  . GLU A 350 ? 0.4006 0.4419 0.3987 -0.0058 0.0021  -0.0124 349 GLU A CD  
2783 O OE1 . GLU A 350 ? 0.2207 0.2603 0.2134 -0.0067 0.0034  -0.0137 349 GLU A OE1 
2784 O OE2 . GLU A 350 ? 0.1705 0.2128 0.1688 -0.0043 0.0003  -0.0099 349 GLU A OE2 
2785 N N   . PHE A 351 ? 0.1124 0.1521 0.1267 -0.0088 0.0023  -0.0150 350 PHE A N   
2786 C CA  . PHE A 351 ? 0.1170 0.1579 0.1342 -0.0086 0.0014  -0.0127 350 PHE A CA  
2787 C C   . PHE A 351 ? 0.1489 0.1913 0.1670 -0.0114 0.0007  -0.0141 350 PHE A C   
2788 O O   . PHE A 351 ? 0.1902 0.2286 0.2080 -0.0134 0.0017  -0.0160 350 PHE A O   
2789 C CB  . PHE A 351 ? 0.1278 0.1647 0.1474 -0.0072 0.0024  -0.0110 350 PHE A CB  
2790 C CG  . PHE A 351 ? 0.1459 0.1838 0.1674 -0.0069 0.0016  -0.0085 350 PHE A CG  
2791 C CD1 . PHE A 351 ? 0.1703 0.2076 0.1924 -0.0091 0.0014  -0.0085 350 PHE A CD1 
2792 C CD2 . PHE A 351 ? 0.1583 0.1973 0.1803 -0.0047 0.0013  -0.0064 350 PHE A CD2 
2793 C CE1 . PHE A 351 ? 0.1646 0.2029 0.1877 -0.0091 0.0010  -0.0065 350 PHE A CE1 
2794 C CE2 . PHE A 351 ? 0.1811 0.2210 0.2044 -0.0045 0.0007  -0.0044 350 PHE A CE2 
2795 C CZ  . PHE A 351 ? 0.1565 0.1963 0.1803 -0.0066 0.0006  -0.0045 350 PHE A CZ  
2796 O OXT . PHE A 351 ? 0.1742 0.2216 0.1935 -0.0117 -0.0006 -0.0135 350 PHE A OXT 
2797 N N   . THR B 1   ? 0.1682 0.1901 0.0857 -0.0532 -0.0013 0.0062  5   THR I N   
2798 C CA  . THR B 1   ? 0.1878 0.1901 0.0918 -0.0506 -0.0033 0.0086  5   THR I CA  
2799 C C   . THR B 1   ? 0.2191 0.2245 0.1300 -0.0501 -0.0014 0.0063  5   THR I C   
2800 O O   . THR B 1   ? 0.1843 0.2082 0.1141 -0.0479 0.0002  0.0047  5   THR I O   
2801 C CB  . THR B 1   ? 0.2456 0.2467 0.1565 -0.0406 -0.0077 0.0117  5   THR I CB  
2802 O OG1 . THR B 1   ? 0.2188 0.2326 0.1480 -0.0361 -0.0060 0.0128  5   THR I OG1 
2803 C CG2 . THR B 1   ? 0.2357 0.2340 0.1402 -0.0405 -0.0089 0.0137  5   THR I CG2 
2804 N N   . THR B 2   ? 0.1996 0.1835 0.0924 -0.0497 -0.0039 0.0056  6   THR I N   
2805 C CA  . THR B 2   ? 0.1917 0.1753 0.0885 -0.0486 -0.0028 0.0037  6   THR I CA  
2806 C C   . THR B 2   ? 0.2098 0.2109 0.1330 -0.0388 -0.0051 0.0055  6   THR I C   
2807 O O   . THR B 2   ? 0.2016 0.2137 0.1370 -0.0385 -0.0023 0.0046  6   THR I O   
2808 C CB  . THR B 2   ? 0.3204 0.2702 0.1860 -0.0479 -0.0081 0.0019  6   THR I CB  
2809 O OG1 . THR B 2   ? 0.3122 0.2366 0.1435 -0.0593 -0.0047 0.0007  6   THR I OG1 
2810 C CG2 . THR B 2   ? 0.2828 0.2276 0.1460 -0.0494 -0.0057 -0.0003 6   THR I CG2 
2811 N N   . TYR B 3   ? 0.1788 0.1812 0.1088 -0.0324 -0.0088 0.0064  7   TYR I N   
2812 C CA  . TYR B 3   ? 0.1699 0.1837 0.1188 -0.0280 -0.0073 0.0063  7   TYR I CA  
2813 C C   . TYR B 3   ? 0.1817 0.2047 0.1372 -0.0291 -0.0036 0.0099  7   TYR I C   
2814 O O   . TYR B 3   ? 0.1674 0.1927 0.1295 -0.0270 -0.0026 0.0098  7   TYR I O   
2815 C CB  . TYR B 3   ? 0.1716 0.1866 0.1253 -0.0253 -0.0080 0.0032  7   TYR I CB  
2816 C CG  . TYR B 3   ? 0.1804 0.2027 0.1468 -0.0269 -0.0013 0.0021  7   TYR I CG  
2817 C CD1 . TYR B 3   ? 0.2086 0.2352 0.1872 -0.0266 0.0006  -0.0039 7   TYR I CD1 
2818 C CD2 . TYR B 3   ? 0.1868 0.2062 0.1473 -0.0302 0.0037  0.0066  7   TYR I CD2 
2819 C CE1 . TYR B 3   ? 0.2091 0.2361 0.1925 -0.0323 0.0098  -0.0060 7   TYR I CE1 
2820 C CE2 . TYR B 3   ? 0.2031 0.2170 0.1627 -0.0344 0.0115  0.0057  7   TYR I CE2 
2821 C CZ  . TYR B 3   ? 0.2759 0.2929 0.2459 -0.0369 0.0158  -0.0005 7   TYR I CZ  
2822 O OH  . TYR B 3   ? 0.2655 0.2709 0.2277 -0.0450 0.0261  -0.0023 7   TYR I OH  
2823 N N   . ALA B 4   ? 0.1274 0.1530 0.0787 -0.0307 -0.0036 0.0116  8   ALA I N   
2824 C CA  . ALA B 4   ? 0.1323 0.1634 0.0866 -0.0276 -0.0051 0.0118  8   ALA I CA  
2825 C C   . ALA B 4   ? 0.1572 0.1992 0.1201 -0.0266 -0.0059 0.0068  8   ALA I C   
2826 O O   . ALA B 4   ? 0.1325 0.1750 0.0985 -0.0198 -0.0094 0.0056  8   ALA I O   
2827 C CB  . ALA B 4   ? 0.1399 0.1740 0.0896 -0.0289 -0.0073 0.0114  8   ALA I CB  
2828 N N   . ASP B 5   ? 0.1317 0.1786 0.0941 -0.0338 -0.0024 0.0026  9   ASP I N   
2829 C CA  . ASP B 5   ? 0.1170 0.1758 0.0879 -0.0357 0.0000  -0.0049 9   ASP I CA  
2830 C C   . ASP B 5   ? 0.1563 0.2089 0.1296 -0.0306 -0.0007 -0.0024 9   ASP I C   
2831 O O   . ASP B 5   ? 0.1375 0.1996 0.1205 -0.0255 -0.0023 -0.0071 9   ASP I O   
2832 C CB  . ASP B 5   ? 0.1438 0.2009 0.1045 -0.0495 0.0078  -0.0108 9   ASP I CB  
2833 C CG  . ASP B 5   ? 0.1956 0.2619 0.1560 -0.0570 0.0100  -0.0163 9   ASP I CG  
2834 O OD1 . ASP B 5   ? 0.1734 0.2572 0.1496 -0.0498 0.0044  -0.0202 9   ASP I OD1 
2835 O OD2 . ASP B 5   ? 0.2090 0.2623 0.1503 -0.0704 0.0170  -0.0184 9   ASP I OD2 
2836 N N   . PHE B 6   ? 0.1185 0.1561 0.0838 -0.0307 -0.0008 0.0028  10  PHE I N   
2837 C CA  . PHE B 6   ? 0.1238 0.1569 0.0930 -0.0266 -0.0017 0.0037  10  PHE I CA  
2838 C C   . PHE B 6   ? 0.1663 0.1990 0.1404 -0.0204 -0.0035 0.0060  10  PHE I C   
2839 O O   . PHE B 6   ? 0.1342 0.1667 0.1110 -0.0164 -0.0046 0.0047  10  PHE I O   
2840 C CB  . PHE B 6   ? 0.1491 0.1700 0.1128 -0.0263 -0.0038 0.0043  10  PHE I CB  
2841 C CG  . PHE B 6   ? 0.1443 0.1628 0.1145 -0.0228 -0.0049 0.0029  10  PHE I CG  
2842 C CD1 . PHE B 6   ? 0.1708 0.1867 0.1384 -0.0229 -0.0045 0.0014  10  PHE I CD1 
2843 C CD2 . PHE B 6   ? 0.1629 0.1823 0.1420 -0.0213 -0.0048 0.0011  10  PHE I CD2 
2844 C CE1 . PHE B 6   ? 0.1738 0.1864 0.1466 -0.0197 -0.0062 0.0001  10  PHE I CE1 
2845 C CE2 . PHE B 6   ? 0.1830 0.2014 0.1692 -0.0200 -0.0050 -0.0023 10  PHE I CE2 
2846 C CZ  . PHE B 6   ? 0.1502 0.1645 0.1329 -0.0182 -0.0068 -0.0018 10  PHE I CZ  
2847 N N   . ILE B 7   ? 0.1256 0.1526 0.0951 -0.0203 -0.0034 0.0091  11  ILE I N   
2848 C CA  . ILE B 7   ? 0.1485 0.1620 0.1092 -0.0175 -0.0034 0.0114  11  ILE I CA  
2849 C C   . ILE B 7   ? 0.2041 0.2154 0.1593 -0.0086 -0.0108 0.0096  11  ILE I C   
2850 O O   . ILE B 7   ? 0.2255 0.2196 0.1684 -0.0041 -0.0132 0.0103  11  ILE I O   
2851 C CB  . ILE B 7   ? 0.2080 0.2123 0.1604 -0.0220 0.0006  0.0136  11  ILE I CB  
2852 C CG1 . ILE B 7   ? 0.2103 0.2199 0.1730 -0.0278 0.0061  0.0098  11  ILE I CG1 
2853 C CG2 . ILE B 7   ? 0.2729 0.2519 0.2031 -0.0217 0.0019  0.0160  11  ILE I CG2 
2854 C CD1 . ILE B 7   ? 0.2514 0.2578 0.2201 -0.0314 0.0112  0.0052  11  ILE I CD1 
2855 N N   . ALA B 8   ? 0.1583 0.1866 0.1221 -0.0060 -0.0150 0.0045  12  ALA I N   
2856 C CA  . ALA B 8   ? 0.1406 0.1747 0.1063 0.0053  -0.0249 -0.0033 12  ALA I CA  
2857 C C   . ALA B 8   ? 0.1875 0.2363 0.1673 0.0085  -0.0255 -0.0110 12  ALA I C   
2858 O O   . ALA B 8   ? 0.1779 0.2328 0.1617 0.0208  -0.0355 -0.0208 12  ALA I O   
2859 C CB  . ALA B 8   ? 0.1417 0.1951 0.1175 0.0050  -0.0281 -0.0106 12  ALA I CB  
2860 N N   . SER B 9   ? 0.1483 0.2012 0.1340 -0.0007 -0.0166 -0.0086 13  SER I N   
2861 C CA  . SER B 9   ? 0.1404 0.2045 0.1364 0.0000  -0.0147 -0.0154 13  SER I CA  
2862 C C   . SER B 9   ? 0.1980 0.2450 0.1854 0.0086  -0.0195 -0.0124 13  SER I C   
2863 O O   . SER B 9   ? 0.1988 0.2226 0.1701 0.0088  -0.0201 -0.0039 13  SER I O   
2864 C CB  . SER B 9   ? 0.1301 0.1941 0.1254 -0.0124 -0.0051 -0.0133 13  SER I CB  
2865 O OG  . SER B 9   ? 0.1687 0.2146 0.1556 -0.0130 -0.0045 -0.0048 13  SER I OG  
2866 N N   . GLY B 10  ? 0.1654 0.2229 0.1619 0.0136  -0.0210 -0.0206 14  GLY I N   
2867 C CA  . GLY B 10  ? 0.1798 0.2194 0.1660 0.0218  -0.0259 -0.0184 14  GLY I CA  
2868 C C   . GLY B 10  ? 0.2141 0.2431 0.1969 0.0131  -0.0181 -0.0110 14  GLY I C   
2869 O O   . GLY B 10  ? 0.2087 0.2250 0.1847 0.0179  -0.0206 -0.0103 14  GLY I O   
2870 N N   . ARG B 11  ? 0.1465 0.1785 0.1323 0.0018  -0.0106 -0.0068 15  ARG I N   
2871 C CA  . ARG B 11  ? 0.1504 0.1731 0.1341 -0.0034 -0.0070 -0.0034 15  ARG I CA  
2872 C C   . ARG B 11  ? 0.1878 0.2011 0.1685 -0.0087 -0.0052 0.0014  15  ARG I C   
2873 O O   . ARG B 11  ? 0.1674 0.1795 0.1496 -0.0124 -0.0046 0.0004  15  ARG I O   
2874 C CB  . ARG B 11  ? 0.1598 0.1895 0.1452 -0.0090 -0.0026 -0.0081 15  ARG I CB  
2875 C CG  . ARG B 11  ? 0.1539 0.1965 0.1465 -0.0052 -0.0016 -0.0171 15  ARG I CG  
2876 C CD  . ARG B 11  ? 0.1792 0.2231 0.1675 -0.0146 0.0067  -0.0231 15  ARG I CD  
2877 N NE  . ARG B 11  ? 0.1673 0.1900 0.1427 -0.0158 0.0059  -0.0178 15  ARG I NE  
2878 C CZ  . ARG B 11  ? 0.2448 0.2631 0.2204 -0.0112 0.0047  -0.0190 15  ARG I CZ  
2879 N NH1 . ARG B 11  ? 0.1723 0.2051 0.1595 -0.0040 0.0036  -0.0257 15  ARG I NH1 
2880 N NH2 . ARG B 11  ? 0.1864 0.1850 0.1502 -0.0119 0.0025  -0.0153 15  ARG I NH2 
2881 N N   . THR B 12  ? 0.1460 0.1502 0.1202 -0.0086 -0.0050 0.0042  16  THR I N   
2882 C CA  . THR B 12  ? 0.1432 0.1429 0.1183 -0.0157 -0.0005 0.0045  16  THR I CA  
2883 C C   . THR B 12  ? 0.1706 0.1583 0.1428 -0.0202 0.0035  0.0024  16  THR I C   
2884 O O   . THR B 12  ? 0.1667 0.1569 0.1462 -0.0278 0.0088  -0.0027 16  THR I O   
2885 C CB  . THR B 12  ? 0.1964 0.1916 0.1633 -0.0176 0.0012  0.0069  16  THR I CB  
2886 O OG1 . THR B 12  ? 0.2286 0.2026 0.1754 -0.0149 0.0002  0.0094  16  THR I OG1 
2887 C CG2 . THR B 12  ? 0.2013 0.2097 0.1723 -0.0147 -0.0023 0.0075  16  THR I CG2 
2888 N N   . GLY B 13  ? 0.1495 0.1247 0.1112 -0.0160 0.0013  0.0040  17  GLY I N   
2889 C CA  . GLY B 13  ? 0.1575 0.1172 0.1119 -0.0217 0.0056  0.0019  17  GLY I CA  
2890 C C   . GLY B 13  ? 0.1716 0.1429 0.1423 -0.0209 0.0036  -0.0023 17  GLY I C   
2891 O O   . GLY B 13  ? 0.1436 0.1293 0.1255 -0.0165 -0.0010 -0.0031 17  GLY I O   
2892 N N   . ARG B 14  ? 0.1507 0.1105 0.1175 -0.0260 0.0069  -0.0056 18  ARG I N   
2893 C CA  . ARG B 14  ? 0.1383 0.1066 0.1189 -0.0242 0.0032  -0.0106 18  ARG I CA  
2894 C C   . ARG B 14  ? 0.1756 0.1450 0.1526 -0.0135 -0.0039 -0.0059 18  ARG I C   
2895 O O   . ARG B 14  ? 0.1832 0.1435 0.1475 -0.0079 -0.0055 -0.0018 18  ARG I O   
2896 C CB  . ARG B 14  ? 0.1390 0.0941 0.1149 -0.0321 0.0082  -0.0155 18  ARG I CB  
2897 C CG  . ARG B 14  ? 0.1713 0.1284 0.1537 -0.0478 0.0194  -0.0257 18  ARG I CG  
2898 C CD  . ARG B 14  ? 0.2101 0.1541 0.1870 -0.0583 0.0260  -0.0326 18  ARG I CD  
2899 N NE  . ARG B 14  ? 0.2989 0.2640 0.3033 -0.0558 0.0199  -0.0441 18  ARG I NE  
2900 C CZ  . ARG B 14  ? 0.4214 0.3811 0.4233 -0.0469 0.0112  -0.0409 18  ARG I CZ  
2901 N NH1 . ARG B 14  ? 0.3057 0.2443 0.2832 -0.0394 0.0082  -0.0277 18  ARG I NH1 
2902 N NH2 . ARG B 14  ? 0.2955 0.2707 0.3193 -0.0441 0.0042  -0.0529 18  ARG I NH2 
2903 N N   . ARG B 15  ? 0.1370 0.1149 0.1223 -0.0106 -0.0083 -0.0087 19  ARG I N   
2904 C CA  . ARG B 15  ? 0.1488 0.1259 0.1278 -0.0050 -0.0110 -0.0068 19  ARG I CA  
2905 C C   . ARG B 15  ? 0.2064 0.1742 0.1818 -0.0024 -0.0135 -0.0086 19  ARG I C   
2906 O O   . ARG B 15  ? 0.1940 0.1580 0.1736 -0.0035 -0.0171 -0.0133 19  ARG I O   
2907 C CB  . ARG B 15  ? 0.1442 0.1242 0.1211 -0.0055 -0.0131 -0.0082 19  ARG I CB  
2908 C CG  . ARG B 15  ? 0.1696 0.1589 0.1488 -0.0078 -0.0103 -0.0059 19  ARG I CG  
2909 C CD  . ARG B 15  ? 0.1739 0.1601 0.1481 -0.0090 -0.0136 -0.0081 19  ARG I CD  
2910 N NE  . ARG B 15  ? 0.1486 0.1343 0.1314 -0.0070 -0.0197 -0.0144 19  ARG I NE  
2911 C CZ  . ARG B 15  ? 0.1984 0.1832 0.1807 -0.0048 -0.0256 -0.0192 19  ARG I CZ  
2912 N NH1 . ARG B 15  ? 0.1448 0.1244 0.1138 -0.0061 -0.0250 -0.0156 19  ARG I NH1 
2913 N NH2 . ARG B 15  ? 0.1704 0.1605 0.1666 -0.0010 -0.0325 -0.0302 19  ARG I NH2 
2914 N N   . ASN B 16  ? 0.1830 0.1486 0.1519 0.0021  -0.0127 -0.0072 20  ASN I N   
2915 C CA  . ASN B 16  ? 0.2090 0.1649 0.1725 0.0050  -0.0146 -0.0088 20  ASN I CA  
2916 C C   . ASN B 16  ? 0.2222 0.1735 0.1786 0.0042  -0.0151 -0.0114 20  ASN I C   
2917 O O   . ASN B 16  ? 0.2097 0.1651 0.1614 0.0013  -0.0115 -0.0125 20  ASN I O   
2918 C CB  . ASN B 16  ? 0.2455 0.2010 0.2044 0.0120  -0.0146 -0.0091 20  ASN I CB  
2919 C CG  . ASN B 16  ? 0.4964 0.4404 0.4472 0.0143  -0.0166 -0.0063 20  ASN I CG  
2920 O OD1 . ASN B 16  ? 0.3859 0.3192 0.3334 0.0070  -0.0145 -0.0046 20  ASN I OD1 
2921 N ND2 . ASN B 16  ? 0.4665 0.4093 0.4109 0.0242  -0.0207 -0.0083 20  ASN I ND2 
2922 N N   . ALA B 17  ? 0.2099 0.1479 0.1604 0.0058  -0.0191 -0.0132 21  ALA I N   
2923 C CA  . ALA B 17  ? 0.2224 0.1451 0.1556 0.0054  -0.0200 -0.0156 21  ALA I CA  
2924 C C   . ALA B 17  ? 0.2698 0.1969 0.1977 0.0044  -0.0113 -0.0174 21  ALA I C   
2925 O O   . ALA B 17  ? 0.2430 0.1831 0.1821 0.0088  -0.0096 -0.0179 21  ALA I O   
2926 C CB  . ALA B 17  ? 0.2437 0.1502 0.1716 0.0090  -0.0280 -0.0182 21  ALA I CB  
2927 N N   . ILE B 18  ? 0.2676 0.1818 0.1760 -0.0016 -0.0059 -0.0208 22  ILE I N   
2928 C CA  . ILE B 18  ? 0.3207 0.2405 0.2248 -0.0058 0.0053  -0.0275 22  ILE I CA  
2929 C C   . ILE B 18  ? 0.4733 0.3708 0.3608 -0.0036 0.0034  -0.0284 22  ILE I C   
2930 O O   . ILE B 18  ? 0.4981 0.3678 0.3659 -0.0027 -0.0049 -0.0254 22  ILE I O   
2931 C CB  . ILE B 18  ? 0.3730 0.2899 0.2616 -0.0190 0.0178  -0.0335 22  ILE I CB  
2932 C CG1 . ILE B 18  ? 0.4166 0.2910 0.2656 -0.0250 0.0146  -0.0305 22  ILE I CG1 
2933 C CG2 . ILE B 18  ? 0.3846 0.3292 0.2945 -0.0201 0.0199  -0.0344 22  ILE I CG2 
2934 C CD1 . ILE B 18  ? 0.4866 0.3353 0.2996 -0.0405 0.0292  -0.0376 22  ILE I CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   0   ?   ?   ?   A . n 
A 1 2   GLY 2   1   ?   ?   ?   A . n 
A 1 3   ASN 3   2   ?   ?   ?   A . n 
A 1 4   ALA 4   3   ?   ?   ?   A . n 
A 1 5   ALA 5   4   ?   ?   ?   A . n 
A 1 6   ALA 6   5   ?   ?   ?   A . n 
A 1 7   ALA 7   6   ?   ?   ?   A . n 
A 1 8   LYS 8   7   ?   ?   ?   A . n 
A 1 9   LYS 9   8   ?   ?   ?   A . n 
A 1 10  GLY 10  9   ?   ?   ?   A . n 
A 1 11  SER 11  10  ?   ?   ?   A . n 
A 1 12  GLU 12  11  ?   ?   ?   A . n 
A 1 13  GLN 13  12  ?   ?   ?   A . n 
A 1 14  GLU 14  13  13  GLU GLU A . n 
A 1 15  SER 15  14  14  SER SER A . n 
A 1 16  VAL 16  15  15  VAL VAL A . n 
A 1 17  LYS 17  16  16  LYS LYS A . n 
A 1 18  GLU 18  17  17  GLU GLU A . n 
A 1 19  PHE 19  18  18  PHE PHE A . n 
A 1 20  LEU 20  19  19  LEU LEU A . n 
A 1 21  ALA 21  20  20  ALA ALA A . n 
A 1 22  LYS 22  21  21  LYS LYS A . n 
A 1 23  ALA 23  22  22  ALA ALA A . n 
A 1 24  LYS 24  23  23  LYS LYS A . n 
A 1 25  GLU 25  24  24  GLU GLU A . n 
A 1 26  ASP 26  25  25  ASP ASP A . n 
A 1 27  PHE 27  26  26  PHE PHE A . n 
A 1 28  LEU 28  27  27  LEU LEU A . n 
A 1 29  LYS 29  28  28  LYS LYS A . n 
A 1 30  LYS 30  29  29  LYS LYS A . n 
A 1 31  TRP 31  30  30  TRP TRP A . n 
A 1 32  GLU 32  31  31  GLU GLU A . n 
A 1 33  ASN 33  32  32  ASN ASN A . n 
A 1 34  PRO 34  33  33  PRO PRO A . n 
A 1 35  ALA 35  34  34  ALA ALA A . n 
A 1 36  GLN 36  35  35  GLN GLN A . n 
A 1 37  ASN 37  36  36  ASN ASN A . n 
A 1 38  THR 38  37  37  THR THR A . n 
A 1 39  ALA 39  38  38  ALA ALA A . n 
A 1 40  HIS 40  39  39  HIS HIS A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  ASP 42  41  41  ASP ASP A . n 
A 1 43  GLN 43  42  42  GLN GLN A . n 
A 1 44  PHE 44  43  43  PHE PHE A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  ARG 46  45  45  ARG ARG A . n 
A 1 47  ILE 47  46  46  ILE ILE A . n 
A 1 48  LYS 48  47  47  LYS LYS A . n 
A 1 49  THR 49  48  48  THR THR A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  GLY 51  50  50  GLY GLY A . n 
A 1 52  THR 52  51  51  THR THR A . n 
A 1 53  GLY 53  52  52  GLY GLY A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  TYR 55  54  54  TYR TYR A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  VAL 58  57  57  VAL VAL A . n 
A 1 59  MET 59  58  58  MET MET A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  VAL 61  60  60  VAL VAL A . n 
A 1 62  LYS 62  61  61  LYS LYS A . n 
A 1 63  HIS 63  62  62  HIS HIS A . n 
A 1 64  MET 64  63  63  MET MET A . n 
A 1 65  GLU 65  64  64  GLU GLU A . n 
A 1 66  THR 66  65  65  THR THR A . n 
A 1 67  GLY 67  66  66  GLY GLY A . n 
A 1 68  ASN 68  67  67  ASN ASN A . n 
A 1 69  HIS 69  68  68  HIS HIS A . n 
A 1 70  TYR 70  69  69  TYR TYR A . n 
A 1 71  ALA 71  70  70  ALA ALA A . n 
A 1 72  MET 72  71  71  MET MET A . n 
A 1 73  LYS 73  72  72  LYS LYS A . n 
A 1 74  ILE 74  73  73  ILE ILE A . n 
A 1 75  LEU 75  74  74  LEU LEU A . n 
A 1 76  ASP 76  75  75  ASP ASP A . n 
A 1 77  LYS 77  76  76  LYS LYS A . n 
A 1 78  GLN 78  77  77  GLN GLN A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  VAL 80  79  79  VAL VAL A . n 
A 1 81  VAL 81  80  80  VAL VAL A . n 
A 1 82  LYS 82  81  81  LYS LYS A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  LYS 84  83  83  LYS LYS A . n 
A 1 85  GLN 85  84  84  GLN GLN A . n 
A 1 86  ILE 86  85  85  ILE ILE A . n 
A 1 87  GLU 87  86  86  GLU GLU A . n 
A 1 88  HIS 88  87  87  HIS HIS A . n 
A 1 89  THR 89  88  88  THR THR A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  ASN 91  90  90  ASN ASN A . n 
A 1 92  GLU 92  91  91  GLU GLU A . n 
A 1 93  LYS 93  92  92  LYS LYS A . n 
A 1 94  ARG 94  93  93  ARG ARG A . n 
A 1 95  ILE 95  94  94  ILE ILE A . n 
A 1 96  LEU 96  95  95  LEU LEU A . n 
A 1 97  GLN 97  96  96  GLN GLN A . n 
A 1 98  ALA 98  97  97  ALA ALA A . n 
A 1 99  VAL 99  98  98  VAL VAL A . n 
A 1 100 ASN 100 99  99  ASN ASN A . n 
A 1 101 PHE 101 100 100 PHE PHE A . n 
A 1 102 PRO 102 101 101 PRO PRO A . n 
A 1 103 PHE 103 102 102 PHE PHE A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 VAL 105 104 104 VAL VAL A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 LEU 107 106 106 LEU LEU A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 PHE 109 108 108 PHE PHE A . n 
A 1 110 SER 110 109 109 SER SER A . n 
A 1 111 PHE 111 110 110 PHE PHE A . n 
A 1 112 LYS 112 111 111 LYS LYS A . n 
A 1 113 ASP 113 112 112 ASP ASP A . n 
A 1 114 ASN 114 113 113 ASN ASN A . n 
A 1 115 SER 115 114 114 SER SER A . n 
A 1 116 ASN 116 115 115 ASN ASN A . n 
A 1 117 LEU 117 116 116 LEU LEU A . n 
A 1 118 TYR 118 117 117 TYR TYR A . n 
A 1 119 MET 119 118 118 MET MET A . n 
A 1 120 VAL 120 119 119 VAL VAL A . n 
A 1 121 LEU 121 120 120 LEU LEU A . n 
A 1 122 GLU 122 121 121 GLU GLU A . n 
A 1 123 TYR 123 122 122 TYR TYR A . n 
A 1 124 LEU 124 123 123 LEU LEU A . n 
A 1 125 PRO 125 124 124 PRO PRO A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 GLY 127 126 126 GLY GLY A . n 
A 1 128 GLU 128 127 127 GLU GLU A . n 
A 1 129 MET 129 128 128 MET MET A . n 
A 1 130 PHE 130 129 129 PHE PHE A . n 
A 1 131 SER 131 130 130 SER SER A . n 
A 1 132 HIS 132 131 131 HIS HIS A . n 
A 1 133 LEU 133 132 132 LEU LEU A . n 
A 1 134 ARG 134 133 133 ARG ARG A . n 
A 1 135 ARG 135 134 134 ARG ARG A . n 
A 1 136 ILE 136 135 135 ILE ILE A . n 
A 1 137 GLY 137 136 136 GLY GLY A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 PHE 139 138 138 PHE PHE A . n 
A 1 140 SEP 140 139 139 SEP SEP A . n 
A 1 141 GLU 141 140 140 GLU GLU A . n 
A 1 142 PRO 142 141 141 PRO PRO A . n 
A 1 143 HIS 143 142 142 HIS HIS A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 ARG 145 144 144 ARG ARG A . n 
A 1 146 PHE 146 145 145 PHE PHE A . n 
A 1 147 TYR 147 146 146 TYR TYR A . n 
A 1 148 ALA 148 147 147 ALA ALA A . n 
A 1 149 ALA 149 148 148 ALA ALA A . n 
A 1 150 GLN 150 149 149 GLN GLN A . n 
A 1 151 ILE 151 150 150 ILE ILE A . n 
A 1 152 VAL 152 151 151 VAL VAL A . n 
A 1 153 LEU 153 152 152 LEU LEU A . n 
A 1 154 THR 154 153 153 THR THR A . n 
A 1 155 PHE 155 154 154 PHE PHE A . n 
A 1 156 GLU 156 155 155 GLU GLU A . n 
A 1 157 TYR 157 156 156 TYR TYR A . n 
A 1 158 LEU 158 157 157 LEU LEU A . n 
A 1 159 HIS 159 158 158 HIS HIS A . n 
A 1 160 SER 160 159 159 SER SER A . n 
A 1 161 LEU 161 160 160 LEU LEU A . n 
A 1 162 ASP 162 161 161 ASP ASP A . n 
A 1 163 LEU 163 162 162 LEU LEU A . n 
A 1 164 ILE 164 163 163 ILE ILE A . n 
A 1 165 TYR 165 164 164 TYR TYR A . n 
A 1 166 ARG 166 165 165 ARG ARG A . n 
A 1 167 ASP 167 166 166 ASP ASP A . n 
A 1 168 LEU 168 167 167 LEU LEU A . n 
A 1 169 LYS 169 168 168 LYS LYS A . n 
A 1 170 PRO 170 169 169 PRO PRO A . n 
A 1 171 GLU 171 170 170 GLU GLU A . n 
A 1 172 ASN 172 171 171 ASN ASN A . n 
A 1 173 LEU 173 172 172 LEU LEU A . n 
A 1 174 MET 174 173 173 MET MET A . n 
A 1 175 ILE 175 174 174 ILE ILE A . n 
A 1 176 ASP 176 175 175 ASP ASP A . n 
A 1 177 GLN 177 176 176 GLN GLN A . n 
A 1 178 GLN 178 177 177 GLN GLN A . n 
A 1 179 GLY 179 178 178 GLY GLY A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 ILE 181 180 180 ILE ILE A . n 
A 1 182 LYS 182 181 181 LYS LYS A . n 
A 1 183 VAL 183 182 182 VAL VAL A . n 
A 1 184 THR 184 183 183 THR THR A . n 
A 1 185 ASP 185 184 184 ASP ASP A . n 
A 1 186 PHE 186 185 185 PHE PHE A . n 
A 1 187 GLY 187 186 186 GLY GLY A . n 
A 1 188 PHE 188 187 187 PHE PHE A . n 
A 1 189 ALA 189 188 188 ALA ALA A . n 
A 1 190 LYS 190 189 189 LYS LYS A . n 
A 1 191 ARG 191 190 190 ARG ARG A . n 
A 1 192 VAL 192 191 191 VAL VAL A . n 
A 1 193 LYS 193 192 192 LYS LYS A . n 
A 1 194 GLY 194 193 193 GLY GLY A . n 
A 1 195 ARG 195 194 194 ARG ARG A . n 
A 1 196 THR 196 195 195 THR THR A . n 
A 1 197 TRP 197 196 196 TRP TRP A . n 
A 1 198 TPO 198 197 197 TPO TPO A . n 
A 1 199 LEU 199 198 198 LEU LEU A . n 
A 1 200 CYS 200 199 199 CYS CYS A . n 
A 1 201 GLY 201 200 200 GLY GLY A . n 
A 1 202 THR 202 201 201 THR THR A . n 
A 1 203 PRO 203 202 202 PRO PRO A . n 
A 1 204 GLU 204 203 203 GLU GLU A . n 
A 1 205 TYR 205 204 204 TYR TYR A . n 
A 1 206 LEU 206 205 205 LEU LEU A . n 
A 1 207 ALA 207 206 206 ALA ALA A . n 
A 1 208 PRO 208 207 207 PRO PRO A . n 
A 1 209 GLU 209 208 208 GLU GLU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 ILE 211 210 210 ILE ILE A . n 
A 1 212 LEU 212 211 211 LEU LEU A . n 
A 1 213 SER 213 212 212 SER SER A . n 
A 1 214 LYS 214 213 213 LYS LYS A . n 
A 1 215 GLY 215 214 214 GLY GLY A . n 
A 1 216 TYR 216 215 215 TYR TYR A . n 
A 1 217 ASN 217 216 216 ASN ASN A . n 
A 1 218 LYS 218 217 217 LYS LYS A . n 
A 1 219 ALA 219 218 218 ALA ALA A . n 
A 1 220 VAL 220 219 219 VAL VAL A . n 
A 1 221 ASP 221 220 220 ASP ASP A . n 
A 1 222 TRP 222 221 221 TRP TRP A . n 
A 1 223 TRP 223 222 222 TRP TRP A . n 
A 1 224 ALA 224 223 223 ALA ALA A . n 
A 1 225 LEU 225 224 224 LEU LEU A . n 
A 1 226 GLY 226 225 225 GLY GLY A . n 
A 1 227 VAL 227 226 226 VAL VAL A . n 
A 1 228 LEU 228 227 227 LEU LEU A . n 
A 1 229 ILE 229 228 228 ILE ILE A . n 
A 1 230 TYR 230 229 229 TYR TYR A . n 
A 1 231 GLU 231 230 230 GLU GLU A . n 
A 1 232 MET 232 231 231 MET MET A . n 
A 1 233 ALA 233 232 232 ALA ALA A . n 
A 1 234 ALA 234 233 233 ALA ALA A . n 
A 1 235 GLY 235 234 234 GLY GLY A . n 
A 1 236 TYR 236 235 235 TYR TYR A . n 
A 1 237 PRO 237 236 236 PRO PRO A . n 
A 1 238 PRO 238 237 237 PRO PRO A . n 
A 1 239 PHE 239 238 238 PHE PHE A . n 
A 1 240 PHE 240 239 239 PHE PHE A . n 
A 1 241 ALA 241 240 240 ALA ALA A . n 
A 1 242 ASP 242 241 241 ASP ASP A . n 
A 1 243 GLN 243 242 242 GLN GLN A . n 
A 1 244 PRO 244 243 243 PRO PRO A . n 
A 1 245 ILE 245 244 244 ILE ILE A . n 
A 1 246 GLN 246 245 245 GLN GLN A . n 
A 1 247 ILE 247 246 246 ILE ILE A . n 
A 1 248 TYR 248 247 247 TYR TYR A . n 
A 1 249 GLU 249 248 248 GLU GLU A . n 
A 1 250 LYS 250 249 249 LYS LYS A . n 
A 1 251 ILE 251 250 250 ILE ILE A . n 
A 1 252 VAL 252 251 251 VAL VAL A . n 
A 1 253 SER 253 252 252 SER SER A . n 
A 1 254 GLY 254 253 253 GLY GLY A . n 
A 1 255 LYS 255 254 254 LYS LYS A . n 
A 1 256 VAL 256 255 255 VAL VAL A . n 
A 1 257 ARG 257 256 256 ARG ARG A . n 
A 1 258 PHE 258 257 257 PHE PHE A . n 
A 1 259 PRO 259 258 258 PRO PRO A . n 
A 1 260 SER 260 259 259 SER SER A . n 
A 1 261 HIS 261 260 260 HIS HIS A . n 
A 1 262 PHE 262 261 261 PHE PHE A . n 
A 1 263 SER 263 262 262 SER SER A . n 
A 1 264 SER 264 263 263 SER SER A . n 
A 1 265 ASP 265 264 264 ASP ASP A . n 
A 1 266 LEU 266 265 265 LEU LEU A . n 
A 1 267 LYS 267 266 266 LYS LYS A . n 
A 1 268 ASP 268 267 267 ASP ASP A . n 
A 1 269 LEU 269 268 268 LEU LEU A . n 
A 1 270 LEU 270 269 269 LEU LEU A . n 
A 1 271 ARG 271 270 270 ARG ARG A . n 
A 1 272 ASN 272 271 271 ASN ASN A . n 
A 1 273 LEU 273 272 272 LEU LEU A . n 
A 1 274 LEU 274 273 273 LEU LEU A . n 
A 1 275 GLN 275 274 274 GLN GLN A . n 
A 1 276 VAL 276 275 275 VAL VAL A . n 
A 1 277 ASP 277 276 276 ASP ASP A . n 
A 1 278 LEU 278 277 277 LEU LEU A . n 
A 1 279 THR 279 278 278 THR THR A . n 
A 1 280 LYS 280 279 279 LYS LYS A . n 
A 1 281 ARG 281 280 280 ARG ARG A . n 
A 1 282 PHE 282 281 281 PHE PHE A . n 
A 1 283 GLY 283 282 282 GLY GLY A . n 
A 1 284 ASN 284 283 283 ASN ASN A . n 
A 1 285 LEU 285 284 284 LEU LEU A . n 
A 1 286 LYS 286 285 285 LYS LYS A . n 
A 1 287 ASN 287 286 286 ASN ASN A . n 
A 1 288 GLY 288 287 287 GLY GLY A . n 
A 1 289 VAL 289 288 288 VAL VAL A . n 
A 1 290 ASN 290 289 289 ASN ASN A . n 
A 1 291 ASP 291 290 290 ASP ASP A . n 
A 1 292 ILE 292 291 291 ILE ILE A . n 
A 1 293 LYS 293 292 292 LYS LYS A . n 
A 1 294 ASN 294 293 293 ASN ASN A . n 
A 1 295 HIS 295 294 294 HIS HIS A . n 
A 1 296 LYS 296 295 295 LYS LYS A . n 
A 1 297 TRP 297 296 296 TRP TRP A . n 
A 1 298 PHE 298 297 297 PHE PHE A . n 
A 1 299 ALA 299 298 298 ALA ALA A . n 
A 1 300 THR 300 299 299 THR THR A . n 
A 1 301 THR 301 300 300 THR THR A . n 
A 1 302 ASP 302 301 301 ASP ASP A . n 
A 1 303 TRP 303 302 302 TRP TRP A . n 
A 1 304 ILE 304 303 303 ILE ILE A . n 
A 1 305 ALA 305 304 304 ALA ALA A . n 
A 1 306 ILE 306 305 305 ILE ILE A . n 
A 1 307 TYR 307 306 306 TYR TYR A . n 
A 1 308 GLN 308 307 307 GLN GLN A . n 
A 1 309 ARG 309 308 308 ARG ARG A . n 
A 1 310 LYS 310 309 309 LYS LYS A . n 
A 1 311 VAL 311 310 310 VAL VAL A . n 
A 1 312 GLU 312 311 311 GLU GLU A . n 
A 1 313 ALA 313 312 312 ALA ALA A . n 
A 1 314 PRO 314 313 313 PRO PRO A . n 
A 1 315 PHE 315 314 314 PHE PHE A . n 
A 1 316 ILE 316 315 315 ILE ILE A . n 
A 1 317 PRO 317 316 316 PRO PRO A . n 
A 1 318 LYS 318 317 317 LYS LYS A . n 
A 1 319 PHE 319 318 318 PHE PHE A . n 
A 1 320 LYS 320 319 319 LYS LYS A . n 
A 1 321 GLY 321 320 320 GLY GLY A . n 
A 1 322 PRO 322 321 321 PRO PRO A . n 
A 1 323 GLY 323 322 322 GLY GLY A . n 
A 1 324 ASP 324 323 323 ASP ASP A . n 
A 1 325 THR 325 324 324 THR THR A . n 
A 1 326 SER 326 325 325 SER SER A . n 
A 1 327 ASN 327 326 326 ASN ASN A . n 
A 1 328 PHE 328 327 327 PHE PHE A . n 
A 1 329 ASP 329 328 328 ASP ASP A . n 
A 1 330 ASP 330 329 329 ASP ASP A . n 
A 1 331 TYR 331 330 330 TYR TYR A . n 
A 1 332 GLU 332 331 331 GLU GLU A . n 
A 1 333 GLU 333 332 332 GLU GLU A . n 
A 1 334 GLU 334 333 333 GLU GLU A . n 
A 1 335 GLU 335 334 334 GLU GLU A . n 
A 1 336 ILE 336 335 335 ILE ILE A . n 
A 1 337 ARG 337 336 336 ARG ARG A . n 
A 1 338 VAL 338 337 337 VAL VAL A . n 
A 1 339 SEP 339 338 338 SEP SEP A . n 
A 1 340 ILE 340 339 339 ILE ILE A . n 
A 1 341 ASN 341 340 340 ASN ASN A . n 
A 1 342 GLU 342 341 341 GLU GLU A . n 
A 1 343 LYS 343 342 342 LYS LYS A . n 
A 1 344 CYS 344 343 343 CYS CYS A . n 
A 1 345 GLY 345 344 344 GLY GLY A . n 
A 1 346 LYS 346 345 345 LYS LYS A . n 
A 1 347 GLU 347 346 346 GLU GLU A . n 
A 1 348 PHE 348 347 347 PHE PHE A . n 
A 1 349 SER 349 348 348 SER SER A . n 
A 1 350 GLU 350 349 349 GLU GLU A . n 
A 1 351 PHE 351 350 350 PHE PHE A . n 
B 2 1   THR 1   5   5   THR THR I . n 
B 2 2   THR 2   6   6   THR THR I . n 
B 2 3   TYR 3   7   7   TYR TYR I . n 
B 2 4   ALA 4   8   8   ALA ALA I . n 
B 2 5   ASP 5   9   9   ASP ASP I . n 
B 2 6   PHE 6   10  10  PHE PHE I . n 
B 2 7   ILE 7   11  11  ILE ILE I . n 
B 2 8   ALA 8   12  12  ALA ALA I . n 
B 2 9   SER 9   13  13  SER SER I . n 
B 2 10  GLY 10  14  14  GLY GLY I . n 
B 2 11  ARG 11  15  15  ARG ARG I . n 
B 2 12  THR 12  16  16  THR THR I . n 
B 2 13  GLY 13  17  17  GLY GLY I . n 
B 2 14  ARG 14  18  18  ARG ARG I . n 
B 2 15  ARG 15  19  19  ARG ARG I . n 
B 2 16  ASN 16  20  20  ASN ASN I . n 
B 2 17  ALA 17  21  21  ALA ALA I . n 
B 2 18  ILE 18  22  22  ILE ILE I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   2001 2001 HOH HOH A . 
C 3 HOH 2   2002 2002 HOH HOH A . 
C 3 HOH 3   2003 2003 HOH HOH A . 
C 3 HOH 4   2004 2004 HOH HOH A . 
C 3 HOH 5   2005 2005 HOH HOH A . 
C 3 HOH 6   2006 2006 HOH HOH A . 
C 3 HOH 7   2007 2007 HOH HOH A . 
C 3 HOH 8   2008 2008 HOH HOH A . 
C 3 HOH 9   2009 2009 HOH HOH A . 
C 3 HOH 10  2010 2010 HOH HOH A . 
C 3 HOH 11  2011 2011 HOH HOH A . 
C 3 HOH 12  2012 2012 HOH HOH A . 
C 3 HOH 13  2013 2013 HOH HOH A . 
C 3 HOH 14  2014 2014 HOH HOH A . 
C 3 HOH 15  2015 2015 HOH HOH A . 
C 3 HOH 16  2016 2016 HOH HOH A . 
C 3 HOH 17  2017 2017 HOH HOH A . 
C 3 HOH 18  2018 2018 HOH HOH A . 
C 3 HOH 19  2019 2019 HOH HOH A . 
C 3 HOH 20  2020 2020 HOH HOH A . 
C 3 HOH 21  2021 2021 HOH HOH A . 
C 3 HOH 22  2022 2022 HOH HOH A . 
C 3 HOH 23  2023 2023 HOH HOH A . 
C 3 HOH 24  2024 2024 HOH HOH A . 
C 3 HOH 25  2025 2025 HOH HOH A . 
C 3 HOH 26  2026 2026 HOH HOH A . 
C 3 HOH 27  2027 2027 HOH HOH A . 
C 3 HOH 28  2028 2028 HOH HOH A . 
C 3 HOH 29  2029 2029 HOH HOH A . 
C 3 HOH 30  2030 2030 HOH HOH A . 
C 3 HOH 31  2031 2031 HOH HOH A . 
C 3 HOH 32  2032 2032 HOH HOH A . 
C 3 HOH 33  2033 2033 HOH HOH A . 
C 3 HOH 34  2034 2034 HOH HOH A . 
C 3 HOH 35  2035 2035 HOH HOH A . 
C 3 HOH 36  2036 2036 HOH HOH A . 
C 3 HOH 37  2037 2037 HOH HOH A . 
C 3 HOH 38  2038 2038 HOH HOH A . 
C 3 HOH 39  2039 2039 HOH HOH A . 
C 3 HOH 40  2040 2040 HOH HOH A . 
C 3 HOH 41  2041 2041 HOH HOH A . 
C 3 HOH 42  2042 2042 HOH HOH A . 
C 3 HOH 43  2043 2043 HOH HOH A . 
C 3 HOH 44  2044 2044 HOH HOH A . 
C 3 HOH 45  2045 2045 HOH HOH A . 
C 3 HOH 46  2046 2046 HOH HOH A . 
C 3 HOH 47  2047 2047 HOH HOH A . 
C 3 HOH 48  2048 2048 HOH HOH A . 
C 3 HOH 49  2049 2049 HOH HOH A . 
C 3 HOH 50  2050 2050 HOH HOH A . 
C 3 HOH 51  2051 2051 HOH HOH A . 
C 3 HOH 52  2052 2052 HOH HOH A . 
C 3 HOH 53  2053 2053 HOH HOH A . 
C 3 HOH 54  2054 2054 HOH HOH A . 
C 3 HOH 55  2055 2055 HOH HOH A . 
C 3 HOH 56  2056 2056 HOH HOH A . 
C 3 HOH 57  2057 2057 HOH HOH A . 
C 3 HOH 58  2058 2058 HOH HOH A . 
C 3 HOH 59  2059 2059 HOH HOH A . 
C 3 HOH 60  2060 2060 HOH HOH A . 
C 3 HOH 61  2061 2061 HOH HOH A . 
C 3 HOH 62  2062 2062 HOH HOH A . 
C 3 HOH 63  2063 2063 HOH HOH A . 
C 3 HOH 64  2064 2064 HOH HOH A . 
C 3 HOH 65  2065 2065 HOH HOH A . 
C 3 HOH 66  2066 2066 HOH HOH A . 
C 3 HOH 67  2067 2067 HOH HOH A . 
C 3 HOH 68  2068 2068 HOH HOH A . 
C 3 HOH 69  2069 2069 HOH HOH A . 
C 3 HOH 70  2070 2070 HOH HOH A . 
C 3 HOH 71  2071 2071 HOH HOH A . 
C 3 HOH 72  2072 2072 HOH HOH A . 
C 3 HOH 73  2073 2073 HOH HOH A . 
C 3 HOH 74  2074 2074 HOH HOH A . 
C 3 HOH 75  2075 2075 HOH HOH A . 
C 3 HOH 76  2076 2076 HOH HOH A . 
C 3 HOH 77  2077 2077 HOH HOH A . 
C 3 HOH 78  2078 2078 HOH HOH A . 
C 3 HOH 79  2079 2079 HOH HOH A . 
C 3 HOH 80  2080 2080 HOH HOH A . 
C 3 HOH 81  2081 2081 HOH HOH A . 
C 3 HOH 82  2082 2082 HOH HOH A . 
C 3 HOH 83  2083 2083 HOH HOH A . 
C 3 HOH 84  2084 2084 HOH HOH A . 
C 3 HOH 85  2085 2085 HOH HOH A . 
C 3 HOH 86  2086 2086 HOH HOH A . 
C 3 HOH 87  2087 2087 HOH HOH A . 
C 3 HOH 88  2088 2088 HOH HOH A . 
C 3 HOH 89  2089 2089 HOH HOH A . 
C 3 HOH 90  2090 2090 HOH HOH A . 
C 3 HOH 91  2091 2091 HOH HOH A . 
C 3 HOH 92  2092 2092 HOH HOH A . 
C 3 HOH 93  2093 2093 HOH HOH A . 
C 3 HOH 94  2094 2094 HOH HOH A . 
C 3 HOH 95  2095 2095 HOH HOH A . 
C 3 HOH 96  2096 2096 HOH HOH A . 
C 3 HOH 97  2097 2097 HOH HOH A . 
C 3 HOH 98  2098 2098 HOH HOH A . 
C 3 HOH 99  2099 2099 HOH HOH A . 
C 3 HOH 100 2100 2100 HOH HOH A . 
C 3 HOH 101 2101 2101 HOH HOH A . 
C 3 HOH 102 2102 2102 HOH HOH A . 
C 3 HOH 103 2103 2103 HOH HOH A . 
C 3 HOH 104 2104 2104 HOH HOH A . 
C 3 HOH 105 2105 2105 HOH HOH A . 
C 3 HOH 106 2106 2106 HOH HOH A . 
C 3 HOH 107 2107 2107 HOH HOH A . 
C 3 HOH 108 2108 2108 HOH HOH A . 
C 3 HOH 109 2109 2109 HOH HOH A . 
C 3 HOH 110 2110 2110 HOH HOH A . 
C 3 HOH 111 2111 2111 HOH HOH A . 
C 3 HOH 112 2112 2112 HOH HOH A . 
C 3 HOH 113 2113 2113 HOH HOH A . 
C 3 HOH 114 2114 2114 HOH HOH A . 
C 3 HOH 115 2115 2115 HOH HOH A . 
C 3 HOH 116 2116 2116 HOH HOH A . 
C 3 HOH 117 2117 2117 HOH HOH A . 
C 3 HOH 118 2118 2118 HOH HOH A . 
C 3 HOH 119 2119 2119 HOH HOH A . 
C 3 HOH 120 2120 2120 HOH HOH A . 
C 3 HOH 121 2121 2121 HOH HOH A . 
C 3 HOH 122 2122 2122 HOH HOH A . 
C 3 HOH 123 2123 2123 HOH HOH A . 
C 3 HOH 124 2124 2124 HOH HOH A . 
C 3 HOH 125 2125 2125 HOH HOH A . 
C 3 HOH 126 2126 2126 HOH HOH A . 
C 3 HOH 127 2127 2127 HOH HOH A . 
C 3 HOH 128 2128 2128 HOH HOH A . 
C 3 HOH 129 2129 2129 HOH HOH A . 
C 3 HOH 130 2130 2130 HOH HOH A . 
C 3 HOH 131 2131 2131 HOH HOH A . 
C 3 HOH 132 2132 2132 HOH HOH A . 
C 3 HOH 133 2133 2133 HOH HOH A . 
C 3 HOH 134 2134 2134 HOH HOH A . 
C 3 HOH 135 2135 2135 HOH HOH A . 
C 3 HOH 136 2136 2136 HOH HOH A . 
C 3 HOH 137 2137 2137 HOH HOH A . 
C 3 HOH 138 2138 2138 HOH HOH A . 
C 3 HOH 139 2139 2139 HOH HOH A . 
C 3 HOH 140 2140 2140 HOH HOH A . 
C 3 HOH 141 2141 2141 HOH HOH A . 
C 3 HOH 142 2142 2142 HOH HOH A . 
C 3 HOH 143 2143 2143 HOH HOH A . 
C 3 HOH 144 2144 2144 HOH HOH A . 
C 3 HOH 145 2145 2145 HOH HOH A . 
C 3 HOH 146 2146 2146 HOH HOH A . 
C 3 HOH 147 2147 2147 HOH HOH A . 
C 3 HOH 148 2148 2148 HOH HOH A . 
C 3 HOH 149 2149 2149 HOH HOH A . 
C 3 HOH 150 2150 2150 HOH HOH A . 
C 3 HOH 151 2151 2151 HOH HOH A . 
C 3 HOH 152 2152 2152 HOH HOH A . 
C 3 HOH 153 2153 2153 HOH HOH A . 
C 3 HOH 154 2154 2154 HOH HOH A . 
C 3 HOH 155 2155 2155 HOH HOH A . 
C 3 HOH 156 2156 2156 HOH HOH A . 
C 3 HOH 157 2157 2157 HOH HOH A . 
C 3 HOH 158 2158 2158 HOH HOH A . 
C 3 HOH 159 2159 2159 HOH HOH A . 
C 3 HOH 160 2160 2160 HOH HOH A . 
C 3 HOH 161 2161 2161 HOH HOH A . 
C 3 HOH 162 2162 2162 HOH HOH A . 
C 3 HOH 163 2163 2163 HOH HOH A . 
C 3 HOH 164 2164 2164 HOH HOH A . 
C 3 HOH 165 2165 2165 HOH HOH A . 
C 3 HOH 166 2166 2166 HOH HOH A . 
C 3 HOH 167 2167 2167 HOH HOH A . 
C 3 HOH 168 2168 2168 HOH HOH A . 
C 3 HOH 169 2169 2169 HOH HOH A . 
C 3 HOH 170 2170 2170 HOH HOH A . 
C 3 HOH 171 2171 2171 HOH HOH A . 
C 3 HOH 172 2172 2172 HOH HOH A . 
C 3 HOH 173 2173 2173 HOH HOH A . 
C 3 HOH 174 2174 2174 HOH HOH A . 
C 3 HOH 175 2175 2175 HOH HOH A . 
C 3 HOH 176 2176 2176 HOH HOH A . 
C 3 HOH 177 2177 2177 HOH HOH A . 
C 3 HOH 178 2178 2178 HOH HOH A . 
C 3 HOH 179 2179 2179 HOH HOH A . 
C 3 HOH 180 2180 2180 HOH HOH A . 
C 3 HOH 181 2181 2181 HOH HOH A . 
C 3 HOH 182 2182 2182 HOH HOH A . 
C 3 HOH 183 2183 2183 HOH HOH A . 
C 3 HOH 184 2184 2184 HOH HOH A . 
C 3 HOH 185 2185 2185 HOH HOH A . 
C 3 HOH 186 2186 2186 HOH HOH A . 
C 3 HOH 187 2187 2187 HOH HOH A . 
C 3 HOH 188 2188 2188 HOH HOH A . 
C 3 HOH 189 2189 2189 HOH HOH A . 
C 3 HOH 190 2190 2190 HOH HOH A . 
C 3 HOH 191 2191 2191 HOH HOH A . 
C 3 HOH 192 2192 2192 HOH HOH A . 
C 3 HOH 193 2193 2193 HOH HOH A . 
C 3 HOH 194 2194 2194 HOH HOH A . 
C 3 HOH 195 2195 2195 HOH HOH A . 
C 3 HOH 196 2196 2196 HOH HOH A . 
C 3 HOH 197 2197 2197 HOH HOH A . 
C 3 HOH 198 2198 2198 HOH HOH A . 
C 3 HOH 199 2199 2199 HOH HOH A . 
C 3 HOH 200 2200 2200 HOH HOH A . 
C 3 HOH 201 2201 2201 HOH HOH A . 
C 3 HOH 202 2202 2202 HOH HOH A . 
C 3 HOH 203 2203 2203 HOH HOH A . 
C 3 HOH 204 2204 2204 HOH HOH A . 
C 3 HOH 205 2205 2205 HOH HOH A . 
C 3 HOH 206 2206 2206 HOH HOH A . 
C 3 HOH 207 2207 2207 HOH HOH A . 
C 3 HOH 208 2208 2208 HOH HOH A . 
C 3 HOH 209 2209 2209 HOH HOH A . 
C 3 HOH 210 2210 2210 HOH HOH A . 
C 3 HOH 211 2211 2211 HOH HOH A . 
C 3 HOH 212 2212 2212 HOH HOH A . 
C 3 HOH 213 2213 2213 HOH HOH A . 
C 3 HOH 214 2214 2214 HOH HOH A . 
C 3 HOH 215 2215 2215 HOH HOH A . 
C 3 HOH 216 2216 2216 HOH HOH A . 
C 3 HOH 217 2217 2217 HOH HOH A . 
C 3 HOH 218 2218 2218 HOH HOH A . 
C 3 HOH 219 2219 2219 HOH HOH A . 
C 3 HOH 220 2220 2220 HOH HOH A . 
C 3 HOH 221 2221 2221 HOH HOH A . 
C 3 HOH 222 2222 2222 HOH HOH A . 
C 3 HOH 223 2223 2223 HOH HOH A . 
C 3 HOH 224 2224 2224 HOH HOH A . 
C 3 HOH 225 2225 2225 HOH HOH A . 
C 3 HOH 226 2226 2226 HOH HOH A . 
C 3 HOH 227 2227 2227 HOH HOH A . 
C 3 HOH 228 2228 2228 HOH HOH A . 
C 3 HOH 229 2229 2229 HOH HOH A . 
C 3 HOH 230 2230 2230 HOH HOH A . 
C 3 HOH 231 2231 2231 HOH HOH A . 
C 3 HOH 232 2232 2232 HOH HOH A . 
C 3 HOH 233 2233 2233 HOH HOH A . 
C 3 HOH 234 2234 2234 HOH HOH A . 
C 3 HOH 235 2235 2235 HOH HOH A . 
C 3 HOH 236 2236 2236 HOH HOH A . 
C 3 HOH 237 2237 2237 HOH HOH A . 
C 3 HOH 238 2238 2238 HOH HOH A . 
C 3 HOH 239 2239 2239 HOH HOH A . 
C 3 HOH 240 2240 2240 HOH HOH A . 
C 3 HOH 241 2241 2241 HOH HOH A . 
C 3 HOH 242 2242 2242 HOH HOH A . 
C 3 HOH 243 2243 2243 HOH HOH A . 
C 3 HOH 244 2244 2244 HOH HOH A . 
C 3 HOH 245 2245 2245 HOH HOH A . 
C 3 HOH 246 2246 2246 HOH HOH A . 
C 3 HOH 247 2247 2247 HOH HOH A . 
C 3 HOH 248 2248 2248 HOH HOH A . 
C 3 HOH 249 2249 2249 HOH HOH A . 
C 3 HOH 250 2250 2250 HOH HOH A . 
C 3 HOH 251 2251 2251 HOH HOH A . 
C 3 HOH 252 2252 2252 HOH HOH A . 
C 3 HOH 253 2253 2253 HOH HOH A . 
C 3 HOH 254 2254 2254 HOH HOH A . 
C 3 HOH 255 2255 2255 HOH HOH A . 
C 3 HOH 256 2256 2256 HOH HOH A . 
C 3 HOH 257 2257 2257 HOH HOH A . 
C 3 HOH 258 2258 2258 HOH HOH A . 
C 3 HOH 259 2259 2259 HOH HOH A . 
C 3 HOH 260 2260 2260 HOH HOH A . 
C 3 HOH 261 2261 2261 HOH HOH A . 
C 3 HOH 262 2262 2262 HOH HOH A . 
C 3 HOH 263 2263 2263 HOH HOH A . 
C 3 HOH 264 2264 2264 HOH HOH A . 
C 3 HOH 265 2265 2265 HOH HOH A . 
C 3 HOH 266 2266 2266 HOH HOH A . 
C 3 HOH 267 2267 2267 HOH HOH A . 
C 3 HOH 268 2268 2268 HOH HOH A . 
C 3 HOH 269 2269 2269 HOH HOH A . 
C 3 HOH 270 2270 2270 HOH HOH A . 
C 3 HOH 271 2271 2271 HOH HOH A . 
C 3 HOH 272 2272 2272 HOH HOH A . 
C 3 HOH 273 2273 2273 HOH HOH A . 
C 3 HOH 274 2274 2274 HOH HOH A . 
C 3 HOH 275 2275 2275 HOH HOH A . 
C 3 HOH 276 2276 2276 HOH HOH A . 
C 3 HOH 277 2277 2277 HOH HOH A . 
C 3 HOH 278 2278 2278 HOH HOH A . 
C 3 HOH 279 2279 2279 HOH HOH A . 
C 3 HOH 280 2280 2280 HOH HOH A . 
C 3 HOH 281 2281 2281 HOH HOH A . 
C 3 HOH 282 2282 2282 HOH HOH A . 
C 3 HOH 283 2283 2283 HOH HOH A . 
C 3 HOH 284 2284 2284 HOH HOH A . 
C 3 HOH 285 2285 2285 HOH HOH A . 
C 3 HOH 286 2286 2286 HOH HOH A . 
C 3 HOH 287 2287 2287 HOH HOH A . 
C 3 HOH 288 2288 2288 HOH HOH A . 
C 3 HOH 289 2289 2289 HOH HOH A . 
C 3 HOH 290 2290 2290 HOH HOH A . 
C 3 HOH 291 2291 2291 HOH HOH A . 
C 3 HOH 292 2292 2292 HOH HOH A . 
C 3 HOH 293 2293 2293 HOH HOH A . 
C 3 HOH 294 2294 2294 HOH HOH A . 
C 3 HOH 295 2295 2295 HOH HOH A . 
C 3 HOH 296 2296 2296 HOH HOH A . 
C 3 HOH 297 2297 2297 HOH HOH A . 
C 3 HOH 298 2298 2298 HOH HOH A . 
C 3 HOH 299 2299 2299 HOH HOH A . 
C 3 HOH 300 2300 2300 HOH HOH A . 
C 3 HOH 301 2301 2301 HOH HOH A . 
C 3 HOH 302 2302 2302 HOH HOH A . 
C 3 HOH 303 2303 2303 HOH HOH A . 
C 3 HOH 304 2304 2304 HOH HOH A . 
C 3 HOH 305 2305 2305 HOH HOH A . 
C 3 HOH 306 2306 2306 HOH HOH A . 
C 3 HOH 307 2307 2307 HOH HOH A . 
C 3 HOH 308 2308 2308 HOH HOH A . 
C 3 HOH 309 2309 2309 HOH HOH A . 
C 3 HOH 310 2310 2310 HOH HOH A . 
C 3 HOH 311 2311 2311 HOH HOH A . 
C 3 HOH 312 2312 2312 HOH HOH A . 
C 3 HOH 313 2313 2313 HOH HOH A . 
C 3 HOH 314 2314 2314 HOH HOH A . 
C 3 HOH 315 2315 2315 HOH HOH A . 
C 3 HOH 316 2316 2316 HOH HOH A . 
C 3 HOH 317 2317 2317 HOH HOH A . 
C 3 HOH 318 2318 2318 HOH HOH A . 
C 3 HOH 319 2319 2319 HOH HOH A . 
C 3 HOH 320 2320 2320 HOH HOH A . 
C 3 HOH 321 2321 2321 HOH HOH A . 
C 3 HOH 322 2322 2322 HOH HOH A . 
C 3 HOH 323 2323 2323 HOH HOH A . 
C 3 HOH 324 2324 2324 HOH HOH A . 
C 3 HOH 325 2325 2325 HOH HOH A . 
C 3 HOH 326 2326 2326 HOH HOH A . 
C 3 HOH 327 2327 2327 HOH HOH A . 
C 3 HOH 328 2328 2328 HOH HOH A . 
C 3 HOH 329 2329 2329 HOH HOH A . 
C 3 HOH 330 2330 2330 HOH HOH A . 
C 3 HOH 331 2331 2331 HOH HOH A . 
C 3 HOH 332 2332 2332 HOH HOH A . 
C 3 HOH 333 2333 2333 HOH HOH A . 
C 3 HOH 334 2334 2334 HOH HOH A . 
C 3 HOH 335 2335 2335 HOH HOH A . 
C 3 HOH 336 2336 2336 HOH HOH A . 
C 3 HOH 337 2337 2337 HOH HOH A . 
C 3 HOH 338 2338 2338 HOH HOH A . 
C 3 HOH 339 2339 2339 HOH HOH A . 
C 3 HOH 340 2340 2340 HOH HOH A . 
C 3 HOH 341 2341 2341 HOH HOH A . 
C 3 HOH 342 2342 2342 HOH HOH A . 
C 3 HOH 343 2343 2343 HOH HOH A . 
C 3 HOH 344 2344 2344 HOH HOH A . 
C 3 HOH 345 2345 2345 HOH HOH A . 
C 3 HOH 346 2346 2346 HOH HOH A . 
C 3 HOH 347 2347 2347 HOH HOH A . 
C 3 HOH 348 2348 2348 HOH HOH A . 
C 3 HOH 349 2349 2349 HOH HOH A . 
C 3 HOH 350 2350 2350 HOH HOH A . 
C 3 HOH 351 2351 2351 HOH HOH A . 
C 3 HOH 352 2352 2352 HOH HOH A . 
C 3 HOH 353 2353 2353 HOH HOH A . 
C 3 HOH 354 2354 2354 HOH HOH A . 
C 3 HOH 355 2355 2355 HOH HOH A . 
C 3 HOH 356 2356 2356 HOH HOH A . 
C 3 HOH 357 2357 2357 HOH HOH A . 
C 3 HOH 358 2358 2358 HOH HOH A . 
C 3 HOH 359 2359 2359 HOH HOH A . 
C 3 HOH 360 2360 2360 HOH HOH A . 
C 3 HOH 361 2361 2361 HOH HOH A . 
C 3 HOH 362 2362 2362 HOH HOH A . 
C 3 HOH 363 2363 2363 HOH HOH A . 
C 3 HOH 364 2364 2364 HOH HOH A . 
C 3 HOH 365 2365 2365 HOH HOH A . 
C 3 HOH 366 2366 2366 HOH HOH A . 
C 3 HOH 367 2367 2367 HOH HOH A . 
C 3 HOH 368 2368 2368 HOH HOH A . 
C 3 HOH 369 2369 2369 HOH HOH A . 
C 3 HOH 370 2370 2370 HOH HOH A . 
C 3 HOH 371 2371 2371 HOH HOH A . 
C 3 HOH 372 2372 2372 HOH HOH A . 
C 3 HOH 373 2373 2373 HOH HOH A . 
C 3 HOH 374 2374 2374 HOH HOH A . 
C 3 HOH 375 2375 2375 HOH HOH A . 
C 3 HOH 376 2376 2376 HOH HOH A . 
C 3 HOH 377 2377 2377 HOH HOH A . 
C 3 HOH 378 2378 2378 HOH HOH A . 
C 3 HOH 379 2379 2379 HOH HOH A . 
C 3 HOH 380 2380 2380 HOH HOH A . 
C 3 HOH 381 2381 2381 HOH HOH A . 
C 3 HOH 382 2382 2382 HOH HOH A . 
C 3 HOH 383 2383 2383 HOH HOH A . 
C 3 HOH 384 2384 2384 HOH HOH A . 
C 3 HOH 385 2385 2385 HOH HOH A . 
C 3 HOH 386 2386 2386 HOH HOH A . 
C 3 HOH 387 2387 2387 HOH HOH A . 
C 3 HOH 388 2388 2388 HOH HOH A . 
C 3 HOH 389 2389 2389 HOH HOH A . 
C 3 HOH 390 2390 2390 HOH HOH A . 
C 3 HOH 391 2391 2391 HOH HOH A . 
C 3 HOH 392 2392 2392 HOH HOH A . 
C 3 HOH 393 2393 2393 HOH HOH A . 
C 3 HOH 394 2394 2394 HOH HOH A . 
C 3 HOH 395 2395 2395 HOH HOH A . 
C 3 HOH 396 2396 2396 HOH HOH A . 
C 3 HOH 397 2397 2397 HOH HOH A . 
C 3 HOH 398 2398 2398 HOH HOH A . 
C 3 HOH 399 2399 2399 HOH HOH A . 
C 3 HOH 400 2400 2400 HOH HOH A . 
C 3 HOH 401 2401 2401 HOH HOH A . 
C 3 HOH 402 2402 2402 HOH HOH A . 
C 3 HOH 403 2403 2403 HOH HOH A . 
C 3 HOH 404 2404 2404 HOH HOH A . 
C 3 HOH 405 2405 2405 HOH HOH A . 
C 3 HOH 406 2406 2406 HOH HOH A . 
C 3 HOH 407 2407 2407 HOH HOH A . 
C 3 HOH 408 2408 2408 HOH HOH A . 
C 3 HOH 409 2409 2409 HOH HOH A . 
C 3 HOH 410 2410 2410 HOH HOH A . 
C 3 HOH 411 2411 2411 HOH HOH A . 
C 3 HOH 412 2412 2412 HOH HOH A . 
C 3 HOH 413 2413 2413 HOH HOH A . 
C 3 HOH 414 2414 2414 HOH HOH A . 
C 3 HOH 415 2415 2415 HOH HOH A . 
C 3 HOH 416 2416 2416 HOH HOH A . 
C 3 HOH 417 2417 2417 HOH HOH A . 
C 3 HOH 418 2418 2418 HOH HOH A . 
C 3 HOH 419 2419 2419 HOH HOH A . 
C 3 HOH 420 2420 2420 HOH HOH A . 
C 3 HOH 421 2421 2421 HOH HOH A . 
C 3 HOH 422 2422 2422 HOH HOH A . 
C 3 HOH 423 2423 2423 HOH HOH A . 
C 3 HOH 424 2424 2424 HOH HOH A . 
C 3 HOH 425 2425 2425 HOH HOH A . 
C 3 HOH 426 2426 2426 HOH HOH A . 
C 3 HOH 427 2427 2427 HOH HOH A . 
C 3 HOH 428 2428 2428 HOH HOH A . 
C 3 HOH 429 2429 2429 HOH HOH A . 
C 3 HOH 430 2430 2430 HOH HOH A . 
C 3 HOH 431 2431 2431 HOH HOH A . 
C 3 HOH 432 2432 2432 HOH HOH A . 
C 3 HOH 433 2433 2433 HOH HOH A . 
C 3 HOH 434 2434 2434 HOH HOH A . 
C 3 HOH 435 2435 2435 HOH HOH A . 
C 3 HOH 436 2436 2436 HOH HOH A . 
C 3 HOH 437 2437 2437 HOH HOH A . 
C 3 HOH 438 2438 2438 HOH HOH A . 
C 3 HOH 439 2439 2439 HOH HOH A . 
C 3 HOH 440 2440 2440 HOH HOH A . 
C 3 HOH 441 2441 2441 HOH HOH A . 
C 3 HOH 442 2442 2442 HOH HOH A . 
C 3 HOH 443 2443 2443 HOH HOH A . 
C 3 HOH 444 2444 2444 HOH HOH A . 
C 3 HOH 445 2445 2445 HOH HOH A . 
C 3 HOH 446 2446 2446 HOH HOH A . 
C 3 HOH 447 2447 2447 HOH HOH A . 
C 3 HOH 448 2448 2448 HOH HOH A . 
C 3 HOH 449 2449 2449 HOH HOH A . 
C 3 HOH 450 2450 2450 HOH HOH A . 
C 3 HOH 451 2451 2451 HOH HOH A . 
C 3 HOH 452 2452 2452 HOH HOH A . 
C 3 HOH 453 2453 2453 HOH HOH A . 
C 3 HOH 454 2454 2454 HOH HOH A . 
C 3 HOH 455 2455 2455 HOH HOH A . 
C 3 HOH 456 2456 2456 HOH HOH A . 
C 3 HOH 457 2457 2457 HOH HOH A . 
C 3 HOH 458 2458 2458 HOH HOH A . 
C 3 HOH 459 2459 2459 HOH HOH A . 
C 3 HOH 460 2460 2460 HOH HOH A . 
C 3 HOH 461 2461 2461 HOH HOH A . 
C 3 HOH 462 2462 2462 HOH HOH A . 
C 3 HOH 463 2463 2463 HOH HOH A . 
C 3 HOH 464 2464 2464 HOH HOH A . 
C 3 HOH 465 2465 2465 HOH HOH A . 
C 3 HOH 466 2466 2466 HOH HOH A . 
C 3 HOH 467 2467 2467 HOH HOH A . 
C 3 HOH 468 2468 2468 HOH HOH A . 
C 3 HOH 469 2469 2469 HOH HOH A . 
C 3 HOH 470 2470 2470 HOH HOH A . 
C 3 HOH 471 2471 2471 HOH HOH A . 
C 3 HOH 472 2472 2472 HOH HOH A . 
C 3 HOH 473 2473 2473 HOH HOH A . 
C 3 HOH 474 2474 2474 HOH HOH A . 
C 3 HOH 475 2475 2475 HOH HOH A . 
C 3 HOH 476 2476 2476 HOH HOH A . 
C 3 HOH 477 2477 2477 HOH HOH A . 
C 3 HOH 478 2478 2478 HOH HOH A . 
C 3 HOH 479 2479 2479 HOH HOH A . 
C 3 HOH 480 2480 2480 HOH HOH A . 
C 3 HOH 481 2481 2481 HOH HOH A . 
C 3 HOH 482 2482 2482 HOH HOH A . 
C 3 HOH 483 2483 2483 HOH HOH A . 
C 3 HOH 484 2484 2484 HOH HOH A . 
C 3 HOH 485 2485 2485 HOH HOH A . 
C 3 HOH 486 2486 2486 HOH HOH A . 
C 3 HOH 487 2487 2487 HOH HOH A . 
C 3 HOH 488 2488 2488 HOH HOH A . 
C 3 HOH 489 2489 2489 HOH HOH A . 
C 3 HOH 490 2490 2490 HOH HOH A . 
C 3 HOH 491 2491 2491 HOH HOH A . 
C 3 HOH 492 2492 2492 HOH HOH A . 
C 3 HOH 493 2493 2493 HOH HOH A . 
C 3 HOH 494 2494 2494 HOH HOH A . 
C 3 HOH 495 2495 2495 HOH HOH A . 
C 3 HOH 496 2496 2496 HOH HOH A . 
C 3 HOH 497 2497 2497 HOH HOH A . 
C 3 HOH 498 2498 2498 HOH HOH A . 
C 3 HOH 499 2499 2499 HOH HOH A . 
C 3 HOH 500 2500 2500 HOH HOH A . 
C 3 HOH 501 2501 2501 HOH HOH A . 
C 3 HOH 502 2502 2502 HOH HOH A . 
C 3 HOH 503 2503 2503 HOH HOH A . 
C 3 HOH 504 2504 2504 HOH HOH A . 
C 3 HOH 505 2505 2505 HOH HOH A . 
C 3 HOH 506 2506 2506 HOH HOH A . 
C 3 HOH 507 2507 2507 HOH HOH A . 
C 3 HOH 508 2508 2508 HOH HOH A . 
C 3 HOH 509 2509 2509 HOH HOH A . 
C 3 HOH 510 2510 2510 HOH HOH A . 
C 3 HOH 511 2511 2511 HOH HOH A . 
C 3 HOH 512 2512 2512 HOH HOH A . 
C 3 HOH 513 2513 2513 HOH HOH A . 
C 3 HOH 514 2514 2514 HOH HOH A . 
C 3 HOH 515 2515 2515 HOH HOH A . 
C 3 HOH 516 2516 2516 HOH HOH A . 
C 3 HOH 517 2517 2517 HOH HOH A . 
C 3 HOH 518 2518 2518 HOH HOH A . 
C 3 HOH 519 2519 2519 HOH HOH A . 
C 3 HOH 520 2520 2520 HOH HOH A . 
C 3 HOH 521 2521 2521 HOH HOH A . 
C 3 HOH 522 2522 2522 HOH HOH A . 
C 3 HOH 523 2523 2523 HOH HOH A . 
C 3 HOH 524 2524 2524 HOH HOH A . 
C 3 HOH 525 2525 2525 HOH HOH A . 
C 3 HOH 526 2526 2526 HOH HOH A . 
C 3 HOH 527 2527 2527 HOH HOH A . 
C 3 HOH 528 2528 2528 HOH HOH A . 
C 3 HOH 529 2529 2529 HOH HOH A . 
C 3 HOH 530 2530 2530 HOH HOH A . 
C 3 HOH 531 2531 2531 HOH HOH A . 
C 3 HOH 532 2532 2532 HOH HOH A . 
C 3 HOH 533 2533 2533 HOH HOH A . 
C 3 HOH 534 2534 2534 HOH HOH A . 
C 3 HOH 535 2535 2535 HOH HOH A . 
C 3 HOH 536 2536 2536 HOH HOH A . 
C 3 HOH 537 2537 2537 HOH HOH A . 
C 3 HOH 538 2538 2538 HOH HOH A . 
C 3 HOH 539 2539 2539 HOH HOH A . 
C 3 HOH 540 2540 2540 HOH HOH A . 
C 3 HOH 541 2541 2541 HOH HOH A . 
C 3 HOH 542 2542 2542 HOH HOH A . 
C 3 HOH 543 2543 2543 HOH HOH A . 
C 3 HOH 544 2544 2544 HOH HOH A . 
C 3 HOH 545 2545 2545 HOH HOH A . 
C 3 HOH 546 2546 2546 HOH HOH A . 
C 3 HOH 547 2547 2547 HOH HOH A . 
C 3 HOH 548 2548 2548 HOH HOH A . 
C 3 HOH 549 2549 2549 HOH HOH A . 
C 3 HOH 550 2550 2550 HOH HOH A . 
C 3 HOH 551 2551 2551 HOH HOH A . 
C 3 HOH 552 2552 2552 HOH HOH A . 
C 3 HOH 553 2553 2553 HOH HOH A . 
C 3 HOH 554 2554 2554 HOH HOH A . 
C 3 HOH 555 2555 2555 HOH HOH A . 
C 3 HOH 556 2556 2556 HOH HOH A . 
C 3 HOH 557 2557 2557 HOH HOH A . 
C 3 HOH 558 2558 2558 HOH HOH A . 
C 3 HOH 559 2559 2559 HOH HOH A . 
C 3 HOH 560 2560 2560 HOH HOH A . 
C 3 HOH 561 2561 2561 HOH HOH A . 
C 3 HOH 562 2562 2562 HOH HOH A . 
C 3 HOH 563 2563 2563 HOH HOH A . 
C 3 HOH 564 2564 2564 HOH HOH A . 
C 3 HOH 565 2565 2565 HOH HOH A . 
C 3 HOH 566 2566 2566 HOH HOH A . 
C 3 HOH 567 2567 2567 HOH HOH A . 
D 3 HOH 1   2001 2001 HOH HOH I . 
D 3 HOH 2   2002 2002 HOH HOH I . 
D 3 HOH 3   2003 2003 HOH HOH I . 
D 3 HOH 4   2004 2004 HOH HOH I . 
D 3 HOH 5   2005 2005 HOH HOH I . 
D 3 HOH 6   2006 2006 HOH HOH I . 
D 3 HOH 7   2007 2007 HOH HOH I . 
D 3 HOH 8   2008 2008 HOH HOH I . 
D 3 HOH 9   2009 2009 HOH HOH I . 
D 3 HOH 10  2010 2010 HOH HOH I . 
D 3 HOH 11  2011 2011 HOH HOH I . 
D 3 HOH 12  2012 2012 HOH HOH I . 
D 3 HOH 13  2013 2013 HOH HOH I . 
D 3 HOH 14  2014 2014 HOH HOH I . 
D 3 HOH 15  2015 2015 HOH HOH I . 
D 3 HOH 16  2016 2016 HOH HOH I . 
D 3 HOH 17  2017 2017 HOH HOH I . 
D 3 HOH 18  2018 2018 HOH HOH I . 
D 3 HOH 19  2019 2019 HOH HOH I . 
D 3 HOH 20  2020 2020 HOH HOH I . 
D 3 HOH 21  2021 2021 HOH HOH I . 
D 3 HOH 22  2022 2022 HOH HOH I . 
D 3 HOH 23  2023 2023 HOH HOH I . 
D 3 HOH 24  2024 2024 HOH HOH I . 
D 3 HOH 25  2025 2025 HOH HOH I . 
D 3 HOH 26  2026 2026 HOH HOH I . 
D 3 HOH 27  2027 2027 HOH HOH I . 
D 3 HOH 28  2028 2028 HOH HOH I . 
D 3 HOH 29  2029 2029 HOH HOH I . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SEP 140 A SEP 139 ? SER PHOSPHOSERINE    
2 A TPO 198 A TPO 197 ? THR PHOSPHOTHREONINE 
3 A SEP 339 A SEP 338 ? SER PHOSPHOSERINE    
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1720  ? 
1 MORE         -2.3  ? 
1 'SSA (A^2)'  16060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2013-10-09 
2 'Structure model' 1 1 2013-11-20 
3 'Structure model' 1 2 2019-10-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Database references'  
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' Other                  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation             
2 3 'Structure model' citation_author      
3 3 'Structure model' pdbx_database_status 
4 3 'Structure model' struct_conn          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.page_last'                  
2 3 'Structure model' '_citation.pdbx_database_id_DOI'       
3 3 'Structure model' '_citation.title'                      
4 3 'Structure model' '_citation_author.name'                
5 3 'Structure model' '_pdbx_database_status.status_code_sf' 
6 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 26.9418 2.5695  82.9545 -0.0687 -0.0343 -0.0554 0.0122  -0.0039 0.0048 0.3871 0.6104 0.7879 0.1232 
0.0154 0.3305 -0.0037 -0.0021 -0.0311 0.0359 0.0262  -0.0283 0.0967  0.0748  -0.0225 
'X-RAY DIFFRACTION' 2 ? refined 14.0418 -2.3702 69.5042 0.0036  0.0231  -0.0154 -0.0153 -0.0037 0.0017 0.0025 3.5522 3.7972 0.2052 
0.4044 3.0375 0.0016  0.0222  0.1033  0.0201 -0.0212 -0.0122 -0.0537 -0.1591 0.0196  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN I' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
BUSTER  refinement       2.11.2 ? 1 
MOSFLM  'data reduction' .      ? 2 
Aimless 'data scaling'   .      ? 3 
PHASER  phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             4C33 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;PKA-S6K1 CHIMERA MUTATIONS ARE F54Y, M120L, V123L, L173M
AND Q181K
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 46  ? ? -106.10 -60.68 
2 1 ASP A 166 ? ? -151.66 40.52  
3 1 ASP A 184 ? ? 69.20   93.31  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2029 ? 6.70 . 
2 1 O ? A HOH 2092 ? 5.94 . 
3 1 O ? A HOH 2094 ? 6.77 . 
4 1 O ? A HOH 2137 ? 6.08 . 
5 1 O ? A HOH 2236 ? 5.94 . 
6 1 O ? A HOH 2250 ? 6.62 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 16  ? CD  ? A LYS 17  CD  
2  1 Y 1 A LYS 16  ? CE  ? A LYS 17  CE  
3  1 Y 1 A LYS 16  ? NZ  ? A LYS 17  NZ  
4  1 Y 1 A LYS 21  ? CG  ? A LYS 22  CG  
5  1 Y 1 A LYS 21  ? CD  ? A LYS 22  CD  
6  1 Y 1 A LYS 21  ? CE  ? A LYS 22  CE  
7  1 Y 1 A LYS 21  ? NZ  ? A LYS 22  NZ  
8  1 Y 1 A LYS 28  ? CD  ? A LYS 29  CD  
9  1 Y 1 A LYS 28  ? CE  ? A LYS 29  CE  
10 1 Y 1 A LYS 28  ? NZ  ? A LYS 29  NZ  
11 1 Y 1 A LYS 29  ? NZ  ? A LYS 30  NZ  
12 1 Y 1 A GLU 64  ? CD  ? A GLU 65  CD  
13 1 Y 1 A GLU 64  ? OE1 ? A GLU 65  OE1 
14 1 Y 1 A GLU 64  ? OE2 ? A GLU 65  OE2 
15 1 Y 1 A LYS 105 ? CE  ? A LYS 106 CE  
16 1 Y 1 A LYS 105 ? NZ  ? A LYS 106 NZ  
17 1 Y 1 A GLN 176 ? CD  ? A GLN 177 CD  
18 1 Y 1 A GLN 176 ? OE1 ? A GLN 177 OE1 
19 1 Y 1 A GLN 176 ? NE2 ? A GLN 177 NE2 
20 1 Y 1 A ARG 256 ? NE  ? A ARG 257 NE  
21 1 Y 1 A ARG 256 ? CZ  ? A ARG 257 CZ  
22 1 Y 1 A ARG 256 ? NH1 ? A ARG 257 NH1 
23 1 Y 1 A ARG 256 ? NH2 ? A ARG 257 NH2 
24 1 Y 1 A LYS 285 ? CG  ? A LYS 286 CG  
25 1 Y 1 A LYS 285 ? CD  ? A LYS 286 CD  
26 1 Y 1 A LYS 285 ? CE  ? A LYS 286 CE  
27 1 Y 1 A LYS 285 ? NZ  ? A LYS 286 NZ  
28 1 Y 1 A LYS 295 ? CD  ? A LYS 296 CD  
29 1 Y 1 A LYS 295 ? CE  ? A LYS 296 CE  
30 1 Y 1 A LYS 295 ? NZ  ? A LYS 296 NZ  
31 1 Y 1 A GLU 311 ? CG  ? A GLU 312 CG  
32 1 Y 1 A GLU 311 ? CD  ? A GLU 312 CD  
33 1 Y 1 A GLU 311 ? OE1 ? A GLU 312 OE1 
34 1 Y 1 A GLU 311 ? OE2 ? A GLU 312 OE2 
35 1 Y 1 A LYS 317 ? CG  ? A LYS 318 CG  
36 1 Y 1 A LYS 317 ? CD  ? A LYS 318 CD  
37 1 Y 1 A LYS 317 ? CE  ? A LYS 318 CE  
38 1 Y 1 A LYS 317 ? NZ  ? A LYS 318 NZ  
39 1 Y 1 A GLU 331 ? CG  ? A GLU 332 CG  
40 1 Y 1 A GLU 331 ? CD  ? A GLU 332 CD  
41 1 Y 1 A GLU 331 ? OE1 ? A GLU 332 OE1 
42 1 Y 1 A GLU 331 ? OE2 ? A GLU 332 OE2 
43 1 Y 1 A LYS 345 ? CD  ? A LYS 346 CD  
44 1 Y 1 A LYS 345 ? CE  ? A LYS 346 CE  
45 1 Y 1 A LYS 345 ? NZ  ? A LYS 346 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 0  ? A MET 1  
2  1 Y 1 A GLY 1  ? A GLY 2  
3  1 Y 1 A ASN 2  ? A ASN 3  
4  1 Y 1 A ALA 3  ? A ALA 4  
5  1 Y 1 A ALA 4  ? A ALA 5  
6  1 Y 1 A ALA 5  ? A ALA 6  
7  1 Y 1 A ALA 6  ? A ALA 7  
8  1 Y 1 A LYS 7  ? A LYS 8  
9  1 Y 1 A LYS 8  ? A LYS 9  
10 1 Y 1 A GLY 9  ? A GLY 10 
11 1 Y 1 A SER 10 ? A SER 11 
12 1 Y 1 A GLU 11 ? A GLU 12 
13 1 Y 1 A GLN 12 ? A GLN 13 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#