data_4C3P
# 
_entry.id   4C3P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4C3P         
PDBE  EBI-58176    
WWPDB D_1290058176 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4C3R 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'STRUCTURE OF DEPHOSPHORYLATED AURORA A (122-403) BOUND TO AMPPCP' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4C3P 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-08-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zorba, A.'  1 
'Kutter, S.' 2 
'Kern, D.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Molecular Mechanism of Aurora a Kinase Autophosphorylation and its Allosteric Activation by Tpx2.' 
_citation.journal_abbrev            Elife 
_citation.journal_volume            3 
_citation.page_first                02667 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24867643 
_citation.pdbx_database_id_DOI      10.7554/ELIFE.02667 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zorba, A.'     1 ? 
primary 'Buosi, V.'     2 ? 
primary 'Kutter, S.'    3 ? 
primary 'Kern, N.'      4 ? 
primary 'Pontiggia, F.' 5 ? 
primary 'Cho, Y.J.'     6 ? 
primary 'Kern, D.'      7 ? 
# 
_cell.entry_id           4C3P 
_cell.length_a           49.927 
_cell.length_b           86.717 
_cell.length_c           153.546 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4C3P 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'AURORA KINASE A'                              32689.459 2  2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 121-403' ? 
2 polymer     man 'TARGETING PROTEIN FOR XKLP2'                  4927.110  2  ?        ? 
'AURORA A KINASE BINDING DOMAIN, RESIDUES 1-43' ? 
3 non-polymer syn 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 505.208   2  ?        ? ? ? 
4 non-polymer syn 'SULFATE ION'                                  96.063    1  ?        ? ? ? 
5 water       nat water                                          18.015    21 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
;AURORA 2, AURORA/IPL1-RELATED KINASE 1, ARK-1, AURORA-RELAT ED KINASE 1, HARK1, BREAST TUMOR-AMPLIFIED KINASE, SERINE/THREONIN E- PROTEIN KINASE 15, SERINE/THREONINE-PROTEIN KINASE 6, SERINE/THR EONINE-PROTEIN KINASE AURORA-A, AURORA A KINASE
;
2 
;DIFFERENTIALLY EXPRESSED IN CANCEROUS AND NON-CANCEROUS LUN G CELLS 2, DIL-2, HEPATOCELLULAR CARCINOMA-ASSOCIATED ANTIGEN 519, PROTEIN FLS353, RESTRICTED EXPRESSION PROLIFERATION-ASSOCIATED PR OTEIN 100, P100, TARGETING PROTEIN FOR XKLP2, TPX2
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH
DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLIS
RLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
;
;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH
DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLIS
RLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
;
A,D ? 
2 'polypeptide(L)' no no MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN B,E ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   SER n 
1 3   LYS n 
1 4   LYS n 
1 5   ARG n 
1 6   GLN n 
1 7   TRP n 
1 8   ALA n 
1 9   LEU n 
1 10  GLU n 
1 11  ASP n 
1 12  PHE n 
1 13  GLU n 
1 14  ILE n 
1 15  GLY n 
1 16  ARG n 
1 17  PRO n 
1 18  LEU n 
1 19  GLY n 
1 20  LYS n 
1 21  GLY n 
1 22  LYS n 
1 23  PHE n 
1 24  GLY n 
1 25  ASN n 
1 26  VAL n 
1 27  TYR n 
1 28  LEU n 
1 29  ALA n 
1 30  ARG n 
1 31  GLU n 
1 32  LYS n 
1 33  GLN n 
1 34  SER n 
1 35  LYS n 
1 36  PHE n 
1 37  ILE n 
1 38  LEU n 
1 39  ALA n 
1 40  LEU n 
1 41  LYS n 
1 42  VAL n 
1 43  LEU n 
1 44  PHE n 
1 45  LYS n 
1 46  ALA n 
1 47  GLN n 
1 48  LEU n 
1 49  GLU n 
1 50  LYS n 
1 51  ALA n 
1 52  GLY n 
1 53  VAL n 
1 54  GLU n 
1 55  HIS n 
1 56  GLN n 
1 57  LEU n 
1 58  ARG n 
1 59  ARG n 
1 60  GLU n 
1 61  VAL n 
1 62  GLU n 
1 63  ILE n 
1 64  GLN n 
1 65  SER n 
1 66  HIS n 
1 67  LEU n 
1 68  ARG n 
1 69  HIS n 
1 70  PRO n 
1 71  ASN n 
1 72  ILE n 
1 73  LEU n 
1 74  ARG n 
1 75  LEU n 
1 76  TYR n 
1 77  GLY n 
1 78  TYR n 
1 79  PHE n 
1 80  HIS n 
1 81  ASP n 
1 82  ALA n 
1 83  THR n 
1 84  ARG n 
1 85  VAL n 
1 86  TYR n 
1 87  LEU n 
1 88  ILE n 
1 89  LEU n 
1 90  GLU n 
1 91  TYR n 
1 92  ALA n 
1 93  PRO n 
1 94  LEU n 
1 95  GLY n 
1 96  THR n 
1 97  VAL n 
1 98  TYR n 
1 99  ARG n 
1 100 GLU n 
1 101 LEU n 
1 102 GLN n 
1 103 LYS n 
1 104 LEU n 
1 105 SER n 
1 106 LYS n 
1 107 PHE n 
1 108 ASP n 
1 109 GLU n 
1 110 GLN n 
1 111 ARG n 
1 112 THR n 
1 113 ALA n 
1 114 THR n 
1 115 TYR n 
1 116 ILE n 
1 117 THR n 
1 118 GLU n 
1 119 LEU n 
1 120 ALA n 
1 121 ASN n 
1 122 ALA n 
1 123 LEU n 
1 124 SER n 
1 125 TYR n 
1 126 CYS n 
1 127 HIS n 
1 128 SER n 
1 129 LYS n 
1 130 ARG n 
1 131 VAL n 
1 132 ILE n 
1 133 HIS n 
1 134 ARG n 
1 135 ASP n 
1 136 ILE n 
1 137 LYS n 
1 138 PRO n 
1 139 GLU n 
1 140 ASN n 
1 141 LEU n 
1 142 LEU n 
1 143 LEU n 
1 144 GLY n 
1 145 SER n 
1 146 ALA n 
1 147 GLY n 
1 148 GLU n 
1 149 LEU n 
1 150 LYS n 
1 151 ILE n 
1 152 ALA n 
1 153 ASP n 
1 154 PHE n 
1 155 GLY n 
1 156 TRP n 
1 157 SER n 
1 158 VAL n 
1 159 HIS n 
1 160 ALA n 
1 161 PRO n 
1 162 SER n 
1 163 SER n 
1 164 ARG n 
1 165 ARG n 
1 166 THR n 
1 167 THR n 
1 168 LEU n 
1 169 CYS n 
1 170 GLY n 
1 171 THR n 
1 172 LEU n 
1 173 ASP n 
1 174 TYR n 
1 175 LEU n 
1 176 PRO n 
1 177 PRO n 
1 178 GLU n 
1 179 MET n 
1 180 ILE n 
1 181 GLU n 
1 182 GLY n 
1 183 ARG n 
1 184 MET n 
1 185 HIS n 
1 186 ASP n 
1 187 GLU n 
1 188 LYS n 
1 189 VAL n 
1 190 ASP n 
1 191 LEU n 
1 192 TRP n 
1 193 SER n 
1 194 LEU n 
1 195 GLY n 
1 196 VAL n 
1 197 LEU n 
1 198 CYS n 
1 199 TYR n 
1 200 GLU n 
1 201 PHE n 
1 202 LEU n 
1 203 VAL n 
1 204 GLY n 
1 205 LYS n 
1 206 PRO n 
1 207 PRO n 
1 208 PHE n 
1 209 GLU n 
1 210 ALA n 
1 211 ASN n 
1 212 THR n 
1 213 TYR n 
1 214 GLN n 
1 215 GLU n 
1 216 THR n 
1 217 TYR n 
1 218 LYS n 
1 219 ARG n 
1 220 ILE n 
1 221 SER n 
1 222 ARG n 
1 223 VAL n 
1 224 GLU n 
1 225 PHE n 
1 226 THR n 
1 227 PHE n 
1 228 PRO n 
1 229 ASP n 
1 230 PHE n 
1 231 VAL n 
1 232 THR n 
1 233 GLU n 
1 234 GLY n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 LEU n 
1 239 ILE n 
1 240 SER n 
1 241 ARG n 
1 242 LEU n 
1 243 LEU n 
1 244 LYS n 
1 245 HIS n 
1 246 ASN n 
1 247 PRO n 
1 248 SER n 
1 249 GLN n 
1 250 ARG n 
1 251 PRO n 
1 252 MET n 
1 253 LEU n 
1 254 ARG n 
1 255 GLU n 
1 256 VAL n 
1 257 LEU n 
1 258 GLU n 
1 259 HIS n 
1 260 PRO n 
1 261 TRP n 
1 262 ILE n 
1 263 THR n 
1 264 ALA n 
1 265 ASN n 
1 266 SER n 
1 267 SER n 
1 268 LYS n 
1 269 PRO n 
1 270 SER n 
1 271 ASN n 
1 272 CYS n 
1 273 GLN n 
1 274 ASN n 
1 275 LYS n 
1 276 GLU n 
1 277 SER n 
1 278 ALA n 
1 279 SER n 
1 280 LYS n 
1 281 GLN n 
1 282 SER n 
2 1   MET n 
2 2   SER n 
2 3   GLN n 
2 4   VAL n 
2 5   LYS n 
2 6   SER n 
2 7   SER n 
2 8   TYR n 
2 9   SER n 
2 10  TYR n 
2 11  ASP n 
2 12  ALA n 
2 13  PRO n 
2 14  SER n 
2 15  ASP n 
2 16  PHE n 
2 17  ILE n 
2 18  ASN n 
2 19  PHE n 
2 20  SER n 
2 21  SER n 
2 22  LEU n 
2 23  ASP n 
2 24  ASP n 
2 25  GLU n 
2 26  GLY n 
2 27  ASP n 
2 28  THR n 
2 29  GLN n 
2 30  ASN n 
2 31  ILE n 
2 32  ASP n 
2 33  SER n 
2 34  TRP n 
2 35  PHE n 
2 36  GLU n 
2 37  GLU n 
2 38  LYS n 
2 39  ALA n 
2 40  ASN n 
2 41  LEU n 
2 42  GLU n 
2 43  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? PLASMID ? ? ? PET28A ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? PLASMID ? ? ? PET28A ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP AURKA_HUMAN 1 ? ? O14965 ? 
2 UNP TPX2_HUMAN  2 ? ? Q9ULW0 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4C3P A 1 ? 282 ? O14965 122 ? 403 ? 122 403 
2 1 4C3P D 1 ? 282 ? O14965 122 ? 403 ? 122 403 
3 2 4C3P B 1 ? 43  ? Q9ULW0 1   ? 43  ? 1   43  
4 2 4C3P E 1 ? 43  ? Q9ULW0 1   ? 43  ? 1   43  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACP non-polymer         . 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' 
;ADENOSINE-5'-[BETA, GAMMA-METHYLENE]TRIPHOSPHATE
;
'C11 H18 N5 O12 P3' 505.208 
ALA 'L-peptide linking' y ALANINE                                        ?                                                  
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                       ?                                                  
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                     ?                                                  
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                ?                                                  
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                       ?                                                  
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                      ?                                                  
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                ?                                                  
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                        ?                                                  
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                      ?                                                  
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                          ?                                                  'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                     ?                                                  
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                        ?                                                  
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                         ?                                                  
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                     ?                                                  
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                  ?                                                  
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                        ?                                                  
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                         ?                                                  
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                  ?                                                  
'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                      ?                                                  
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                     ?                                                  
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                       ?                                                  
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                         ?                                                  
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          4C3P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.23 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;CRYSTALS OF DEPHOSPHORYLATED A(122-403) IN COMPLEX WITH AMPPCP AND TPX2(1-43) WERE GROWN AT 18C BY VAPOR DIFFUSION AND THE HANGING DROP OBTAINED BY COMBINING 300UM DEP A(122-403) WITH 1.5MM AMPPCP AND 300UM TPX2(1-43) WITH 0.2M LITHIUM SULFATE MONOHYDRATE, 0.1M BISTRIS PH5.5, 25% PEG3350.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2012-12-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL, SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.21433 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.2.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.2.2 
_diffrn_source.pdbx_wavelength             1.21433 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4C3P 
_reflns.observed_criterion_sigma_I   2.3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.50 
_reflns.d_resolution_high            2.69 
_reflns.number_obs                   19139 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.26 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.00 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.9 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.69 
_reflns_shell.d_res_low              2.76 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.30 
_reflns_shell.pdbx_redundancy        7.2 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4C3P 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18104 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.48 
_refine.ls_d_res_high                            2.69 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_R_factor_obs                          0.20526 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20066 
_refine.ls_R_factor_R_free                       0.28857 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  1035 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.936 
_refine.correlation_coeff_Fo_to_Fc_free          0.882 
_refine.B_iso_mean                               53.940 
_refine.aniso_B[1][1]                            -0.01 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.01 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 1OL7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.402 
_refine.overall_SU_ML                            0.307 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             14.978 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4574 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         67 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               4662 
_refine_hist.d_res_high                       2.69 
_refine_hist.d_res_low                        47.48 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.019  ? 4760  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 4517  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.511  1.982  ? 6448  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.786  3.000  ? 10394 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.032  5.000  ? 553   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.439 22.807 ? 228   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.873 15.000 ? 826   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.104 15.000 ? 40    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.078  0.200  ? 687   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 5230  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1144  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.694 
_refine_ls_shell.d_res_low                        2.764 
_refine_ls_shell.number_reflns_R_work             1293 
_refine_ls_shell.R_factor_R_work                  0.284 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.400 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             88 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4C3P 
_struct.title                     'Structure of dephosphorylated Aurora A (122-403) bound to TPX2 and AMPPCP' 
_struct.pdbx_descriptor           'AURORA KINASE A (E.C.2.7.11.1), TARGETING PROTEIN FOR XKLP2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4C3P 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, ACTIVATION, ALLOSTERY, CELL CYCLE, CANCER' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 8   ? GLU A 10  ? ALA A 129 GLU A 131 5 ? 3  
HELX_P HELX_P2  2  LYS A 45  ? ALA A 51  ? LYS A 166 ALA A 172 1 ? 7  
HELX_P HELX_P3  3  VAL A 53  ? HIS A 66  ? VAL A 174 HIS A 187 1 ? 14 
HELX_P HELX_P4  4  THR A 96  ? SER A 105 ? THR A 217 SER A 226 1 ? 10 
HELX_P HELX_P5  5  ASP A 108 ? LYS A 129 ? ASP A 229 LYS A 250 1 ? 22 
HELX_P HELX_P6  6  LYS A 137 ? GLU A 139 ? LYS A 258 GLU A 260 5 ? 3  
HELX_P HELX_P7  7  THR A 171 ? LEU A 175 ? THR A 292 LEU A 296 5 ? 5  
HELX_P HELX_P8  8  PRO A 176 ? ASP A 186 ? PRO A 297 ASP A 307 1 ? 11 
HELX_P HELX_P9  9  LYS A 188 ? GLY A 204 ? LYS A 309 GLY A 325 1 ? 17 
HELX_P HELX_P10 10 THR A 212 ? ARG A 222 ? THR A 333 ARG A 343 1 ? 11 
HELX_P HELX_P11 11 THR A 232 ? LEU A 243 ? THR A 353 LEU A 364 1 ? 12 
HELX_P HELX_P12 12 ASN A 246 ? ARG A 250 ? ASN A 367 ARG A 371 5 ? 5  
HELX_P HELX_P13 13 MET A 252 ? HIS A 259 ? MET A 373 HIS A 380 1 ? 8  
HELX_P HELX_P14 14 HIS A 259 ? SER A 266 ? HIS A 380 SER A 387 1 ? 8  
HELX_P HELX_P15 15 ALA C 8   ? GLU C 10  ? ALA D 129 GLU D 131 5 ? 3  
HELX_P HELX_P16 16 LYS C 45  ? ALA C 51  ? LYS D 166 ALA D 172 1 ? 7  
HELX_P HELX_P17 17 VAL C 53  ? SER C 65  ? VAL D 174 SER D 186 1 ? 13 
HELX_P HELX_P18 18 THR C 96  ? SER C 105 ? THR D 217 SER D 226 1 ? 10 
HELX_P HELX_P19 19 ASP C 108 ? SER C 128 ? ASP D 229 SER D 249 1 ? 21 
HELX_P HELX_P20 20 LYS C 137 ? GLU C 139 ? LYS D 258 GLU D 260 5 ? 3  
HELX_P HELX_P21 21 THR C 171 ? LEU C 175 ? THR D 292 LEU D 296 5 ? 5  
HELX_P HELX_P22 22 PRO C 176 ? GLU C 181 ? PRO D 297 GLU D 302 1 ? 6  
HELX_P HELX_P23 23 LYS C 188 ? GLY C 204 ? LYS D 309 GLY D 325 1 ? 17 
HELX_P HELX_P24 24 THR C 212 ? VAL C 223 ? THR D 333 VAL D 344 1 ? 12 
HELX_P HELX_P25 25 THR C 232 ? LEU C 243 ? THR D 353 LEU D 364 1 ? 12 
HELX_P HELX_P26 26 ASN C 246 ? ARG C 250 ? ASN D 367 ARG D 371 5 ? 5  
HELX_P HELX_P27 27 MET C 252 ? HIS C 259 ? MET D 373 HIS D 380 1 ? 8  
HELX_P HELX_P28 28 HIS C 259 ? SER C 266 ? HIS D 380 SER D 387 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
DA ? 5 ? 
DB ? 2 ? 
DC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DA 4 5 ? anti-parallel 
DB 1 2 ? anti-parallel 
DC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 PHE A 12  ? LYS A 20  ? PHE A 133 LYS A 141 
AA 2 ASN A 25  ? GLU A 31  ? ASN A 146 GLU A 152 
AA 3 ILE A 37  ? PHE A 44  ? ILE A 158 PHE A 165 
AA 4 ARG A 84  ? LEU A 89  ? ARG A 205 LEU A 210 
AA 5 LEU A 75  ? HIS A 80  ? LEU A 196 HIS A 201 
AB 1 VAL A 131 ? ILE A 132 ? VAL A 252 ILE A 253 
AB 2 VAL A 158 ? HIS A 159 ? VAL A 279 HIS A 280 
AC 1 LEU A 141 ? LEU A 143 ? LEU A 262 LEU A 264 
AC 2 LEU A 149 ? ILE A 151 ? LEU A 270 ILE A 272 
DA 1 PHE C 12  ? GLY C 19  ? PHE D 133 GLY D 140 
DA 2 GLY C 24  ? GLU C 31  ? GLY D 145 GLU D 152 
DA 3 ILE C 37  ? PHE C 44  ? ILE D 158 PHE D 165 
DA 4 ARG C 84  ? LEU C 89  ? ARG D 205 LEU D 210 
DA 5 LEU C 75  ? HIS C 80  ? LEU D 196 HIS D 201 
DB 1 VAL C 131 ? ILE C 132 ? VAL D 252 ILE D 253 
DB 2 VAL C 158 ? HIS C 159 ? VAL D 279 HIS D 280 
DC 1 LEU C 141 ? LEU C 143 ? LEU D 262 LEU D 264 
DC 2 LEU C 149 ? ILE C 151 ? LEU D 270 ILE D 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 18  ? N LEU A 139 O VAL A 26  ? O VAL A 147 
AA 2 3 N ALA A 29  ? N ALA A 150 O LEU A 38  ? O LEU A 159 
AA 3 4 N LEU A 43  ? N LEU A 164 O VAL A 85  ? O VAL A 206 
AA 4 5 O ILE A 88  ? O ILE A 209 N TYR A 76  ? N TYR A 197 
AB 1 2 N ILE A 132 ? N ILE A 253 O VAL A 158 ? O VAL A 279 
AC 1 2 N LEU A 142 ? N LEU A 263 O LYS A 150 ? O LYS A 271 
DA 1 2 N LEU C 18  ? N LEU D 139 O VAL C 26  ? O VAL D 147 
DA 2 3 N ALA C 29  ? N ALA D 150 O LEU C 38  ? O LEU D 159 
DA 3 4 N LEU C 43  ? N LEU D 164 O VAL C 85  ? O VAL D 206 
DA 4 5 O ILE C 88  ? O ILE D 209 N TYR C 76  ? N TYR D 197 
DB 1 2 N ILE C 132 ? N ILE D 253 O VAL C 158 ? O VAL D 279 
DC 1 2 N LEU C 142 ? N LEU D 263 O LYS C 150 ? O LYS D 271 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE ACP A 1389' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE ACP D 1391' 
AC3 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 1392' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 LEU A 18  ? LEU A 139  . ? 1_555 ? 
2  AC1 12 LYS A 20  ? LYS A 141  . ? 1_555 ? 
3  AC1 12 GLY A 21  ? GLY A 142  . ? 1_555 ? 
4  AC1 12 LYS A 22  ? LYS A 143  . ? 1_555 ? 
5  AC1 12 VAL A 26  ? VAL A 147  . ? 1_555 ? 
6  AC1 12 LYS A 41  ? LYS A 162  . ? 1_555 ? 
7  AC1 12 LEU A 73  ? LEU A 194  . ? 1_555 ? 
8  AC1 12 GLU A 90  ? GLU A 211  . ? 1_555 ? 
9  AC1 12 ALA A 92  ? ALA A 213  . ? 1_555 ? 
10 AC1 12 THR A 96  ? THR A 217  . ? 1_555 ? 
11 AC1 12 LEU A 142 ? LEU A 263  . ? 1_555 ? 
12 AC1 12 HOH H .   ? HOH A 2004 . ? 1_555 ? 
13 AC2 11 LEU C 18  ? LEU D 139  . ? 1_555 ? 
14 AC2 11 GLY C 19  ? GLY D 140  . ? 1_555 ? 
15 AC2 11 LYS C 22  ? LYS D 143  . ? 1_555 ? 
16 AC2 11 VAL C 26  ? VAL D 147  . ? 1_555 ? 
17 AC2 11 ALA C 39  ? ALA D 160  . ? 1_555 ? 
18 AC2 11 LYS C 41  ? LYS D 162  . ? 1_555 ? 
19 AC2 11 LEU C 73  ? LEU D 194  . ? 1_555 ? 
20 AC2 11 GLU C 90  ? GLU D 211  . ? 1_555 ? 
21 AC2 11 TYR C 91  ? TYR D 212  . ? 1_555 ? 
22 AC2 11 ALA C 92  ? ALA D 213  . ? 1_555 ? 
23 AC2 11 ASP C 153 ? ASP D 274  . ? 1_555 ? 
24 AC3 3  ARG A 134 ? ARG A 255  . ? 1_555 ? 
25 AC3 3  ARG C 134 ? ARG D 255  . ? 1_555 ? 
26 AC3 3  ARG C 183 ? ARG D 304  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4C3P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4C3P 
_atom_sites.fract_transf_matrix[1][1]   0.020029 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011532 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006513 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 4   ? 28.954  36.199  -27.169 1.00 83.02  ? 125  LYS A N     1 
ATOM   2    C CA    . LYS A 1 4   ? 28.768  35.627  -25.785 1.00 75.15  ? 125  LYS A CA    1 
ATOM   3    C C     . LYS A 1 4   ? 29.473  34.269  -25.678 1.00 76.55  ? 125  LYS A C     1 
ATOM   4    O O     . LYS A 1 4   ? 30.216  33.850  -26.584 1.00 82.91  ? 125  LYS A O     1 
ATOM   5    C CB    . LYS A 1 4   ? 27.276  35.461  -25.425 1.00 65.93  ? 125  LYS A CB    1 
ATOM   6    C CG    . LYS A 1 4   ? 26.427  36.722  -25.493 1.00 61.48  ? 125  LYS A CG    1 
ATOM   7    C CD    . LYS A 1 4   ? 26.083  37.091  -26.925 1.00 59.38  ? 125  LYS A CD    1 
ATOM   8    C CE    . LYS A 1 4   ? 24.851  37.956  -27.009 1.00 64.60  ? 125  LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 4   ? 23.645  37.350  -26.376 1.00 67.07  ? 125  LYS A NZ    1 
ATOM   10   N N     . ARG A 1 5   ? 29.283  33.604  -24.547 1.00 71.17  ? 126  ARG A N     1 
ATOM   11   C CA    . ARG A 1 5   ? 29.445  32.179  -24.518 1.00 66.01  ? 126  ARG A CA    1 
ATOM   12   C C     . ARG A 1 5   ? 28.008  31.662  -24.459 1.00 58.97  ? 126  ARG A C     1 
ATOM   13   O O     . ARG A 1 5   ? 27.475  31.226  -25.470 1.00 58.26  ? 126  ARG A O     1 
ATOM   14   C CB    . ARG A 1 5   ? 30.324  31.703  -23.361 1.00 67.20  ? 126  ARG A CB    1 
ATOM   15   C CG    . ARG A 1 5   ? 30.761  30.245  -23.521 1.00 74.58  ? 126  ARG A CG    1 
ATOM   16   C CD    . ARG A 1 5   ? 32.169  30.041  -24.092 1.00 75.11  ? 126  ARG A CD    1 
ATOM   17   N NE    . ARG A 1 5   ? 33.072  29.542  -23.049 1.00 77.23  ? 126  ARG A NE    1 
ATOM   18   C CZ    . ARG A 1 5   ? 33.769  30.303  -22.202 1.00 79.71  ? 126  ARG A CZ    1 
ATOM   19   N NH1   . ARG A 1 5   ? 33.710  31.636  -22.257 1.00 77.89  ? 126  ARG A NH1   1 
ATOM   20   N NH2   . ARG A 1 5   ? 34.538  29.720  -21.283 1.00 78.35  ? 126  ARG A NH2   1 
ATOM   21   N N     . GLN A 1 6   ? 27.345  31.818  -23.321 1.00 54.52  ? 127  GLN A N     1 
ATOM   22   C CA    . GLN A 1 6   ? 26.129  31.048  -23.054 1.00 53.08  ? 127  GLN A CA    1 
ATOM   23   C C     . GLN A 1 6   ? 24.829  31.785  -23.441 1.00 52.90  ? 127  GLN A C     1 
ATOM   24   O O     . GLN A 1 6   ? 24.757  33.028  -23.418 1.00 55.40  ? 127  GLN A O     1 
ATOM   25   C CB    . GLN A 1 6   ? 26.090  30.631  -21.582 1.00 48.27  ? 127  GLN A CB    1 
ATOM   26   C CG    . GLN A 1 6   ? 27.376  30.012  -21.082 1.00 48.58  ? 127  GLN A CG    1 
ATOM   27   C CD    . GLN A 1 6   ? 27.621  28.670  -21.696 1.00 50.42  ? 127  GLN A CD    1 
ATOM   28   O OE1   . GLN A 1 6   ? 28.358  28.542  -22.678 1.00 50.66  ? 127  GLN A OE1   1 
ATOM   29   N NE2   . GLN A 1 6   ? 26.966  27.651  -21.145 1.00 53.88  ? 127  GLN A NE2   1 
ATOM   30   N N     . TRP A 1 7   ? 23.808  31.012  -23.801 1.00 44.33  ? 128  TRP A N     1 
ATOM   31   C CA    . TRP A 1 7   ? 22.540  31.597  -24.101 1.00 44.45  ? 128  TRP A CA    1 
ATOM   32   C C     . TRP A 1 7   ? 21.947  32.165  -22.837 1.00 42.86  ? 128  TRP A C     1 
ATOM   33   O O     . TRP A 1 7   ? 22.086  31.581  -21.760 1.00 43.41  ? 128  TRP A O     1 
ATOM   34   C CB    . TRP A 1 7   ? 21.574  30.579  -24.741 1.00 47.10  ? 128  TRP A CB    1 
ATOM   35   C CG    . TRP A 1 7   ? 21.637  30.633  -26.220 1.00 51.80  ? 128  TRP A CG    1 
ATOM   36   C CD1   . TRP A 1 7   ? 21.402  31.736  -27.046 1.00 51.65  ? 128  TRP A CD1   1 
ATOM   37   C CD2   . TRP A 1 7   ? 22.002  29.577  -27.069 1.00 54.11  ? 128  TRP A CD2   1 
ATOM   38   N NE1   . TRP A 1 7   ? 21.603  31.397  -28.359 1.00 52.51  ? 128  TRP A NE1   1 
ATOM   39   C CE2   . TRP A 1 7   ? 21.970  30.074  -28.401 1.00 58.17  ? 128  TRP A CE2   1 
ATOM   40   C CE3   . TRP A 1 7   ? 22.358  28.252  -26.845 1.00 58.81  ? 128  TRP A CE3   1 
ATOM   41   C CZ2   . TRP A 1 7   ? 22.280  29.280  -29.485 1.00 65.27  ? 128  TRP A CZ2   1 
ATOM   42   C CZ3   . TRP A 1 7   ? 22.669  27.456  -27.925 1.00 67.74  ? 128  TRP A CZ3   1 
ATOM   43   C CH2   . TRP A 1 7   ? 22.625  27.967  -29.229 1.00 74.96  ? 128  TRP A CH2   1 
ATOM   44   N N     . ALA A 1 8   ? 21.266  33.298  -22.974 1.00 40.84  ? 129  ALA A N     1 
ATOM   45   C CA    . ALA A 1 8   ? 20.367  33.773  -21.920 1.00 39.48  ? 129  ALA A CA    1 
ATOM   46   C C     . ALA A 1 8   ? 19.047  34.221  -22.527 1.00 39.23  ? 129  ALA A C     1 
ATOM   47   O O     . ALA A 1 8   ? 19.011  34.655  -23.676 1.00 37.83  ? 129  ALA A O     1 
ATOM   48   C CB    . ALA A 1 8   ? 21.007  34.903  -21.148 1.00 38.17  ? 129  ALA A CB    1 
ATOM   49   N N     . LEU A 1 9   ? 17.967  34.128  -21.743 1.00 41.84  ? 130  LEU A N     1 
ATOM   50   C CA    . LEU A 1 9   ? 16.612  34.500  -22.202 1.00 40.57  ? 130  LEU A CA    1 
ATOM   51   C C     . LEU A 1 9   ? 16.584  35.882  -22.844 1.00 44.36  ? 130  LEU A C     1 
ATOM   52   O O     . LEU A 1 9   ? 15.840  36.131  -23.762 1.00 45.93  ? 130  LEU A O     1 
ATOM   53   C CB    . LEU A 1 9   ? 15.641  34.450  -21.039 1.00 38.07  ? 130  LEU A CB    1 
ATOM   54   C CG    . LEU A 1 9   ? 14.159  34.738  -21.309 1.00 39.70  ? 130  LEU A CG    1 
ATOM   55   C CD1   . LEU A 1 9   ? 13.511  33.811  -22.326 1.00 40.66  ? 130  LEU A CD1   1 
ATOM   56   C CD2   . LEU A 1 9   ? 13.395  34.638  -20.005 1.00 40.54  ? 130  LEU A CD2   1 
ATOM   57   N N     . GLU A 1 10  ? 17.462  36.752  -22.380 1.00 52.19  ? 131  GLU A N     1 
ATOM   58   C CA    . GLU A 1 10  ? 17.566  38.125  -22.867 1.00 57.01  ? 131  GLU A CA    1 
ATOM   59   C C     . GLU A 1 10  ? 18.198  38.265  -24.248 1.00 50.53  ? 131  GLU A C     1 
ATOM   60   O O     . GLU A 1 10  ? 18.552  39.361  -24.641 1.00 50.09  ? 131  GLU A O     1 
ATOM   61   C CB    . GLU A 1 10  ? 18.405  38.968  -21.870 1.00 65.19  ? 131  GLU A CB    1 
ATOM   62   C CG    . GLU A 1 10  ? 18.080  38.759  -20.381 1.00 74.26  ? 131  GLU A CG    1 
ATOM   63   C CD    . GLU A 1 10  ? 16.584  38.880  -20.043 1.00 78.28  ? 131  GLU A CD    1 
ATOM   64   O OE1   . GLU A 1 10  ? 15.819  39.518  -20.822 1.00 76.27  ? 131  GLU A OE1   1 
ATOM   65   O OE2   . GLU A 1 10  ? 16.178  38.341  -18.980 1.00 72.01  ? 131  GLU A OE2   1 
ATOM   66   N N     . ASP A 1 11  ? 18.398  37.177  -24.970 1.00 49.76  ? 132  ASP A N     1 
ATOM   67   C CA    . ASP A 1 11  ? 18.958  37.291  -26.318 1.00 49.65  ? 132  ASP A CA    1 
ATOM   68   C C     . ASP A 1 11  ? 17.812  37.290  -27.297 1.00 48.08  ? 132  ASP A C     1 
ATOM   69   O O     . ASP A 1 11  ? 18.013  37.537  -28.479 1.00 47.44  ? 132  ASP A O     1 
ATOM   70   C CB    . ASP A 1 11  ? 19.903  36.131  -26.619 1.00 49.25  ? 132  ASP A CB    1 
ATOM   71   C CG    . ASP A 1 11  ? 20.916  35.925  -25.533 1.00 51.22  ? 132  ASP A CG    1 
ATOM   72   O OD1   . ASP A 1 11  ? 20.830  36.650  -24.530 1.00 59.66  ? 132  ASP A OD1   1 
ATOM   73   O OD2   . ASP A 1 11  ? 21.790  35.044  -25.645 1.00 55.27  ? 132  ASP A OD2   1 
ATOM   74   N N     . PHE A 1 12  ? 16.607  37.050  -26.781 1.00 46.12  ? 133  PHE A N     1 
ATOM   75   C CA    . PHE A 1 12  ? 15.467  36.760  -27.604 1.00 45.35  ? 133  PHE A CA    1 
ATOM   76   C C     . PHE A 1 12  ? 14.339  37.737  -27.348 1.00 48.52  ? 133  PHE A C     1 
ATOM   77   O O     . PHE A 1 12  ? 13.882  37.895  -26.213 1.00 49.22  ? 133  PHE A O     1 
ATOM   78   C CB    . PHE A 1 12  ? 14.963  35.326  -27.331 1.00 42.61  ? 133  PHE A CB    1 
ATOM   79   C CG    . PHE A 1 12  ? 16.030  34.261  -27.467 1.00 38.36  ? 133  PHE A CG    1 
ATOM   80   C CD1   . PHE A 1 12  ? 16.327  33.711  -28.697 1.00 37.47  ? 133  PHE A CD1   1 
ATOM   81   C CD2   . PHE A 1 12  ? 16.722  33.818  -26.367 1.00 34.79  ? 133  PHE A CD2   1 
ATOM   82   C CE1   . PHE A 1 12  ? 17.302  32.746  -28.834 1.00 35.49  ? 133  PHE A CE1   1 
ATOM   83   C CE2   . PHE A 1 12  ? 17.690  32.857  -26.484 1.00 33.33  ? 133  PHE A CE2   1 
ATOM   84   C CZ    . PHE A 1 12  ? 17.992  32.324  -27.721 1.00 34.94  ? 133  PHE A CZ    1 
ATOM   85   N N     . GLU A 1 13  ? 13.894  38.389  -28.416 1.00 50.38  ? 134  GLU A N     1 
ATOM   86   C CA    . GLU A 1 13  ? 12.542  38.895  -28.477 1.00 50.27  ? 134  GLU A CA    1 
ATOM   87   C C     . GLU A 1 13  ? 11.668  37.672  -28.612 1.00 47.99  ? 134  GLU A C     1 
ATOM   88   O O     . GLU A 1 13  ? 12.091  36.676  -29.143 1.00 54.95  ? 134  GLU A O     1 
ATOM   89   C CB    . GLU A 1 13  ? 12.320  39.749  -29.705 1.00 56.91  ? 134  GLU A CB    1 
ATOM   90   C CG    . GLU A 1 13  ? 12.954  41.125  -29.699 1.00 61.88  ? 134  GLU A CG    1 
ATOM   91   C CD    . GLU A 1 13  ? 12.546  41.938  -30.929 1.00 70.57  ? 134  GLU A CD    1 
ATOM   92   O OE1   . GLU A 1 13  ? 11.320  42.014  -31.235 1.00 66.40  ? 134  GLU A OE1   1 
ATOM   93   O OE2   . GLU A 1 13  ? 13.455  42.488  -31.601 1.00 75.84  ? 134  GLU A OE2   1 
ATOM   94   N N     . ILE A 1 14  ? 10.431  37.791  -28.184 1.00 45.83  ? 135  ILE A N     1 
ATOM   95   C CA    . ILE A 1 14  ? 9.529   36.690  -27.997 1.00 46.11  ? 135  ILE A CA    1 
ATOM   96   C C     . ILE A 1 14  ? 8.177   37.134  -28.562 1.00 47.86  ? 135  ILE A C     1 
ATOM   97   O O     . ILE A 1 14  ? 7.690   38.200  -28.215 1.00 49.16  ? 135  ILE A O     1 
ATOM   98   C CB    . ILE A 1 14  ? 9.346   36.465  -26.488 1.00 47.06  ? 135  ILE A CB    1 
ATOM   99   C CG1   . ILE A 1 14  ? 10.673  36.084  -25.824 1.00 48.50  ? 135  ILE A CG1   1 
ATOM   100  C CG2   . ILE A 1 14  ? 8.236   35.463  -26.204 1.00 46.62  ? 135  ILE A CG2   1 
ATOM   101  C CD1   . ILE A 1 14  ? 10.895  34.601  -25.684 1.00 51.23  ? 135  ILE A CD1   1 
ATOM   102  N N     . GLY A 1 15  ? 7.563   36.318  -29.407 1.00 46.56  ? 136  GLY A N     1 
ATOM   103  C CA    . GLY A 1 15  ? 6.318   36.692  -30.079 1.00 45.10  ? 136  GLY A CA    1 
ATOM   104  C C     . GLY A 1 15  ? 5.154   35.841  -29.645 1.00 44.19  ? 136  GLY A C     1 
ATOM   105  O O     . GLY A 1 15  ? 5.015   35.540  -28.477 1.00 49.36  ? 136  GLY A O     1 
ATOM   106  N N     . ARG A 1 16  ? 4.314   35.434  -30.582 1.00 44.53  ? 137  ARG A N     1 
ATOM   107  C CA    . ARG A 1 16  ? 3.069   34.741  -30.218 1.00 44.34  ? 137  ARG A CA    1 
ATOM   108  C C     . ARG A 1 16  ? 3.307   33.312  -29.742 1.00 47.24  ? 137  ARG A C     1 
ATOM   109  O O     . ARG A 1 16  ? 4.283   32.683  -30.147 1.00 50.52  ? 137  ARG A O     1 
ATOM   110  C CB    . ARG A 1 16  ? 2.103   34.715  -31.408 1.00 43.99  ? 137  ARG A CB    1 
ATOM   111  C CG    . ARG A 1 16  ? 2.741   34.478  -32.774 1.00 43.03  ? 137  ARG A CG    1 
ATOM   112  C CD    . ARG A 1 16  ? 1.675   34.304  -33.841 1.00 42.67  ? 137  ARG A CD    1 
ATOM   113  N NE    . ARG A 1 16  ? 1.461   32.907  -34.194 1.00 42.11  ? 137  ARG A NE    1 
ATOM   114  C CZ    . ARG A 1 16  ? 2.008   32.291  -35.239 1.00 39.62  ? 137  ARG A CZ    1 
ATOM   115  N NH1   . ARG A 1 16  ? 2.827   32.914  -36.070 1.00 39.77  ? 137  ARG A NH1   1 
ATOM   116  N NH2   . ARG A 1 16  ? 1.751   31.018  -35.438 1.00 39.06  ? 137  ARG A NH2   1 
ATOM   117  N N     . PRO A 1 17  ? 2.418   32.784  -28.891 1.00 50.04  ? 138  PRO A N     1 
ATOM   118  C CA    . PRO A 1 17  ? 2.492   31.354  -28.622 1.00 52.34  ? 138  PRO A CA    1 
ATOM   119  C C     . PRO A 1 17  ? 2.146   30.534  -29.842 1.00 54.71  ? 138  PRO A C     1 
ATOM   120  O O     . PRO A 1 17  ? 1.104   30.773  -30.458 1.00 53.22  ? 138  PRO A O     1 
ATOM   121  C CB    . PRO A 1 17  ? 1.433   31.126  -27.534 1.00 53.72  ? 138  PRO A CB    1 
ATOM   122  C CG    . PRO A 1 17  ? 0.623   32.376  -27.498 1.00 55.15  ? 138  PRO A CG    1 
ATOM   123  C CD    . PRO A 1 17  ? 1.557   33.464  -27.917 1.00 54.29  ? 138  PRO A CD    1 
ATOM   124  N N     . LEU A 1 18  ? 3.016   29.567  -30.166 1.00 54.54  ? 139  LEU A N     1 
ATOM   125  C CA    . LEU A 1 18  ? 2.801   28.645  -31.279 1.00 46.10  ? 139  LEU A CA    1 
ATOM   126  C C     . LEU A 1 18  ? 2.019   27.450  -30.841 1.00 45.28  ? 139  LEU A C     1 
ATOM   127  O O     . LEU A 1 18  ? 1.599   26.648  -31.674 1.00 44.38  ? 139  LEU A O     1 
ATOM   128  C CB    . LEU A 1 18  ? 4.117   28.170  -31.849 1.00 47.66  ? 139  LEU A CB    1 
ATOM   129  C CG    . LEU A 1 18  ? 4.995   29.264  -32.429 1.00 50.34  ? 139  LEU A CG    1 
ATOM   130  C CD1   . LEU A 1 18  ? 6.345   28.691  -32.839 1.00 53.91  ? 139  LEU A CD1   1 
ATOM   131  C CD2   . LEU A 1 18  ? 4.291   29.906  -33.608 1.00 49.82  ? 139  LEU A CD2   1 
ATOM   132  N N     . GLY A 1 19  ? 1.817   27.302  -29.541 1.00 46.78  ? 140  GLY A N     1 
ATOM   133  C CA    . GLY A 1 19  ? 0.939   26.254  -29.062 1.00 49.65  ? 140  GLY A CA    1 
ATOM   134  C C     . GLY A 1 19  ? 1.270   25.815  -27.672 1.00 50.30  ? 140  GLY A C     1 
ATOM   135  O O     . GLY A 1 19  ? 2.188   26.350  -27.051 1.00 51.17  ? 140  GLY A O     1 
ATOM   136  N N     . LYS A 1 20  ? 0.503   24.847  -27.185 1.00 53.18  ? 141  LYS A N     1 
ATOM   137  C CA    . LYS A 1 20  ? 0.653   24.358  -25.824 1.00 61.03  ? 141  LYS A CA    1 
ATOM   138  C C     . LYS A 1 20  ? 1.100   22.908  -25.841 1.00 64.17  ? 141  LYS A C     1 
ATOM   139  O O     . LYS A 1 20  ? 0.593   22.098  -26.626 1.00 65.40  ? 141  LYS A O     1 
ATOM   140  C CB    . LYS A 1 20  ? -0.666  24.481  -25.057 1.00 65.49  ? 141  LYS A CB    1 
ATOM   141  C CG    . LYS A 1 20  ? -0.611  24.014  -23.606 1.00 68.42  ? 141  LYS A CG    1 
ATOM   142  C CD    . LYS A 1 20  ? -2.009  23.986  -22.997 1.00 71.20  ? 141  LYS A CD    1 
ATOM   143  C CE    . LYS A 1 20  ? -2.070  23.207  -21.688 1.00 72.40  ? 141  LYS A CE    1 
ATOM   144  N NZ    . LYS A 1 20  ? -1.785  21.752  -21.851 1.00 73.19  ? 141  LYS A NZ    1 
ATOM   145  N N     . GLY A 1 21  ? 2.062   22.600  -24.972 1.00 66.94  ? 142  GLY A N     1 
ATOM   146  C CA    . GLY A 1 21  ? 2.467   21.230  -24.687 1.00 65.18  ? 142  GLY A CA    1 
ATOM   147  C C     . GLY A 1 21  ? 2.034   20.810  -23.292 1.00 64.43  ? 142  GLY A C     1 
ATOM   148  O O     . GLY A 1 21  ? 1.447   21.593  -22.539 1.00 62.21  ? 142  GLY A O     1 
ATOM   149  N N     . LYS A 1 22  ? 2.327   19.560  -22.956 1.00 67.29  ? 143  LYS A N     1 
ATOM   150  C CA    . LYS A 1 22  ? 2.128   19.063  -21.601 1.00 68.58  ? 143  LYS A CA    1 
ATOM   151  C C     . LYS A 1 22  ? 2.741   20.022  -20.572 1.00 64.16  ? 143  LYS A C     1 
ATOM   152  O O     . LYS A 1 22  ? 2.041   20.524  -19.700 1.00 62.20  ? 143  LYS A O     1 
ATOM   153  C CB    . LYS A 1 22  ? 2.770   17.682  -21.428 1.00 74.33  ? 143  LYS A CB    1 
ATOM   154  C CG    . LYS A 1 22  ? 2.408   16.620  -22.464 1.00 77.21  ? 143  LYS A CG    1 
ATOM   155  C CD    . LYS A 1 22  ? 2.921   15.256  -22.001 1.00 81.02  ? 143  LYS A CD    1 
ATOM   156  C CE    . LYS A 1 22  ? 3.443   14.388  -23.139 1.00 85.22  ? 143  LYS A CE    1 
ATOM   157  N NZ    . LYS A 1 22  ? 2.352   13.687  -23.871 1.00 86.18  ? 143  LYS A NZ    1 
ATOM   158  N N     . PHE A 1 23  ? 4.039   20.296  -20.710 1.00 62.43  ? 144  PHE A N     1 
ATOM   159  C CA    . PHE A 1 23  ? 4.830   20.918  -19.633 1.00 60.06  ? 144  PHE A CA    1 
ATOM   160  C C     . PHE A 1 23  ? 5.170   22.394  -19.785 1.00 55.07  ? 144  PHE A C     1 
ATOM   161  O O     . PHE A 1 23  ? 5.988   22.929  -19.036 1.00 55.89  ? 144  PHE A O     1 
ATOM   162  C CB    . PHE A 1 23  ? 6.100   20.106  -19.425 1.00 56.23  ? 144  PHE A CB    1 
ATOM   163  C CG    . PHE A 1 23  ? 5.819   18.691  -19.082 1.00 55.48  ? 144  PHE A CG    1 
ATOM   164  C CD1   . PHE A 1 23  ? 5.221   18.381  -17.879 1.00 60.11  ? 144  PHE A CD1   1 
ATOM   165  C CD2   . PHE A 1 23  ? 6.109   17.684  -19.961 1.00 56.78  ? 144  PHE A CD2   1 
ATOM   166  C CE1   . PHE A 1 23  ? 4.934   17.083  -17.541 1.00 60.89  ? 144  PHE A CE1   1 
ATOM   167  C CE2   . PHE A 1 23  ? 5.829   16.376  -19.644 1.00 60.65  ? 144  PHE A CE2   1 
ATOM   168  C CZ    . PHE A 1 23  ? 5.235   16.074  -18.431 1.00 65.07  ? 144  PHE A CZ    1 
ATOM   169  N N     . GLY A 1 24  ? 4.495   23.061  -20.706 1.00 49.87  ? 145  GLY A N     1 
ATOM   170  C CA    . GLY A 1 24  ? 4.743   24.469  -20.973 1.00 49.21  ? 145  GLY A CA    1 
ATOM   171  C C     . GLY A 1 24  ? 4.369   24.779  -22.411 1.00 48.93  ? 145  GLY A C     1 
ATOM   172  O O     . GLY A 1 24  ? 3.760   23.952  -23.081 1.00 50.50  ? 145  GLY A O     1 
ATOM   173  N N     . ASN A 1 25  ? 4.752   25.953  -22.895 1.00 46.54  ? 146  ASN A N     1 
ATOM   174  C CA    . ASN A 1 25  ? 4.276   26.419  -24.179 1.00 48.56  ? 146  ASN A CA    1 
ATOM   175  C C     . ASN A 1 25  ? 5.421   26.718  -25.123 1.00 42.63  ? 146  ASN A C     1 
ATOM   176  O O     . ASN A 1 25  ? 6.534   27.041  -24.693 1.00 41.52  ? 146  ASN A O     1 
ATOM   177  C CB    . ASN A 1 25  ? 3.379   27.657  -23.982 1.00 59.06  ? 146  ASN A CB    1 
ATOM   178  C CG    . ASN A 1 25  ? 2.094   27.344  -23.194 1.00 65.98  ? 146  ASN A CG    1 
ATOM   179  O OD1   . ASN A 1 25  ? 2.115   27.194  -21.960 1.00 70.89  ? 146  ASN A OD1   1 
ATOM   180  N ND2   . ASN A 1 25  ? 0.967   27.245  -23.908 1.00 67.36  ? 146  ASN A ND2   1 
ATOM   181  N N     . VAL A 1 26  ? 5.163   26.584  -26.415 1.00 37.45  ? 147  VAL A N     1 
ATOM   182  C CA    . VAL A 1 26  ? 6.147   26.986  -27.404 1.00 37.06  ? 147  VAL A CA    1 
ATOM   183  C C     . VAL A 1 26  ? 5.854   28.379  -27.926 1.00 38.30  ? 147  VAL A C     1 
ATOM   184  O O     . VAL A 1 26  ? 4.699   28.687  -28.282 1.00 42.95  ? 147  VAL A O     1 
ATOM   185  C CB    . VAL A 1 26  ? 6.128   26.073  -28.605 1.00 36.37  ? 147  VAL A CB    1 
ATOM   186  C CG1   . VAL A 1 26  ? 7.339   26.375  -29.476 1.00 38.02  ? 147  VAL A CG1   1 
ATOM   187  C CG2   . VAL A 1 26  ? 6.051   24.626  -28.146 1.00 35.86  ? 147  VAL A CG2   1 
ATOM   188  N N     . TYR A 1 27  ? 6.885   29.210  -27.992 1.00 36.41  ? 148  TYR A N     1 
ATOM   189  C CA    . TYR A 1 27  ? 6.736   30.570  -28.500 1.00 38.79  ? 148  TYR A CA    1 
ATOM   190  C C     . TYR A 1 27  ? 7.477   30.767  -29.795 1.00 39.79  ? 148  TYR A C     1 
ATOM   191  O O     . TYR A 1 27  ? 8.483   30.124  -30.047 1.00 42.95  ? 148  TYR A O     1 
ATOM   192  C CB    . TYR A 1 27  ? 7.287   31.577  -27.506 1.00 38.54  ? 148  TYR A CB    1 
ATOM   193  C CG    . TYR A 1 27  ? 6.495   31.610  -26.242 1.00 42.83  ? 148  TYR A CG    1 
ATOM   194  C CD1   . TYR A 1 27  ? 6.726   30.682  -25.254 1.00 43.55  ? 148  TYR A CD1   1 
ATOM   195  C CD2   . TYR A 1 27  ? 5.484   32.549  -26.045 1.00 43.25  ? 148  TYR A CD2   1 
ATOM   196  C CE1   . TYR A 1 27  ? 6.003   30.684  -24.089 1.00 44.45  ? 148  TYR A CE1   1 
ATOM   197  C CE2   . TYR A 1 27  ? 4.754   32.555  -24.881 1.00 44.65  ? 148  TYR A CE2   1 
ATOM   198  C CZ    . TYR A 1 27  ? 5.019   31.617  -23.903 1.00 45.68  ? 148  TYR A CZ    1 
ATOM   199  O OH    . TYR A 1 27  ? 4.304   31.577  -22.729 1.00 45.97  ? 148  TYR A OH    1 
ATOM   200  N N     . LEU A 1 28  ? 6.999   31.696  -30.604 1.00 39.51  ? 149  LEU A N     1 
ATOM   201  C CA    . LEU A 1 28  ? 7.816   32.215  -31.674 1.00 37.94  ? 149  LEU A CA    1 
ATOM   202  C C     . LEU A 1 28  ? 8.895   33.087  -31.028 1.00 35.69  ? 149  LEU A C     1 
ATOM   203  O O     . LEU A 1 28  ? 8.777   33.507  -29.874 1.00 37.09  ? 149  LEU A O     1 
ATOM   204  C CB    . LEU A 1 28  ? 6.958   33.000  -32.666 1.00 38.65  ? 149  LEU A CB    1 
ATOM   205  C CG    . LEU A 1 28  ? 7.666   33.389  -33.971 1.00 39.65  ? 149  LEU A CG    1 
ATOM   206  C CD1   . LEU A 1 28  ? 7.975   32.155  -34.801 1.00 41.04  ? 149  LEU A CD1   1 
ATOM   207  C CD2   . LEU A 1 28  ? 6.841   34.366  -34.789 1.00 40.58  ? 149  LEU A CD2   1 
ATOM   208  N N     . ALA A 1 29  ? 9.964   33.351  -31.747 1.00 34.02  ? 150  ALA A N     1 
ATOM   209  C CA    . ALA A 1 29  ? 11.051  34.100  -31.148 1.00 33.92  ? 150  ALA A CA    1 
ATOM   210  C C     . ALA A 1 29  ? 12.109  34.496  -32.148 1.00 33.95  ? 150  ALA A C     1 
ATOM   211  O O     . ALA A 1 29  ? 12.236  33.918  -33.221 1.00 35.31  ? 150  ALA A O     1 
ATOM   212  C CB    . ALA A 1 29  ? 11.683  33.279  -30.024 1.00 35.49  ? 150  ALA A CB    1 
ATOM   213  N N     . ARG A 1 30  ? 12.893  35.480  -31.764 1.00 37.15  ? 151  ARG A N     1 
ATOM   214  C CA    . ARG A 1 30  ? 13.911  36.026  -32.629 1.00 42.30  ? 151  ARG A CA    1 
ATOM   215  C C     . ARG A 1 30  ? 15.170  36.286  -31.792 1.00 42.87  ? 151  ARG A C     1 
ATOM   216  O O     . ARG A 1 30  ? 15.089  36.753  -30.653 1.00 46.33  ? 151  ARG A O     1 
ATOM   217  C CB    . ARG A 1 30  ? 13.338  37.306  -33.197 1.00 45.50  ? 151  ARG A CB    1 
ATOM   218  C CG    . ARG A 1 30  ? 14.179  38.057  -34.194 1.00 49.55  ? 151  ARG A CG    1 
ATOM   219  C CD    . ARG A 1 30  ? 13.344  39.189  -34.770 1.00 50.31  ? 151  ARG A CD    1 
ATOM   220  N NE    . ARG A 1 30  ? 12.691  38.787  -36.013 1.00 54.27  ? 151  ARG A NE    1 
ATOM   221  C CZ    . ARG A 1 30  ? 11.443  39.097  -36.387 1.00 52.96  ? 151  ARG A CZ    1 
ATOM   222  N NH1   . ARG A 1 30  ? 10.638  39.805  -35.600 1.00 51.78  ? 151  ARG A NH1   1 
ATOM   223  N NH2   . ARG A 1 30  ? 10.988  38.667  -37.570 1.00 51.64  ? 151  ARG A NH2   1 
ATOM   224  N N     . GLU A 1 31  ? 16.327  35.941  -32.320 1.00 41.54  ? 152  GLU A N     1 
ATOM   225  C CA    . GLU A 1 31  ? 17.563  36.195  -31.600 1.00 45.15  ? 152  GLU A CA    1 
ATOM   226  C C     . GLU A 1 31  ? 17.834  37.662  -31.893 1.00 47.57  ? 152  GLU A C     1 
ATOM   227  O O     . GLU A 1 31  ? 17.714  38.066  -33.040 1.00 50.19  ? 152  GLU A O     1 
ATOM   228  C CB    . GLU A 1 31  ? 18.674  35.289  -32.114 1.00 46.76  ? 152  GLU A CB    1 
ATOM   229  C CG    . GLU A 1 31  ? 19.931  35.270  -31.268 1.00 56.22  ? 152  GLU A CG    1 
ATOM   230  C CD    . GLU A 1 31  ? 20.903  36.416  -31.593 1.00 65.61  ? 152  GLU A CD    1 
ATOM   231  O OE1   . GLU A 1 31  ? 21.357  36.533  -32.765 1.00 69.61  ? 152  GLU A OE1   1 
ATOM   232  O OE2   . GLU A 1 31  ? 21.226  37.203  -30.668 1.00 67.48  ? 152  GLU A OE2   1 
ATOM   233  N N     . LYS A 1 32  ? 18.133  38.467  -30.872 1.00 46.14  ? 153  LYS A N     1 
ATOM   234  C CA    . LYS A 1 32  ? 18.325  39.913  -31.063 1.00 45.33  ? 153  LYS A CA    1 
ATOM   235  C C     . LYS A 1 32  ? 19.437  40.222  -32.080 1.00 46.23  ? 153  LYS A C     1 
ATOM   236  O O     . LYS A 1 32  ? 19.181  40.834  -33.097 1.00 57.49  ? 153  LYS A O     1 
ATOM   237  C CB    . LYS A 1 32  ? 18.637  40.614  -29.740 1.00 44.75  ? 153  LYS A CB    1 
ATOM   238  C CG    . LYS A 1 32  ? 17.490  40.729  -28.733 1.00 45.93  ? 153  LYS A CG    1 
ATOM   239  C CD    . LYS A 1 32  ? 18.078  41.053  -27.358 1.00 47.68  ? 153  LYS A CD    1 
ATOM   240  C CE    . LYS A 1 32  ? 17.085  41.629  -26.351 1.00 53.64  ? 153  LYS A CE    1 
ATOM   241  N NZ    . LYS A 1 32  ? 16.061  40.657  -25.857 1.00 56.58  ? 153  LYS A NZ    1 
ATOM   242  N N     . GLN A 1 33  ? 20.654  39.772  -31.826 1.00 45.60  ? 154  GLN A N     1 
ATOM   243  C CA    . GLN A 1 33  ? 21.821  40.195  -32.602 1.00 48.38  ? 154  GLN A CA    1 
ATOM   244  C C     . GLN A 1 33  ? 21.828  39.824  -34.096 1.00 52.65  ? 154  GLN A C     1 
ATOM   245  O O     . GLN A 1 33  ? 22.532  40.460  -34.886 1.00 53.52  ? 154  GLN A O     1 
ATOM   246  C CB    . GLN A 1 33  ? 23.094  39.667  -31.939 1.00 50.86  ? 154  GLN A CB    1 
ATOM   247  C CG    . GLN A 1 33  ? 23.150  40.039  -30.464 1.00 53.83  ? 154  GLN A CG    1 
ATOM   248  C CD    . GLN A 1 33  ? 24.539  40.027  -29.868 1.00 56.57  ? 154  GLN A CD    1 
ATOM   249  O OE1   . GLN A 1 33  ? 25.490  39.444  -30.424 1.00 55.12  ? 154  GLN A OE1   1 
ATOM   250  N NE2   . GLN A 1 33  ? 24.661  40.661  -28.700 1.00 56.85  ? 154  GLN A NE2   1 
ATOM   251  N N     . SER A 1 34  ? 21.081  38.792  -34.481 1.00 52.25  ? 155  SER A N     1 
ATOM   252  C CA    . SER A 1 34  ? 20.946  38.435  -35.890 1.00 50.76  ? 155  SER A CA    1 
ATOM   253  C C     . SER A 1 34  ? 19.494  38.483  -36.408 1.00 51.03  ? 155  SER A C     1 
ATOM   254  O O     . SER A 1 34  ? 19.243  38.223  -37.577 1.00 50.60  ? 155  SER A O     1 
ATOM   255  C CB    . SER A 1 34  ? 21.519  37.053  -36.119 1.00 50.15  ? 155  SER A CB    1 
ATOM   256  O OG    . SER A 1 34  ? 20.665  36.081  -35.561 1.00 50.42  ? 155  SER A OG    1 
ATOM   257  N N     . LYS A 1 35  ? 18.545  38.802  -35.540 1.00 53.52  ? 156  LYS A N     1 
ATOM   258  C CA    . LYS A 1 35  ? 17.123  38.868  -35.904 1.00 55.24  ? 156  LYS A CA    1 
ATOM   259  C C     . LYS A 1 35  ? 16.554  37.601  -36.588 1.00 52.47  ? 156  LYS A C     1 
ATOM   260  O O     . LYS A 1 35  ? 15.578  37.683  -37.323 1.00 53.00  ? 156  LYS A O     1 
ATOM   261  C CB    . LYS A 1 35  ? 16.879  40.122  -36.734 1.00 57.09  ? 156  LYS A CB    1 
ATOM   262  C CG    . LYS A 1 35  ? 17.096  41.377  -35.917 1.00 61.15  ? 156  LYS A CG    1 
ATOM   263  C CD    . LYS A 1 35  ? 17.559  42.535  -36.769 1.00 65.88  ? 156  LYS A CD    1 
ATOM   264  C CE    . LYS A 1 35  ? 17.923  43.733  -35.907 1.00 72.42  ? 156  LYS A CE    1 
ATOM   265  N NZ    . LYS A 1 35  ? 17.772  45.003  -36.681 1.00 77.61  ? 156  LYS A NZ    1 
ATOM   266  N N     . PHE A 1 36  ? 17.135  36.444  -36.271 1.00 47.79  ? 157  PHE A N     1 
ATOM   267  C CA    . PHE A 1 36  ? 16.792  35.158  -36.872 1.00 46.97  ? 157  PHE A CA    1 
ATOM   268  C C     . PHE A 1 36  ? 15.631  34.530  -36.123 1.00 45.78  ? 157  PHE A C     1 
ATOM   269  O O     . PHE A 1 36  ? 15.587  34.546  -34.885 1.00 46.12  ? 157  PHE A O     1 
ATOM   270  C CB    . PHE A 1 36  ? 18.023  34.236  -36.797 1.00 50.59  ? 157  PHE A CB    1 
ATOM   271  C CG    . PHE A 1 36  ? 17.840  32.871  -37.418 1.00 52.95  ? 157  PHE A CG    1 
ATOM   272  C CD1   . PHE A 1 36  ? 17.117  31.883  -36.773 1.00 56.46  ? 157  PHE A CD1   1 
ATOM   273  C CD2   . PHE A 1 36  ? 18.459  32.554  -38.621 1.00 59.60  ? 157  PHE A CD2   1 
ATOM   274  C CE1   . PHE A 1 36  ? 16.983  30.630  -37.333 1.00 59.77  ? 157  PHE A CE1   1 
ATOM   275  C CE2   . PHE A 1 36  ? 18.334  31.296  -39.187 1.00 59.00  ? 157  PHE A CE2   1 
ATOM   276  C CZ    . PHE A 1 36  ? 17.592  30.335  -38.539 1.00 61.03  ? 157  PHE A CZ    1 
ATOM   277  N N     . ILE A 1 37  ? 14.709  33.945  -36.875 1.00 45.91  ? 158  ILE A N     1 
ATOM   278  C CA    . ILE A 1 37  ? 13.427  33.494  -36.332 1.00 44.30  ? 158  ILE A CA    1 
ATOM   279  C C     . ILE A 1 37  ? 13.499  32.035  -35.922 1.00 43.05  ? 158  ILE A C     1 
ATOM   280  O O     . ILE A 1 37  ? 13.927  31.198  -36.682 1.00 46.61  ? 158  ILE A O     1 
ATOM   281  C CB    . ILE A 1 37  ? 12.285  33.700  -37.344 1.00 43.88  ? 158  ILE A CB    1 
ATOM   282  C CG1   . ILE A 1 37  ? 12.009  35.189  -37.529 1.00 45.36  ? 158  ILE A CG1   1 
ATOM   283  C CG2   . ILE A 1 37  ? 11.005  33.046  -36.867 1.00 45.61  ? 158  ILE A CG2   1 
ATOM   284  C CD1   . ILE A 1 37  ? 11.385  35.837  -36.310 1.00 46.60  ? 158  ILE A CD1   1 
ATOM   285  N N     . LEU A 1 38  ? 13.059  31.744  -34.708 1.00 39.23  ? 159  LEU A N     1 
ATOM   286  C CA    . LEU A 1 38  ? 13.127  30.416  -34.196 1.00 35.39  ? 159  LEU A CA    1 
ATOM   287  C C     . LEU A 1 38  ? 11.971  30.226  -33.283 1.00 34.92  ? 159  LEU A C     1 
ATOM   288  O O     . LEU A 1 38  ? 11.122  31.106  -33.190 1.00 37.93  ? 159  LEU A O     1 
ATOM   289  C CB    . LEU A 1 38  ? 14.444  30.168  -33.489 1.00 35.97  ? 159  LEU A CB    1 
ATOM   290  C CG    . LEU A 1 38  ? 15.189  31.328  -32.883 1.00 39.54  ? 159  LEU A CG    1 
ATOM   291  C CD1   . LEU A 1 38  ? 14.771  31.506  -31.434 1.00 43.34  ? 159  LEU A CD1   1 
ATOM   292  C CD2   . LEU A 1 38  ? 16.681  31.085  -32.983 1.00 39.51  ? 159  LEU A CD2   1 
ATOM   293  N N     . ALA A 1 39  ? 11.888  29.041  -32.694 1.00 33.04  ? 160  ALA A N     1 
ATOM   294  C CA    . ALA A 1 39  ? 10.905  28.737  -31.696 1.00 32.04  ? 160  ALA A CA    1 
ATOM   295  C C     . ALA A 1 39  ? 11.651  28.362  -30.431 1.00 32.57  ? 160  ALA A C     1 
ATOM   296  O O     . ALA A 1 39  ? 12.686  27.700  -30.458 1.00 30.24  ? 160  ALA A O     1 
ATOM   297  C CB    . ALA A 1 39  ? 10.005  27.607  -32.138 1.00 32.89  ? 160  ALA A CB    1 
ATOM   298  N N     . LEU A 1 40  ? 11.087  28.825  -29.324 1.00 34.60  ? 161  LEU A N     1 
ATOM   299  C CA    . LEU A 1 40  ? 11.667  28.734  -28.025 1.00 31.88  ? 161  LEU A CA    1 
ATOM   300  C C     . LEU A 1 40  ? 10.626  27.992  -27.232 1.00 32.55  ? 161  LEU A C     1 
ATOM   301  O O     . LEU A 1 40  ? 9.554   28.511  -26.986 1.00 30.87  ? 161  LEU A O     1 
ATOM   302  C CB    . LEU A 1 40  ? 11.850  30.120  -27.495 1.00 32.27  ? 161  LEU A CB    1 
ATOM   303  C CG    . LEU A 1 40  ? 12.583  30.236  -26.184 1.00 33.32  ? 161  LEU A CG    1 
ATOM   304  C CD1   . LEU A 1 40  ? 14.074  30.144  -26.418 1.00 34.41  ? 161  LEU A CD1   1 
ATOM   305  C CD2   . LEU A 1 40  ? 12.232  31.569  -25.570 1.00 33.68  ? 161  LEU A CD2   1 
ATOM   306  N N     . LYS A 1 41  ? 10.947  26.754  -26.885 1.00 34.34  ? 162  LYS A N     1 
ATOM   307  C CA    . LYS A 1 41  ? 10.059  25.859  -26.164 1.00 37.87  ? 162  LYS A CA    1 
ATOM   308  C C     . LYS A 1 41  ? 10.348  26.005  -24.695 1.00 36.03  ? 162  LYS A C     1 
ATOM   309  O O     . LYS A 1 41  ? 11.471  26.155  -24.314 1.00 38.30  ? 162  LYS A O     1 
ATOM   310  C CB    . LYS A 1 41  ? 10.329  24.436  -26.598 1.00 38.69  ? 162  LYS A CB    1 
ATOM   311  C CG    . LYS A 1 41  ? 9.368   23.429  -26.035 1.00 40.38  ? 162  LYS A CG    1 
ATOM   312  C CD    . LYS A 1 41  ? 9.390   22.193  -26.897 1.00 42.60  ? 162  LYS A CD    1 
ATOM   313  C CE    . LYS A 1 41  ? 8.698   21.065  -26.184 1.00 47.90  ? 162  LYS A CE    1 
ATOM   314  N NZ    . LYS A 1 41  ? 8.170   20.054  -27.142 1.00 53.44  ? 162  LYS A NZ    1 
ATOM   315  N N     . VAL A 1 42  ? 9.330   26.015  -23.869 1.00 38.01  ? 163  VAL A N     1 
ATOM   316  C CA    . VAL A 1 42  ? 9.529   26.357  -22.467 1.00 40.12  ? 163  VAL A CA    1 
ATOM   317  C C     . VAL A 1 42  ? 8.958   25.264  -21.638 1.00 40.19  ? 163  VAL A C     1 
ATOM   318  O O     . VAL A 1 42  ? 7.800   24.893  -21.814 1.00 41.37  ? 163  VAL A O     1 
ATOM   319  C CB    . VAL A 1 42  ? 8.817   27.645  -22.084 1.00 42.87  ? 163  VAL A CB    1 
ATOM   320  C CG1   . VAL A 1 42  ? 8.956   27.888  -20.605 1.00 43.36  ? 163  VAL A CG1   1 
ATOM   321  C CG2   . VAL A 1 42  ? 9.418   28.812  -22.848 1.00 48.67  ? 163  VAL A CG2   1 
ATOM   322  N N     . LEU A 1 43  ? 9.775   24.739  -20.742 1.00 40.33  ? 164  LEU A N     1 
ATOM   323  C CA    . LEU A 1 43  ? 9.380   23.606  -19.956 1.00 41.42  ? 164  LEU A CA    1 
ATOM   324  C C     . LEU A 1 43  ? 9.546   24.003  -18.504 1.00 41.63  ? 164  LEU A C     1 
ATOM   325  O O     . LEU A 1 43  ? 10.616  24.473  -18.099 1.00 41.74  ? 164  LEU A O     1 
ATOM   326  C CB    . LEU A 1 43  ? 10.230  22.404  -20.337 1.00 41.70  ? 164  LEU A CB    1 
ATOM   327  C CG    . LEU A 1 43  ? 10.121  21.972  -21.811 1.00 43.24  ? 164  LEU A CG    1 
ATOM   328  C CD1   . LEU A 1 43  ? 11.472  21.551  -22.346 1.00 45.42  ? 164  LEU A CD1   1 
ATOM   329  C CD2   . LEU A 1 43  ? 9.154   20.823  -22.040 1.00 44.28  ? 164  LEU A CD2   1 
ATOM   330  N N     . PHE A 1 44  ? 8.470   23.823  -17.737 1.00 44.35  ? 165  PHE A N     1 
ATOM   331  C CA    . PHE A 1 44  ? 8.432   24.148  -16.295 1.00 44.86  ? 165  PHE A CA    1 
ATOM   332  C C     . PHE A 1 44  ? 9.076   23.074  -15.428 1.00 40.98  ? 165  PHE A C     1 
ATOM   333  O O     . PHE A 1 44  ? 8.597   21.957  -15.337 1.00 37.11  ? 165  PHE A O     1 
ATOM   334  C CB    . PHE A 1 44  ? 6.979   24.433  -15.849 1.00 47.83  ? 165  PHE A CB    1 
ATOM   335  C CG    . PHE A 1 44  ? 6.498   25.781  -16.285 1.00 52.27  ? 165  PHE A CG    1 
ATOM   336  C CD1   . PHE A 1 44  ? 6.854   26.918  -15.564 1.00 54.35  ? 165  PHE A CD1   1 
ATOM   337  C CD2   . PHE A 1 44  ? 5.785   25.933  -17.462 1.00 52.74  ? 165  PHE A CD2   1 
ATOM   338  C CE1   . PHE A 1 44  ? 6.472   28.172  -15.993 1.00 56.03  ? 165  PHE A CE1   1 
ATOM   339  C CE2   . PHE A 1 44  ? 5.406   27.185  -17.898 1.00 53.56  ? 165  PHE A CE2   1 
ATOM   340  C CZ    . PHE A 1 44  ? 5.741   28.304  -17.164 1.00 56.59  ? 165  PHE A CZ    1 
ATOM   341  N N     . LYS A 1 45  ? 10.173  23.419  -14.773 1.00 43.92  ? 166  LYS A N     1 
ATOM   342  C CA    . LYS A 1 45  ? 10.878  22.444  -13.944 1.00 43.24  ? 166  LYS A CA    1 
ATOM   343  C C     . LYS A 1 45  ? 9.958   21.796  -12.913 1.00 43.75  ? 166  LYS A C     1 
ATOM   344  O O     . LYS A 1 45  ? 9.966   20.587  -12.773 1.00 44.80  ? 166  LYS A O     1 
ATOM   345  C CB    . LYS A 1 45  ? 12.063  23.093  -13.257 1.00 40.79  ? 166  LYS A CB    1 
ATOM   346  C CG    . LYS A 1 45  ? 13.198  23.401  -14.207 1.00 38.89  ? 166  LYS A CG    1 
ATOM   347  C CD    . LYS A 1 45  ? 14.341  24.035  -13.456 1.00 38.17  ? 166  LYS A CD    1 
ATOM   348  C CE    . LYS A 1 45  ? 15.556  24.139  -14.345 1.00 40.62  ? 166  LYS A CE    1 
ATOM   349  N NZ    . LYS A 1 45  ? 16.589  25.051  -13.789 1.00 40.59  ? 166  LYS A NZ    1 
ATOM   350  N N     . ALA A 1 46  ? 9.147   22.596  -12.226 1.00 46.81  ? 167  ALA A N     1 
ATOM   351  C CA    . ALA A 1 46  ? 8.167   22.056  -11.262 1.00 48.06  ? 167  ALA A CA    1 
ATOM   352  C C     . ALA A 1 46  ? 7.333   20.911  -11.844 1.00 47.94  ? 167  ALA A C     1 
ATOM   353  O O     . ALA A 1 46  ? 7.331   19.806  -11.294 1.00 45.79  ? 167  ALA A O     1 
ATOM   354  C CB    . ALA A 1 46  ? 7.251   23.149  -10.765 1.00 47.09  ? 167  ALA A CB    1 
ATOM   355  N N     . GLN A 1 47  ? 6.659   21.156  -12.966 1.00 46.84  ? 168  GLN A N     1 
ATOM   356  C CA    . GLN A 1 47  ? 5.837   20.118  -13.566 1.00 48.92  ? 168  GLN A CA    1 
ATOM   357  C C     . GLN A 1 47  ? 6.686   18.942  -14.024 1.00 49.49  ? 168  GLN A C     1 
ATOM   358  O O     . GLN A 1 47  ? 6.213   17.820  -14.049 1.00 55.20  ? 168  GLN A O     1 
ATOM   359  C CB    . GLN A 1 47  ? 5.052   20.630  -14.768 1.00 53.15  ? 168  GLN A CB    1 
ATOM   360  C CG    . GLN A 1 47  ? 4.190   21.863  -14.552 1.00 57.44  ? 168  GLN A CG    1 
ATOM   361  C CD    . GLN A 1 47  ? 3.420   22.251  -15.818 1.00 66.62  ? 168  GLN A CD    1 
ATOM   362  O OE1   . GLN A 1 47  ? 3.007   21.385  -16.622 1.00 64.91  ? 168  GLN A OE1   1 
ATOM   363  N NE2   . GLN A 1 47  ? 3.235   23.559  -16.011 1.00 66.83  ? 168  GLN A NE2   1 
ATOM   364  N N     . LEU A 1 48  ? 7.927   19.183  -14.415 1.00 49.63  ? 169  LEU A N     1 
ATOM   365  C CA    . LEU A 1 48  ? 8.748   18.086  -14.939 1.00 53.57  ? 169  LEU A CA    1 
ATOM   366  C C     . LEU A 1 48  ? 9.145   17.110  -13.841 1.00 56.96  ? 169  LEU A C     1 
ATOM   367  O O     . LEU A 1 48  ? 9.049   15.875  -14.018 1.00 51.20  ? 169  LEU A O     1 
ATOM   368  C CB    . LEU A 1 48  ? 10.020  18.603  -15.617 1.00 50.30  ? 169  LEU A CB    1 
ATOM   369  C CG    . LEU A 1 48  ? 9.885   19.307  -16.961 1.00 45.06  ? 169  LEU A CG    1 
ATOM   370  C CD1   . LEU A 1 48  ? 11.193  20.016  -17.282 1.00 43.91  ? 169  LEU A CD1   1 
ATOM   371  C CD2   . LEU A 1 48  ? 9.511   18.319  -18.041 1.00 45.33  ? 169  LEU A CD2   1 
ATOM   372  N N     . GLU A 1 49  ? 9.591   17.688  -12.722 1.00 62.91  ? 170  GLU A N     1 
ATOM   373  C CA    . GLU A 1 49  ? 10.079  16.929  -11.560 1.00 67.83  ? 170  GLU A CA    1 
ATOM   374  C C     . GLU A 1 49  ? 8.906   16.253  -10.851 1.00 64.42  ? 170  GLU A C     1 
ATOM   375  O O     . GLU A 1 49  ? 9.062   15.169  -10.296 1.00 58.13  ? 170  GLU A O     1 
ATOM   376  C CB    . GLU A 1 49  ? 10.914  17.824  -10.612 1.00 70.94  ? 170  GLU A CB    1 
ATOM   377  C CG    . GLU A 1 49  ? 12.088  18.533  -11.317 1.00 76.34  ? 170  GLU A CG    1 
ATOM   378  C CD    . GLU A 1 49  ? 12.904  19.484  -10.434 1.00 80.28  ? 170  GLU A CD    1 
ATOM   379  O OE1   . GLU A 1 49  ? 12.312  20.279  -9.672  1.00 86.80  ? 170  GLU A OE1   1 
ATOM   380  O OE2   . GLU A 1 49  ? 14.156  19.457  -10.521 1.00 78.87  ? 170  GLU A OE2   1 
ATOM   381  N N     . LYS A 1 50  ? 7.725   16.866  -10.931 1.00 64.44  ? 171  LYS A N     1 
ATOM   382  C CA    . LYS A 1 50  ? 6.509   16.234  -10.431 1.00 63.88  ? 171  LYS A CA    1 
ATOM   383  C C     . LYS A 1 50  ? 6.053   15.087  -11.325 1.00 59.16  ? 171  LYS A C     1 
ATOM   384  O O     . LYS A 1 50  ? 5.255   14.265  -10.894 1.00 69.98  ? 171  LYS A O     1 
ATOM   385  C CB    . LYS A 1 50  ? 5.358   17.240  -10.278 1.00 68.71  ? 171  LYS A CB    1 
ATOM   386  C CG    . LYS A 1 50  ? 4.320   16.832  -9.233  1.00 73.67  ? 171  LYS A CG    1 
ATOM   387  C CD    . LYS A 1 50  ? 2.879   17.013  -9.701  1.00 74.37  ? 171  LYS A CD    1 
ATOM   388  C CE    . LYS A 1 50  ? 2.433   18.464  -9.637  1.00 76.94  ? 171  LYS A CE    1 
ATOM   389  N NZ    . LYS A 1 50  ? 1.057   18.658  -10.182 1.00 74.00  ? 171  LYS A NZ    1 
ATOM   390  N N     . ALA A 1 51  ? 6.523   15.012  -12.560 1.00 54.79  ? 172  ALA A N     1 
ATOM   391  C CA    . ALA A 1 51  ? 6.071   13.927  -13.451 1.00 54.86  ? 172  ALA A CA    1 
ATOM   392  C C     . ALA A 1 51  ? 7.153   12.894  -13.732 1.00 53.96  ? 172  ALA A C     1 
ATOM   393  O O     . ALA A 1 51  ? 6.924   11.956  -14.505 1.00 55.27  ? 172  ALA A O     1 
ATOM   394  C CB    . ALA A 1 51  ? 5.531   14.488  -14.761 1.00 54.48  ? 172  ALA A CB    1 
ATOM   395  N N     . GLY A 1 52  ? 8.320   13.068  -13.115 1.00 52.18  ? 173  GLY A N     1 
ATOM   396  C CA    . GLY A 1 52  ? 9.433   12.130  -13.265 1.00 50.59  ? 173  GLY A CA    1 
ATOM   397  C C     . GLY A 1 52  ? 9.963   11.936  -14.679 1.00 51.44  ? 173  GLY A C     1 
ATOM   398  O O     . GLY A 1 52  ? 10.295  10.810  -15.056 1.00 52.74  ? 173  GLY A O     1 
ATOM   399  N N     . VAL A 1 53  ? 10.055  13.023  -15.457 1.00 50.62  ? 174  VAL A N     1 
ATOM   400  C CA    . VAL A 1 53  ? 10.563  12.957  -16.836 1.00 47.63  ? 174  VAL A CA    1 
ATOM   401  C C     . VAL A 1 53  ? 11.808  13.808  -17.115 1.00 45.51  ? 174  VAL A C     1 
ATOM   402  O O     . VAL A 1 53  ? 12.071  14.161  -18.264 1.00 43.71  ? 174  VAL A O     1 
ATOM   403  C CB    . VAL A 1 53  ? 9.480   13.358  -17.839 1.00 49.37  ? 174  VAL A CB    1 
ATOM   404  C CG1   . VAL A 1 53  ? 8.313   12.387  -17.759 1.00 52.79  ? 174  VAL A CG1   1 
ATOM   405  C CG2   . VAL A 1 53  ? 9.028   14.791  -17.602 1.00 48.27  ? 174  VAL A CG2   1 
ATOM   406  N N     . GLU A 1 54  ? 12.585  14.125  -16.090 1.00 42.18  ? 175  GLU A N     1 
ATOM   407  C CA    . GLU A 1 54  ? 13.787  14.876  -16.312 1.00 44.94  ? 175  GLU A CA    1 
ATOM   408  C C     . GLU A 1 54  ? 14.725  14.098  -17.230 1.00 43.77  ? 175  GLU A C     1 
ATOM   409  O O     . GLU A 1 54  ? 15.232  14.634  -18.216 1.00 47.54  ? 175  GLU A O     1 
ATOM   410  C CB    . GLU A 1 54  ? 14.480  15.200  -15.002 1.00 51.77  ? 175  GLU A CB    1 
ATOM   411  C CG    . GLU A 1 54  ? 13.664  16.097  -14.080 1.00 57.61  ? 175  GLU A CG    1 
ATOM   412  C CD    . GLU A 1 54  ? 12.925  15.323  -12.984 1.00 68.42  ? 175  GLU A CD    1 
ATOM   413  O OE1   . GLU A 1 54  ? 12.106  14.394  -13.306 1.00 63.35  ? 175  GLU A OE1   1 
ATOM   414  O OE2   . GLU A 1 54  ? 13.170  15.661  -11.788 1.00 73.84  ? 175  GLU A OE2   1 
ATOM   415  N N     . HIS A 1 55  ? 14.936  12.829  -16.933 1.00 41.07  ? 176  HIS A N     1 
ATOM   416  C CA    . HIS A 1 55  ? 15.869  12.026  -17.714 1.00 38.92  ? 176  HIS A CA    1 
ATOM   417  C C     . HIS A 1 55  ? 15.381  11.760  -19.115 1.00 38.18  ? 176  HIS A C     1 
ATOM   418  O O     . HIS A 1 55  ? 16.182  11.694  -20.035 1.00 38.00  ? 176  HIS A O     1 
ATOM   419  C CB    . HIS A 1 55  ? 16.226  10.739  -16.986 1.00 38.47  ? 176  HIS A CB    1 
ATOM   420  C CG    . HIS A 1 55  ? 16.982  10.979  -15.717 1.00 44.18  ? 176  HIS A CG    1 
ATOM   421  N ND1   . HIS A 1 55  ? 17.059  10.052  -14.696 1.00 45.41  ? 176  HIS A ND1   1 
ATOM   422  C CD2   . HIS A 1 55  ? 17.668  12.069  -15.289 1.00 47.06  ? 176  HIS A CD2   1 
ATOM   423  C CE1   . HIS A 1 55  ? 17.788  10.548  -13.714 1.00 47.60  ? 176  HIS A CE1   1 
ATOM   424  N NE2   . HIS A 1 55  ? 18.163  11.773  -14.045 1.00 48.22  ? 176  HIS A NE2   1 
ATOM   425  N N     . GLN A 1 56  ? 14.073  11.623  -19.279 1.00 41.55  ? 177  GLN A N     1 
ATOM   426  C CA    . GLN A 1 56  ? 13.462  11.495  -20.601 1.00 42.65  ? 177  GLN A CA    1 
ATOM   427  C C     . GLN A 1 56  ? 13.747  12.729  -21.416 1.00 37.88  ? 177  GLN A C     1 
ATOM   428  O O     . GLN A 1 56  ? 14.123  12.632  -22.588 1.00 35.54  ? 177  GLN A O     1 
ATOM   429  C CB    . GLN A 1 56  ? 11.953  11.320  -20.484 1.00 52.13  ? 177  GLN A CB    1 
ATOM   430  C CG    . GLN A 1 56  ? 11.236  11.162  -21.825 1.00 64.49  ? 177  GLN A CG    1 
ATOM   431  C CD    . GLN A 1 56  ? 9.975   10.305  -21.719 1.00 76.48  ? 177  GLN A CD    1 
ATOM   432  O OE1   . GLN A 1 56  ? 9.538   9.953   -20.612 1.00 87.36  ? 177  GLN A OE1   1 
ATOM   433  N NE2   . GLN A 1 56  ? 9.388   9.958   -22.867 1.00 76.88  ? 177  GLN A NE2   1 
ATOM   434  N N     . LEU A 1 57  ? 13.569  13.890  -20.792 1.00 34.44  ? 178  LEU A N     1 
ATOM   435  C CA    . LEU A 1 57  ? 13.859  15.156  -21.455 1.00 33.33  ? 178  LEU A CA    1 
ATOM   436  C C     . LEU A 1 57  ? 15.311  15.202  -21.881 1.00 34.47  ? 178  LEU A C     1 
ATOM   437  O O     . LEU A 1 57  ? 15.630  15.568  -23.011 1.00 34.08  ? 178  LEU A O     1 
ATOM   438  C CB    . LEU A 1 57  ? 13.571  16.341  -20.542 1.00 31.93  ? 178  LEU A CB    1 
ATOM   439  C CG    . LEU A 1 57  ? 13.942  17.706  -21.128 1.00 31.03  ? 178  LEU A CG    1 
ATOM   440  C CD1   . LEU A 1 57  ? 12.945  18.031  -22.227 1.00 32.05  ? 178  LEU A CD1   1 
ATOM   441  C CD2   . LEU A 1 57  ? 13.990  18.824  -20.097 1.00 29.28  ? 178  LEU A CD2   1 
ATOM   442  N N     . ARG A 1 58  ? 16.186  14.836  -20.954 1.00 36.14  ? 179  ARG A N     1 
ATOM   443  C CA    . ARG A 1 58  ? 17.620  14.866  -21.179 1.00 36.12  ? 179  ARG A CA    1 
ATOM   444  C C     . ARG A 1 58  ? 17.978  14.058  -22.414 1.00 36.10  ? 179  ARG A C     1 
ATOM   445  O O     . ARG A 1 58  ? 18.659  14.542  -23.314 1.00 37.95  ? 179  ARG A O     1 
ATOM   446  C CB    . ARG A 1 58  ? 18.318  14.281  -19.956 1.00 39.03  ? 179  ARG A CB    1 
ATOM   447  C CG    . ARG A 1 58  ? 19.751  14.723  -19.804 1.00 38.18  ? 179  ARG A CG    1 
ATOM   448  C CD    . ARG A 1 58  ? 20.641  13.573  -19.492 1.00 40.39  ? 179  ARG A CD    1 
ATOM   449  N NE    . ARG A 1 58  ? 21.120  13.620  -18.128 1.00 44.27  ? 179  ARG A NE    1 
ATOM   450  C CZ    . ARG A 1 58  ? 20.952  12.676  -17.211 1.00 45.15  ? 179  ARG A CZ    1 
ATOM   451  N NH1   . ARG A 1 58  ? 20.279  11.555  -17.458 1.00 43.46  ? 179  ARG A NH1   1 
ATOM   452  N NH2   . ARG A 1 58  ? 21.472  12.885  -16.013 1.00 47.92  ? 179  ARG A NH2   1 
ATOM   453  N N     . ARG A 1 59  ? 17.467  12.835  -22.457 1.00 35.90  ? 180  ARG A N     1 
ATOM   454  C CA    . ARG A 1 59  ? 17.632  11.952  -23.593 1.00 37.91  ? 180  ARG A CA    1 
ATOM   455  C C     . ARG A 1 59  ? 17.132  12.687  -24.846 1.00 37.82  ? 180  ARG A C     1 
ATOM   456  O O     . ARG A 1 59  ? 17.870  12.831  -25.817 1.00 36.28  ? 180  ARG A O     1 
ATOM   457  C CB    . ARG A 1 59  ? 16.883  10.611  -23.344 1.00 41.66  ? 180  ARG A CB    1 
ATOM   458  C CG    . ARG A 1 59  ? 17.469  9.376   -24.036 1.00 45.49  ? 180  ARG A CG    1 
ATOM   459  C CD    . ARG A 1 59  ? 17.018  8.010   -23.466 1.00 51.62  ? 180  ARG A CD    1 
ATOM   460  N NE    . ARG A 1 59  ? 17.310  7.704   -22.034 1.00 66.07  ? 180  ARG A NE    1 
ATOM   461  C CZ    . ARG A 1 59  ? 18.515  7.672   -21.406 1.00 68.66  ? 180  ARG A CZ    1 
ATOM   462  N NH1   . ARG A 1 59  ? 19.664  7.979   -22.029 1.00 61.15  ? 180  ARG A NH1   1 
ATOM   463  N NH2   . ARG A 1 59  ? 18.565  7.359   -20.097 1.00 65.45  ? 180  ARG A NH2   1 
ATOM   464  N N     . GLU A 1 60  ? 15.902  13.199  -24.808 1.00 40.18  ? 181  GLU A N     1 
ATOM   465  C CA    . GLU A 1 60  ? 15.309  13.875  -25.989 1.00 42.24  ? 181  GLU A CA    1 
ATOM   466  C C     . GLU A 1 60  ? 16.204  15.011  -26.521 1.00 38.94  ? 181  GLU A C     1 
ATOM   467  O O     . GLU A 1 60  ? 16.507  15.050  -27.700 1.00 39.70  ? 181  GLU A O     1 
ATOM   468  C CB    . GLU A 1 60  ? 13.892  14.376  -25.666 1.00 47.38  ? 181  GLU A CB    1 
ATOM   469  C CG    . GLU A 1 60  ? 13.198  15.209  -26.749 1.00 56.56  ? 181  GLU A CG    1 
ATOM   470  C CD    . GLU A 1 60  ? 11.685  15.417  -26.485 1.00 66.89  ? 181  GLU A CD    1 
ATOM   471  O OE1   . GLU A 1 60  ? 11.199  15.020  -25.389 1.00 65.95  ? 181  GLU A OE1   1 
ATOM   472  O OE2   . GLU A 1 60  ? 10.973  15.975  -27.374 1.00 67.08  ? 181  GLU A OE2   1 
ATOM   473  N N     . VAL A 1 61  ? 16.640  15.918  -25.654 1.00 35.48  ? 182  VAL A N     1 
ATOM   474  C CA    . VAL A 1 61  ? 17.471  17.035  -26.071 1.00 33.95  ? 182  VAL A CA    1 
ATOM   475  C C     . VAL A 1 61  ? 18.829  16.565  -26.593 1.00 36.50  ? 182  VAL A C     1 
ATOM   476  O O     . VAL A 1 61  ? 19.278  17.029  -27.641 1.00 34.45  ? 182  VAL A O     1 
ATOM   477  C CB    . VAL A 1 61  ? 17.683  17.999  -24.903 1.00 35.63  ? 182  VAL A CB    1 
ATOM   478  C CG1   . VAL A 1 61  ? 18.837  18.944  -25.161 1.00 36.39  ? 182  VAL A CG1   1 
ATOM   479  C CG2   . VAL A 1 61  ? 16.416  18.794  -24.643 1.00 37.43  ? 182  VAL A CG2   1 
ATOM   480  N N     . GLU A 1 62  ? 19.491  15.643  -25.876 1.00 38.27  ? 183  GLU A N     1 
ATOM   481  C CA    . GLU A 1 62  ? 20.804  15.133  -26.333 1.00 36.13  ? 183  GLU A CA    1 
ATOM   482  C C     . GLU A 1 62  ? 20.700  14.487  -27.695 1.00 33.91  ? 183  GLU A C     1 
ATOM   483  O O     . GLU A 1 62  ? 21.418  14.841  -28.607 1.00 35.39  ? 183  GLU A O     1 
ATOM   484  C CB    . GLU A 1 62  ? 21.408  14.159  -25.342 1.00 37.33  ? 183  GLU A CB    1 
ATOM   485  C CG    . GLU A 1 62  ? 21.816  14.836  -24.033 1.00 41.05  ? 183  GLU A CG    1 
ATOM   486  C CD    . GLU A 1 62  ? 22.369  13.885  -22.979 1.00 42.36  ? 183  GLU A CD    1 
ATOM   487  O OE1   . GLU A 1 62  ? 22.347  12.632  -23.163 1.00 45.38  ? 183  GLU A OE1   1 
ATOM   488  O OE2   . GLU A 1 62  ? 22.851  14.405  -21.959 1.00 39.92  ? 183  GLU A OE2   1 
ATOM   489  N N     . ILE A 1 63  ? 19.778  13.561  -27.860 1.00 34.50  ? 184  ILE A N     1 
ATOM   490  C CA    . ILE A 1 63  ? 19.660  12.894  -29.147 1.00 35.89  ? 184  ILE A CA    1 
ATOM   491  C C     . ILE A 1 63  ? 19.382  13.849  -30.322 1.00 35.64  ? 184  ILE A C     1 
ATOM   492  O O     . ILE A 1 63  ? 19.975  13.754  -31.371 1.00 35.56  ? 184  ILE A O     1 
ATOM   493  C CB    . ILE A 1 63  ? 18.577  11.835  -29.108 1.00 36.11  ? 184  ILE A CB    1 
ATOM   494  C CG1   . ILE A 1 63  ? 19.130  10.595  -28.425 1.00 35.71  ? 184  ILE A CG1   1 
ATOM   495  C CG2   . ILE A 1 63  ? 18.143  11.473  -30.524 1.00 37.95  ? 184  ILE A CG2   1 
ATOM   496  C CD1   . ILE A 1 63  ? 18.067  9.555   -28.110 1.00 36.98  ? 184  ILE A CD1   1 
ATOM   497  N N     . GLN A 1 64  ? 18.468  14.769  -30.128 1.00 37.50  ? 185  GLN A N     1 
ATOM   498  C CA    . GLN A 1 64  ? 17.969  15.561  -31.211 1.00 35.72  ? 185  GLN A CA    1 
ATOM   499  C C     . GLN A 1 64  ? 18.989  16.647  -31.576 1.00 36.59  ? 185  GLN A C     1 
ATOM   500  O O     . GLN A 1 64  ? 19.127  17.047  -32.758 1.00 35.79  ? 185  GLN A O     1 
ATOM   501  C CB    . GLN A 1 64  ? 16.622  16.146  -30.803 1.00 33.58  ? 185  GLN A CB    1 
ATOM   502  C CG    . GLN A 1 64  ? 16.023  16.989  -31.892 1.00 34.92  ? 185  GLN A CG    1 
ATOM   503  C CD    . GLN A 1 64  ? 14.784  17.701  -31.457 1.00 34.65  ? 185  GLN A CD    1 
ATOM   504  O OE1   . GLN A 1 64  ? 14.488  17.798  -30.280 1.00 37.44  ? 185  GLN A OE1   1 
ATOM   505  N NE2   . GLN A 1 64  ? 14.052  18.207  -32.413 1.00 36.37  ? 185  GLN A NE2   1 
ATOM   506  N N     . SER A 1 65  ? 19.710  17.128  -30.571 1.00 35.11  ? 186  SER A N     1 
ATOM   507  C CA    . SER A 1 65  ? 20.671  18.186  -30.811 1.00 34.88  ? 186  SER A CA    1 
ATOM   508  C C     . SER A 1 65  ? 21.807  17.743  -31.716 1.00 36.84  ? 186  SER A C     1 
ATOM   509  O O     . SER A 1 65  ? 22.515  18.571  -32.250 1.00 42.11  ? 186  SER A O     1 
ATOM   510  C CB    . SER A 1 65  ? 21.262  18.642  -29.492 1.00 34.31  ? 186  SER A CB    1 
ATOM   511  O OG    . SER A 1 65  ? 21.931  17.555  -28.894 1.00 33.51  ? 186  SER A OG    1 
ATOM   512  N N     . HIS A 1 66  ? 22.018  16.444  -31.871 1.00 42.08  ? 187  HIS A N     1 
ATOM   513  C CA    . HIS A 1 66  ? 23.161  15.953  -32.638 1.00 44.72  ? 187  HIS A CA    1 
ATOM   514  C C     . HIS A 1 66  ? 22.774  15.506  -34.018 1.00 45.23  ? 187  HIS A C     1 
ATOM   515  O O     . HIS A 1 66  ? 23.628  15.047  -34.776 1.00 54.55  ? 187  HIS A O     1 
ATOM   516  C CB    . HIS A 1 66  ? 23.899  14.848  -31.867 1.00 48.39  ? 187  HIS A CB    1 
ATOM   517  C CG    . HIS A 1 66  ? 24.683  15.380  -30.711 1.00 56.36  ? 187  HIS A CG    1 
ATOM   518  N ND1   . HIS A 1 66  ? 24.094  15.734  -29.515 1.00 58.13  ? 187  HIS A ND1   1 
ATOM   519  C CD2   . HIS A 1 66  ? 25.991  15.710  -30.598 1.00 63.19  ? 187  HIS A CD2   1 
ATOM   520  C CE1   . HIS A 1 66  ? 25.010  16.231  -28.704 1.00 59.92  ? 187  HIS A CE1   1 
ATOM   521  N NE2   . HIS A 1 66  ? 26.172  16.225  -29.335 1.00 64.16  ? 187  HIS A NE2   1 
ATOM   522  N N     . LEU A 1 67  ? 21.503  15.659  -34.364 1.00 42.21  ? 188  LEU A N     1 
ATOM   523  C CA    . LEU A 1 67  ? 21.020  15.310  -35.692 1.00 40.91  ? 188  LEU A CA    1 
ATOM   524  C C     . LEU A 1 67  ? 20.920  16.544  -36.575 1.00 40.14  ? 188  LEU A C     1 
ATOM   525  O O     . LEU A 1 67  ? 20.257  17.501  -36.209 1.00 39.27  ? 188  LEU A O     1 
ATOM   526  C CB    . LEU A 1 67  ? 19.650  14.668  -35.580 1.00 39.54  ? 188  LEU A CB    1 
ATOM   527  C CG    . LEU A 1 67  ? 19.553  13.158  -35.378 1.00 41.06  ? 188  LEU A CG    1 
ATOM   528  C CD1   . LEU A 1 67  ? 20.817  12.501  -34.843 1.00 42.18  ? 188  LEU A CD1   1 
ATOM   529  C CD2   . LEU A 1 67  ? 18.383  12.887  -34.455 1.00 40.75  ? 188  LEU A CD2   1 
ATOM   530  N N     . ARG A 1 68  ? 21.585  16.514  -37.732 1.00 44.00  ? 189  ARG A N     1 
ATOM   531  C CA    . ARG A 1 68  ? 21.473  17.574  -38.750 1.00 45.76  ? 189  ARG A CA    1 
ATOM   532  C C     . ARG A 1 68  ? 20.970  16.928  -40.008 1.00 42.34  ? 189  ARG A C     1 
ATOM   533  O O     . ARG A 1 68  ? 21.698  16.157  -40.629 1.00 42.84  ? 189  ARG A O     1 
ATOM   534  C CB    . ARG A 1 68  ? 22.815  18.228  -39.068 1.00 51.00  ? 189  ARG A CB    1 
ATOM   535  C CG    . ARG A 1 68  ? 23.665  18.608  -37.868 1.00 62.63  ? 189  ARG A CG    1 
ATOM   536  C CD    . ARG A 1 68  ? 23.210  19.894  -37.188 1.00 72.14  ? 189  ARG A CD    1 
ATOM   537  N NE    . ARG A 1 68  ? 24.354  20.744  -36.835 1.00 80.74  ? 189  ARG A NE    1 
ATOM   538  C CZ    . ARG A 1 68  ? 24.986  21.572  -37.675 1.00 86.22  ? 189  ARG A CZ    1 
ATOM   539  N NH1   . ARG A 1 68  ? 24.606  21.697  -38.954 1.00 83.73  ? 189  ARG A NH1   1 
ATOM   540  N NH2   . ARG A 1 68  ? 26.016  22.287  -37.227 1.00 91.84  ? 189  ARG A NH2   1 
ATOM   541  N N     . HIS A 1 69  ? 19.719  17.224  -40.368 1.00 41.90  ? 190  HIS A N     1 
ATOM   542  C CA    . HIS A 1 69  ? 19.079  16.673  -41.568 1.00 38.59  ? 190  HIS A CA    1 
ATOM   543  C C     . HIS A 1 69  ? 17.958  17.599  -42.003 1.00 36.05  ? 190  HIS A C     1 
ATOM   544  O O     . HIS A 1 69  ? 17.271  18.176  -41.171 1.00 35.68  ? 190  HIS A O     1 
ATOM   545  C CB    . HIS A 1 69  ? 18.525  15.284  -41.271 1.00 40.42  ? 190  HIS A CB    1 
ATOM   546  C CG    . HIS A 1 69  ? 18.166  14.508  -42.494 1.00 43.85  ? 190  HIS A CG    1 
ATOM   547  N ND1   . HIS A 1 69  ? 16.932  14.604  -43.099 1.00 43.64  ? 190  HIS A ND1   1 
ATOM   548  C CD2   . HIS A 1 69  ? 18.887  13.636  -43.241 1.00 43.79  ? 190  HIS A CD2   1 
ATOM   549  C CE1   . HIS A 1 69  ? 16.901  13.813  -44.155 1.00 45.60  ? 190  HIS A CE1   1 
ATOM   550  N NE2   . HIS A 1 69  ? 18.076  13.218  -44.267 1.00 44.07  ? 190  HIS A NE2   1 
ATOM   551  N N     . PRO A 1 70  ? 17.778  17.786  -43.313 1.00 34.61  ? 191  PRO A N     1 
ATOM   552  C CA    . PRO A 1 70  ? 16.694  18.706  -43.696 1.00 32.94  ? 191  PRO A CA    1 
ATOM   553  C C     . PRO A 1 70  ? 15.302  18.265  -43.216 1.00 32.30  ? 191  PRO A C     1 
ATOM   554  O O     . PRO A 1 70  ? 14.436  19.092  -43.099 1.00 34.72  ? 191  PRO A O     1 
ATOM   555  C CB    . PRO A 1 70  ? 16.746  18.676  -45.241 1.00 30.96  ? 191  PRO A CB    1 
ATOM   556  C CG    . PRO A 1 70  ? 17.359  17.352  -45.560 1.00 31.19  ? 191  PRO A CG    1 
ATOM   557  C CD    . PRO A 1 70  ? 18.407  17.172  -44.492 1.00 32.00  ? 191  PRO A CD    1 
ATOM   558  N N     . ASN A 1 71  ? 15.085  16.978  -42.981 1.00 31.63  ? 192  ASN A N     1 
ATOM   559  C CA    . ASN A 1 71  ? 13.778  16.485  -42.582 1.00 34.33  ? 192  ASN A CA    1 
ATOM   560  C C     . ASN A 1 71  ? 13.718  16.181  -41.109 1.00 33.92  ? 192  ASN A C     1 
ATOM   561  O O     . ASN A 1 71  ? 12.772  15.525  -40.652 1.00 31.91  ? 192  ASN A O     1 
ATOM   562  C CB    . ASN A 1 71  ? 13.402  15.228  -43.358 1.00 36.98  ? 192  ASN A CB    1 
ATOM   563  C CG    . ASN A 1 71  ? 13.528  15.420  -44.847 1.00 40.35  ? 192  ASN A CG    1 
ATOM   564  O OD1   . ASN A 1 71  ? 14.158  14.614  -45.552 1.00 42.10  ? 192  ASN A OD1   1 
ATOM   565  N ND2   . ASN A 1 71  ? 12.958  16.510  -45.338 1.00 41.62  ? 192  ASN A ND2   1 
ATOM   566  N N     . ILE A 1 72  ? 14.732  16.640  -40.377 1.00 30.95  ? 193  ILE A N     1 
ATOM   567  C CA    . ILE A 1 72  ? 14.717  16.585  -38.938 1.00 29.78  ? 193  ILE A CA    1 
ATOM   568  C C     . ILE A 1 72  ? 14.754  17.973  -38.329 1.00 31.42  ? 193  ILE A C     1 
ATOM   569  O O     . ILE A 1 72  ? 15.587  18.781  -38.699 1.00 35.92  ? 193  ILE A O     1 
ATOM   570  C CB    . ILE A 1 72  ? 15.913  15.821  -38.447 1.00 28.83  ? 193  ILE A CB    1 
ATOM   571  C CG1   . ILE A 1 72  ? 15.836  14.413  -38.994 1.00 29.84  ? 193  ILE A CG1   1 
ATOM   572  C CG2   . ILE A 1 72  ? 15.909  15.781  -36.931 1.00 31.36  ? 193  ILE A CG2   1 
ATOM   573  C CD1   . ILE A 1 72  ? 16.934  13.486  -38.524 1.00 29.78  ? 193  ILE A CD1   1 
ATOM   574  N N     . LEU A 1 73  ? 13.882  18.245  -37.367 1.00 31.84  ? 194  LEU A N     1 
ATOM   575  C CA    . LEU A 1 73  ? 13.837  19.566  -36.714 1.00 34.34  ? 194  LEU A CA    1 
ATOM   576  C C     . LEU A 1 73  ? 15.113  19.871  -35.918 1.00 35.48  ? 194  LEU A C     1 
ATOM   577  O O     . LEU A 1 73  ? 15.503  19.104  -35.046 1.00 35.58  ? 194  LEU A O     1 
ATOM   578  C CB    . LEU A 1 73  ? 12.621  19.664  -35.796 1.00 34.87  ? 194  LEU A CB    1 
ATOM   579  C CG    . LEU A 1 73  ? 12.076  21.068  -35.593 1.00 36.46  ? 194  LEU A CG    1 
ATOM   580  C CD1   . LEU A 1 73  ? 11.346  21.558  -36.842 1.00 38.16  ? 194  LEU A CD1   1 
ATOM   581  C CD2   . LEU A 1 73  ? 11.128  21.109  -34.394 1.00 37.79  ? 194  LEU A CD2   1 
ATOM   582  N N     . ARG A 1 74  ? 15.762  20.988  -36.233 1.00 37.39  ? 195  ARG A N     1 
ATOM   583  C CA    . ARG A 1 74  ? 16.987  21.355  -35.544 1.00 39.06  ? 195  ARG A CA    1 
ATOM   584  C C     . ARG A 1 74  ? 16.630  21.765  -34.136 1.00 36.32  ? 195  ARG A C     1 
ATOM   585  O O     . ARG A 1 74  ? 15.726  22.564  -33.932 1.00 36.79  ? 195  ARG A O     1 
ATOM   586  C CB    . ARG A 1 74  ? 17.734  22.521  -36.233 1.00 41.79  ? 195  ARG A CB    1 
ATOM   587  C CG    . ARG A 1 74  ? 18.641  22.141  -37.408 1.00 46.57  ? 195  ARG A CG    1 
ATOM   588  C CD    . ARG A 1 74  ? 19.852  21.256  -37.053 1.00 50.11  ? 195  ARG A CD    1 
ATOM   589  N NE    . ARG A 1 74  ? 20.827  21.854  -36.121 1.00 51.64  ? 195  ARG A NE    1 
ATOM   590  C CZ    . ARG A 1 74  ? 21.700  22.827  -36.427 1.00 54.83  ? 195  ARG A CZ    1 
ATOM   591  N NH1   . ARG A 1 74  ? 21.749  23.383  -37.643 1.00 58.78  ? 195  ARG A NH1   1 
ATOM   592  N NH2   . ARG A 1 74  ? 22.532  23.270  -35.501 1.00 54.65  ? 195  ARG A NH2   1 
ATOM   593  N N     . LEU A 1 75  ? 17.353  21.202  -33.182 1.00 34.42  ? 196  LEU A N     1 
ATOM   594  C CA    . LEU A 1 75  ? 17.448  21.718  -31.828 1.00 33.14  ? 196  LEU A CA    1 
ATOM   595  C C     . LEU A 1 75  ? 18.799  22.378  -31.760 1.00 32.38  ? 196  LEU A C     1 
ATOM   596  O O     . LEU A 1 75  ? 19.811  21.697  -31.771 1.00 35.68  ? 196  LEU A O     1 
ATOM   597  C CB    . LEU A 1 75  ? 17.376  20.569  -30.820 1.00 34.08  ? 196  LEU A CB    1 
ATOM   598  C CG    . LEU A 1 75  ? 17.397  20.871  -29.326 1.00 34.77  ? 196  LEU A CG    1 
ATOM   599  C CD1   . LEU A 1 75  ? 16.180  21.624  -28.874 1.00 36.90  ? 196  LEU A CD1   1 
ATOM   600  C CD2   . LEU A 1 75  ? 17.399  19.586  -28.559 1.00 36.80  ? 196  LEU A CD2   1 
ATOM   601  N N     . TYR A 1 76  ? 18.823  23.700  -31.709 1.00 32.54  ? 197  TYR A N     1 
ATOM   602  C CA    . TYR A 1 76  ? 20.075  24.475  -31.739 1.00 32.41  ? 197  TYR A CA    1 
ATOM   603  C C     . TYR A 1 76  ? 20.822  24.536  -30.402 1.00 32.52  ? 197  TYR A C     1 
ATOM   604  O O     . TYR A 1 76  ? 22.051  24.769  -30.367 1.00 29.40  ? 197  TYR A O     1 
ATOM   605  C CB    . TYR A 1 76  ? 19.769  25.915  -32.115 1.00 31.76  ? 197  TYR A CB    1 
ATOM   606  C CG    . TYR A 1 76  ? 19.340  26.087  -33.522 1.00 31.58  ? 197  TYR A CG    1 
ATOM   607  C CD1   . TYR A 1 76  ? 20.222  25.877  -34.557 1.00 32.82  ? 197  TYR A CD1   1 
ATOM   608  C CD2   . TYR A 1 76  ? 18.054  26.488  -33.823 1.00 31.38  ? 197  TYR A CD2   1 
ATOM   609  C CE1   . TYR A 1 76  ? 19.810  26.040  -35.871 1.00 36.05  ? 197  TYR A CE1   1 
ATOM   610  C CE2   . TYR A 1 76  ? 17.643  26.659  -35.118 1.00 32.24  ? 197  TYR A CE2   1 
ATOM   611  C CZ    . TYR A 1 76  ? 18.522  26.437  -36.138 1.00 34.60  ? 197  TYR A CZ    1 
ATOM   612  O OH    . TYR A 1 76  ? 18.103  26.609  -37.441 1.00 41.52  ? 197  TYR A OH    1 
ATOM   613  N N     . GLY A 1 77  ? 20.058  24.395  -29.320 1.00 31.23  ? 198  GLY A N     1 
ATOM   614  C CA    . GLY A 1 77  ? 20.563  24.635  -27.976 1.00 32.27  ? 198  GLY A CA    1 
ATOM   615  C C     . GLY A 1 77  ? 19.523  24.617  -26.865 1.00 30.15  ? 198  GLY A C     1 
ATOM   616  O O     . GLY A 1 77  ? 18.328  24.632  -27.134 1.00 29.82  ? 198  GLY A O     1 
ATOM   617  N N     . TYR A 1 78  ? 19.990  24.532  -25.623 1.00 28.34  ? 199  TYR A N     1 
ATOM   618  C CA    . TYR A 1 78  ? 19.129  24.641  -24.470 1.00 29.54  ? 199  TYR A CA    1 
ATOM   619  C C     . TYR A 1 78  ? 19.762  25.573  -23.463 1.00 31.58  ? 199  TYR A C     1 
ATOM   620  O O     . TYR A 1 78  ? 20.910  25.954  -23.567 1.00 31.26  ? 199  TYR A O     1 
ATOM   621  C CB    . TYR A 1 78  ? 18.848  23.279  -23.832 1.00 30.32  ? 199  TYR A CB    1 
ATOM   622  C CG    . TYR A 1 78  ? 19.829  22.862  -22.778 1.00 31.55  ? 199  TYR A CG    1 
ATOM   623  C CD1   . TYR A 1 78  ? 21.087  22.388  -23.128 1.00 34.08  ? 199  TYR A CD1   1 
ATOM   624  C CD2   . TYR A 1 78  ? 19.517  22.948  -21.434 1.00 33.02  ? 199  TYR A CD2   1 
ATOM   625  C CE1   . TYR A 1 78  ? 22.012  22.025  -22.166 1.00 35.00  ? 199  TYR A CE1   1 
ATOM   626  C CE2   . TYR A 1 78  ? 20.435  22.583  -20.459 1.00 34.16  ? 199  TYR A CE2   1 
ATOM   627  C CZ    . TYR A 1 78  ? 21.673  22.119  -20.831 1.00 36.64  ? 199  TYR A CZ    1 
ATOM   628  O OH    . TYR A 1 78  ? 22.610  21.762  -19.883 1.00 42.68  ? 199  TYR A OH    1 
ATOM   629  N N     . PHE A 1 79  ? 18.971  25.976  -22.497 1.00 34.23  ? 200  PHE A N     1 
ATOM   630  C CA    . PHE A 1 79  ? 19.498  26.670  -21.338 1.00 34.48  ? 200  PHE A CA    1 
ATOM   631  C C     . PHE A 1 79  ? 18.374  26.628  -20.361 1.00 33.70  ? 200  PHE A C     1 
ATOM   632  O O     . PHE A 1 79  ? 17.286  26.142  -20.703 1.00 33.09  ? 200  PHE A O     1 
ATOM   633  C CB    . PHE A 1 79  ? 19.936  28.092  -21.666 1.00 34.95  ? 200  PHE A CB    1 
ATOM   634  C CG    . PHE A 1 79  ? 18.841  28.987  -22.209 1.00 34.99  ? 200  PHE A CG    1 
ATOM   635  C CD1   . PHE A 1 79  ? 18.576  29.037  -23.567 1.00 34.92  ? 200  PHE A CD1   1 
ATOM   636  C CD2   . PHE A 1 79  ? 18.137  29.831  -21.374 1.00 32.69  ? 200  PHE A CD2   1 
ATOM   637  C CE1   . PHE A 1 79  ? 17.599  29.877  -24.076 1.00 33.22  ? 200  PHE A CE1   1 
ATOM   638  C CE2   . PHE A 1 79  ? 17.155  30.667  -21.878 1.00 33.72  ? 200  PHE A CE2   1 
ATOM   639  C CZ    . PHE A 1 79  ? 16.882  30.688  -23.227 1.00 32.77  ? 200  PHE A CZ    1 
ATOM   640  N N     . HIS A 1 80  ? 18.617  27.090  -19.152 1.00 34.24  ? 201  HIS A N     1 
ATOM   641  C CA    . HIS A 1 80  ? 17.551  27.095  -18.156 1.00 36.19  ? 201  HIS A CA    1 
ATOM   642  C C     . HIS A 1 80  ? 17.831  28.104  -17.099 1.00 37.41  ? 201  HIS A C     1 
ATOM   643  O O     . HIS A 1 80  ? 18.969  28.522  -16.923 1.00 38.03  ? 201  HIS A O     1 
ATOM   644  C CB    . HIS A 1 80  ? 17.477  25.752  -17.499 1.00 36.71  ? 201  HIS A CB    1 
ATOM   645  C CG    . HIS A 1 80  ? 18.789  25.308  -16.950 1.00 38.85  ? 201  HIS A CG    1 
ATOM   646  N ND1   . HIS A 1 80  ? 19.050  25.237  -15.601 1.00 39.64  ? 201  HIS A ND1   1 
ATOM   647  C CD2   . HIS A 1 80  ? 19.920  24.908  -17.573 1.00 40.74  ? 201  HIS A CD2   1 
ATOM   648  C CE1   . HIS A 1 80  ? 20.281  24.802  -15.413 1.00 40.52  ? 201  HIS A CE1   1 
ATOM   649  N NE2   . HIS A 1 80  ? 20.832  24.599  -16.594 1.00 42.57  ? 201  HIS A NE2   1 
ATOM   650  N N     . ASP A 1 81  ? 16.777  28.485  -16.399 1.00 40.91  ? 202  ASP A N     1 
ATOM   651  C CA    . ASP A 1 81  ? 16.850  29.458  -15.318 1.00 46.80  ? 202  ASP A CA    1 
ATOM   652  C C     . ASP A 1 81  ? 16.270  28.749  -14.097 1.00 49.38  ? 202  ASP A C     1 
ATOM   653  O O     . ASP A 1 81  ? 16.156  27.527  -14.107 1.00 55.54  ? 202  ASP A O     1 
ATOM   654  C CB    . ASP A 1 81  ? 16.114  30.768  -15.705 1.00 50.70  ? 202  ASP A CB    1 
ATOM   655  C CG    . ASP A 1 81  ? 14.596  30.589  -15.905 1.00 55.82  ? 202  ASP A CG    1 
ATOM   656  O OD1   . ASP A 1 81  ? 14.076  29.466  -15.747 1.00 63.79  ? 202  ASP A OD1   1 
ATOM   657  O OD2   . ASP A 1 81  ? 13.912  31.588  -16.229 1.00 62.66  ? 202  ASP A OD2   1 
ATOM   658  N N     . ALA A 1 82  ? 15.910  29.474  -13.051 1.00 49.11  ? 203  ALA A N     1 
ATOM   659  C CA    . ALA A 1 82  ? 15.493  28.823  -11.815 1.00 49.22  ? 203  ALA A CA    1 
ATOM   660  C C     . ALA A 1 82  ? 14.210  28.001  -11.956 1.00 50.04  ? 203  ALA A C     1 
ATOM   661  O O     . ALA A 1 82  ? 14.072  26.939  -11.334 1.00 53.53  ? 203  ALA A O     1 
ATOM   662  C CB    . ALA A 1 82  ? 15.327  29.863  -10.725 1.00 51.84  ? 203  ALA A CB    1 
ATOM   663  N N     . THR A 1 83  ? 13.276  28.486  -12.767 1.00 47.24  ? 204  THR A N     1 
ATOM   664  C CA    . THR A 1 83  ? 11.954  27.870  -12.877 1.00 47.85  ? 204  THR A CA    1 
ATOM   665  C C     . THR A 1 83  ? 11.751  27.036  -14.159 1.00 44.37  ? 204  THR A C     1 
ATOM   666  O O     . THR A 1 83  ? 10.952  26.093  -14.198 1.00 40.00  ? 204  THR A O     1 
ATOM   667  C CB    . THR A 1 83  ? 10.853  28.967  -12.784 1.00 55.66  ? 204  THR A CB    1 
ATOM   668  O OG1   . THR A 1 83  ? 10.799  29.752  -13.988 1.00 59.47  ? 204  THR A OG1   1 
ATOM   669  C CG2   . THR A 1 83  ? 11.130  29.908  -11.616 1.00 55.59  ? 204  THR A CG2   1 
ATOM   670  N N     . ARG A 1 84  ? 12.489  27.375  -15.208 1.00 44.06  ? 205  ARG A N     1 
ATOM   671  C CA    . ARG A 1 84  ? 12.145  26.938  -16.542 1.00 43.01  ? 205  ARG A CA    1 
ATOM   672  C C     . ARG A 1 84  ? 13.346  26.380  -17.301 1.00 37.69  ? 205  ARG A C     1 
ATOM   673  O O     . ARG A 1 84  ? 14.462  26.829  -17.097 1.00 35.70  ? 205  ARG A O     1 
ATOM   674  C CB    . ARG A 1 84  ? 11.541  28.124  -17.300 1.00 48.10  ? 205  ARG A CB    1 
ATOM   675  C CG    . ARG A 1 84  ? 10.118  28.494  -16.902 1.00 54.17  ? 205  ARG A CG    1 
ATOM   676  C CD    . ARG A 1 84  ? 9.744   29.887  -17.407 1.00 63.69  ? 205  ARG A CD    1 
ATOM   677  N NE    . ARG A 1 84  ? 10.191  30.993  -16.534 1.00 71.93  ? 205  ARG A NE    1 
ATOM   678  C CZ    . ARG A 1 84  ? 9.386   31.918  -15.986 1.00 77.85  ? 205  ARG A CZ    1 
ATOM   679  N NH1   . ARG A 1 84  ? 8.064   31.913  -16.207 1.00 72.93  ? 205  ARG A NH1   1 
ATOM   680  N NH2   . ARG A 1 84  ? 9.904   32.871  -15.210 1.00 74.01  ? 205  ARG A NH2   1 
ATOM   681  N N     . VAL A 1 85  ? 13.090  25.396  -18.165 1.00 33.52  ? 206  VAL A N     1 
ATOM   682  C CA    . VAL A 1 85  ? 14.058  24.926  -19.165 1.00 33.37  ? 206  VAL A CA    1 
ATOM   683  C C     . VAL A 1 85  ? 13.628  25.388  -20.567 1.00 33.89  ? 206  VAL A C     1 
ATOM   684  O O     . VAL A 1 85  ? 12.486  25.149  -20.971 1.00 35.38  ? 206  VAL A O     1 
ATOM   685  C CB    . VAL A 1 85  ? 14.106  23.380  -19.204 1.00 31.55  ? 206  VAL A CB    1 
ATOM   686  C CG1   . VAL A 1 85  ? 15.022  22.856  -20.286 1.00 29.62  ? 206  VAL A CG1   1 
ATOM   687  C CG2   . VAL A 1 85  ? 14.545  22.841  -17.874 1.00 34.15  ? 206  VAL A CG2   1 
ATOM   688  N N     . TYR A 1 86  ? 14.556  25.967  -21.323 1.00 31.61  ? 207  TYR A N     1 
ATOM   689  C CA    . TYR A 1 86  ? 14.276  26.528  -22.636 1.00 31.49  ? 207  TYR A CA    1 
ATOM   690  C C     . TYR A 1 86  ? 14.964  25.771  -23.768 1.00 29.88  ? 207  TYR A C     1 
ATOM   691  O O     . TYR A 1 86  ? 16.198  25.619  -23.772 1.00 29.25  ? 207  TYR A O     1 
ATOM   692  C CB    . TYR A 1 86  ? 14.808  27.977  -22.668 1.00 34.32  ? 207  TYR A CB    1 
ATOM   693  C CG    . TYR A 1 86  ? 14.222  28.894  -21.627 1.00 37.16  ? 207  TYR A CG    1 
ATOM   694  C CD1   . TYR A 1 86  ? 13.015  29.539  -21.850 1.00 41.69  ? 207  TYR A CD1   1 
ATOM   695  C CD2   . TYR A 1 86  ? 14.863  29.111  -20.414 1.00 42.06  ? 207  TYR A CD2   1 
ATOM   696  C CE1   . TYR A 1 86  ? 12.455  30.372  -20.891 1.00 44.75  ? 207  TYR A CE1   1 
ATOM   697  C CE2   . TYR A 1 86  ? 14.326  29.958  -19.449 1.00 43.11  ? 207  TYR A CE2   1 
ATOM   698  C CZ    . TYR A 1 86  ? 13.126  30.591  -19.696 1.00 45.97  ? 207  TYR A CZ    1 
ATOM   699  O OH    . TYR A 1 86  ? 12.568  31.424  -18.754 1.00 50.60  ? 207  TYR A OH    1 
ATOM   700  N N     . LEU A 1 87  ? 14.195  25.358  -24.761 1.00 28.63  ? 208  LEU A N     1 
ATOM   701  C CA    . LEU A 1 87  ? 14.744  24.749  -25.971 1.00 28.41  ? 208  LEU A CA    1 
ATOM   702  C C     . LEU A 1 87  ? 14.691  25.663  -27.201 1.00 29.63  ? 208  LEU A C     1 
ATOM   703  O O     . LEU A 1 87  ? 13.676  26.215  -27.525 1.00 34.75  ? 208  LEU A O     1 
ATOM   704  C CB    . LEU A 1 87  ? 14.011  23.456  -26.270 1.00 28.09  ? 208  LEU A CB    1 
ATOM   705  C CG    . LEU A 1 87  ? 13.796  22.521  -25.083 1.00 28.64  ? 208  LEU A CG    1 
ATOM   706  C CD1   . LEU A 1 87  ? 13.080  21.266  -25.515 1.00 26.46  ? 208  LEU A CD1   1 
ATOM   707  C CD2   . LEU A 1 87  ? 15.146  22.182  -24.461 1.00 31.23  ? 208  LEU A CD2   1 
ATOM   708  N N     . ILE A 1 88  ? 15.795  25.784  -27.913 1.00 30.09  ? 209  ILE A N     1 
ATOM   709  C CA    . ILE A 1 88  ? 15.896  26.662  -29.059 1.00 28.72  ? 209  ILE A CA    1 
ATOM   710  C C     . ILE A 1 88  ? 15.776  25.813  -30.305 1.00 29.99  ? 209  ILE A C     1 
ATOM   711  O O     . ILE A 1 88  ? 16.715  25.125  -30.682 1.00 30.35  ? 209  ILE A O     1 
ATOM   712  C CB    . ILE A 1 88  ? 17.260  27.353  -29.080 1.00 28.12  ? 209  ILE A CB    1 
ATOM   713  C CG1   . ILE A 1 88  ? 17.455  28.175  -27.807 1.00 29.12  ? 209  ILE A CG1   1 
ATOM   714  C CG2   . ILE A 1 88  ? 17.389  28.226  -30.309 1.00 27.95  ? 209  ILE A CG2   1 
ATOM   715  C CD1   . ILE A 1 88  ? 18.898  28.541  -27.557 1.00 29.73  ? 209  ILE A CD1   1 
ATOM   716  N N     . LEU A 1 89  ? 14.631  25.874  -30.955 1.00 30.69  ? 210  LEU A N     1 
ATOM   717  C CA    . LEU A 1 89  ? 14.358  25.006  -32.065 1.00 30.22  ? 210  LEU A CA    1 
ATOM   718  C C     . LEU A 1 89  ? 14.186  25.818  -33.342 1.00 33.65  ? 210  LEU A C     1 
ATOM   719  O O     . LEU A 1 89  ? 13.741  26.966  -33.314 1.00 31.84  ? 210  LEU A O     1 
ATOM   720  C CB    . LEU A 1 89  ? 13.061  24.263  -31.781 1.00 29.89  ? 210  LEU A CB    1 
ATOM   721  C CG    . LEU A 1 89  ? 13.018  23.380  -30.535 1.00 30.19  ? 210  LEU A CG    1 
ATOM   722  C CD1   . LEU A 1 89  ? 11.597  23.134  -30.030 1.00 28.62  ? 210  LEU A CD1   1 
ATOM   723  C CD2   . LEU A 1 89  ? 13.686  22.070  -30.884 1.00 31.15  ? 210  LEU A CD2   1 
ATOM   724  N N     . GLU A 1 90  ? 14.508  25.187  -34.467 1.00 34.52  ? 211  GLU A N     1 
ATOM   725  C CA    . GLU A 1 90  ? 14.082  25.656  -35.780 1.00 35.40  ? 211  GLU A CA    1 
ATOM   726  C C     . GLU A 1 90  ? 12.586  25.870  -35.794 1.00 33.32  ? 211  GLU A C     1 
ATOM   727  O O     . GLU A 1 90  ? 11.871  25.109  -35.197 1.00 33.17  ? 211  GLU A O     1 
ATOM   728  C CB    . GLU A 1 90  ? 14.482  24.592  -36.803 1.00 37.58  ? 211  GLU A CB    1 
ATOM   729  C CG    . GLU A 1 90  ? 13.766  24.560  -38.129 1.00 38.51  ? 211  GLU A CG    1 
ATOM   730  C CD    . GLU A 1 90  ? 14.257  23.388  -39.007 1.00 45.02  ? 211  GLU A CD    1 
ATOM   731  O OE1   . GLU A 1 90  ? 14.916  22.426  -38.502 1.00 40.28  ? 211  GLU A OE1   1 
ATOM   732  O OE2   . GLU A 1 90  ? 13.976  23.427  -40.235 1.00 54.52  ? 211  GLU A OE2   1 
ATOM   733  N N     . TYR A 1 91  ? 12.125  26.900  -36.490 1.00 34.81  ? 212  TYR A N     1 
ATOM   734  C CA    . TYR A 1 91  ? 10.701  27.221  -36.591 1.00 35.45  ? 212  TYR A CA    1 
ATOM   735  C C     . TYR A 1 91  ? 10.140  26.553  -37.800 1.00 38.81  ? 212  TYR A C     1 
ATOM   736  O O     . TYR A 1 91  ? 10.717  26.692  -38.879 1.00 43.54  ? 212  TYR A O     1 
ATOM   737  C CB    . TYR A 1 91  ? 10.547  28.719  -36.746 1.00 36.59  ? 212  TYR A CB    1 
ATOM   738  C CG    . TYR A 1 91  ? 9.180   29.211  -37.133 1.00 38.26  ? 212  TYR A CG    1 
ATOM   739  C CD1   . TYR A 1 91  ? 8.064   28.885  -36.399 1.00 38.85  ? 212  TYR A CD1   1 
ATOM   740  C CD2   . TYR A 1 91  ? 9.018   30.061  -38.225 1.00 42.26  ? 212  TYR A CD2   1 
ATOM   741  C CE1   . TYR A 1 91  ? 6.818   29.358  -36.760 1.00 39.30  ? 212  TYR A CE1   1 
ATOM   742  C CE2   . TYR A 1 91  ? 7.780   30.546  -38.592 1.00 40.45  ? 212  TYR A CE2   1 
ATOM   743  C CZ    . TYR A 1 91  ? 6.687   30.187  -37.860 1.00 41.84  ? 212  TYR A CZ    1 
ATOM   744  O OH    . TYR A 1 91  ? 5.450   30.667  -38.248 1.00 49.22  ? 212  TYR A OH    1 
ATOM   745  N N     . ALA A 1 92  ? 9.024   25.833  -37.633 1.00 40.22  ? 213  ALA A N     1 
ATOM   746  C CA    . ALA A 1 92  ? 8.282   25.210  -38.757 1.00 38.57  ? 213  ALA A CA    1 
ATOM   747  C C     . ALA A 1 92  ? 7.007   25.968  -39.072 1.00 38.88  ? 213  ALA A C     1 
ATOM   748  O O     . ALA A 1 92  ? 6.020   25.816  -38.357 1.00 39.40  ? 213  ALA A O     1 
ATOM   749  C CB    . ALA A 1 92  ? 7.916   23.777  -38.421 1.00 42.16  ? 213  ALA A CB    1 
ATOM   750  N N     . PRO A 1 93  ? 6.993   26.743  -40.169 1.00 39.33  ? 214  PRO A N     1 
ATOM   751  C CA    . PRO A 1 93  ? 5.881   27.658  -40.424 1.00 40.45  ? 214  PRO A CA    1 
ATOM   752  C C     . PRO A 1 93  ? 4.528   27.064  -40.742 1.00 42.04  ? 214  PRO A C     1 
ATOM   753  O O     . PRO A 1 93  ? 3.517   27.708  -40.475 1.00 50.69  ? 214  PRO A O     1 
ATOM   754  C CB    . PRO A 1 93  ? 6.341   28.449  -41.650 1.00 39.35  ? 214  PRO A CB    1 
ATOM   755  C CG    . PRO A 1 93  ? 7.797   28.212  -41.758 1.00 40.70  ? 214  PRO A CG    1 
ATOM   756  C CD    . PRO A 1 93  ? 8.010   26.832  -41.224 1.00 39.74  ? 214  PRO A CD    1 
ATOM   757  N N     . LEU A 1 94  ? 4.474   25.881  -41.324 1.00 43.38  ? 215  LEU A N     1 
ATOM   758  C CA    . LEU A 1 94  ? 3.221   25.432  -41.947 1.00 44.03  ? 215  LEU A CA    1 
ATOM   759  C C     . LEU A 1 94  ? 2.453   24.413  -41.129 1.00 42.06  ? 215  LEU A C     1 
ATOM   760  O O     . LEU A 1 94  ? 1.601   23.704  -41.655 1.00 42.77  ? 215  LEU A O     1 
ATOM   761  C CB    . LEU A 1 94  ? 3.506   24.874  -43.348 1.00 47.15  ? 215  LEU A CB    1 
ATOM   762  C CG    . LEU A 1 94  ? 3.967   25.873  -44.410 1.00 48.79  ? 215  LEU A CG    1 
ATOM   763  C CD1   . LEU A 1 94  ? 4.047   25.178  -45.762 1.00 48.87  ? 215  LEU A CD1   1 
ATOM   764  C CD2   . LEU A 1 94  ? 3.006   27.046  -44.469 1.00 50.17  ? 215  LEU A CD2   1 
ATOM   765  N N     . GLY A 1 95  ? 2.756   24.319  -39.840 1.00 43.80  ? 216  GLY A N     1 
ATOM   766  C CA    . GLY A 1 95  ? 1.952   23.487  -38.922 1.00 40.18  ? 216  GLY A CA    1 
ATOM   767  C C     . GLY A 1 95  ? 2.278   22.008  -38.932 1.00 36.87  ? 216  GLY A C     1 
ATOM   768  O O     . GLY A 1 95  ? 3.195   21.565  -39.621 1.00 36.41  ? 216  GLY A O     1 
ATOM   769  N N     . THR A 1 96  ? 1.523   21.240  -38.159 1.00 35.09  ? 217  THR A N     1 
ATOM   770  C CA    . THR A 1 96  ? 1.761   19.824  -38.075 1.00 36.43  ? 217  THR A CA    1 
ATOM   771  C C     . THR A 1 96  ? 1.152   19.128  -39.272 1.00 37.40  ? 217  THR A C     1 
ATOM   772  O O     . THR A 1 96  ? 0.377   19.706  -40.018 1.00 39.97  ? 217  THR A O     1 
ATOM   773  C CB    . THR A 1 96  ? 1.205   19.244  -36.782 1.00 39.45  ? 217  THR A CB    1 
ATOM   774  O OG1   . THR A 1 96  ? -0.221  19.405  -36.764 1.00 43.30  ? 217  THR A OG1   1 
ATOM   775  C CG2   . THR A 1 96  ? 1.835   19.950  -35.543 1.00 38.00  ? 217  THR A CG2   1 
ATOM   776  N N     . VAL A 1 97  ? 1.540   17.889  -39.489 1.00 38.87  ? 218  VAL A N     1 
ATOM   777  C CA    . VAL A 1 97  ? 0.942   17.113  -40.565 1.00 41.37  ? 218  VAL A CA    1 
ATOM   778  C C     . VAL A 1 97  ? -0.453  16.706  -40.098 1.00 44.30  ? 218  VAL A C     1 
ATOM   779  O O     . VAL A 1 97  ? -1.363  16.600  -40.898 1.00 51.88  ? 218  VAL A O     1 
ATOM   780  C CB    . VAL A 1 97  ? 1.819   15.903  -40.970 1.00 38.85  ? 218  VAL A CB    1 
ATOM   781  C CG1   . VAL A 1 97  ? 1.026   14.872  -41.734 1.00 40.88  ? 218  VAL A CG1   1 
ATOM   782  C CG2   . VAL A 1 97  ? 2.957   16.367  -41.850 1.00 37.86  ? 218  VAL A CG2   1 
ATOM   783  N N     . TYR A 1 98  ? -0.617  16.520  -38.793 1.00 45.80  ? 219  TYR A N     1 
ATOM   784  C CA    . TYR A 1 98  ? -1.907  16.211  -38.197 1.00 45.16  ? 219  TYR A CA    1 
ATOM   785  C C     . TYR A 1 98  ? -2.974  17.232  -38.572 1.00 47.85  ? 219  TYR A C     1 
ATOM   786  O O     . TYR A 1 98  ? -4.016  16.850  -39.068 1.00 51.84  ? 219  TYR A O     1 
ATOM   787  C CB    . TYR A 1 98  ? -1.761  16.148  -36.691 1.00 45.98  ? 219  TYR A CB    1 
ATOM   788  C CG    . TYR A 1 98  ? -3.021  15.881  -35.933 1.00 49.36  ? 219  TYR A CG    1 
ATOM   789  C CD1   . TYR A 1 98  ? -3.589  14.608  -35.922 1.00 53.20  ? 219  TYR A CD1   1 
ATOM   790  C CD2   . TYR A 1 98  ? -3.643  16.894  -35.197 1.00 54.17  ? 219  TYR A CD2   1 
ATOM   791  C CE1   . TYR A 1 98  ? -4.736  14.343  -35.201 1.00 55.40  ? 219  TYR A CE1   1 
ATOM   792  C CE2   . TYR A 1 98  ? -4.803  16.644  -34.474 1.00 55.15  ? 219  TYR A CE2   1 
ATOM   793  C CZ    . TYR A 1 98  ? -5.338  15.363  -34.478 1.00 56.12  ? 219  TYR A CZ    1 
ATOM   794  O OH    . TYR A 1 98  ? -6.483  15.089  -33.775 1.00 58.26  ? 219  TYR A OH    1 
ATOM   795  N N     . ARG A 1 99  ? -2.733  18.522  -38.356 1.00 49.20  ? 220  ARG A N     1 
ATOM   796  C CA    . ARG A 1 99  ? -3.761  19.498  -38.669 1.00 50.39  ? 220  ARG A CA    1 
ATOM   797  C C     . ARG A 1 99  ? -4.039  19.474  -40.144 1.00 48.08  ? 220  ARG A C     1 
ATOM   798  O O     . ARG A 1 99  ? -5.184  19.615  -40.529 1.00 50.75  ? 220  ARG A O     1 
ATOM   799  C CB    . ARG A 1 99  ? -3.407  20.911  -38.228 1.00 59.39  ? 220  ARG A CB    1 
ATOM   800  C CG    . ARG A 1 99  ? -4.504  21.940  -38.528 1.00 72.18  ? 220  ARG A CG    1 
ATOM   801  C CD    . ARG A 1 99  ? -4.704  22.960  -37.394 1.00 84.12  ? 220  ARG A CD    1 
ATOM   802  N NE    . ARG A 1 99  ? -5.156  24.285  -37.858 1.00 91.47  ? 220  ARG A NE    1 
ATOM   803  C CZ    . ARG A 1 99  ? -5.414  25.332  -37.064 1.00 91.24  ? 220  ARG A CZ    1 
ATOM   804  N NH1   . ARG A 1 99  ? -5.282  25.228  -35.738 1.00 88.91  ? 220  ARG A NH1   1 
ATOM   805  N NH2   . ARG A 1 99  ? -5.813  26.490  -37.598 1.00 84.14  ? 220  ARG A NH2   1 
ATOM   806  N N     . GLU A 1 100 ? -3.012  19.267  -40.965 1.00 46.00  ? 221  GLU A N     1 
ATOM   807  C CA    . GLU A 1 100 ? -3.173  19.283  -42.418 1.00 47.46  ? 221  GLU A CA    1 
ATOM   808  C C     . GLU A 1 100 ? -4.033  18.105  -42.842 1.00 49.43  ? 221  GLU A C     1 
ATOM   809  O O     . GLU A 1 100 ? -4.982  18.232  -43.616 1.00 45.09  ? 221  GLU A O     1 
ATOM   810  C CB    . GLU A 1 100 ? -1.818  19.180  -43.102 1.00 51.10  ? 221  GLU A CB    1 
ATOM   811  C CG    . GLU A 1 100 ? -1.829  19.532  -44.584 1.00 57.49  ? 221  GLU A CG    1 
ATOM   812  C CD    . GLU A 1 100 ? -0.656  18.919  -45.360 1.00 66.02  ? 221  GLU A CD    1 
ATOM   813  O OE1   . GLU A 1 100 ? 0.001   17.988  -44.836 1.00 66.11  ? 221  GLU A OE1   1 
ATOM   814  O OE2   . GLU A 1 100 ? -0.389  19.347  -46.516 1.00 73.18  ? 221  GLU A OE2   1 
ATOM   815  N N     . LEU A 1 101 ? -3.688  16.949  -42.295 1.00 51.87  ? 222  LEU A N     1 
ATOM   816  C CA    . LEU A 1 101 ? -4.406  15.725  -42.554 1.00 49.00  ? 222  LEU A CA    1 
ATOM   817  C C     . LEU A 1 101 ? -5.878  15.893  -42.264 1.00 46.74  ? 222  LEU A C     1 
ATOM   818  O O     . LEU A 1 101 ? -6.701  15.420  -43.027 1.00 51.89  ? 222  LEU A O     1 
ATOM   819  C CB    . LEU A 1 101 ? -3.837  14.584  -41.713 1.00 48.12  ? 222  LEU A CB    1 
ATOM   820  C CG    . LEU A 1 101 ? -4.313  13.157  -42.018 1.00 46.99  ? 222  LEU A CG    1 
ATOM   821  C CD1   . LEU A 1 101 ? -4.433  12.888  -43.507 1.00 45.85  ? 222  LEU A CD1   1 
ATOM   822  C CD2   . LEU A 1 101 ? -3.339  12.173  -41.382 1.00 49.64  ? 222  LEU A CD2   1 
ATOM   823  N N     . GLN A 1 102 ? -6.218  16.587  -41.193 1.00 43.61  ? 223  GLN A N     1 
ATOM   824  C CA    . GLN A 1 102 ? -7.616  16.725  -40.839 1.00 49.66  ? 223  GLN A CA    1 
ATOM   825  C C     . GLN A 1 102 ? -8.354  17.916  -41.450 1.00 56.11  ? 223  GLN A C     1 
ATOM   826  O O     . GLN A 1 102 ? -9.485  18.167  -41.081 1.00 58.66  ? 223  GLN A O     1 
ATOM   827  C CB    . GLN A 1 102 ? -7.780  16.723  -39.333 1.00 50.27  ? 223  GLN A CB    1 
ATOM   828  C CG    . GLN A 1 102 ? -7.222  17.908  -38.609 1.00 51.06  ? 223  GLN A CG    1 
ATOM   829  C CD    . GLN A 1 102 ? -7.582  17.834  -37.140 1.00 59.52  ? 223  GLN A CD    1 
ATOM   830  O OE1   . GLN A 1 102 ? -8.063  16.789  -36.657 1.00 55.81  ? 223  GLN A OE1   1 
ATOM   831  N NE2   . GLN A 1 102 ? -7.372  18.945  -36.414 1.00 60.80  ? 223  GLN A NE2   1 
ATOM   832  N N     . LYS A 1 103 ? -7.715  18.655  -42.354 1.00 62.70  ? 224  LYS A N     1 
ATOM   833  C CA    . LYS A 1 103 ? -8.404  19.644  -43.180 1.00 65.43  ? 224  LYS A CA    1 
ATOM   834  C C     . LYS A 1 103 ? -8.682  18.977  -44.504 1.00 63.33  ? 224  LYS A C     1 
ATOM   835  O O     . LYS A 1 103 ? -9.778  19.095  -45.036 1.00 71.07  ? 224  LYS A O     1 
ATOM   836  C CB    . LYS A 1 103 ? -7.553  20.903  -43.440 1.00 71.54  ? 224  LYS A CB    1 
ATOM   837  C CG    . LYS A 1 103 ? -7.018  21.627  -42.207 1.00 75.31  ? 224  LYS A CG    1 
ATOM   838  C CD    . LYS A 1 103 ? -8.080  22.310  -41.355 1.00 74.75  ? 224  LYS A CD    1 
ATOM   839  C CE    . LYS A 1 103 ? -7.462  22.850  -40.066 1.00 76.20  ? 224  LYS A CE    1 
ATOM   840  N NZ    . LYS A 1 103 ? -8.180  24.042  -39.523 1.00 75.70  ? 224  LYS A NZ    1 
ATOM   841  N N     . LEU A 1 104 ? -7.679  18.286  -45.042 1.00 56.14  ? 225  LEU A N     1 
ATOM   842  C CA    . LEU A 1 104 ? -7.831  17.593  -46.311 1.00 55.45  ? 225  LEU A CA    1 
ATOM   843  C C     . LEU A 1 104 ? -8.446  16.206  -46.195 1.00 51.19  ? 225  LEU A C     1 
ATOM   844  O O     . LEU A 1 104 ? -8.666  15.568  -47.200 1.00 48.95  ? 225  LEU A O     1 
ATOM   845  C CB    . LEU A 1 104 ? -6.484  17.472  -47.028 1.00 55.28  ? 225  LEU A CB    1 
ATOM   846  C CG    . LEU A 1 104 ? -5.752  18.779  -47.305 1.00 55.20  ? 225  LEU A CG    1 
ATOM   847  C CD1   . LEU A 1 104 ? -4.528  18.520  -48.172 1.00 55.52  ? 225  LEU A CD1   1 
ATOM   848  C CD2   . LEU A 1 104 ? -6.683  19.778  -47.961 1.00 55.57  ? 225  LEU A CD2   1 
ATOM   849  N N     . SER A 1 105 ? -8.676  15.728  -44.979 1.00 54.73  ? 226  SER A N     1 
ATOM   850  C CA    . SER A 1 105 ? -9.236  14.390  -44.722 1.00 54.07  ? 226  SER A CA    1 
ATOM   851  C C     . SER A 1 105 ? -8.241  13.253  -45.006 1.00 49.51  ? 226  SER A C     1 
ATOM   852  O O     . SER A 1 105 ? -7.948  12.413  -44.150 1.00 48.28  ? 226  SER A O     1 
ATOM   853  C CB    . SER A 1 105 ? -10.526 14.195  -45.518 1.00 57.09  ? 226  SER A CB    1 
ATOM   854  O OG    . SER A 1 105 ? -11.438 13.405  -44.781 1.00 65.60  ? 226  SER A OG    1 
ATOM   855  N N     . LYS A 1 106 ? -7.744  13.230  -46.227 1.00 47.87  ? 227  LYS A N     1 
ATOM   856  C CA    . LYS A 1 106 ? -6.714  12.304  -46.636 1.00 46.75  ? 227  LYS A CA    1 
ATOM   857  C C     . LYS A 1 106 ? -5.888  12.981  -47.731 1.00 43.14  ? 227  LYS A C     1 
ATOM   858  O O     . LYS A 1 106 ? -6.259  14.039  -48.221 1.00 44.08  ? 227  LYS A O     1 
ATOM   859  C CB    . LYS A 1 106 ? -7.357  11.013  -47.131 1.00 51.70  ? 227  LYS A CB    1 
ATOM   860  C CG    . LYS A 1 106 ? -8.371  11.189  -48.262 1.00 55.58  ? 227  LYS A CG    1 
ATOM   861  C CD    . LYS A 1 106 ? -9.533  10.199  -48.147 1.00 57.35  ? 227  LYS A CD    1 
ATOM   862  C CE    . LYS A 1 106 ? -10.299 10.070  -49.458 1.00 58.01  ? 227  LYS A CE    1 
ATOM   863  N NZ    . LYS A 1 106 ? -9.542  9.369   -50.546 1.00 56.40  ? 227  LYS A NZ    1 
ATOM   864  N N     . PHE A 1 107 ? -4.764  12.392  -48.084 1.00 39.49  ? 228  PHE A N     1 
ATOM   865  C CA    . PHE A 1 107 ? -3.907  12.957  -49.075 1.00 42.50  ? 228  PHE A CA    1 
ATOM   866  C C     . PHE A 1 107 ? -4.003  12.102  -50.312 1.00 47.60  ? 228  PHE A C     1 
ATOM   867  O O     . PHE A 1 107 ? -4.198  10.882  -50.219 1.00 49.07  ? 228  PHE A O     1 
ATOM   868  C CB    . PHE A 1 107 ? -2.438  12.919  -48.639 1.00 46.03  ? 228  PHE A CB    1 
ATOM   869  C CG    . PHE A 1 107 ? -2.141  13.597  -47.327 1.00 47.16  ? 228  PHE A CG    1 
ATOM   870  C CD1   . PHE A 1 107 ? -2.864  14.690  -46.893 1.00 47.33  ? 228  PHE A CD1   1 
ATOM   871  C CD2   . PHE A 1 107 ? -1.072  13.162  -46.555 1.00 47.34  ? 228  PHE A CD2   1 
ATOM   872  C CE1   . PHE A 1 107 ? -2.569  15.292  -45.681 1.00 48.67  ? 228  PHE A CE1   1 
ATOM   873  C CE2   . PHE A 1 107 ? -0.763  13.772  -45.353 1.00 46.38  ? 228  PHE A CE2   1 
ATOM   874  C CZ    . PHE A 1 107 ? -1.518  14.833  -44.912 1.00 46.99  ? 228  PHE A CZ    1 
ATOM   875  N N     . ASP A 1 108 ? -3.824  12.748  -51.464 1.00 51.88  ? 229  ASP A N     1 
ATOM   876  C CA    . ASP A 1 108 ? -3.530  12.071  -52.718 1.00 53.05  ? 229  ASP A CA    1 
ATOM   877  C C     . ASP A 1 108 ? -2.226  11.306  -52.561 1.00 52.50  ? 229  ASP A C     1 
ATOM   878  O O     . ASP A 1 108 ? -1.541  11.462  -51.564 1.00 59.23  ? 229  ASP A O     1 
ATOM   879  C CB    . ASP A 1 108 ? -3.438  13.073  -53.888 1.00 59.11  ? 229  ASP A CB    1 
ATOM   880  C CG    . ASP A 1 108 ? -2.412  14.201  -53.646 1.00 69.64  ? 229  ASP A CG    1 
ATOM   881  O OD1   . ASP A 1 108 ? -1.388  13.980  -52.958 1.00 79.77  ? 229  ASP A OD1   1 
ATOM   882  O OD2   . ASP A 1 108 ? -2.633  15.324  -54.156 1.00 73.15  ? 229  ASP A OD2   1 
ATOM   883  N N     . GLU A 1 109 ? -1.867  10.517  -53.565 1.00 50.67  ? 230  GLU A N     1 
ATOM   884  C CA    . GLU A 1 109 ? -0.693  9.684   -53.499 1.00 47.92  ? 230  GLU A CA    1 
ATOM   885  C C     . GLU A 1 109 ? 0.577   10.469  -53.718 1.00 49.02  ? 230  GLU A C     1 
ATOM   886  O O     . GLU A 1 109 ? 1.667   9.936   -53.503 1.00 54.78  ? 230  GLU A O     1 
ATOM   887  C CB    . GLU A 1 109 ? -0.769  8.579   -54.559 1.00 54.43  ? 230  GLU A CB    1 
ATOM   888  C CG    . GLU A 1 109 ? -2.118  7.845   -54.616 1.00 60.22  ? 230  GLU A CG    1 
ATOM   889  C CD    . GLU A 1 109 ? -2.119  6.596   -55.507 1.00 62.49  ? 230  GLU A CD    1 
ATOM   890  O OE1   . GLU A 1 109 ? -1.099  5.858   -55.585 1.00 61.24  ? 230  GLU A OE1   1 
ATOM   891  O OE2   . GLU A 1 109 ? -3.173  6.351   -56.129 1.00 63.24  ? 230  GLU A OE2   1 
ATOM   892  N N     . GLN A 1 110 ? 0.466   11.712  -54.184 1.00 50.17  ? 231  GLN A N     1 
ATOM   893  C CA    . GLN A 1 110 ? 1.656   12.478  -54.558 1.00 55.17  ? 231  GLN A CA    1 
ATOM   894  C C     . GLN A 1 110 ? 2.266   12.928  -53.256 1.00 52.38  ? 231  GLN A C     1 
ATOM   895  O O     . GLN A 1 110 ? 3.461   12.713  -53.000 1.00 48.90  ? 231  GLN A O     1 
ATOM   896  C CB    . GLN A 1 110 ? 1.350   13.711  -55.446 1.00 62.68  ? 231  GLN A CB    1 
ATOM   897  C CG    . GLN A 1 110 ? 0.253   13.554  -56.512 1.00 74.07  ? 231  GLN A CG    1 
ATOM   898  C CD    . GLN A 1 110 ? 0.251   12.188  -57.205 1.00 82.98  ? 231  GLN A CD    1 
ATOM   899  O OE1   . GLN A 1 110 ? 1.312   11.617  -57.512 1.00 89.84  ? 231  GLN A OE1   1 
ATOM   900  N NE2   . GLN A 1 110 ? -0.947  11.652  -57.443 1.00 78.94  ? 231  GLN A NE2   1 
ATOM   901  N N     . ARG A 1 111 ? 1.410   13.527  -52.432 1.00 45.32  ? 232  ARG A N     1 
ATOM   902  C CA    . ARG A 1 111 ? 1.797   14.025  -51.142 1.00 46.75  ? 232  ARG A CA    1 
ATOM   903  C C     . ARG A 1 111 ? 2.339   12.867  -50.290 1.00 50.16  ? 232  ARG A C     1 
ATOM   904  O O     . ARG A 1 111 ? 3.450   12.952  -49.736 1.00 47.45  ? 232  ARG A O     1 
ATOM   905  C CB    . ARG A 1 111 ? 0.589   14.668  -50.475 1.00 49.47  ? 232  ARG A CB    1 
ATOM   906  C CG    . ARG A 1 111 ? 0.892   15.952  -49.748 1.00 53.93  ? 232  ARG A CG    1 
ATOM   907  C CD    . ARG A 1 111 ? -0.362  16.538  -49.112 1.00 61.63  ? 232  ARG A CD    1 
ATOM   908  N NE    . ARG A 1 111 ? -0.473  17.968  -49.416 1.00 68.48  ? 232  ARG A NE    1 
ATOM   909  C CZ    . ARG A 1 111 ? -1.196  18.480  -50.412 1.00 78.09  ? 232  ARG A CZ    1 
ATOM   910  N NH1   . ARG A 1 111 ? -1.922  17.694  -51.213 1.00 83.92  ? 232  ARG A NH1   1 
ATOM   911  N NH2   . ARG A 1 111 ? -1.209  19.796  -50.603 1.00 81.04  ? 232  ARG A NH2   1 
ATOM   912  N N     . THR A 1 112 ? 1.557   11.777  -50.225 1.00 48.37  ? 233  THR A N     1 
ATOM   913  C CA    . THR A 1 112 ? 1.896   10.613  -49.410 1.00 45.30  ? 233  THR A CA    1 
ATOM   914  C C     . THR A 1 112 ? 3.281   10.099  -49.715 1.00 43.90  ? 233  THR A C     1 
ATOM   915  O O     . THR A 1 112 ? 4.096   9.955   -48.830 1.00 42.25  ? 233  THR A O     1 
ATOM   916  C CB    . THR A 1 112 ? 0.903   9.455   -49.587 1.00 45.19  ? 233  THR A CB    1 
ATOM   917  O OG1   . THR A 1 112 ? -0.386  9.848   -49.114 1.00 48.92  ? 233  THR A OG1   1 
ATOM   918  C CG2   . THR A 1 112 ? 1.334   8.266   -48.760 1.00 47.66  ? 233  THR A CG2   1 
ATOM   919  N N     . ALA A 1 113 ? 3.531   9.809   -50.976 1.00 46.33  ? 234  ALA A N     1 
ATOM   920  C CA    . ALA A 1 113 ? 4.799   9.270   -51.396 1.00 45.95  ? 234  ALA A CA    1 
ATOM   921  C C     . ALA A 1 113 ? 5.906   10.241  -51.076 1.00 45.76  ? 234  ALA A C     1 
ATOM   922  O O     . ALA A 1 113 ? 7.024   9.823   -50.757 1.00 43.87  ? 234  ALA A O     1 
ATOM   923  C CB    . ALA A 1 113 ? 4.769   9.022   -52.888 1.00 49.10  ? 234  ALA A CB    1 
ATOM   924  N N     . THR A 1 114 ? 5.594   11.535  -51.178 1.00 43.91  ? 235  THR A N     1 
ATOM   925  C CA    . THR A 1 114 ? 6.590   12.570  -50.978 1.00 46.36  ? 235  THR A CA    1 
ATOM   926  C C     . THR A 1 114 ? 6.988   12.525  -49.507 1.00 43.17  ? 235  THR A C     1 
ATOM   927  O O     . THR A 1 114 ? 8.152   12.239  -49.164 1.00 46.37  ? 235  THR A O     1 
ATOM   928  C CB    . THR A 1 114 ? 6.076   13.965  -51.408 1.00 48.82  ? 235  THR A CB    1 
ATOM   929  O OG1   . THR A 1 114 ? 5.531   13.889  -52.729 1.00 59.80  ? 235  THR A OG1   1 
ATOM   930  C CG2   . THR A 1 114 ? 7.185   14.969  -51.453 1.00 47.50  ? 235  THR A CG2   1 
ATOM   931  N N     . TYR A 1 115 ? 6.009   12.722  -48.641 1.00 38.74  ? 236  TYR A N     1 
ATOM   932  C CA    . TYR A 1 115 ? 6.223   12.540  -47.209 1.00 36.38  ? 236  TYR A CA    1 
ATOM   933  C C     . TYR A 1 115 ? 6.880   11.224  -46.815 1.00 36.10  ? 236  TYR A C     1 
ATOM   934  O O     . TYR A 1 115 ? 7.714   11.223  -45.915 1.00 40.68  ? 236  TYR A O     1 
ATOM   935  C CB    . TYR A 1 115 ? 4.923   12.655  -46.447 1.00 35.70  ? 236  TYR A CB    1 
ATOM   936  C CG    . TYR A 1 115 ? 4.263   14.017  -46.460 1.00 35.33  ? 236  TYR A CG    1 
ATOM   937  C CD1   . TYR A 1 115 ? 4.926   15.157  -46.882 1.00 34.73  ? 236  TYR A CD1   1 
ATOM   938  C CD2   . TYR A 1 115 ? 2.978   14.156  -45.975 1.00 36.35  ? 236  TYR A CD2   1 
ATOM   939  C CE1   . TYR A 1 115 ? 4.303   16.392  -46.852 1.00 35.82  ? 236  TYR A CE1   1 
ATOM   940  C CE2   . TYR A 1 115 ? 2.351   15.378  -45.936 1.00 36.21  ? 236  TYR A CE2   1 
ATOM   941  C CZ    . TYR A 1 115 ? 3.011   16.483  -46.381 1.00 35.42  ? 236  TYR A CZ    1 
ATOM   942  O OH    . TYR A 1 115 ? 2.339   17.656  -46.349 1.00 34.19  ? 236  TYR A OH    1 
ATOM   943  N N     . ILE A 1 116 ? 6.518   10.109  -47.445 1.00 34.82  ? 237  ILE A N     1 
ATOM   944  C CA    . ILE A 1 116 ? 7.095   8.812   -47.052 1.00 35.31  ? 237  ILE A CA    1 
ATOM   945  C C     . ILE A 1 116 ? 8.560   8.820   -47.412 1.00 39.62  ? 237  ILE A C     1 
ATOM   946  O O     . ILE A 1 116 ? 9.393   8.309   -46.658 1.00 40.72  ? 237  ILE A O     1 
ATOM   947  C CB    . ILE A 1 116 ? 6.415   7.598   -47.714 1.00 33.89  ? 237  ILE A CB    1 
ATOM   948  C CG1   . ILE A 1 116 ? 4.966   7.456   -47.268 1.00 37.91  ? 237  ILE A CG1   1 
ATOM   949  C CG2   . ILE A 1 116 ? 7.143   6.322   -47.377 1.00 33.39  ? 237  ILE A CG2   1 
ATOM   950  C CD1   . ILE A 1 116 ? 4.751   7.367   -45.762 1.00 41.35  ? 237  ILE A CD1   1 
ATOM   951  N N     . THR A 1 117 ? 8.881   9.409   -48.563 1.00 43.28  ? 238  THR A N     1 
ATOM   952  C CA    . THR A 1 117 ? 10.267  9.494   -48.985 1.00 45.50  ? 238  THR A CA    1 
ATOM   953  C C     . THR A 1 117 ? 11.056  10.353  -48.018 1.00 45.11  ? 238  THR A C     1 
ATOM   954  O O     . THR A 1 117 ? 12.170  9.977   -47.586 1.00 44.27  ? 238  THR A O     1 
ATOM   955  C CB    . THR A 1 117 ? 10.399  10.110  -50.374 1.00 48.10  ? 238  THR A CB    1 
ATOM   956  O OG1   . THR A 1 117 ? 9.567   9.396   -51.294 1.00 52.64  ? 238  THR A OG1   1 
ATOM   957  C CG2   . THR A 1 117 ? 11.838  10.042  -50.830 1.00 47.99  ? 238  THR A CG2   1 
ATOM   958  N N     . GLU A 1 118 ? 10.461  11.499  -47.684 1.00 40.89  ? 239  GLU A N     1 
ATOM   959  C CA    . GLU A 1 118 ? 11.050  12.421  -46.723 1.00 40.53  ? 239  GLU A CA    1 
ATOM   960  C C     . GLU A 1 118 ? 11.269  11.747  -45.385 1.00 38.24  ? 239  GLU A C     1 
ATOM   961  O O     . GLU A 1 118 ? 12.297  11.912  -44.789 1.00 35.39  ? 239  GLU A O     1 
ATOM   962  C CB    . GLU A 1 118 ? 10.189  13.687  -46.607 1.00 44.05  ? 239  GLU A CB    1 
ATOM   963  C CG    . GLU A 1 118 ? 10.372  14.557  -47.850 1.00 49.89  ? 239  GLU A CG    1 
ATOM   964  C CD    . GLU A 1 118 ? 9.569   15.847  -47.899 1.00 56.57  ? 239  GLU A CD    1 
ATOM   965  O OE1   . GLU A 1 118 ? 8.387   15.893  -47.442 1.00 58.02  ? 239  GLU A OE1   1 
ATOM   966  O OE2   . GLU A 1 118 ? 10.140  16.826  -48.454 1.00 66.87  ? 239  GLU A OE2   1 
ATOM   967  N N     . LEU A 1 119 ? 10.312  10.931  -44.951 1.00 40.72  ? 240  LEU A N     1 
ATOM   968  C CA    . LEU A 1 119 ? 10.429  10.212  -43.706 1.00 39.04  ? 240  LEU A CA    1 
ATOM   969  C C     . LEU A 1 119 ? 11.498  9.169   -43.738 1.00 41.03  ? 240  LEU A C     1 
ATOM   970  O O     . LEU A 1 119 ? 12.218  8.999   -42.769 1.00 40.87  ? 240  LEU A O     1 
ATOM   971  C CB    . LEU A 1 119 ? 9.134   9.517   -43.377 1.00 40.90  ? 240  LEU A CB    1 
ATOM   972  C CG    . LEU A 1 119 ? 8.355   10.193  -42.260 1.00 43.20  ? 240  LEU A CG    1 
ATOM   973  C CD1   . LEU A 1 119 ? 6.877   9.793   -42.295 1.00 44.93  ? 240  LEU A CD1   1 
ATOM   974  C CD2   . LEU A 1 119 ? 9.000   9.819   -40.934 1.00 41.86  ? 240  LEU A CD2   1 
ATOM   975  N N     . ALA A 1 120 ? 11.577  8.441   -44.844 1.00 43.04  ? 241  ALA A N     1 
ATOM   976  C CA    . ALA A 1 120 ? 12.497  7.315   -44.950 1.00 43.16  ? 241  ALA A CA    1 
ATOM   977  C C     . ALA A 1 120 ? 13.922  7.801   -45.019 1.00 43.33  ? 241  ALA A C     1 
ATOM   978  O O     . ALA A 1 120 ? 14.836  7.140   -44.517 1.00 44.98  ? 241  ALA A O     1 
ATOM   979  C CB    . ALA A 1 120 ? 12.178  6.485   -46.182 1.00 45.64  ? 241  ALA A CB    1 
ATOM   980  N N     . ASN A 1 121 ? 14.118  8.947   -45.660 1.00 41.50  ? 242  ASN A N     1 
ATOM   981  C CA    . ASN A 1 121 ? 15.414  9.580   -45.633 1.00 41.30  ? 242  ASN A CA    1 
ATOM   982  C C     . ASN A 1 121 ? 15.803  9.941   -44.228 1.00 40.36  ? 242  ASN A C     1 
ATOM   983  O O     . ASN A 1 121 ? 16.921  9.627   -43.793 1.00 39.14  ? 242  ASN A O     1 
ATOM   984  C CB    . ASN A 1 121 ? 15.435  10.825  -46.510 1.00 43.67  ? 242  ASN A CB    1 
ATOM   985  C CG    . ASN A 1 121 ? 15.679  10.498  -47.966 1.00 44.88  ? 242  ASN A CG    1 
ATOM   986  O OD1   . ASN A 1 121 ? 16.185  9.412   -48.303 1.00 45.84  ? 242  ASN A OD1   1 
ATOM   987  N ND2   . ASN A 1 121 ? 15.325  11.429  -48.840 1.00 43.67  ? 242  ASN A ND2   1 
ATOM   988  N N     . ALA A 1 122 ? 14.873  10.575  -43.509 1.00 38.85  ? 243  ALA A N     1 
ATOM   989  C CA    . ALA A 1 122 ? 15.154  10.992  -42.136 1.00 38.79  ? 243  ALA A CA    1 
ATOM   990  C C     . ALA A 1 122 ? 15.529  9.820   -41.231 1.00 39.49  ? 243  ALA A C     1 
ATOM   991  O O     . ALA A 1 122 ? 16.448  9.946   -40.437 1.00 44.63  ? 243  ALA A O     1 
ATOM   992  C CB    . ALA A 1 122 ? 13.993  11.767  -41.557 1.00 37.04  ? 243  ALA A CB    1 
ATOM   993  N N     . LEU A 1 123 ? 14.845  8.687   -41.365 1.00 38.65  ? 244  LEU A N     1 
ATOM   994  C CA    . LEU A 1 123 ? 15.122  7.529   -40.533 1.00 41.23  ? 244  LEU A CA    1 
ATOM   995  C C     . LEU A 1 123 ? 16.369  6.778   -40.952 1.00 48.19  ? 244  LEU A C     1 
ATOM   996  O O     . LEU A 1 123 ? 17.062  6.187   -40.105 1.00 52.33  ? 244  LEU A O     1 
ATOM   997  C CB    . LEU A 1 123 ? 13.960  6.569   -40.550 1.00 41.94  ? 244  LEU A CB    1 
ATOM   998  C CG    . LEU A 1 123 ? 12.724  7.083   -39.820 1.00 43.35  ? 244  LEU A CG    1 
ATOM   999  C CD1   . LEU A 1 123 ? 11.533  6.259   -40.242 1.00 42.82  ? 244  LEU A CD1   1 
ATOM   1000 C CD2   . LEU A 1 123 ? 12.913  7.020   -38.317 1.00 46.51  ? 244  LEU A CD2   1 
ATOM   1001 N N     . SER A 1 124 ? 16.654  6.778   -42.252 1.00 49.06  ? 245  SER A N     1 
ATOM   1002 C CA    . SER A 1 124 ? 17.894  6.196   -42.740 1.00 46.25  ? 245  SER A CA    1 
ATOM   1003 C C     . SER A 1 124 ? 19.078  6.939   -42.126 1.00 44.84  ? 245  SER A C     1 
ATOM   1004 O O     . SER A 1 124 ? 20.073  6.337   -41.734 1.00 46.89  ? 245  SER A O     1 
ATOM   1005 C CB    . SER A 1 124 ? 17.953  6.261   -44.251 1.00 47.37  ? 245  SER A CB    1 
ATOM   1006 O OG    . SER A 1 124 ? 19.084  5.550   -44.695 1.00 53.76  ? 245  SER A OG    1 
ATOM   1007 N N     . TYR A 1 125 ? 18.949  8.253   -42.013 1.00 43.03  ? 246  TYR A N     1 
ATOM   1008 C CA    . TYR A 1 125 ? 19.996  9.067   -41.404 1.00 41.92  ? 246  TYR A CA    1 
ATOM   1009 C C     . TYR A 1 125 ? 20.094  8.759   -39.913 1.00 42.08  ? 246  TYR A C     1 
ATOM   1010 O O     . TYR A 1 125 ? 21.131  8.326   -39.454 1.00 41.38  ? 246  TYR A O     1 
ATOM   1011 C CB    . TYR A 1 125 ? 19.721  10.534  -41.673 1.00 41.23  ? 246  TYR A CB    1 
ATOM   1012 C CG    . TYR A 1 125 ? 20.553  11.489  -40.895 1.00 43.65  ? 246  TYR A CG    1 
ATOM   1013 C CD1   . TYR A 1 125 ? 21.777  11.958  -41.397 1.00 45.02  ? 246  TYR A CD1   1 
ATOM   1014 C CD2   . TYR A 1 125 ? 20.115  11.966  -39.665 1.00 42.42  ? 246  TYR A CD2   1 
ATOM   1015 C CE1   . TYR A 1 125 ? 22.546  12.859  -40.672 1.00 44.52  ? 246  TYR A CE1   1 
ATOM   1016 C CE2   . TYR A 1 125 ? 20.866  12.881  -38.950 1.00 44.07  ? 246  TYR A CE2   1 
ATOM   1017 C CZ    . TYR A 1 125 ? 22.080  13.314  -39.448 1.00 45.01  ? 246  TYR A CZ    1 
ATOM   1018 O OH    . TYR A 1 125 ? 22.810  14.205  -38.716 1.00 47.38  ? 246  TYR A OH    1 
ATOM   1019 N N     . CYS A 1 126 ? 19.006  8.923   -39.170 1.00 40.49  ? 247  CYS A N     1 
ATOM   1020 C CA    . CYS A 1 126 ? 18.958  8.459   -37.773 1.00 40.98  ? 247  CYS A CA    1 
ATOM   1021 C C     . CYS A 1 126 ? 19.584  7.092   -37.538 1.00 39.60  ? 247  CYS A C     1 
ATOM   1022 O O     . CYS A 1 126 ? 20.304  6.879   -36.583 1.00 34.32  ? 247  CYS A O     1 
ATOM   1023 C CB    . CYS A 1 126 ? 17.512  8.327   -37.315 1.00 43.82  ? 247  CYS A CB    1 
ATOM   1024 S SG    . CYS A 1 126 ? 16.682  9.877   -37.026 1.00 44.72  ? 247  CYS A SG    1 
ATOM   1025 N N     . HIS A 1 127 ? 19.223  6.136   -38.372 1.00 43.36  ? 248  HIS A N     1 
ATOM   1026 C CA    . HIS A 1 127 ? 19.809  4.818   -38.267 1.00 46.12  ? 248  HIS A CA    1 
ATOM   1027 C C     . HIS A 1 127 ? 21.284  4.875   -38.582 1.00 48.30  ? 248  HIS A C     1 
ATOM   1028 O O     . HIS A 1 127 ? 22.074  4.277   -37.859 1.00 45.11  ? 248  HIS A O     1 
ATOM   1029 C CB    . HIS A 1 127 ? 19.094  3.847   -39.186 1.00 45.33  ? 248  HIS A CB    1 
ATOM   1030 C CG    . HIS A 1 127 ? 17.694  3.581   -38.756 1.00 46.15  ? 248  HIS A CG    1 
ATOM   1031 N ND1   . HIS A 1 127 ? 16.786  2.904   -39.532 1.00 47.54  ? 248  HIS A ND1   1 
ATOM   1032 C CD2   . HIS A 1 127 ? 17.035  3.945   -37.633 1.00 46.68  ? 248  HIS A CD2   1 
ATOM   1033 C CE1   . HIS A 1 127 ? 15.632  2.838   -38.895 1.00 46.96  ? 248  HIS A CE1   1 
ATOM   1034 N NE2   . HIS A 1 127 ? 15.754  3.470   -37.743 1.00 46.01  ? 248  HIS A NE2   1 
ATOM   1035 N N     . SER A 1 128 ? 21.652  5.622   -39.631 1.00 50.19  ? 249  SER A N     1 
ATOM   1036 C CA    . SER A 1 128 ? 23.068  5.808   -39.978 1.00 53.70  ? 249  SER A CA    1 
ATOM   1037 C C     . SER A 1 128 ? 23.892  6.192   -38.735 1.00 58.13  ? 249  SER A C     1 
ATOM   1038 O O     . SER A 1 128 ? 24.973  5.645   -38.515 1.00 68.81  ? 249  SER A O     1 
ATOM   1039 C CB    . SER A 1 128 ? 23.262  6.845   -41.109 1.00 54.58  ? 249  SER A CB    1 
ATOM   1040 O OG    . SER A 1 128 ? 23.709  8.110   -40.627 1.00 52.73  ? 249  SER A OG    1 
ATOM   1041 N N     . LYS A 1 129 ? 23.359  7.101   -37.917 1.00 55.41  ? 250  LYS A N     1 
ATOM   1042 C CA    . LYS A 1 129 ? 24.017  7.561   -36.702 1.00 52.38  ? 250  LYS A CA    1 
ATOM   1043 C C     . LYS A 1 129 ? 23.512  6.846   -35.445 1.00 54.20  ? 250  LYS A C     1 
ATOM   1044 O O     . LYS A 1 129 ? 23.469  7.430   -34.359 1.00 54.81  ? 250  LYS A O     1 
ATOM   1045 C CB    . LYS A 1 129 ? 23.819  9.063   -36.577 1.00 55.05  ? 250  LYS A CB    1 
ATOM   1046 C CG    . LYS A 1 129 ? 24.413  9.830   -37.752 1.00 60.33  ? 250  LYS A CG    1 
ATOM   1047 C CD    . LYS A 1 129 ? 24.358  11.337  -37.549 1.00 63.13  ? 250  LYS A CD    1 
ATOM   1048 C CE    . LYS A 1 129 ? 25.424  11.816  -36.572 1.00 66.34  ? 250  LYS A CE    1 
ATOM   1049 N NZ    . LYS A 1 129 ? 24.930  12.917  -35.691 1.00 68.22  ? 250  LYS A NZ    1 
ATOM   1050 N N     . ARG A 1 130 ? 23.122  5.584   -35.606 1.00 54.74  ? 251  ARG A N     1 
ATOM   1051 C CA    . ARG A 1 130 ? 22.806  4.691   -34.493 1.00 57.06  ? 251  ARG A CA    1 
ATOM   1052 C C     . ARG A 1 130 ? 21.660  5.147   -33.554 1.00 49.64  ? 251  ARG A C     1 
ATOM   1053 O O     . ARG A 1 130 ? 21.689  4.916   -32.357 1.00 47.71  ? 251  ARG A O     1 
ATOM   1054 C CB    . ARG A 1 130 ? 24.098  4.376   -33.724 1.00 64.79  ? 251  ARG A CB    1 
ATOM   1055 C CG    . ARG A 1 130 ? 24.935  3.277   -34.376 1.00 74.25  ? 251  ARG A CG    1 
ATOM   1056 C CD    . ARG A 1 130 ? 24.388  1.901   -33.999 1.00 85.43  ? 251  ARG A CD    1 
ATOM   1057 N NE    . ARG A 1 130 ? 25.047  0.766   -34.654 1.00 90.93  ? 251  ARG A NE    1 
ATOM   1058 C CZ    . ARG A 1 130 ? 24.664  -0.507  -34.509 1.00 96.09  ? 251  ARG A CZ    1 
ATOM   1059 N NH1   . ARG A 1 130 ? 23.627  -0.823  -33.729 1.00 99.29  ? 251  ARG A NH1   1 
ATOM   1060 N NH2   . ARG A 1 130 ? 25.318  -1.475  -35.143 1.00 92.14  ? 251  ARG A NH2   1 
ATOM   1061 N N     . VAL A 1 131 ? 20.632  5.761   -34.120 1.00 44.82  ? 252  VAL A N     1 
ATOM   1062 C CA    . VAL A 1 131 ? 19.494  6.245   -33.336 1.00 43.73  ? 252  VAL A CA    1 
ATOM   1063 C C     . VAL A 1 131 ? 18.209  5.600   -33.822 1.00 44.04  ? 252  VAL A C     1 
ATOM   1064 O O     . VAL A 1 131 ? 17.913  5.613   -35.013 1.00 43.91  ? 252  VAL A O     1 
ATOM   1065 C CB    . VAL A 1 131 ? 19.358  7.771   -33.468 1.00 44.22  ? 252  VAL A CB    1 
ATOM   1066 C CG1   . VAL A 1 131 ? 18.315  8.309   -32.520 1.00 46.73  ? 252  VAL A CG1   1 
ATOM   1067 C CG2   . VAL A 1 131 ? 20.680  8.455   -33.172 1.00 46.11  ? 252  VAL A CG2   1 
ATOM   1068 N N     . ILE A 1 132 ? 17.451  5.008   -32.913 1.00 48.78  ? 253  ILE A N     1 
ATOM   1069 C CA    . ILE A 1 132 ? 16.141  4.470   -33.275 1.00 50.20  ? 253  ILE A CA    1 
ATOM   1070 C C     . ILE A 1 132 ? 15.088  5.442   -32.780 1.00 51.39  ? 253  ILE A C     1 
ATOM   1071 O O     . ILE A 1 132 ? 14.997  5.717   -31.579 1.00 50.25  ? 253  ILE A O     1 
ATOM   1072 C CB    . ILE A 1 132 ? 15.888  3.062   -32.697 1.00 51.17  ? 253  ILE A CB    1 
ATOM   1073 C CG1   . ILE A 1 132 ? 17.038  2.117   -33.065 1.00 52.54  ? 253  ILE A CG1   1 
ATOM   1074 C CG2   . ILE A 1 132 ? 14.575  2.498   -33.231 1.00 52.02  ? 253  ILE A CG2   1 
ATOM   1075 C CD1   . ILE A 1 132 ? 17.958  1.826   -31.915 1.00 54.89  ? 253  ILE A CD1   1 
ATOM   1076 N N     . HIS A 1 133 ? 14.333  6.008   -33.723 1.00 54.50  ? 254  HIS A N     1 
ATOM   1077 C CA    . HIS A 1 133 ? 13.193  6.853   -33.402 1.00 54.35  ? 254  HIS A CA    1 
ATOM   1078 C C     . HIS A 1 133 ? 12.125  5.847   -33.073 1.00 59.49  ? 254  HIS A C     1 
ATOM   1079 O O     . HIS A 1 133 ? 12.160  4.743   -33.601 1.00 68.35  ? 254  HIS A O     1 
ATOM   1080 C CB    . HIS A 1 133 ? 12.776  7.707   -34.605 1.00 50.51  ? 254  HIS A CB    1 
ATOM   1081 C CG    . HIS A 1 133 ? 11.844  8.814   -34.235 1.00 52.86  ? 254  HIS A CG    1 
ATOM   1082 N ND1   . HIS A 1 133 ? 10.513  8.603   -33.943 1.00 52.26  ? 254  HIS A ND1   1 
ATOM   1083 C CD2   . HIS A 1 133 ? 12.066  10.133  -34.032 1.00 53.15  ? 254  HIS A CD2   1 
ATOM   1084 C CE1   . HIS A 1 133 ? 9.949   9.747   -33.607 1.00 53.13  ? 254  HIS A CE1   1 
ATOM   1085 N NE2   . HIS A 1 133 ? 10.869  10.694  -33.657 1.00 53.01  ? 254  HIS A NE2   1 
ATOM   1086 N N     . ARG A 1 134 ? 11.175  6.154   -32.211 1.00 63.86  ? 255  ARG A N     1 
ATOM   1087 C CA    . ARG A 1 134 ? 10.194  5.105   -31.928 1.00 67.95  ? 255  ARG A CA    1 
ATOM   1088 C C     . ARG A 1 134 ? 8.715   5.405   -32.208 1.00 71.49  ? 255  ARG A C     1 
ATOM   1089 O O     . ARG A 1 134 ? 8.136   4.807   -33.116 1.00 77.86  ? 255  ARG A O     1 
ATOM   1090 C CB    . ARG A 1 134 ? 10.448  4.542   -30.540 1.00 67.28  ? 255  ARG A CB    1 
ATOM   1091 C CG    . ARG A 1 134 ? 11.605  3.558   -30.581 1.00 66.56  ? 255  ARG A CG    1 
ATOM   1092 C CD    . ARG A 1 134 ? 11.918  2.982   -29.221 1.00 67.72  ? 255  ARG A CD    1 
ATOM   1093 N NE    . ARG A 1 134 ? 12.732  1.783   -29.348 1.00 67.68  ? 255  ARG A NE    1 
ATOM   1094 C CZ    . ARG A 1 134 ? 13.315  1.167   -28.328 1.00 69.09  ? 255  ARG A CZ    1 
ATOM   1095 N NH1   . ARG A 1 134 ? 13.185  1.644   -27.088 1.00 64.03  ? 255  ARG A NH1   1 
ATOM   1096 N NH2   . ARG A 1 134 ? 14.039  0.071   -28.556 1.00 69.30  ? 255  ARG A NH2   1 
ATOM   1097 N N     . ASP A 1 135 ? 8.103   6.304   -31.455 1.00 74.22  ? 256  ASP A N     1 
ATOM   1098 C CA    . ASP A 1 135 ? 6.714   6.636   -31.703 1.00 80.35  ? 256  ASP A CA    1 
ATOM   1099 C C     . ASP A 1 135 ? 6.600   7.816   -32.668 1.00 73.65  ? 256  ASP A C     1 
ATOM   1100 O O     . ASP A 1 135 ? 6.827   8.963   -32.272 1.00 79.90  ? 256  ASP A O     1 
ATOM   1101 C CB    . ASP A 1 135 ? 6.014   6.953   -30.378 1.00 93.13  ? 256  ASP A CB    1 
ATOM   1102 C CG    . ASP A 1 135 ? 4.507   6.722   -30.436 1.00 104.24 ? 256  ASP A CG    1 
ATOM   1103 O OD1   . ASP A 1 135 ? 3.989   6.283   -31.493 1.00 106.05 ? 256  ASP A OD1   1 
ATOM   1104 O OD2   . ASP A 1 135 ? 3.842   6.971   -29.406 1.00 108.56 ? 256  ASP A OD2   1 
ATOM   1105 N N     . ILE A 1 136 ? 6.267   7.548   -33.931 1.00 61.55  ? 257  ILE A N     1 
ATOM   1106 C CA    . ILE A 1 136 ? 5.985   8.646   -34.861 1.00 60.77  ? 257  ILE A CA    1 
ATOM   1107 C C     . ILE A 1 136 ? 4.514   8.671   -35.190 1.00 57.45  ? 257  ILE A C     1 
ATOM   1108 O O     . ILE A 1 136 ? 3.991   7.719   -35.745 1.00 62.64  ? 257  ILE A O     1 
ATOM   1109 C CB    . ILE A 1 136 ? 6.736   8.585   -36.211 1.00 57.37  ? 257  ILE A CB    1 
ATOM   1110 C CG1   . ILE A 1 136 ? 7.974   7.707   -36.136 1.00 60.10  ? 257  ILE A CG1   1 
ATOM   1111 C CG2   . ILE A 1 136 ? 7.123   9.992   -36.638 1.00 55.10  ? 257  ILE A CG2   1 
ATOM   1112 C CD1   . ILE A 1 136 ? 8.892   7.838   -37.334 1.00 59.19  ? 257  ILE A CD1   1 
ATOM   1113 N N     . LYS A 1 137 ? 3.861   9.769   -34.844 1.00 51.77  ? 258  LYS A N     1 
ATOM   1114 C CA    . LYS A 1 137 ? 2.511   10.021  -35.278 1.00 47.39  ? 258  LYS A CA    1 
ATOM   1115 C C     . LYS A 1 137 ? 2.415   11.421  -35.879 1.00 42.61  ? 258  LYS A C     1 
ATOM   1116 O O     . LYS A 1 137 ? 3.212   12.281  -35.554 1.00 40.16  ? 258  LYS A O     1 
ATOM   1117 C CB    . LYS A 1 137 ? 1.567   9.872   -34.103 1.00 51.18  ? 258  LYS A CB    1 
ATOM   1118 C CG    . LYS A 1 137 ? 1.910   10.714  -32.899 1.00 53.26  ? 258  LYS A CG    1 
ATOM   1119 C CD    . LYS A 1 137 ? 2.592   9.895   -31.823 1.00 57.58  ? 258  LYS A CD    1 
ATOM   1120 C CE    . LYS A 1 137 ? 2.502   10.605  -30.482 1.00 62.55  ? 258  LYS A CE    1 
ATOM   1121 N NZ    . LYS A 1 137 ? 1.078   10.880  -30.095 1.00 62.61  ? 258  LYS A NZ    1 
ATOM   1122 N N     . PRO A 1 138 ? 1.438   11.652  -36.763 1.00 39.97  ? 259  PRO A N     1 
ATOM   1123 C CA    . PRO A 1 138 ? 1.237   12.922  -37.459 1.00 39.50  ? 259  PRO A CA    1 
ATOM   1124 C C     . PRO A 1 138 ? 1.486   14.181  -36.637 1.00 40.39  ? 259  PRO A C     1 
ATOM   1125 O O     . PRO A 1 138 ? 2.064   15.137  -37.146 1.00 42.93  ? 259  PRO A O     1 
ATOM   1126 C CB    . PRO A 1 138 ? -0.231  12.859  -37.840 1.00 39.68  ? 259  PRO A CB    1 
ATOM   1127 C CG    . PRO A 1 138 ? -0.462  11.414  -38.090 1.00 39.93  ? 259  PRO A CG    1 
ATOM   1128 C CD    . PRO A 1 138 ? 0.384   10.683  -37.098 1.00 39.15  ? 259  PRO A CD    1 
ATOM   1129 N N     . GLU A 1 139 ? 1.053   14.174  -35.383 1.00 40.39  ? 260  GLU A N     1 
ATOM   1130 C CA    . GLU A 1 139 ? 1.272   15.285  -34.452 1.00 42.70  ? 260  GLU A CA    1 
ATOM   1131 C C     . GLU A 1 139 ? 2.734   15.690  -34.264 1.00 40.43  ? 260  GLU A C     1 
ATOM   1132 O O     . GLU A 1 139 ? 3.014   16.820  -33.937 1.00 49.14  ? 260  GLU A O     1 
ATOM   1133 C CB    . GLU A 1 139 ? 0.724   14.912  -33.073 1.00 46.32  ? 260  GLU A CB    1 
ATOM   1134 C CG    . GLU A 1 139 ? -0.754  14.602  -33.064 1.00 51.23  ? 260  GLU A CG    1 
ATOM   1135 C CD    . GLU A 1 139 ? -1.083  13.126  -33.325 1.00 55.26  ? 260  GLU A CD    1 
ATOM   1136 O OE1   . GLU A 1 139 ? -0.729  12.570  -34.402 1.00 51.55  ? 260  GLU A OE1   1 
ATOM   1137 O OE2   . GLU A 1 139 ? -1.742  12.524  -32.446 1.00 60.14  ? 260  GLU A OE2   1 
ATOM   1138 N N     . ASN A 1 140 ? 3.651   14.749  -34.433 1.00 38.76  ? 261  ASN A N     1 
ATOM   1139 C CA    . ASN A 1 140 ? 5.081   14.967  -34.263 1.00 38.89  ? 261  ASN A CA    1 
ATOM   1140 C C     . ASN A 1 140 ? 5.803   15.313  -35.558 1.00 36.79  ? 261  ASN A C     1 
ATOM   1141 O O     . ASN A 1 140 ? 7.034   15.413  -35.583 1.00 38.98  ? 261  ASN A O     1 
ATOM   1142 C CB    . ASN A 1 140 ? 5.717   13.699  -33.686 1.00 42.20  ? 261  ASN A CB    1 
ATOM   1143 C CG    . ASN A 1 140 ? 5.012   13.211  -32.425 1.00 44.38  ? 261  ASN A CG    1 
ATOM   1144 O OD1   . ASN A 1 140 ? 4.705   12.033  -32.312 1.00 47.63  ? 261  ASN A OD1   1 
ATOM   1145 N ND2   . ASN A 1 140 ? 4.745   14.122  -31.480 1.00 44.36  ? 261  ASN A ND2   1 
ATOM   1146 N N     . LEU A 1 141 ? 5.036   15.473  -36.629 1.00 32.33  ? 262  LEU A N     1 
ATOM   1147 C CA    . LEU A 1 141 ? 5.561   15.775  -37.921 1.00 30.52  ? 262  LEU A CA    1 
ATOM   1148 C C     . LEU A 1 141 ? 5.170   17.226  -38.225 1.00 32.55  ? 262  LEU A C     1 
ATOM   1149 O O     . LEU A 1 141 ? 4.001   17.533  -38.316 1.00 36.67  ? 262  LEU A O     1 
ATOM   1150 C CB    . LEU A 1 141 ? 4.959   14.821  -38.951 1.00 28.97  ? 262  LEU A CB    1 
ATOM   1151 C CG    . LEU A 1 141 ? 5.200   13.303  -38.803 1.00 28.67  ? 262  LEU A CG    1 
ATOM   1152 C CD1   . LEU A 1 141 ? 4.639   12.525  -39.982 1.00 26.35  ? 262  LEU A CD1   1 
ATOM   1153 C CD2   . LEU A 1 141 ? 6.683   12.966  -38.630 1.00 29.46  ? 262  LEU A CD2   1 
ATOM   1154 N N     . LEU A 1 142 ? 6.144   18.119  -38.351 1.00 31.45  ? 263  LEU A N     1 
ATOM   1155 C CA    . LEU A 1 142 ? 5.885   19.495  -38.687 1.00 30.31  ? 263  LEU A CA    1 
ATOM   1156 C C     . LEU A 1 142 ? 6.224   19.726  -40.144 1.00 32.66  ? 263  LEU A C     1 
ATOM   1157 O O     . LEU A 1 142 ? 6.776   18.847  -40.802 1.00 33.64  ? 263  LEU A O     1 
ATOM   1158 C CB    . LEU A 1 142 ? 6.741   20.397  -37.811 1.00 30.73  ? 263  LEU A CB    1 
ATOM   1159 C CG    . LEU A 1 142 ? 6.490   20.206  -36.320 1.00 31.70  ? 263  LEU A CG    1 
ATOM   1160 C CD1   . LEU A 1 142 ? 7.231   21.227  -35.490 1.00 32.39  ? 263  LEU A CD1   1 
ATOM   1161 C CD2   . LEU A 1 142 ? 5.019   20.308  -36.035 1.00 32.86  ? 263  LEU A CD2   1 
ATOM   1162 N N     . LEU A 1 143 ? 5.905   20.919  -40.641 1.00 35.33  ? 264  LEU A N     1 
ATOM   1163 C CA    . LEU A 1 143 ? 6.130   21.275  -42.037 1.00 37.46  ? 264  LEU A CA    1 
ATOM   1164 C C     . LEU A 1 143 ? 6.978   22.549  -42.201 1.00 40.33  ? 264  LEU A C     1 
ATOM   1165 O O     . LEU A 1 143 ? 6.581   23.611  -41.760 1.00 43.53  ? 264  LEU A O     1 
ATOM   1166 C CB    . LEU A 1 143 ? 4.780   21.482  -42.708 1.00 37.48  ? 264  LEU A CB    1 
ATOM   1167 C CG    . LEU A 1 143 ? 3.871   20.266  -42.772 1.00 36.01  ? 264  LEU A CG    1 
ATOM   1168 C CD1   . LEU A 1 143 ? 2.469   20.672  -43.192 1.00 36.24  ? 264  LEU A CD1   1 
ATOM   1169 C CD2   . LEU A 1 143 ? 4.446   19.239  -43.726 1.00 36.13  ? 264  LEU A CD2   1 
ATOM   1170 N N     . GLY A 1 144 ? 8.131   22.428  -42.849 1.00 42.63  ? 265  GLY A N     1 
ATOM   1171 C CA    . GLY A 1 144 ? 8.995   23.559  -43.136 1.00 46.03  ? 265  GLY A CA    1 
ATOM   1172 C C     . GLY A 1 144 ? 8.369   24.425  -44.218 1.00 53.45  ? 265  GLY A C     1 
ATOM   1173 O O     . GLY A 1 144 ? 7.231   24.174  -44.635 1.00 52.54  ? 265  GLY A O     1 
ATOM   1174 N N     . SER A 1 145 ? 9.117   25.431  -44.682 1.00 58.55  ? 266  SER A N     1 
ATOM   1175 C CA    . SER A 1 145 ? 8.562   26.514  -45.516 1.00 58.71  ? 266  SER A CA    1 
ATOM   1176 C C     . SER A 1 145 ? 8.111   26.061  -46.901 1.00 54.88  ? 266  SER A C     1 
ATOM   1177 O O     . SER A 1 145 ? 7.087   26.510  -47.406 1.00 49.74  ? 266  SER A O     1 
ATOM   1178 C CB    . SER A 1 145 ? 9.581   27.657  -45.659 1.00 64.12  ? 266  SER A CB    1 
ATOM   1179 O OG    . SER A 1 145 ? 10.742  27.252  -46.376 1.00 66.71  ? 266  SER A OG    1 
ATOM   1180 N N     . ALA A 1 146 ? 8.888   25.172  -47.510 1.00 55.11  ? 267  ALA A N     1 
ATOM   1181 C CA    . ALA A 1 146 ? 8.568   24.629  -48.830 1.00 51.45  ? 267  ALA A CA    1 
ATOM   1182 C C     . ALA A 1 146 ? 7.617   23.428  -48.786 1.00 52.73  ? 267  ALA A C     1 
ATOM   1183 O O     . ALA A 1 146 ? 7.477   22.745  -49.796 1.00 56.37  ? 267  ALA A O     1 
ATOM   1184 C CB    . ALA A 1 146 ? 9.858   24.233  -49.553 1.00 49.44  ? 267  ALA A CB    1 
ATOM   1185 N N     . GLY A 1 147 ? 6.990   23.149  -47.638 1.00 51.96  ? 268  GLY A N     1 
ATOM   1186 C CA    . GLY A 1 147 ? 6.064   22.015  -47.501 1.00 50.74  ? 268  GLY A CA    1 
ATOM   1187 C C     . GLY A 1 147 ? 6.660   20.711  -46.969 1.00 50.25  ? 268  GLY A C     1 
ATOM   1188 O O     . GLY A 1 147 ? 5.927   19.738  -46.772 1.00 51.57  ? 268  GLY A O     1 
ATOM   1189 N N     . GLU A 1 148 ? 7.971   20.692  -46.718 1.00 50.58  ? 269  GLU A N     1 
ATOM   1190 C CA    . GLU A 1 148 ? 8.692   19.460  -46.358 1.00 51.29  ? 269  GLU A CA    1 
ATOM   1191 C C     . GLU A 1 148 ? 8.561   19.045  -44.873 1.00 49.46  ? 269  GLU A C     1 
ATOM   1192 O O     . GLU A 1 148 ? 8.501   19.895  -43.980 1.00 45.41  ? 269  GLU A O     1 
ATOM   1193 C CB    . GLU A 1 148 ? 10.176  19.552  -46.764 1.00 52.73  ? 269  GLU A CB    1 
ATOM   1194 C CG    . GLU A 1 148 ? 11.086  20.342  -45.830 1.00 59.85  ? 269  GLU A CG    1 
ATOM   1195 C CD    . GLU A 1 148 ? 10.942  21.861  -45.955 1.00 67.18  ? 269  GLU A CD    1 
ATOM   1196 O OE1   . GLU A 1 148 ? 9.864   22.364  -46.354 1.00 64.99  ? 269  GLU A OE1   1 
ATOM   1197 O OE2   . GLU A 1 148 ? 11.926  22.565  -45.642 1.00 70.24  ? 269  GLU A OE2   1 
ATOM   1198 N N     . LEU A 1 149 ? 8.524   17.725  -44.644 1.00 44.86  ? 270  LEU A N     1 
ATOM   1199 C CA    . LEU A 1 149 ? 8.393   17.138  -43.317 1.00 42.12  ? 270  LEU A CA    1 
ATOM   1200 C C     . LEU A 1 149 ? 9.582   17.396  -42.479 1.00 39.79  ? 270  LEU A C     1 
ATOM   1201 O O     . LEU A 1 149 ? 10.693  17.312  -42.957 1.00 38.91  ? 270  LEU A O     1 
ATOM   1202 C CB    . LEU A 1 149 ? 8.254   15.604  -43.360 1.00 42.51  ? 270  LEU A CB    1 
ATOM   1203 C CG    . LEU A 1 149 ? 6.850   15.110  -43.043 1.00 43.65  ? 270  LEU A CG    1 
ATOM   1204 C CD1   . LEU A 1 149 ? 5.848   15.787  -43.946 1.00 46.72  ? 270  LEU A CD1   1 
ATOM   1205 C CD2   . LEU A 1 149 ? 6.738   13.616  -43.193 1.00 45.41  ? 270  LEU A CD2   1 
ATOM   1206 N N     . LYS A 1 150 ? 9.312   17.636  -41.203 1.00 37.99  ? 271  LYS A N     1 
ATOM   1207 C CA    . LYS A 1 150 ? 10.312  17.650  -40.174 1.00 37.29  ? 271  LYS A CA    1 
ATOM   1208 C C     . LYS A 1 150 ? 9.862   16.806  -39.013 1.00 37.45  ? 271  LYS A C     1 
ATOM   1209 O O     . LYS A 1 150 ? 8.856   17.085  -38.369 1.00 40.91  ? 271  LYS A O     1 
ATOM   1210 C CB    . LYS A 1 150 ? 10.564  19.085  -39.740 1.00 38.75  ? 271  LYS A CB    1 
ATOM   1211 C CG    . LYS A 1 150 ? 11.494  19.758  -40.729 1.00 38.16  ? 271  LYS A CG    1 
ATOM   1212 C CD    . LYS A 1 150 ? 11.168  21.192  -40.971 1.00 36.70  ? 271  LYS A CD    1 
ATOM   1213 C CE    . LYS A 1 150 ? 11.994  21.668  -42.155 1.00 37.76  ? 271  LYS A CE    1 
ATOM   1214 N NZ    . LYS A 1 150 ? 13.434  21.271  -42.053 1.00 36.62  ? 271  LYS A NZ    1 
ATOM   1215 N N     . ILE A 1 151 ? 10.591  15.733  -38.774 1.00 35.97  ? 272  ILE A N     1 
ATOM   1216 C CA    . ILE A 1 151 ? 10.377  14.935  -37.604 1.00 35.44  ? 272  ILE A CA    1 
ATOM   1217 C C     . ILE A 1 151 ? 10.753  15.751  -36.365 1.00 33.72  ? 272  ILE A C     1 
ATOM   1218 O O     . ILE A 1 151 ? 11.829  16.271  -36.313 1.00 33.53  ? 272  ILE A O     1 
ATOM   1219 C CB    . ILE A 1 151 ? 11.256  13.693  -37.689 1.00 36.31  ? 272  ILE A CB    1 
ATOM   1220 C CG1   . ILE A 1 151 ? 10.671  12.740  -38.712 1.00 40.23  ? 272  ILE A CG1   1 
ATOM   1221 C CG2   . ILE A 1 151 ? 11.333  12.984  -36.357 1.00 37.54  ? 272  ILE A CG2   1 
ATOM   1222 C CD1   . ILE A 1 151 ? 11.522  11.495  -38.925 1.00 43.43  ? 272  ILE A CD1   1 
ATOM   1223 N N     . ALA A 1 152 ? 9.902   15.830  -35.352 1.00 34.27  ? 273  ALA A N     1 
ATOM   1224 C CA    . ALA A 1 152 ? 10.286  16.569  -34.175 1.00 39.39  ? 273  ALA A CA    1 
ATOM   1225 C C     . ALA A 1 152 ? 9.852   16.048  -32.794 1.00 43.66  ? 273  ALA A C     1 
ATOM   1226 O O     . ALA A 1 152 ? 9.434   16.850  -31.960 1.00 44.20  ? 273  ALA A O     1 
ATOM   1227 C CB    . ALA A 1 152 ? 9.806   17.996  -34.345 1.00 42.34  ? 273  ALA A CB    1 
ATOM   1228 N N     . ASP A 1 153 ? 9.956   14.754  -32.500 1.00 46.72  ? 274  ASP A N     1 
ATOM   1229 C CA    . ASP A 1 153 ? 9.707   14.365  -31.118 1.00 53.05  ? 274  ASP A CA    1 
ATOM   1230 C C     . ASP A 1 153 ? 10.907  13.752  -30.440 1.00 53.47  ? 274  ASP A C     1 
ATOM   1231 O O     . ASP A 1 153 ? 11.507  14.386  -29.571 1.00 61.25  ? 274  ASP A O     1 
ATOM   1232 C CB    . ASP A 1 153 ? 8.464   13.488  -30.928 1.00 62.82  ? 274  ASP A CB    1 
ATOM   1233 C CG    . ASP A 1 153 ? 7.909   13.561  -29.468 1.00 65.46  ? 274  ASP A CG    1 
ATOM   1234 O OD1   . ASP A 1 153 ? 8.539   12.980  -28.556 1.00 57.68  ? 274  ASP A OD1   1 
ATOM   1235 O OD2   . ASP A 1 153 ? 6.864   14.235  -29.233 1.00 69.04  ? 274  ASP A OD2   1 
ATOM   1236 N N     . PHE A 1 154 ? 11.260  12.533  -30.795 1.00 45.91  ? 275  PHE A N     1 
ATOM   1237 C CA    . PHE A 1 154 ? 12.351  11.853  -30.092 1.00 44.16  ? 275  PHE A CA    1 
ATOM   1238 C C     . PHE A 1 154 ? 12.089  11.590  -28.620 1.00 47.28  ? 275  PHE A C     1 
ATOM   1239 O O     . PHE A 1 154 ? 13.033  11.409  -27.856 1.00 55.60  ? 275  PHE A O     1 
ATOM   1240 C CB    . PHE A 1 154 ? 13.648  12.639  -30.231 1.00 39.39  ? 275  PHE A CB    1 
ATOM   1241 C CG    . PHE A 1 154 ? 13.943  12.992  -31.636 1.00 37.74  ? 275  PHE A CG    1 
ATOM   1242 C CD1   . PHE A 1 154 ? 14.435  12.031  -32.494 1.00 34.71  ? 275  PHE A CD1   1 
ATOM   1243 C CD2   . PHE A 1 154 ? 13.642  14.255  -32.121 1.00 36.08  ? 275  PHE A CD2   1 
ATOM   1244 C CE1   . PHE A 1 154 ? 14.653  12.332  -33.810 1.00 36.30  ? 275  PHE A CE1   1 
ATOM   1245 C CE2   . PHE A 1 154 ? 13.851  14.568  -33.435 1.00 35.50  ? 275  PHE A CE2   1 
ATOM   1246 C CZ    . PHE A 1 154 ? 14.364  13.611  -34.281 1.00 38.44  ? 275  PHE A CZ    1 
ATOM   1247 N N     . GLY A 1 155 ? 10.819  11.557  -28.220 1.00 51.35  ? 276  GLY A N     1 
ATOM   1248 C CA    . GLY A 1 155 ? 10.448  11.351  -26.810 1.00 49.42  ? 276  GLY A CA    1 
ATOM   1249 C C     . GLY A 1 155 ? 10.715  9.934   -26.347 1.00 45.70  ? 276  GLY A C     1 
ATOM   1250 O O     . GLY A 1 155 ? 10.979  9.700   -25.168 1.00 42.62  ? 276  GLY A O     1 
ATOM   1251 N N     . TRP A 1 156 ? 10.673  9.006   -27.297 1.00 44.16  ? 277  TRP A N     1 
ATOM   1252 C CA    . TRP A 1 156 ? 10.956  7.602   -27.048 1.00 47.75  ? 277  TRP A CA    1 
ATOM   1253 C C     . TRP A 1 156 ? 12.162  7.117   -27.868 1.00 42.12  ? 277  TRP A C     1 
ATOM   1254 O O     . TRP A 1 156 ? 12.350  5.946   -28.101 1.00 43.74  ? 277  TRP A O     1 
ATOM   1255 C CB    . TRP A 1 156 ? 9.664   6.806   -27.321 1.00 55.33  ? 277  TRP A CB    1 
ATOM   1256 C CG    . TRP A 1 156 ? 8.566   7.303   -26.420 1.00 63.52  ? 277  TRP A CG    1 
ATOM   1257 C CD1   . TRP A 1 156 ? 7.740   8.371   -26.650 1.00 71.54  ? 277  TRP A CD1   1 
ATOM   1258 C CD2   . TRP A 1 156 ? 8.245   6.824   -25.103 1.00 73.12  ? 277  TRP A CD2   1 
ATOM   1259 N NE1   . TRP A 1 156 ? 6.902   8.564   -25.570 1.00 80.47  ? 277  TRP A NE1   1 
ATOM   1260 C CE2   . TRP A 1 156 ? 7.190   7.626   -24.609 1.00 81.32  ? 277  TRP A CE2   1 
ATOM   1261 C CE3   . TRP A 1 156 ? 8.732   5.784   -24.300 1.00 76.10  ? 277  TRP A CE3   1 
ATOM   1262 C CZ2   . TRP A 1 156 ? 6.607   7.411   -23.348 1.00 83.56  ? 277  TRP A CZ2   1 
ATOM   1263 C CZ3   . TRP A 1 156 ? 8.153   5.576   -23.041 1.00 77.74  ? 277  TRP A CZ3   1 
ATOM   1264 C CH2   . TRP A 1 156 ? 7.106   6.385   -22.584 1.00 79.15  ? 277  TRP A CH2   1 
ATOM   1265 N N     . SER A 1 157 ? 13.001  8.056   -28.263 1.00 41.79  ? 278  SER A N     1 
ATOM   1266 C CA    . SER A 1 157 ? 14.160  7.795   -29.061 1.00 40.69  ? 278  SER A CA    1 
ATOM   1267 C C     . SER A 1 157 ? 15.329  7.245   -28.223 1.00 42.80  ? 278  SER A C     1 
ATOM   1268 O O     . SER A 1 157 ? 15.609  7.673   -27.095 1.00 39.49  ? 278  SER A O     1 
ATOM   1269 C CB    . SER A 1 157 ? 14.571  9.087   -29.769 1.00 43.58  ? 278  SER A CB    1 
ATOM   1270 O OG    . SER A 1 157 ? 13.702  9.367   -30.872 1.00 48.82  ? 278  SER A OG    1 
ATOM   1271 N N     . VAL A 1 158 ? 16.028  6.284   -28.797 1.00 44.74  ? 279  VAL A N     1 
ATOM   1272 C CA    . VAL A 1 158 ? 17.102  5.632   -28.093 1.00 44.96  ? 279  VAL A CA    1 
ATOM   1273 C C     . VAL A 1 158 ? 18.311  5.569   -28.999 1.00 48.99  ? 279  VAL A C     1 
ATOM   1274 O O     . VAL A 1 158 ? 18.174  5.366   -30.212 1.00 44.25  ? 279  VAL A O     1 
ATOM   1275 C CB    . VAL A 1 158 ? 16.690  4.219   -27.622 1.00 41.55  ? 279  VAL A CB    1 
ATOM   1276 C CG1   . VAL A 1 158 ? 15.438  4.291   -26.766 1.00 40.34  ? 279  VAL A CG1   1 
ATOM   1277 C CG2   . VAL A 1 158 ? 16.484  3.269   -28.795 1.00 40.07  ? 279  VAL A CG2   1 
ATOM   1278 N N     . HIS A 1 159 ? 19.482  5.802   -28.404 1.00 60.62  ? 280  HIS A N     1 
ATOM   1279 C CA    . HIS A 1 159 ? 20.746  5.381   -29.006 1.00 70.47  ? 280  HIS A CA    1 
ATOM   1280 C C     . HIS A 1 159 ? 20.806  3.868   -28.969 1.00 72.63  ? 280  HIS A C     1 
ATOM   1281 O O     . HIS A 1 159 ? 20.620  3.277   -27.907 1.00 76.72  ? 280  HIS A O     1 
ATOM   1282 C CB    . HIS A 1 159 ? 21.954  5.937   -28.254 1.00 73.67  ? 280  HIS A CB    1 
ATOM   1283 C CG    . HIS A 1 159 ? 22.760  6.901   -29.056 1.00 79.43  ? 280  HIS A CG    1 
ATOM   1284 N ND1   . HIS A 1 159 ? 22.858  8.237   -28.735 1.00 83.37  ? 280  HIS A ND1   1 
ATOM   1285 C CD2   . HIS A 1 159 ? 23.489  6.727   -30.184 1.00 83.52  ? 280  HIS A CD2   1 
ATOM   1286 C CE1   . HIS A 1 159 ? 23.617  8.846   -29.630 1.00 89.01  ? 280  HIS A CE1   1 
ATOM   1287 N NE2   . HIS A 1 159 ? 24.012  7.952   -30.521 1.00 90.44  ? 280  HIS A NE2   1 
ATOM   1288 N N     . ALA A 1 160 ? 21.029  3.250   -30.127 1.00 78.15  ? 281  ALA A N     1 
ATOM   1289 C CA    . ALA A 1 160 ? 21.349  1.825   -30.186 1.00 86.61  ? 281  ALA A CA    1 
ATOM   1290 C C     . ALA A 1 160 ? 22.696  1.600   -29.493 1.00 93.92  ? 281  ALA A C     1 
ATOM   1291 O O     . ALA A 1 160 ? 23.668  2.319   -29.787 1.00 81.03  ? 281  ALA A O     1 
ATOM   1292 C CB    . ALA A 1 160 ? 21.424  1.341   -31.630 1.00 84.81  ? 281  ALA A CB    1 
ATOM   1293 N N     . PRO A 1 161 ? 22.753  0.637   -28.543 1.00 106.19 ? 282  PRO A N     1 
ATOM   1294 C CA    . PRO A 1 161 ? 24.077  0.173   -28.125 1.00 111.47 ? 282  PRO A CA    1 
ATOM   1295 C C     . PRO A 1 161 ? 24.858  -0.349  -29.342 1.00 110.90 ? 282  PRO A C     1 
ATOM   1296 O O     . PRO A 1 161 ? 24.337  -1.147  -30.136 1.00 107.15 ? 282  PRO A O     1 
ATOM   1297 C CB    . PRO A 1 161 ? 23.763  -0.944  -27.117 1.00 106.62 ? 282  PRO A CB    1 
ATOM   1298 C CG    . PRO A 1 161 ? 22.434  -0.563  -26.552 1.00 103.97 ? 282  PRO A CG    1 
ATOM   1299 C CD    . PRO A 1 161 ? 21.683  0.077   -27.690 1.00 102.26 ? 282  PRO A CD    1 
ATOM   1300 N N     . SER A 1 162 ? 26.078  0.147   -29.505 1.00 107.14 ? 283  SER A N     1 
ATOM   1301 C CA    . SER A 1 162 ? 26.913  -0.250  -30.627 1.00 108.21 ? 283  SER A CA    1 
ATOM   1302 C C     . SER A 1 162 ? 27.804  -1.440  -30.231 1.00 112.72 ? 283  SER A C     1 
ATOM   1303 O O     . SER A 1 162 ? 28.001  -1.714  -29.040 1.00 102.73 ? 283  SER A O     1 
ATOM   1304 C CB    . SER A 1 162 ? 27.722  0.946   -31.131 1.00 103.19 ? 283  SER A CB    1 
ATOM   1305 O OG    . SER A 1 162 ? 26.869  1.866   -31.793 1.00 96.35  ? 283  SER A OG    1 
ATOM   1306 N N     . SER A 1 163 ? 28.331  -2.132  -31.242 1.00 115.45 ? 284  SER A N     1 
ATOM   1307 C CA    . SER A 1 163 ? 28.903  -3.480  -31.097 1.00 114.78 ? 284  SER A CA    1 
ATOM   1308 C C     . SER A 1 163 ? 27.778  -4.474  -30.786 1.00 113.61 ? 284  SER A C     1 
ATOM   1309 O O     . SER A 1 163 ? 27.946  -5.375  -29.965 1.00 109.57 ? 284  SER A O     1 
ATOM   1310 C CB    . SER A 1 163 ? 29.996  -3.538  -30.010 1.00 116.49 ? 284  SER A CB    1 
ATOM   1311 O OG    . SER A 1 163 ? 30.896  -2.443  -30.093 1.00 108.62 ? 284  SER A OG    1 
ATOM   1312 N N     . ARG A 1 164 ? 26.641  -4.317  -31.467 1.00 118.69 ? 285  ARG A N     1 
ATOM   1313 C CA    . ARG A 1 164 ? 25.413  -5.032  -31.097 1.00 121.18 ? 285  ARG A CA    1 
ATOM   1314 C C     . ARG A 1 164 ? 25.439  -6.546  -31.373 1.00 118.41 ? 285  ARG A C     1 
ATOM   1315 O O     . ARG A 1 164 ? 24.587  -7.279  -30.872 1.00 114.89 ? 285  ARG A O     1 
ATOM   1316 C CB    . ARG A 1 164 ? 24.177  -4.374  -31.735 1.00 125.88 ? 285  ARG A CB    1 
ATOM   1317 C CG    . ARG A 1 164 ? 23.993  -4.614  -33.228 1.00 128.44 ? 285  ARG A CG    1 
ATOM   1318 C CD    . ARG A 1 164 ? 22.522  -4.548  -33.626 1.00 127.53 ? 285  ARG A CD    1 
ATOM   1319 N NE    . ARG A 1 164 ? 22.228  -5.377  -34.792 1.00 124.64 ? 285  ARG A NE    1 
ATOM   1320 C CZ    . ARG A 1 164 ? 22.177  -6.710  -34.789 1.00 120.02 ? 285  ARG A CZ    1 
ATOM   1321 N NH1   . ARG A 1 164 ? 22.414  -7.408  -33.678 1.00 114.18 ? 285  ARG A NH1   1 
ATOM   1322 N NH2   . ARG A 1 164 ? 21.896  -7.354  -35.914 1.00 116.99 ? 285  ARG A NH2   1 
ATOM   1323 N N     . ARG A 1 165 ? 26.402  -7.010  -32.167 1.00 116.91 ? 286  ARG A N     1 
ATOM   1324 C CA    . ARG A 1 165 ? 26.627  -8.446  -32.323 1.00 120.31 ? 286  ARG A CA    1 
ATOM   1325 C C     . ARG A 1 165 ? 27.465  -8.971  -31.147 1.00 126.95 ? 286  ARG A C     1 
ATOM   1326 O O     . ARG A 1 165 ? 27.136  -9.999  -30.556 1.00 126.09 ? 286  ARG A O     1 
ATOM   1327 C CB    . ARG A 1 165 ? 27.307  -8.755  -33.667 1.00 117.60 ? 286  ARG A CB    1 
ATOM   1328 C CG    . ARG A 1 165 ? 27.168  -10.207 -34.123 1.00 115.92 ? 286  ARG A CG    1 
ATOM   1329 C CD    . ARG A 1 165 ? 28.440  -11.032 -33.938 1.00 114.51 ? 286  ARG A CD    1 
ATOM   1330 N NE    . ARG A 1 165 ? 28.153  -12.470 -33.839 1.00 115.15 ? 286  ARG A NE    1 
ATOM   1331 C CZ    . ARG A 1 165 ? 29.027  -13.458 -34.063 1.00 113.36 ? 286  ARG A CZ    1 
ATOM   1332 N NH1   . ARG A 1 165 ? 30.284  -13.205 -34.422 1.00 114.61 ? 286  ARG A NH1   1 
ATOM   1333 N NH2   . ARG A 1 165 ? 28.637  -14.723 -33.934 1.00 105.84 ? 286  ARG A NH2   1 
ATOM   1334 N N     . THR A 1 166 ? 28.531  -8.244  -30.806 1.00 129.12 ? 287  THR A N     1 
ATOM   1335 C CA    . THR A 1 166 ? 29.467  -8.643  -29.743 1.00 124.90 ? 287  THR A CA    1 
ATOM   1336 C C     . THR A 1 166 ? 28.901  -8.445  -28.331 1.00 120.90 ? 287  THR A C     1 
ATOM   1337 O O     . THR A 1 166 ? 29.094  -9.297  -27.465 1.00 104.60 ? 287  THR A O     1 
ATOM   1338 C CB    . THR A 1 166 ? 30.792  -7.844  -29.835 1.00 125.73 ? 287  THR A CB    1 
ATOM   1339 O OG1   . THR A 1 166 ? 31.299  -7.887  -31.176 1.00 124.82 ? 287  THR A OG1   1 
ATOM   1340 C CG2   . THR A 1 166 ? 31.842  -8.403  -28.876 1.00 123.51 ? 287  THR A CG2   1 
ATOM   1341 N N     . THR A 1 167 ? 28.226  -7.315  -28.106 1.00 119.77 ? 288  THR A N     1 
ATOM   1342 C CA    . THR A 1 167 ? 27.703  -6.956  -26.780 1.00 120.16 ? 288  THR A CA    1 
ATOM   1343 C C     . THR A 1 167 ? 26.516  -7.829  -26.343 1.00 122.48 ? 288  THR A C     1 
ATOM   1344 O O     . THR A 1 167 ? 26.279  -8.013  -25.145 1.00 119.88 ? 288  THR A O     1 
ATOM   1345 C CB    . THR A 1 167 ? 27.304  -5.459  -26.707 1.00 123.17 ? 288  THR A CB    1 
ATOM   1346 O OG1   . THR A 1 167 ? 27.070  -5.088  -25.343 1.00 128.93 ? 288  THR A OG1   1 
ATOM   1347 C CG2   . THR A 1 167 ? 26.047  -5.158  -27.526 1.00 123.72 ? 288  THR A CG2   1 
ATOM   1348 N N     . LEU A 1 168 ? 25.774  -8.355  -27.316 1.00 119.89 ? 289  LEU A N     1 
ATOM   1349 C CA    . LEU A 1 168 ? 24.682  -9.284  -27.043 1.00 113.66 ? 289  LEU A CA    1 
ATOM   1350 C C     . LEU A 1 168 ? 25.282  -10.674 -26.813 1.00 107.83 ? 289  LEU A C     1 
ATOM   1351 O O     . LEU A 1 168 ? 25.184  -11.231 -25.717 1.00 95.10  ? 289  LEU A O     1 
ATOM   1352 C CB    . LEU A 1 168 ? 23.681  -9.284  -28.212 1.00 112.89 ? 289  LEU A CB    1 
ATOM   1353 C CG    . LEU A 1 168 ? 22.273  -9.830  -27.960 1.00 108.47 ? 289  LEU A CG    1 
ATOM   1354 C CD1   . LEU A 1 168 ? 21.609  -9.053  -26.838 1.00 106.73 ? 289  LEU A CD1   1 
ATOM   1355 C CD2   . LEU A 1 168 ? 21.428  -9.777  -29.229 1.00 103.38 ? 289  LEU A CD2   1 
ATOM   1356 N N     . CYS A 1 169 ? 25.923  -11.200 -27.857 1.00 108.64 ? 290  CYS A N     1 
ATOM   1357 C CA    . CYS A 1 169 ? 26.671  -12.461 -27.819 1.00 107.09 ? 290  CYS A CA    1 
ATOM   1358 C C     . CYS A 1 169 ? 27.628  -12.483 -26.622 1.00 101.36 ? 290  CYS A C     1 
ATOM   1359 O O     . CYS A 1 169 ? 28.467  -11.595 -26.492 1.00 101.87 ? 290  CYS A O     1 
ATOM   1360 C CB    . CYS A 1 169 ? 27.453  -12.588 -29.135 1.00 111.28 ? 290  CYS A CB    1 
ATOM   1361 S SG    . CYS A 1 169 ? 28.382  -14.106 -29.424 1.00 114.32 ? 290  CYS A SG    1 
ATOM   1362 N N     . GLY A 1 170 ? 27.494  -13.477 -25.744 1.00 97.78  ? 291  GLY A N     1 
ATOM   1363 C CA    . GLY A 1 170 ? 28.308  -13.541 -24.519 1.00 101.05 ? 291  GLY A CA    1 
ATOM   1364 C C     . GLY A 1 170 ? 27.526  -13.431 -23.212 1.00 104.02 ? 291  GLY A C     1 
ATOM   1365 O O     . GLY A 1 170 ? 27.898  -14.055 -22.214 1.00 108.13 ? 291  GLY A O     1 
ATOM   1366 N N     . THR A 1 171 ? 26.468  -12.617 -23.197 1.00 99.45  ? 292  THR A N     1 
ATOM   1367 C CA    . THR A 1 171 ? 25.475  -12.651 -22.104 1.00 91.32  ? 292  THR A CA    1 
ATOM   1368 C C     . THR A 1 171 ? 24.215  -13.439 -22.542 1.00 79.86  ? 292  THR A C     1 
ATOM   1369 O O     . THR A 1 171 ? 23.286  -13.645 -21.753 1.00 79.30  ? 292  THR A O     1 
ATOM   1370 C CB    . THR A 1 171 ? 25.140  -11.226 -21.565 1.00 91.22  ? 292  THR A CB    1 
ATOM   1371 O OG1   . THR A 1 171 ? 24.132  -11.304 -20.542 1.00 96.94  ? 292  THR A OG1   1 
ATOM   1372 C CG2   . THR A 1 171 ? 24.678  -10.289 -22.671 1.00 89.09  ? 292  THR A CG2   1 
ATOM   1373 N N     . LEU A 1 172 ? 24.242  -13.920 -23.785 1.00 67.55  ? 293  LEU A N     1 
ATOM   1374 C CA    . LEU A 1 172 ? 23.139  -14.649 -24.433 1.00 63.63  ? 293  LEU A CA    1 
ATOM   1375 C C     . LEU A 1 172 ? 22.433  -15.755 -23.606 1.00 61.29  ? 293  LEU A C     1 
ATOM   1376 O O     . LEU A 1 172 ? 21.212  -15.915 -23.679 1.00 51.31  ? 293  LEU A O     1 
ATOM   1377 C CB    . LEU A 1 172 ? 23.668  -15.276 -25.733 1.00 62.83  ? 293  LEU A CB    1 
ATOM   1378 C CG    . LEU A 1 172 ? 22.631  -15.862 -26.685 1.00 64.46  ? 293  LEU A CG    1 
ATOM   1379 C CD1   . LEU A 1 172 ? 21.840  -14.738 -27.334 1.00 66.15  ? 293  LEU A CD1   1 
ATOM   1380 C CD2   . LEU A 1 172 ? 23.284  -16.734 -27.738 1.00 65.56  ? 293  LEU A CD2   1 
ATOM   1381 N N     . ASP A 1 173 ? 23.206  -16.550 -22.866 1.00 61.45  ? 294  ASP A N     1 
ATOM   1382 C CA    . ASP A 1 173 ? 22.638  -17.639 -22.085 1.00 57.05  ? 294  ASP A CA    1 
ATOM   1383 C C     . ASP A 1 173 ? 21.600  -17.058 -21.124 1.00 53.50  ? 294  ASP A C     1 
ATOM   1384 O O     . ASP A 1 173 ? 20.583  -17.685 -20.837 1.00 53.67  ? 294  ASP A O     1 
ATOM   1385 C CB    . ASP A 1 173 ? 23.733  -18.390 -21.290 1.00 62.51  ? 294  ASP A CB    1 
ATOM   1386 C CG    . ASP A 1 173 ? 24.511  -19.446 -22.123 1.00 59.11  ? 294  ASP A CG    1 
ATOM   1387 O OD1   . ASP A 1 173 ? 23.902  -20.306 -22.809 1.00 57.56  ? 294  ASP A OD1   1 
ATOM   1388 O OD2   . ASP A 1 173 ? 25.757  -19.451 -22.022 1.00 57.25  ? 294  ASP A OD2   1 
ATOM   1389 N N     . TYR A 1 174 ? 21.842  -15.834 -20.661 1.00 52.84  ? 295  TYR A N     1 
ATOM   1390 C CA    . TYR A 1 174 ? 21.060  -15.269 -19.568 1.00 51.85  ? 295  TYR A CA    1 
ATOM   1391 C C     . TYR A 1 174 ? 19.841  -14.421 -19.910 1.00 53.33  ? 295  TYR A C     1 
ATOM   1392 O O     . TYR A 1 174 ? 19.011  -14.165 -19.026 1.00 62.36  ? 295  TYR A O     1 
ATOM   1393 C CB    . TYR A 1 174 ? 21.985  -14.472 -18.664 1.00 52.05  ? 295  TYR A CB    1 
ATOM   1394 C CG    . TYR A 1 174 ? 23.024  -15.356 -18.084 1.00 50.73  ? 295  TYR A CG    1 
ATOM   1395 C CD1   . TYR A 1 174 ? 22.715  -16.229 -17.057 1.00 49.98  ? 295  TYR A CD1   1 
ATOM   1396 C CD2   . TYR A 1 174 ? 24.290  -15.371 -18.609 1.00 53.94  ? 295  TYR A CD2   1 
ATOM   1397 C CE1   . TYR A 1 174 ? 23.665  -17.070 -16.540 1.00 52.31  ? 295  TYR A CE1   1 
ATOM   1398 C CE2   . TYR A 1 174 ? 25.259  -16.203 -18.107 1.00 56.34  ? 295  TYR A CE2   1 
ATOM   1399 C CZ    . TYR A 1 174 ? 24.949  -17.051 -17.077 1.00 57.04  ? 295  TYR A CZ    1 
ATOM   1400 O OH    . TYR A 1 174 ? 25.955  -17.862 -16.600 1.00 61.47  ? 295  TYR A OH    1 
ATOM   1401 N N     . LEU A 1 175 ? 19.707  -13.973 -21.150 1.00 51.62  ? 296  LEU A N     1 
ATOM   1402 C CA    . LEU A 1 175 ? 18.591  -13.095 -21.470 1.00 51.00  ? 296  LEU A CA    1 
ATOM   1403 C C     . LEU A 1 175 ? 17.465  -13.829 -22.167 1.00 47.74  ? 296  LEU A C     1 
ATOM   1404 O O     . LEU A 1 175 ? 17.693  -14.813 -22.878 1.00 44.58  ? 296  LEU A O     1 
ATOM   1405 C CB    . LEU A 1 175 ? 19.025  -11.833 -22.231 1.00 56.76  ? 296  LEU A CB    1 
ATOM   1406 C CG    . LEU A 1 175 ? 20.274  -11.870 -23.101 1.00 57.50  ? 296  LEU A CG    1 
ATOM   1407 C CD1   . LEU A 1 175 ? 20.075  -12.884 -24.211 1.00 58.62  ? 296  LEU A CD1   1 
ATOM   1408 C CD2   . LEU A 1 175 ? 20.562  -10.491 -23.665 1.00 58.56  ? 296  LEU A CD2   1 
ATOM   1409 N N     . PRO A 1 176 ? 16.229  -13.364 -21.923 1.00 45.23  ? 297  PRO A N     1 
ATOM   1410 C CA    . PRO A 1 176 ? 15.042  -14.058 -22.383 1.00 45.73  ? 297  PRO A CA    1 
ATOM   1411 C C     . PRO A 1 176 ? 14.757  -13.781 -23.839 1.00 50.72  ? 297  PRO A C     1 
ATOM   1412 O O     . PRO A 1 176 ? 15.270  -12.799 -24.382 1.00 55.61  ? 297  PRO A O     1 
ATOM   1413 C CB    . PRO A 1 176 ? 13.935  -13.463 -21.522 1.00 44.64  ? 297  PRO A CB    1 
ATOM   1414 C CG    . PRO A 1 176 ? 14.429  -12.111 -21.169 1.00 43.36  ? 297  PRO A CG    1 
ATOM   1415 C CD    . PRO A 1 176 ? 15.904  -12.224 -21.049 1.00 43.32  ? 297  PRO A CD    1 
ATOM   1416 N N     . PRO A 1 177 ? 13.897  -14.606 -24.461 1.00 52.99  ? 298  PRO A N     1 
ATOM   1417 C CA    . PRO A 1 177 ? 13.576  -14.392 -25.874 1.00 54.29  ? 298  PRO A CA    1 
ATOM   1418 C C     . PRO A 1 177 ? 13.246  -12.911 -26.180 1.00 57.20  ? 298  PRO A C     1 
ATOM   1419 O O     . PRO A 1 177 ? 13.940  -12.300 -26.988 1.00 59.81  ? 298  PRO A O     1 
ATOM   1420 C CB    . PRO A 1 177 ? 12.372  -15.324 -26.106 1.00 55.74  ? 298  PRO A CB    1 
ATOM   1421 C CG    . PRO A 1 177 ? 12.432  -16.348 -25.004 1.00 51.36  ? 298  PRO A CG    1 
ATOM   1422 C CD    . PRO A 1 177 ? 13.018  -15.619 -23.832 1.00 51.73  ? 298  PRO A CD    1 
ATOM   1423 N N     . GLU A 1 178 ? 12.259  -12.337 -25.487 1.00 60.42  ? 299  GLU A N     1 
ATOM   1424 C CA    . GLU A 1 178 ? 11.914  -10.893 -25.600 1.00 64.28  ? 299  GLU A CA    1 
ATOM   1425 C C     . GLU A 1 178 ? 13.110  -9.973  -25.802 1.00 63.16  ? 299  GLU A C     1 
ATOM   1426 O O     . GLU A 1 178 ? 13.063  -9.035  -26.603 1.00 59.58  ? 299  GLU A O     1 
ATOM   1427 C CB    . GLU A 1 178 ? 11.236  -10.358 -24.323 1.00 66.99  ? 299  GLU A CB    1 
ATOM   1428 C CG    . GLU A 1 178 ? 10.071  -11.158 -23.761 1.00 70.02  ? 299  GLU A CG    1 
ATOM   1429 C CD    . GLU A 1 178 ? 10.420  -11.887 -22.475 1.00 63.87  ? 299  GLU A CD    1 
ATOM   1430 O OE1   . GLU A 1 178 ? 10.606  -11.243 -21.421 1.00 56.74  ? 299  GLU A OE1   1 
ATOM   1431 O OE2   . GLU A 1 178 ? 10.483  -13.120 -22.527 1.00 63.31  ? 299  GLU A OE2   1 
ATOM   1432 N N     . MET A 1 179 ? 14.156  -10.214 -25.021 1.00 63.93  ? 300  MET A N     1 
ATOM   1433 C CA    . MET A 1 179 ? 15.285  -9.306  -24.967 1.00 70.29  ? 300  MET A CA    1 
ATOM   1434 C C     . MET A 1 179 ? 16.227  -9.547  -26.121 1.00 70.34  ? 300  MET A C     1 
ATOM   1435 O O     . MET A 1 179 ? 16.942  -8.640  -26.541 1.00 71.64  ? 300  MET A O     1 
ATOM   1436 C CB    . MET A 1 179 ? 16.046  -9.460  -23.652 1.00 77.99  ? 300  MET A CB    1 
ATOM   1437 C CG    . MET A 1 179 ? 15.450  -8.671  -22.507 1.00 82.13  ? 300  MET A CG    1 
ATOM   1438 S SD    . MET A 1 179 ? 16.057  -6.978  -22.446 1.00 95.66  ? 300  MET A SD    1 
ATOM   1439 C CE    . MET A 1 179 ? 15.111  -6.167  -23.744 1.00 94.06  ? 300  MET A CE    1 
ATOM   1440 N N     . ILE A 1 180 ? 16.237  -10.767 -26.628 1.00 66.94  ? 301  ILE A N     1 
ATOM   1441 C CA    . ILE A 1 180 ? 17.125  -11.081 -27.711 1.00 68.41  ? 301  ILE A CA    1 
ATOM   1442 C C     . ILE A 1 180 ? 16.552  -10.493 -28.981 1.00 73.08  ? 301  ILE A C     1 
ATOM   1443 O O     . ILE A 1 180 ? 17.284  -9.909  -29.778 1.00 71.47  ? 301  ILE A O     1 
ATOM   1444 C CB    . ILE A 1 180 ? 17.297  -12.582 -27.903 1.00 66.74  ? 301  ILE A CB    1 
ATOM   1445 C CG1   . ILE A 1 180 ? 17.841  -13.220 -26.633 1.00 61.98  ? 301  ILE A CG1   1 
ATOM   1446 C CG2   . ILE A 1 180 ? 18.280  -12.818 -29.028 1.00 70.48  ? 301  ILE A CG2   1 
ATOM   1447 C CD1   . ILE A 1 180 ? 17.651  -14.714 -26.579 1.00 63.51  ? 301  ILE A CD1   1 
ATOM   1448 N N     . GLU A 1 181 ? 15.241  -10.651 -29.161 1.00 79.88  ? 302  GLU A N     1 
ATOM   1449 C CA    . GLU A 1 181 ? 14.552  -10.122 -30.349 1.00 86.82  ? 302  GLU A CA    1 
ATOM   1450 C C     . GLU A 1 181 ? 14.494  -8.605  -30.302 1.00 85.64  ? 302  GLU A C     1 
ATOM   1451 O O     . GLU A 1 181 ? 14.711  -7.939  -31.319 1.00 81.52  ? 302  GLU A O     1 
ATOM   1452 C CB    . GLU A 1 181 ? 13.136  -10.706 -30.492 1.00 87.95  ? 302  GLU A CB    1 
ATOM   1453 C CG    . GLU A 1 181 ? 13.053  -12.235 -30.445 1.00 91.36  ? 302  GLU A CG    1 
ATOM   1454 C CD    . GLU A 1 181 ? 14.091  -12.940 -31.317 1.00 99.63  ? 302  GLU A CD    1 
ATOM   1455 O OE1   . GLU A 1 181 ? 14.449  -12.413 -32.402 1.00 110.28 ? 302  GLU A OE1   1 
ATOM   1456 O OE2   . GLU A 1 181 ? 14.548  -14.036 -30.918 1.00 94.31  ? 302  GLU A OE2   1 
ATOM   1457 N N     . GLY A 1 182 ? 14.209  -8.070  -29.116 1.00 84.50  ? 303  GLY A N     1 
ATOM   1458 C CA    . GLY A 1 182 ? 14.280  -6.641  -28.885 1.00 87.06  ? 303  GLY A CA    1 
ATOM   1459 C C     . GLY A 1 182 ? 15.498  -6.021  -29.547 1.00 91.01  ? 303  GLY A C     1 
ATOM   1460 O O     . GLY A 1 182 ? 15.357  -5.121  -30.377 1.00 91.98  ? 303  GLY A O     1 
ATOM   1461 N N     . ARG A 1 183 ? 16.681  -6.541  -29.204 1.00 94.09  ? 304  ARG A N     1 
ATOM   1462 C CA    . ARG A 1 183 ? 17.979  -5.964  -29.613 1.00 91.63  ? 304  ARG A CA    1 
ATOM   1463 C C     . ARG A 1 183 ? 18.490  -6.405  -31.011 1.00 88.32  ? 304  ARG A C     1 
ATOM   1464 O O     . ARG A 1 183 ? 19.426  -5.803  -31.564 1.00 81.88  ? 304  ARG A O     1 
ATOM   1465 C CB    . ARG A 1 183 ? 19.048  -6.265  -28.550 1.00 87.71  ? 304  ARG A CB    1 
ATOM   1466 C CG    . ARG A 1 183 ? 18.806  -5.621  -27.184 1.00 90.27  ? 304  ARG A CG    1 
ATOM   1467 C CD    . ARG A 1 183 ? 19.872  -6.078  -26.185 1.00 94.97  ? 304  ARG A CD    1 
ATOM   1468 N NE    . ARG A 1 183 ? 19.499  -5.891  -24.777 1.00 97.99  ? 304  ARG A NE    1 
ATOM   1469 C CZ    . ARG A 1 183 ? 20.176  -6.373  -23.727 1.00 92.04  ? 304  ARG A CZ    1 
ATOM   1470 N NH1   . ARG A 1 183 ? 21.290  -7.082  -23.888 1.00 91.37  ? 304  ARG A NH1   1 
ATOM   1471 N NH2   . ARG A 1 183 ? 19.740  -6.139  -22.495 1.00 88.44  ? 304  ARG A NH2   1 
ATOM   1472 N N     . MET A 1 184 ? 17.891  -7.443  -31.586 1.00 85.39  ? 305  MET A N     1 
ATOM   1473 C CA    . MET A 1 184 ? 18.259  -7.836  -32.943 1.00 85.66  ? 305  MET A CA    1 
ATOM   1474 C C     . MET A 1 184 ? 17.687  -6.855  -33.951 1.00 83.55  ? 305  MET A C     1 
ATOM   1475 O O     . MET A 1 184 ? 18.415  -6.359  -34.806 1.00 87.43  ? 305  MET A O     1 
ATOM   1476 C CB    . MET A 1 184 ? 17.781  -9.255  -33.285 1.00 89.64  ? 305  MET A CB    1 
ATOM   1477 C CG    . MET A 1 184 ? 18.695  -10.385 -32.823 1.00 94.50  ? 305  MET A CG    1 
ATOM   1478 S SD    . MET A 1 184 ? 20.452  -9.985  -32.635 1.00 96.71  ? 305  MET A SD    1 
ATOM   1479 C CE    . MET A 1 184 ? 21.117  -11.608 -32.258 1.00 95.06  ? 305  MET A CE    1 
ATOM   1480 N N     . HIS A 1 185 ? 16.392  -6.570  -33.830 1.00 83.74  ? 306  HIS A N     1 
ATOM   1481 C CA    . HIS A 1 185 ? 15.656  -5.814  -34.843 1.00 84.42  ? 306  HIS A CA    1 
ATOM   1482 C C     . HIS A 1 185 ? 14.945  -4.566  -34.333 1.00 82.93  ? 306  HIS A C     1 
ATOM   1483 O O     . HIS A 1 185 ? 13.977  -4.134  -34.970 1.00 75.95  ? 306  HIS A O     1 
ATOM   1484 C CB    . HIS A 1 185 ? 14.580  -6.698  -35.476 1.00 83.61  ? 306  HIS A CB    1 
ATOM   1485 C CG    . HIS A 1 185 ? 15.088  -7.997  -35.998 1.00 84.02  ? 306  HIS A CG    1 
ATOM   1486 N ND1   . HIS A 1 185 ? 14.969  -9.176  -35.292 1.00 85.81  ? 306  HIS A ND1   1 
ATOM   1487 C CD2   . HIS A 1 185 ? 15.696  -8.311  -37.164 1.00 83.96  ? 306  HIS A CD2   1 
ATOM   1488 C CE1   . HIS A 1 185 ? 15.493  -10.161 -35.999 1.00 86.52  ? 306  HIS A CE1   1 
ATOM   1489 N NE2   . HIS A 1 185 ? 15.940  -9.663  -37.138 1.00 87.76  ? 306  HIS A NE2   1 
ATOM   1490 N N     . ASP A 1 186 ? 15.380  -3.988  -33.209 1.00 82.77  ? 307  ASP A N     1 
ATOM   1491 C CA    . ASP A 1 186 ? 14.736  -2.748  -32.721 1.00 84.49  ? 307  ASP A CA    1 
ATOM   1492 C C     . ASP A 1 186 ? 14.722  -1.704  -33.850 1.00 76.75  ? 307  ASP A C     1 
ATOM   1493 O O     . ASP A 1 186 ? 13.720  -1.011  -34.067 1.00 66.64  ? 307  ASP A O     1 
ATOM   1494 C CB    . ASP A 1 186 ? 15.376  -2.192  -31.425 1.00 85.36  ? 307  ASP A CB    1 
ATOM   1495 C CG    . ASP A 1 186 ? 16.908  -2.212  -31.444 1.00 85.31  ? 307  ASP A CG    1 
ATOM   1496 O OD1   . ASP A 1 186 ? 17.495  -2.549  -32.504 1.00 78.07  ? 307  ASP A OD1   1 
ATOM   1497 O OD2   . ASP A 1 186 ? 17.509  -1.887  -30.384 1.00 78.13  ? 307  ASP A OD2   1 
ATOM   1498 N N     . GLU A 1 187 ? 15.849  -1.637  -34.558 1.00 73.16  ? 308  GLU A N     1 
ATOM   1499 C CA    . GLU A 1 187 ? 15.979  -0.998  -35.862 1.00 69.11  ? 308  GLU A CA    1 
ATOM   1500 C C     . GLU A 1 187 ? 14.685  -1.030  -36.709 1.00 64.09  ? 308  GLU A C     1 
ATOM   1501 O O     . GLU A 1 187 ? 14.218  0.001   -37.172 1.00 62.13  ? 308  GLU A O     1 
ATOM   1502 C CB    . GLU A 1 187 ? 17.136  -1.711  -36.577 1.00 75.02  ? 308  GLU A CB    1 
ATOM   1503 C CG    . GLU A 1 187 ? 17.340  -1.400  -38.047 1.00 83.46  ? 308  GLU A CG    1 
ATOM   1504 C CD    . GLU A 1 187 ? 17.854  0.003   -38.293 1.00 89.76  ? 308  GLU A CD    1 
ATOM   1505 O OE1   . GLU A 1 187 ? 17.640  0.876   -37.421 1.00 88.08  ? 308  GLU A OE1   1 
ATOM   1506 O OE2   . GLU A 1 187 ? 18.463  0.229   -39.370 1.00 95.95  ? 308  GLU A OE2   1 
ATOM   1507 N N     . LYS A 1 188 ? 14.096  -2.212  -36.862 1.00 62.73  ? 309  LYS A N     1 
ATOM   1508 C CA    . LYS A 1 188 ? 12.962  -2.442  -37.770 1.00 60.25  ? 309  LYS A CA    1 
ATOM   1509 C C     . LYS A 1 188 ? 11.629  -1.903  -37.265 1.00 53.69  ? 309  LYS A C     1 
ATOM   1510 O O     . LYS A 1 188 ? 10.653  -1.848  -38.008 1.00 52.13  ? 309  LYS A O     1 
ATOM   1511 C CB    . LYS A 1 188 ? 12.821  -3.940  -38.064 1.00 64.88  ? 309  LYS A CB    1 
ATOM   1512 C CG    . LYS A 1 188 ? 14.033  -4.552  -38.772 1.00 72.30  ? 309  LYS A CG    1 
ATOM   1513 C CD    . LYS A 1 188 ? 13.886  -4.582  -40.292 1.00 75.37  ? 309  LYS A CD    1 
ATOM   1514 C CE    . LYS A 1 188 ? 15.240  -4.672  -40.989 1.00 82.10  ? 309  LYS A CE    1 
ATOM   1515 N NZ    . LYS A 1 188 ? 15.127  -4.965  -42.448 1.00 85.29  ? 309  LYS A NZ    1 
ATOM   1516 N N     . VAL A 1 189 ? 11.582  -1.490  -36.012 1.00 49.15  ? 310  VAL A N     1 
ATOM   1517 C CA    . VAL A 1 189 ? 10.394  -0.822  -35.494 1.00 49.04  ? 310  VAL A CA    1 
ATOM   1518 C C     . VAL A 1 189 ? 10.032  0.413   -36.323 1.00 48.99  ? 310  VAL A C     1 
ATOM   1519 O O     . VAL A 1 189 ? 8.867   0.766   -36.438 1.00 48.43  ? 310  VAL A O     1 
ATOM   1520 C CB    . VAL A 1 189 ? 10.597  -0.326  -34.057 1.00 49.76  ? 310  VAL A CB    1 
ATOM   1521 C CG1   . VAL A 1 189 ? 9.406   0.505   -33.622 1.00 51.20  ? 310  VAL A CG1   1 
ATOM   1522 C CG2   . VAL A 1 189 ? 10.830  -1.475  -33.087 1.00 53.37  ? 310  VAL A CG2   1 
ATOM   1523 N N     . ASP A 1 190 ? 11.032  1.095   -36.873 1.00 51.96  ? 311  ASP A N     1 
ATOM   1524 C CA    . ASP A 1 190 ? 10.766  2.314   -37.657 1.00 51.67  ? 311  ASP A CA    1 
ATOM   1525 C C     . ASP A 1 190 ? 10.121  2.001   -38.987 1.00 45.64  ? 311  ASP A C     1 
ATOM   1526 O O     . ASP A 1 190 ? 9.573   2.884   -39.623 1.00 41.17  ? 311  ASP A O     1 
ATOM   1527 C CB    . ASP A 1 190 ? 12.039  3.141   -37.872 1.00 52.05  ? 311  ASP A CB    1 
ATOM   1528 C CG    . ASP A 1 190 ? 12.481  3.855   -36.615 1.00 54.81  ? 311  ASP A CG    1 
ATOM   1529 O OD1   . ASP A 1 190 ? 11.583  4.137   -35.785 1.00 53.75  ? 311  ASP A OD1   1 
ATOM   1530 O OD2   . ASP A 1 190 ? 13.710  4.133   -36.463 1.00 55.78  ? 311  ASP A OD2   1 
ATOM   1531 N N     . LEU A 1 191 ? 10.161  0.743   -39.398 1.00 43.36  ? 312  LEU A N     1 
ATOM   1532 C CA    . LEU A 1 191 ? 9.513   0.376   -40.640 1.00 41.97  ? 312  LEU A CA    1 
ATOM   1533 C C     . LEU A 1 191 ? 8.026   0.179   -40.473 1.00 38.26  ? 312  LEU A C     1 
ATOM   1534 O O     . LEU A 1 191 ? 7.270   0.496   -41.379 1.00 39.20  ? 312  LEU A O     1 
ATOM   1535 C CB    . LEU A 1 191 ? 10.218  -0.807  -41.281 1.00 43.42  ? 312  LEU A CB    1 
ATOM   1536 C CG    . LEU A 1 191 ? 11.405  -0.131  -41.997 1.00 46.93  ? 312  LEU A CG    1 
ATOM   1537 C CD1   . LEU A 1 191 ? 12.725  -0.882  -41.878 1.00 47.82  ? 312  LEU A CD1   1 
ATOM   1538 C CD2   . LEU A 1 191 ? 11.023  0.134   -43.444 1.00 45.78  ? 312  LEU A CD2   1 
ATOM   1539 N N     . TRP A 1 192 ? 7.600   -0.287  -39.307 1.00 34.80  ? 313  TRP A N     1 
ATOM   1540 C CA    . TRP A 1 192 ? 6.185   -0.449  -39.043 1.00 34.48  ? 313  TRP A CA    1 
ATOM   1541 C C     . TRP A 1 192 ? 5.557   0.915   -39.131 1.00 36.00  ? 313  TRP A C     1 
ATOM   1542 O O     . TRP A 1 192 ? 4.642   1.144   -39.916 1.00 38.08  ? 313  TRP A O     1 
ATOM   1543 C CB    . TRP A 1 192 ? 5.991   -1.026  -37.648 1.00 35.96  ? 313  TRP A CB    1 
ATOM   1544 C CG    . TRP A 1 192 ? 4.588   -1.270  -37.239 1.00 34.93  ? 313  TRP A CG    1 
ATOM   1545 C CD1   . TRP A 1 192 ? 3.776   -0.410  -36.610 1.00 34.07  ? 313  TRP A CD1   1 
ATOM   1546 C CD2   . TRP A 1 192 ? 3.842   -2.483  -37.410 1.00 35.03  ? 313  TRP A CD2   1 
ATOM   1547 N NE1   . TRP A 1 192 ? 2.551   -0.997  -36.382 1.00 34.17  ? 313  TRP A NE1   1 
ATOM   1548 C CE2   . TRP A 1 192 ? 2.577   -2.275  -36.858 1.00 32.02  ? 313  TRP A CE2   1 
ATOM   1549 C CE3   . TRP A 1 192 ? 4.127   -3.726  -37.985 1.00 37.03  ? 313  TRP A CE3   1 
ATOM   1550 C CZ2   . TRP A 1 192 ? 1.604   -3.249  -36.847 1.00 31.66  ? 313  TRP A CZ2   1 
ATOM   1551 C CZ3   . TRP A 1 192 ? 3.143   -4.705  -37.977 1.00 35.03  ? 313  TRP A CZ3   1 
ATOM   1552 C CH2   . TRP A 1 192 ? 1.905   -4.457  -37.405 1.00 33.37  ? 313  TRP A CH2   1 
ATOM   1553 N N     . SER A 1 193 ? 6.101   1.833   -38.350 1.00 36.26  ? 314  SER A N     1 
ATOM   1554 C CA    . SER A 1 193 ? 5.671   3.205   -38.357 1.00 37.67  ? 314  SER A CA    1 
ATOM   1555 C C     . SER A 1 193 ? 5.474   3.779   -39.758 1.00 37.68  ? 314  SER A C     1 
ATOM   1556 O O     . SER A 1 193 ? 4.395   4.313   -40.052 1.00 43.16  ? 314  SER A O     1 
ATOM   1557 C CB    . SER A 1 193 ? 6.639   4.034   -37.550 1.00 39.23  ? 314  SER A CB    1 
ATOM   1558 O OG    . SER A 1 193 ? 6.656   3.544   -36.204 1.00 42.10  ? 314  SER A OG    1 
ATOM   1559 N N     . LEU A 1 194 ? 6.456   3.666   -40.639 1.00 33.82  ? 315  LEU A N     1 
ATOM   1560 C CA    . LEU A 1 194 ? 6.213   4.101   -42.017 1.00 33.21  ? 315  LEU A CA    1 
ATOM   1561 C C     . LEU A 1 194 ? 4.940   3.490   -42.599 1.00 30.84  ? 315  LEU A C     1 
ATOM   1562 O O     . LEU A 1 194 ? 4.166   4.140   -43.283 1.00 31.20  ? 315  LEU A O     1 
ATOM   1563 C CB    . LEU A 1 194 ? 7.343   3.698   -42.926 1.00 34.55  ? 315  LEU A CB    1 
ATOM   1564 C CG    . LEU A 1 194 ? 8.232   4.850   -43.287 1.00 38.32  ? 315  LEU A CG    1 
ATOM   1565 C CD1   . LEU A 1 194 ? 9.151   5.147   -42.132 1.00 40.72  ? 315  LEU A CD1   1 
ATOM   1566 C CD2   . LEU A 1 194 ? 9.063   4.499   -44.498 1.00 40.20  ? 315  LEU A CD2   1 
ATOM   1567 N N     . GLY A 1 195 ? 4.755   2.215   -42.355 1.00 30.30  ? 316  GLY A N     1 
ATOM   1568 C CA    . GLY A 1 195 ? 3.632   1.505   -42.921 1.00 31.54  ? 316  GLY A CA    1 
ATOM   1569 C C     . GLY A 1 195 ? 2.331   2.082   -42.430 1.00 29.69  ? 316  GLY A C     1 
ATOM   1570 O O     . GLY A 1 195 ? 1.490   2.466   -43.223 1.00 28.54  ? 316  GLY A O     1 
ATOM   1571 N N     . VAL A 1 196 ? 2.206   2.173   -41.117 1.00 29.11  ? 317  VAL A N     1 
ATOM   1572 C CA    . VAL A 1 196 ? 1.034   2.742   -40.487 1.00 30.88  ? 317  VAL A CA    1 
ATOM   1573 C C     . VAL A 1 196 ? 0.719   4.142   -41.009 1.00 32.40  ? 317  VAL A C     1 
ATOM   1574 O O     . VAL A 1 196 ? -0.418  4.432   -41.369 1.00 30.10  ? 317  VAL A O     1 
ATOM   1575 C CB    . VAL A 1 196 ? 1.221   2.830   -38.970 1.00 31.23  ? 317  VAL A CB    1 
ATOM   1576 C CG1   . VAL A 1 196 ? 0.058   3.567   -38.344 1.00 32.35  ? 317  VAL A CG1   1 
ATOM   1577 C CG2   . VAL A 1 196 ? 1.337   1.439   -38.377 1.00 31.42  ? 317  VAL A CG2   1 
ATOM   1578 N N     . LEU A 1 197 ? 1.736   4.997   -41.040 1.00 34.48  ? 318  LEU A N     1 
ATOM   1579 C CA    . LEU A 1 197 ? 1.553   6.383   -41.420 1.00 36.22  ? 318  LEU A CA    1 
ATOM   1580 C C     . LEU A 1 197 ? 1.117   6.479   -42.856 1.00 39.38  ? 318  LEU A C     1 
ATOM   1581 O O     . LEU A 1 197 ? 0.179   7.207   -43.187 1.00 38.46  ? 318  LEU A O     1 
ATOM   1582 C CB    . LEU A 1 197 ? 2.858   7.149   -41.243 1.00 38.66  ? 318  LEU A CB    1 
ATOM   1583 C CG    . LEU A 1 197 ? 2.986   7.927   -39.940 1.00 40.06  ? 318  LEU A CG    1 
ATOM   1584 C CD1   . LEU A 1 197 ? 4.450   8.150   -39.628 1.00 43.39  ? 318  LEU A CD1   1 
ATOM   1585 C CD2   . LEU A 1 197 ? 2.249   9.248   -40.021 1.00 39.73  ? 318  LEU A CD2   1 
ATOM   1586 N N     . CYS A 1 198 ? 1.825   5.760   -43.721 1.00 42.31  ? 319  CYS A N     1 
ATOM   1587 C CA    . CYS A 1 198 ? 1.464   5.709   -45.131 1.00 42.34  ? 319  CYS A CA    1 
ATOM   1588 C C     . CYS A 1 198 ? 0.003   5.344   -45.254 1.00 37.13  ? 319  CYS A C     1 
ATOM   1589 O O     . CYS A 1 198 ? -0.730  5.939   -46.024 1.00 38.30  ? 319  CYS A O     1 
ATOM   1590 C CB    . CYS A 1 198 ? 2.323   4.688   -45.889 1.00 46.76  ? 319  CYS A CB    1 
ATOM   1591 S SG    . CYS A 1 198 ? 1.903   4.581   -47.647 1.00 53.32  ? 319  CYS A SG    1 
ATOM   1592 N N     . TYR A 1 199 ? -0.427  4.375   -44.467 1.00 35.95  ? 320  TYR A N     1 
ATOM   1593 C CA    . TYR A 1 199 ? -1.810  3.958   -44.506 1.00 34.82  ? 320  TYR A CA    1 
ATOM   1594 C C     . TYR A 1 199 ? -2.714  5.090   -44.074 1.00 34.42  ? 320  TYR A C     1 
ATOM   1595 O O     . TYR A 1 199 ? -3.730  5.322   -44.713 1.00 31.25  ? 320  TYR A O     1 
ATOM   1596 C CB    . TYR A 1 199 ? -2.043  2.749   -43.612 1.00 34.40  ? 320  TYR A CB    1 
ATOM   1597 C CG    . TYR A 1 199 ? -3.481  2.240   -43.621 1.00 33.55  ? 320  TYR A CG    1 
ATOM   1598 C CD1   . TYR A 1 199 ? -4.472  2.868   -42.888 1.00 32.45  ? 320  TYR A CD1   1 
ATOM   1599 C CD2   . TYR A 1 199 ? -3.822  1.121   -44.336 1.00 31.44  ? 320  TYR A CD2   1 
ATOM   1600 C CE1   . TYR A 1 199 ? -5.763  2.389   -42.891 1.00 33.10  ? 320  TYR A CE1   1 
ATOM   1601 C CE2   . TYR A 1 199 ? -5.109  0.644   -44.350 1.00 31.17  ? 320  TYR A CE2   1 
ATOM   1602 C CZ    . TYR A 1 199 ? -6.074  1.271   -43.629 1.00 31.91  ? 320  TYR A CZ    1 
ATOM   1603 O OH    . TYR A 1 199 ? -7.362  0.770   -43.649 1.00 32.39  ? 320  TYR A OH    1 
ATOM   1604 N N     . GLU A 1 200 ? -2.339  5.781   -42.993 1.00 35.70  ? 321  GLU A N     1 
ATOM   1605 C CA    . GLU A 1 200 ? -3.161  6.848   -42.446 1.00 36.68  ? 321  GLU A CA    1 
ATOM   1606 C C     . GLU A 1 200 ? -3.238  7.988   -43.436 1.00 36.35  ? 321  GLU A C     1 
ATOM   1607 O O     . GLU A 1 200 ? -4.300  8.569   -43.630 1.00 41.42  ? 321  GLU A O     1 
ATOM   1608 C CB    . GLU A 1 200 ? -2.649  7.344   -41.103 1.00 40.42  ? 321  GLU A CB    1 
ATOM   1609 C CG    . GLU A 1 200 ? -3.674  8.220   -40.376 1.00 47.11  ? 321  GLU A CG    1 
ATOM   1610 C CD    . GLU A 1 200 ? -3.229  8.762   -39.001 1.00 51.30  ? 321  GLU A CD    1 
ATOM   1611 O OE1   . GLU A 1 200 ? -2.134  8.430   -38.505 1.00 47.75  ? 321  GLU A OE1   1 
ATOM   1612 O OE2   . GLU A 1 200 ? -3.994  9.551   -38.402 1.00 56.63  ? 321  GLU A OE2   1 
ATOM   1613 N N     . PHE A 1 201 ? -2.144  8.278   -44.113 1.00 34.89  ? 322  PHE A N     1 
ATOM   1614 C CA    . PHE A 1 201 ? -2.159  9.342   -45.113 1.00 35.01  ? 322  PHE A CA    1 
ATOM   1615 C C     . PHE A 1 201 ? -3.171  9.086   -46.226 1.00 38.17  ? 322  PHE A C     1 
ATOM   1616 O O     . PHE A 1 201 ? -3.917  9.973   -46.598 1.00 41.17  ? 322  PHE A O     1 
ATOM   1617 C CB    . PHE A 1 201 ? -0.769  9.536   -45.710 1.00 34.15  ? 322  PHE A CB    1 
ATOM   1618 C CG    . PHE A 1 201 ? 0.240   10.093  -44.737 1.00 33.65  ? 322  PHE A CG    1 
ATOM   1619 C CD1   . PHE A 1 201 ? -0.143  10.591  -43.495 1.00 32.63  ? 322  PHE A CD1   1 
ATOM   1620 C CD2   . PHE A 1 201 ? 1.578   10.156  -45.087 1.00 34.62  ? 322  PHE A CD2   1 
ATOM   1621 C CE1   . PHE A 1 201 ? 0.796   11.110  -42.626 1.00 33.99  ? 322  PHE A CE1   1 
ATOM   1622 C CE2   . PHE A 1 201 ? 2.526   10.684  -44.218 1.00 33.62  ? 322  PHE A CE2   1 
ATOM   1623 C CZ    . PHE A 1 201 ? 2.134   11.164  -42.990 1.00 34.03  ? 322  PHE A CZ    1 
ATOM   1624 N N     . LEU A 1 202 ? -3.222  7.878   -46.762 1.00 38.99  ? 323  LEU A N     1 
ATOM   1625 C CA    . LEU A 1 202 ? -4.126  7.625   -47.871 1.00 37.82  ? 323  LEU A CA    1 
ATOM   1626 C C     . LEU A 1 202 ? -5.584  7.545   -47.387 1.00 43.77  ? 323  LEU A C     1 
ATOM   1627 O O     . LEU A 1 202 ? -6.517  8.047   -48.041 1.00 44.86  ? 323  LEU A O     1 
ATOM   1628 C CB    . LEU A 1 202 ? -3.730  6.348   -48.575 1.00 36.55  ? 323  LEU A CB    1 
ATOM   1629 C CG    . LEU A 1 202 ? -2.289  6.253   -49.078 1.00 35.86  ? 323  LEU A CG    1 
ATOM   1630 C CD1   . LEU A 1 202 ? -1.999  4.831   -49.497 1.00 36.24  ? 323  LEU A CD1   1 
ATOM   1631 C CD2   . LEU A 1 202 ? -2.052  7.184   -50.251 1.00 37.49  ? 323  LEU A CD2   1 
ATOM   1632 N N     . VAL A 1 203 ? -5.783  6.957   -46.217 1.00 42.87  ? 324  VAL A N     1 
ATOM   1633 C CA    . VAL A 1 203 ? -7.124  6.596   -45.799 1.00 41.36  ? 324  VAL A CA    1 
ATOM   1634 C C     . VAL A 1 203 ? -7.727  7.596   -44.818 1.00 40.90  ? 324  VAL A C     1 
ATOM   1635 O O     . VAL A 1 203 ? -8.932  7.761   -44.756 1.00 36.54  ? 324  VAL A O     1 
ATOM   1636 C CB    . VAL A 1 203 ? -7.109  5.192   -45.196 1.00 38.87  ? 324  VAL A CB    1 
ATOM   1637 C CG1   . VAL A 1 203 ? -8.507  4.805   -44.755 1.00 38.79  ? 324  VAL A CG1   1 
ATOM   1638 C CG2   . VAL A 1 203 ? -6.537  4.222   -46.209 1.00 35.72  ? 324  VAL A CG2   1 
ATOM   1639 N N     . GLY A 1 204 ? -6.879  8.257   -44.047 1.00 43.43  ? 325  GLY A N     1 
ATOM   1640 C CA    . GLY A 1 204 ? -7.340  9.292   -43.138 1.00 44.01  ? 325  GLY A CA    1 
ATOM   1641 C C     . GLY A 1 204 ? -7.661  8.733   -41.774 1.00 45.30  ? 325  GLY A C     1 
ATOM   1642 O O     . GLY A 1 204 ? -8.343  9.371   -40.996 1.00 48.78  ? 325  GLY A O     1 
ATOM   1643 N N     . LYS A 1 205 ? -7.171  7.541   -41.479 1.00 45.76  ? 326  LYS A N     1 
ATOM   1644 C CA    . LYS A 1 205 ? -7.350  6.952   -40.164 1.00 48.64  ? 326  LYS A CA    1 
ATOM   1645 C C     . LYS A 1 205 ? -6.450  5.717   -40.095 1.00 48.16  ? 326  LYS A C     1 
ATOM   1646 O O     . LYS A 1 205 ? -6.298  5.001   -41.096 1.00 46.40  ? 326  LYS A O     1 
ATOM   1647 C CB    . LYS A 1 205 ? -8.819  6.576   -39.921 1.00 51.78  ? 326  LYS A CB    1 
ATOM   1648 C CG    . LYS A 1 205 ? -9.298  5.410   -40.759 1.00 56.25  ? 326  LYS A CG    1 
ATOM   1649 C CD    . LYS A 1 205 ? -10.804 5.427   -40.984 1.00 65.42  ? 326  LYS A CD    1 
ATOM   1650 C CE    . LYS A 1 205 ? -11.331 4.063   -41.450 1.00 69.01  ? 326  LYS A CE    1 
ATOM   1651 N NZ    . LYS A 1 205 ? -10.735 3.530   -42.716 1.00 67.64  ? 326  LYS A NZ    1 
ATOM   1652 N N     . PRO A 1 206 ? -5.853  5.452   -38.920 1.00 44.15  ? 327  PRO A N     1 
ATOM   1653 C CA    . PRO A 1 206 ? -4.894  4.362   -38.931 1.00 42.54  ? 327  PRO A CA    1 
ATOM   1654 C C     . PRO A 1 206 ? -5.560  2.995   -39.117 1.00 38.85  ? 327  PRO A C     1 
ATOM   1655 O O     . PRO A 1 206 ? -6.757  2.851   -38.876 1.00 35.41  ? 327  PRO A O     1 
ATOM   1656 C CB    . PRO A 1 206 ? -4.189  4.472   -37.574 1.00 43.21  ? 327  PRO A CB    1 
ATOM   1657 C CG    . PRO A 1 206 ? -5.005  5.433   -36.752 1.00 45.84  ? 327  PRO A CG    1 
ATOM   1658 C CD    . PRO A 1 206 ? -6.197  5.868   -37.556 1.00 45.29  ? 327  PRO A CD    1 
ATOM   1659 N N     . PRO A 1 207 ? -4.778  2.008   -39.572 1.00 34.88  ? 328  PRO A N     1 
ATOM   1660 C CA    . PRO A 1 207 ? -5.188  0.666   -39.903 1.00 33.24  ? 328  PRO A CA    1 
ATOM   1661 C C     . PRO A 1 207 ? -5.890  -0.104  -38.808 1.00 34.14  ? 328  PRO A C     1 
ATOM   1662 O O     . PRO A 1 207 ? -6.669  -1.020  -39.096 1.00 40.48  ? 328  PRO A O     1 
ATOM   1663 C CB    . PRO A 1 207 ? -3.872  -0.037  -40.169 1.00 34.27  ? 328  PRO A CB    1 
ATOM   1664 C CG    . PRO A 1 207 ? -2.924  1.008   -40.552 1.00 34.11  ? 328  PRO A CG    1 
ATOM   1665 C CD    . PRO A 1 207 ? -3.354  2.241   -39.860 1.00 34.13  ? 328  PRO A CD    1 
ATOM   1666 N N     . PHE A 1 208 ? -5.587  0.228   -37.566 1.00 33.89  ? 329  PHE A N     1 
ATOM   1667 C CA    . PHE A 1 208 ? -5.941  -0.603  -36.454 1.00 30.86  ? 329  PHE A CA    1 
ATOM   1668 C C     . PHE A 1 208 ? -6.840  0.165   -35.482 1.00 34.07  ? 329  PHE A C     1 
ATOM   1669 O O     . PHE A 1 208 ? -7.006  -0.232  -34.325 1.00 35.97  ? 329  PHE A O     1 
ATOM   1670 C CB    . PHE A 1 208 ? -4.642  -1.076  -35.780 1.00 29.63  ? 329  PHE A CB    1 
ATOM   1671 C CG    . PHE A 1 208 ? -3.660  -1.766  -36.708 1.00 27.24  ? 329  PHE A CG    1 
ATOM   1672 C CD1   . PHE A 1 208 ? -3.927  -3.010  -37.228 1.00 28.86  ? 329  PHE A CD1   1 
ATOM   1673 C CD2   . PHE A 1 208 ? -2.453  -1.181  -37.018 1.00 27.65  ? 329  PHE A CD2   1 
ATOM   1674 C CE1   . PHE A 1 208 ? -3.021  -3.653  -38.065 1.00 29.19  ? 329  PHE A CE1   1 
ATOM   1675 C CE2   . PHE A 1 208 ? -1.533  -1.797  -37.844 1.00 26.95  ? 329  PHE A CE2   1 
ATOM   1676 C CZ    . PHE A 1 208 ? -1.808  -3.040  -38.364 1.00 29.28  ? 329  PHE A CZ    1 
ATOM   1677 N N     . GLU A 1 209 ? -7.453  1.252   -35.943 1.00 39.36  ? 330  GLU A N     1 
ATOM   1678 C CA    . GLU A 1 209 ? -8.421  2.009   -35.113 1.00 45.86  ? 330  GLU A CA    1 
ATOM   1679 C C     . GLU A 1 209 ? -9.515  1.092   -34.581 1.00 41.11  ? 330  GLU A C     1 
ATOM   1680 O O     . GLU A 1 209 ? -9.956  0.204   -35.276 1.00 39.71  ? 330  GLU A O     1 
ATOM   1681 C CB    . GLU A 1 209 ? -9.083  3.137   -35.917 1.00 52.42  ? 330  GLU A CB    1 
ATOM   1682 C CG    . GLU A 1 209 ? -9.722  4.239   -35.073 1.00 58.96  ? 330  GLU A CG    1 
ATOM   1683 C CD    . GLU A 1 209 ? -8.911  5.543   -35.060 1.00 68.57  ? 330  GLU A CD    1 
ATOM   1684 O OE1   . GLU A 1 209 ? -9.019  6.331   -36.036 1.00 72.67  ? 330  GLU A OE1   1 
ATOM   1685 O OE2   . GLU A 1 209 ? -8.165  5.792   -34.075 1.00 72.20  ? 330  GLU A OE2   1 
ATOM   1686 N N     . ALA A 1 210 ? -9.952  1.311   -33.353 1.00 41.63  ? 331  ALA A N     1 
ATOM   1687 C CA    . ALA A 1 210 ? -11.018 0.502   -32.759 1.00 44.09  ? 331  ALA A CA    1 
ATOM   1688 C C     . ALA A 1 210 ? -11.616 1.235   -31.587 1.00 45.59  ? 331  ALA A C     1 
ATOM   1689 O O     . ALA A 1 210 ? -11.043 2.185   -31.101 1.00 43.79  ? 331  ALA A O     1 
ATOM   1690 C CB    . ALA A 1 210 ? -10.484 -0.853  -32.313 1.00 44.80  ? 331  ALA A CB    1 
ATOM   1691 N N     . ASN A 1 211 ? -12.780 0.790   -31.137 1.00 53.40  ? 332  ASN A N     1 
ATOM   1692 C CA    . ASN A 1 211 ? -13.400 1.348   -29.930 1.00 54.66  ? 332  ASN A CA    1 
ATOM   1693 C C     . ASN A 1 211 ? -12.571 1.306   -28.651 1.00 50.32  ? 332  ASN A C     1 
ATOM   1694 O O     . ASN A 1 211 ? -12.672 2.212   -27.820 1.00 52.71  ? 332  ASN A O     1 
ATOM   1695 C CB    . ASN A 1 211 ? -14.692 0.606   -29.646 1.00 61.12  ? 332  ASN A CB    1 
ATOM   1696 C CG    . ASN A 1 211 ? -15.833 1.120   -30.468 1.00 70.24  ? 332  ASN A CG    1 
ATOM   1697 O OD1   . ASN A 1 211 ? -15.681 2.082   -31.232 1.00 75.20  ? 332  ASN A OD1   1 
ATOM   1698 N ND2   . ASN A 1 211 ? -16.997 0.499   -30.308 1.00 72.58  ? 332  ASN A ND2   1 
ATOM   1699 N N     . THR A 1 212 ? -11.802 0.236   -28.471 1.00 45.79  ? 333  THR A N     1 
ATOM   1700 C CA    . THR A 1 212 ? -11.144 -0.034  -27.193 1.00 46.60  ? 333  THR A CA    1 
ATOM   1701 C C     . THR A 1 212 ? -9.676  -0.175  -27.414 1.00 45.67  ? 333  THR A C     1 
ATOM   1702 O O     . THR A 1 212 ? -9.235  -0.506  -28.503 1.00 45.06  ? 333  THR A O     1 
ATOM   1703 C CB    . THR A 1 212 ? -11.668 -1.321  -26.492 1.00 47.54  ? 333  THR A CB    1 
ATOM   1704 O OG1   . THR A 1 212 ? -11.114 -2.507  -27.084 1.00 47.44  ? 333  THR A OG1   1 
ATOM   1705 C CG2   . THR A 1 212 ? -13.196 -1.395  -26.531 1.00 47.17  ? 333  THR A CG2   1 
ATOM   1706 N N     . TYR A 1 213 ? -8.904  0.089   -26.382 1.00 48.84  ? 334  TYR A N     1 
ATOM   1707 C CA    . TYR A 1 213 ? -7.499  -0.204  -26.461 1.00 57.06  ? 334  TYR A CA    1 
ATOM   1708 C C     . TYR A 1 213 ? -7.287  -1.705  -26.617 1.00 54.42  ? 334  TYR A C     1 
ATOM   1709 O O     . TYR A 1 213 ? -6.383  -2.123  -27.331 1.00 57.72  ? 334  TYR A O     1 
ATOM   1710 C CB    . TYR A 1 213 ? -6.737  0.377   -25.257 1.00 67.39  ? 334  TYR A CB    1 
ATOM   1711 C CG    . TYR A 1 213 ? -6.711  1.898   -25.251 1.00 82.08  ? 334  TYR A CG    1 
ATOM   1712 C CD1   . TYR A 1 213 ? -6.578  2.626   -26.443 1.00 93.71  ? 334  TYR A CD1   1 
ATOM   1713 C CD2   . TYR A 1 213 ? -6.833  2.618   -24.062 1.00 94.90  ? 334  TYR A CD2   1 
ATOM   1714 C CE1   . TYR A 1 213 ? -6.567  4.015   -26.446 1.00 103.13 ? 334  TYR A CE1   1 
ATOM   1715 C CE2   . TYR A 1 213 ? -6.815  4.011   -24.057 1.00 99.63  ? 334  TYR A CE2   1 
ATOM   1716 C CZ    . TYR A 1 213 ? -6.687  4.705   -25.253 1.00 102.71 ? 334  TYR A CZ    1 
ATOM   1717 O OH    . TYR A 1 213 ? -6.669  6.082   -25.262 1.00 107.65 ? 334  TYR A OH    1 
ATOM   1718 N N     . GLN A 1 214 ? -8.144  -2.512  -26.007 1.00 53.33  ? 335  GLN A N     1 
ATOM   1719 C CA    . GLN A 1 214 ? -7.981  -3.954  -26.077 1.00 56.03  ? 335  GLN A CA    1 
ATOM   1720 C C     . GLN A 1 214 ? -8.159  -4.492  -27.492 1.00 52.34  ? 335  GLN A C     1 
ATOM   1721 O O     . GLN A 1 214 ? -7.410  -5.362  -27.883 1.00 48.29  ? 335  GLN A O     1 
ATOM   1722 C CB    . GLN A 1 214 ? -8.930  -4.672  -25.115 1.00 63.16  ? 335  GLN A CB    1 
ATOM   1723 C CG    . GLN A 1 214 ? -8.695  -4.348  -23.635 1.00 69.84  ? 335  GLN A CG    1 
ATOM   1724 C CD    . GLN A 1 214 ? -9.629  -3.251  -23.107 1.00 76.75  ? 335  GLN A CD    1 
ATOM   1725 O OE1   . GLN A 1 214 ? -9.603  -2.104  -23.572 1.00 74.05  ? 335  GLN A OE1   1 
ATOM   1726 N NE2   . GLN A 1 214 ? -10.471 -3.609  -22.139 1.00 77.77  ? 335  GLN A NE2   1 
ATOM   1727 N N     . GLU A 1 215 ? -9.141  -3.992  -28.250 1.00 51.84  ? 336  GLU A N     1 
ATOM   1728 C CA    . GLU A 1 215 ? -9.352  -4.441  -29.647 1.00 53.86  ? 336  GLU A CA    1 
ATOM   1729 C C     . GLU A 1 215 ? -8.234  -3.974  -30.555 1.00 46.42  ? 336  GLU A C     1 
ATOM   1730 O O     . GLU A 1 215 ? -7.659  -4.747  -31.305 1.00 43.89  ? 336  GLU A O     1 
ATOM   1731 C CB    . GLU A 1 215 ? -10.648 -3.897  -30.240 1.00 62.58  ? 336  GLU A CB    1 
ATOM   1732 C CG    . GLU A 1 215 ? -11.910 -4.602  -29.795 1.00 73.90  ? 336  GLU A CG    1 
ATOM   1733 C CD    . GLU A 1 215 ? -13.103 -3.650  -29.733 1.00 86.76  ? 336  GLU A CD    1 
ATOM   1734 O OE1   . GLU A 1 215 ? -13.003 -2.627  -29.011 1.00 84.07  ? 336  GLU A OE1   1 
ATOM   1735 O OE2   . GLU A 1 215 ? -14.138 -3.921  -30.399 1.00 88.84  ? 336  GLU A OE2   1 
ATOM   1736 N N     . THR A 1 216 ? -7.956  -2.685  -30.501 1.00 41.91  ? 337  THR A N     1 
ATOM   1737 C CA    . THR A 1 216 ? -6.827  -2.137  -31.204 1.00 38.87  ? 337  THR A CA    1 
ATOM   1738 C C     . THR A 1 216 ? -5.633  -3.012  -30.944 1.00 37.01  ? 337  THR A C     1 
ATOM   1739 O O     . THR A 1 216 ? -4.939  -3.396  -31.877 1.00 37.25  ? 337  THR A O     1 
ATOM   1740 C CB    . THR A 1 216 ? -6.537  -0.690  -30.780 1.00 36.89  ? 337  THR A CB    1 
ATOM   1741 O OG1   . THR A 1 216 ? -7.583  0.154   -31.269 1.00 35.89  ? 337  THR A OG1   1 
ATOM   1742 C CG2   . THR A 1 216 ? -5.202  -0.201  -31.366 1.00 36.51  ? 337  THR A CG2   1 
ATOM   1743 N N     . TYR A 1 217 ? -5.411  -3.337  -29.680 1.00 37.88  ? 338  TYR A N     1 
ATOM   1744 C CA    . TYR A 1 217 ? -4.325  -4.246  -29.291 1.00 43.78  ? 338  TYR A CA    1 
ATOM   1745 C C     . TYR A 1 217 ? -4.426  -5.643  -29.960 1.00 40.48  ? 338  TYR A C     1 
ATOM   1746 O O     . TYR A 1 217 ? -3.447  -6.140  -30.467 1.00 42.76  ? 338  TYR A O     1 
ATOM   1747 C CB    . TYR A 1 217 ? -4.240  -4.361  -27.751 1.00 49.35  ? 338  TYR A CB    1 
ATOM   1748 C CG    . TYR A 1 217 ? -3.254  -5.404  -27.274 1.00 59.30  ? 338  TYR A CG    1 
ATOM   1749 C CD1   . TYR A 1 217 ? -3.621  -6.755  -27.187 1.00 64.88  ? 338  TYR A CD1   1 
ATOM   1750 C CD2   . TYR A 1 217 ? -1.952  -5.057  -26.923 1.00 63.73  ? 338  TYR A CD2   1 
ATOM   1751 C CE1   . TYR A 1 217 ? -2.718  -7.724  -26.765 1.00 67.46  ? 338  TYR A CE1   1 
ATOM   1752 C CE2   . TYR A 1 217 ? -1.047  -6.025  -26.495 1.00 67.95  ? 338  TYR A CE2   1 
ATOM   1753 C CZ    . TYR A 1 217 ? -1.430  -7.351  -26.422 1.00 71.00  ? 338  TYR A CZ    1 
ATOM   1754 O OH    . TYR A 1 217 ? -0.520  -8.295  -25.994 1.00 76.56  ? 338  TYR A OH    1 
ATOM   1755 N N     . LYS A 1 218 ? -5.592  -6.273  -29.985 1.00 39.87  ? 339  LYS A N     1 
ATOM   1756 C CA    . LYS A 1 218 ? -5.705  -7.532  -30.687 1.00 43.03  ? 339  LYS A CA    1 
ATOM   1757 C C     . LYS A 1 218 ? -5.489  -7.337  -32.178 1.00 39.12  ? 339  LYS A C     1 
ATOM   1758 O O     . LYS A 1 218 ? -4.792  -8.120  -32.809 1.00 38.36  ? 339  LYS A O     1 
ATOM   1759 C CB    . LYS A 1 218 ? -7.055  -8.176  -30.442 1.00 50.59  ? 339  LYS A CB    1 
ATOM   1760 C CG    . LYS A 1 218 ? -7.253  -8.719  -29.023 1.00 58.81  ? 339  LYS A CG    1 
ATOM   1761 C CD    . LYS A 1 218 ? -8.538  -9.540  -28.900 1.00 66.47  ? 339  LYS A CD    1 
ATOM   1762 C CE    . LYS A 1 218 ? -9.633  -9.049  -29.865 1.00 69.75  ? 339  LYS A CE    1 
ATOM   1763 N NZ    . LYS A 1 218 ? -10.939 -9.733  -29.704 1.00 71.12  ? 339  LYS A NZ    1 
ATOM   1764 N N     . ARG A 1 219 ? -6.054  -6.273  -32.730 1.00 34.90  ? 340  ARG A N     1 
ATOM   1765 C CA    . ARG A 1 219 ? -5.933  -6.016  -34.147 1.00 36.18  ? 340  ARG A CA    1 
ATOM   1766 C C     . ARG A 1 219 ? -4.460  -5.908  -34.544 1.00 37.22  ? 340  ARG A C     1 
ATOM   1767 O O     . ARG A 1 219 ? -4.031  -6.575  -35.478 1.00 40.72  ? 340  ARG A O     1 
ATOM   1768 C CB    . ARG A 1 219 ? -6.684  -4.738  -34.537 1.00 39.67  ? 340  ARG A CB    1 
ATOM   1769 C CG    . ARG A 1 219 ? -8.181  -4.712  -34.201 1.00 40.42  ? 340  ARG A CG    1 
ATOM   1770 C CD    . ARG A 1 219 ? -9.086  -4.840  -35.417 1.00 43.71  ? 340  ARG A CD    1 
ATOM   1771 N NE    . ARG A 1 219 ? -9.927  -3.650  -35.645 1.00 47.37  ? 340  ARG A NE    1 
ATOM   1772 C CZ    . ARG A 1 219 ? -11.155 -3.464  -35.146 1.00 47.26  ? 340  ARG A CZ    1 
ATOM   1773 N NH1   . ARG A 1 219 ? -11.720 -4.376  -34.355 1.00 48.19  ? 340  ARG A NH1   1 
ATOM   1774 N NH2   . ARG A 1 219 ? -11.827 -2.353  -35.434 1.00 47.49  ? 340  ARG A NH2   1 
ATOM   1775 N N     . ILE A 1 220 ? -3.684  -5.098  -33.823 1.00 34.01  ? 341  ILE A N     1 
ATOM   1776 C CA    . ILE A 1 220 ? -2.292  -4.858  -34.172 1.00 33.26  ? 341  ILE A CA    1 
ATOM   1777 C C     . ILE A 1 220 ? -1.578  -6.156  -34.028 1.00 37.77  ? 341  ILE A C     1 
ATOM   1778 O O     . ILE A 1 220 ? -0.734  -6.534  -34.866 1.00 38.85  ? 341  ILE A O     1 
ATOM   1779 C CB    . ILE A 1 220 ? -1.615  -3.883  -33.200 1.00 33.40  ? 341  ILE A CB    1 
ATOM   1780 C CG1   . ILE A 1 220 ? -2.182  -2.474  -33.385 1.00 33.11  ? 341  ILE A CG1   1 
ATOM   1781 C CG2   . ILE A 1 220 ? -0.089  -3.885  -33.364 1.00 32.19  ? 341  ILE A CG2   1 
ATOM   1782 C CD1   . ILE A 1 220 ? -2.064  -1.604  -32.155 1.00 30.50  ? 341  ILE A CD1   1 
ATOM   1783 N N     . SER A 1 221 ? -1.927  -6.838  -32.943 1.00 41.61  ? 342  SER A N     1 
ATOM   1784 C CA    . SER A 1 221 ? -1.275  -8.076  -32.563 1.00 43.45  ? 342  SER A CA    1 
ATOM   1785 C C     . SER A 1 221 ? -1.411  -9.113  -33.668 1.00 43.67  ? 342  SER A C     1 
ATOM   1786 O O     . SER A 1 221 ? -0.430  -9.733  -34.050 1.00 44.39  ? 342  SER A O     1 
ATOM   1787 C CB    . SER A 1 221 ? -1.863  -8.596  -31.268 1.00 43.63  ? 342  SER A CB    1 
ATOM   1788 O OG    . SER A 1 221 ? -1.316  -9.858  -31.002 1.00 51.74  ? 342  SER A OG    1 
ATOM   1789 N N     . ARG A 1 222 ? -2.618  -9.244  -34.212 1.00 42.23  ? 343  ARG A N     1 
ATOM   1790 C CA    . ARG A 1 222 ? -2.866  -10.101 -35.369 1.00 42.42  ? 343  ARG A CA    1 
ATOM   1791 C C     . ARG A 1 222 ? -2.724  -9.405  -36.724 1.00 40.99  ? 343  ARG A C     1 
ATOM   1792 O O     . ARG A 1 222 ? -3.126  -9.977  -37.736 1.00 43.95  ? 343  ARG A O     1 
ATOM   1793 C CB    . ARG A 1 222 ? -4.300  -10.642 -35.328 1.00 43.75  ? 343  ARG A CB    1 
ATOM   1794 C CG    . ARG A 1 222 ? -4.710  -11.351 -34.056 1.00 44.43  ? 343  ARG A CG    1 
ATOM   1795 C CD    . ARG A 1 222 ? -6.210  -11.331 -33.986 1.00 44.91  ? 343  ARG A CD    1 
ATOM   1796 N NE    . ARG A 1 222 ? -6.706  -11.920 -32.758 1.00 51.77  ? 343  ARG A NE    1 
ATOM   1797 C CZ    . ARG A 1 222 ? -8.000  -12.020 -32.450 1.00 55.80  ? 343  ARG A CZ    1 
ATOM   1798 N NH1   . ARG A 1 222 ? -8.942  -11.583 -33.287 1.00 51.39  ? 343  ARG A NH1   1 
ATOM   1799 N NH2   . ARG A 1 222 ? -8.351  -12.577 -31.296 1.00 60.84  ? 343  ARG A NH2   1 
ATOM   1800 N N     . VAL A 1 223 ? -2.221  -8.178  -36.782 1.00 38.47  ? 344  VAL A N     1 
ATOM   1801 C CA    . VAL A 1 223 ? -2.117  -7.486  -38.077 1.00 36.26  ? 344  VAL A CA    1 
ATOM   1802 C C     . VAL A 1 223 ? -3.453  -7.567  -38.873 1.00 36.40  ? 344  VAL A C     1 
ATOM   1803 O O     . VAL A 1 223 ? -3.491  -7.889  -40.050 1.00 38.51  ? 344  VAL A O     1 
ATOM   1804 C CB    . VAL A 1 223 ? -0.908  -8.051  -38.869 1.00 34.46  ? 344  VAL A CB    1 
ATOM   1805 C CG1   . VAL A 1 223 ? -0.515  -7.170  -40.047 1.00 34.28  ? 344  VAL A CG1   1 
ATOM   1806 C CG2   . VAL A 1 223 ? 0.282   -8.176  -37.954 1.00 33.64  ? 344  VAL A CG2   1 
ATOM   1807 N N     . GLU A 1 224 ? -4.561  -7.283  -38.212 1.00 39.27  ? 345  GLU A N     1 
ATOM   1808 C CA    . GLU A 1 224 ? -5.846  -7.215  -38.871 1.00 40.30  ? 345  GLU A CA    1 
ATOM   1809 C C     . GLU A 1 224 ? -6.117  -5.800  -39.382 1.00 41.07  ? 345  GLU A C     1 
ATOM   1810 O O     . GLU A 1 224 ? -6.451  -4.866  -38.614 1.00 36.77  ? 345  GLU A O     1 
ATOM   1811 C CB    . GLU A 1 224 ? -6.967  -7.572  -37.919 1.00 45.99  ? 345  GLU A CB    1 
ATOM   1812 C CG    . GLU A 1 224 ? -6.929  -8.964  -37.334 1.00 51.12  ? 345  GLU A CG    1 
ATOM   1813 C CD    . GLU A 1 224 ? -8.244  -9.318  -36.637 1.00 60.55  ? 345  GLU A CD    1 
ATOM   1814 O OE1   . GLU A 1 224 ? -9.286  -8.648  -36.900 1.00 65.42  ? 345  GLU A OE1   1 
ATOM   1815 O OE2   . GLU A 1 224 ? -8.244  -10.274 -35.828 1.00 72.32  ? 345  GLU A OE2   1 
ATOM   1816 N N     . PHE A 1 225 ? -5.965  -5.656  -40.693 1.00 42.69  ? 346  PHE A N     1 
ATOM   1817 C CA    . PHE A 1 225 ? -6.385  -4.466  -41.401 1.00 41.04  ? 346  PHE A CA    1 
ATOM   1818 C C     . PHE A 1 225 ? -6.816  -4.802  -42.834 1.00 40.31  ? 346  PHE A C     1 
ATOM   1819 O O     . PHE A 1 225 ? -6.392  -5.795  -43.423 1.00 43.13  ? 346  PHE A O     1 
ATOM   1820 C CB    . PHE A 1 225 ? -5.249  -3.437  -41.404 1.00 39.82  ? 346  PHE A CB    1 
ATOM   1821 C CG    . PHE A 1 225 ? -4.052  -3.849  -42.211 1.00 40.21  ? 346  PHE A CG    1 
ATOM   1822 C CD1   . PHE A 1 225 ? -3.976  -3.554  -43.551 1.00 40.10  ? 346  PHE A CD1   1 
ATOM   1823 C CD2   . PHE A 1 225 ? -2.975  -4.508  -41.617 1.00 42.56  ? 346  PHE A CD2   1 
ATOM   1824 C CE1   . PHE A 1 225 ? -2.856  -3.914  -44.288 1.00 42.66  ? 346  PHE A CE1   1 
ATOM   1825 C CE2   . PHE A 1 225 ? -1.858  -4.884  -42.355 1.00 39.11  ? 346  PHE A CE2   1 
ATOM   1826 C CZ    . PHE A 1 225 ? -1.800  -4.590  -43.690 1.00 39.93  ? 346  PHE A CZ    1 
ATOM   1827 N N     . THR A 1 226 ? -7.648  -3.948  -43.398 1.00 37.00  ? 347  THR A N     1 
ATOM   1828 C CA    . THR A 1 226 ? -8.042  -4.087  -44.763 1.00 35.82  ? 347  THR A CA    1 
ATOM   1829 C C     . THR A 1 226 ? -8.008  -2.720  -45.427 1.00 37.17  ? 347  THR A C     1 
ATOM   1830 O O     . THR A 1 226 ? -8.287  -1.732  -44.798 1.00 36.26  ? 347  THR A O     1 
ATOM   1831 C CB    . THR A 1 226 ? -9.449  -4.694  -44.828 1.00 35.91  ? 347  THR A CB    1 
ATOM   1832 O OG1   . THR A 1 226 ? -10.390 -3.847  -44.143 1.00 30.85  ? 347  THR A OG1   1 
ATOM   1833 C CG2   . THR A 1 226 ? -9.435  -6.058  -44.166 1.00 37.73  ? 347  THR A CG2   1 
ATOM   1834 N N     . PHE A 1 227 ? -7.666  -2.675  -46.705 1.00 38.02  ? 348  PHE A N     1 
ATOM   1835 C CA    . PHE A 1 227 ? -7.646  -1.428  -47.435 1.00 39.16  ? 348  PHE A CA    1 
ATOM   1836 C C     . PHE A 1 227 ? -9.029  -1.128  -47.957 1.00 45.40  ? 348  PHE A C     1 
ATOM   1837 O O     . PHE A 1 227 ? -9.746  -2.072  -48.285 1.00 51.59  ? 348  PHE A O     1 
ATOM   1838 C CB    . PHE A 1 227 ? -6.750  -1.583  -48.632 1.00 36.65  ? 348  PHE A CB    1 
ATOM   1839 C CG    . PHE A 1 227 ? -5.345  -1.906  -48.284 1.00 35.25  ? 348  PHE A CG    1 
ATOM   1840 C CD1   . PHE A 1 227 ? -4.483  -0.914  -47.878 1.00 33.87  ? 348  PHE A CD1   1 
ATOM   1841 C CD2   . PHE A 1 227 ? -4.877  -3.198  -48.384 1.00 33.73  ? 348  PHE A CD2   1 
ATOM   1842 C CE1   . PHE A 1 227 ? -3.175  -1.223  -47.584 1.00 33.44  ? 348  PHE A CE1   1 
ATOM   1843 C CE2   . PHE A 1 227 ? -3.575  -3.510  -48.097 1.00 31.85  ? 348  PHE A CE2   1 
ATOM   1844 C CZ    . PHE A 1 227 ? -2.724  -2.522  -47.695 1.00 33.10  ? 348  PHE A CZ    1 
ATOM   1845 N N     . PRO A 1 228 ? -9.410  0.171   -48.071 1.00 48.32  ? 349  PRO A N     1 
ATOM   1846 C CA    . PRO A 1 228 ? -10.617 0.491   -48.859 1.00 48.84  ? 349  PRO A CA    1 
ATOM   1847 C C     . PRO A 1 228 ? -10.302 0.468   -50.329 1.00 54.06  ? 349  PRO A C     1 
ATOM   1848 O O     . PRO A 1 228 ? -9.121  0.387   -50.724 1.00 52.28  ? 349  PRO A O     1 
ATOM   1849 C CB    . PRO A 1 228 ? -11.014 1.904   -48.407 1.00 47.69  ? 349  PRO A CB    1 
ATOM   1850 C CG    . PRO A 1 228 ? -10.155 2.204   -47.228 1.00 49.83  ? 349  PRO A CG    1 
ATOM   1851 C CD    . PRO A 1 228 ? -8.911  1.356   -47.361 1.00 48.35  ? 349  PRO A CD    1 
ATOM   1852 N N     . ASP A 1 229 ? -11.353 0.531   -51.136 1.00 60.22  ? 350  ASP A N     1 
ATOM   1853 C CA    . ASP A 1 229 ? -11.215 0.250   -52.562 1.00 64.17  ? 350  ASP A CA    1 
ATOM   1854 C C     . ASP A 1 229 ? -10.240 1.176   -53.259 1.00 62.34  ? 350  ASP A C     1 
ATOM   1855 O O     . ASP A 1 229 ? -9.340  0.710   -53.961 1.00 68.92  ? 350  ASP A O     1 
ATOM   1856 C CB    . ASP A 1 229 ? -12.576 0.297   -53.254 1.00 70.87  ? 350  ASP A CB    1 
ATOM   1857 C CG    . ASP A 1 229 ? -13.391 -0.973  -53.027 1.00 78.98  ? 350  ASP A CG    1 
ATOM   1858 O OD1   . ASP A 1 229 ? -12.850 -1.937  -52.427 1.00 82.30  ? 350  ASP A OD1   1 
ATOM   1859 O OD2   . ASP A 1 229 ? -14.571 -1.004  -53.455 1.00 82.56  ? 350  ASP A OD2   1 
ATOM   1860 N N     . PHE A 1 230 ? -10.385 2.478   -53.043 1.00 57.88  ? 351  PHE A N     1 
ATOM   1861 C CA    . PHE A 1 230 ? -9.572  3.462   -53.784 1.00 56.06  ? 351  PHE A CA    1 
ATOM   1862 C C     . PHE A 1 230 ? -8.047  3.389   -53.564 1.00 53.81  ? 351  PHE A C     1 
ATOM   1863 O O     . PHE A 1 230 ? -7.305  4.154   -54.181 1.00 54.24  ? 351  PHE A O     1 
ATOM   1864 C CB    . PHE A 1 230 ? -10.073 4.878   -53.514 1.00 53.82  ? 351  PHE A CB    1 
ATOM   1865 C CG    . PHE A 1 230 ? -9.995  5.276   -52.079 1.00 57.15  ? 351  PHE A CG    1 
ATOM   1866 C CD1   . PHE A 1 230 ? -8.792  5.730   -51.535 1.00 52.40  ? 351  PHE A CD1   1 
ATOM   1867 C CD2   . PHE A 1 230 ? -11.125 5.178   -51.256 1.00 57.06  ? 351  PHE A CD2   1 
ATOM   1868 C CE1   . PHE A 1 230 ? -8.724  6.085   -50.209 1.00 49.06  ? 351  PHE A CE1   1 
ATOM   1869 C CE2   . PHE A 1 230 ? -11.056 5.536   -49.919 1.00 54.95  ? 351  PHE A CE2   1 
ATOM   1870 C CZ    . PHE A 1 230 ? -9.852  5.997   -49.403 1.00 52.02  ? 351  PHE A CZ    1 
ATOM   1871 N N     . VAL A 1 231 ? -7.576  2.481   -52.710 1.00 51.52  ? 352  VAL A N     1 
ATOM   1872 C CA    . VAL A 1 231 ? -6.139  2.290   -52.525 1.00 49.29  ? 352  VAL A CA    1 
ATOM   1873 C C     . VAL A 1 231 ? -5.587  1.348   -53.617 1.00 51.19  ? 352  VAL A C     1 
ATOM   1874 O O     . VAL A 1 231 ? -6.001  0.203   -53.736 1.00 51.95  ? 352  VAL A O     1 
ATOM   1875 C CB    . VAL A 1 231 ? -5.793  1.802   -51.086 1.00 45.70  ? 352  VAL A CB    1 
ATOM   1876 C CG1   . VAL A 1 231 ? -4.308  1.528   -50.932 1.00 44.46  ? 352  VAL A CG1   1 
ATOM   1877 C CG2   . VAL A 1 231 ? -6.184  2.845   -50.068 1.00 45.09  ? 352  VAL A CG2   1 
ATOM   1878 N N     . THR A 1 232 ? -4.620  1.859   -54.377 1.00 55.47  ? 353  THR A N     1 
ATOM   1879 C CA    . THR A 1 232 ? -4.052  1.215   -55.565 1.00 52.94  ? 353  THR A CA    1 
ATOM   1880 C C     . THR A 1 232 ? -3.166  0.028   -55.193 1.00 55.24  ? 353  THR A C     1 
ATOM   1881 O O     . THR A 1 232 ? -2.902  -0.176  -54.025 1.00 54.04  ? 353  THR A O     1 
ATOM   1882 C CB    . THR A 1 232 ? -3.226  2.246   -56.370 1.00 51.53  ? 353  THR A CB    1 
ATOM   1883 O OG1   . THR A 1 232 ? -2.139  2.739   -55.576 1.00 50.28  ? 353  THR A OG1   1 
ATOM   1884 C CG2   . THR A 1 232 ? -4.104  3.425   -56.764 1.00 48.93  ? 353  THR A CG2   1 
ATOM   1885 N N     . GLU A 1 233 ? -2.719  -0.758  -56.175 1.00 57.90  ? 354  GLU A N     1 
ATOM   1886 C CA    . GLU A 1 233 ? -1.968  -1.974  -55.872 1.00 60.02  ? 354  GLU A CA    1 
ATOM   1887 C C     . GLU A 1 233 ? -0.604  -1.637  -55.315 1.00 62.39  ? 354  GLU A C     1 
ATOM   1888 O O     . GLU A 1 233 ? -0.115  -2.312  -54.408 1.00 63.64  ? 354  GLU A O     1 
ATOM   1889 C CB    . GLU A 1 233 ? -1.776  -2.880  -57.104 1.00 66.32  ? 354  GLU A CB    1 
ATOM   1890 C CG    . GLU A 1 233 ? -1.240  -4.291  -56.751 1.00 73.29  ? 354  GLU A CG    1 
ATOM   1891 C CD    . GLU A 1 233 ? -0.020  -4.759  -57.575 1.00 75.92  ? 354  GLU A CD    1 
ATOM   1892 O OE1   . GLU A 1 233 ? 1.117   -4.254  -57.355 1.00 72.86  ? 354  GLU A OE1   1 
ATOM   1893 O OE2   . GLU A 1 233 ? -0.191  -5.672  -58.424 1.00 73.36  ? 354  GLU A OE2   1 
ATOM   1894 N N     . GLY A 1 234 ? 0.032   -0.621  -55.892 1.00 61.40  ? 355  GLY A N     1 
ATOM   1895 C CA    . GLY A 1 234 ? 1.391   -0.264  -55.497 1.00 58.77  ? 355  GLY A CA    1 
ATOM   1896 C C     . GLY A 1 234 ? 1.450   0.131   -54.032 1.00 53.58  ? 355  GLY A C     1 
ATOM   1897 O O     . GLY A 1 234 ? 2.403   -0.208  -53.323 1.00 52.95  ? 355  GLY A O     1 
ATOM   1898 N N     . ALA A 1 235 ? 0.415   0.823   -53.574 1.00 44.71  ? 356  ALA A N     1 
ATOM   1899 C CA    . ALA A 1 235 ? 0.318   1.184   -52.176 1.00 46.38  ? 356  ALA A CA    1 
ATOM   1900 C C     . ALA A 1 235 ? 0.077   -0.049  -51.319 1.00 46.88  ? 356  ALA A C     1 
ATOM   1901 O O     . ALA A 1 235 ? 0.766   -0.248  -50.313 1.00 51.83  ? 356  ALA A O     1 
ATOM   1902 C CB    . ALA A 1 235 ? -0.796  2.197   -51.957 1.00 49.10  ? 356  ALA A CB    1 
ATOM   1903 N N     . ARG A 1 236 ? -0.890  -0.877  -51.718 1.00 44.58  ? 357  ARG A N     1 
ATOM   1904 C CA    . ARG A 1 236 ? -1.230  -2.087  -50.968 1.00 44.59  ? 357  ARG A CA    1 
ATOM   1905 C C     . ARG A 1 236 ? 0.014   -2.876  -50.807 1.00 41.86  ? 357  ARG A C     1 
ATOM   1906 O O     . ARG A 1 236 ? 0.296   -3.402  -49.738 1.00 40.51  ? 357  ARG A O     1 
ATOM   1907 C CB    . ARG A 1 236 ? -2.256  -2.964  -51.695 1.00 45.60  ? 357  ARG A CB    1 
ATOM   1908 C CG    . ARG A 1 236 ? -3.675  -2.479  -51.576 1.00 45.68  ? 357  ARG A CG    1 
ATOM   1909 C CD    . ARG A 1 236 ? -4.501  -2.973  -52.740 1.00 48.52  ? 357  ARG A CD    1 
ATOM   1910 N NE    . ARG A 1 236 ? -5.841  -2.392  -52.690 1.00 48.04  ? 357  ARG A NE    1 
ATOM   1911 C CZ    . ARG A 1 236 ? -6.879  -2.970  -52.107 1.00 49.75  ? 357  ARG A CZ    1 
ATOM   1912 N NH1   . ARG A 1 236 ? -6.726  -4.166  -51.529 1.00 52.10  ? 357  ARG A NH1   1 
ATOM   1913 N NH2   . ARG A 1 236 ? -8.069  -2.358  -52.103 1.00 48.36  ? 357  ARG A NH2   1 
ATOM   1914 N N     . ASP A 1 237 ? 0.768   -2.943  -51.886 1.00 44.58  ? 358  ASP A N     1 
ATOM   1915 C CA    . ASP A 1 237 ? 1.977   -3.709  -51.858 1.00 53.81  ? 358  ASP A CA    1 
ATOM   1916 C C     . ASP A 1 237 ? 2.910   -3.177  -50.779 1.00 52.02  ? 358  ASP A C     1 
ATOM   1917 O O     . ASP A 1 237 ? 3.382   -3.934  -49.935 1.00 48.47  ? 358  ASP A O     1 
ATOM   1918 C CB    . ASP A 1 237 ? 2.688   -3.705  -53.204 1.00 57.99  ? 358  ASP A CB    1 
ATOM   1919 C CG    . ASP A 1 237 ? 3.891   -4.621  -53.196 1.00 66.15  ? 358  ASP A CG    1 
ATOM   1920 O OD1   . ASP A 1 237 ? 3.664   -5.850  -53.165 1.00 69.16  ? 358  ASP A OD1   1 
ATOM   1921 O OD2   . ASP A 1 237 ? 5.046   -4.120  -53.162 1.00 68.64  ? 358  ASP A OD2   1 
ATOM   1922 N N     . LEU A 1 238 ? 3.164   -1.874  -50.802 1.00 51.08  ? 359  LEU A N     1 
ATOM   1923 C CA    . LEU A 1 238 ? 4.160   -1.296  -49.905 1.00 50.44  ? 359  LEU A CA    1 
ATOM   1924 C C     . LEU A 1 238 ? 3.754   -1.426  -48.429 1.00 46.14  ? 359  LEU A C     1 
ATOM   1925 O O     . LEU A 1 238 ? 4.552   -1.830  -47.589 1.00 47.31  ? 359  LEU A O     1 
ATOM   1926 C CB    . LEU A 1 238 ? 4.401   0.170   -50.262 1.00 53.87  ? 359  LEU A CB    1 
ATOM   1927 C CG    . LEU A 1 238 ? 5.477   0.867   -49.418 1.00 57.80  ? 359  LEU A CG    1 
ATOM   1928 C CD1   . LEU A 1 238 ? 6.787   0.088   -49.455 1.00 58.23  ? 359  LEU A CD1   1 
ATOM   1929 C CD2   . LEU A 1 238 ? 5.682   2.298   -49.900 1.00 59.83  ? 359  LEU A CD2   1 
ATOM   1930 N N     . ILE A 1 239 ? 2.510   -1.095  -48.117 1.00 40.60  ? 360  ILE A N     1 
ATOM   1931 C CA    . ILE A 1 239 ? 2.050   -1.155  -46.744 1.00 37.75  ? 360  ILE A CA    1 
ATOM   1932 C C     . ILE A 1 239 ? 2.051   -2.597  -46.241 1.00 40.11  ? 360  ILE A C     1 
ATOM   1933 O O     . ILE A 1 239 ? 2.539   -2.889  -45.158 1.00 39.26  ? 360  ILE A O     1 
ATOM   1934 C CB    . ILE A 1 239 ? 0.653   -0.553  -46.616 1.00 33.07  ? 360  ILE A CB    1 
ATOM   1935 C CG1   . ILE A 1 239 ? 0.726   0.932   -46.865 1.00 30.00  ? 360  ILE A CG1   1 
ATOM   1936 C CG2   . ILE A 1 239 ? 0.087   -0.809  -45.229 1.00 33.68  ? 360  ILE A CG2   1 
ATOM   1937 C CD1   . ILE A 1 239 ? -0.524  1.482   -47.489 1.00 30.06  ? 360  ILE A CD1   1 
ATOM   1938 N N     . SER A 1 240 ? 1.525   -3.499  -47.049 1.00 43.30  ? 361  SER A N     1 
ATOM   1939 C CA    . SER A 1 240 ? 1.512   -4.898  -46.687 1.00 46.96  ? 361  SER A CA    1 
ATOM   1940 C C     . SER A 1 240 ? 2.911   -5.385  -46.280 1.00 45.22  ? 361  SER A C     1 
ATOM   1941 O O     . SER A 1 240 ? 3.045   -6.215  -45.377 1.00 50.01  ? 361  SER A O     1 
ATOM   1942 C CB    . SER A 1 240 ? 0.935   -5.739  -47.845 1.00 50.47  ? 361  SER A CB    1 
ATOM   1943 O OG    . SER A 1 240 ? -0.464  -5.499  -48.031 1.00 49.69  ? 361  SER A OG    1 
ATOM   1944 N N     . ARG A 1 241 ? 3.940   -4.860  -46.934 1.00 44.05  ? 362  ARG A N     1 
ATOM   1945 C CA    . ARG A 1 241 ? 5.295   -5.325  -46.727 1.00 48.12  ? 362  ARG A CA    1 
ATOM   1946 C C     . ARG A 1 241 ? 5.802   -4.728  -45.429 1.00 49.48  ? 362  ARG A C     1 
ATOM   1947 O O     . ARG A 1 241 ? 6.610   -5.340  -44.723 1.00 50.93  ? 362  ARG A O     1 
ATOM   1948 C CB    . ARG A 1 241 ? 6.219   -4.891  -47.881 1.00 55.25  ? 362  ARG A CB    1 
ATOM   1949 C CG    . ARG A 1 241 ? 5.868   -5.418  -49.274 1.00 62.88  ? 362  ARG A CG    1 
ATOM   1950 C CD    . ARG A 1 241 ? 6.712   -6.620  -49.729 1.00 73.31  ? 362  ARG A CD    1 
ATOM   1951 N NE    . ARG A 1 241 ? 8.129   -6.302  -49.971 1.00 80.27  ? 362  ARG A NE    1 
ATOM   1952 C CZ    . ARG A 1 241 ? 8.594   -5.604  -51.013 1.00 85.61  ? 362  ARG A CZ    1 
ATOM   1953 N NH1   . ARG A 1 241 ? 7.761   -5.113  -51.932 1.00 88.16  ? 362  ARG A NH1   1 
ATOM   1954 N NH2   . ARG A 1 241 ? 9.905   -5.378  -51.133 1.00 82.32  ? 362  ARG A NH2   1 
ATOM   1955 N N     . LEU A 1 242 ? 5.338   -3.515  -45.126 1.00 48.34  ? 363  LEU A N     1 
ATOM   1956 C CA    . LEU A 1 242 ? 5.815   -2.771  -43.958 1.00 42.86  ? 363  LEU A CA    1 
ATOM   1957 C C     . LEU A 1 242 ? 5.170   -3.259  -42.697 1.00 39.81  ? 363  LEU A C     1 
ATOM   1958 O O     . LEU A 1 242 ? 5.823   -3.358  -41.679 1.00 42.75  ? 363  LEU A O     1 
ATOM   1959 C CB    . LEU A 1 242 ? 5.546   -1.286  -44.114 1.00 40.29  ? 363  LEU A CB    1 
ATOM   1960 C CG    . LEU A 1 242 ? 6.478   -0.604  -45.111 1.00 38.02  ? 363  LEU A CG    1 
ATOM   1961 C CD1   . LEU A 1 242 ? 5.945   0.764   -45.511 1.00 37.61  ? 363  LEU A CD1   1 
ATOM   1962 C CD2   . LEU A 1 242 ? 7.881   -0.502  -44.558 1.00 36.77  ? 363  LEU A CD2   1 
ATOM   1963 N N     . LEU A 1 243 ? 3.896   -3.585  -42.767 1.00 38.78  ? 364  LEU A N     1 
ATOM   1964 C CA    . LEU A 1 243 ? 3.169   -4.108  -41.601 1.00 42.92  ? 364  LEU A CA    1 
ATOM   1965 C C     . LEU A 1 243 ? 3.222   -5.646  -41.440 1.00 41.61  ? 364  LEU A C     1 
ATOM   1966 O O     . LEU A 1 243 ? 2.195   -6.309  -41.397 1.00 41.64  ? 364  LEU A O     1 
ATOM   1967 C CB    . LEU A 1 243 ? 1.691   -3.663  -41.668 1.00 40.77  ? 364  LEU A CB    1 
ATOM   1968 C CG    . LEU A 1 243 ? 1.431   -2.191  -41.921 1.00 40.53  ? 364  LEU A CG    1 
ATOM   1969 C CD1   . LEU A 1 243 ? -0.052  -1.928  -41.987 1.00 42.81  ? 364  LEU A CD1   1 
ATOM   1970 C CD2   . LEU A 1 243 ? 2.076   -1.350  -40.850 1.00 41.82  ? 364  LEU A CD2   1 
ATOM   1971 N N     . LYS A 1 244 ? 4.414   -6.201  -41.326 1.00 44.11  ? 365  LYS A N     1 
ATOM   1972 C CA    . LYS A 1 244 ? 4.593   -7.653  -41.142 1.00 45.26  ? 365  LYS A CA    1 
ATOM   1973 C C     . LYS A 1 244 ? 4.779   -7.929  -39.663 1.00 43.03  ? 365  LYS A C     1 
ATOM   1974 O O     . LYS A 1 244 ? 5.504   -7.214  -38.973 1.00 47.07  ? 365  LYS A O     1 
ATOM   1975 C CB    . LYS A 1 244 ? 5.810   -8.156  -41.941 1.00 47.03  ? 365  LYS A CB    1 
ATOM   1976 C CG    . LYS A 1 244 ? 5.545   -8.391  -43.424 1.00 47.48  ? 365  LYS A CG    1 
ATOM   1977 C CD    . LYS A 1 244 ? 5.396   -9.880  -43.718 1.00 52.58  ? 365  LYS A CD    1 
ATOM   1978 C CE    . LYS A 1 244 ? 4.876   -10.175 -45.127 1.00 55.19  ? 365  LYS A CE    1 
ATOM   1979 N NZ    . LYS A 1 244 ? 5.916   -9.973  -46.186 1.00 56.31  ? 365  LYS A NZ    1 
ATOM   1980 N N     . HIS A 1 245 ? 4.124   -8.956  -39.162 1.00 43.39  ? 366  HIS A N     1 
ATOM   1981 C CA    . HIS A 1 245 ? 4.169   -9.217  -37.737 1.00 46.34  ? 366  HIS A CA    1 
ATOM   1982 C C     . HIS A 1 245 ? 5.590   -9.405  -37.255 1.00 50.32  ? 366  HIS A C     1 
ATOM   1983 O O     . HIS A 1 245 ? 5.949   -8.879  -36.198 1.00 50.17  ? 366  HIS A O     1 
ATOM   1984 C CB    . HIS A 1 245 ? 3.343   -10.443 -37.360 1.00 48.58  ? 366  HIS A CB    1 
ATOM   1985 C CG    . HIS A 1 245 ? 3.355   -10.738 -35.894 1.00 52.66  ? 366  HIS A CG    1 
ATOM   1986 N ND1   . HIS A 1 245 ? 2.319   -10.391 -35.056 1.00 56.72  ? 366  HIS A ND1   1 
ATOM   1987 C CD2   . HIS A 1 245 ? 4.293   -11.318 -35.110 1.00 54.38  ? 366  HIS A CD2   1 
ATOM   1988 C CE1   . HIS A 1 245 ? 2.611   -10.756 -33.820 1.00 55.30  ? 366  HIS A CE1   1 
ATOM   1989 N NE2   . HIS A 1 245 ? 3.809   -11.309 -33.826 1.00 54.85  ? 366  HIS A NE2   1 
ATOM   1990 N N     . ASN A 1 246 ? 6.397   -10.151 -38.015 1.00 56.81  ? 367  ASN A N     1 
ATOM   1991 C CA    . ASN A 1 246 ? 7.718   -10.558 -37.527 1.00 65.79  ? 367  ASN A CA    1 
ATOM   1992 C C     . ASN A 1 246 ? 8.794   -9.615  -38.024 1.00 60.96  ? 367  ASN A C     1 
ATOM   1993 O O     . ASN A 1 246 ? 9.139   -9.643  -39.198 1.00 68.58  ? 367  ASN A O     1 
ATOM   1994 C CB    . ASN A 1 246 ? 8.024   -12.029 -37.872 1.00 72.18  ? 367  ASN A CB    1 
ATOM   1995 C CG    . ASN A 1 246 ? 7.377   -13.011 -36.873 1.00 79.96  ? 367  ASN A CG    1 
ATOM   1996 O OD1   . ASN A 1 246 ? 7.388   -12.792 -35.642 1.00 71.43  ? 367  ASN A OD1   1 
ATOM   1997 N ND2   . ASN A 1 246 ? 6.809   -14.096 -37.401 1.00 81.76  ? 367  ASN A ND2   1 
ATOM   1998 N N     . PRO A 1 247 ? 9.339   -8.787  -37.118 1.00 57.06  ? 368  PRO A N     1 
ATOM   1999 C CA    . PRO A 1 247 ? 10.149  -7.620  -37.490 1.00 58.31  ? 368  PRO A CA    1 
ATOM   2000 C C     . PRO A 1 247 ? 11.010  -7.838  -38.730 1.00 58.72  ? 368  PRO A C     1 
ATOM   2001 O O     . PRO A 1 247 ? 11.033  -6.999  -39.642 1.00 58.67  ? 368  PRO A O     1 
ATOM   2002 C CB    . PRO A 1 247 ? 11.021  -7.381  -36.246 1.00 57.09  ? 368  PRO A CB    1 
ATOM   2003 C CG    . PRO A 1 247 ? 10.243  -7.944  -35.104 1.00 54.95  ? 368  PRO A CG    1 
ATOM   2004 C CD    . PRO A 1 247 ? 9.319   -9.001  -35.655 1.00 57.08  ? 368  PRO A CD    1 
ATOM   2005 N N     . SER A 1 248 ? 11.666  -8.991  -38.762 1.00 64.10  ? 369  SER A N     1 
ATOM   2006 C CA    . SER A 1 248 ? 12.625  -9.347  -39.798 1.00 64.62  ? 369  SER A CA    1 
ATOM   2007 C C     . SER A 1 248 ? 12.089  -9.316  -41.230 1.00 63.33  ? 369  SER A C     1 
ATOM   2008 O O     . SER A 1 248 ? 12.813  -8.956  -42.139 1.00 65.55  ? 369  SER A O     1 
ATOM   2009 C CB    . SER A 1 248 ? 13.183  -10.732 -39.498 1.00 66.05  ? 369  SER A CB    1 
ATOM   2010 O OG    . SER A 1 248 ? 14.132  -11.085 -40.469 1.00 67.94  ? 369  SER A OG    1 
ATOM   2011 N N     . GLN A 1 249 ? 10.838  -9.690  -41.453 1.00 62.23  ? 370  GLN A N     1 
ATOM   2012 C CA    . GLN A 1 249 ? 10.325  -9.695  -42.831 1.00 67.72  ? 370  GLN A CA    1 
ATOM   2013 C C     . GLN A 1 249 ? 10.065  -8.301  -43.407 1.00 63.72  ? 370  GLN A C     1 
ATOM   2014 O O     . GLN A 1 249 ? 9.795   -8.153  -44.611 1.00 58.48  ? 370  GLN A O     1 
ATOM   2015 C CB    . GLN A 1 249 ? 9.056   -10.536 -42.938 1.00 72.61  ? 370  GLN A CB    1 
ATOM   2016 C CG    . GLN A 1 249 ? 9.322   -12.028 -42.916 1.00 75.97  ? 370  GLN A CG    1 
ATOM   2017 C CD    . GLN A 1 249 ? 8.221   -12.778 -42.221 1.00 76.85  ? 370  GLN A CD    1 
ATOM   2018 O OE1   . GLN A 1 249 ? 8.435   -13.380 -41.168 1.00 84.33  ? 370  GLN A OE1   1 
ATOM   2019 N NE2   . GLN A 1 249 ? 7.018   -12.708 -42.779 1.00 78.51  ? 370  GLN A NE2   1 
ATOM   2020 N N     . ARG A 1 250 ? 10.135  -7.282  -42.554 1.00 59.40  ? 371  ARG A N     1 
ATOM   2021 C CA    . ARG A 1 250 ? 9.932   -5.919  -43.012 1.00 54.00  ? 371  ARG A CA    1 
ATOM   2022 C C     . ARG A 1 250 ? 11.146  -5.541  -43.850 1.00 52.05  ? 371  ARG A C     1 
ATOM   2023 O O     . ARG A 1 250 ? 12.275  -5.906  -43.504 1.00 49.14  ? 371  ARG A O     1 
ATOM   2024 C CB    . ARG A 1 250 ? 9.763   -4.964  -41.836 1.00 50.59  ? 371  ARG A CB    1 
ATOM   2025 C CG    . ARG A 1 250 ? 8.579   -5.321  -40.948 1.00 49.49  ? 371  ARG A CG    1 
ATOM   2026 C CD    . ARG A 1 250 ? 8.520   -4.450  -39.709 1.00 44.99  ? 371  ARG A CD    1 
ATOM   2027 N NE    . ARG A 1 250 ? 7.811   -5.134  -38.641 1.00 42.69  ? 371  ARG A NE    1 
ATOM   2028 C CZ    . ARG A 1 250 ? 7.921   -4.844  -37.342 1.00 43.87  ? 371  ARG A CZ    1 
ATOM   2029 N NH1   . ARG A 1 250 ? 8.706   -3.864  -36.925 1.00 43.53  ? 371  ARG A NH1   1 
ATOM   2030 N NH2   . ARG A 1 250 ? 7.242   -5.550  -36.447 1.00 43.92  ? 371  ARG A NH2   1 
ATOM   2031 N N     . PRO A 1 251 ? 10.920  -4.822  -44.958 1.00 51.16  ? 372  PRO A N     1 
ATOM   2032 C CA    . PRO A 1 251 ? 11.995  -4.414  -45.855 1.00 51.44  ? 372  PRO A CA    1 
ATOM   2033 C C     . PRO A 1 251 ? 13.007  -3.534  -45.161 1.00 52.28  ? 372  PRO A C     1 
ATOM   2034 O O     . PRO A 1 251 ? 13.011  -3.434  -43.943 1.00 55.46  ? 372  PRO A O     1 
ATOM   2035 C CB    . PRO A 1 251 ? 11.268  -3.622  -46.946 1.00 51.79  ? 372  PRO A CB    1 
ATOM   2036 C CG    . PRO A 1 251 ? 9.999   -3.172  -46.327 1.00 51.75  ? 372  PRO A CG    1 
ATOM   2037 C CD    . PRO A 1 251 ? 9.625   -4.231  -45.341 1.00 53.16  ? 372  PRO A CD    1 
ATOM   2038 N N     . MET A 1 252 ? 13.879  -2.913  -45.931 1.00 55.34  ? 373  MET A N     1 
ATOM   2039 C CA    . MET A 1 252 ? 14.835  -1.976  -45.379 1.00 57.03  ? 373  MET A CA    1 
ATOM   2040 C C     . MET A 1 252 ? 14.489  -0.639  -45.994 1.00 57.21  ? 373  MET A C     1 
ATOM   2041 O O     . MET A 1 252 ? 13.714  -0.565  -46.962 1.00 56.09  ? 373  MET A O     1 
ATOM   2042 C CB    . MET A 1 252 ? 16.258  -2.391  -45.731 1.00 61.85  ? 373  MET A CB    1 
ATOM   2043 C CG    . MET A 1 252 ? 16.479  -3.898  -45.829 1.00 65.68  ? 373  MET A CG    1 
ATOM   2044 S SD    . MET A 1 252 ? 18.192  -4.353  -46.197 1.00 77.06  ? 373  MET A SD    1 
ATOM   2045 C CE    . MET A 1 252 ? 18.484  -3.624  -47.821 1.00 79.18  ? 373  MET A CE    1 
ATOM   2046 N N     . LEU A 1 253 ? 15.048  0.422   -45.435 1.00 57.58  ? 374  LEU A N     1 
ATOM   2047 C CA    . LEU A 1 253 ? 14.720  1.774   -45.902 1.00 56.73  ? 374  LEU A CA    1 
ATOM   2048 C C     . LEU A 1 253 ? 15.170  1.937   -47.352 1.00 56.86  ? 374  LEU A C     1 
ATOM   2049 O O     . LEU A 1 253 ? 14.489  2.561   -48.186 1.00 48.17  ? 374  LEU A O     1 
ATOM   2050 C CB    . LEU A 1 253 ? 15.329  2.821   -44.955 1.00 56.82  ? 374  LEU A CB    1 
ATOM   2051 C CG    . LEU A 1 253 ? 14.643  2.754   -43.565 1.00 58.28  ? 374  LEU A CG    1 
ATOM   2052 C CD1   . LEU A 1 253 ? 15.470  3.381   -42.457 1.00 58.19  ? 374  LEU A CD1   1 
ATOM   2053 C CD2   . LEU A 1 253 ? 13.248  3.372   -43.606 1.00 54.26  ? 374  LEU A CD2   1 
ATOM   2054 N N     . ARG A 1 254 ? 16.289  1.285   -47.644 1.00 62.90  ? 375  ARG A N     1 
ATOM   2055 C CA    . ARG A 1 254 ? 16.851  1.223   -48.981 1.00 67.30  ? 375  ARG A CA    1 
ATOM   2056 C C     . ARG A 1 254 ? 15.788  0.682   -49.954 1.00 68.65  ? 375  ARG A C     1 
ATOM   2057 O O     . ARG A 1 254 ? 15.571  1.275   -51.019 1.00 67.81  ? 375  ARG A O     1 
ATOM   2058 C CB    . ARG A 1 254 ? 18.181  0.425   -49.014 1.00 72.44  ? 375  ARG A CB    1 
ATOM   2059 C CG    . ARG A 1 254 ? 18.663  -0.191  -47.684 1.00 78.95  ? 375  ARG A CG    1 
ATOM   2060 C CD    . ARG A 1 254 ? 19.007  0.827   -46.562 1.00 79.45  ? 375  ARG A CD    1 
ATOM   2061 N NE    . ARG A 1 254 ? 18.513  0.418   -45.227 1.00 80.00  ? 375  ARG A NE    1 
ATOM   2062 C CZ    . ARG A 1 254 ? 18.690  1.106   -44.088 1.00 84.79  ? 375  ARG A CZ    1 
ATOM   2063 N NH1   . ARG A 1 254 ? 19.365  2.257   -44.078 1.00 87.90  ? 375  ARG A NH1   1 
ATOM   2064 N NH2   . ARG A 1 254 ? 18.193  0.644   -42.938 1.00 76.73  ? 375  ARG A NH2   1 
ATOM   2065 N N     . GLU A 1 255 ? 15.083  -0.388  -49.562 1.00 67.10  ? 376  GLU A N     1 
ATOM   2066 C CA    . GLU A 1 255 ? 14.006  -0.957  -50.397 1.00 61.26  ? 376  GLU A CA    1 
ATOM   2067 C C     . GLU A 1 255 ? 12.759  -0.082  -50.441 1.00 61.10  ? 376  GLU A C     1 
ATOM   2068 O O     . GLU A 1 255 ? 11.999  -0.183  -51.408 1.00 64.90  ? 376  GLU A O     1 
ATOM   2069 C CB    . GLU A 1 255 ? 13.558  -2.347  -49.927 1.00 66.36  ? 376  GLU A CB    1 
ATOM   2070 C CG    . GLU A 1 255 ? 14.620  -3.441  -49.763 1.00 67.73  ? 376  GLU A CG    1 
ATOM   2071 C CD    . GLU A 1 255 ? 14.019  -4.782  -49.312 1.00 69.16  ? 376  GLU A CD    1 
ATOM   2072 O OE1   . GLU A 1 255 ? 12.883  -5.126  -49.756 1.00 71.56  ? 376  GLU A OE1   1 
ATOM   2073 O OE2   . GLU A 1 255 ? 14.675  -5.500  -48.513 1.00 64.14  ? 376  GLU A OE2   1 
ATOM   2074 N N     . VAL A 1 256 ? 12.516  0.743   -49.409 1.00 58.34  ? 377  VAL A N     1 
ATOM   2075 C CA    . VAL A 1 256 ? 11.354  1.675   -49.432 1.00 58.24  ? 377  VAL A CA    1 
ATOM   2076 C C     . VAL A 1 256 ? 11.623  2.858   -50.388 1.00 61.07  ? 377  VAL A C     1 
ATOM   2077 O O     . VAL A 1 256 ? 10.706  3.351   -51.067 1.00 55.79  ? 377  VAL A O     1 
ATOM   2078 C CB    . VAL A 1 256 ? 10.934  2.212   -48.020 1.00 55.01  ? 377  VAL A CB    1 
ATOM   2079 C CG1   . VAL A 1 256 ? 9.606   2.948   -48.083 1.00 51.00  ? 377  VAL A CG1   1 
ATOM   2080 C CG2   . VAL A 1 256 ? 10.813  1.090   -47.010 1.00 56.91  ? 377  VAL A CG2   1 
ATOM   2081 N N     . LEU A 1 257 ? 12.873  3.319   -50.437 1.00 65.91  ? 378  LEU A N     1 
ATOM   2082 C CA    . LEU A 1 257 ? 13.260  4.362   -51.402 1.00 69.24  ? 378  LEU A CA    1 
ATOM   2083 C C     . LEU A 1 257 ? 13.147  3.842   -52.835 1.00 70.62  ? 378  LEU A C     1 
ATOM   2084 O O     . LEU A 1 257 ? 12.590  4.515   -53.712 1.00 71.48  ? 378  LEU A O     1 
ATOM   2085 C CB    . LEU A 1 257 ? 14.682  4.863   -51.134 1.00 67.22  ? 378  LEU A CB    1 
ATOM   2086 C CG    . LEU A 1 257 ? 14.851  6.054   -50.181 1.00 68.70  ? 378  LEU A CG    1 
ATOM   2087 C CD1   . LEU A 1 257 ? 13.964  5.965   -48.955 1.00 65.64  ? 378  LEU A CD1   1 
ATOM   2088 C CD2   . LEU A 1 257 ? 16.313  6.175   -49.769 1.00 74.66  ? 378  LEU A CD2   1 
ATOM   2089 N N     . GLU A 1 258 ? 13.661  2.637   -53.059 1.00 69.00  ? 379  GLU A N     1 
ATOM   2090 C CA    . GLU A 1 258 ? 13.657  2.047   -54.387 1.00 73.32  ? 379  GLU A CA    1 
ATOM   2091 C C     . GLU A 1 258 ? 12.244  1.632   -54.860 1.00 71.27  ? 379  GLU A C     1 
ATOM   2092 O O     . GLU A 1 258 ? 11.975  1.631   -56.055 1.00 78.27  ? 379  GLU A O     1 
ATOM   2093 C CB    . GLU A 1 258 ? 14.649  0.869   -54.445 1.00 78.80  ? 379  GLU A CB    1 
ATOM   2094 C CG    . GLU A 1 258 ? 16.130  1.290   -54.397 1.00 81.37  ? 379  GLU A CG    1 
ATOM   2095 C CD    . GLU A 1 258 ? 17.076  0.213   -53.840 1.00 87.11  ? 379  GLU A CD    1 
ATOM   2096 O OE1   . GLU A 1 258 ? 16.630  -0.935  -53.599 1.00 87.54  ? 379  GLU A OE1   1 
ATOM   2097 O OE2   . GLU A 1 258 ? 18.279  0.511   -53.628 1.00 86.70  ? 379  GLU A OE2   1 
ATOM   2098 N N     . HIS A 1 259 ? 11.344  1.310   -53.935 1.00 66.06  ? 380  HIS A N     1 
ATOM   2099 C CA    . HIS A 1 259 ? 10.012  0.766   -54.280 1.00 63.69  ? 380  HIS A CA    1 
ATOM   2100 C C     . HIS A 1 259 ? 9.328   1.477   -55.463 1.00 60.98  ? 380  HIS A C     1 
ATOM   2101 O O     . HIS A 1 259 ? 9.396   2.691   -55.579 1.00 64.81  ? 380  HIS A O     1 
ATOM   2102 C CB    . HIS A 1 259 ? 9.092   0.809   -53.054 1.00 62.13  ? 380  HIS A CB    1 
ATOM   2103 C CG    . HIS A 1 259 ? 7.871   -0.045  -53.172 1.00 57.15  ? 380  HIS A CG    1 
ATOM   2104 N ND1   . HIS A 1 259 ? 6.726   0.383   -53.804 1.00 56.85  ? 380  HIS A ND1   1 
ATOM   2105 C CD2   . HIS A 1 259 ? 7.606   -1.295  -52.726 1.00 56.90  ? 380  HIS A CD2   1 
ATOM   2106 C CE1   . HIS A 1 259 ? 5.804   -0.560  -53.738 1.00 53.05  ? 380  HIS A CE1   1 
ATOM   2107 N NE2   . HIS A 1 259 ? 6.313   -1.592  -53.091 1.00 54.66  ? 380  HIS A NE2   1 
ATOM   2108 N N     . PRO A 1 260 ? 8.674   0.714   -56.352 1.00 60.19  ? 381  PRO A N     1 
ATOM   2109 C CA    . PRO A 1 260 ? 8.078   1.292   -57.564 1.00 56.18  ? 381  PRO A CA    1 
ATOM   2110 C C     . PRO A 1 260 ? 7.038   2.356   -57.306 1.00 54.42  ? 381  PRO A C     1 
ATOM   2111 O O     . PRO A 1 260 ? 7.122   3.443   -57.879 1.00 57.30  ? 381  PRO A O     1 
ATOM   2112 C CB    . PRO A 1 260 ? 7.413   0.092   -58.241 1.00 57.65  ? 381  PRO A CB    1 
ATOM   2113 C CG    . PRO A 1 260 ? 8.184   -1.079  -57.770 1.00 59.60  ? 381  PRO A CG    1 
ATOM   2114 C CD    . PRO A 1 260 ? 8.687   -0.761  -56.395 1.00 60.37  ? 381  PRO A CD    1 
ATOM   2115 N N     . TRP A 1 261 ? 6.048   2.028   -56.482 1.00 52.66  ? 382  TRP A N     1 
ATOM   2116 C CA    . TRP A 1 261 ? 4.971   2.965   -56.143 1.00 49.71  ? 382  TRP A CA    1 
ATOM   2117 C C     . TRP A 1 261 ? 5.509   4.310   -55.625 1.00 51.25  ? 382  TRP A C     1 
ATOM   2118 O O     . TRP A 1 261 ? 4.967   5.371   -55.978 1.00 51.08  ? 382  TRP A O     1 
ATOM   2119 C CB    . TRP A 1 261 ? 3.984   2.345   -55.131 1.00 45.55  ? 382  TRP A CB    1 
ATOM   2120 C CG    . TRP A 1 261 ? 2.880   3.286   -54.766 1.00 45.70  ? 382  TRP A CG    1 
ATOM   2121 C CD1   . TRP A 1 261 ? 1.769   3.573   -55.504 1.00 45.84  ? 382  TRP A CD1   1 
ATOM   2122 C CD2   . TRP A 1 261 ? 2.805   4.108   -53.591 1.00 43.01  ? 382  TRP A CD2   1 
ATOM   2123 N NE1   . TRP A 1 261 ? 0.995   4.511   -54.849 1.00 44.14  ? 382  TRP A NE1   1 
ATOM   2124 C CE2   . TRP A 1 261 ? 1.617   4.856   -53.678 1.00 44.16  ? 382  TRP A CE2   1 
ATOM   2125 C CE3   . TRP A 1 261 ? 3.625   4.270   -52.469 1.00 42.78  ? 382  TRP A CE3   1 
ATOM   2126 C CZ2   . TRP A 1 261 ? 1.229   5.759   -52.686 1.00 47.66  ? 382  TRP A CZ2   1 
ATOM   2127 C CZ3   . TRP A 1 261 ? 3.251   5.156   -51.492 1.00 44.23  ? 382  TRP A CZ3   1 
ATOM   2128 C CH2   . TRP A 1 261 ? 2.061   5.901   -51.604 1.00 46.96  ? 382  TRP A CH2   1 
ATOM   2129 N N     . ILE A 1 262 ? 6.576   4.265   -54.818 1.00 48.14  ? 383  ILE A N     1 
ATOM   2130 C CA    . ILE A 1 262 ? 7.223   5.490   -54.311 1.00 49.34  ? 383  ILE A CA    1 
ATOM   2131 C C     . ILE A 1 262 ? 7.847   6.320   -55.434 1.00 51.96  ? 383  ILE A C     1 
ATOM   2132 O O     . ILE A 1 262 ? 7.444   7.461   -55.677 1.00 57.28  ? 383  ILE A O     1 
ATOM   2133 C CB    . ILE A 1 262 ? 8.312   5.175   -53.252 1.00 46.11  ? 383  ILE A CB    1 
ATOM   2134 C CG1   . ILE A 1 262 ? 7.675   4.638   -51.977 1.00 46.38  ? 383  ILE A CG1   1 
ATOM   2135 C CG2   . ILE A 1 262 ? 9.138   6.404   -52.924 1.00 45.66  ? 383  ILE A CG2   1 
ATOM   2136 C CD1   . ILE A 1 262 ? 6.749   5.608   -51.282 1.00 45.93  ? 383  ILE A CD1   1 
ATOM   2137 N N     . THR A 1 263 ? 8.840   5.752   -56.106 1.00 54.47  ? 384  THR A N     1 
ATOM   2138 C CA    . THR A 1 263 ? 9.537   6.466   -57.166 1.00 54.74  ? 384  THR A CA    1 
ATOM   2139 C C     . THR A 1 263 ? 8.488   7.066   -58.094 1.00 52.41  ? 384  THR A C     1 
ATOM   2140 O O     . THR A 1 263 ? 8.507   8.266   -58.356 1.00 51.38  ? 384  THR A O     1 
ATOM   2141 C CB    . THR A 1 263 ? 10.507  5.545   -57.917 1.00 53.94  ? 384  THR A CB    1 
ATOM   2142 O OG1   . THR A 1 263 ? 9.808   4.375   -58.339 1.00 57.69  ? 384  THR A OG1   1 
ATOM   2143 C CG2   . THR A 1 263 ? 11.647  5.120   -57.003 1.00 53.84  ? 384  THR A CG2   1 
ATOM   2144 N N     . ALA A 1 264 ? 7.528   6.254   -58.513 1.00 50.17  ? 385  ALA A N     1 
ATOM   2145 C CA    . ALA A 1 264 ? 6.433   6.734   -59.389 1.00 57.43  ? 385  ALA A CA    1 
ATOM   2146 C C     . ALA A 1 264 ? 5.680   8.010   -58.954 1.00 56.02  ? 385  ALA A C     1 
ATOM   2147 O O     . ALA A 1 264 ? 5.296   8.776   -59.818 1.00 55.76  ? 385  ALA A O     1 
ATOM   2148 C CB    . ALA A 1 264 ? 5.416   5.618   -59.634 1.00 60.83  ? 385  ALA A CB    1 
ATOM   2149 N N     . ASN A 1 265 ? 5.439   8.226   -57.652 1.00 55.93  ? 386  ASN A N     1 
ATOM   2150 C CA    . ASN A 1 265 ? 4.660   9.406   -57.182 1.00 53.96  ? 386  ASN A CA    1 
ATOM   2151 C C     . ASN A 1 265 ? 5.455   10.452  -56.394 1.00 58.22  ? 386  ASN A C     1 
ATOM   2152 O O     . ASN A 1 265 ? 4.952   11.567  -56.144 1.00 58.37  ? 386  ASN A O     1 
ATOM   2153 C CB    . ASN A 1 265 ? 3.480   8.966   -56.318 1.00 53.68  ? 386  ASN A CB    1 
ATOM   2154 C CG    . ASN A 1 265 ? 2.504   8.092   -57.067 1.00 54.15  ? 386  ASN A CG    1 
ATOM   2155 O OD1   . ASN A 1 265 ? 1.720   8.576   -57.879 1.00 57.75  ? 386  ASN A OD1   1 
ATOM   2156 N ND2   . ASN A 1 265 ? 2.554   6.792   -56.806 1.00 52.97  ? 386  ASN A ND2   1 
ATOM   2157 N N     . SER A 1 266 ? 6.676   10.094  -55.989 1.00 60.33  ? 387  SER A N     1 
ATOM   2158 C CA    . SER A 1 266 ? 7.521   10.998  -55.213 1.00 64.62  ? 387  SER A CA    1 
ATOM   2159 C C     . SER A 1 266 ? 7.965   12.184  -56.060 1.00 66.86  ? 387  SER A C     1 
ATOM   2160 O O     . SER A 1 266 ? 8.556   11.998  -57.112 1.00 73.33  ? 387  SER A O     1 
ATOM   2161 C CB    . SER A 1 266 ? 8.758   10.268  -54.680 1.00 65.51  ? 387  SER A CB    1 
ATOM   2162 O OG    . SER A 1 266 ? 9.709   11.188  -54.151 1.00 64.53  ? 387  SER A OG    1 
ATOM   2163 N N     . SER A 1 267 ? 7.686   13.397  -55.591 1.00 67.01  ? 388  SER A N     1 
ATOM   2164 C CA    . SER A 1 267 ? 8.114   14.605  -56.284 1.00 64.66  ? 388  SER A CA    1 
ATOM   2165 C C     . SER A 1 267 ? 9.379   15.190  -55.637 1.00 63.77  ? 388  SER A C     1 
ATOM   2166 O O     . SER A 1 267 ? 10.220  14.453  -55.116 1.00 60.81  ? 388  SER A O     1 
ATOM   2167 C CB    . SER A 1 267 ? 6.969   15.631  -56.311 1.00 62.07  ? 388  SER A CB    1 
ATOM   2168 O OG    . SER A 1 267 ? 6.692   16.148  -55.025 1.00 58.25  ? 388  SER A OG    1 
ATOM   2169 N N     . SER B 2 6   ? 17.928  17.064  -11.929 1.00 59.84  ? 6    SER B N     1 
ATOM   2170 C CA    . SER B 2 6   ? 17.923  18.052  -10.824 1.00 62.81  ? 6    SER B CA    1 
ATOM   2171 C C     . SER B 2 6   ? 18.997  19.123  -11.097 1.00 63.17  ? 6    SER B C     1 
ATOM   2172 O O     . SER B 2 6   ? 18.836  20.294  -10.675 1.00 62.05  ? 6    SER B O     1 
ATOM   2173 C CB    . SER B 2 6   ? 18.119  17.342  -9.463  1.00 67.10  ? 6    SER B CB    1 
ATOM   2174 O OG    . SER B 2 6   ? 17.549  18.069  -8.371  1.00 67.43  ? 6    SER B OG    1 
ATOM   2175 N N     . SER B 2 7   ? 20.060  18.758  -11.828 1.00 53.75  ? 7    SER B N     1 
ATOM   2176 C CA    . SER B 2 7   ? 21.100  19.754  -12.186 1.00 56.16  ? 7    SER B CA    1 
ATOM   2177 C C     . SER B 2 7   ? 20.983  20.385  -13.599 1.00 55.50  ? 7    SER B C     1 
ATOM   2178 O O     . SER B 2 7   ? 21.635  21.400  -13.902 1.00 51.65  ? 7    SER B O     1 
ATOM   2179 C CB    . SER B 2 7   ? 22.488  19.149  -12.044 1.00 59.05  ? 7    SER B CB    1 
ATOM   2180 O OG    . SER B 2 7   ? 23.458  20.180  -12.090 1.00 59.52  ? 7    SER B OG    1 
ATOM   2181 N N     . TYR B 2 8   ? 20.185  19.755  -14.460 1.00 52.29  ? 8    TYR B N     1 
ATOM   2182 C CA    . TYR B 2 8   ? 19.913  20.243  -15.815 1.00 47.16  ? 8    TYR B CA    1 
ATOM   2183 C C     . TYR B 2 8   ? 21.165  20.484  -16.661 1.00 43.80  ? 8    TYR B C     1 
ATOM   2184 O O     . TYR B 2 8   ? 21.160  21.363  -17.513 1.00 43.74  ? 8    TYR B O     1 
ATOM   2185 C CB    . TYR B 2 8   ? 18.992  21.479  -15.756 1.00 45.79  ? 8    TYR B CB    1 
ATOM   2186 C CG    . TYR B 2 8   ? 17.654  21.136  -15.143 1.00 40.81  ? 8    TYR B CG    1 
ATOM   2187 C CD1   . TYR B 2 8   ? 16.622  20.638  -15.914 1.00 36.75  ? 8    TYR B CD1   1 
ATOM   2188 C CD2   . TYR B 2 8   ? 17.444  21.251  -13.774 1.00 40.57  ? 8    TYR B CD2   1 
ATOM   2189 C CE1   . TYR B 2 8   ? 15.413  20.292  -15.344 1.00 35.26  ? 8    TYR B CE1   1 
ATOM   2190 C CE2   . TYR B 2 8   ? 16.228  20.910  -13.198 1.00 37.23  ? 8    TYR B CE2   1 
ATOM   2191 C CZ    . TYR B 2 8   ? 15.227  20.428  -13.983 1.00 35.56  ? 8    TYR B CZ    1 
ATOM   2192 O OH    . TYR B 2 8   ? 14.024  20.093  -13.404 1.00 38.00  ? 8    TYR B OH    1 
ATOM   2193 N N     . SER B 2 9   ? 22.222  19.697  -16.431 1.00 44.04  ? 9    SER B N     1 
ATOM   2194 C CA    . SER B 2 9   ? 23.376  19.632  -17.360 1.00 45.37  ? 9    SER B CA    1 
ATOM   2195 C C     . SER B 2 9   ? 23.240  18.504  -18.377 1.00 42.75  ? 9    SER B C     1 
ATOM   2196 O O     . SER B 2 9   ? 23.316  17.347  -18.012 1.00 44.77  ? 9    SER B O     1 
ATOM   2197 C CB    . SER B 2 9   ? 24.674  19.479  -16.601 1.00 45.77  ? 9    SER B CB    1 
ATOM   2198 O OG    . SER B 2 9   ? 24.863  20.649  -15.817 1.00 52.75  ? 9    SER B OG    1 
ATOM   2199 N N     . TYR B 2 10  ? 22.999  18.845  -19.642 1.00 39.49  ? 10   TYR B N     1 
ATOM   2200 C CA    . TYR B 2 10  ? 22.850  17.848  -20.675 1.00 39.28  ? 10   TYR B CA    1 
ATOM   2201 C C     . TYR B 2 10  ? 24.070  17.960  -21.516 1.00 41.25  ? 10   TYR B C     1 
ATOM   2202 O O     . TYR B 2 10  ? 24.521  19.053  -21.782 1.00 47.96  ? 10   TYR B O     1 
ATOM   2203 C CB    . TYR B 2 10  ? 21.653  18.116  -21.567 1.00 37.51  ? 10   TYR B CB    1 
ATOM   2204 C CG    . TYR B 2 10  ? 20.340  18.349  -20.860 1.00 39.15  ? 10   TYR B CG    1 
ATOM   2205 C CD1   . TYR B 2 10  ? 20.096  17.860  -19.576 1.00 40.45  ? 10   TYR B CD1   1 
ATOM   2206 C CD2   . TYR B 2 10  ? 19.321  19.039  -21.491 1.00 40.61  ? 10   TYR B CD2   1 
ATOM   2207 C CE1   . TYR B 2 10  ? 18.882  18.066  -18.944 1.00 39.66  ? 10   TYR B CE1   1 
ATOM   2208 C CE2   . TYR B 2 10  ? 18.104  19.257  -20.865 1.00 41.66  ? 10   TYR B CE2   1 
ATOM   2209 C CZ    . TYR B 2 10  ? 17.884  18.761  -19.601 1.00 41.89  ? 10   TYR B CZ    1 
ATOM   2210 O OH    . TYR B 2 10  ? 16.666  18.994  -19.005 1.00 42.99  ? 10   TYR B OH    1 
ATOM   2211 N N     . ASP B 2 11  ? 24.606  16.835  -21.951 1.00 44.38  ? 11   ASP B N     1 
ATOM   2212 C CA    . ASP B 2 11  ? 25.663  16.831  -22.944 1.00 46.93  ? 11   ASP B CA    1 
ATOM   2213 C C     . ASP B 2 11  ? 25.043  17.298  -24.248 1.00 43.40  ? 11   ASP B C     1 
ATOM   2214 O O     . ASP B 2 11  ? 24.950  16.532  -25.214 1.00 43.65  ? 11   ASP B O     1 
ATOM   2215 C CB    . ASP B 2 11  ? 26.254  15.425  -23.101 1.00 52.46  ? 11   ASP B CB    1 
ATOM   2216 C CG    . ASP B 2 11  ? 26.875  14.897  -21.811 1.00 56.60  ? 11   ASP B CG    1 
ATOM   2217 O OD1   . ASP B 2 11  ? 27.311  15.724  -20.971 1.00 60.65  ? 11   ASP B OD1   1 
ATOM   2218 O OD2   . ASP B 2 11  ? 26.930  13.648  -21.647 1.00 60.73  ? 11   ASP B OD2   1 
ATOM   2219 N N     . ALA B 2 12  ? 24.597  18.558  -24.249 1.00 38.25  ? 12   ALA B N     1 
ATOM   2220 C CA    . ALA B 2 12  ? 23.995  19.191  -25.424 1.00 35.50  ? 12   ALA B CA    1 
ATOM   2221 C C     . ALA B 2 12  ? 24.442  20.661  -25.517 1.00 32.38  ? 12   ALA B C     1 
ATOM   2222 O O     . ALA B 2 12  ? 24.833  21.237  -24.531 1.00 29.59  ? 12   ALA B O     1 
ATOM   2223 C CB    . ALA B 2 12  ? 22.487  19.081  -25.345 1.00 34.70  ? 12   ALA B CB    1 
ATOM   2224 N N     . PRO B 2 13  ? 24.374  21.269  -26.702 1.00 32.81  ? 13   PRO B N     1 
ATOM   2225 C CA    . PRO B 2 13  ? 24.949  22.629  -26.870 1.00 32.85  ? 13   PRO B CA    1 
ATOM   2226 C C     . PRO B 2 13  ? 24.245  23.716  -26.082 1.00 36.87  ? 13   PRO B C     1 
ATOM   2227 O O     . PRO B 2 13  ? 23.026  23.844  -26.165 1.00 34.56  ? 13   PRO B O     1 
ATOM   2228 C CB    . PRO B 2 13  ? 24.810  22.919  -28.358 1.00 30.55  ? 13   PRO B CB    1 
ATOM   2229 C CG    . PRO B 2 13  ? 24.440  21.626  -28.994 1.00 32.93  ? 13   PRO B CG    1 
ATOM   2230 C CD    . PRO B 2 13  ? 23.835  20.719  -27.957 1.00 32.86  ? 13   PRO B CD    1 
ATOM   2231 N N     . SER B 2 14  ? 25.027  24.490  -25.332 1.00 39.58  ? 14   SER B N     1 
ATOM   2232 C CA    . SER B 2 14  ? 24.517  25.574  -24.521 1.00 40.96  ? 14   SER B CA    1 
ATOM   2233 C C     . SER B 2 14  ? 25.063  26.910  -24.995 1.00 43.80  ? 14   SER B C     1 
ATOM   2234 O O     . SER B 2 14  ? 24.712  27.938  -24.442 1.00 46.38  ? 14   SER B O     1 
ATOM   2235 C CB    . SER B 2 14  ? 24.945  25.360  -23.062 1.00 42.65  ? 14   SER B CB    1 
ATOM   2236 O OG    . SER B 2 14  ? 23.842  25.026  -22.252 1.00 47.55  ? 14   SER B OG    1 
ATOM   2237 N N     . ASP B 2 15  ? 25.934  26.912  -26.001 1.00 47.71  ? 15   ASP B N     1 
ATOM   2238 C CA    . ASP B 2 15  ? 26.636  28.141  -26.401 1.00 49.54  ? 15   ASP B CA    1 
ATOM   2239 C C     . ASP B 2 15  ? 25.916  28.970  -27.465 1.00 49.35  ? 15   ASP B C     1 
ATOM   2240 O O     . ASP B 2 15  ? 25.316  28.425  -28.383 1.00 51.93  ? 15   ASP B O     1 
ATOM   2241 C CB    . ASP B 2 15  ? 28.070  27.847  -26.851 1.00 56.91  ? 15   ASP B CB    1 
ATOM   2242 C CG    . ASP B 2 15  ? 28.226  26.493  -27.521 1.00 70.65  ? 15   ASP B CG    1 
ATOM   2243 O OD1   . ASP B 2 15  ? 27.229  25.972  -28.073 1.00 85.96  ? 15   ASP B OD1   1 
ATOM   2244 O OD2   . ASP B 2 15  ? 29.354  25.942  -27.487 1.00 80.61  ? 15   ASP B OD2   1 
ATOM   2245 N N     . PHE B 2 16  ? 25.993  30.296  -27.317 1.00 49.10  ? 16   PHE B N     1 
ATOM   2246 C CA    . PHE B 2 16  ? 25.482  31.257  -28.287 1.00 47.81  ? 16   PHE B CA    1 
ATOM   2247 C C     . PHE B 2 16  ? 25.929  30.920  -29.703 1.00 47.72  ? 16   PHE B C     1 
ATOM   2248 O O     . PHE B 2 16  ? 27.046  30.475  -29.927 1.00 41.61  ? 16   PHE B O     1 
ATOM   2249 C CB    . PHE B 2 16  ? 25.967  32.665  -27.933 1.00 50.11  ? 16   PHE B CB    1 
ATOM   2250 C CG    . PHE B 2 16  ? 25.422  33.752  -28.838 1.00 50.51  ? 16   PHE B CG    1 
ATOM   2251 C CD1   . PHE B 2 16  ? 24.194  34.340  -28.578 1.00 51.77  ? 16   PHE B CD1   1 
ATOM   2252 C CD2   . PHE B 2 16  ? 26.152  34.202  -29.940 1.00 50.43  ? 16   PHE B CD2   1 
ATOM   2253 C CE1   . PHE B 2 16  ? 23.698  35.341  -29.411 1.00 52.96  ? 16   PHE B CE1   1 
ATOM   2254 C CE2   . PHE B 2 16  ? 25.668  35.203  -30.769 1.00 48.07  ? 16   PHE B CE2   1 
ATOM   2255 C CZ    . PHE B 2 16  ? 24.440  35.771  -30.507 1.00 50.05  ? 16   PHE B CZ    1 
ATOM   2256 N N     . ILE B 2 17  ? 25.041  31.122  -30.662 1.00 49.31  ? 17   ILE B N     1 
ATOM   2257 C CA    . ILE B 2 17  ? 25.368  30.838  -32.048 1.00 51.11  ? 17   ILE B CA    1 
ATOM   2258 C C     . ILE B 2 17  ? 25.216  32.114  -32.833 1.00 48.83  ? 17   ILE B C     1 
ATOM   2259 O O     . ILE B 2 17  ? 24.230  32.829  -32.704 1.00 43.81  ? 17   ILE B O     1 
ATOM   2260 C CB    . ILE B 2 17  ? 24.463  29.733  -32.655 1.00 54.47  ? 17   ILE B CB    1 
ATOM   2261 C CG1   . ILE B 2 17  ? 24.798  28.370  -32.021 1.00 52.26  ? 17   ILE B CG1   1 
ATOM   2262 C CG2   . ILE B 2 17  ? 24.628  29.661  -34.180 1.00 53.17  ? 17   ILE B CG2   1 
ATOM   2263 C CD1   . ILE B 2 17  ? 23.877  27.242  -32.445 1.00 51.54  ? 17   ILE B CD1   1 
ATOM   2264 N N     . ASN B 2 18  ? 26.225  32.408  -33.625 1.00 48.75  ? 18   ASN B N     1 
ATOM   2265 C CA    . ASN B 2 18  ? 26.099  33.439  -34.597 1.00 53.37  ? 18   ASN B CA    1 
ATOM   2266 C C     . ASN B 2 18  ? 25.314  32.818  -35.754 1.00 55.12  ? 18   ASN B C     1 
ATOM   2267 O O     . ASN B 2 18  ? 25.827  31.952  -36.457 1.00 58.23  ? 18   ASN B O     1 
ATOM   2268 C CB    . ASN B 2 18  ? 27.485  33.909  -35.007 1.00 58.38  ? 18   ASN B CB    1 
ATOM   2269 C CG    . ASN B 2 18  ? 27.444  34.939  -36.113 1.00 70.25  ? 18   ASN B CG    1 
ATOM   2270 O OD1   . ASN B 2 18  ? 26.366  35.457  -36.481 1.00 72.04  ? 18   ASN B OD1   1 
ATOM   2271 N ND2   . ASN B 2 18  ? 28.623  35.244  -36.668 1.00 72.85  ? 18   ASN B ND2   1 
ATOM   2272 N N     . PHE B 2 19  ? 24.061  33.225  -35.933 1.00 58.28  ? 19   PHE B N     1 
ATOM   2273 C CA    . PHE B 2 19  ? 23.187  32.579  -36.926 1.00 61.35  ? 19   PHE B CA    1 
ATOM   2274 C C     . PHE B 2 19  ? 23.434  33.072  -38.336 1.00 71.31  ? 19   PHE B C     1 
ATOM   2275 O O     . PHE B 2 19  ? 23.131  32.385  -39.312 1.00 77.55  ? 19   PHE B O     1 
ATOM   2276 C CB    . PHE B 2 19  ? 21.718  32.792  -36.588 1.00 55.00  ? 19   PHE B CB    1 
ATOM   2277 C CG    . PHE B 2 19  ? 21.239  31.945  -35.472 1.00 48.96  ? 19   PHE B CG    1 
ATOM   2278 C CD1   . PHE B 2 19  ? 21.189  30.579  -35.611 1.00 49.38  ? 19   PHE B CD1   1 
ATOM   2279 C CD2   . PHE B 2 19  ? 20.814  32.511  -34.291 1.00 47.40  ? 19   PHE B CD2   1 
ATOM   2280 C CE1   . PHE B 2 19  ? 20.734  29.777  -34.581 1.00 48.90  ? 19   PHE B CE1   1 
ATOM   2281 C CE2   . PHE B 2 19  ? 20.372  31.722  -33.253 1.00 46.98  ? 19   PHE B CE2   1 
ATOM   2282 C CZ    . PHE B 2 19  ? 20.326  30.350  -33.400 1.00 46.87  ? 19   PHE B CZ    1 
ATOM   2283 N N     . SER B 2 20  ? 23.977  34.273  -38.440 1.00 81.67  ? 20   SER B N     1 
ATOM   2284 C CA    . SER B 2 20  ? 24.383  34.811  -39.729 1.00 91.76  ? 20   SER B CA    1 
ATOM   2285 C C     . SER B 2 20  ? 25.542  34.006  -40.377 1.00 89.96  ? 20   SER B C     1 
ATOM   2286 O O     . SER B 2 20  ? 25.830  34.184  -41.562 1.00 96.01  ? 20   SER B O     1 
ATOM   2287 C CB    . SER B 2 20  ? 24.758  36.292  -39.558 1.00 96.73  ? 20   SER B CB    1 
ATOM   2288 O OG    . SER B 2 20  ? 23.844  36.947  -38.679 1.00 93.11  ? 20   SER B OG    1 
ATOM   2289 N N     . SER B 2 21  ? 26.185  33.122  -39.607 1.00 88.12  ? 21   SER B N     1 
ATOM   2290 C CA    . SER B 2 21  ? 27.351  32.348  -40.068 1.00 92.00  ? 21   SER B CA    1 
ATOM   2291 C C     . SER B 2 21  ? 27.035  30.894  -40.461 1.00 90.72  ? 21   SER B C     1 
ATOM   2292 O O     . SER B 2 21  ? 25.924  30.398  -40.235 1.00 85.71  ? 21   SER B O     1 
ATOM   2293 C CB    . SER B 2 21  ? 28.450  32.349  -38.982 1.00 92.76  ? 21   SER B CB    1 
ATOM   2294 O OG    . SER B 2 21  ? 28.233  31.348  -37.988 1.00 88.93  ? 21   SER B OG    1 
ATOM   2295 N N     . LEU B 2 22  ? 28.044  30.239  -41.048 1.00 92.50  ? 22   LEU B N     1 
ATOM   2296 C CA    . LEU B 2 22  ? 28.047  28.795  -41.376 1.00 95.74  ? 22   LEU B CA    1 
ATOM   2297 C C     . LEU B 2 22  ? 26.882  27.989  -40.772 1.00 100.32 ? 22   LEU B C     1 
ATOM   2298 O O     . LEU B 2 22  ? 26.374  27.042  -41.383 1.00 93.66  ? 22   LEU B O     1 
ATOM   2299 C CB    . LEU B 2 22  ? 29.402  28.165  -40.963 1.00 91.63  ? 22   LEU B CB    1 
ATOM   2300 C CG    . LEU B 2 22  ? 29.931  28.399  -39.529 1.00 90.37  ? 22   LEU B CG    1 
ATOM   2301 C CD1   . LEU B 2 22  ? 29.209  27.514  -38.515 1.00 88.82  ? 22   LEU B CD1   1 
ATOM   2302 C CD2   . LEU B 2 22  ? 31.444  28.199  -39.427 1.00 86.18  ? 22   LEU B CD2   1 
ATOM   2303 N N     . LYS C 1 4   ? 27.457  19.878  1.295   1.00 52.12  ? 125  LYS D N     1 
ATOM   2304 C CA    . LYS C 1 4   ? 28.231  20.966  0.618   1.00 61.46  ? 125  LYS D CA    1 
ATOM   2305 C C     . LYS C 1 4   ? 29.704  20.618  0.346   1.00 59.06  ? 125  LYS D C     1 
ATOM   2306 O O     . LYS C 1 4   ? 30.253  21.014  -0.688  1.00 60.13  ? 125  LYS D O     1 
ATOM   2307 C CB    . LYS C 1 4   ? 28.084  22.312  1.388   1.00 68.49  ? 125  LYS D CB    1 
ATOM   2308 C CG    . LYS C 1 4   ? 29.208  23.372  1.285   1.00 68.97  ? 125  LYS D CG    1 
ATOM   2309 C CD    . LYS C 1 4   ? 29.682  23.823  -0.105  1.00 70.42  ? 125  LYS D CD    1 
ATOM   2310 C CE    . LYS C 1 4   ? 28.660  23.703  -1.236  1.00 77.87  ? 125  LYS D CE    1 
ATOM   2311 N NZ    . LYS C 1 4   ? 27.337  24.351  -0.990  1.00 76.49  ? 125  LYS D NZ    1 
ATOM   2312 N N     . ARG C 1 5   ? 30.358  19.912  1.259   1.00 59.85  ? 126  ARG D N     1 
ATOM   2313 C CA    . ARG C 1 5   ? 31.743  19.481  1.007   1.00 62.44  ? 126  ARG D CA    1 
ATOM   2314 C C     . ARG C 1 5   ? 31.712  18.285  0.028   1.00 59.67  ? 126  ARG D C     1 
ATOM   2315 O O     . ARG C 1 5   ? 30.792  17.456  0.075   1.00 55.25  ? 126  ARG D O     1 
ATOM   2316 C CB    . ARG C 1 5   ? 32.460  19.149  2.323   1.00 60.61  ? 126  ARG D CB    1 
ATOM   2317 C CG    . ARG C 1 5   ? 33.949  18.830  2.171   1.00 59.24  ? 126  ARG D CG    1 
ATOM   2318 C CD    . ARG C 1 5   ? 34.463  17.987  3.337   1.00 58.88  ? 126  ARG D CD    1 
ATOM   2319 N NE    . ARG C 1 5   ? 35.722  17.329  3.003   1.00 60.55  ? 126  ARG D NE    1 
ATOM   2320 C CZ    . ARG C 1 5   ? 36.362  16.456  3.783   1.00 57.81  ? 126  ARG D CZ    1 
ATOM   2321 N NH1   . ARG C 1 5   ? 35.866  16.114  4.966   1.00 55.30  ? 126  ARG D NH1   1 
ATOM   2322 N NH2   . ARG C 1 5   ? 37.507  15.913  3.362   1.00 54.73  ? 126  ARG D NH2   1 
ATOM   2323 N N     . GLN C 1 6   ? 32.699  18.214  -0.861  1.00 56.19  ? 127  GLN D N     1 
ATOM   2324 C CA    . GLN C 1 6   ? 32.620  17.353  -2.046  1.00 57.78  ? 127  GLN D CA    1 
ATOM   2325 C C     . GLN C 1 6   ? 33.822  16.372  -2.108  1.00 55.87  ? 127  GLN D C     1 
ATOM   2326 O O     . GLN C 1 6   ? 34.933  16.698  -1.681  1.00 60.46  ? 127  GLN D O     1 
ATOM   2327 C CB    . GLN C 1 6   ? 32.544  18.262  -3.293  1.00 57.60  ? 127  GLN D CB    1 
ATOM   2328 C CG    . GLN C 1 6   ? 31.383  17.989  -4.252  1.00 65.31  ? 127  GLN D CG    1 
ATOM   2329 C CD    . GLN C 1 6   ? 29.984  18.218  -3.647  1.00 70.35  ? 127  GLN D CD    1 
ATOM   2330 O OE1   . GLN C 1 6   ? 29.851  18.734  -2.537  1.00 75.72  ? 127  GLN D OE1   1 
ATOM   2331 N NE2   . GLN C 1 6   ? 28.935  17.823  -4.383  1.00 65.02  ? 127  GLN D NE2   1 
ATOM   2332 N N     . TRP C 1 7   ? 33.604  15.169  -2.625  1.00 49.53  ? 128  TRP D N     1 
ATOM   2333 C CA    . TRP C 1 7   ? 34.661  14.162  -2.667  1.00 46.71  ? 128  TRP D CA    1 
ATOM   2334 C C     . TRP C 1 7   ? 35.907  14.690  -3.357  1.00 48.11  ? 128  TRP D C     1 
ATOM   2335 O O     . TRP C 1 7   ? 35.794  15.435  -4.306  1.00 46.50  ? 128  TRP D O     1 
ATOM   2336 C CB    . TRP C 1 7   ? 34.197  12.917  -3.438  1.00 46.68  ? 128  TRP D CB    1 
ATOM   2337 C CG    . TRP C 1 7   ? 33.128  12.129  -2.752  1.00 48.20  ? 128  TRP D CG    1 
ATOM   2338 C CD1   . TRP C 1 7   ? 31.838  11.907  -3.188  1.00 47.25  ? 128  TRP D CD1   1 
ATOM   2339 C CD2   . TRP C 1 7   ? 33.242  11.472  -1.489  1.00 46.64  ? 128  TRP D CD2   1 
ATOM   2340 N NE1   . TRP C 1 7   ? 31.152  11.145  -2.266  1.00 46.58  ? 128  TRP D NE1   1 
ATOM   2341 C CE2   . TRP C 1 7   ? 31.995  10.860  -1.218  1.00 47.90  ? 128  TRP D CE2   1 
ATOM   2342 C CE3   . TRP C 1 7   ? 34.282  11.332  -0.564  1.00 47.38  ? 128  TRP D CE3   1 
ATOM   2343 C CZ2   . TRP C 1 7   ? 31.762  10.127  -0.045  1.00 49.82  ? 128  TRP D CZ2   1 
ATOM   2344 C CZ3   . TRP C 1 7   ? 34.055  10.594  0.595   1.00 49.98  ? 128  TRP D CZ3   1 
ATOM   2345 C CH2   . TRP C 1 7   ? 32.806  10.003  0.846   1.00 50.31  ? 128  TRP D CH2   1 
ATOM   2346 N N     . ALA C 1 8   ? 37.092  14.293  -2.885  1.00 52.68  ? 129  ALA D N     1 
ATOM   2347 C CA    . ALA C 1 8   ? 38.353  14.516  -3.621  1.00 51.65  ? 129  ALA D CA    1 
ATOM   2348 C C     . ALA C 1 8   ? 39.227  13.257  -3.583  1.00 53.51  ? 129  ALA D C     1 
ATOM   2349 O O     . ALA C 1 8   ? 39.061  12.417  -2.702  1.00 53.51  ? 129  ALA D O     1 
ATOM   2350 C CB    . ALA C 1 8   ? 39.104  15.706  -3.046  1.00 52.38  ? 129  ALA D CB    1 
ATOM   2351 N N     . LEU C 1 9   ? 40.148  13.112  -4.534  1.00 54.93  ? 130  LEU D N     1 
ATOM   2352 C CA    . LEU C 1 9   ? 40.999  11.913  -4.571  1.00 58.18  ? 130  LEU D CA    1 
ATOM   2353 C C     . LEU C 1 9   ? 41.817  11.716  -3.292  1.00 64.42  ? 130  LEU D C     1 
ATOM   2354 O O     . LEU C 1 9   ? 41.974  10.587  -2.832  1.00 68.68  ? 130  LEU D O     1 
ATOM   2355 C CB    . LEU C 1 9   ? 41.936  11.924  -5.777  1.00 56.15  ? 130  LEU D CB    1 
ATOM   2356 C CG    . LEU C 1 9   ? 42.756  10.649  -5.998  1.00 56.54  ? 130  LEU D CG    1 
ATOM   2357 C CD1   . LEU C 1 9   ? 41.859  9.412   -6.014  1.00 58.64  ? 130  LEU D CD1   1 
ATOM   2358 C CD2   . LEU C 1 9   ? 43.564  10.749  -7.286  1.00 54.61  ? 130  LEU D CD2   1 
ATOM   2359 N N     . GLU C 1 10  ? 42.316  12.804  -2.704  1.00 72.65  ? 131  GLU D N     1 
ATOM   2360 C CA    . GLU C 1 10  ? 43.138  12.705  -1.485  1.00 75.45  ? 131  GLU D CA    1 
ATOM   2361 C C     . GLU C 1 10  ? 42.293  12.648  -0.196  1.00 71.20  ? 131  GLU D C     1 
ATOM   2362 O O     . GLU C 1 10  ? 42.751  13.047  0.869   1.00 70.54  ? 131  GLU D O     1 
ATOM   2363 C CB    . GLU C 1 10  ? 44.183  13.836  -1.441  1.00 85.63  ? 131  GLU D CB    1 
ATOM   2364 C CG    . GLU C 1 10  ? 45.139  13.836  -2.640  1.00 92.98  ? 131  GLU D CG    1 
ATOM   2365 C CD    . GLU C 1 10  ? 46.140  14.992  -2.634  1.00 100.31 ? 131  GLU D CD    1 
ATOM   2366 O OE1   . GLU C 1 10  ? 46.825  15.197  -1.603  1.00 96.48  ? 131  GLU D OE1   1 
ATOM   2367 O OE2   . GLU C 1 10  ? 46.256  15.688  -3.674  1.00 98.94  ? 131  GLU D OE2   1 
ATOM   2368 N N     . ASP C 1 11  ? 41.062  12.146  -0.308  1.00 65.75  ? 132  ASP D N     1 
ATOM   2369 C CA    . ASP C 1 11  ? 40.268  11.747  0.844   1.00 61.59  ? 132  ASP D CA    1 
ATOM   2370 C C     . ASP C 1 11  ? 40.389  10.258  1.115   1.00 58.26  ? 132  ASP D C     1 
ATOM   2371 O O     . ASP C 1 11  ? 39.762  9.766   2.051   1.00 55.94  ? 132  ASP D O     1 
ATOM   2372 C CB    . ASP C 1 11  ? 38.785  12.065  0.631   1.00 65.87  ? 132  ASP D CB    1 
ATOM   2373 C CG    . ASP C 1 11  ? 38.478  13.541  0.731   1.00 72.19  ? 132  ASP D CG    1 
ATOM   2374 O OD1   . ASP C 1 11  ? 39.338  14.303  1.242   1.00 76.61  ? 132  ASP D OD1   1 
ATOM   2375 O OD2   . ASP C 1 11  ? 37.364  13.937  0.303   1.00 76.99  ? 132  ASP D OD2   1 
ATOM   2376 N N     . PHE C 1 12  ? 41.190  9.550   0.312   1.00 58.10  ? 133  PHE D N     1 
ATOM   2377 C CA    . PHE C 1 12  ? 41.320  8.088   0.396   1.00 54.92  ? 133  PHE D CA    1 
ATOM   2378 C C     . PHE C 1 12  ? 42.762  7.628   0.359   1.00 58.00  ? 133  PHE D C     1 
ATOM   2379 O O     . PHE C 1 12  ? 43.579  8.182   -0.375  1.00 57.15  ? 133  PHE D O     1 
ATOM   2380 C CB    . PHE C 1 12  ? 40.610  7.386   -0.783  1.00 52.24  ? 133  PHE D CB    1 
ATOM   2381 C CG    . PHE C 1 12  ? 39.246  7.925   -1.088  1.00 47.34  ? 133  PHE D CG    1 
ATOM   2382 C CD1   . PHE C 1 12  ? 39.090  9.000   -1.939  1.00 45.53  ? 133  PHE D CD1   1 
ATOM   2383 C CD2   . PHE C 1 12  ? 38.130  7.358   -0.524  1.00 44.43  ? 133  PHE D CD2   1 
ATOM   2384 C CE1   . PHE C 1 12  ? 37.834  9.509   -2.206  1.00 44.22  ? 133  PHE D CE1   1 
ATOM   2385 C CE2   . PHE C 1 12  ? 36.879  7.861   -0.788  1.00 42.72  ? 133  PHE D CE2   1 
ATOM   2386 C CZ    . PHE C 1 12  ? 36.731  8.937   -1.630  1.00 41.79  ? 133  PHE D CZ    1 
ATOM   2387 N N     . GLU C 1 13  ? 43.042  6.566   1.112   1.00 64.46  ? 134  GLU D N     1 
ATOM   2388 C CA    . GLU C 1 13  ? 44.303  5.843   1.010   1.00 66.97  ? 134  GLU D CA    1 
ATOM   2389 C C     . GLU C 1 13  ? 44.081  4.753   -0.037  1.00 63.98  ? 134  GLU D C     1 
ATOM   2390 O O     . GLU C 1 13  ? 43.338  3.806   0.216   1.00 59.70  ? 134  GLU D O     1 
ATOM   2391 C CB    . GLU C 1 13  ? 44.684  5.228   2.372   1.00 74.15  ? 134  GLU D CB    1 
ATOM   2392 C CG    . GLU C 1 13  ? 44.579  6.186   3.568   1.00 84.86  ? 134  GLU D CG    1 
ATOM   2393 C CD    . GLU C 1 13  ? 45.019  5.577   4.908   1.00 97.63  ? 134  GLU D CD    1 
ATOM   2394 O OE1   . GLU C 1 13  ? 45.961  4.744   4.926   1.00 100.43 ? 134  GLU D OE1   1 
ATOM   2395 O OE2   . GLU C 1 13  ? 44.421  5.935   5.958   1.00 97.02  ? 134  GLU D OE2   1 
ATOM   2396 N N     . ILE C 1 14  ? 44.682  4.901   -1.218  1.00 62.75  ? 135  ILE D N     1 
ATOM   2397 C CA    . ILE C 1 14  ? 44.532  3.905   -2.308  1.00 59.81  ? 135  ILE D CA    1 
ATOM   2398 C C     . ILE C 1 14  ? 45.354  2.640   -2.009  1.00 58.88  ? 135  ILE D C     1 
ATOM   2399 O O     . ILE C 1 14  ? 46.578  2.686   -2.015  1.00 54.70  ? 135  ILE D O     1 
ATOM   2400 C CB    . ILE C 1 14  ? 44.987  4.462   -3.696  1.00 61.84  ? 135  ILE D CB    1 
ATOM   2401 C CG1   . ILE C 1 14  ? 44.239  5.753   -4.078  1.00 60.92  ? 135  ILE D CG1   1 
ATOM   2402 C CG2   . ILE C 1 14  ? 44.801  3.418   -4.795  1.00 63.27  ? 135  ILE D CG2   1 
ATOM   2403 C CD1   . ILE C 1 14  ? 42.734  5.615   -4.164  1.00 60.48  ? 135  ILE D CD1   1 
ATOM   2404 N N     . GLY C 1 15  ? 44.674  1.517   -1.765  1.00 59.77  ? 136  GLY D N     1 
ATOM   2405 C CA    . GLY C 1 15  ? 45.313  0.234   -1.472  1.00 53.81  ? 136  GLY D CA    1 
ATOM   2406 C C     . GLY C 1 15  ? 45.575  -0.635  -2.702  1.00 55.64  ? 136  GLY D C     1 
ATOM   2407 O O     . GLY C 1 15  ? 45.841  -0.140  -3.797  1.00 52.92  ? 136  GLY D O     1 
ATOM   2408 N N     . ARG C 1 16  ? 45.512  -1.946  -2.504  1.00 56.97  ? 137  ARG D N     1 
ATOM   2409 C CA    . ARG C 1 16  ? 45.800  -2.925  -3.549  1.00 57.68  ? 137  ARG D CA    1 
ATOM   2410 C C     . ARG C 1 16  ? 44.634  -3.081  -4.505  1.00 58.37  ? 137  ARG D C     1 
ATOM   2411 O O     . ARG C 1 16  ? 43.495  -2.853  -4.121  1.00 56.73  ? 137  ARG D O     1 
ATOM   2412 C CB    . ARG C 1 16  ? 46.073  -4.299  -2.916  1.00 56.34  ? 137  ARG D CB    1 
ATOM   2413 C CG    . ARG C 1 16  ? 44.851  -4.984  -2.314  1.00 54.38  ? 137  ARG D CG    1 
ATOM   2414 C CD    . ARG C 1 16  ? 45.259  -6.009  -1.273  1.00 54.78  ? 137  ARG D CD    1 
ATOM   2415 N NE    . ARG C 1 16  ? 44.123  -6.531  -0.526  1.00 53.85  ? 137  ARG D NE    1 
ATOM   2416 C CZ    . ARG C 1 16  ? 43.315  -7.494  -0.954  1.00 55.07  ? 137  ARG D CZ    1 
ATOM   2417 N NH1   . ARG C 1 16  ? 43.499  -8.053  -2.157  1.00 52.87  ? 137  ARG D NH1   1 
ATOM   2418 N NH2   . ARG C 1 16  ? 42.304  -7.893  -0.176  1.00 53.48  ? 137  ARG D NH2   1 
ATOM   2419 N N     . PRO C 1 17  ? 44.910  -3.529  -5.738  1.00 60.15  ? 138  PRO D N     1 
ATOM   2420 C CA    . PRO C 1 17  ? 43.829  -3.716  -6.702  1.00 60.11  ? 138  PRO D CA    1 
ATOM   2421 C C     . PRO C 1 17  ? 42.971  -4.946  -6.388  1.00 60.05  ? 138  PRO D C     1 
ATOM   2422 O O     . PRO C 1 17  ? 43.479  -5.918  -5.829  1.00 61.18  ? 138  PRO D O     1 
ATOM   2423 C CB    . PRO C 1 17  ? 44.576  -3.890  -8.034  1.00 60.36  ? 138  PRO D CB    1 
ATOM   2424 C CG    . PRO C 1 17  ? 45.895  -4.454  -7.650  1.00 58.08  ? 138  PRO D CG    1 
ATOM   2425 C CD    . PRO C 1 17  ? 46.227  -3.868  -6.307  1.00 58.53  ? 138  PRO D CD    1 
ATOM   2426 N N     . LEU C 1 18  ? 41.683  -4.880  -6.735  1.00 58.07  ? 139  LEU D N     1 
ATOM   2427 C CA    . LEU C 1 18  ? 40.766  -6.007  -6.608  1.00 54.85  ? 139  LEU D CA    1 
ATOM   2428 C C     . LEU C 1 18  ? 40.382  -6.571  -7.958  1.00 56.60  ? 139  LEU D C     1 
ATOM   2429 O O     . LEU C 1 18  ? 39.775  -7.645  -8.049  1.00 61.76  ? 139  LEU D O     1 
ATOM   2430 C CB    . LEU C 1 18  ? 39.499  -5.565  -5.905  1.00 54.99  ? 139  LEU D CB    1 
ATOM   2431 C CG    . LEU C 1 18  ? 39.692  -5.001  -4.504  1.00 57.11  ? 139  LEU D CG    1 
ATOM   2432 C CD1   . LEU C 1 18  ? 38.397  -4.370  -3.997  1.00 57.07  ? 139  LEU D CD1   1 
ATOM   2433 C CD2   . LEU C 1 18  ? 40.190  -6.091  -3.569  1.00 54.01  ? 139  LEU D CD2   1 
ATOM   2434 N N     . GLY C 1 19  ? 40.699  -5.853  -9.020  1.00 54.77  ? 140  GLY D N     1 
ATOM   2435 C CA    . GLY C 1 19  ? 40.345  -6.353  -10.319 1.00 59.11  ? 140  GLY D CA    1 
ATOM   2436 C C     . GLY C 1 19  ? 40.680  -5.404  -11.428 1.00 64.01  ? 140  GLY D C     1 
ATOM   2437 O O     . GLY C 1 19  ? 41.023  -4.231  -11.194 1.00 64.83  ? 140  GLY D O     1 
ATOM   2438 N N     . LYS C 1 20  ? 40.582  -5.937  -12.641 1.00 67.02  ? 141  LYS D N     1 
ATOM   2439 C CA    . LYS C 1 20  ? 40.826  -5.181  -13.850 1.00 71.72  ? 141  LYS D CA    1 
ATOM   2440 C C     . LYS C 1 20  ? 39.523  -4.460  -14.250 1.00 75.52  ? 141  LYS D C     1 
ATOM   2441 O O     . LYS C 1 20  ? 39.228  -3.383  -13.726 1.00 87.99  ? 141  LYS D O     1 
ATOM   2442 C CB    . LYS C 1 20  ? 41.378  -6.107  -14.934 1.00 73.55  ? 141  LYS D CB    1 
ATOM   2443 C CG    . LYS C 1 20  ? 41.850  -5.413  -16.196 1.00 79.54  ? 141  LYS D CG    1 
ATOM   2444 C CD    . LYS C 1 20  ? 42.281  -6.425  -17.253 1.00 84.80  ? 141  LYS D CD    1 
ATOM   2445 C CE    . LYS C 1 20  ? 42.141  -5.847  -18.652 1.00 90.69  ? 141  LYS D CE    1 
ATOM   2446 N NZ    . LYS C 1 20  ? 42.480  -6.841  -19.709 1.00 96.58  ? 141  LYS D NZ    1 
ATOM   2447 N N     . GLY C 1 21  ? 38.721  -5.038  -15.128 1.00 68.55  ? 142  GLY D N     1 
ATOM   2448 C CA    . GLY C 1 21  ? 37.566  -4.317  -15.645 1.00 68.46  ? 142  GLY D CA    1 
ATOM   2449 C C     . GLY C 1 21  ? 37.887  -3.617  -16.950 1.00 66.04  ? 142  GLY D C     1 
ATOM   2450 O O     . GLY C 1 21  ? 39.045  -3.322  -17.243 1.00 61.19  ? 142  GLY D O     1 
ATOM   2451 N N     . LYS C 1 22  ? 36.849  -3.327  -17.726 1.00 69.97  ? 143  LYS D N     1 
ATOM   2452 C CA    . LYS C 1 22  ? 37.028  -2.861  -19.097 1.00 74.82  ? 143  LYS D CA    1 
ATOM   2453 C C     . LYS C 1 22  ? 37.665  -1.459  -19.223 1.00 69.36  ? 143  LYS D C     1 
ATOM   2454 O O     . LYS C 1 22  ? 38.638  -1.297  -19.972 1.00 75.63  ? 143  LYS D O     1 
ATOM   2455 C CB    . LYS C 1 22  ? 35.696  -2.931  -19.863 1.00 86.92  ? 143  LYS D CB    1 
ATOM   2456 C CG    . LYS C 1 22  ? 35.867  -2.943  -21.380 1.00 97.39  ? 143  LYS D CG    1 
ATOM   2457 C CD    . LYS C 1 22  ? 34.547  -3.105  -22.123 1.00 101.20 ? 143  LYS D CD    1 
ATOM   2458 C CE    . LYS C 1 22  ? 34.703  -2.735  -23.594 1.00 103.02 ? 143  LYS D CE    1 
ATOM   2459 N NZ    . LYS C 1 22  ? 33.410  -2.411  -24.264 1.00 102.28 ? 143  LYS D NZ    1 
ATOM   2460 N N     . PHE C 1 23  ? 37.156  -0.465  -18.489 1.00 56.58  ? 144  PHE D N     1 
ATOM   2461 C CA    . PHE C 1 23  ? 37.600  0.931   -18.673 1.00 54.03  ? 144  PHE D CA    1 
ATOM   2462 C C     . PHE C 1 23  ? 38.470  1.528   -17.544 1.00 54.93  ? 144  PHE D C     1 
ATOM   2463 O O     . PHE C 1 23  ? 38.580  2.764   -17.412 1.00 55.58  ? 144  PHE D O     1 
ATOM   2464 C CB    . PHE C 1 23  ? 36.377  1.818   -18.896 1.00 50.11  ? 144  PHE D CB    1 
ATOM   2465 C CG    . PHE C 1 23  ? 35.514  1.348   -19.998 1.00 45.58  ? 144  PHE D CG    1 
ATOM   2466 C CD1   . PHE C 1 23  ? 35.781  1.715   -21.288 1.00 43.35  ? 144  PHE D CD1   1 
ATOM   2467 C CD2   . PHE C 1 23  ? 34.455  0.504   -19.743 1.00 47.35  ? 144  PHE D CD2   1 
ATOM   2468 C CE1   . PHE C 1 23  ? 34.990  1.273   -22.317 1.00 44.39  ? 144  PHE D CE1   1 
ATOM   2469 C CE2   . PHE C 1 23  ? 33.668  0.032   -20.771 1.00 46.38  ? 144  PHE D CE2   1 
ATOM   2470 C CZ    . PHE C 1 23  ? 33.938  0.418   -22.062 1.00 46.33  ? 144  PHE D CZ    1 
ATOM   2471 N N     . GLY C 1 24  ? 39.100  0.660   -16.762 1.00 48.73  ? 145  GLY D N     1 
ATOM   2472 C CA    . GLY C 1 24  ? 39.855  1.081   -15.596 1.00 50.53  ? 145  GLY D CA    1 
ATOM   2473 C C     . GLY C 1 24  ? 39.809  0.013   -14.518 1.00 51.91  ? 145  GLY D C     1 
ATOM   2474 O O     . GLY C 1 24  ? 39.456  -1.146  -14.786 1.00 53.89  ? 145  GLY D O     1 
ATOM   2475 N N     . ASN C 1 25  ? 40.149  0.391   -13.297 1.00 48.91  ? 146  ASN D N     1 
ATOM   2476 C CA    . ASN C 1 25  ? 40.402  -0.596  -12.266 1.00 53.21  ? 146  ASN D CA    1 
ATOM   2477 C C     . ASN C 1 25  ? 39.646  -0.360  -10.986 1.00 49.60  ? 146  ASN D C     1 
ATOM   2478 O O     . ASN C 1 25  ? 39.222  0.755   -10.712 1.00 51.33  ? 146  ASN D O     1 
ATOM   2479 C CB    . ASN C 1 25  ? 41.897  -0.623  -11.954 1.00 64.30  ? 146  ASN D CB    1 
ATOM   2480 C CG    . ASN C 1 25  ? 42.644  -1.643  -12.788 1.00 74.10  ? 146  ASN D CG    1 
ATOM   2481 O OD1   . ASN C 1 25  ? 42.388  -1.792  -13.984 1.00 74.05  ? 146  ASN D OD1   1 
ATOM   2482 N ND2   . ASN C 1 25  ? 43.573  -2.361  -12.154 1.00 83.96  ? 146  ASN D ND2   1 
ATOM   2483 N N     . VAL C 1 26  ? 39.512  -1.422  -10.197 1.00 45.45  ? 147  VAL D N     1 
ATOM   2484 C CA    . VAL C 1 26  ? 38.936  -1.347  -8.869  1.00 44.14  ? 147  VAL D CA    1 
ATOM   2485 C C     . VAL C 1 26  ? 39.984  -1.568  -7.797  1.00 43.80  ? 147  VAL D C     1 
ATOM   2486 O O     . VAL C 1 26  ? 40.628  -2.604  -7.773  1.00 44.20  ? 147  VAL D O     1 
ATOM   2487 C CB    . VAL C 1 26  ? 37.867  -2.421  -8.684  1.00 43.67  ? 147  VAL D CB    1 
ATOM   2488 C CG1   . VAL C 1 26  ? 37.108  -2.191  -7.365  1.00 44.18  ? 147  VAL D CG1   1 
ATOM   2489 C CG2   . VAL C 1 26  ? 36.940  -2.412  -9.883  1.00 42.67  ? 147  VAL D CG2   1 
ATOM   2490 N N     . TYR C 1 27  ? 40.130  -0.604  -6.897  1.00 46.47  ? 148  TYR D N     1 
ATOM   2491 C CA    . TYR C 1 27  ? 41.112  -0.698  -5.817  1.00 48.53  ? 148  TYR D CA    1 
ATOM   2492 C C     . TYR C 1 27  ? 40.440  -0.728  -4.478  1.00 44.18  ? 148  TYR D C     1 
ATOM   2493 O O     . TYR C 1 27  ? 39.464  -0.027  -4.269  1.00 46.74  ? 148  TYR D O     1 
ATOM   2494 C CB    . TYR C 1 27  ? 42.064  0.497   -5.824  1.00 51.42  ? 148  TYR D CB    1 
ATOM   2495 C CG    . TYR C 1 27  ? 42.829  0.669   -7.103  1.00 56.34  ? 148  TYR D CG    1 
ATOM   2496 C CD1   . TYR C 1 27  ? 44.071  0.065   -7.287  1.00 61.07  ? 148  TYR D CD1   1 
ATOM   2497 C CD2   . TYR C 1 27  ? 42.321  1.448   -8.126  1.00 59.87  ? 148  TYR D CD2   1 
ATOM   2498 C CE1   . TYR C 1 27  ? 44.783  0.236   -8.465  1.00 65.33  ? 148  TYR D CE1   1 
ATOM   2499 C CE2   . TYR C 1 27  ? 43.017  1.626   -9.307  1.00 64.41  ? 148  TYR D CE2   1 
ATOM   2500 C CZ    . TYR C 1 27  ? 44.244  1.020   -9.478  1.00 66.72  ? 148  TYR D CZ    1 
ATOM   2501 O OH    . TYR C 1 27  ? 44.917  1.215   -10.665 1.00 72.65  ? 148  TYR D OH    1 
ATOM   2502 N N     . LEU C 1 28  ? 40.983  -1.525  -3.566  1.00 43.83  ? 149  LEU D N     1 
ATOM   2503 C CA    . LEU C 1 28  ? 40.662  -1.411  -2.145  1.00 45.44  ? 149  LEU D CA    1 
ATOM   2504 C C     . LEU C 1 28  ? 41.110  -0.031  -1.692  1.00 45.62  ? 149  LEU D C     1 
ATOM   2505 O O     . LEU C 1 28  ? 42.014  0.553   -2.274  1.00 49.49  ? 149  LEU D O     1 
ATOM   2506 C CB    . LEU C 1 28  ? 41.371  -2.495  -1.322  1.00 45.25  ? 149  LEU D CB    1 
ATOM   2507 C CG    . LEU C 1 28  ? 40.843  -2.720  0.105   1.00 49.80  ? 149  LEU D CG    1 
ATOM   2508 C CD1   . LEU C 1 28  ? 39.326  -2.931  0.127   1.00 54.07  ? 149  LEU D CD1   1 
ATOM   2509 C CD2   . LEU C 1 28  ? 41.531  -3.891  0.789   1.00 49.45  ? 149  LEU D CD2   1 
ATOM   2510 N N     . ALA C 1 29  ? 40.458  0.518   -0.685  1.00 47.08  ? 150  ALA D N     1 
ATOM   2511 C CA    . ALA C 1 29  ? 40.822  1.843   -0.214  1.00 46.52  ? 150  ALA D CA    1 
ATOM   2512 C C     . ALA C 1 29  ? 40.109  2.166   1.083   1.00 49.11  ? 150  ALA D C     1 
ATOM   2513 O O     . ALA C 1 29  ? 39.157  1.487   1.473   1.00 46.49  ? 150  ALA D O     1 
ATOM   2514 C CB    . ALA C 1 29  ? 40.510  2.888   -1.268  1.00 46.43  ? 150  ALA D CB    1 
ATOM   2515 N N     . ARG C 1 30  ? 40.597  3.208   1.742   1.00 54.28  ? 151  ARG D N     1 
ATOM   2516 C CA    . ARG C 1 30  ? 40.128  3.587   3.058   1.00 58.31  ? 151  ARG D CA    1 
ATOM   2517 C C     . ARG C 1 30  ? 39.868  5.088   3.057   1.00 54.55  ? 151  ARG D C     1 
ATOM   2518 O O     . ARG C 1 30  ? 40.678  5.844   2.532   1.00 51.20  ? 151  ARG D O     1 
ATOM   2519 C CB    . ARG C 1 30  ? 41.207  3.226   4.076   1.00 64.13  ? 151  ARG D CB    1 
ATOM   2520 C CG    . ARG C 1 30  ? 40.793  3.385   5.536   1.00 71.86  ? 151  ARG D CG    1 
ATOM   2521 C CD    . ARG C 1 30  ? 41.697  2.567   6.455   1.00 75.45  ? 151  ARG D CD    1 
ATOM   2522 N NE    . ARG C 1 30  ? 43.088  2.624   5.993   1.00 80.99  ? 151  ARG D NE    1 
ATOM   2523 C CZ    . ARG C 1 30  ? 44.039  1.737   6.283   1.00 73.40  ? 151  ARG D CZ    1 
ATOM   2524 N NH1   . ARG C 1 30  ? 43.795  0.699   7.084   1.00 73.95  ? 151  ARG D NH1   1 
ATOM   2525 N NH2   . ARG C 1 30  ? 45.250  1.904   5.762   1.00 63.74  ? 151  ARG D NH2   1 
ATOM   2526 N N     . GLU C 1 31  ? 38.746  5.510   3.625   1.00 52.46  ? 152  GLU D N     1 
ATOM   2527 C CA    . GLU C 1 31  ? 38.441  6.939   3.748   1.00 57.30  ? 152  GLU D CA    1 
ATOM   2528 C C     . GLU C 1 31  ? 39.253  7.538   4.902   1.00 57.80  ? 152  GLU D C     1 
ATOM   2529 O O     . GLU C 1 31  ? 38.951  7.307   6.081   1.00 53.99  ? 152  GLU D O     1 
ATOM   2530 C CB    . GLU C 1 31  ? 36.934  7.177   3.958   1.00 59.36  ? 152  GLU D CB    1 
ATOM   2531 C CG    . GLU C 1 31  ? 36.484  8.616   3.714   1.00 61.91  ? 152  GLU D CG    1 
ATOM   2532 C CD    . GLU C 1 31  ? 36.811  9.571   4.864   1.00 65.44  ? 152  GLU D CD    1 
ATOM   2533 O OE1   . GLU C 1 31  ? 35.983  9.680   5.807   1.00 64.47  ? 152  GLU D OE1   1 
ATOM   2534 O OE2   . GLU C 1 31  ? 37.879  10.236  4.805   1.00 63.20  ? 152  GLU D OE2   1 
ATOM   2535 N N     . LYS C 1 32  ? 40.261  8.333   4.540   1.00 62.37  ? 153  LYS D N     1 
ATOM   2536 C CA    . LYS C 1 32  ? 41.317  8.768   5.467   1.00 66.61  ? 153  LYS D CA    1 
ATOM   2537 C C     . LYS C 1 32  ? 40.834  9.198   6.862   1.00 66.96  ? 153  LYS D C     1 
ATOM   2538 O O     . LYS C 1 32  ? 41.459  8.840   7.854   1.00 76.05  ? 153  LYS D O     1 
ATOM   2539 C CB    . LYS C 1 32  ? 42.185  9.867   4.833   1.00 64.66  ? 153  LYS D CB    1 
ATOM   2540 C CG    . LYS C 1 32  ? 43.382  9.317   4.067   1.00 68.55  ? 153  LYS D CG    1 
ATOM   2541 C CD    . LYS C 1 32  ? 44.469  10.359  3.799   1.00 68.82  ? 153  LYS D CD    1 
ATOM   2542 C CE    . LYS C 1 32  ? 44.336  11.001  2.430   1.00 71.44  ? 153  LYS D CE    1 
ATOM   2543 N NZ    . LYS C 1 32  ? 44.933  10.190  1.322   1.00 73.26  ? 153  LYS D NZ    1 
ATOM   2544 N N     . GLN C 1 33  ? 39.725  9.929   6.938   1.00 62.39  ? 154  GLN D N     1 
ATOM   2545 C CA    . GLN C 1 33  ? 39.205  10.414  8.223   1.00 63.20  ? 154  GLN D CA    1 
ATOM   2546 C C     . GLN C 1 33  ? 38.563  9.325   9.052   1.00 63.15  ? 154  GLN D C     1 
ATOM   2547 O O     . GLN C 1 33  ? 38.955  9.113   10.178  1.00 71.14  ? 154  GLN D O     1 
ATOM   2548 C CB    . GLN C 1 33  ? 38.171  11.528  8.027   1.00 60.60  ? 154  GLN D CB    1 
ATOM   2549 C CG    . GLN C 1 33  ? 38.703  12.719  7.242   1.00 60.13  ? 154  GLN D CG    1 
ATOM   2550 C CD    . GLN C 1 33  ? 37.800  13.920  7.335   1.00 56.14  ? 154  GLN D CD    1 
ATOM   2551 O OE1   . GLN C 1 33  ? 36.651  13.812  7.780   1.00 57.39  ? 154  GLN D OE1   1 
ATOM   2552 N NE2   . GLN C 1 33  ? 38.307  15.071  6.916   1.00 50.63  ? 154  GLN D NE2   1 
ATOM   2553 N N     . SER C 1 34  ? 37.571  8.650   8.481   1.00 67.15  ? 155  SER D N     1 
ATOM   2554 C CA    . SER C 1 34  ? 36.719  7.701   9.203   1.00 63.27  ? 155  SER D CA    1 
ATOM   2555 C C     . SER C 1 34  ? 37.280  6.296   9.231   1.00 62.91  ? 155  SER D C     1 
ATOM   2556 O O     . SER C 1 34  ? 36.734  5.441   9.926   1.00 56.18  ? 155  SER D O     1 
ATOM   2557 C CB    . SER C 1 34  ? 35.355  7.616   8.532   1.00 64.87  ? 155  SER D CB    1 
ATOM   2558 O OG    . SER C 1 34  ? 35.462  6.856   7.334   1.00 62.14  ? 155  SER D OG    1 
ATOM   2559 N N     . LYS C 1 35  ? 38.329  6.047   8.443   1.00 65.60  ? 156  LYS D N     1 
ATOM   2560 C CA    . LYS C 1 35  ? 38.965  4.725   8.368   1.00 69.20  ? 156  LYS D CA    1 
ATOM   2561 C C     . LYS C 1 35  ? 38.089  3.641   7.711   1.00 64.33  ? 156  LYS D C     1 
ATOM   2562 O O     . LYS C 1 35  ? 38.441  2.464   7.770   1.00 65.21  ? 156  LYS D O     1 
ATOM   2563 C CB    . LYS C 1 35  ? 39.398  4.233   9.771   1.00 73.65  ? 156  LYS D CB    1 
ATOM   2564 C CG    . LYS C 1 35  ? 40.151  5.243   10.638  1.00 75.71  ? 156  LYS D CG    1 
ATOM   2565 C CD    . LYS C 1 35  ? 41.644  4.946   10.741  1.00 78.28  ? 156  LYS D CD    1 
ATOM   2566 C CE    . LYS C 1 35  ? 42.391  5.293   9.463   1.00 80.87  ? 156  LYS D CE    1 
ATOM   2567 N NZ    . LYS C 1 35  ? 43.869  5.265   9.655   1.00 83.93  ? 156  LYS D NZ    1 
ATOM   2568 N N     . PHE C 1 36  ? 36.978  4.032   7.078   1.00 61.80  ? 157  PHE D N     1 
ATOM   2569 C CA    . PHE C 1 36  ? 36.005  3.082   6.506   1.00 58.04  ? 157  PHE D CA    1 
ATOM   2570 C C     . PHE C 1 36  ? 36.589  2.373   5.296   1.00 59.79  ? 157  PHE D C     1 
ATOM   2571 O O     . PHE C 1 36  ? 37.098  3.018   4.379   1.00 59.64  ? 157  PHE D O     1 
ATOM   2572 C CB    . PHE C 1 36  ? 34.741  3.818   6.094   1.00 56.40  ? 157  PHE D CB    1 
ATOM   2573 C CG    . PHE C 1 36  ? 33.554  2.929   5.815   1.00 59.49  ? 157  PHE D CG    1 
ATOM   2574 C CD1   . PHE C 1 36  ? 33.306  2.451   4.530   1.00 60.60  ? 157  PHE D CD1   1 
ATOM   2575 C CD2   . PHE C 1 36  ? 32.639  2.629   6.822   1.00 59.56  ? 157  PHE D CD2   1 
ATOM   2576 C CE1   . PHE C 1 36  ? 32.192  1.662   4.267   1.00 60.66  ? 157  PHE D CE1   1 
ATOM   2577 C CE2   . PHE C 1 36  ? 31.527  1.837   6.566   1.00 59.05  ? 157  PHE D CE2   1 
ATOM   2578 C CZ    . PHE C 1 36  ? 31.299  1.358   5.286   1.00 61.16  ? 157  PHE D CZ    1 
ATOM   2579 N N     . ILE C 1 37  ? 36.533  1.042   5.308   1.00 60.64  ? 158  ILE D N     1 
ATOM   2580 C CA    . ILE C 1 37  ? 37.037  0.264   4.195   1.00 58.34  ? 158  ILE D CA    1 
ATOM   2581 C C     . ILE C 1 37  ? 35.974  0.234   3.121   1.00 55.63  ? 158  ILE D C     1 
ATOM   2582 O O     . ILE C 1 37  ? 34.826  -0.179  3.348   1.00 60.88  ? 158  ILE D O     1 
ATOM   2583 C CB    . ILE C 1 37  ? 37.432  -1.177  4.590   1.00 60.61  ? 158  ILE D CB    1 
ATOM   2584 C CG1   . ILE C 1 37  ? 38.655  -1.165  5.523   1.00 61.75  ? 158  ILE D CG1   1 
ATOM   2585 C CG2   . ILE C 1 37  ? 37.737  -2.013  3.342   1.00 57.04  ? 158  ILE D CG2   1 
ATOM   2586 C CD1   . ILE C 1 37  ? 39.989  -1.003  4.807   1.00 61.68  ? 158  ILE D CD1   1 
ATOM   2587 N N     . LEU C 1 38  ? 36.366  0.669   1.937   1.00 50.47  ? 159  LEU D N     1 
ATOM   2588 C CA    . LEU C 1 38  ? 35.482  0.604   0.801   1.00 48.82  ? 159  LEU D CA    1 
ATOM   2589 C C     . LEU C 1 38  ? 36.269  0.164   -0.434  1.00 44.44  ? 159  LEU D C     1 
ATOM   2590 O O     . LEU C 1 38  ? 37.413  -0.316  -0.322  1.00 43.07  ? 159  LEU D O     1 
ATOM   2591 C CB    . LEU C 1 38  ? 34.771  1.950   0.639   1.00 51.66  ? 159  LEU D CB    1 
ATOM   2592 C CG    . LEU C 1 38  ? 35.708  3.147   0.486   1.00 56.87  ? 159  LEU D CG    1 
ATOM   2593 C CD1   . LEU C 1 38  ? 35.987  3.412   -0.994  1.00 58.33  ? 159  LEU D CD1   1 
ATOM   2594 C CD2   . LEU C 1 38  ? 35.143  4.375   1.178   1.00 54.78  ? 159  LEU D CD2   1 
ATOM   2595 N N     . ALA C 1 39  ? 35.620  0.263   -1.591  1.00 43.01  ? 160  ALA D N     1 
ATOM   2596 C CA    . ALA C 1 39  ? 36.209  -0.083  -2.883  1.00 40.09  ? 160  ALA D CA    1 
ATOM   2597 C C     . ALA C 1 39  ? 36.044  1.081   -3.838  1.00 39.63  ? 160  ALA D C     1 
ATOM   2598 O O     . ALA C 1 39  ? 34.978  1.675   -3.925  1.00 45.31  ? 160  ALA D O     1 
ATOM   2599 C CB    . ALA C 1 39  ? 35.525  -1.299  -3.434  1.00 41.18  ? 160  ALA D CB    1 
ATOM   2600 N N     . LEU C 1 40  ? 37.100  1.397   -4.561  1.00 40.35  ? 161  LEU D N     1 
ATOM   2601 C CA    . LEU C 1 40  ? 37.154  2.595   -5.379  1.00 40.55  ? 161  LEU D CA    1 
ATOM   2602 C C     . LEU C 1 40  ? 37.347  2.169   -6.829  1.00 38.69  ? 161  LEU D C     1 
ATOM   2603 O O     . LEU C 1 40  ? 38.337  1.552   -7.176  1.00 38.93  ? 161  LEU D O     1 
ATOM   2604 C CB    . LEU C 1 40  ? 38.322  3.461   -4.918  1.00 43.16  ? 161  LEU D CB    1 
ATOM   2605 C CG    . LEU C 1 40  ? 38.241  4.928   -5.313  1.00 45.08  ? 161  LEU D CG    1 
ATOM   2606 C CD1   . LEU C 1 40  ? 37.388  5.647   -4.308  1.00 46.40  ? 161  LEU D CD1   1 
ATOM   2607 C CD2   . LEU C 1 40  ? 39.602  5.588   -5.395  1.00 47.29  ? 161  LEU D CD2   1 
ATOM   2608 N N     . LYS C 1 41  ? 36.369  2.450   -7.667  1.00 39.47  ? 162  LYS D N     1 
ATOM   2609 C CA    . LYS C 1 41  ? 36.422  2.022   -9.047  1.00 39.70  ? 162  LYS D CA    1 
ATOM   2610 C C     . LYS C 1 41  ? 36.852  3.218   -9.851  1.00 40.98  ? 162  LYS D C     1 
ATOM   2611 O O     . LYS C 1 41  ? 36.228  4.277   -9.755  1.00 41.43  ? 162  LYS D O     1 
ATOM   2612 C CB    . LYS C 1 41  ? 35.060  1.549   -9.507  1.00 40.94  ? 162  LYS D CB    1 
ATOM   2613 C CG    . LYS C 1 41  ? 35.034  1.038   -10.935 1.00 41.19  ? 162  LYS D CG    1 
ATOM   2614 C CD    . LYS C 1 41  ? 33.847  0.124   -11.140 1.00 40.38  ? 162  LYS D CD    1 
ATOM   2615 C CE    . LYS C 1 41  ? 33.887  -0.479  -12.522 1.00 41.41  ? 162  LYS D CE    1 
ATOM   2616 N NZ    . LYS C 1 41  ? 32.792  -1.478  -12.594 1.00 44.40  ? 162  LYS D NZ    1 
ATOM   2617 N N     . VAL C 1 42  ? 37.924  3.053   -10.624 1.00 39.94  ? 163  VAL D N     1 
ATOM   2618 C CA    . VAL C 1 42  ? 38.478  4.142   -11.380 1.00 40.77  ? 163  VAL D CA    1 
ATOM   2619 C C     . VAL C 1 42  ? 38.312  3.849   -12.839 1.00 40.49  ? 163  VAL D C     1 
ATOM   2620 O O     . VAL C 1 42  ? 38.808  2.822   -13.328 1.00 41.12  ? 163  VAL D O     1 
ATOM   2621 C CB    . VAL C 1 42  ? 39.972  4.331   -11.145 1.00 41.22  ? 163  VAL D CB    1 
ATOM   2622 C CG1   . VAL C 1 42  ? 40.432  5.575   -11.885 1.00 42.16  ? 163  VAL D CG1   1 
ATOM   2623 C CG2   . VAL C 1 42  ? 40.254  4.470   -9.673  1.00 44.45  ? 163  VAL D CG2   1 
ATOM   2624 N N     . LEU C 1 43  ? 37.641  4.767   -13.531 1.00 37.64  ? 164  LEU D N     1 
ATOM   2625 C CA    . LEU C 1 43  ? 37.470  4.668   -14.983 1.00 37.98  ? 164  LEU D CA    1 
ATOM   2626 C C     . LEU C 1 43  ? 38.201  5.837   -15.602 1.00 35.54  ? 164  LEU D C     1 
ATOM   2627 O O     . LEU C 1 43  ? 38.440  6.837   -14.957 1.00 35.13  ? 164  LEU D O     1 
ATOM   2628 C CB    . LEU C 1 43  ? 35.991  4.705   -15.351 1.00 37.09  ? 164  LEU D CB    1 
ATOM   2629 C CG    . LEU C 1 43  ? 35.167  3.812   -14.424 1.00 37.34  ? 164  LEU D CG    1 
ATOM   2630 C CD1   . LEU C 1 43  ? 33.920  4.509   -13.926 1.00 37.68  ? 164  LEU D CD1   1 
ATOM   2631 C CD2   . LEU C 1 43  ? 34.827  2.513   -15.118 1.00 39.91  ? 164  LEU D CD2   1 
ATOM   2632 N N     . PHE C 1 44  ? 38.553  5.689   -16.856 1.00 38.81  ? 165  PHE D N     1 
ATOM   2633 C CA    . PHE C 1 44  ? 39.332  6.687   -17.564 1.00 41.33  ? 165  PHE D CA    1 
ATOM   2634 C C     . PHE C 1 44  ? 38.467  7.337   -18.612 1.00 37.75  ? 165  PHE D C     1 
ATOM   2635 O O     . PHE C 1 44  ? 38.001  6.656   -19.516 1.00 36.04  ? 165  PHE D O     1 
ATOM   2636 C CB    . PHE C 1 44  ? 40.507  6.024   -18.268 1.00 42.00  ? 165  PHE D CB    1 
ATOM   2637 C CG    . PHE C 1 44  ? 41.662  5.715   -17.367 1.00 45.16  ? 165  PHE D CG    1 
ATOM   2638 C CD1   . PHE C 1 44  ? 42.620  6.700   -17.074 1.00 46.28  ? 165  PHE D CD1   1 
ATOM   2639 C CD2   . PHE C 1 44  ? 41.833  4.419   -16.839 1.00 47.10  ? 165  PHE D CD2   1 
ATOM   2640 C CE1   . PHE C 1 44  ? 43.718  6.396   -16.265 1.00 45.91  ? 165  PHE D CE1   1 
ATOM   2641 C CE2   . PHE C 1 44  ? 42.931  4.112   -16.032 1.00 46.09  ? 165  PHE D CE2   1 
ATOM   2642 C CZ    . PHE C 1 44  ? 43.866  5.104   -15.741 1.00 46.04  ? 165  PHE D CZ    1 
ATOM   2643 N N     . LYS C 1 45  ? 38.297  8.654   -18.502 1.00 37.18  ? 166  LYS D N     1 
ATOM   2644 C CA    . LYS C 1 45  ? 37.460  9.436   -19.422 1.00 37.63  ? 166  LYS D CA    1 
ATOM   2645 C C     . LYS C 1 45  ? 37.760  9.218   -20.896 1.00 40.74  ? 166  LYS D C     1 
ATOM   2646 O O     . LYS C 1 45  ? 36.846  9.137   -21.707 1.00 41.57  ? 166  LYS D O     1 
ATOM   2647 C CB    . LYS C 1 45  ? 37.572  10.918  -19.097 1.00 37.65  ? 166  LYS D CB    1 
ATOM   2648 C CG    . LYS C 1 45  ? 36.990  11.272  -17.737 1.00 37.68  ? 166  LYS D CG    1 
ATOM   2649 C CD    . LYS C 1 45  ? 36.963  12.760  -17.513 1.00 37.79  ? 166  LYS D CD    1 
ATOM   2650 C CE    . LYS C 1 45  ? 36.253  13.055  -16.213 1.00 40.91  ? 166  LYS D CE    1 
ATOM   2651 N NZ    . LYS C 1 45  ? 36.040  14.516  -16.031 1.00 42.62  ? 166  LYS D NZ    1 
ATOM   2652 N N     . ALA C 1 46  ? 39.039  9.093   -21.239 1.00 46.49  ? 167  ALA D N     1 
ATOM   2653 C CA    . ALA C 1 46  ? 39.454  8.982   -22.641 1.00 48.40  ? 167  ALA D CA    1 
ATOM   2654 C C     . ALA C 1 46  ? 39.085  7.651   -23.263 1.00 46.41  ? 167  ALA D C     1 
ATOM   2655 O O     . ALA C 1 46  ? 39.019  7.547   -24.484 1.00 49.76  ? 167  ALA D O     1 
ATOM   2656 C CB    . ALA C 1 46  ? 40.953  9.215   -22.767 1.00 51.35  ? 167  ALA D CB    1 
ATOM   2657 N N     . GLN C 1 47  ? 38.892  6.637   -22.429 1.00 43.77  ? 168  GLN D N     1 
ATOM   2658 C CA    . GLN C 1 47  ? 38.424  5.324   -22.883 1.00 46.83  ? 168  GLN D CA    1 
ATOM   2659 C C     . GLN C 1 47  ? 36.865  5.238   -22.995 1.00 44.17  ? 168  GLN D C     1 
ATOM   2660 O O     . GLN C 1 47  ? 36.339  4.562   -23.895 1.00 40.86  ? 168  GLN D O     1 
ATOM   2661 C CB    . GLN C 1 47  ? 38.953  4.213   -21.955 1.00 48.06  ? 168  GLN D CB    1 
ATOM   2662 C CG    . GLN C 1 47  ? 40.440  3.906   -22.108 1.00 52.00  ? 168  GLN D CG    1 
ATOM   2663 C CD    . GLN C 1 47  ? 40.958  2.841   -21.128 1.00 53.42  ? 168  GLN D CD    1 
ATOM   2664 O OE1   . GLN C 1 47  ? 40.599  1.659   -21.196 1.00 50.79  ? 168  GLN D OE1   1 
ATOM   2665 N NE2   . GLN C 1 47  ? 41.820  3.266   -20.219 1.00 55.51  ? 168  GLN D NE2   1 
ATOM   2666 N N     . LEU C 1 48  ? 36.164  5.890   -22.065 1.00 39.78  ? 169  LEU D N     1 
ATOM   2667 C CA    . LEU C 1 48  ? 34.711  6.006   -22.097 1.00 41.39  ? 169  LEU D CA    1 
ATOM   2668 C C     . LEU C 1 48  ? 34.270  6.846   -23.304 1.00 44.77  ? 169  LEU D C     1 
ATOM   2669 O O     . LEU C 1 48  ? 33.305  6.488   -23.986 1.00 46.99  ? 169  LEU D O     1 
ATOM   2670 C CB    . LEU C 1 48  ? 34.170  6.657   -20.798 1.00 41.09  ? 169  LEU D CB    1 
ATOM   2671 C CG    . LEU C 1 48  ? 34.422  5.957   -19.450 1.00 40.16  ? 169  LEU D CG    1 
ATOM   2672 C CD1   . LEU C 1 48  ? 34.238  6.873   -18.252 1.00 38.11  ? 169  LEU D CD1   1 
ATOM   2673 C CD2   . LEU C 1 48  ? 33.517  4.748   -19.294 1.00 40.33  ? 169  LEU D CD2   1 
ATOM   2674 N N     . GLU C 1 49  ? 34.957  7.956   -23.576 1.00 44.76  ? 170  GLU D N     1 
ATOM   2675 C CA    . GLU C 1 49  ? 34.644  8.737   -24.769 1.00 49.21  ? 170  GLU D CA    1 
ATOM   2676 C C     . GLU C 1 49  ? 34.928  7.958   -26.096 1.00 48.75  ? 170  GLU D C     1 
ATOM   2677 O O     . GLU C 1 49  ? 34.112  7.977   -27.021 1.00 51.22  ? 170  GLU D O     1 
ATOM   2678 C CB    . GLU C 1 49  ? 35.293  10.131  -24.692 1.00 55.37  ? 170  GLU D CB    1 
ATOM   2679 C CG    . GLU C 1 49  ? 34.439  11.109  -23.844 1.00 65.13  ? 170  GLU D CG    1 
ATOM   2680 C CD    . GLU C 1 49  ? 35.192  12.233  -23.079 1.00 68.37  ? 170  GLU D CD    1 
ATOM   2681 O OE1   . GLU C 1 49  ? 36.424  12.144  -22.841 1.00 62.48  ? 170  GLU D OE1   1 
ATOM   2682 O OE2   . GLU C 1 49  ? 34.518  13.221  -22.680 1.00 68.99  ? 170  GLU D OE2   1 
ATOM   2683 N N     . LYS C 1 50  ? 36.014  7.196   -26.145 1.00 48.65  ? 171  LYS D N     1 
ATOM   2684 C CA    . LYS C 1 50  ? 36.413  6.429   -27.351 1.00 47.56  ? 171  LYS D CA    1 
ATOM   2685 C C     . LYS C 1 50  ? 35.458  5.307   -27.699 1.00 45.10  ? 171  LYS D C     1 
ATOM   2686 O O     . LYS C 1 50  ? 35.235  5.015   -28.887 1.00 47.26  ? 171  LYS D O     1 
ATOM   2687 C CB    . LYS C 1 50  ? 37.797  5.832   -27.126 1.00 48.98  ? 171  LYS D CB    1 
ATOM   2688 C CG    . LYS C 1 50  ? 38.486  5.117   -28.289 1.00 48.25  ? 171  LYS D CG    1 
ATOM   2689 C CD    . LYS C 1 50  ? 39.834  4.602   -27.744 1.00 48.89  ? 171  LYS D CD    1 
ATOM   2690 C CE    . LYS C 1 50  ? 40.525  3.614   -28.639 1.00 48.94  ? 171  LYS D CE    1 
ATOM   2691 N NZ    . LYS C 1 50  ? 40.983  4.255   -29.900 1.00 53.98  ? 171  LYS D NZ    1 
ATOM   2692 N N     . ALA C 1 51  ? 34.914  4.684   -26.655 1.00 40.43  ? 172  ALA D N     1 
ATOM   2693 C CA    . ALA C 1 51  ? 33.907  3.650   -26.783 1.00 37.20  ? 172  ALA D CA    1 
ATOM   2694 C C     . ALA C 1 51  ? 32.530  4.236   -26.824 1.00 39.57  ? 172  ALA D C     1 
ATOM   2695 O O     . ALA C 1 51  ? 31.575  3.503   -27.027 1.00 46.19  ? 172  ALA D O     1 
ATOM   2696 C CB    . ALA C 1 51  ? 33.975  2.705   -25.608 1.00 38.55  ? 172  ALA D CB    1 
ATOM   2697 N N     . GLY C 1 52  ? 32.407  5.538   -26.603 1.00 40.40  ? 173  GLY D N     1 
ATOM   2698 C CA    . GLY C 1 52  ? 31.106  6.171   -26.490 1.00 39.94  ? 173  GLY D CA    1 
ATOM   2699 C C     . GLY C 1 52  ? 30.165  5.476   -25.509 1.00 38.62  ? 173  GLY D C     1 
ATOM   2700 O O     . GLY C 1 52  ? 29.016  5.216   -25.857 1.00 41.91  ? 173  GLY D O     1 
ATOM   2701 N N     . VAL C 1 53  ? 30.637  5.170   -24.298 1.00 34.73  ? 174  VAL D N     1 
ATOM   2702 C CA    . VAL C 1 53  ? 29.786  4.526   -23.290 1.00 34.61  ? 174  VAL D CA    1 
ATOM   2703 C C     . VAL C 1 53  ? 29.494  5.371   -22.054 1.00 36.01  ? 174  VAL D C     1 
ATOM   2704 O O     . VAL C 1 53  ? 29.045  4.843   -21.036 1.00 36.84  ? 174  VAL D O     1 
ATOM   2705 C CB    . VAL C 1 53  ? 30.371  3.177   -22.827 1.00 33.77  ? 174  VAL D CB    1 
ATOM   2706 C CG1   . VAL C 1 53  ? 30.575  2.264   -24.026 1.00 32.08  ? 174  VAL D CG1   1 
ATOM   2707 C CG2   . VAL C 1 53  ? 31.644  3.371   -22.006 1.00 33.67  ? 174  VAL D CG2   1 
ATOM   2708 N N     . GLU C 1 54  ? 29.719  6.679   -22.163 1.00 36.64  ? 175  GLU D N     1 
ATOM   2709 C CA    . GLU C 1 54  ? 29.560  7.594   -21.058 1.00 39.30  ? 175  GLU D CA    1 
ATOM   2710 C C     . GLU C 1 54  ? 28.119  7.624   -20.561 1.00 38.09  ? 175  GLU D C     1 
ATOM   2711 O O     . GLU C 1 54  ? 27.858  7.688   -19.368 1.00 39.55  ? 175  GLU D O     1 
ATOM   2712 C CB    . GLU C 1 54  ? 29.942  9.021   -21.456 1.00 46.00  ? 175  GLU D CB    1 
ATOM   2713 C CG    . GLU C 1 54  ? 31.228  9.194   -22.250 1.00 53.94  ? 175  GLU D CG    1 
ATOM   2714 C CD    . GLU C 1 54  ? 30.980  9.425   -23.756 1.00 62.10  ? 175  GLU D CD    1 
ATOM   2715 O OE1   . GLU C 1 54  ? 30.429  8.507   -24.448 1.00 57.05  ? 175  GLU D OE1   1 
ATOM   2716 O OE2   . GLU C 1 54  ? 31.353  10.537  -24.235 1.00 62.69  ? 175  GLU D OE2   1 
ATOM   2717 N N     . HIS C 1 55  ? 27.171  7.613   -21.477 1.00 38.00  ? 176  HIS D N     1 
ATOM   2718 C CA    . HIS C 1 55  ? 25.770  7.641   -21.078 1.00 36.51  ? 176  HIS D CA    1 
ATOM   2719 C C     . HIS C 1 55  ? 25.300  6.339   -20.467 1.00 35.52  ? 176  HIS D C     1 
ATOM   2720 O O     . HIS C 1 55  ? 24.411  6.349   -19.621 1.00 34.95  ? 176  HIS D O     1 
ATOM   2721 C CB    . HIS C 1 55  ? 24.896  8.060   -22.253 1.00 36.90  ? 176  HIS D CB    1 
ATOM   2722 C CG    . HIS C 1 55  ? 25.058  9.500   -22.621 1.00 37.83  ? 176  HIS D CG    1 
ATOM   2723 N ND1   . HIS C 1 55  ? 24.731  9.993   -23.862 1.00 39.07  ? 176  HIS D ND1   1 
ATOM   2724 C CD2   . HIS C 1 55  ? 25.530  10.551  -21.909 1.00 36.84  ? 176  HIS D CD2   1 
ATOM   2725 C CE1   . HIS C 1 55  ? 24.981  11.287  -23.893 1.00 39.50  ? 176  HIS D CE1   1 
ATOM   2726 N NE2   . HIS C 1 55  ? 25.482  11.645  -22.726 1.00 38.08  ? 176  HIS D NE2   1 
ATOM   2727 N N     . GLN C 1 56  ? 25.911  5.228   -20.861 1.00 38.38  ? 177  GLN D N     1 
ATOM   2728 C CA    . GLN C 1 56  ? 25.672  3.958   -20.170 1.00 42.75  ? 177  GLN D CA    1 
ATOM   2729 C C     . GLN C 1 56  ? 26.297  4.005   -18.784 1.00 38.34  ? 177  GLN D C     1 
ATOM   2730 O O     . GLN C 1 56  ? 25.761  3.439   -17.851 1.00 35.17  ? 177  GLN D O     1 
ATOM   2731 C CB    . GLN C 1 56  ? 26.164  2.743   -20.970 1.00 49.17  ? 177  GLN D CB    1 
ATOM   2732 C CG    . GLN C 1 56  ? 25.560  2.684   -22.374 1.00 59.04  ? 177  GLN D CG    1 
ATOM   2733 C CD    . GLN C 1 56  ? 25.733  1.342   -23.076 1.00 70.35  ? 177  GLN D CD    1 
ATOM   2734 O OE1   . GLN C 1 56  ? 25.010  1.036   -24.041 1.00 77.21  ? 177  GLN D OE1   1 
ATOM   2735 N NE2   . GLN C 1 56  ? 26.692  0.532   -22.600 1.00 75.99  ? 177  GLN D NE2   1 
ATOM   2736 N N     . LEU C 1 57  ? 27.400  4.719   -18.628 1.00 36.55  ? 178  LEU D N     1 
ATOM   2737 C CA    . LEU C 1 57  ? 27.974  4.846   -17.298 1.00 36.84  ? 178  LEU D CA    1 
ATOM   2738 C C     . LEU C 1 57  ? 27.061  5.720   -16.435 1.00 36.10  ? 178  LEU D C     1 
ATOM   2739 O O     . LEU C 1 57  ? 26.685  5.332   -15.322 1.00 34.75  ? 178  LEU D O     1 
ATOM   2740 C CB    . LEU C 1 57  ? 29.414  5.402   -17.324 1.00 35.19  ? 178  LEU D CB    1 
ATOM   2741 C CG    . LEU C 1 57  ? 29.963  5.721   -15.912 1.00 35.15  ? 178  LEU D CG    1 
ATOM   2742 C CD1   . LEU C 1 57  ? 29.981  4.488   -15.019 1.00 34.27  ? 178  LEU D CD1   1 
ATOM   2743 C CD2   . LEU C 1 57  ? 31.350  6.339   -15.982 1.00 35.64  ? 178  LEU D CD2   1 
ATOM   2744 N N     . ARG C 1 58  ? 26.737  6.902   -16.947 1.00 35.31  ? 179  ARG D N     1 
ATOM   2745 C CA    . ARG C 1 58  ? 25.879  7.844   -16.243 1.00 37.91  ? 179  ARG D CA    1 
ATOM   2746 C C     . ARG C 1 58  ? 24.647  7.134   -15.719 1.00 39.34  ? 179  ARG D C     1 
ATOM   2747 O O     . ARG C 1 58  ? 24.351  7.184   -14.533 1.00 41.73  ? 179  ARG D O     1 
ATOM   2748 C CB    . ARG C 1 58  ? 25.449  8.962   -17.184 1.00 39.25  ? 179  ARG D CB    1 
ATOM   2749 C CG    . ARG C 1 58  ? 24.539  10.022  -16.576 1.00 39.23  ? 179  ARG D CG    1 
ATOM   2750 C CD    . ARG C 1 58  ? 24.454  11.221  -17.509 1.00 39.60  ? 179  ARG D CD    1 
ATOM   2751 N NE    . ARG C 1 58  ? 23.575  10.939  -18.638 1.00 39.71  ? 179  ARG D NE    1 
ATOM   2752 C CZ    . ARG C 1 58  ? 23.374  11.754  -19.667 1.00 37.85  ? 179  ARG D CZ    1 
ATOM   2753 N NH1   . ARG C 1 58  ? 23.991  12.931  -19.748 1.00 38.88  ? 179  ARG D NH1   1 
ATOM   2754 N NH2   . ARG C 1 58  ? 22.555  11.381  -20.630 1.00 35.23  ? 179  ARG D NH2   1 
ATOM   2755 N N     . ARG C 1 59  ? 23.949  6.442   -16.607 1.00 40.68  ? 180  ARG D N     1 
ATOM   2756 C CA    . ARG C 1 59  ? 22.733  5.724   -16.229 1.00 41.15  ? 180  ARG D CA    1 
ATOM   2757 C C     . ARG C 1 59  ? 22.984  4.671   -15.151 1.00 38.76  ? 180  ARG D C     1 
ATOM   2758 O O     . ARG C 1 59  ? 22.261  4.639   -14.181 1.00 36.69  ? 180  ARG D O     1 
ATOM   2759 C CB    . ARG C 1 59  ? 22.119  5.067   -17.452 1.00 41.77  ? 180  ARG D CB    1 
ATOM   2760 C CG    . ARG C 1 59  ? 20.778  4.423   -17.191 1.00 45.81  ? 180  ARG D CG    1 
ATOM   2761 C CD    . ARG C 1 59  ? 20.614  3.205   -18.073 1.00 51.56  ? 180  ARG D CD    1 
ATOM   2762 N NE    . ARG C 1 59  ? 20.543  3.551   -19.488 1.00 57.10  ? 180  ARG D NE    1 
ATOM   2763 C CZ    . ARG C 1 59  ? 19.414  3.732   -20.176 1.00 71.38  ? 180  ARG D CZ    1 
ATOM   2764 N NH1   . ARG C 1 59  ? 18.215  3.603   -19.603 1.00 77.23  ? 180  ARG D NH1   1 
ATOM   2765 N NH2   . ARG C 1 59  ? 19.480  4.048   -21.462 1.00 80.72  ? 180  ARG D NH2   1 
ATOM   2766 N N     . GLU C 1 60  ? 24.006  3.825   -15.304 1.00 40.72  ? 181  GLU D N     1 
ATOM   2767 C CA    . GLU C 1 60  ? 24.256  2.793   -14.291 1.00 44.20  ? 181  GLU D CA    1 
ATOM   2768 C C     . GLU C 1 60  ? 24.619  3.372   -12.924 1.00 40.40  ? 181  GLU D C     1 
ATOM   2769 O O     . GLU C 1 60  ? 24.226  2.827   -11.917 1.00 39.23  ? 181  GLU D O     1 
ATOM   2770 C CB    . GLU C 1 60  ? 25.211  1.668   -14.762 1.00 50.60  ? 181  GLU D CB    1 
ATOM   2771 C CG    . GLU C 1 60  ? 26.688  1.978   -14.956 1.00 59.89  ? 181  GLU D CG    1 
ATOM   2772 C CD    . GLU C 1 60  ? 27.434  0.851   -15.711 1.00 69.21  ? 181  GLU D CD    1 
ATOM   2773 O OE1   . GLU C 1 60  ? 27.533  -0.274  -15.157 1.00 77.59  ? 181  GLU D OE1   1 
ATOM   2774 O OE2   . GLU C 1 60  ? 27.916  1.074   -16.860 1.00 63.45  ? 181  GLU D OE2   1 
ATOM   2775 N N     . VAL C 1 61  ? 25.277  4.527   -12.907 1.00 40.20  ? 182  VAL D N     1 
ATOM   2776 C CA    . VAL C 1 61  ? 25.601  5.273   -11.669 1.00 37.22  ? 182  VAL D CA    1 
ATOM   2777 C C     . VAL C 1 61  ? 24.405  5.999   -11.053 1.00 36.62  ? 182  VAL D C     1 
ATOM   2778 O O     . VAL C 1 61  ? 24.253  6.050   -9.831  1.00 36.23  ? 182  VAL D O     1 
ATOM   2779 C CB    . VAL C 1 61  ? 26.687  6.321   -11.958 1.00 35.61  ? 182  VAL D CB    1 
ATOM   2780 C CG1   . VAL C 1 61  ? 26.854  7.283   -10.799 1.00 34.25  ? 182  VAL D CG1   1 
ATOM   2781 C CG2   . VAL C 1 61  ? 27.988  5.618   -12.273 1.00 36.26  ? 182  VAL D CG2   1 
ATOM   2782 N N     . GLU C 1 62  ? 23.574  6.593   -11.898 1.00 38.38  ? 183  GLU D N     1 
ATOM   2783 C CA    . GLU C 1 62  ? 22.356  7.255   -11.424 1.00 38.54  ? 183  GLU D CA    1 
ATOM   2784 C C     . GLU C 1 62  ? 21.465  6.213   -10.780 1.00 37.65  ? 183  GLU D C     1 
ATOM   2785 O O     . GLU C 1 62  ? 21.041  6.369   -9.630  1.00 36.43  ? 183  GLU D O     1 
ATOM   2786 C CB    . GLU C 1 62  ? 21.647  8.011   -12.554 1.00 38.54  ? 183  GLU D CB    1 
ATOM   2787 C CG    . GLU C 1 62  ? 22.492  9.167   -13.093 1.00 41.38  ? 183  GLU D CG    1 
ATOM   2788 C CD    . GLU C 1 62  ? 21.751  10.131  -14.024 1.00 47.75  ? 183  GLU D CD    1 
ATOM   2789 O OE1   . GLU C 1 62  ? 20.767  9.743   -14.713 1.00 52.85  ? 183  GLU D OE1   1 
ATOM   2790 O OE2   . GLU C 1 62  ? 22.179  11.311  -14.076 1.00 50.37  ? 183  GLU D OE2   1 
ATOM   2791 N N     . ILE C 1 63  ? 21.247  5.110   -11.485 1.00 36.38  ? 184  ILE D N     1 
ATOM   2792 C CA    . ILE C 1 63  ? 20.365  4.060   -10.972 1.00 36.50  ? 184  ILE D CA    1 
ATOM   2793 C C     . ILE C 1 63  ? 20.879  3.415   -9.662  1.00 35.61  ? 184  ILE D C     1 
ATOM   2794 O O     . ILE C 1 63  ? 20.149  3.312   -8.698  1.00 35.63  ? 184  ILE D O     1 
ATOM   2795 C CB    . ILE C 1 63  ? 20.083  3.004   -12.058 1.00 35.92  ? 184  ILE D CB    1 
ATOM   2796 C CG1   . ILE C 1 63  ? 19.129  3.579   -13.101 1.00 34.80  ? 184  ILE D CG1   1 
ATOM   2797 C CG2   . ILE C 1 63  ? 19.462  1.753   -11.460 1.00 37.87  ? 184  ILE D CG2   1 
ATOM   2798 C CD1   . ILE C 1 63  ? 18.951  2.709   -14.328 1.00 35.36  ? 184  ILE D CD1   1 
ATOM   2799 N N     . GLN C 1 64  ? 22.138  3.011   -9.622  1.00 35.37  ? 185  GLN D N     1 
ATOM   2800 C CA    . GLN C 1 64  ? 22.624  2.234   -8.502  1.00 34.98  ? 185  GLN D CA    1 
ATOM   2801 C C     . GLN C 1 64  ? 22.687  3.044   -7.245  1.00 37.28  ? 185  GLN D C     1 
ATOM   2802 O O     . GLN C 1 64  ? 22.237  2.588   -6.222  1.00 37.60  ? 185  GLN D O     1 
ATOM   2803 C CB    . GLN C 1 64  ? 23.999  1.673   -8.809  1.00 36.10  ? 185  GLN D CB    1 
ATOM   2804 C CG    . GLN C 1 64  ? 24.535  0.726   -7.750  1.00 37.20  ? 185  GLN D CG    1 
ATOM   2805 C CD    . GLN C 1 64  ? 25.774  -0.002  -8.197  1.00 39.47  ? 185  GLN D CD    1 
ATOM   2806 O OE1   . GLN C 1 64  ? 26.269  0.193   -9.300  1.00 41.32  ? 185  GLN D OE1   1 
ATOM   2807 N NE2   . GLN C 1 64  ? 26.280  -0.857  -7.341  1.00 47.42  ? 185  GLN D NE2   1 
ATOM   2808 N N     . SER C 1 65  ? 23.245  4.249   -7.334  1.00 42.46  ? 186  SER D N     1 
ATOM   2809 C CA    . SER C 1 65  ? 23.387  5.160   -6.193  1.00 45.47  ? 186  SER D CA    1 
ATOM   2810 C C     . SER C 1 65  ? 22.086  5.552   -5.505  1.00 45.73  ? 186  SER D C     1 
ATOM   2811 O O     . SER C 1 65  ? 22.144  6.170   -4.445  1.00 51.89  ? 186  SER D O     1 
ATOM   2812 C CB    . SER C 1 65  ? 24.108  6.453   -6.612  1.00 47.17  ? 186  SER D CB    1 
ATOM   2813 O OG    . SER C 1 65  ? 23.350  7.166   -7.572  1.00 47.48  ? 186  SER D OG    1 
ATOM   2814 N N     . HIS C 1 66  ? 20.938  5.236   -6.102  1.00 47.34  ? 187  HIS D N     1 
ATOM   2815 C CA    . HIS C 1 66  ? 19.618  5.442   -5.454  1.00 52.99  ? 187  HIS D CA    1 
ATOM   2816 C C     . HIS C 1 66  ? 18.975  4.104   -5.142  1.00 49.02  ? 187  HIS D C     1 
ATOM   2817 O O     . HIS C 1 66  ? 17.824  3.874   -5.440  1.00 54.99  ? 187  HIS D O     1 
ATOM   2818 C CB    . HIS C 1 66  ? 18.678  6.316   -6.324  1.00 57.35  ? 187  HIS D CB    1 
ATOM   2819 C CG    . HIS C 1 66  ? 19.133  7.743   -6.449  1.00 61.38  ? 187  HIS D CG    1 
ATOM   2820 N ND1   . HIS C 1 66  ? 19.715  8.246   -7.592  1.00 59.69  ? 187  HIS D ND1   1 
ATOM   2821 C CD2   . HIS C 1 66  ? 19.139  8.757   -5.551  1.00 65.34  ? 187  HIS D CD2   1 
ATOM   2822 C CE1   . HIS C 1 66  ? 20.050  9.507   -7.399  1.00 59.62  ? 187  HIS D CE1   1 
ATOM   2823 N NE2   . HIS C 1 66  ? 19.707  9.843   -6.170  1.00 64.71  ? 187  HIS D NE2   1 
ATOM   2824 N N     . LEU C 1 67  ? 19.748  3.231   -4.531  1.00 46.90  ? 188  LEU D N     1 
ATOM   2825 C CA    . LEU C 1 67  ? 19.312  1.890   -4.196  1.00 49.00  ? 188  LEU D CA    1 
ATOM   2826 C C     . LEU C 1 67  ? 19.982  1.500   -2.865  1.00 51.74  ? 188  LEU D C     1 
ATOM   2827 O O     . LEU C 1 67  ? 21.203  1.316   -2.811  1.00 49.97  ? 188  LEU D O     1 
ATOM   2828 C CB    . LEU C 1 67  ? 19.708  0.920   -5.318  1.00 49.23  ? 188  LEU D CB    1 
ATOM   2829 C CG    . LEU C 1 67  ? 18.710  0.256   -6.290  1.00 50.25  ? 188  LEU D CG    1 
ATOM   2830 C CD1   . LEU C 1 67  ? 17.602  1.171   -6.790  1.00 52.95  ? 188  LEU D CD1   1 
ATOM   2831 C CD2   . LEU C 1 67  ? 19.465  -0.341  -7.479  1.00 49.27  ? 188  LEU D CD2   1 
ATOM   2832 N N     . ARG C 1 68  ? 19.192  1.434   -1.793  1.00 54.82  ? 189  ARG D N     1 
ATOM   2833 C CA    . ARG C 1 68  ? 19.691  1.013   -0.479  1.00 60.11  ? 189  ARG D CA    1 
ATOM   2834 C C     . ARG C 1 68  ? 19.045  -0.340  -0.203  1.00 52.16  ? 189  ARG D C     1 
ATOM   2835 O O     . ARG C 1 68  ? 17.866  -0.409  0.093   1.00 50.47  ? 189  ARG D O     1 
ATOM   2836 C CB    . ARG C 1 68  ? 19.335  2.011   0.642   1.00 67.28  ? 189  ARG D CB    1 
ATOM   2837 C CG    . ARG C 1 68  ? 19.154  3.475   0.219   1.00 82.04  ? 189  ARG D CG    1 
ATOM   2838 C CD    . ARG C 1 68  ? 20.419  4.325   0.350   1.00 88.63  ? 189  ARG D CD    1 
ATOM   2839 N NE    . ARG C 1 68  ? 20.669  4.743   1.739   1.00 98.75  ? 189  ARG D NE    1 
ATOM   2840 C CZ    . ARG C 1 68  ? 20.352  5.931   2.269   1.00 101.65 ? 189  ARG D CZ    1 
ATOM   2841 N NH1   . ARG C 1 68  ? 19.743  6.870   1.546   1.00 107.39 ? 189  ARG D NH1   1 
ATOM   2842 N NH2   . ARG C 1 68  ? 20.641  6.177   3.547   1.00 93.55  ? 189  ARG D NH2   1 
ATOM   2843 N N     . HIS C 1 69  ? 19.796  -1.420  -0.353  1.00 48.43  ? 190  HIS D N     1 
ATOM   2844 C CA    . HIS C 1 69  ? 19.263  -2.716  -0.021  1.00 47.09  ? 190  HIS D CA    1 
ATOM   2845 C C     . HIS C 1 69  ? 20.367  -3.695  0.320   1.00 48.27  ? 190  HIS D C     1 
ATOM   2846 O O     . HIS C 1 69  ? 21.354  -3.789  -0.409  1.00 49.49  ? 190  HIS D O     1 
ATOM   2847 C CB    . HIS C 1 69  ? 18.435  -3.249  -1.181  1.00 49.69  ? 190  HIS D CB    1 
ATOM   2848 C CG    . HIS C 1 69  ? 17.655  -4.484  -0.848  1.00 49.69  ? 190  HIS D CG    1 
ATOM   2849 N ND1   . HIS C 1 69  ? 18.205  -5.746  -0.914  1.00 48.54  ? 190  HIS D ND1   1 
ATOM   2850 C CD2   . HIS C 1 69  ? 16.381  -4.650  -0.424  1.00 47.60  ? 190  HIS D CD2   1 
ATOM   2851 C CE1   . HIS C 1 69  ? 17.297  -6.637  -0.567  1.00 47.97  ? 190  HIS D CE1   1 
ATOM   2852 N NE2   . HIS C 1 69  ? 16.181  -5.998  -0.264  1.00 47.15  ? 190  HIS D NE2   1 
ATOM   2853 N N     . PRO C 1 70  ? 20.192  -4.456  1.423   1.00 49.81  ? 191  PRO D N     1 
ATOM   2854 C CA    . PRO C 1 70  ? 21.255  -5.360  1.946   1.00 45.46  ? 191  PRO D CA    1 
ATOM   2855 C C     . PRO C 1 70  ? 21.873  -6.256  0.892   1.00 43.36  ? 191  PRO D C     1 
ATOM   2856 O O     . PRO C 1 70  ? 23.062  -6.522  0.926   1.00 43.50  ? 191  PRO D O     1 
ATOM   2857 C CB    . PRO C 1 70  ? 20.538  -6.200  3.014   1.00 45.06  ? 191  PRO D CB    1 
ATOM   2858 C CG    . PRO C 1 70  ? 19.098  -5.802  2.993   1.00 46.05  ? 191  PRO D CG    1 
ATOM   2859 C CD    . PRO C 1 70  ? 18.967  -4.503  2.248   1.00 46.84  ? 191  PRO D CD    1 
ATOM   2860 N N     . ASN C 1 71  ? 21.043  -6.720  -0.031  1.00 45.27  ? 192  ASN D N     1 
ATOM   2861 C CA    . ASN C 1 71  ? 21.471  -7.571  -1.142  1.00 42.40  ? 192  ASN D CA    1 
ATOM   2862 C C     . ASN C 1 71  ? 21.854  -6.859  -2.454  1.00 40.49  ? 192  ASN D C     1 
ATOM   2863 O O     . ASN C 1 71  ? 21.983  -7.513  -3.482  1.00 40.02  ? 192  ASN D O     1 
ATOM   2864 C CB    . ASN C 1 71  ? 20.371  -8.605  -1.401  1.00 43.70  ? 192  ASN D CB    1 
ATOM   2865 C CG    . ASN C 1 71  ? 20.197  -9.570  -0.236  1.00 45.83  ? 192  ASN D CG    1 
ATOM   2866 O OD1   . ASN C 1 71  ? 21.170  -10.117 0.276   1.00 45.15  ? 192  ASN D OD1   1 
ATOM   2867 N ND2   . ASN C 1 71  ? 18.954  -9.785  0.184   1.00 48.64  ? 192  ASN D ND2   1 
ATOM   2868 N N     . ILE C 1 72  ? 22.038  -5.536  -2.417  1.00 41.16  ? 193  ILE D N     1 
ATOM   2869 C CA    . ILE C 1 72  ? 22.498  -4.739  -3.584  1.00 39.43  ? 193  ILE D CA    1 
ATOM   2870 C C     . ILE C 1 72  ? 23.765  -3.954  -3.218  1.00 36.68  ? 193  ILE D C     1 
ATOM   2871 O O     . ILE C 1 72  ? 23.817  -3.334  -2.160  1.00 34.70  ? 193  ILE D O     1 
ATOM   2872 C CB    . ILE C 1 72  ? 21.391  -3.755  -4.065  1.00 38.99  ? 193  ILE D CB    1 
ATOM   2873 C CG1   . ILE C 1 72  ? 20.164  -4.561  -4.540  1.00 39.18  ? 193  ILE D CG1   1 
ATOM   2874 C CG2   . ILE C 1 72  ? 21.917  -2.824  -5.166  1.00 37.28  ? 193  ILE D CG2   1 
ATOM   2875 C CD1   . ILE C 1 72  ? 19.165  -3.794  -5.400  1.00 37.27  ? 193  ILE D CD1   1 
ATOM   2876 N N     . LEU C 1 73  ? 24.789  -3.978  -4.067  1.00 36.28  ? 194  LEU D N     1 
ATOM   2877 C CA    . LEU C 1 73  ? 26.021  -3.253  -3.729  1.00 37.67  ? 194  LEU D CA    1 
ATOM   2878 C C     . LEU C 1 73  ? 25.716  -1.774  -3.626  1.00 40.98  ? 194  LEU D C     1 
ATOM   2879 O O     . LEU C 1 73  ? 25.172  -1.195  -4.593  1.00 39.86  ? 194  LEU D O     1 
ATOM   2880 C CB    . LEU C 1 73  ? 27.114  -3.420  -4.783  1.00 38.75  ? 194  LEU D CB    1 
ATOM   2881 C CG    . LEU C 1 73  ? 28.379  -4.224  -4.458  1.00 39.30  ? 194  LEU D CG    1 
ATOM   2882 C CD1   . LEU C 1 73  ? 29.542  -3.774  -5.348  1.00 37.05  ? 194  LEU D CD1   1 
ATOM   2883 C CD2   . LEU C 1 73  ? 28.771  -4.112  -2.998  1.00 39.55  ? 194  LEU D CD2   1 
ATOM   2884 N N     . ARG C 1 74  ? 26.051  -1.170  -2.476  1.00 38.54  ? 195  ARG D N     1 
ATOM   2885 C CA    . ARG C 1 74  ? 25.915  0.265   -2.306  1.00 41.07  ? 195  ARG D CA    1 
ATOM   2886 C C     . ARG C 1 74  ? 27.008  0.955   -3.086  1.00 40.08  ? 195  ARG D C     1 
ATOM   2887 O O     . ARG C 1 74  ? 28.170  0.590   -2.973  1.00 38.54  ? 195  ARG D O     1 
ATOM   2888 C CB    . ARG C 1 74  ? 26.030  0.712   -0.845  1.00 45.48  ? 195  ARG D CB    1 
ATOM   2889 C CG    . ARG C 1 74  ? 24.793  1.388   -0.266  1.00 50.28  ? 195  ARG D CG    1 
ATOM   2890 C CD    . ARG C 1 74  ? 24.341  2.644   -1.032  1.00 57.30  ? 195  ARG D CD    1 
ATOM   2891 N NE    . ARG C 1 74  ? 24.564  3.923   -0.339  1.00 61.52  ? 195  ARG D NE    1 
ATOM   2892 C CZ    . ARG C 1 74  ? 24.045  4.260   0.847   1.00 64.89  ? 195  ARG D CZ    1 
ATOM   2893 N NH1   . ARG C 1 74  ? 23.293  3.406   1.527   1.00 70.58  ? 195  ARG D NH1   1 
ATOM   2894 N NH2   . ARG C 1 74  ? 24.299  5.455   1.379   1.00 66.57  ? 195  ARG D NH2   1 
ATOM   2895 N N     . LEU C 1 75  ? 26.599  1.938   -3.889  1.00 40.51  ? 196  LEU D N     1 
ATOM   2896 C CA    . LEU C 1 75  ? 27.481  2.917   -4.485  1.00 37.79  ? 196  LEU D CA    1 
ATOM   2897 C C     . LEU C 1 75  ? 27.172  4.181   -3.727  1.00 39.16  ? 196  LEU D C     1 
ATOM   2898 O O     . LEU C 1 75  ? 26.067  4.703   -3.835  1.00 43.18  ? 196  LEU D O     1 
ATOM   2899 C CB    . LEU C 1 75  ? 27.168  3.101   -5.963  1.00 36.41  ? 196  LEU D CB    1 
ATOM   2900 C CG    . LEU C 1 75  ? 27.723  4.335   -6.661  1.00 36.72  ? 196  LEU D CG    1 
ATOM   2901 C CD1   . LEU C 1 75  ? 29.216  4.263   -6.778  1.00 38.92  ? 196  LEU D CD1   1 
ATOM   2902 C CD2   . LEU C 1 75  ? 27.180  4.461   -8.062  1.00 40.70  ? 196  LEU D CD2   1 
ATOM   2903 N N     . TYR C 1 76  ? 28.146  4.656   -2.959  1.00 38.31  ? 197  TYR D N     1 
ATOM   2904 C CA    . TYR C 1 76  ? 27.969  5.777   -2.057  1.00 38.34  ? 197  TYR D CA    1 
ATOM   2905 C C     . TYR C 1 76  ? 28.068  7.120   -2.739  1.00 38.17  ? 197  TYR D C     1 
ATOM   2906 O O     . TYR C 1 76  ? 27.479  8.094   -2.278  1.00 40.98  ? 197  TYR D O     1 
ATOM   2907 C CB    . TYR C 1 76  ? 29.025  5.728   -0.947  1.00 39.69  ? 197  TYR D CB    1 
ATOM   2908 C CG    . TYR C 1 76  ? 28.811  4.598   0.014   1.00 40.70  ? 197  TYR D CG    1 
ATOM   2909 C CD1   . TYR C 1 76  ? 27.696  4.588   0.848   1.00 41.75  ? 197  TYR D CD1   1 
ATOM   2910 C CD2   . TYR C 1 76  ? 29.717  3.529   0.091   1.00 43.31  ? 197  TYR D CD2   1 
ATOM   2911 C CE1   . TYR C 1 76  ? 27.476  3.558   1.735   1.00 42.63  ? 197  TYR D CE1   1 
ATOM   2912 C CE2   . TYR C 1 76  ? 29.515  2.491   0.991   1.00 45.27  ? 197  TYR D CE2   1 
ATOM   2913 C CZ    . TYR C 1 76  ? 28.384  2.519   1.804   1.00 46.03  ? 197  TYR D CZ    1 
ATOM   2914 O OH    . TYR C 1 76  ? 28.137  1.512   2.693   1.00 50.93  ? 197  TYR D OH    1 
ATOM   2915 N N     . GLY C 1 77  ? 28.844  7.206   -3.804  1.00 36.61  ? 198  GLY D N     1 
ATOM   2916 C CA    . GLY C 1 77  ? 29.009  8.489   -4.470  1.00 35.53  ? 198  GLY D CA    1 
ATOM   2917 C C     . GLY C 1 77  ? 29.932  8.399   -5.650  1.00 33.48  ? 198  GLY D C     1 
ATOM   2918 O O     . GLY C 1 77  ? 30.380  7.323   -6.002  1.00 35.96  ? 198  GLY D O     1 
ATOM   2919 N N     . TYR C 1 78  ? 30.216  9.538   -6.259  1.00 32.25  ? 199  TYR D N     1 
ATOM   2920 C CA    . TYR C 1 78  ? 31.166  9.601   -7.361  1.00 31.62  ? 199  TYR D CA    1 
ATOM   2921 C C     . TYR C 1 78  ? 31.827  10.985  -7.425  1.00 33.25  ? 199  TYR D C     1 
ATOM   2922 O O     . TYR C 1 78  ? 31.342  11.949  -6.821  1.00 34.89  ? 199  TYR D O     1 
ATOM   2923 C CB    . TYR C 1 78  ? 30.453  9.265   -8.683  1.00 31.23  ? 199  TYR D CB    1 
ATOM   2924 C CG    . TYR C 1 78  ? 29.997  10.456  -9.481  1.00 29.05  ? 199  TYR D CG    1 
ATOM   2925 C CD1   . TYR C 1 78  ? 28.898  11.181  -9.099  1.00 31.41  ? 199  TYR D CD1   1 
ATOM   2926 C CD2   . TYR C 1 78  ? 30.681  10.856  -10.596 1.00 29.84  ? 199  TYR D CD2   1 
ATOM   2927 C CE1   . TYR C 1 78  ? 28.486  12.296  -9.809  1.00 33.65  ? 199  TYR D CE1   1 
ATOM   2928 C CE2   . TYR C 1 78  ? 30.281  11.956  -11.324 1.00 31.78  ? 199  TYR D CE2   1 
ATOM   2929 C CZ    . TYR C 1 78  ? 29.181  12.670  -10.931 1.00 32.46  ? 199  TYR D CZ    1 
ATOM   2930 O OH    . TYR C 1 78  ? 28.781  13.765  -11.641 1.00 34.38  ? 199  TYR D OH    1 
ATOM   2931 N N     . PHE C 1 79  ? 32.947  11.074  -8.132  1.00 34.24  ? 200  PHE D N     1 
ATOM   2932 C CA    . PHE C 1 79  ? 33.540  12.358  -8.462  1.00 35.14  ? 200  PHE D CA    1 
ATOM   2933 C C     . PHE C 1 79  ? 34.473  12.097  -9.612  1.00 36.17  ? 200  PHE D C     1 
ATOM   2934 O O     . PHE C 1 79  ? 34.584  10.981  -10.057 1.00 34.27  ? 200  PHE D O     1 
ATOM   2935 C CB    . PHE C 1 79  ? 34.275  12.983  -7.271  1.00 34.99  ? 200  PHE D CB    1 
ATOM   2936 C CG    . PHE C 1 79  ? 35.364  12.116  -6.713  1.00 36.09  ? 200  PHE D CG    1 
ATOM   2937 C CD1   . PHE C 1 79  ? 35.063  11.059  -5.868  1.00 37.56  ? 200  PHE D CD1   1 
ATOM   2938 C CD2   . PHE C 1 79  ? 36.673  12.335  -7.047  1.00 36.15  ? 200  PHE D CD2   1 
ATOM   2939 C CE1   . PHE C 1 79  ? 36.059  10.242  -5.354  1.00 36.60  ? 200  PHE D CE1   1 
ATOM   2940 C CE2   . PHE C 1 79  ? 37.673  11.516  -6.554  1.00 38.10  ? 200  PHE D CE2   1 
ATOM   2941 C CZ    . PHE C 1 79  ? 37.367  10.464  -5.704  1.00 36.50  ? 200  PHE D CZ    1 
ATOM   2942 N N     . HIS C 1 80  ? 35.133  13.135  -10.097 1.00 42.03  ? 201  HIS D N     1 
ATOM   2943 C CA    . HIS C 1 80  ? 35.923  13.016  -11.291 1.00 44.32  ? 201  HIS D CA    1 
ATOM   2944 C C     . HIS C 1 80  ? 36.935  14.114  -11.359 1.00 45.90  ? 201  HIS D C     1 
ATOM   2945 O O     . HIS C 1 80  ? 36.627  15.245  -11.032 1.00 47.85  ? 201  HIS D O     1 
ATOM   2946 C CB    . HIS C 1 80  ? 35.026  13.053  -12.544 1.00 48.29  ? 201  HIS D CB    1 
ATOM   2947 C CG    . HIS C 1 80  ? 34.170  14.284  -12.690 1.00 46.50  ? 201  HIS D CG    1 
ATOM   2948 N ND1   . HIS C 1 80  ? 34.554  15.373  -13.445 1.00 46.97  ? 201  HIS D ND1   1 
ATOM   2949 C CD2   . HIS C 1 80  ? 32.910  14.551  -12.266 1.00 47.86  ? 201  HIS D CD2   1 
ATOM   2950 C CE1   . HIS C 1 80  ? 33.589  16.278  -13.437 1.00 46.18  ? 201  HIS D CE1   1 
ATOM   2951 N NE2   . HIS C 1 80  ? 32.574  15.800  -12.740 1.00 45.64  ? 201  HIS D NE2   1 
ATOM   2952 N N     . ASP C 1 81  ? 38.145  13.764  -11.772 1.00 47.89  ? 202  ASP D N     1 
ATOM   2953 C CA    . ASP C 1 81  ? 39.188  14.738  -11.977 1.00 48.43  ? 202  ASP D CA    1 
ATOM   2954 C C     . ASP C 1 81  ? 39.291  14.916  -13.485 1.00 52.41  ? 202  ASP D C     1 
ATOM   2955 O O     . ASP C 1 81  ? 38.410  14.454  -14.230 1.00 50.32  ? 202  ASP D O     1 
ATOM   2956 C CB    . ASP C 1 81  ? 40.500  14.309  -11.288 1.00 50.76  ? 202  ASP D CB    1 
ATOM   2957 C CG    . ASP C 1 81  ? 41.223  13.159  -11.989 1.00 57.64  ? 202  ASP D CG    1 
ATOM   2958 O OD1   . ASP C 1 81  ? 41.115  12.994  -13.225 1.00 61.33  ? 202  ASP D OD1   1 
ATOM   2959 O OD2   . ASP C 1 81  ? 41.958  12.424  -11.290 1.00 63.16  ? 202  ASP D OD2   1 
ATOM   2960 N N     . ALA C 1 82  ? 40.342  15.587  -13.940 1.00 55.11  ? 203  ALA D N     1 
ATOM   2961 C CA    . ALA C 1 82  ? 40.480  15.914  -15.354 1.00 56.92  ? 203  ALA D CA    1 
ATOM   2962 C C     . ALA C 1 82  ? 40.464  14.682  -16.268 1.00 63.23  ? 203  ALA D C     1 
ATOM   2963 O O     . ALA C 1 82  ? 39.965  14.773  -17.396 1.00 73.80  ? 203  ALA D O     1 
ATOM   2964 C CB    . ALA C 1 82  ? 41.752  16.721  -15.584 1.00 58.19  ? 203  ALA D CB    1 
ATOM   2965 N N     . THR C 1 83  ? 40.987  13.543  -15.789 1.00 60.38  ? 204  THR D N     1 
ATOM   2966 C CA    . THR C 1 83  ? 41.174  12.341  -16.631 1.00 57.09  ? 204  THR D CA    1 
ATOM   2967 C C     . THR C 1 83  ? 40.487  11.026  -16.195 1.00 47.97  ? 204  THR D C     1 
ATOM   2968 O O     . THR C 1 83  ? 40.426  10.083  -16.977 1.00 43.36  ? 204  THR D O     1 
ATOM   2969 C CB    . THR C 1 83  ? 42.668  12.026  -16.732 1.00 57.51  ? 204  THR D CB    1 
ATOM   2970 O OG1   . THR C 1 83  ? 43.160  11.695  -15.424 1.00 65.96  ? 204  THR D OG1   1 
ATOM   2971 C CG2   . THR C 1 83  ? 43.417  13.211  -17.285 1.00 55.14  ? 204  THR D CG2   1 
ATOM   2972 N N     . ARG C 1 84  ? 40.006  10.971  -14.958 1.00 42.68  ? 205  ARG D N     1 
ATOM   2973 C CA    . ARG C 1 84  ? 39.477  9.758   -14.373 1.00 41.50  ? 205  ARG D CA    1 
ATOM   2974 C C     . ARG C 1 84  ? 38.083  9.981   -13.798 1.00 40.73  ? 205  ARG D C     1 
ATOM   2975 O O     . ARG C 1 84  ? 37.734  11.084  -13.383 1.00 44.01  ? 205  ARG D O     1 
ATOM   2976 C CB    . ARG C 1 84  ? 40.393  9.299   -13.233 1.00 45.20  ? 205  ARG D CB    1 
ATOM   2977 C CG    . ARG C 1 84  ? 41.588  8.475   -13.672 1.00 48.45  ? 205  ARG D CG    1 
ATOM   2978 C CD    . ARG C 1 84  ? 42.577  8.265   -12.527 1.00 53.63  ? 205  ARG D CD    1 
ATOM   2979 N NE    . ARG C 1 84  ? 43.335  9.467   -12.194 1.00 56.99  ? 205  ARG D NE    1 
ATOM   2980 C CZ    . ARG C 1 84  ? 44.296  9.984   -12.964 1.00 67.73  ? 205  ARG D CZ    1 
ATOM   2981 N NH1   . ARG C 1 84  ? 44.635  9.428   -14.137 1.00 65.98  ? 205  ARG D NH1   1 
ATOM   2982 N NH2   . ARG C 1 84  ? 44.925  11.083  -12.566 1.00 74.23  ? 205  ARG D NH2   1 
ATOM   2983 N N     . VAL C 1 85  ? 37.290  8.924   -13.750 1.00 37.26  ? 206  VAL D N     1 
ATOM   2984 C CA    . VAL C 1 85  ? 36.055  8.947   -12.988 1.00 37.53  ? 206  VAL D CA    1 
ATOM   2985 C C     . VAL C 1 85  ? 36.198  7.923   -11.871 1.00 38.31  ? 206  VAL D C     1 
ATOM   2986 O O     . VAL C 1 85  ? 36.758  6.830   -12.075 1.00 41.64  ? 206  VAL D O     1 
ATOM   2987 C CB    . VAL C 1 85  ? 34.834  8.602   -13.864 1.00 36.28  ? 206  VAL D CB    1 
ATOM   2988 C CG1   . VAL C 1 85  ? 33.555  8.688   -13.061 1.00 35.20  ? 206  VAL D CG1   1 
ATOM   2989 C CG2   . VAL C 1 85  ? 34.753  9.557   -15.029 1.00 39.53  ? 206  VAL D CG2   1 
ATOM   2990 N N     . TYR C 1 86  ? 35.660  8.260   -10.709 1.00 35.83  ? 207  TYR D N     1 
ATOM   2991 C CA    . TYR C 1 86  ? 35.815  7.450   -9.524  1.00 36.19  ? 207  TYR D CA    1 
ATOM   2992 C C     . TYR C 1 86  ? 34.462  7.121   -8.928  1.00 35.94  ? 207  TYR D C     1 
ATOM   2993 O O     . TYR C 1 86  ? 33.647  8.026   -8.793  1.00 36.98  ? 207  TYR D O     1 
ATOM   2994 C CB    . TYR C 1 86  ? 36.572  8.265   -8.503  1.00 37.12  ? 207  TYR D CB    1 
ATOM   2995 C CG    . TYR C 1 86  ? 37.939  8.693   -8.906  1.00 35.51  ? 207  TYR D CG    1 
ATOM   2996 C CD1   . TYR C 1 86  ? 39.044  7.880   -8.644  1.00 38.61  ? 207  TYR D CD1   1 
ATOM   2997 C CD2   . TYR C 1 86  ? 38.155  9.928   -9.490  1.00 35.46  ? 207  TYR D CD2   1 
ATOM   2998 C CE1   . TYR C 1 86  ? 40.338  8.283   -8.991  1.00 39.21  ? 207  TYR D CE1   1 
ATOM   2999 C CE2   . TYR C 1 86  ? 39.440  10.353  -9.829  1.00 37.74  ? 207  TYR D CE2   1 
ATOM   3000 C CZ    . TYR C 1 86  ? 40.529  9.530   -9.577  1.00 38.41  ? 207  TYR D CZ    1 
ATOM   3001 O OH    . TYR C 1 86  ? 41.798  9.934   -9.909  1.00 39.21  ? 207  TYR D OH    1 
ATOM   3002 N N     . LEU C 1 87  ? 34.220  5.849   -8.580  1.00 35.98  ? 208  LEU D N     1 
ATOM   3003 C CA    . LEU C 1 87  ? 32.938  5.405   -8.003  1.00 33.80  ? 208  LEU D CA    1 
ATOM   3004 C C     . LEU C 1 87  ? 33.185  4.798   -6.645  1.00 37.64  ? 208  LEU D C     1 
ATOM   3005 O O     . LEU C 1 87  ? 34.012  3.885   -6.512  1.00 39.99  ? 208  LEU D O     1 
ATOM   3006 C CB    . LEU C 1 87  ? 32.315  4.332   -8.855  1.00 33.56  ? 208  LEU D CB    1 
ATOM   3007 C CG    . LEU C 1 87  ? 32.126  4.608   -10.335 1.00 34.57  ? 208  LEU D CG    1 
ATOM   3008 C CD1   . LEU C 1 87  ? 31.515  3.378   -11.000 1.00 34.62  ? 208  LEU D CD1   1 
ATOM   3009 C CD2   . LEU C 1 87  ? 31.243  5.823   -10.516 1.00 34.98  ? 208  LEU D CD2   1 
ATOM   3010 N N     . ILE C 1 88  ? 32.478  5.269   -5.624  1.00 37.19  ? 209  ILE D N     1 
ATOM   3011 C CA    . ILE C 1 88  ? 32.782  4.832   -4.275  1.00 36.27  ? 209  ILE D CA    1 
ATOM   3012 C C     . ILE C 1 88  ? 31.783  3.749   -3.908  1.00 39.22  ? 209  ILE D C     1 
ATOM   3013 O O     . ILE C 1 88  ? 30.606  4.038   -3.669  1.00 35.93  ? 209  ILE D O     1 
ATOM   3014 C CB    . ILE C 1 88  ? 32.735  6.006   -3.297  1.00 38.30  ? 209  ILE D CB    1 
ATOM   3015 C CG1   . ILE C 1 88  ? 33.759  7.078   -3.708  1.00 39.54  ? 209  ILE D CG1   1 
ATOM   3016 C CG2   . ILE C 1 88  ? 33.002  5.552   -1.861  1.00 36.41  ? 209  ILE D CG2   1 
ATOM   3017 C CD1   . ILE C 1 88  ? 33.329  8.473   -3.301  1.00 40.46  ? 209  ILE D CD1   1 
ATOM   3018 N N     . LEU C 1 89  ? 32.275  2.502   -3.863  1.00 41.30  ? 210  LEU D N     1 
ATOM   3019 C CA    . LEU C 1 89  ? 31.432  1.314   -3.730  1.00 40.38  ? 210  LEU D CA    1 
ATOM   3020 C C     . LEU C 1 89  ? 31.607  0.606   -2.390  1.00 41.72  ? 210  LEU D C     1 
ATOM   3021 O O     . LEU C 1 89  ? 32.674  0.662   -1.759  1.00 37.12  ? 210  LEU D O     1 
ATOM   3022 C CB    . LEU C 1 89  ? 31.775  0.334   -4.834  1.00 41.69  ? 210  LEU D CB    1 
ATOM   3023 C CG    . LEU C 1 89  ? 31.669  0.861   -6.271  1.00 41.79  ? 210  LEU D CG    1 
ATOM   3024 C CD1   . LEU C 1 89  ? 32.556  0.069   -7.220  1.00 40.43  ? 210  LEU D CD1   1 
ATOM   3025 C CD2   . LEU C 1 89  ? 30.223  0.825   -6.730  1.00 42.04  ? 210  LEU D CD2   1 
ATOM   3026 N N     . GLU C 1 90  ? 30.547  -0.069  -1.961  1.00 40.84  ? 211  GLU D N     1 
ATOM   3027 C CA    . GLU C 1 90  ? 30.656  -1.010  -0.861  1.00 42.37  ? 211  GLU D CA    1 
ATOM   3028 C C     . GLU C 1 90  ? 31.674  -2.071  -1.285  1.00 40.55  ? 211  GLU D C     1 
ATOM   3029 O O     . GLU C 1 90  ? 31.811  -2.384  -2.475  1.00 39.93  ? 211  GLU D O     1 
ATOM   3030 C CB    . GLU C 1 90  ? 29.269  -1.590  -0.510  1.00 44.07  ? 211  GLU D CB    1 
ATOM   3031 C CG    . GLU C 1 90  ? 29.223  -2.953  0.166   1.00 46.85  ? 211  GLU D CG    1 
ATOM   3032 C CD    . GLU C 1 90  ? 27.812  -3.343  0.683   1.00 55.66  ? 211  GLU D CD    1 
ATOM   3033 O OE1   . GLU C 1 90  ? 26.793  -3.338  -0.072  1.00 50.74  ? 211  GLU D OE1   1 
ATOM   3034 O OE2   . GLU C 1 90  ? 27.715  -3.693  1.886   1.00 69.20  ? 211  GLU D OE2   1 
ATOM   3035 N N     . TYR C 1 91  ? 32.419  -2.581  -0.315  1.00 40.14  ? 212  TYR D N     1 
ATOM   3036 C CA    . TYR C 1 91  ? 33.470  -3.577  -0.560  1.00 40.19  ? 212  TYR D CA    1 
ATOM   3037 C C     . TYR C 1 91  ? 32.960  -4.977  -0.201  1.00 40.51  ? 212  TYR D C     1 
ATOM   3038 O O     . TYR C 1 91  ? 32.499  -5.210  0.912   1.00 39.83  ? 212  TYR D O     1 
ATOM   3039 C CB    . TYR C 1 91  ? 34.720  -3.227  0.247   1.00 38.96  ? 212  TYR D CB    1 
ATOM   3040 C CG    . TYR C 1 91  ? 35.733  -4.332  0.321   1.00 38.74  ? 212  TYR D CG    1 
ATOM   3041 C CD1   . TYR C 1 91  ? 36.175  -4.978  -0.837  1.00 40.30  ? 212  TYR D CD1   1 
ATOM   3042 C CD2   . TYR C 1 91  ? 36.260  -4.742  1.548   1.00 36.33  ? 212  TYR D CD2   1 
ATOM   3043 C CE1   . TYR C 1 91  ? 37.113  -6.003  -0.774  1.00 39.65  ? 212  TYR D CE1   1 
ATOM   3044 C CE2   . TYR C 1 91  ? 37.186  -5.767  1.616   1.00 35.79  ? 212  TYR D CE2   1 
ATOM   3045 C CZ    . TYR C 1 91  ? 37.603  -6.386  0.455   1.00 38.84  ? 212  TYR D CZ    1 
ATOM   3046 O OH    . TYR C 1 91  ? 38.530  -7.383  0.512   1.00 45.72  ? 212  TYR D OH    1 
ATOM   3047 N N     . ALA C 1 92  ? 33.044  -5.885  -1.172  1.00 45.13  ? 213  ALA D N     1 
ATOM   3048 C CA    . ALA C 1 92  ? 32.609  -7.294  -1.059  1.00 48.60  ? 213  ALA D CA    1 
ATOM   3049 C C     . ALA C 1 92  ? 33.836  -8.264  -0.983  1.00 51.97  ? 213  ALA D C     1 
ATOM   3050 O O     . ALA C 1 92  ? 34.471  -8.576  -1.997  1.00 46.72  ? 213  ALA D O     1 
ATOM   3051 C CB    . ALA C 1 92  ? 31.717  -7.649  -2.246  1.00 44.55  ? 213  ALA D CB    1 
ATOM   3052 N N     . PRO C 1 93  ? 34.168  -8.747  0.223   1.00 58.33  ? 214  PRO D N     1 
ATOM   3053 C CA    . PRO C 1 93  ? 35.424  -9.498  0.339   1.00 60.75  ? 214  PRO D CA    1 
ATOM   3054 C C     . PRO C 1 93  ? 35.460  -10.841 -0.406  1.00 60.61  ? 214  PRO D C     1 
ATOM   3055 O O     . PRO C 1 93  ? 36.415  -11.122 -1.131  1.00 68.53  ? 214  PRO D O     1 
ATOM   3056 C CB    . PRO C 1 93  ? 35.550  -9.725  1.853   1.00 63.39  ? 214  PRO D CB    1 
ATOM   3057 C CG    . PRO C 1 93  ? 34.662  -8.685  2.485   1.00 61.04  ? 214  PRO D CG    1 
ATOM   3058 C CD    . PRO C 1 93  ? 33.516  -8.565  1.535   1.00 59.50  ? 214  PRO D CD    1 
ATOM   3059 N N     . LEU C 1 94  ? 34.416  -11.646 -0.272  1.00 56.60  ? 215  LEU D N     1 
ATOM   3060 C CA    . LEU C 1 94  ? 34.509  -13.063 -0.630  1.00 51.92  ? 215  LEU D CA    1 
ATOM   3061 C C     . LEU C 1 94  ? 34.348  -13.374 -2.130  1.00 50.02  ? 215  LEU D C     1 
ATOM   3062 O O     . LEU C 1 94  ? 33.932  -14.468 -2.507  1.00 46.15  ? 215  LEU D O     1 
ATOM   3063 C CB    . LEU C 1 94  ? 33.532  -13.846 0.251   1.00 51.41  ? 215  LEU D CB    1 
ATOM   3064 C CG    . LEU C 1 94  ? 33.814  -13.643 1.759   1.00 50.51  ? 215  LEU D CG    1 
ATOM   3065 C CD1   . LEU C 1 94  ? 32.975  -14.559 2.623   1.00 51.79  ? 215  LEU D CD1   1 
ATOM   3066 C CD2   . LEU C 1 94  ? 35.268  -13.885 2.097   1.00 48.40  ? 215  LEU D CD2   1 
ATOM   3067 N N     . GLY C 1 95  ? 34.706  -12.409 -2.984  1.00 49.60  ? 216  GLY D N     1 
ATOM   3068 C CA    . GLY C 1 95  ? 34.669  -12.590 -4.440  1.00 45.84  ? 216  GLY D CA    1 
ATOM   3069 C C     . GLY C 1 95  ? 33.305  -12.732 -5.083  1.00 43.29  ? 216  GLY D C     1 
ATOM   3070 O O     . GLY C 1 95  ? 32.306  -12.252 -4.557  1.00 48.00  ? 216  GLY D O     1 
ATOM   3071 N N     . THR C 1 96  ? 33.262  -13.418 -6.221  1.00 43.61  ? 217  THR D N     1 
ATOM   3072 C CA    . THR C 1 96  ? 32.026  -13.577 -6.998  1.00 43.73  ? 217  THR D CA    1 
ATOM   3073 C C     . THR C 1 96  ? 31.413  -14.963 -6.882  1.00 43.04  ? 217  THR D C     1 
ATOM   3074 O O     . THR C 1 96  ? 32.101  -15.954 -6.635  1.00 49.12  ? 217  THR D O     1 
ATOM   3075 C CB    . THR C 1 96  ? 32.283  -13.323 -8.502  1.00 44.38  ? 217  THR D CB    1 
ATOM   3076 O OG1   . THR C 1 96  ? 32.863  -14.483 -9.095  1.00 46.10  ? 217  THR D OG1   1 
ATOM   3077 C CG2   . THR C 1 96  ? 33.229  -12.168 -8.704  1.00 43.51  ? 217  THR D CG2   1 
ATOM   3078 N N     . VAL C 1 97  ? 30.111  -15.036 -7.095  1.00 43.32  ? 218  VAL D N     1 
ATOM   3079 C CA    . VAL C 1 97  ? 29.423  -16.326 -7.223  1.00 42.46  ? 218  VAL D CA    1 
ATOM   3080 C C     . VAL C 1 97  ? 29.930  -17.125 -8.421  1.00 41.92  ? 218  VAL D C     1 
ATOM   3081 O O     . VAL C 1 97  ? 29.735  -18.332 -8.485  1.00 39.27  ? 218  VAL D O     1 
ATOM   3082 C CB    . VAL C 1 97  ? 27.904  -16.133 -7.367  1.00 41.14  ? 218  VAL D CB    1 
ATOM   3083 C CG1   . VAL C 1 97  ? 27.181  -17.472 -7.534  1.00 42.57  ? 218  VAL D CG1   1 
ATOM   3084 C CG2   . VAL C 1 97  ? 27.389  -15.400 -6.158  1.00 39.94  ? 218  VAL D CG2   1 
ATOM   3085 N N     . TYR C 1 98  ? 30.558  -16.461 -9.381  1.00 43.28  ? 219  TYR D N     1 
ATOM   3086 C CA    . TYR C 1 98  ? 31.198  -17.194 -10.451 1.00 48.09  ? 219  TYR D CA    1 
ATOM   3087 C C     . TYR C 1 98  ? 32.371  -18.038 -9.915  1.00 43.86  ? 219  TYR D C     1 
ATOM   3088 O O     . TYR C 1 98  ? 32.471  -19.220 -10.231 1.00 41.52  ? 219  TYR D O     1 
ATOM   3089 C CB    . TYR C 1 98  ? 31.658  -16.265 -11.573 1.00 53.57  ? 219  TYR D CB    1 
ATOM   3090 C CG    . TYR C 1 98  ? 32.248  -17.021 -12.736 1.00 61.07  ? 219  TYR D CG    1 
ATOM   3091 C CD1   . TYR C 1 98  ? 31.433  -17.798 -13.579 1.00 66.77  ? 219  TYR D CD1   1 
ATOM   3092 C CD2   . TYR C 1 98  ? 33.619  -16.990 -12.977 1.00 61.91  ? 219  TYR D CD2   1 
ATOM   3093 C CE1   . TYR C 1 98  ? 31.978  -18.508 -14.634 1.00 70.57  ? 219  TYR D CE1   1 
ATOM   3094 C CE2   . TYR C 1 98  ? 34.174  -17.684 -14.033 1.00 66.68  ? 219  TYR D CE2   1 
ATOM   3095 C CZ    . TYR C 1 98  ? 33.358  -18.438 -14.854 1.00 72.16  ? 219  TYR D CZ    1 
ATOM   3096 O OH    . TYR C 1 98  ? 33.943  -19.121 -15.883 1.00 78.35  ? 219  TYR D OH    1 
ATOM   3097 N N     . ARG C 1 99  ? 33.232  -17.455 -9.085  1.00 43.35  ? 220  ARG D N     1 
ATOM   3098 C CA    . ARG C 1 99  ? 34.352  -18.224 -8.553  1.00 46.43  ? 220  ARG D CA    1 
ATOM   3099 C C     . ARG C 1 99  ? 33.797  -19.359 -7.747  1.00 45.89  ? 220  ARG D C     1 
ATOM   3100 O O     . ARG C 1 99  ? 34.202  -20.487 -7.952  1.00 47.81  ? 220  ARG D O     1 
ATOM   3101 C CB    . ARG C 1 99  ? 35.319  -17.423 -7.680  1.00 51.00  ? 220  ARG D CB    1 
ATOM   3102 C CG    . ARG C 1 99  ? 36.731  -18.008 -7.721  1.00 60.95  ? 220  ARG D CG    1 
ATOM   3103 C CD    . ARG C 1 99  ? 37.454  -18.067 -6.378  1.00 72.33  ? 220  ARG D CD    1 
ATOM   3104 N NE    . ARG C 1 99  ? 38.316  -16.910 -6.122  1.00 82.73  ? 220  ARG D NE    1 
ATOM   3105 C CZ    . ARG C 1 99  ? 37.919  -15.762 -5.560  1.00 95.34  ? 220  ARG D CZ    1 
ATOM   3106 N NH1   . ARG C 1 99  ? 36.657  -15.582 -5.172  1.00 103.38 ? 220  ARG D NH1   1 
ATOM   3107 N NH2   . ARG C 1 99  ? 38.796  -14.776 -5.371  1.00 96.46  ? 220  ARG D NH2   1 
ATOM   3108 N N     . GLU C 1 100 ? 32.862  -19.067 -6.845  1.00 43.92  ? 221  GLU D N     1 
ATOM   3109 C CA    . GLU C 1 100 ? 32.323  -20.096 -5.971  1.00 45.65  ? 221  GLU D CA    1 
ATOM   3110 C C     . GLU C 1 100 ? 31.798  -21.286 -6.775  1.00 47.94  ? 221  GLU D C     1 
ATOM   3111 O O     . GLU C 1 100 ? 32.061  -22.446 -6.435  1.00 52.35  ? 221  GLU D O     1 
ATOM   3112 C CB    . GLU C 1 100 ? 31.232  -19.539 -5.051  1.00 46.71  ? 221  GLU D CB    1 
ATOM   3113 C CG    . GLU C 1 100 ? 30.737  -20.548 -4.020  1.00 50.78  ? 221  GLU D CG    1 
ATOM   3114 C CD    . GLU C 1 100 ? 29.799  -19.953 -2.977  1.00 55.98  ? 221  GLU D CD    1 
ATOM   3115 O OE1   . GLU C 1 100 ? 29.063  -18.997 -3.312  1.00 54.32  ? 221  GLU D OE1   1 
ATOM   3116 O OE2   . GLU C 1 100 ? 29.797  -20.448 -1.816  1.00 60.82  ? 221  GLU D OE2   1 
ATOM   3117 N N     . LEU C 1 101 ? 31.091  -21.006 -7.858  1.00 48.51  ? 222  LEU D N     1 
ATOM   3118 C CA    . LEU C 1 101 ? 30.440  -22.061 -8.617  1.00 49.77  ? 222  LEU D CA    1 
ATOM   3119 C C     . LEU C 1 101 ? 31.439  -22.941 -9.370  1.00 49.37  ? 222  LEU D C     1 
ATOM   3120 O O     . LEU C 1 101 ? 31.253  -24.152 -9.466  1.00 50.79  ? 222  LEU D O     1 
ATOM   3121 C CB    . LEU C 1 101 ? 29.414  -21.457 -9.559  1.00 47.42  ? 222  LEU D CB    1 
ATOM   3122 C CG    . LEU C 1 101 ? 28.418  -22.423 -10.163 1.00 47.46  ? 222  LEU D CG    1 
ATOM   3123 C CD1   . LEU C 1 101 ? 27.727  -23.290 -9.123  1.00 46.97  ? 222  LEU D CD1   1 
ATOM   3124 C CD2   . LEU C 1 101 ? 27.412  -21.601 -10.934 1.00 49.75  ? 222  LEU D CD2   1 
ATOM   3125 N N     . GLN C 1 102 ? 32.506  -22.340 -9.875  1.00 53.44  ? 223  GLN D N     1 
ATOM   3126 C CA    . GLN C 1 102 ? 33.637  -23.112 -10.408 1.00 61.36  ? 223  GLN D CA    1 
ATOM   3127 C C     . GLN C 1 102 ? 34.283  -24.026 -9.361  1.00 63.03  ? 223  GLN D C     1 
ATOM   3128 O O     . GLN C 1 102 ? 34.549  -25.190 -9.649  1.00 67.15  ? 223  GLN D O     1 
ATOM   3129 C CB    . GLN C 1 102 ? 34.713  -22.185 -10.957 1.00 66.71  ? 223  GLN D CB    1 
ATOM   3130 C CG    . GLN C 1 102 ? 34.333  -21.461 -12.234 1.00 72.09  ? 223  GLN D CG    1 
ATOM   3131 C CD    . GLN C 1 102 ? 35.434  -20.512 -12.689 1.00 83.69  ? 223  GLN D CD    1 
ATOM   3132 O OE1   . GLN C 1 102 ? 36.029  -19.776 -11.878 1.00 83.05  ? 223  GLN D OE1   1 
ATOM   3133 N NE2   . GLN C 1 102 ? 35.717  -20.518 -13.992 1.00 86.83  ? 223  GLN D NE2   1 
ATOM   3134 N N     . LYS C 1 103 ? 34.533  -23.492 -8.162  1.00 61.35  ? 224  LYS D N     1 
ATOM   3135 C CA    . LYS C 1 103 ? 35.186  -24.241 -7.070  1.00 62.18  ? 224  LYS D CA    1 
ATOM   3136 C C     . LYS C 1 103 ? 34.325  -25.361 -6.466  1.00 54.15  ? 224  LYS D C     1 
ATOM   3137 O O     . LYS C 1 103 ? 34.863  -26.328 -5.918  1.00 55.31  ? 224  LYS D O     1 
ATOM   3138 C CB    . LYS C 1 103 ? 35.639  -23.306 -5.922  1.00 65.70  ? 224  LYS D CB    1 
ATOM   3139 C CG    . LYS C 1 103 ? 36.690  -22.269 -6.285  1.00 69.63  ? 224  LYS D CG    1 
ATOM   3140 C CD    . LYS C 1 103 ? 38.015  -22.874 -6.722  1.00 76.80  ? 224  LYS D CD    1 
ATOM   3141 C CE    . LYS C 1 103 ? 38.776  -21.929 -7.648  1.00 83.36  ? 224  LYS D CE    1 
ATOM   3142 N NZ    . LYS C 1 103 ? 40.039  -22.555 -8.128  1.00 87.05  ? 224  LYS D NZ    1 
ATOM   3143 N N     . LEU C 1 104 ? 33.010  -25.226 -6.528  1.00 46.05  ? 225  LEU D N     1 
ATOM   3144 C CA    . LEU C 1 104 ? 32.145  -26.312 -6.094  1.00 45.01  ? 225  LEU D CA    1 
ATOM   3145 C C     . LEU C 1 104 ? 31.507  -27.070 -7.240  1.00 43.71  ? 225  LEU D C     1 
ATOM   3146 O O     . LEU C 1 104 ? 30.854  -28.058 -6.975  1.00 42.12  ? 225  LEU D O     1 
ATOM   3147 C CB    . LEU C 1 104 ? 31.019  -25.808 -5.195  1.00 45.70  ? 225  LEU D CB    1 
ATOM   3148 C CG    . LEU C 1 104 ? 31.387  -25.007 -3.953  1.00 47.10  ? 225  LEU D CG    1 
ATOM   3149 C CD1   . LEU C 1 104 ? 30.133  -24.807 -3.127  1.00 44.91  ? 225  LEU D CD1   1 
ATOM   3150 C CD2   . LEU C 1 104 ? 32.484  -25.674 -3.121  1.00 46.86  ? 225  LEU D CD2   1 
ATOM   3151 N N     . SER C 1 105 ? 31.647  -26.616 -8.491  1.00 45.77  ? 226  SER D N     1 
ATOM   3152 C CA    . SER C 1 105 ? 31.068  -27.341 -9.648  1.00 50.07  ? 226  SER D CA    1 
ATOM   3153 C C     . SER C 1 105 ? 29.541  -27.079 -9.797  1.00 52.58  ? 226  SER D C     1 
ATOM   3154 O O     . SER C 1 105 ? 29.075  -26.591 -10.843 1.00 51.33  ? 226  SER D O     1 
ATOM   3155 C CB    . SER C 1 105 ? 31.348  -28.857 -9.525  1.00 50.19  ? 226  SER D CB    1 
ATOM   3156 O OG    . SER C 1 105 ? 31.526  -29.465 -10.781 1.00 51.90  ? 226  SER D OG    1 
ATOM   3157 N N     . LYS C 1 106 ? 28.786  -27.431 -8.752  1.00 51.42  ? 227  LYS D N     1 
ATOM   3158 C CA    . LYS C 1 106 ? 27.412  -26.977 -8.558  1.00 50.65  ? 227  LYS D CA    1 
ATOM   3159 C C     . LYS C 1 106 ? 27.103  -26.759 -7.064  1.00 49.03  ? 227  LYS D C     1 
ATOM   3160 O O     . LYS C 1 106 ? 27.925  -27.067 -6.196  1.00 43.06  ? 227  LYS D O     1 
ATOM   3161 C CB    . LYS C 1 106 ? 26.428  -27.969 -9.161  1.00 51.58  ? 227  LYS D CB    1 
ATOM   3162 C CG    . LYS C 1 106 ? 26.546  -29.374 -8.614  1.00 53.33  ? 227  LYS D CG    1 
ATOM   3163 C CD    . LYS C 1 106 ? 25.894  -30.363 -9.564  1.00 55.99  ? 227  LYS D CD    1 
ATOM   3164 C CE    . LYS C 1 106 ? 26.312  -31.784 -9.243  1.00 60.58  ? 227  LYS D CE    1 
ATOM   3165 N NZ    . LYS C 1 106 ? 26.037  -32.705 -10.385 1.00 64.93  ? 227  LYS D NZ    1 
ATOM   3166 N N     . PHE C 1 107 ? 25.922  -26.199 -6.796  1.00 46.10  ? 228  PHE D N     1 
ATOM   3167 C CA    . PHE C 1 107 ? 25.440  -25.960 -5.453  1.00 45.59  ? 228  PHE D CA    1 
ATOM   3168 C C     . PHE C 1 107 ? 24.348  -26.928 -5.034  1.00 48.09  ? 228  PHE D C     1 
ATOM   3169 O O     . PHE C 1 107 ? 23.602  -27.494 -5.847  1.00 53.73  ? 228  PHE D O     1 
ATOM   3170 C CB    . PHE C 1 107 ? 24.873  -24.545 -5.340  1.00 49.05  ? 228  PHE D CB    1 
ATOM   3171 C CG    . PHE C 1 107 ? 25.873  -23.458 -5.584  1.00 47.23  ? 228  PHE D CG    1 
ATOM   3172 C CD1   . PHE C 1 107 ? 27.231  -23.670 -5.398  1.00 48.65  ? 228  PHE D CD1   1 
ATOM   3173 C CD2   . PHE C 1 107 ? 25.446  -22.211 -5.971  1.00 48.02  ? 228  PHE D CD2   1 
ATOM   3174 C CE1   . PHE C 1 107 ? 28.147  -22.661 -5.634  1.00 49.66  ? 228  PHE D CE1   1 
ATOM   3175 C CE2   . PHE C 1 107 ? 26.350  -21.188 -6.194  1.00 49.74  ? 228  PHE D CE2   1 
ATOM   3176 C CZ    . PHE C 1 107 ? 27.706  -21.417 -6.025  1.00 50.42  ? 228  PHE D CZ    1 
ATOM   3177 N N     . ASP C 1 108 ? 24.254  -27.108 -3.734  1.00 50.46  ? 229  ASP D N     1 
ATOM   3178 C CA    . ASP C 1 108 ? 23.183  -27.893 -3.147  1.00 55.44  ? 229  ASP D CA    1 
ATOM   3179 C C     . ASP C 1 108 ? 21.857  -27.118 -3.169  1.00 50.99  ? 229  ASP D C     1 
ATOM   3180 O O     . ASP C 1 108 ? 21.843  -25.911 -3.381  1.00 47.01  ? 229  ASP D O     1 
ATOM   3181 C CB    . ASP C 1 108 ? 23.550  -28.276 -1.705  1.00 60.86  ? 229  ASP D CB    1 
ATOM   3182 C CG    . ASP C 1 108 ? 24.003  -27.074 -0.865  1.00 68.61  ? 229  ASP D CG    1 
ATOM   3183 O OD1   . ASP C 1 108 ? 25.059  -26.454 -1.181  1.00 74.86  ? 229  ASP D OD1   1 
ATOM   3184 O OD2   . ASP C 1 108 ? 23.293  -26.748 0.108   1.00 75.68  ? 229  ASP D OD2   1 
ATOM   3185 N N     . GLU C 1 109 ? 20.757  -27.822 -2.923  1.00 49.12  ? 230  GLU D N     1 
ATOM   3186 C CA    . GLU C 1 109 ? 19.455  -27.188 -2.776  1.00 50.70  ? 230  GLU D CA    1 
ATOM   3187 C C     . GLU C 1 109 ? 19.448  -26.049 -1.734  1.00 49.58  ? 230  GLU D C     1 
ATOM   3188 O O     . GLU C 1 109 ? 18.758  -25.042 -1.913  1.00 45.27  ? 230  GLU D O     1 
ATOM   3189 C CB    . GLU C 1 109 ? 18.378  -28.232 -2.436  1.00 50.86  ? 230  GLU D CB    1 
ATOM   3190 C CG    . GLU C 1 109 ? 18.204  -29.299 -3.517  1.00 56.92  ? 230  GLU D CG    1 
ATOM   3191 C CD    . GLU C 1 109 ? 16.833  -29.998 -3.489  1.00 66.49  ? 230  GLU D CD    1 
ATOM   3192 O OE1   . GLU C 1 109 ? 16.460  -30.541 -2.412  1.00 74.85  ? 230  GLU D OE1   1 
ATOM   3193 O OE2   . GLU C 1 109 ? 16.120  -30.012 -4.544  1.00 59.06  ? 230  GLU D OE2   1 
ATOM   3194 N N     . GLN C 1 110 ? 20.202  -26.202 -0.649  1.00 52.68  ? 231  GLN D N     1 
ATOM   3195 C CA    . GLN C 1 110 ? 20.097  -25.249 0.455   1.00 55.58  ? 231  GLN D CA    1 
ATOM   3196 C C     . GLN C 1 110 ? 20.728  -23.915 0.053   1.00 55.67  ? 231  GLN D C     1 
ATOM   3197 O O     . GLN C 1 110 ? 20.131  -22.866 0.265   1.00 59.34  ? 231  GLN D O     1 
ATOM   3198 C CB    . GLN C 1 110 ? 20.714  -25.807 1.746   1.00 60.05  ? 231  GLN D CB    1 
ATOM   3199 C CG    . GLN C 1 110 ? 20.616  -24.865 2.955   1.00 66.58  ? 231  GLN D CG    1 
ATOM   3200 C CD    . GLN C 1 110 ? 21.920  -24.714 3.747   1.00 69.11  ? 231  GLN D CD    1 
ATOM   3201 O OE1   . GLN C 1 110 ? 23.018  -24.625 3.178   1.00 70.79  ? 231  GLN D OE1   1 
ATOM   3202 N NE2   . GLN C 1 110 ? 21.798  -24.657 5.069   1.00 68.61  ? 231  GLN D NE2   1 
ATOM   3203 N N     . ARG C 1 111 ? 21.920  -23.964 -0.539  1.00 50.85  ? 232  ARG D N     1 
ATOM   3204 C CA    . ARG C 1 111 ? 22.592  -22.767 -1.054  1.00 50.24  ? 232  ARG D CA    1 
ATOM   3205 C C     . ARG C 1 111 ? 21.836  -22.026 -2.184  1.00 51.09  ? 232  ARG D C     1 
ATOM   3206 O O     . ARG C 1 111 ? 21.655  -20.792 -2.136  1.00 48.68  ? 232  ARG D O     1 
ATOM   3207 C CB    . ARG C 1 111 ? 23.973  -23.146 -1.558  1.00 51.45  ? 232  ARG D CB    1 
ATOM   3208 C CG    . ARG C 1 111 ? 24.690  -22.034 -2.296  1.00 54.02  ? 232  ARG D CG    1 
ATOM   3209 C CD    . ARG C 1 111 ? 26.187  -22.219 -2.198  1.00 57.30  ? 232  ARG D CD    1 
ATOM   3210 N NE    . ARG C 1 111 ? 26.657  -21.839 -0.873  1.00 59.82  ? 232  ARG D NE    1 
ATOM   3211 C CZ    . ARG C 1 111 ? 27.796  -22.252 -0.331  1.00 66.15  ? 232  ARG D CZ    1 
ATOM   3212 N NH1   . ARG C 1 111 ? 28.604  -23.050 -1.009  1.00 71.50  ? 232  ARG D NH1   1 
ATOM   3213 N NH2   . ARG C 1 111 ? 28.140  -21.857 0.889   1.00 66.43  ? 232  ARG D NH2   1 
ATOM   3214 N N     . THR C 1 112 ? 21.437  -22.772 -3.212  1.00 45.94  ? 233  THR D N     1 
ATOM   3215 C CA    . THR C 1 112 ? 20.618  -22.222 -4.283  1.00 43.16  ? 233  THR D CA    1 
ATOM   3216 C C     . THR C 1 112 ? 19.327  -21.522 -3.805  1.00 42.28  ? 233  THR D C     1 
ATOM   3217 O O     . THR C 1 112 ? 19.072  -20.378 -4.176  1.00 43.85  ? 233  THR D O     1 
ATOM   3218 C CB    . THR C 1 112 ? 20.267  -23.314 -5.281  1.00 42.49  ? 233  THR D CB    1 
ATOM   3219 O OG1   . THR C 1 112 ? 21.484  -23.880 -5.773  1.00 45.17  ? 233  THR D OG1   1 
ATOM   3220 C CG2   . THR C 1 112 ? 19.463  -22.756 -6.429  1.00 43.22  ? 233  THR D CG2   1 
ATOM   3221 N N     . ALA C 1 113 ? 18.533  -22.181 -2.970  1.00 41.86  ? 234  ALA D N     1 
ATOM   3222 C CA    . ALA C 1 113 ? 17.269  -21.590 -2.523  1.00 41.78  ? 234  ALA D CA    1 
ATOM   3223 C C     . ALA C 1 113 ? 17.538  -20.306 -1.771  1.00 45.67  ? 234  ALA D C     1 
ATOM   3224 O O     . ALA C 1 113 ? 16.728  -19.375 -1.825  1.00 54.68  ? 234  ALA D O     1 
ATOM   3225 C CB    . ALA C 1 113 ? 16.490  -22.554 -1.653  1.00 39.87  ? 234  ALA D CB    1 
ATOM   3226 N N     . THR C 1 114 ? 18.679  -20.252 -1.086  1.00 43.43  ? 235  THR D N     1 
ATOM   3227 C CA    . THR C 1 114 ? 19.046  -19.111 -0.247  1.00 43.34  ? 235  THR D CA    1 
ATOM   3228 C C     . THR C 1 114 ? 19.470  -17.905 -1.094  1.00 44.15  ? 235  THR D C     1 
ATOM   3229 O O     . THR C 1 114 ? 18.980  -16.773 -0.902  1.00 41.40  ? 235  THR D O     1 
ATOM   3230 C CB    . THR C 1 114 ? 20.189  -19.500 0.726   1.00 43.29  ? 235  THR D CB    1 
ATOM   3231 O OG1   . THR C 1 114 ? 19.772  -20.608 1.544   1.00 41.01  ? 235  THR D OG1   1 
ATOM   3232 C CG2   . THR C 1 114 ? 20.569  -18.328 1.621   1.00 43.44  ? 235  THR D CG2   1 
ATOM   3233 N N     . TYR C 1 115 ? 20.389  -18.171 -2.020  1.00 41.47  ? 236  TYR D N     1 
ATOM   3234 C CA    . TYR C 1 115 ? 20.737  -17.241 -3.066  1.00 39.05  ? 236  TYR D CA    1 
ATOM   3235 C C     . TYR C 1 115 ? 19.531  -16.732 -3.898  1.00 39.04  ? 236  TYR D C     1 
ATOM   3236 O O     . TYR C 1 115 ? 19.436  -15.537 -4.179  1.00 36.77  ? 236  TYR D O     1 
ATOM   3237 C CB    . TYR C 1 115 ? 21.742  -17.903 -3.982  1.00 40.93  ? 236  TYR D CB    1 
ATOM   3238 C CG    . TYR C 1 115 ? 23.160  -17.957 -3.466  1.00 41.79  ? 236  TYR D CG    1 
ATOM   3239 C CD1   . TYR C 1 115 ? 23.517  -17.468 -2.213  1.00 44.22  ? 236  TYR D CD1   1 
ATOM   3240 C CD2   . TYR C 1 115 ? 24.145  -18.553 -4.233  1.00 44.33  ? 236  TYR D CD2   1 
ATOM   3241 C CE1   . TYR C 1 115 ? 24.827  -17.545 -1.758  1.00 45.70  ? 236  TYR D CE1   1 
ATOM   3242 C CE2   . TYR C 1 115 ? 25.453  -18.638 -3.794  1.00 46.01  ? 236  TYR D CE2   1 
ATOM   3243 C CZ    . TYR C 1 115 ? 25.790  -18.134 -2.564  1.00 48.57  ? 236  TYR D CZ    1 
ATOM   3244 O OH    . TYR C 1 115 ? 27.099  -18.242 -2.165  1.00 52.45  ? 236  TYR D OH    1 
ATOM   3245 N N     . ILE C 1 116 ? 18.632  -17.619 -4.310  1.00 37.86  ? 237  ILE D N     1 
ATOM   3246 C CA    . ILE C 1 116 ? 17.443  -17.191 -5.045  1.00 38.53  ? 237  ILE D CA    1 
ATOM   3247 C C     . ILE C 1 116 ? 16.538  -16.330 -4.172  1.00 42.44  ? 237  ILE D C     1 
ATOM   3248 O O     . ILE C 1 116 ? 15.824  -15.460 -4.680  1.00 48.02  ? 237  ILE D O     1 
ATOM   3249 C CB    . ILE C 1 116 ? 16.613  -18.390 -5.557  1.00 38.91  ? 237  ILE D CB    1 
ATOM   3250 C CG1   . ILE C 1 116 ? 17.383  -19.212 -6.592  1.00 39.46  ? 237  ILE D CG1   1 
ATOM   3251 C CG2   . ILE C 1 116 ? 15.303  -17.928 -6.180  1.00 41.20  ? 237  ILE D CG2   1 
ATOM   3252 C CD1   . ILE C 1 116 ? 18.026  -18.419 -7.721  1.00 39.59  ? 237  ILE D CD1   1 
ATOM   3253 N N     . THR C 1 117 ? 16.536  -16.562 -2.862  1.00 43.90  ? 238  THR D N     1 
ATOM   3254 C CA    . THR C 1 117 ? 15.714  -15.732 -1.978  1.00 43.02  ? 238  THR D CA    1 
ATOM   3255 C C     . THR C 1 117 ? 16.272  -14.310 -1.941  1.00 40.91  ? 238  THR D C     1 
ATOM   3256 O O     . THR C 1 117 ? 15.522  -13.372 -2.113  1.00 37.38  ? 238  THR D O     1 
ATOM   3257 C CB    . THR C 1 117 ? 15.623  -16.301 -0.552  1.00 43.01  ? 238  THR D CB    1 
ATOM   3258 O OG1   . THR C 1 117 ? 14.948  -17.570 -0.578  1.00 41.66  ? 238  THR D OG1   1 
ATOM   3259 C CG2   . THR C 1 117 ? 14.887  -15.337 0.376   1.00 40.36  ? 238  THR D CG2   1 
ATOM   3260 N N     . GLU C 1 118 ? 17.589  -14.169 -1.752  1.00 43.00  ? 239  GLU D N     1 
ATOM   3261 C CA    . GLU C 1 118 ? 18.273  -12.844 -1.804  1.00 43.17  ? 239  GLU D CA    1 
ATOM   3262 C C     . GLU C 1 118 ? 18.158  -12.104 -3.135  1.00 41.08  ? 239  GLU D C     1 
ATOM   3263 O O     . GLU C 1 118 ? 18.031  -10.896 -3.146  1.00 42.93  ? 239  GLU D O     1 
ATOM   3264 C CB    . GLU C 1 118 ? 19.746  -12.957 -1.426  1.00 45.28  ? 239  GLU D CB    1 
ATOM   3265 C CG    . GLU C 1 118 ? 19.970  -13.105 0.074   1.00 50.45  ? 239  GLU D CG    1 
ATOM   3266 C CD    . GLU C 1 118 ? 21.019  -14.155 0.414   1.00 57.87  ? 239  GLU D CD    1 
ATOM   3267 O OE1   . GLU C 1 118 ? 22.188  -14.047 -0.051  1.00 56.48  ? 239  GLU D OE1   1 
ATOM   3268 O OE2   . GLU C 1 118 ? 20.653  -15.108 1.143   1.00 64.80  ? 239  GLU D OE2   1 
ATOM   3269 N N     . LEU C 1 119 ? 18.196  -12.819 -4.250  1.00 39.84  ? 240  LEU D N     1 
ATOM   3270 C CA    . LEU C 1 119 ? 17.941  -12.215 -5.537  1.00 39.45  ? 240  LEU D CA    1 
ATOM   3271 C C     . LEU C 1 119 ? 16.518  -11.726 -5.665  1.00 39.19  ? 240  LEU D C     1 
ATOM   3272 O O     . LEU C 1 119 ? 16.293  -10.613 -6.122  1.00 39.92  ? 240  LEU D O     1 
ATOM   3273 C CB    . LEU C 1 119 ? 18.223  -13.203 -6.654  1.00 41.76  ? 240  LEU D CB    1 
ATOM   3274 C CG    . LEU C 1 119 ? 19.713  -13.336 -6.890  1.00 44.67  ? 240  LEU D CG    1 
ATOM   3275 C CD1   . LEU C 1 119 ? 20.067  -14.584 -7.699  1.00 48.79  ? 240  LEU D CD1   1 
ATOM   3276 C CD2   . LEU C 1 119 ? 20.189  -12.081 -7.583  1.00 46.93  ? 240  LEU D CD2   1 
ATOM   3277 N N     . ALA C 1 120 ? 15.558  -12.556 -5.276  1.00 40.06  ? 241  ALA D N     1 
ATOM   3278 C CA    . ALA C 1 120 ? 14.134  -12.176 -5.343  1.00 39.67  ? 241  ALA D CA    1 
ATOM   3279 C C     . ALA C 1 120 ? 13.782  -10.957 -4.467  1.00 37.93  ? 241  ALA D C     1 
ATOM   3280 O O     . ALA C 1 120 ? 12.979  -10.114 -4.870  1.00 36.85  ? 241  ALA D O     1 
ATOM   3281 C CB    . ALA C 1 120 ? 13.247  -13.361 -4.979  1.00 38.46  ? 241  ALA D CB    1 
ATOM   3282 N N     . ASN C 1 121 ? 14.381  -10.866 -3.285  1.00 37.22  ? 242  ASN D N     1 
ATOM   3283 C CA    . ASN C 1 121 ? 14.164  -9.718  -2.408  1.00 38.92  ? 242  ASN D CA    1 
ATOM   3284 C C     . ASN C 1 121 ? 14.760  -8.434  -2.976  1.00 38.62  ? 242  ASN D C     1 
ATOM   3285 O O     . ASN C 1 121 ? 14.082  -7.404  -3.050  1.00 39.43  ? 242  ASN D O     1 
ATOM   3286 C CB    . ASN C 1 121 ? 14.705  -9.999  -1.001  1.00 40.34  ? 242  ASN D CB    1 
ATOM   3287 C CG    . ASN C 1 121 ? 13.813  -10.934 -0.220  1.00 41.36  ? 242  ASN D CG    1 
ATOM   3288 O OD1   . ASN C 1 121 ? 12.611  -10.982 -0.436  1.00 47.79  ? 242  ASN D OD1   1 
ATOM   3289 N ND2   . ASN C 1 121 ? 14.393  -11.680 0.686   1.00 42.63  ? 242  ASN D ND2   1 
ATOM   3290 N N     . ALA C 1 122 ? 16.015  -8.510  -3.406  1.00 39.28  ? 243  ALA D N     1 
ATOM   3291 C CA    . ALA C 1 122 ? 16.676  -7.388  -4.065  1.00 40.85  ? 243  ALA D CA    1 
ATOM   3292 C C     . ALA C 1 122 ? 15.915  -6.963  -5.309  1.00 42.37  ? 243  ALA D C     1 
ATOM   3293 O O     . ALA C 1 122 ? 15.837  -5.772  -5.604  1.00 42.92  ? 243  ALA D O     1 
ATOM   3294 C CB    . ALA C 1 122 ? 18.095  -7.759  -4.439  1.00 41.55  ? 243  ALA D CB    1 
ATOM   3295 N N     . LEU C 1 123 ? 15.354  -7.933  -6.031  1.00 44.25  ? 244  LEU D N     1 
ATOM   3296 C CA    . LEU C 1 123 ? 14.614  -7.643  -7.274  1.00 44.79  ? 244  LEU D CA    1 
ATOM   3297 C C     . LEU C 1 123 ? 13.280  -7.011  -7.012  1.00 42.98  ? 244  LEU D C     1 
ATOM   3298 O O     . LEU C 1 123 ? 12.872  -6.135  -7.777  1.00 39.81  ? 244  LEU D O     1 
ATOM   3299 C CB    . LEU C 1 123 ? 14.391  -8.891  -8.115  1.00 44.03  ? 244  LEU D CB    1 
ATOM   3300 C CG    . LEU C 1 123 ? 15.578  -9.421  -8.910  1.00 43.67  ? 244  LEU D CG    1 
ATOM   3301 C CD1   . LEU C 1 123 ? 15.098  -10.601 -9.758  1.00 45.04  ? 244  LEU D CD1   1 
ATOM   3302 C CD2   . LEU C 1 123 ? 16.179  -8.316  -9.756  1.00 41.87  ? 244  LEU D CD2   1 
ATOM   3303 N N     . SER C 1 124 ? 12.598  -7.470  -5.958  1.00 42.53  ? 245  SER D N     1 
ATOM   3304 C CA    . SER C 1 124 ? 11.343  -6.832  -5.518  1.00 43.82  ? 245  SER D CA    1 
ATOM   3305 C C     . SER C 1 124 ? 11.619  -5.367  -5.243  1.00 42.44  ? 245  SER D C     1 
ATOM   3306 O O     . SER C 1 124 ? 10.927  -4.499  -5.759  1.00 39.56  ? 245  SER D O     1 
ATOM   3307 C CB    . SER C 1 124 ? 10.790  -7.436  -4.226  1.00 43.19  ? 245  SER D CB    1 
ATOM   3308 O OG    . SER C 1 124 ? 10.413  -8.780  -4.389  1.00 47.40  ? 245  SER D OG    1 
ATOM   3309 N N     . TYR C 1 125 ? 12.635  -5.101  -4.426  1.00 40.12  ? 246  TYR D N     1 
ATOM   3310 C CA    . TYR C 1 125 ? 12.963  -3.729  -4.062  1.00 40.23  ? 246  TYR D CA    1 
ATOM   3311 C C     . TYR C 1 125 ? 13.163  -2.915  -5.336  1.00 41.68  ? 246  TYR D C     1 
ATOM   3312 O O     . TYR C 1 125 ? 12.521  -1.879  -5.533  1.00 44.28  ? 246  TYR D O     1 
ATOM   3313 C CB    . TYR C 1 125 ? 14.207  -3.706  -3.181  1.00 39.39  ? 246  TYR D CB    1 
ATOM   3314 C CG    . TYR C 1 125 ? 14.788  -2.351  -2.899  1.00 38.38  ? 246  TYR D CG    1 
ATOM   3315 C CD1   . TYR C 1 125 ? 14.268  -1.556  -1.889  1.00 36.09  ? 246  TYR D CD1   1 
ATOM   3316 C CD2   . TYR C 1 125 ? 15.891  -1.873  -3.623  1.00 40.13  ? 246  TYR D CD2   1 
ATOM   3317 C CE1   . TYR C 1 125 ? 14.803  -0.315  -1.602  1.00 36.66  ? 246  TYR D CE1   1 
ATOM   3318 C CE2   . TYR C 1 125 ? 16.437  -0.625  -3.346  1.00 40.20  ? 246  TYR D CE2   1 
ATOM   3319 C CZ    . TYR C 1 125 ? 15.878  0.149   -2.334  1.00 39.89  ? 246  TYR D CZ    1 
ATOM   3320 O OH    . TYR C 1 125 ? 16.400  1.379   -2.028  1.00 40.66  ? 246  TYR D OH    1 
ATOM   3321 N N     . CYS C 1 126 ? 14.016  -3.416  -6.218  1.00 42.02  ? 247  CYS D N     1 
ATOM   3322 C CA    . CYS C 1 126 ? 14.286  -2.752  -7.475  1.00 44.08  ? 247  CYS D CA    1 
ATOM   3323 C C     . CYS C 1 126 ? 13.031  -2.330  -8.214  1.00 43.85  ? 247  CYS D C     1 
ATOM   3324 O O     . CYS C 1 126 ? 12.990  -1.251  -8.765  1.00 46.92  ? 247  CYS D O     1 
ATOM   3325 C CB    . CYS C 1 126 ? 15.073  -3.674  -8.392  1.00 46.26  ? 247  CYS D CB    1 
ATOM   3326 S SG    . CYS C 1 126 ? 16.812  -3.658  -8.045  1.00 47.63  ? 247  CYS D SG    1 
ATOM   3327 N N     . HIS C 1 127 ? 12.041  -3.217  -8.265  1.00 43.26  ? 248  HIS D N     1 
ATOM   3328 C CA    . HIS C 1 127 ? 10.832  -2.994  -9.038  1.00 42.12  ? 248  HIS D CA    1 
ATOM   3329 C C     . HIS C 1 127 ? 9.961   -1.971  -8.330  1.00 45.19  ? 248  HIS D C     1 
ATOM   3330 O O     . HIS C 1 127 ? 9.381   -1.083  -8.957  1.00 45.04  ? 248  HIS D O     1 
ATOM   3331 C CB    . HIS C 1 127 ? 10.095  -4.310  -9.209  1.00 41.35  ? 248  HIS D CB    1 
ATOM   3332 C CG    . HIS C 1 127 ? 10.779  -5.255  -10.140 1.00 44.05  ? 248  HIS D CG    1 
ATOM   3333 N ND1   . HIS C 1 127 ? 10.160  -6.365  -10.671 1.00 49.07  ? 248  HIS D ND1   1 
ATOM   3334 C CD2   . HIS C 1 127 ? 12.030  -5.244  -10.657 1.00 46.13  ? 248  HIS D CD2   1 
ATOM   3335 C CE1   . HIS C 1 127 ? 11.003  -7.001  -11.468 1.00 46.81  ? 248  HIS D CE1   1 
ATOM   3336 N NE2   . HIS C 1 127 ? 12.144  -6.338  -11.477 1.00 46.34  ? 248  HIS D NE2   1 
ATOM   3337 N N     . SER C 1 128 ? 9.918   -2.081  -7.008  1.00 46.83  ? 249  SER D N     1 
ATOM   3338 C CA    . SER C 1 128 ? 9.247   -1.112  -6.157  1.00 48.41  ? 249  SER D CA    1 
ATOM   3339 C C     . SER C 1 128 ? 9.794   0.296   -6.376  1.00 49.87  ? 249  SER D C     1 
ATOM   3340 O O     . SER C 1 128 ? 9.261   1.254   -5.797  1.00 50.50  ? 249  SER D O     1 
ATOM   3341 C CB    . SER C 1 128 ? 9.438   -1.489  -4.680  1.00 50.24  ? 249  SER D CB    1 
ATOM   3342 O OG    . SER C 1 128 ? 10.726  -1.074  -4.202  1.00 52.26  ? 249  SER D OG    1 
ATOM   3343 N N     . LYS C 1 129 ? 10.887  0.405   -7.138  1.00 46.35  ? 250  LYS D N     1 
ATOM   3344 C CA    . LYS C 1 129 ? 11.466  1.698   -7.512  1.00 47.84  ? 250  LYS D CA    1 
ATOM   3345 C C     . LYS C 1 129 ? 11.462  1.893   -9.007  1.00 48.79  ? 250  LYS D C     1 
ATOM   3346 O O     . LYS C 1 129 ? 12.198  2.732   -9.545  1.00 47.88  ? 250  LYS D O     1 
ATOM   3347 C CB    . LYS C 1 129 ? 12.877  1.840   -6.974  1.00 44.40  ? 250  LYS D CB    1 
ATOM   3348 C CG    . LYS C 1 129 ? 12.857  1.910   -5.475  1.00 48.88  ? 250  LYS D CG    1 
ATOM   3349 C CD    . LYS C 1 129 ? 14.222  2.304   -4.938  1.00 55.16  ? 250  LYS D CD    1 
ATOM   3350 C CE    . LYS C 1 129 ? 14.126  2.812   -3.511  1.00 52.42  ? 250  LYS D CE    1 
ATOM   3351 N NZ    . LYS C 1 129 ? 13.164  3.935   -3.401  1.00 50.85  ? 250  LYS D NZ    1 
ATOM   3352 N N     . ARG C 1 130 ? 10.598  1.128   -9.662  1.00 50.38  ? 251  ARG D N     1 
ATOM   3353 C CA    . ARG C 1 130 ? 10.395  1.228   -11.090 1.00 52.60  ? 251  ARG D CA    1 
ATOM   3354 C C     . ARG C 1 130 ? 11.717  0.974   -11.843 1.00 50.12  ? 251  ARG D C     1 
ATOM   3355 O O     . ARG C 1 130 ? 11.994  1.589   -12.892 1.00 48.82  ? 251  ARG D O     1 
ATOM   3356 C CB    . ARG C 1 130 ? 9.777   2.596   -11.435 1.00 57.57  ? 251  ARG D CB    1 
ATOM   3357 C CG    . ARG C 1 130 ? 8.920   3.240   -10.339 1.00 64.34  ? 251  ARG D CG    1 
ATOM   3358 C CD    . ARG C 1 130 ? 7.814   4.131   -10.911 1.00 71.13  ? 251  ARG D CD    1 
ATOM   3359 N NE    . ARG C 1 130 ? 6.655   3.335   -11.339 1.00 82.00  ? 251  ARG D NE    1 
ATOM   3360 C CZ    . ARG C 1 130 ? 5.636   3.775   -12.087 1.00 91.05  ? 251  ARG D CZ    1 
ATOM   3361 N NH1   . ARG C 1 130 ? 5.589   5.031   -12.527 1.00 97.17  ? 251  ARG D NH1   1 
ATOM   3362 N NH2   . ARG C 1 130 ? 4.647   2.943   -12.406 1.00 89.50  ? 251  ARG D NH2   1 
ATOM   3363 N N     . VAL C 1 131 ? 12.527  0.062   -11.306 1.00 43.96  ? 252  VAL D N     1 
ATOM   3364 C CA    . VAL C 1 131 ? 13.810  -0.273  -11.903 1.00 40.32  ? 252  VAL D CA    1 
ATOM   3365 C C     . VAL C 1 131 ? 13.800  -1.731  -12.250 1.00 39.34  ? 252  VAL D C     1 
ATOM   3366 O O     . VAL C 1 131 ? 13.511  -2.550  -11.397 1.00 39.01  ? 252  VAL D O     1 
ATOM   3367 C CB    . VAL C 1 131 ? 14.979  0.008   -10.949 1.00 40.51  ? 252  VAL D CB    1 
ATOM   3368 C CG1   . VAL C 1 131 ? 16.290  -0.525  -11.513 1.00 40.95  ? 252  VAL D CG1   1 
ATOM   3369 C CG2   . VAL C 1 131 ? 15.084  1.500   -10.682 1.00 41.56  ? 252  VAL D CG2   1 
ATOM   3370 N N     . ILE C 1 132 ? 14.119  -2.024  -13.507 1.00 39.64  ? 253  ILE D N     1 
ATOM   3371 C CA    . ILE C 1 132 ? 14.172  -3.375  -14.057 1.00 40.84  ? 253  ILE D CA    1 
ATOM   3372 C C     . ILE C 1 132 ? 15.643  -3.694  -14.299 1.00 40.44  ? 253  ILE D C     1 
ATOM   3373 O O     . ILE C 1 132 ? 16.326  -2.979  -15.025 1.00 38.97  ? 253  ILE D O     1 
ATOM   3374 C CB    . ILE C 1 132 ? 13.431  -3.449  -15.413 1.00 43.60  ? 253  ILE D CB    1 
ATOM   3375 C CG1   . ILE C 1 132 ? 11.967  -3.014  -15.275 1.00 46.27  ? 253  ILE D CG1   1 
ATOM   3376 C CG2   . ILE C 1 132 ? 13.437  -4.856  -15.979 1.00 45.92  ? 253  ILE D CG2   1 
ATOM   3377 C CD1   . ILE C 1 132 ? 11.389  -2.516  -16.586 1.00 45.50  ? 253  ILE D CD1   1 
ATOM   3378 N N     . HIS C 1 133 ? 16.133  -4.773  -13.703 1.00 41.90  ? 254  HIS D N     1 
ATOM   3379 C CA    . HIS C 1 133 ? 17.550  -5.079  -13.766 1.00 43.33  ? 254  HIS D CA    1 
ATOM   3380 C C     . HIS C 1 133 ? 17.972  -5.641  -15.117 1.00 43.86  ? 254  HIS D C     1 
ATOM   3381 O O     . HIS C 1 133 ? 19.023  -5.307  -15.638 1.00 39.93  ? 254  HIS D O     1 
ATOM   3382 C CB    . HIS C 1 133 ? 17.953  -6.044  -12.654 1.00 41.88  ? 254  HIS D CB    1 
ATOM   3383 C CG    . HIS C 1 133 ? 19.435  -6.209  -12.538 1.00 44.24  ? 254  HIS D CG    1 
ATOM   3384 N ND1   . HIS C 1 133 ? 20.145  -7.136  -13.273 1.00 46.38  ? 254  HIS D ND1   1 
ATOM   3385 C CD2   . HIS C 1 133 ? 20.350  -5.537  -11.808 1.00 46.98  ? 254  HIS D CD2   1 
ATOM   3386 C CE1   . HIS C 1 133 ? 21.430  -7.042  -12.987 1.00 45.30  ? 254  HIS D CE1   1 
ATOM   3387 N NE2   . HIS C 1 133 ? 21.582  -6.075  -12.104 1.00 49.32  ? 254  HIS D NE2   1 
ATOM   3388 N N     . ARG C 1 134 ? 17.140  -6.510  -15.658 1.00 51.28  ? 255  ARG D N     1 
ATOM   3389 C CA    . ARG C 1 134 ? 17.411  -7.230  -16.908 1.00 60.65  ? 255  ARG D CA    1 
ATOM   3390 C C     . ARG C 1 134 ? 18.504  -8.300  -16.722 1.00 67.81  ? 255  ARG D C     1 
ATOM   3391 O O     . ARG C 1 134 ? 18.216  -9.371  -16.159 1.00 75.02  ? 255  ARG D O     1 
ATOM   3392 C CB    . ARG C 1 134 ? 17.637  -6.280  -18.095 1.00 58.62  ? 255  ARG D CB    1 
ATOM   3393 C CG    . ARG C 1 134 ? 16.609  -5.155  -18.118 1.00 61.10  ? 255  ARG D CG    1 
ATOM   3394 C CD    . ARG C 1 134 ? 15.925  -4.947  -19.456 1.00 65.22  ? 255  ARG D CD    1 
ATOM   3395 N NE    . ARG C 1 134 ? 16.567  -3.899  -20.255 1.00 64.66  ? 255  ARG D NE    1 
ATOM   3396 C CZ    . ARG C 1 134 ? 15.953  -2.849  -20.805 1.00 60.95  ? 255  ARG D CZ    1 
ATOM   3397 N NH1   . ARG C 1 134 ? 14.640  -2.653  -20.660 1.00 58.95  ? 255  ARG D NH1   1 
ATOM   3398 N NH2   . ARG C 1 134 ? 16.672  -1.980  -21.509 1.00 58.29  ? 255  ARG D NH2   1 
ATOM   3399 N N     . ASP C 1 135 ? 19.736  -8.021  -17.135 1.00 71.06  ? 256  ASP D N     1 
ATOM   3400 C CA    . ASP C 1 135 ? 20.723  -9.091  -17.316 1.00 81.99  ? 256  ASP D CA    1 
ATOM   3401 C C     . ASP C 1 135 ? 21.515  -9.313  -16.044 1.00 72.83  ? 256  ASP D C     1 
ATOM   3402 O O     . ASP C 1 135 ? 22.180  -8.399  -15.595 1.00 71.54  ? 256  ASP D O     1 
ATOM   3403 C CB    . ASP C 1 135 ? 21.672  -8.767  -18.488 1.00 96.05  ? 256  ASP D CB    1 
ATOM   3404 C CG    . ASP C 1 135 ? 20.919  -8.350  -19.778 1.00 108.10 ? 256  ASP D CG    1 
ATOM   3405 O OD1   . ASP C 1 135 ? 19.728  -8.724  -19.925 1.00 124.38 ? 256  ASP D OD1   1 
ATOM   3406 O OD2   . ASP C 1 135 ? 21.515  -7.651  -20.643 1.00 99.99  ? 256  ASP D OD2   1 
ATOM   3407 N N     . ILE C 1 136 ? 21.410  -10.514 -15.459 1.00 70.80  ? 257  ILE D N     1 
ATOM   3408 C CA    . ILE C 1 136 ? 22.254  -10.930 -14.330 1.00 68.16  ? 257  ILE D CA    1 
ATOM   3409 C C     . ILE C 1 136 ? 23.033  -12.207 -14.623 1.00 63.06  ? 257  ILE D C     1 
ATOM   3410 O O     . ILE C 1 136 ? 22.467  -13.287 -14.760 1.00 66.44  ? 257  ILE D O     1 
ATOM   3411 C CB    . ILE C 1 136 ? 21.475  -11.229 -13.022 1.00 69.72  ? 257  ILE D CB    1 
ATOM   3412 C CG1   . ILE C 1 136 ? 20.183  -10.423 -12.929 1.00 72.76  ? 257  ILE D CG1   1 
ATOM   3413 C CG2   . ILE C 1 136 ? 22.376  -10.962 -11.814 1.00 68.47  ? 257  ILE D CG2   1 
ATOM   3414 C CD1   . ILE C 1 136 ? 19.583  -10.367 -11.532 1.00 68.32  ? 257  ILE D CD1   1 
ATOM   3415 N N     . LYS C 1 137 ? 24.343  -12.078 -14.682 1.00 57.31  ? 258  LYS D N     1 
ATOM   3416 C CA    . LYS C 1 137 ? 25.223  -13.229 -14.689 1.00 52.99  ? 258  LYS D CA    1 
ATOM   3417 C C     . LYS C 1 137 ? 25.727  -13.476 -13.251 1.00 45.59  ? 258  LYS D C     1 
ATOM   3418 O O     . LYS C 1 137 ? 25.734  -12.562 -12.428 1.00 40.60  ? 258  LYS D O     1 
ATOM   3419 C CB    . LYS C 1 137 ? 26.403  -12.940 -15.632 1.00 58.33  ? 258  LYS D CB    1 
ATOM   3420 C CG    . LYS C 1 137 ? 25.964  -12.574 -17.048 1.00 62.89  ? 258  LYS D CG    1 
ATOM   3421 C CD    . LYS C 1 137 ? 27.131  -12.313 -17.983 1.00 67.02  ? 258  LYS D CD    1 
ATOM   3422 C CE    . LYS C 1 137 ? 27.893  -11.052 -17.588 1.00 68.61  ? 258  LYS D CE    1 
ATOM   3423 N NZ    . LYS C 1 137 ? 28.758  -10.559 -18.698 1.00 65.60  ? 258  LYS D NZ    1 
ATOM   3424 N N     . PRO C 1 138 ? 26.160  -14.705 -12.946 1.00 39.13  ? 259  PRO D N     1 
ATOM   3425 C CA    . PRO C 1 138 ? 26.861  -14.910 -11.709 1.00 39.82  ? 259  PRO D CA    1 
ATOM   3426 C C     . PRO C 1 138 ? 28.119  -14.063 -11.562 1.00 44.22  ? 259  PRO D C     1 
ATOM   3427 O O     . PRO C 1 138 ? 28.484  -13.740 -10.422 1.00 47.24  ? 259  PRO D O     1 
ATOM   3428 C CB    . PRO C 1 138 ? 27.228  -16.387 -11.761 1.00 39.60  ? 259  PRO D CB    1 
ATOM   3429 C CG    . PRO C 1 138 ? 26.183  -16.999 -12.618 1.00 38.47  ? 259  PRO D CG    1 
ATOM   3430 C CD    . PRO C 1 138 ? 25.967  -15.968 -13.669 1.00 39.43  ? 259  PRO D CD    1 
ATOM   3431 N N     . GLU C 1 139 ? 28.777  -13.700 -12.667 1.00 47.02  ? 260  GLU D N     1 
ATOM   3432 C CA    . GLU C 1 139 ? 29.946  -12.797 -12.590 1.00 55.19  ? 260  GLU D CA    1 
ATOM   3433 C C     . GLU C 1 139 ? 29.590  -11.475 -11.928 1.00 50.86  ? 260  GLU D C     1 
ATOM   3434 O O     . GLU C 1 139 ? 30.461  -10.830 -11.374 1.00 49.98  ? 260  GLU D O     1 
ATOM   3435 C CB    . GLU C 1 139 ? 30.542  -12.465 -13.972 1.00 65.02  ? 260  GLU D CB    1 
ATOM   3436 C CG    . GLU C 1 139 ? 31.494  -13.500 -14.552 1.00 74.38  ? 260  GLU D CG    1 
ATOM   3437 C CD    . GLU C 1 139 ? 30.806  -14.530 -15.442 1.00 83.95  ? 260  GLU D CD    1 
ATOM   3438 O OE1   . GLU C 1 139 ? 29.549  -14.614 -15.439 1.00 85.80  ? 260  GLU D OE1   1 
ATOM   3439 O OE2   . GLU C 1 139 ? 31.540  -15.266 -16.144 1.00 85.98  ? 260  GLU D OE2   1 
ATOM   3440 N N     . ASN C 1 140 ? 28.323  -11.063 -12.024 1.00 48.26  ? 261  ASN D N     1 
ATOM   3441 C CA    . ASN C 1 140 ? 27.868  -9.788  -11.451 1.00 49.49  ? 261  ASN D CA    1 
ATOM   3442 C C     . ASN C 1 140 ? 27.353  -9.936  -10.036 1.00 44.87  ? 261  ASN D C     1 
ATOM   3443 O O     . ASN C 1 140 ? 26.825  -8.994  -9.476  1.00 44.26  ? 261  ASN D O     1 
ATOM   3444 C CB    . ASN C 1 140 ? 26.742  -9.174  -12.299 1.00 53.68  ? 261  ASN D CB    1 
ATOM   3445 C CG    . ASN C 1 140 ? 27.121  -9.000  -13.765 1.00 58.54  ? 261  ASN D CG    1 
ATOM   3446 O OD1   . ASN C 1 140 ? 28.285  -8.737  -14.106 1.00 58.74  ? 261  ASN D OD1   1 
ATOM   3447 N ND2   . ASN C 1 140 ? 26.122  -9.132  -14.645 1.00 61.45  ? 261  ASN D ND2   1 
ATOM   3448 N N     . LEU C 1 141 ? 27.483  -11.123 -9.463  1.00 44.37  ? 262  LEU D N     1 
ATOM   3449 C CA    . LEU C 1 141 ? 26.939  -11.398 -8.148  1.00 43.86  ? 262  LEU D CA    1 
ATOM   3450 C C     . LEU C 1 141 ? 28.094  -11.573 -7.200  1.00 41.52  ? 262  LEU D C     1 
ATOM   3451 O O     . LEU C 1 141 ? 28.756  -12.598 -7.231  1.00 42.85  ? 262  LEU D O     1 
ATOM   3452 C CB    . LEU C 1 141 ? 26.082  -12.663 -8.189  1.00 43.02  ? 262  LEU D CB    1 
ATOM   3453 C CG    . LEU C 1 141 ? 24.787  -12.603 -8.994  1.00 40.31  ? 262  LEU D CG    1 
ATOM   3454 C CD1   . LEU C 1 141 ? 24.071  -13.941 -8.957  1.00 39.81  ? 262  LEU D CD1   1 
ATOM   3455 C CD2   . LEU C 1 141 ? 23.863  -11.529 -8.458  1.00 40.32  ? 262  LEU D CD2   1 
ATOM   3456 N N     . LEU C 1 142 ? 28.357  -10.555 -6.390  1.00 41.65  ? 263  LEU D N     1 
ATOM   3457 C CA    . LEU C 1 142 ? 29.461  -10.597 -5.415  1.00 43.36  ? 263  LEU D CA    1 
ATOM   3458 C C     . LEU C 1 142 ? 28.965  -11.117 -4.076  1.00 43.27  ? 263  LEU D C     1 
ATOM   3459 O O     . LEU C 1 142 ? 27.764  -11.150 -3.832  1.00 44.83  ? 263  LEU D O     1 
ATOM   3460 C CB    . LEU C 1 142 ? 30.055  -9.217  -5.199  1.00 41.98  ? 263  LEU D CB    1 
ATOM   3461 C CG    . LEU C 1 142 ? 30.448  -8.507  -6.473  1.00 44.86  ? 263  LEU D CG    1 
ATOM   3462 C CD1   . LEU C 1 142 ? 30.649  -7.037  -6.181  1.00 46.27  ? 263  LEU D CD1   1 
ATOM   3463 C CD2   . LEU C 1 142 ? 31.705  -9.146  -7.053  1.00 48.55  ? 263  LEU D CD2   1 
ATOM   3464 N N     . LEU C 1 143 ? 29.897  -11.502 -3.210  1.00 42.11  ? 264  LEU D N     1 
ATOM   3465 C CA    . LEU C 1 143 ? 29.551  -11.952 -1.878  1.00 39.78  ? 264  LEU D CA    1 
ATOM   3466 C C     . LEU C 1 143 ? 30.146  -11.056 -0.791  1.00 40.16  ? 264  LEU D C     1 
ATOM   3467 O O     . LEU C 1 143 ? 31.364  -10.863 -0.738  1.00 39.38  ? 264  LEU D O     1 
ATOM   3468 C CB    . LEU C 1 143 ? 30.024  -13.377 -1.724  1.00 38.67  ? 264  LEU D CB    1 
ATOM   3469 C CG    . LEU C 1 143 ? 29.268  -14.354 -2.603  1.00 37.84  ? 264  LEU D CG    1 
ATOM   3470 C CD1   . LEU C 1 143 ? 30.091  -15.577 -2.951  1.00 37.75  ? 264  LEU D CD1   1 
ATOM   3471 C CD2   . LEU C 1 143 ? 28.026  -14.786 -1.869  1.00 41.60  ? 264  LEU D CD2   1 
ATOM   3472 N N     . GLY C 1 144 ? 29.276  -10.512 0.060   1.00 42.18  ? 265  GLY D N     1 
ATOM   3473 C CA    . GLY C 1 144 ? 29.671  -9.820  1.290   1.00 45.35  ? 265  GLY D CA    1 
ATOM   3474 C C     . GLY C 1 144 ? 30.320  -10.756 2.295   1.00 55.45  ? 265  GLY D C     1 
ATOM   3475 O O     . GLY C 1 144 ? 30.430  -11.965 2.061   1.00 56.99  ? 265  GLY D O     1 
ATOM   3476 N N     . SER C 1 145 ? 30.746  -10.209 3.433   1.00 72.23  ? 266  SER D N     1 
ATOM   3477 C CA    . SER C 1 145 ? 31.625  -10.951 4.376   1.00 79.08  ? 266  SER D CA    1 
ATOM   3478 C C     . SER C 1 145 ? 30.939  -12.051 5.233   1.00 80.40  ? 266  SER D C     1 
ATOM   3479 O O     . SER C 1 145 ? 31.626  -12.820 5.927   1.00 85.43  ? 266  SER D O     1 
ATOM   3480 C CB    . SER C 1 145 ? 32.378  -9.974  5.285   1.00 79.21  ? 266  SER D CB    1 
ATOM   3481 O OG    . SER C 1 145 ? 31.479  -9.224  6.082   1.00 87.62  ? 266  SER D OG    1 
ATOM   3482 N N     . ALA C 1 146 ? 29.604  -12.107 5.192   1.00 71.82  ? 267  ALA D N     1 
ATOM   3483 C CA    . ALA C 1 146 ? 28.840  -13.256 5.688   1.00 65.03  ? 267  ALA D CA    1 
ATOM   3484 C C     . ALA C 1 146 ? 28.448  -14.196 4.535   1.00 63.36  ? 267  ALA D C     1 
ATOM   3485 O O     . ALA C 1 146 ? 27.555  -15.024 4.683   1.00 56.02  ? 267  ALA D O     1 
ATOM   3486 C CB    . ALA C 1 146 ? 27.585  -12.768 6.399   1.00 63.37  ? 267  ALA D CB    1 
ATOM   3487 N N     . GLY C 1 147 ? 29.091  -14.040 3.378   1.00 63.03  ? 268  GLY D N     1 
ATOM   3488 C CA    . GLY C 1 147 ? 28.645  -14.697 2.152   1.00 65.12  ? 268  GLY D CA    1 
ATOM   3489 C C     . GLY C 1 147 ? 27.229  -14.344 1.700   1.00 64.44  ? 268  GLY D C     1 
ATOM   3490 O O     . GLY C 1 147 ? 26.644  -15.050 0.873   1.00 65.88  ? 268  GLY D O     1 
ATOM   3491 N N     . GLU C 1 148 ? 26.668  -13.273 2.258   1.00 65.96  ? 269  GLU D N     1 
ATOM   3492 C CA    . GLU C 1 148 ? 25.365  -12.742 1.822   1.00 64.48  ? 269  GLU D CA    1 
ATOM   3493 C C     . GLU C 1 148 ? 25.528  -12.117 0.419   1.00 60.11  ? 269  GLU D C     1 
ATOM   3494 O O     . GLU C 1 148 ? 26.557  -11.482 0.108   1.00 50.46  ? 269  GLU D O     1 
ATOM   3495 C CB    . GLU C 1 148 ? 24.782  -11.748 2.860   1.00 65.41  ? 269  GLU D CB    1 
ATOM   3496 C CG    . GLU C 1 148 ? 25.493  -10.382 3.040   1.00 69.55  ? 269  GLU D CG    1 
ATOM   3497 C CD    . GLU C 1 148 ? 26.923  -10.419 3.633   1.00 69.37  ? 269  GLU D CD    1 
ATOM   3498 O OE1   . GLU C 1 148 ? 27.678  -11.382 3.367   1.00 64.05  ? 269  GLU D OE1   1 
ATOM   3499 O OE2   . GLU C 1 148 ? 27.321  -9.456  4.339   1.00 65.89  ? 269  GLU D OE2   1 
ATOM   3500 N N     . LEU C 1 149 ? 24.520  -12.320 -0.425  1.00 56.56  ? 270  LEU D N     1 
ATOM   3501 C CA    . LEU C 1 149 ? 24.644  -12.053 -1.869  1.00 51.52  ? 270  LEU D CA    1 
ATOM   3502 C C     . LEU C 1 149 ? 24.371  -10.592 -2.238  1.00 46.23  ? 270  LEU D C     1 
ATOM   3503 O O     . LEU C 1 149 ? 23.431  -10.005 -1.698  1.00 39.11  ? 270  LEU D O     1 
ATOM   3504 C CB    . LEU C 1 149 ? 23.681  -12.962 -2.621  1.00 51.22  ? 270  LEU D CB    1 
ATOM   3505 C CG    . LEU C 1 149 ? 24.015  -13.220 -4.066  1.00 51.34  ? 270  LEU D CG    1 
ATOM   3506 C CD1   . LEU C 1 149 ? 25.511  -13.360 -4.220  1.00 54.32  ? 270  LEU D CD1   1 
ATOM   3507 C CD2   . LEU C 1 149 ? 23.326  -14.482 -4.545  1.00 51.45  ? 270  LEU D CD2   1 
ATOM   3508 N N     . LYS C 1 150 ? 25.198  -10.037 -3.146  1.00 43.51  ? 271  LYS D N     1 
ATOM   3509 C CA    . LYS C 1 150 ? 25.202  -8.596  -3.535  1.00 44.28  ? 271  LYS D CA    1 
ATOM   3510 C C     . LYS C 1 150 ? 25.140  -8.320  -5.062  1.00 42.70  ? 271  LYS D C     1 
ATOM   3511 O O     . LYS C 1 150 ? 26.169  -8.384  -5.739  1.00 45.90  ? 271  LYS D O     1 
ATOM   3512 C CB    . LYS C 1 150 ? 26.498  -7.927  -3.036  1.00 45.26  ? 271  LYS D CB    1 
ATOM   3513 C CG    . LYS C 1 150 ? 26.701  -7.877  -1.544  1.00 45.77  ? 271  LYS D CG    1 
ATOM   3514 C CD    . LYS C 1 150 ? 25.767  -6.887  -0.898  1.00 47.65  ? 271  LYS D CD    1 
ATOM   3515 C CE    . LYS C 1 150 ? 26.018  -6.786  0.599   1.00 51.67  ? 271  LYS D CE    1 
ATOM   3516 N NZ    . LYS C 1 150 ? 27.442  -6.487  0.911   1.00 53.64  ? 271  LYS D NZ    1 
ATOM   3517 N N     . ILE C 1 151 ? 23.974  -7.967  -5.600  1.00 40.39  ? 272  ILE D N     1 
ATOM   3518 C CA    . ILE C 1 151 ? 23.859  -7.546  -7.014  1.00 36.58  ? 272  ILE D CA    1 
ATOM   3519 C C     . ILE C 1 151 ? 24.769  -6.331  -7.280  1.00 36.99  ? 272  ILE D C     1 
ATOM   3520 O O     . ILE C 1 151 ? 24.647  -5.306  -6.612  1.00 35.79  ? 272  ILE D O     1 
ATOM   3521 C CB    . ILE C 1 151 ? 22.401  -7.198  -7.362  1.00 36.89  ? 272  ILE D CB    1 
ATOM   3522 C CG1   . ILE C 1 151 ? 21.525  -8.446  -7.320  1.00 38.55  ? 272  ILE D CG1   1 
ATOM   3523 C CG2   . ILE C 1 151 ? 22.266  -6.603  -8.762  1.00 39.37  ? 272  ILE D CG2   1 
ATOM   3524 C CD1   . ILE C 1 151 ? 20.036  -8.169  -7.531  1.00 38.73  ? 272  ILE D CD1   1 
ATOM   3525 N N     . ALA C 1 152 ? 25.669  -6.456  -8.261  1.00 39.93  ? 273  ALA D N     1 
ATOM   3526 C CA    . ALA C 1 152 ? 26.791  -5.495  -8.469  1.00 42.12  ? 273  ALA D CA    1 
ATOM   3527 C C     . ALA C 1 152 ? 26.840  -4.756  -9.817  1.00 44.87  ? 273  ALA D C     1 
ATOM   3528 O O     . ALA C 1 152 ? 27.446  -3.688  -9.883  1.00 49.99  ? 273  ALA D O     1 
ATOM   3529 C CB    . ALA C 1 152 ? 28.134  -6.183  -8.251  1.00 39.64  ? 273  ALA D CB    1 
ATOM   3530 N N     . ASP C 1 153 ? 26.242  -5.305  -10.873 1.00 46.54  ? 274  ASP D N     1 
ATOM   3531 C CA    . ASP C 1 153 ? 26.275  -4.683  -12.212 1.00 48.79  ? 274  ASP D CA    1 
ATOM   3532 C C     . ASP C 1 153 ? 24.885  -4.171  -12.597 1.00 49.65  ? 274  ASP D C     1 
ATOM   3533 O O     . ASP C 1 153 ? 23.868  -4.745  -12.209 1.00 50.65  ? 274  ASP D O     1 
ATOM   3534 C CB    . ASP C 1 153 ? 26.786  -5.694  -13.244 1.00 52.56  ? 274  ASP D CB    1 
ATOM   3535 C CG    . ASP C 1 153 ? 27.446  -5.042  -14.444 1.00 58.42  ? 274  ASP D CG    1 
ATOM   3536 O OD1   . ASP C 1 153 ? 28.669  -4.752  -14.408 1.00 62.83  ? 274  ASP D OD1   1 
ATOM   3537 O OD2   . ASP C 1 153 ? 26.735  -4.845  -15.452 1.00 70.91  ? 274  ASP D OD2   1 
ATOM   3538 N N     . PHE C 1 154 ? 24.837  -3.070  -13.335 1.00 50.35  ? 275  PHE D N     1 
ATOM   3539 C CA    . PHE C 1 154 ? 23.560  -2.444  -13.674 1.00 50.21  ? 275  PHE D CA    1 
ATOM   3540 C C     . PHE C 1 154 ? 23.564  -1.844  -15.066 1.00 47.31  ? 275  PHE D C     1 
ATOM   3541 O O     . PHE C 1 154 ? 22.744  -0.968  -15.353 1.00 43.69  ? 275  PHE D O     1 
ATOM   3542 C CB    . PHE C 1 154 ? 23.230  -1.344  -12.663 1.00 50.80  ? 275  PHE D CB    1 
ATOM   3543 C CG    . PHE C 1 154 ? 22.853  -1.858  -11.308 1.00 50.54  ? 275  PHE D CG    1 
ATOM   3544 C CD1   . PHE C 1 154 ? 21.564  -2.290  -11.053 1.00 49.36  ? 275  PHE D CD1   1 
ATOM   3545 C CD2   . PHE C 1 154 ? 23.785  -1.901  -10.284 1.00 53.32  ? 275  PHE D CD2   1 
ATOM   3546 C CE1   . PHE C 1 154 ? 21.197  -2.763  -9.807  1.00 48.73  ? 275  PHE D CE1   1 
ATOM   3547 C CE2   . PHE C 1 154 ? 23.428  -2.379  -9.030  1.00 53.83  ? 275  PHE D CE2   1 
ATOM   3548 C CZ    . PHE C 1 154 ? 22.129  -2.813  -8.795  1.00 51.32  ? 275  PHE D CZ    1 
ATOM   3549 N N     . GLY C 1 155 ? 24.460  -2.340  -15.920 1.00 44.92  ? 276  GLY D N     1 
ATOM   3550 C CA    . GLY C 1 155 ? 24.705  -1.767  -17.233 1.00 43.28  ? 276  GLY D CA    1 
ATOM   3551 C C     . GLY C 1 155 ? 23.501  -1.843  -18.135 1.00 44.88  ? 276  GLY D C     1 
ATOM   3552 O O     . GLY C 1 155 ? 23.271  -0.937  -18.929 1.00 47.66  ? 276  GLY D O     1 
ATOM   3553 N N     . TRP C 1 156 ? 22.720  -2.913  -17.996 1.00 50.07  ? 277  TRP D N     1 
ATOM   3554 C CA    . TRP C 1 156 ? 21.507  -3.129  -18.796 1.00 53.31  ? 277  TRP D CA    1 
ATOM   3555 C C     . TRP C 1 156 ? 20.191  -2.694  -18.129 1.00 48.49  ? 277  TRP D C     1 
ATOM   3556 O O     . TRP C 1 156 ? 19.133  -2.719  -18.757 1.00 52.92  ? 277  TRP D O     1 
ATOM   3557 C CB    . TRP C 1 156 ? 21.445  -4.587  -19.231 1.00 61.60  ? 277  TRP D CB    1 
ATOM   3558 C CG    . TRP C 1 156 ? 22.582  -4.933  -20.206 1.00 76.08  ? 277  TRP D CG    1 
ATOM   3559 C CD1   . TRP C 1 156 ? 23.729  -5.633  -19.923 1.00 78.57  ? 277  TRP D CD1   1 
ATOM   3560 C CD2   . TRP C 1 156 ? 22.677  -4.568  -21.592 1.00 83.06  ? 277  TRP D CD2   1 
ATOM   3561 N NE1   . TRP C 1 156 ? 24.511  -5.738  -21.042 1.00 81.51  ? 277  TRP D NE1   1 
ATOM   3562 C CE2   . TRP C 1 156 ? 23.897  -5.091  -22.080 1.00 84.61  ? 277  TRP D CE2   1 
ATOM   3563 C CE3   . TRP C 1 156 ? 21.849  -3.854  -22.469 1.00 89.14  ? 277  TRP D CE3   1 
ATOM   3564 C CZ2   . TRP C 1 156 ? 24.309  -4.929  -23.408 1.00 89.04  ? 277  TRP D CZ2   1 
ATOM   3565 C CZ3   . TRP C 1 156 ? 22.259  -3.693  -23.798 1.00 90.90  ? 277  TRP D CZ3   1 
ATOM   3566 C CH2   . TRP C 1 156 ? 23.480  -4.229  -24.250 1.00 92.66  ? 277  TRP D CH2   1 
ATOM   3567 N N     . SER C 1 157 ? 20.268  -2.249  -16.882 1.00 46.45  ? 278  SER D N     1 
ATOM   3568 C CA    . SER C 1 157 ? 19.096  -1.814  -16.120 1.00 46.19  ? 278  SER D CA    1 
ATOM   3569 C C     . SER C 1 157 ? 18.481  -0.546  -16.691 1.00 48.04  ? 278  SER D C     1 
ATOM   3570 O O     . SER C 1 157 ? 19.203  0.313   -17.189 1.00 51.39  ? 278  SER D O     1 
ATOM   3571 C CB    . SER C 1 157 ? 19.498  -1.545  -14.667 1.00 43.75  ? 278  SER D CB    1 
ATOM   3572 O OG    . SER C 1 157 ? 20.158  -2.658  -14.122 1.00 40.37  ? 278  SER D OG    1 
ATOM   3573 N N     . VAL C 1 158 ? 17.158  -0.428  -16.600 1.00 49.49  ? 279  VAL D N     1 
ATOM   3574 C CA    . VAL C 1 158 ? 16.435  0.778   -17.060 1.00 53.22  ? 279  VAL D CA    1 
ATOM   3575 C C     . VAL C 1 158 ? 15.445  1.250   -16.010 1.00 54.69  ? 279  VAL D C     1 
ATOM   3576 O O     . VAL C 1 158 ? 15.008  0.458   -15.186 1.00 55.61  ? 279  VAL D O     1 
ATOM   3577 C CB    . VAL C 1 158 ? 15.661  0.531   -18.368 1.00 52.55  ? 279  VAL D CB    1 
ATOM   3578 C CG1   . VAL C 1 158 ? 16.627  0.455   -19.537 1.00 55.65  ? 279  VAL D CG1   1 
ATOM   3579 C CG2   . VAL C 1 158 ? 14.813  -0.737  -18.277 1.00 52.24  ? 279  VAL D CG2   1 
ATOM   3580 N N     . HIS C 1 159 ? 15.097  2.531   -16.035 1.00 60.41  ? 280  HIS D N     1 
ATOM   3581 C CA    . HIS C 1 159 ? 14.082  3.040   -15.127 1.00 72.58  ? 280  HIS D CA    1 
ATOM   3582 C C     . HIS C 1 159 ? 12.749  2.989   -15.862 1.00 77.85  ? 280  HIS D C     1 
ATOM   3583 O O     . HIS C 1 159 ? 12.666  3.352   -17.031 1.00 84.18  ? 280  HIS D O     1 
ATOM   3584 C CB    . HIS C 1 159 ? 14.417  4.448   -14.625 1.00 76.36  ? 280  HIS D CB    1 
ATOM   3585 C CG    . HIS C 1 159 ? 13.549  4.903   -13.488 1.00 87.50  ? 280  HIS D CG    1 
ATOM   3586 N ND1   . HIS C 1 159 ? 13.985  4.924   -12.179 1.00 92.07  ? 280  HIS D ND1   1 
ATOM   3587 C CD2   . HIS C 1 159 ? 12.268  5.349   -13.463 1.00 91.86  ? 280  HIS D CD2   1 
ATOM   3588 C CE1   . HIS C 1 159 ? 13.012  5.370   -11.399 1.00 93.25  ? 280  HIS D CE1   1 
ATOM   3589 N NE2   . HIS C 1 159 ? 11.959  5.633   -12.153 1.00 92.37  ? 280  HIS D NE2   1 
ATOM   3590 N N     . ALA C 1 160 ? 11.712  2.510   -15.180 1.00 86.57  ? 281  ALA D N     1 
ATOM   3591 C CA    . ALA C 1 160 ? 10.426  2.235   -15.817 1.00 89.49  ? 281  ALA D CA    1 
ATOM   3592 C C     . ALA C 1 160 ? 9.483   3.440   -15.738 1.00 97.02  ? 281  ALA D C     1 
ATOM   3593 O O     . ALA C 1 160 ? 9.458   4.141   -14.723 1.00 98.36  ? 281  ALA D O     1 
ATOM   3594 C CB    . ALA C 1 160 ? 9.782   1.020   -15.176 1.00 88.52  ? 281  ALA D CB    1 
ATOM   3595 N N     . PRO C 1 161 ? 8.701   3.686   -16.810 1.00 106.40 ? 282  PRO D N     1 
ATOM   3596 C CA    . PRO C 1 161 ? 7.705   4.769   -16.783 1.00 103.99 ? 282  PRO D CA    1 
ATOM   3597 C C     . PRO C 1 161 ? 6.714   4.644   -15.621 1.00 100.30 ? 282  PRO D C     1 
ATOM   3598 O O     . PRO C 1 161 ? 6.084   5.628   -15.234 1.00 99.15  ? 282  PRO D O     1 
ATOM   3599 C CB    . PRO C 1 161 ? 6.974   4.611   -18.124 1.00 107.97 ? 282  PRO D CB    1 
ATOM   3600 C CG    . PRO C 1 161 ? 7.942   3.906   -19.017 1.00 107.75 ? 282  PRO D CG    1 
ATOM   3601 C CD    . PRO C 1 161 ? 8.749   3.009   -18.124 1.00 106.82 ? 282  PRO D CD    1 
ATOM   3602 N N     . LEU C 1 168 ? 2.144   6.255   -21.043 1.00 110.33 ? 289  LEU D N     1 
ATOM   3603 C CA    . LEU C 1 168 ? 2.439   4.944   -21.615 1.00 110.13 ? 289  LEU D CA    1 
ATOM   3604 C C     . LEU C 1 168 ? 1.832   4.827   -23.026 1.00 107.68 ? 289  LEU D C     1 
ATOM   3605 O O     . LEU C 1 168 ? 2.529   4.461   -23.976 1.00 94.56  ? 289  LEU D O     1 
ATOM   3606 C CB    . LEU C 1 168 ? 1.915   3.804   -20.709 1.00 109.91 ? 289  LEU D CB    1 
ATOM   3607 C CG    . LEU C 1 168 ? 2.203   3.734   -19.192 1.00 107.49 ? 289  LEU D CG    1 
ATOM   3608 C CD1   . LEU C 1 168 ? 3.574   4.299   -18.848 1.00 105.82 ? 289  LEU D CD1   1 
ATOM   3609 C CD2   . LEU C 1 168 ? 1.122   4.429   -18.370 1.00 103.57 ? 289  LEU D CD2   1 
ATOM   3610 N N     . CYS C 1 169 ? 0.536   5.144   -23.145 1.00 108.14 ? 290  CYS D N     1 
ATOM   3611 C CA    . CYS C 1 169 ? -0.209  5.020   -24.409 1.00 102.41 ? 290  CYS D CA    1 
ATOM   3612 C C     . CYS C 1 169 ? -1.199  6.190   -24.654 1.00 105.55 ? 290  CYS D C     1 
ATOM   3613 O O     . CYS C 1 169 ? -0.936  7.329   -24.252 1.00 108.88 ? 290  CYS D O     1 
ATOM   3614 C CB    . CYS C 1 169 ? -0.938  3.673   -24.468 1.00 93.83  ? 290  CYS D CB    1 
ATOM   3615 S SG    . CYS C 1 169 ? -2.556  3.698   -23.659 1.00 94.01  ? 290  CYS D SG    1 
ATOM   3616 N N     . GLY C 1 170 ? -2.337  5.892   -25.295 1.00 101.52 ? 291  GLY D N     1 
ATOM   3617 C CA    . GLY C 1 170 ? -3.104  6.885   -26.065 1.00 91.79  ? 291  GLY D CA    1 
ATOM   3618 C C     . GLY C 1 170 ? -2.498  6.989   -27.458 1.00 87.29  ? 291  GLY D C     1 
ATOM   3619 O O     . GLY C 1 170 ? -2.896  7.826   -28.272 1.00 81.48  ? 291  GLY D O     1 
ATOM   3620 N N     . THR C 1 171 ? -1.538  6.097   -27.719 1.00 83.15  ? 292  THR D N     1 
ATOM   3621 C CA    . THR C 1 171 ? -0.658  6.147   -28.886 1.00 71.07  ? 292  THR D CA    1 
ATOM   3622 C C     . THR C 1 171 ? -0.399  4.764   -29.480 1.00 61.63  ? 292  THR D C     1 
ATOM   3623 O O     . THR C 1 171 ? 0.514   4.602   -30.305 1.00 48.79  ? 292  THR D O     1 
ATOM   3624 C CB    . THR C 1 171 ? 0.703   6.761   -28.488 1.00 74.02  ? 292  THR D CB    1 
ATOM   3625 O OG1   . THR C 1 171 ? 1.303   7.385   -29.627 1.00 75.89  ? 292  THR D OG1   1 
ATOM   3626 C CG2   . THR C 1 171 ? 1.675   5.702   -27.863 1.00 72.21  ? 292  THR D CG2   1 
ATOM   3627 N N     . LEU C 1 172 ? -1.183  3.764   -29.068 1.00 56.93  ? 293  LEU D N     1 
ATOM   3628 C CA    . LEU C 1 172 ? -0.906  2.407   -29.535 1.00 61.28  ? 293  LEU D CA    1 
ATOM   3629 C C     . LEU C 1 172 ? -1.222  2.234   -31.006 1.00 53.15  ? 293  LEU D C     1 
ATOM   3630 O O     . LEU C 1 172 ? -0.583  1.446   -31.674 1.00 50.85  ? 293  LEU D O     1 
ATOM   3631 C CB    . LEU C 1 172 ? -1.556  1.295   -28.693 1.00 63.17  ? 293  LEU D CB    1 
ATOM   3632 C CG    . LEU C 1 172 ? -2.899  1.508   -28.026 1.00 68.70  ? 293  LEU D CG    1 
ATOM   3633 C CD1   . LEU C 1 172 ? -3.922  2.122   -28.972 1.00 71.25  ? 293  LEU D CD1   1 
ATOM   3634 C CD2   . LEU C 1 172 ? -3.353  0.155   -27.498 1.00 70.76  ? 293  LEU D CD2   1 
ATOM   3635 N N     . ASP C 1 173 ? -2.157  2.994   -31.538 1.00 47.21  ? 294  ASP D N     1 
ATOM   3636 C CA    . ASP C 1 173 ? -2.434  2.855   -32.957 1.00 46.94  ? 294  ASP D CA    1 
ATOM   3637 C C     . ASP C 1 173 ? -1.161  2.791   -33.778 1.00 39.59  ? 294  ASP D C     1 
ATOM   3638 O O     . ASP C 1 173 ? -1.143  2.129   -34.801 1.00 39.00  ? 294  ASP D O     1 
ATOM   3639 C CB    . ASP C 1 173 ? -3.331  3.986   -33.461 1.00 50.18  ? 294  ASP D CB    1 
ATOM   3640 C CG    . ASP C 1 173 ? -4.759  3.841   -32.978 1.00 53.49  ? 294  ASP D CG    1 
ATOM   3641 O OD1   . ASP C 1 173 ? -5.509  2.980   -33.531 1.00 52.08  ? 294  ASP D OD1   1 
ATOM   3642 O OD2   . ASP C 1 173 ? -5.105  4.585   -32.024 1.00 53.73  ? 294  ASP D OD2   1 
ATOM   3643 N N     . TYR C 1 174 ? -0.106  3.456   -33.304 1.00 37.97  ? 295  TYR D N     1 
ATOM   3644 C CA    . TYR C 1 174 ? 1.152   3.573   -34.034 1.00 37.89  ? 295  TYR D CA    1 
ATOM   3645 C C     . TYR C 1 174 ? 2.278   2.663   -33.565 1.00 37.90  ? 295  TYR D C     1 
ATOM   3646 O O     . TYR C 1 174 ? 3.348   2.690   -34.163 1.00 37.12  ? 295  TYR D O     1 
ATOM   3647 C CB    . TYR C 1 174 ? 1.634   5.015   -34.005 1.00 39.21  ? 295  TYR D CB    1 
ATOM   3648 C CG    . TYR C 1 174 ? 0.626   5.942   -34.601 1.00 39.46  ? 295  TYR D CG    1 
ATOM   3649 C CD1   . TYR C 1 174 ? 0.619   6.213   -35.972 1.00 38.26  ? 295  TYR D CD1   1 
ATOM   3650 C CD2   . TYR C 1 174 ? -0.360  6.513   -33.800 1.00 38.42  ? 295  TYR D CD2   1 
ATOM   3651 C CE1   . TYR C 1 174 ? -0.335  7.039   -36.515 1.00 37.86  ? 295  TYR D CE1   1 
ATOM   3652 C CE2   . TYR C 1 174 ? -1.322  7.340   -34.332 1.00 37.59  ? 295  TYR D CE2   1 
ATOM   3653 C CZ    . TYR C 1 174 ? -1.307  7.606   -35.678 1.00 39.43  ? 295  TYR D CZ    1 
ATOM   3654 O OH    . TYR C 1 174 ? -2.294  8.452   -36.158 1.00 45.77  ? 295  TYR D OH    1 
ATOM   3655 N N     . LEU C 1 175 ? 2.031   1.851   -32.539 1.00 37.44  ? 296  LEU D N     1 
ATOM   3656 C CA    . LEU C 1 175 ? 3.050   0.968   -31.980 1.00 40.60  ? 296  LEU D CA    1 
ATOM   3657 C C     . LEU C 1 175 ? 3.088   -0.391  -32.626 1.00 41.26  ? 296  LEU D C     1 
ATOM   3658 O O     . LEU C 1 175 ? 2.044   -0.987  -32.794 1.00 45.53  ? 296  LEU D O     1 
ATOM   3659 C CB    . LEU C 1 175 ? 2.775   0.742   -30.494 1.00 44.35  ? 296  LEU D CB    1 
ATOM   3660 C CG    . LEU C 1 175 ? 2.932   2.012   -29.640 1.00 47.64  ? 296  LEU D CG    1 
ATOM   3661 C CD1   . LEU C 1 175 ? 2.520   1.790   -28.183 1.00 48.01  ? 296  LEU D CD1   1 
ATOM   3662 C CD2   . LEU C 1 175 ? 4.354   2.559   -29.751 1.00 43.87  ? 296  LEU D CD2   1 
ATOM   3663 N N     . PRO C 1 176 ? 4.296   -0.934  -32.920 1.00 44.75  ? 297  PRO D N     1 
ATOM   3664 C CA    . PRO C 1 176 ? 4.354   -2.310  -33.444 1.00 42.71  ? 297  PRO D CA    1 
ATOM   3665 C C     . PRO C 1 176 ? 3.995   -3.353  -32.390 1.00 43.77  ? 297  PRO D C     1 
ATOM   3666 O O     . PRO C 1 176 ? 4.016   -3.049  -31.207 1.00 47.20  ? 297  PRO D O     1 
ATOM   3667 C CB    . PRO C 1 176 ? 5.824   -2.485  -33.839 1.00 43.48  ? 297  PRO D CB    1 
ATOM   3668 C CG    . PRO C 1 176 ? 6.535   -1.227  -33.522 1.00 41.48  ? 297  PRO D CG    1 
ATOM   3669 C CD    . PRO C 1 176 ? 5.646   -0.406  -32.641 1.00 43.75  ? 297  PRO D CD    1 
ATOM   3670 N N     . PRO C 1 177 ? 3.698   -4.588  -32.801 1.00 44.58  ? 298  PRO D N     1 
ATOM   3671 C CA    . PRO C 1 177 ? 3.416   -5.631  -31.805 1.00 45.87  ? 298  PRO D CA    1 
ATOM   3672 C C     . PRO C 1 177 ? 4.569   -5.855  -30.819 1.00 52.75  ? 298  PRO D C     1 
ATOM   3673 O O     . PRO C 1 177 ? 4.337   -6.024  -29.620 1.00 59.74  ? 298  PRO D O     1 
ATOM   3674 C CB    . PRO C 1 177 ? 3.226   -6.884  -32.648 1.00 43.90  ? 298  PRO D CB    1 
ATOM   3675 C CG    . PRO C 1 177 ? 2.990   -6.393  -34.043 1.00 43.87  ? 298  PRO D CG    1 
ATOM   3676 C CD    . PRO C 1 177 ? 3.783   -5.133  -34.161 1.00 43.62  ? 298  PRO D CD    1 
ATOM   3677 N N     . GLU C 1 178 ? 5.805   -5.831  -31.310 1.00 57.26  ? 299  GLU D N     1 
ATOM   3678 C CA    . GLU C 1 178 ? 6.962   -6.106  -30.444 1.00 59.49  ? 299  GLU D CA    1 
ATOM   3679 C C     . GLU C 1 178 ? 7.248   -5.024  -29.386 1.00 62.64  ? 299  GLU D C     1 
ATOM   3680 O O     . GLU C 1 178 ? 7.946   -5.323  -28.429 1.00 63.03  ? 299  GLU D O     1 
ATOM   3681 C CB    . GLU C 1 178 ? 8.236   -6.409  -31.262 1.00 54.80  ? 299  GLU D CB    1 
ATOM   3682 C CG    . GLU C 1 178 ? 8.837   -5.217  -32.003 1.00 53.61  ? 299  GLU D CG    1 
ATOM   3683 C CD    . GLU C 1 178 ? 8.377   -5.088  -33.443 1.00 54.34  ? 299  GLU D CD    1 
ATOM   3684 O OE1   . GLU C 1 178 ? 7.331   -5.685  -33.819 1.00 55.95  ? 299  GLU D OE1   1 
ATOM   3685 O OE2   . GLU C 1 178 ? 9.065   -4.380  -34.208 1.00 47.46  ? 299  GLU D OE2   1 
ATOM   3686 N N     . MET C 1 179 ? 6.748   -3.792  -29.554 1.00 64.96  ? 300  MET D N     1 
ATOM   3687 C CA    . MET C 1 179 ? 6.893   -2.752  -28.515 1.00 69.73  ? 300  MET D CA    1 
ATOM   3688 C C     . MET C 1 179 ? 5.676   -2.798  -27.604 1.00 69.37  ? 300  MET D C     1 
ATOM   3689 O O     . MET C 1 179 ? 5.789   -2.688  -26.397 1.00 72.58  ? 300  MET D O     1 
ATOM   3690 C CB    . MET C 1 179 ? 7.048   -1.353  -29.110 1.00 77.87  ? 300  MET D CB    1 
ATOM   3691 C CG    . MET C 1 179 ? 8.340   -1.111  -29.887 1.00 89.81  ? 300  MET D CG    1 
ATOM   3692 S SD    . MET C 1 179 ? 9.819   -0.791  -28.887 1.00 116.55 ? 300  MET D SD    1 
ATOM   3693 C CE    . MET C 1 179 ? 10.627  -2.398  -28.843 1.00 114.52 ? 300  MET D CE    1 
ATOM   3694 N N     . ILE C 1 180 ? 4.508   -2.945  -28.203 1.00 71.45  ? 301  ILE D N     1 
ATOM   3695 C CA    . ILE C 1 180 ? 3.289   -3.314  -27.495 1.00 72.34  ? 301  ILE D CA    1 
ATOM   3696 C C     . ILE C 1 180 ? 3.540   -4.432  -26.469 1.00 77.05  ? 301  ILE D C     1 
ATOM   3697 O O     . ILE C 1 180 ? 3.374   -4.218  -25.270 1.00 68.44  ? 301  ILE D O     1 
ATOM   3698 C CB    . ILE C 1 180 ? 2.230   -3.742  -28.536 1.00 72.42  ? 301  ILE D CB    1 
ATOM   3699 C CG1   . ILE C 1 180 ? 1.516   -2.511  -29.069 1.00 72.56  ? 301  ILE D CG1   1 
ATOM   3700 C CG2   . ILE C 1 180 ? 1.210   -4.694  -27.965 1.00 73.96  ? 301  ILE D CG2   1 
ATOM   3701 C CD1   . ILE C 1 180 ? 0.797   -2.768  -30.366 1.00 75.28  ? 301  ILE D CD1   1 
ATOM   3702 N N     . GLU C 1 181 ? 3.940   -5.611  -26.953 1.00 88.60  ? 302  GLU D N     1 
ATOM   3703 C CA    . GLU C 1 181 ? 4.235   -6.786  -26.100 1.00 95.98  ? 302  GLU D CA    1 
ATOM   3704 C C     . GLU C 1 181 ? 5.707   -6.780  -25.699 1.00 99.08  ? 302  GLU D C     1 
ATOM   3705 O O     . GLU C 1 181 ? 6.479   -5.968  -26.202 1.00 97.84  ? 302  GLU D O     1 
ATOM   3706 C CB    . GLU C 1 181 ? 3.888   -8.093  -26.832 1.00 95.93  ? 302  GLU D CB    1 
ATOM   3707 C CG    . GLU C 1 181 ? 2.394   -8.374  -26.891 1.00 98.02  ? 302  GLU D CG    1 
ATOM   3708 C CD    . GLU C 1 181 ? 1.971   -9.242  -28.069 1.00 101.28 ? 302  GLU D CD    1 
ATOM   3709 O OE1   . GLU C 1 181 ? 2.364   -8.962  -29.230 1.00 97.39  ? 302  GLU D OE1   1 
ATOM   3710 O OE2   . GLU C 1 181 ? 1.205   -10.201 -27.827 1.00 103.27 ? 302  GLU D OE2   1 
ATOM   3711 N N     . GLY C 1 182 ? 6.105   -7.666  -24.789 1.00 102.89 ? 303  GLY D N     1 
ATOM   3712 C CA    . GLY C 1 182 ? 7.466   -7.631  -24.245 1.00 107.63 ? 303  GLY D CA    1 
ATOM   3713 C C     . GLY C 1 182 ? 7.681   -6.402  -23.363 1.00 113.79 ? 303  GLY D C     1 
ATOM   3714 O O     . GLY C 1 182 ? 8.237   -6.510  -22.262 1.00 118.92 ? 303  GLY D O     1 
ATOM   3715 N N     . ARG C 1 183 ? 7.270   -5.233  -23.863 1.00 105.43 ? 304  ARG D N     1 
ATOM   3716 C CA    . ARG C 1 183 ? 7.100   -4.038  -23.036 1.00 105.58 ? 304  ARG D CA    1 
ATOM   3717 C C     . ARG C 1 183 ? 5.665   -3.949  -22.506 1.00 105.31 ? 304  ARG D C     1 
ATOM   3718 O O     . ARG C 1 183 ? 4.722   -4.441  -23.126 1.00 98.00  ? 304  ARG D O     1 
ATOM   3719 C CB    . ARG C 1 183 ? 7.499   -2.779  -23.804 1.00 109.57 ? 304  ARG D CB    1 
ATOM   3720 C CG    . ARG C 1 183 ? 8.991   -2.479  -23.728 1.00 112.72 ? 304  ARG D CG    1 
ATOM   3721 C CD    . ARG C 1 183 ? 9.438   -1.422  -24.731 1.00 107.02 ? 304  ARG D CD    1 
ATOM   3722 N NE    . ARG C 1 183 ? 10.362  -0.468  -24.108 1.00 106.28 ? 304  ARG D NE    1 
ATOM   3723 C CZ    . ARG C 1 183 ? 10.076  0.795   -23.779 1.00 101.42 ? 304  ARG D CZ    1 
ATOM   3724 N NH1   . ARG C 1 183 ? 8.879   1.335   -24.017 1.00 96.70  ? 304  ARG D NH1   1 
ATOM   3725 N NH2   . ARG C 1 183 ? 11.016  1.541   -23.211 1.00 102.33 ? 304  ARG D NH2   1 
ATOM   3726 N N     . MET C 1 184 ? 5.527   -3.334  -21.335 1.00 110.42 ? 305  MET D N     1 
ATOM   3727 C CA    . MET C 1 184 ? 4.346   -3.500  -20.467 1.00 119.28 ? 305  MET D CA    1 
ATOM   3728 C C     . MET C 1 184 ? 4.114   -4.972  -20.042 1.00 113.47 ? 305  MET D C     1 
ATOM   3729 O O     . MET C 1 184 ? 3.034   -5.334  -19.568 1.00 108.17 ? 305  MET D O     1 
ATOM   3730 C CB    . MET C 1 184 ? 3.083   -2.828  -21.056 1.00 130.24 ? 305  MET D CB    1 
ATOM   3731 C CG    . MET C 1 184 ? 3.086   -1.289  -20.973 1.00 140.81 ? 305  MET D CG    1 
ATOM   3732 S SD    . MET C 1 184 ? 2.168   -0.472  -19.619 1.00 153.12 ? 305  MET D SD    1 
ATOM   3733 C CE    . MET C 1 184 ? 3.319   -0.503  -18.239 1.00 144.51 ? 305  MET D CE    1 
ATOM   3734 N N     . HIS C 1 185 ? 5.138   -5.810  -20.238 1.00 112.06 ? 306  HIS D N     1 
ATOM   3735 C CA    . HIS C 1 185 ? 5.396   -7.002  -19.407 1.00 102.98 ? 306  HIS D CA    1 
ATOM   3736 C C     . HIS C 1 185 ? 6.891   -7.015  -19.118 1.00 88.34  ? 306  HIS D C     1 
ATOM   3737 O O     . HIS C 1 185 ? 7.581   -8.021  -19.260 1.00 85.12  ? 306  HIS D O     1 
ATOM   3738 C CB    . HIS C 1 185 ? 4.911   -8.302  -20.059 1.00 103.25 ? 306  HIS D CB    1 
ATOM   3739 C CG    . HIS C 1 185 ? 3.605   -8.774  -19.513 1.00 108.49 ? 306  HIS D CG    1 
ATOM   3740 N ND1   . HIS C 1 185 ? 3.435   -9.098  -18.184 1.00 109.77 ? 306  HIS D ND1   1 
ATOM   3741 C CD2   . HIS C 1 185 ? 2.398   -8.947  -20.102 1.00 109.72 ? 306  HIS D CD2   1 
ATOM   3742 C CE1   . HIS C 1 185 ? 2.181   -9.463  -17.979 1.00 112.63 ? 306  HIS D CE1   1 
ATOM   3743 N NE2   . HIS C 1 185 ? 1.531   -9.381  -19.127 1.00 112.44 ? 306  HIS D NE2   1 
ATOM   3744 N N     . ASP C 1 186 ? 7.356   -5.849  -18.692 1.00 80.81  ? 307  ASP D N     1 
ATOM   3745 C CA    . ASP C 1 186 ? 8.756   -5.581  -18.483 1.00 74.05  ? 307  ASP D CA    1 
ATOM   3746 C C     . ASP C 1 186 ? 9.320   -6.158  -17.173 1.00 71.45  ? 307  ASP D C     1 
ATOM   3747 O O     . ASP C 1 186 ? 10.480  -6.533  -17.174 1.00 62.83  ? 307  ASP D O     1 
ATOM   3748 C CB    . ASP C 1 186 ? 9.001   -4.069  -18.555 1.00 77.81  ? 307  ASP D CB    1 
ATOM   3749 C CG    . ASP C 1 186 ? 9.492   -3.606  -19.928 1.00 86.46  ? 307  ASP D CG    1 
ATOM   3750 O OD1   . ASP C 1 186 ? 9.820   -4.460  -20.788 1.00 91.67  ? 307  ASP D OD1   1 
ATOM   3751 O OD2   . ASP C 1 186 ? 9.569   -2.373  -20.142 1.00 84.95  ? 307  ASP D OD2   1 
ATOM   3752 N N     . GLU C 1 187 ? 8.543   -6.218  -16.074 1.00 71.97  ? 308  GLU D N     1 
ATOM   3753 C CA    . GLU C 1 187 ? 8.995   -6.923  -14.840 1.00 75.16  ? 308  GLU D CA    1 
ATOM   3754 C C     . GLU C 1 187 ? 9.473   -8.345  -15.162 1.00 67.15  ? 308  GLU D C     1 
ATOM   3755 O O     . GLU C 1 187 ? 10.529  -8.779  -14.696 1.00 65.65  ? 308  GLU D O     1 
ATOM   3756 C CB    . GLU C 1 187 ? 7.902   -7.019  -13.728 1.00 86.97  ? 308  GLU D CB    1 
ATOM   3757 C CG    . GLU C 1 187 ? 7.998   -8.313  -12.854 1.00 96.91  ? 308  GLU D CG    1 
ATOM   3758 C CD    . GLU C 1 187 ? 7.188   -8.345  -11.532 1.00 104.42 ? 308  GLU D CD    1 
ATOM   3759 O OE1   . GLU C 1 187 ? 7.621   -7.760  -10.501 1.00 97.85  ? 308  GLU D OE1   1 
ATOM   3760 O OE2   . GLU C 1 187 ? 6.129   -9.019  -11.497 1.00 99.84  ? 308  GLU D OE2   1 
ATOM   3761 N N     . LYS C 1 188 ? 8.692   -9.060  -15.961 1.00 55.77  ? 309  LYS D N     1 
ATOM   3762 C CA    . LYS C 1 188 ? 8.872   -10.498 -16.111 1.00 53.66  ? 309  LYS D CA    1 
ATOM   3763 C C     . LYS C 1 188 ? 10.191  -10.885 -16.798 1.00 52.43  ? 309  LYS D C     1 
ATOM   3764 O O     . LYS C 1 188 ? 10.552  -12.071 -16.874 1.00 46.58  ? 309  LYS D O     1 
ATOM   3765 C CB    . LYS C 1 188 ? 7.680   -11.096 -16.856 1.00 54.62  ? 309  LYS D CB    1 
ATOM   3766 C CG    . LYS C 1 188 ? 6.330   -10.854 -16.183 1.00 58.07  ? 309  LYS D CG    1 
ATOM   3767 C CD    . LYS C 1 188 ? 6.218   -11.553 -14.831 1.00 59.94  ? 309  LYS D CD    1 
ATOM   3768 C CE    . LYS C 1 188 ? 5.064   -11.033 -13.978 1.00 60.75  ? 309  LYS D CE    1 
ATOM   3769 N NZ    . LYS C 1 188 ? 3.904   -11.965 -13.883 1.00 60.63  ? 309  LYS D NZ    1 
ATOM   3770 N N     . VAL C 1 189 ? 10.918  -9.893  -17.296 1.00 50.44  ? 310  VAL D N     1 
ATOM   3771 C CA    . VAL C 1 189 ? 12.267  -10.136 -17.793 1.00 51.06  ? 310  VAL D CA    1 
ATOM   3772 C C     . VAL C 1 189 ? 13.183  -10.589 -16.636 1.00 47.94  ? 310  VAL D C     1 
ATOM   3773 O O     . VAL C 1 189 ? 14.021  -11.471 -16.813 1.00 45.42  ? 310  VAL D O     1 
ATOM   3774 C CB    . VAL C 1 189 ? 12.840  -8.890  -18.525 1.00 52.87  ? 310  VAL D CB    1 
ATOM   3775 C CG1   . VAL C 1 189 ? 13.265  -7.798  -17.539 1.00 53.61  ? 310  VAL D CG1   1 
ATOM   3776 C CG2   . VAL C 1 189 ? 14.003  -9.273  -19.424 1.00 52.77  ? 310  VAL D CG2   1 
ATOM   3777 N N     . ASP C 1 190 ? 13.000  -10.014 -15.446 1.00 47.31  ? 311  ASP D N     1 
ATOM   3778 C CA    . ASP C 1 190 ? 13.841  -10.376 -14.288 1.00 46.97  ? 311  ASP D CA    1 
ATOM   3779 C C     . ASP C 1 190 ? 13.508  -11.740 -13.719 1.00 43.16  ? 311  ASP D C     1 
ATOM   3780 O O     . ASP C 1 190 ? 14.303  -12.305 -12.994 1.00 44.96  ? 311  ASP D O     1 
ATOM   3781 C CB    . ASP C 1 190 ? 13.764  -9.316  -13.180 1.00 47.62  ? 311  ASP D CB    1 
ATOM   3782 C CG    . ASP C 1 190 ? 14.503  -8.025  -13.545 1.00 49.47  ? 311  ASP D CG    1 
ATOM   3783 O OD1   . ASP C 1 190 ? 15.508  -8.099  -14.301 1.00 50.81  ? 311  ASP D OD1   1 
ATOM   3784 O OD2   . ASP C 1 190 ? 14.079  -6.941  -13.075 1.00 45.68  ? 311  ASP D OD2   1 
ATOM   3785 N N     . LEU C 1 191 ? 12.342  -12.268 -14.063 1.00 42.50  ? 312  LEU D N     1 
ATOM   3786 C CA    . LEU C 1 191 ? 11.956  -13.598 -13.634 1.00 40.36  ? 312  LEU D CA    1 
ATOM   3787 C C     . LEU C 1 191 ? 12.619  -14.652 -14.431 1.00 36.58  ? 312  LEU D C     1 
ATOM   3788 O O     . LEU C 1 191 ? 12.927  -15.693 -13.896 1.00 36.99  ? 312  LEU D O     1 
ATOM   3789 C CB    . LEU C 1 191 ? 10.436  -13.789 -13.653 1.00 41.77  ? 312  LEU D CB    1 
ATOM   3790 C CG    . LEU C 1 191 ? 9.949   -13.213 -12.324 1.00 44.74  ? 312  LEU D CG    1 
ATOM   3791 C CD1   . LEU C 1 191 ? 9.453   -11.772 -12.467 1.00 44.34  ? 312  LEU D CD1   1 
ATOM   3792 C CD2   . LEU C 1 191 ? 8.940   -14.129 -11.677 1.00 44.06  ? 312  LEU D CD2   1 
ATOM   3793 N N     . TRP C 1 192 ? 12.840  -14.388 -15.709 1.00 39.57  ? 313  TRP D N     1 
ATOM   3794 C CA    . TRP C 1 192 ? 13.574  -15.311 -16.561 1.00 38.65  ? 313  TRP D CA    1 
ATOM   3795 C C     . TRP C 1 192 ? 14.957  -15.516 -16.017 1.00 40.41  ? 313  TRP D C     1 
ATOM   3796 O O     . TRP C 1 192 ? 15.370  -16.640 -15.758 1.00 41.20  ? 313  TRP D O     1 
ATOM   3797 C CB    . TRP C 1 192 ? 13.712  -14.751 -17.946 1.00 39.08  ? 313  TRP D CB    1 
ATOM   3798 C CG    . TRP C 1 192 ? 14.424  -15.674 -18.845 1.00 41.39  ? 313  TRP D CG    1 
ATOM   3799 C CD1   . TRP C 1 192 ? 15.772  -15.765 -19.037 1.00 37.92  ? 313  TRP D CD1   1 
ATOM   3800 C CD2   . TRP C 1 192 ? 13.820  -16.660 -19.700 1.00 39.12  ? 313  TRP D CD2   1 
ATOM   3801 N NE1   . TRP C 1 192 ? 16.038  -16.749 -19.958 1.00 38.50  ? 313  TRP D NE1   1 
ATOM   3802 C CE2   . TRP C 1 192 ? 14.857  -17.308 -20.381 1.00 37.18  ? 313  TRP D CE2   1 
ATOM   3803 C CE3   . TRP C 1 192 ? 12.507  -17.042 -19.955 1.00 39.15  ? 313  TRP D CE3   1 
ATOM   3804 C CZ2   . TRP C 1 192 ? 14.620  -18.326 -21.305 1.00 38.86  ? 313  TRP D CZ2   1 
ATOM   3805 C CZ3   . TRP C 1 192 ? 12.274  -18.060 -20.871 1.00 42.30  ? 313  TRP D CZ3   1 
ATOM   3806 C CH2   . TRP C 1 192 ? 13.323  -18.691 -21.532 1.00 39.35  ? 313  TRP D CH2   1 
ATOM   3807 N N     . SER C 1 193 ? 15.664  -14.408 -15.847 1.00 45.44  ? 314  SER D N     1 
ATOM   3808 C CA    . SER C 1 193 ? 16.998  -14.412 -15.258 1.00 51.25  ? 314  SER D CA    1 
ATOM   3809 C C     . SER C 1 193 ? 17.116  -15.284 -14.004 1.00 48.00  ? 314  SER D C     1 
ATOM   3810 O O     . SER C 1 193 ? 18.102  -16.001 -13.835 1.00 51.25  ? 314  SER D O     1 
ATOM   3811 C CB    . SER C 1 193 ? 17.430  -12.976 -14.947 1.00 56.47  ? 314  SER D CB    1 
ATOM   3812 O OG    . SER C 1 193 ? 17.877  -12.340 -16.141 1.00 65.46  ? 314  SER D OG    1 
ATOM   3813 N N     . LEU C 1 194 ? 16.119  -15.219 -13.132 1.00 45.24  ? 315  LEU D N     1 
ATOM   3814 C CA    . LEU C 1 194 ? 16.125  -16.010 -11.905 1.00 43.97  ? 315  LEU D CA    1 
ATOM   3815 C C     . LEU C 1 194 ? 16.054  -17.506 -12.221 1.00 41.86  ? 315  LEU D C     1 
ATOM   3816 O O     . LEU C 1 194 ? 16.720  -18.294 -11.589 1.00 40.32  ? 315  LEU D O     1 
ATOM   3817 C CB    . LEU C 1 194 ? 14.955  -15.606 -11.010 1.00 44.02  ? 315  LEU D CB    1 
ATOM   3818 C CG    . LEU C 1 194 ? 15.337  -15.263 -9.588  1.00 45.48  ? 315  LEU D CG    1 
ATOM   3819 C CD1   . LEU C 1 194 ? 16.330  -14.124 -9.591  1.00 46.53  ? 315  LEU D CD1   1 
ATOM   3820 C CD2   . LEU C 1 194 ? 14.114  -14.879 -8.776  1.00 45.83  ? 315  LEU D CD2   1 
ATOM   3821 N N     . GLY C 1 195 ? 15.246  -17.884 -13.205 1.00 40.61  ? 316  GLY D N     1 
ATOM   3822 C CA    . GLY C 1 195 ? 15.122  -19.275 -13.604 1.00 40.63  ? 316  GLY D CA    1 
ATOM   3823 C C     . GLY C 1 195 ? 16.438  -19.829 -14.102 1.00 42.01  ? 316  GLY D C     1 
ATOM   3824 O O     . GLY C 1 195 ? 16.827  -20.950 -13.784 1.00 45.97  ? 316  GLY D O     1 
ATOM   3825 N N     . VAL C 1 196 ? 17.134  -19.028 -14.888 1.00 40.90  ? 317  VAL D N     1 
ATOM   3826 C CA    . VAL C 1 196 ? 18.421  -19.419 -15.428 1.00 39.38  ? 317  VAL D CA    1 
ATOM   3827 C C     . VAL C 1 196 ? 19.495  -19.553 -14.335 1.00 39.13  ? 317  VAL D C     1 
ATOM   3828 O O     . VAL C 1 196 ? 20.330  -20.472 -14.386 1.00 34.34  ? 317  VAL D O     1 
ATOM   3829 C CB    . VAL C 1 196 ? 18.856  -18.412 -16.490 1.00 39.59  ? 317  VAL D CB    1 
ATOM   3830 C CG1   . VAL C 1 196 ? 20.312  -18.597 -16.854 1.00 41.42  ? 317  VAL D CG1   1 
ATOM   3831 C CG2   . VAL C 1 196 ? 17.979  -18.573 -17.719 1.00 41.88  ? 317  VAL D CG2   1 
ATOM   3832 N N     . LEU C 1 197 ? 19.462  -18.652 -13.353 1.00 38.16  ? 318  LEU D N     1 
ATOM   3833 C CA    . LEU C 1 197 ? 20.392  -18.716 -12.245 1.00 41.03  ? 318  LEU D CA    1 
ATOM   3834 C C     . LEU C 1 197 ? 20.122  -19.934 -11.374 1.00 45.13  ? 318  LEU D C     1 
ATOM   3835 O O     . LEU C 1 197 ? 21.058  -20.579 -10.882 1.00 45.15  ? 318  LEU D O     1 
ATOM   3836 C CB    . LEU C 1 197 ? 20.354  -17.431 -11.422 1.00 43.40  ? 318  LEU D CB    1 
ATOM   3837 C CG    . LEU C 1 197 ? 21.381  -16.351 -11.828 1.00 49.28  ? 318  LEU D CG    1 
ATOM   3838 C CD1   . LEU C 1 197 ? 21.635  -16.256 -13.331 1.00 51.10  ? 318  LEU D CD1   1 
ATOM   3839 C CD2   . LEU C 1 197 ? 20.953  -14.983 -11.318 1.00 53.09  ? 318  LEU D CD2   1 
ATOM   3840 N N     . CYS C 1 198 ? 18.845  -20.261 -11.204 1.00 45.89  ? 319  CYS D N     1 
ATOM   3841 C CA    . CYS C 1 198 ? 18.461  -21.365 -10.355 1.00 46.56  ? 319  CYS D CA    1 
ATOM   3842 C C     . CYS C 1 198 ? 18.944  -22.652 -10.994 1.00 45.61  ? 319  CYS D C     1 
ATOM   3843 O O     . CYS C 1 198 ? 19.598  -23.489 -10.355 1.00 47.10  ? 319  CYS D O     1 
ATOM   3844 C CB    . CYS C 1 198 ? 16.947  -21.404 -10.184 1.00 50.59  ? 319  CYS D CB    1 
ATOM   3845 S SG    . CYS C 1 198 ? 16.391  -22.514 -8.866  1.00 55.94  ? 319  CYS D SG    1 
ATOM   3846 N N     . TYR C 1 199 ? 18.641  -22.799 -12.273 1.00 42.39  ? 320  TYR D N     1 
ATOM   3847 C CA    . TYR C 1 199 ? 19.114  -23.936 -13.009 1.00 40.01  ? 320  TYR D CA    1 
ATOM   3848 C C     . TYR C 1 199 ? 20.634  -24.029 -12.881 1.00 41.92  ? 320  TYR D C     1 
ATOM   3849 O O     . TYR C 1 199 ? 21.163  -25.074 -12.509 1.00 40.24  ? 320  TYR D O     1 
ATOM   3850 C CB    . TYR C 1 199 ? 18.710  -23.819 -14.460 1.00 38.64  ? 320  TYR D CB    1 
ATOM   3851 C CG    . TYR C 1 199 ? 19.068  -25.030 -15.255 1.00 39.08  ? 320  TYR D CG    1 
ATOM   3852 C CD1   . TYR C 1 199 ? 20.367  -25.235 -15.662 1.00 38.55  ? 320  TYR D CD1   1 
ATOM   3853 C CD2   . TYR C 1 199 ? 18.109  -25.975 -15.604 1.00 41.92  ? 320  TYR D CD2   1 
ATOM   3854 C CE1   . TYR C 1 199 ? 20.719  -26.342 -16.394 1.00 40.51  ? 320  TYR D CE1   1 
ATOM   3855 C CE2   . TYR C 1 199 ? 18.460  -27.103 -16.342 1.00 42.65  ? 320  TYR D CE2   1 
ATOM   3856 C CZ    . TYR C 1 199 ? 19.776  -27.264 -16.730 1.00 41.72  ? 320  TYR D CZ    1 
ATOM   3857 O OH    . TYR C 1 199 ? 20.193  -28.333 -17.454 1.00 43.18  ? 320  TYR D OH    1 
ATOM   3858 N N     . GLU C 1 200 ? 21.319  -22.926 -13.159 1.00 41.79  ? 321  GLU D N     1 
ATOM   3859 C CA    . GLU C 1 200 ? 22.767  -22.910 -13.170 1.00 43.89  ? 321  GLU D CA    1 
ATOM   3860 C C     . GLU C 1 200 ? 23.427  -23.257 -11.828 1.00 45.25  ? 321  GLU D C     1 
ATOM   3861 O O     . GLU C 1 200 ? 24.403  -24.002 -11.774 1.00 44.60  ? 321  GLU D O     1 
ATOM   3862 C CB    . GLU C 1 200 ? 23.253  -21.544 -13.607 1.00 46.99  ? 321  GLU D CB    1 
ATOM   3863 C CG    . GLU C 1 200 ? 24.753  -21.412 -13.510 1.00 50.26  ? 321  GLU D CG    1 
ATOM   3864 C CD    . GLU C 1 200 ? 25.338  -20.635 -14.651 1.00 57.08  ? 321  GLU D CD    1 
ATOM   3865 O OE1   . GLU C 1 200 ? 24.939  -19.470 -14.861 1.00 60.68  ? 321  GLU D OE1   1 
ATOM   3866 O OE2   . GLU C 1 200 ? 26.203  -21.211 -15.335 1.00 66.40  ? 321  GLU D OE2   1 
ATOM   3867 N N     . PHE C 1 201 ? 22.920  -22.692 -10.751 1.00 44.81  ? 322  PHE D N     1 
ATOM   3868 C CA    . PHE C 1 201 ? 23.427  -23.028 -9.443  1.00 44.91  ? 322  PHE D CA    1 
ATOM   3869 C C     . PHE C 1 201 ? 23.314  -24.522 -9.167  1.00 46.53  ? 322  PHE D C     1 
ATOM   3870 O O     . PHE C 1 201 ? 24.256  -25.124 -8.645  1.00 50.17  ? 322  PHE D O     1 
ATOM   3871 C CB    . PHE C 1 201 ? 22.680  -22.258 -8.356  1.00 44.73  ? 322  PHE D CB    1 
ATOM   3872 C CG    . PHE C 1 201 ? 22.851  -20.762 -8.419  1.00 42.70  ? 322  PHE D CG    1 
ATOM   3873 C CD1   . PHE C 1 201 ? 23.963  -20.185 -8.987  1.00 41.81  ? 322  PHE D CD1   1 
ATOM   3874 C CD2   . PHE C 1 201 ? 21.895  -19.936 -7.856  1.00 45.53  ? 322  PHE D CD2   1 
ATOM   3875 C CE1   . PHE C 1 201 ? 24.109  -18.819 -9.026  1.00 43.08  ? 322  PHE D CE1   1 
ATOM   3876 C CE2   . PHE C 1 201 ? 22.043  -18.560 -7.867  1.00 46.58  ? 322  PHE D CE2   1 
ATOM   3877 C CZ    . PHE C 1 201 ? 23.150  -18.004 -8.461  1.00 45.73  ? 322  PHE D CZ    1 
ATOM   3878 N N     . LEU C 1 202 ? 22.180  -25.122 -9.521  1.00 45.95  ? 323  LEU D N     1 
ATOM   3879 C CA    . LEU C 1 202 ? 21.935  -26.544 -9.199  1.00 45.27  ? 323  LEU D CA    1 
ATOM   3880 C C     . LEU C 1 202 ? 22.624  -27.533 -10.116 1.00 44.43  ? 323  LEU D C     1 
ATOM   3881 O O     . LEU C 1 202 ? 22.880  -28.655 -9.702  1.00 50.02  ? 323  LEU D O     1 
ATOM   3882 C CB    . LEU C 1 202 ? 20.443  -26.876 -9.235  1.00 42.71  ? 323  LEU D CB    1 
ATOM   3883 C CG    . LEU C 1 202 ? 19.628  -26.365 -8.051  1.00 40.89  ? 323  LEU D CG    1 
ATOM   3884 C CD1   . LEU C 1 202 ? 18.144  -26.429 -8.410  1.00 41.42  ? 323  LEU D CD1   1 
ATOM   3885 C CD2   . LEU C 1 202 ? 19.945  -27.133 -6.783  1.00 38.83  ? 323  LEU D CD2   1 
ATOM   3886 N N     . VAL C 1 203 ? 22.884  -27.138 -11.354 1.00 42.81  ? 324  VAL D N     1 
ATOM   3887 C CA    . VAL C 1 203 ? 23.293  -28.066 -12.391 1.00 44.28  ? 324  VAL D CA    1 
ATOM   3888 C C     . VAL C 1 203 ? 24.726  -27.827 -12.809 1.00 48.40  ? 324  VAL D C     1 
ATOM   3889 O O     . VAL C 1 203 ? 25.390  -28.754 -13.275 1.00 56.85  ? 324  VAL D O     1 
ATOM   3890 C CB    . VAL C 1 203 ? 22.399  -27.929 -13.635 1.00 47.61  ? 324  VAL D CB    1 
ATOM   3891 C CG1   . VAL C 1 203 ? 22.880  -28.842 -14.763 1.00 50.35  ? 324  VAL D CG1   1 
ATOM   3892 C CG2   . VAL C 1 203 ? 20.936  -28.216 -13.296 1.00 46.63  ? 324  VAL D CG2   1 
ATOM   3893 N N     . GLY C 1 204 ? 25.191  -26.586 -12.679 1.00 47.65  ? 325  GLY D N     1 
ATOM   3894 C CA    . GLY C 1 204 ? 26.588  -26.244 -12.909 1.00 46.45  ? 325  GLY D CA    1 
ATOM   3895 C C     . GLY C 1 204 ? 26.783  -25.318 -14.083 1.00 48.37  ? 325  GLY D C     1 
ATOM   3896 O O     . GLY C 1 204 ? 27.791  -24.632 -14.150 1.00 48.88  ? 325  GLY D O     1 
ATOM   3897 N N     . LYS C 1 205 ? 25.818  -25.303 -15.004 1.00 51.48  ? 326  LYS D N     1 
ATOM   3898 C CA    . LYS C 1 205 ? 25.880  -24.497 -16.220 1.00 50.56  ? 326  LYS D CA    1 
ATOM   3899 C C     . LYS C 1 205 ? 24.477  -24.163 -16.691 1.00 46.87  ? 326  LYS D C     1 
ATOM   3900 O O     . LYS C 1 205 ? 23.566  -24.942 -16.457 1.00 42.35  ? 326  LYS D O     1 
ATOM   3901 C CB    . LYS C 1 205 ? 26.574  -25.300 -17.318 1.00 58.54  ? 326  LYS D CB    1 
ATOM   3902 C CG    . LYS C 1 205 ? 25.762  -26.476 -17.865 1.00 64.57  ? 326  LYS D CG    1 
ATOM   3903 C CD    . LYS C 1 205 ? 26.608  -27.360 -18.780 1.00 73.73  ? 326  LYS D CD    1 
ATOM   3904 C CE    . LYS C 1 205 ? 25.784  -28.431 -19.486 1.00 77.01  ? 326  LYS D CE    1 
ATOM   3905 N NZ    . LYS C 1 205 ? 25.434  -29.561 -18.576 1.00 78.14  ? 326  LYS D NZ    1 
ATOM   3906 N N     . PRO C 1 206 ? 24.302  -23.049 -17.431 1.00 47.45  ? 327  PRO D N     1 
ATOM   3907 C CA    . PRO C 1 206 ? 22.938  -22.636 -17.807 1.00 44.27  ? 327  PRO D CA    1 
ATOM   3908 C C     . PRO C 1 206 ? 22.221  -23.574 -18.760 1.00 43.13  ? 327  PRO D C     1 
ATOM   3909 O O     . PRO C 1 206 ? 22.832  -24.295 -19.541 1.00 39.89  ? 327  PRO D O     1 
ATOM   3910 C CB    . PRO C 1 206 ? 23.128  -21.267 -18.471 1.00 46.25  ? 327  PRO D CB    1 
ATOM   3911 C CG    . PRO C 1 206 ? 24.606  -20.998 -18.479 1.00 49.73  ? 327  PRO D CG    1 
ATOM   3912 C CD    . PRO C 1 206 ? 25.316  -22.287 -18.176 1.00 48.55  ? 327  PRO D CD    1 
ATOM   3913 N N     . PRO C 1 207 ? 20.894  -23.540 -18.719 1.00 48.88  ? 328  PRO D N     1 
ATOM   3914 C CA    . PRO C 1 207 ? 20.131  -24.579 -19.418 1.00 52.76  ? 328  PRO D CA    1 
ATOM   3915 C C     . PRO C 1 207 ? 20.205  -24.539 -20.943 1.00 49.21  ? 328  PRO D C     1 
ATOM   3916 O O     . PRO C 1 207 ? 19.865  -25.541 -21.573 1.00 50.05  ? 328  PRO D O     1 
ATOM   3917 C CB    . PRO C 1 207 ? 18.691  -24.344 -18.934 1.00 52.41  ? 328  PRO D CB    1 
ATOM   3918 C CG    . PRO C 1 207 ? 18.660  -22.910 -18.532 1.00 48.57  ? 328  PRO D CG    1 
ATOM   3919 C CD    . PRO C 1 207 ? 20.028  -22.567 -18.034 1.00 45.86  ? 328  PRO D CD    1 
ATOM   3920 N N     . PHE C 1 208 ? 20.637  -23.416 -21.519 1.00 48.04  ? 329  PHE D N     1 
ATOM   3921 C CA    . PHE C 1 208 ? 20.668  -23.264 -22.982 1.00 52.05  ? 329  PHE D CA    1 
ATOM   3922 C C     . PHE C 1 208 ? 22.089  -23.156 -23.548 1.00 52.23  ? 329  PHE D C     1 
ATOM   3923 O O     . PHE C 1 208 ? 22.284  -22.717 -24.674 1.00 54.00  ? 329  PHE D O     1 
ATOM   3924 C CB    . PHE C 1 208 ? 19.823  -22.052 -23.421 1.00 51.77  ? 329  PHE D CB    1 
ATOM   3925 C CG    . PHE C 1 208 ? 18.458  -22.003 -22.799 1.00 48.51  ? 329  PHE D CG    1 
ATOM   3926 C CD1   . PHE C 1 208 ? 17.507  -22.935 -23.124 1.00 49.24  ? 329  PHE D CD1   1 
ATOM   3927 C CD2   . PHE C 1 208 ? 18.134  -21.020 -21.871 1.00 51.74  ? 329  PHE D CD2   1 
ATOM   3928 C CE1   . PHE C 1 208 ? 16.247  -22.901 -22.534 1.00 50.91  ? 329  PHE D CE1   1 
ATOM   3929 C CE2   . PHE C 1 208 ? 16.884  -20.982 -21.276 1.00 48.60  ? 329  PHE D CE2   1 
ATOM   3930 C CZ    . PHE C 1 208 ? 15.939  -21.923 -21.613 1.00 47.89  ? 329  PHE D CZ    1 
ATOM   3931 N N     . GLU C 1 209 ? 23.076  -23.566 -22.764 1.00 56.72  ? 330  GLU D N     1 
ATOM   3932 C CA    . GLU C 1 209 ? 24.450  -23.641 -23.230 1.00 57.67  ? 330  GLU D CA    1 
ATOM   3933 C C     . GLU C 1 209 ? 24.583  -24.611 -24.402 1.00 54.80  ? 330  GLU D C     1 
ATOM   3934 O O     . GLU C 1 209 ? 23.966  -25.670 -24.424 1.00 52.63  ? 330  GLU D O     1 
ATOM   3935 C CB    . GLU C 1 209 ? 25.365  -24.085 -22.083 1.00 64.13  ? 330  GLU D CB    1 
ATOM   3936 C CG    . GLU C 1 209 ? 26.850  -24.126 -22.434 1.00 69.66  ? 330  GLU D CG    1 
ATOM   3937 C CD    . GLU C 1 209 ? 27.721  -23.539 -21.338 1.00 73.48  ? 330  GLU D CD    1 
ATOM   3938 O OE1   . GLU C 1 209 ? 27.802  -22.287 -21.258 1.00 74.53  ? 330  GLU D OE1   1 
ATOM   3939 O OE2   . GLU C 1 209 ? 28.319  -24.323 -20.561 1.00 72.81  ? 330  GLU D OE2   1 
ATOM   3940 N N     . ALA C 1 210 ? 25.394  -24.229 -25.378 1.00 54.55  ? 331  ALA D N     1 
ATOM   3941 C CA    . ALA C 1 210 ? 25.663  -25.077 -26.515 1.00 56.61  ? 331  ALA D CA    1 
ATOM   3942 C C     . ALA C 1 210 ? 26.945  -24.627 -27.262 1.00 59.43  ? 331  ALA D C     1 
ATOM   3943 O O     . ALA C 1 210 ? 27.482  -23.542 -27.016 1.00 53.79  ? 331  ALA D O     1 
ATOM   3944 C CB    . ALA C 1 210 ? 24.446  -25.088 -27.438 1.00 57.21  ? 331  ALA D CB    1 
ATOM   3945 N N     . ASN C 1 211 ? 27.425  -25.490 -28.159 1.00 62.67  ? 332  ASN D N     1 
ATOM   3946 C CA    . ASN C 1 211 ? 28.619  -25.246 -28.992 1.00 63.14  ? 332  ASN D CA    1 
ATOM   3947 C C     . ASN C 1 211 ? 28.689  -23.883 -29.655 1.00 64.01  ? 332  ASN D C     1 
ATOM   3948 O O     . ASN C 1 211 ? 29.743  -23.242 -29.717 1.00 59.80  ? 332  ASN D O     1 
ATOM   3949 C CB    . ASN C 1 211 ? 28.620  -26.238 -30.147 1.00 66.10  ? 332  ASN D CB    1 
ATOM   3950 C CG    . ASN C 1 211 ? 28.833  -27.661 -29.705 1.00 67.51  ? 332  ASN D CG    1 
ATOM   3951 O OD1   . ASN C 1 211 ? 29.509  -27.925 -28.707 1.00 74.69  ? 332  ASN D OD1   1 
ATOM   3952 N ND2   . ASN C 1 211 ? 28.266  -28.595 -30.457 1.00 64.12  ? 332  ASN D ND2   1 
ATOM   3953 N N     . THR C 1 212 ? 27.552  -23.482 -30.206 1.00 64.14  ? 333  THR D N     1 
ATOM   3954 C CA    . THR C 1 212 ? 27.477  -22.337 -31.082 1.00 62.73  ? 333  THR D CA    1 
ATOM   3955 C C     . THR C 1 212 ? 26.507  -21.355 -30.448 1.00 64.97  ? 333  THR D C     1 
ATOM   3956 O O     . THR C 1 212 ? 25.635  -21.756 -29.678 1.00 60.42  ? 333  THR D O     1 
ATOM   3957 C CB    . THR C 1 212 ? 27.050  -22.792 -32.506 1.00 60.29  ? 333  THR D CB    1 
ATOM   3958 O OG1   . THR C 1 212 ? 25.671  -23.157 -32.548 1.00 54.28  ? 333  THR D OG1   1 
ATOM   3959 C CG2   . THR C 1 212 ? 27.843  -24.019 -32.930 1.00 60.18  ? 333  THR D CG2   1 
ATOM   3960 N N     . TYR C 1 213 ? 26.674  -20.069 -30.730 1.00 71.77  ? 334  TYR D N     1 
ATOM   3961 C CA    . TYR C 1 213 ? 25.710  -19.068 -30.252 1.00 79.72  ? 334  TYR D CA    1 
ATOM   3962 C C     . TYR C 1 213 ? 24.356  -19.339 -30.895 1.00 78.98  ? 334  TYR D C     1 
ATOM   3963 O O     . TYR C 1 213 ? 23.312  -19.049 -30.326 1.00 77.16  ? 334  TYR D O     1 
ATOM   3964 C CB    . TYR C 1 213 ? 26.175  -17.652 -30.585 1.00 83.62  ? 334  TYR D CB    1 
ATOM   3965 C CG    . TYR C 1 213 ? 27.570  -17.363 -30.080 1.00 100.50 ? 334  TYR D CG    1 
ATOM   3966 C CD1   . TYR C 1 213 ? 27.826  -17.235 -28.714 1.00 106.83 ? 334  TYR D CD1   1 
ATOM   3967 C CD2   . TYR C 1 213 ? 28.645  -17.239 -30.967 1.00 114.39 ? 334  TYR D CD2   1 
ATOM   3968 C CE1   . TYR C 1 213 ? 29.109  -16.981 -28.244 1.00 113.26 ? 334  TYR D CE1   1 
ATOM   3969 C CE2   . TYR C 1 213 ? 29.931  -16.981 -30.508 1.00 117.40 ? 334  TYR D CE2   1 
ATOM   3970 C CZ    . TYR C 1 213 ? 30.158  -16.854 -29.148 1.00 117.85 ? 334  TYR D CZ    1 
ATOM   3971 O OH    . TYR C 1 213 ? 31.429  -16.595 -28.694 1.00 120.33 ? 334  TYR D OH    1 
ATOM   3972 N N     . GLN C 1 214 ? 24.411  -19.946 -32.075 1.00 80.24  ? 335  GLN D N     1 
ATOM   3973 C CA    . GLN C 1 214 ? 23.264  -20.157 -32.928 1.00 80.41  ? 335  GLN D CA    1 
ATOM   3974 C C     . GLN C 1 214 ? 22.442  -21.338 -32.424 1.00 71.74  ? 335  GLN D C     1 
ATOM   3975 O O     . GLN C 1 214 ? 21.240  -21.228 -32.298 1.00 65.65  ? 335  GLN D O     1 
ATOM   3976 C CB    . GLN C 1 214 ? 23.741  -20.360 -34.376 1.00 93.08  ? 335  GLN D CB    1 
ATOM   3977 C CG    . GLN C 1 214 ? 24.644  -19.222 -34.902 1.00 102.54 ? 335  GLN D CG    1 
ATOM   3978 C CD    . GLN C 1 214 ? 26.162  -19.458 -34.750 1.00 105.23 ? 335  GLN D CD    1 
ATOM   3979 O OE1   . GLN C 1 214 ? 26.876  -18.662 -34.116 1.00 91.57  ? 335  GLN D OE1   1 
ATOM   3980 N NE2   . GLN C 1 214 ? 26.661  -20.537 -35.357 1.00 106.52 ? 335  GLN D NE2   1 
ATOM   3981 N N     . GLU C 1 215 ? 23.086  -22.463 -32.131 1.00 71.56  ? 336  GLU D N     1 
ATOM   3982 C CA    . GLU C 1 215 ? 22.453  -23.490 -31.323 1.00 70.95  ? 336  GLU D CA    1 
ATOM   3983 C C     . GLU C 1 215 ? 21.816  -22.817 -30.111 1.00 73.32  ? 336  GLU D C     1 
ATOM   3984 O O     . GLU C 1 215 ? 20.624  -22.969 -29.893 1.00 77.68  ? 336  GLU D O     1 
ATOM   3985 C CB    . GLU C 1 215 ? 23.453  -24.529 -30.815 1.00 80.90  ? 336  GLU D CB    1 
ATOM   3986 C CG    . GLU C 1 215 ? 23.745  -25.691 -31.757 1.00 92.18  ? 336  GLU D CG    1 
ATOM   3987 C CD    . GLU C 1 215 ? 24.738  -26.702 -31.171 1.00 96.48  ? 336  GLU D CD    1 
ATOM   3988 O OE1   . GLU C 1 215 ? 24.501  -27.215 -30.048 1.00 93.19  ? 336  GLU D OE1   1 
ATOM   3989 O OE2   . GLU C 1 215 ? 25.758  -26.991 -31.841 1.00 97.82  ? 336  GLU D OE2   1 
ATOM   3990 N N     . THR C 1 216 ? 22.598  -22.073 -29.324 1.00 69.30  ? 337  THR D N     1 
ATOM   3991 C CA    . THR C 1 216 ? 22.089  -21.511 -28.058 1.00 66.13  ? 337  THR D CA    1 
ATOM   3992 C C     . THR C 1 216 ? 20.837  -20.651 -28.293 1.00 65.08  ? 337  THR D C     1 
ATOM   3993 O O     . THR C 1 216 ? 19.743  -21.035 -27.893 1.00 65.54  ? 337  THR D O     1 
ATOM   3994 C CB    . THR C 1 216 ? 23.173  -20.721 -27.278 1.00 64.01  ? 337  THR D CB    1 
ATOM   3995 O OG1   . THR C 1 216 ? 24.028  -21.638 -26.590 1.00 61.07  ? 337  THR D OG1   1 
ATOM   3996 C CG2   . THR C 1 216 ? 22.554  -19.782 -26.234 1.00 63.31  ? 337  THR D CG2   1 
ATOM   3997 N N     . TYR C 1 217 ? 21.001  -19.499 -28.932 1.00 62.16  ? 338  TYR D N     1 
ATOM   3998 C CA    . TYR C 1 217 ? 19.878  -18.622 -29.301 1.00 66.37  ? 338  TYR D CA    1 
ATOM   3999 C C     . TYR C 1 217 ? 18.589  -19.374 -29.664 1.00 64.15  ? 338  TYR D C     1 
ATOM   4000 O O     . TYR C 1 217 ? 17.552  -19.194 -29.038 1.00 63.04  ? 338  TYR D O     1 
ATOM   4001 C CB    . TYR C 1 217 ? 20.308  -17.775 -30.494 1.00 69.49  ? 338  TYR D CB    1 
ATOM   4002 C CG    . TYR C 1 217 ? 19.211  -17.002 -31.158 1.00 67.02  ? 338  TYR D CG    1 
ATOM   4003 C CD1   . TYR C 1 217 ? 18.435  -17.566 -32.161 1.00 69.95  ? 338  TYR D CD1   1 
ATOM   4004 C CD2   . TYR C 1 217 ? 18.983  -15.688 -30.812 1.00 67.40  ? 338  TYR D CD2   1 
ATOM   4005 C CE1   . TYR C 1 217 ? 17.440  -16.834 -32.775 1.00 74.44  ? 338  TYR D CE1   1 
ATOM   4006 C CE2   . TYR C 1 217 ? 18.002  -14.950 -31.422 1.00 68.95  ? 338  TYR D CE2   1 
ATOM   4007 C CZ    . TYR C 1 217 ? 17.231  -15.520 -32.389 1.00 72.10  ? 338  TYR D CZ    1 
ATOM   4008 O OH    . TYR C 1 217 ? 16.264  -14.733 -32.953 1.00 78.22  ? 338  TYR D OH    1 
ATOM   4009 N N     . LYS C 1 218 ? 18.683  -20.211 -30.692 1.00 61.85  ? 339  LYS D N     1 
ATOM   4010 C CA    . LYS C 1 218 ? 17.598  -21.087 -31.130 1.00 60.24  ? 339  LYS D CA    1 
ATOM   4011 C C     . LYS C 1 218 ? 16.923  -21.819 -29.961 1.00 53.80  ? 339  LYS D C     1 
ATOM   4012 O O     . LYS C 1 218 ? 15.709  -21.868 -29.887 1.00 56.82  ? 339  LYS D O     1 
ATOM   4013 C CB    . LYS C 1 218 ? 18.159  -22.112 -32.138 1.00 64.94  ? 339  LYS D CB    1 
ATOM   4014 C CG    . LYS C 1 218 ? 17.128  -22.892 -32.929 1.00 68.70  ? 339  LYS D CG    1 
ATOM   4015 C CD    . LYS C 1 218 ? 16.544  -22.061 -34.079 1.00 75.21  ? 339  LYS D CD    1 
ATOM   4016 C CE    . LYS C 1 218 ? 17.420  -22.103 -35.332 1.00 78.07  ? 339  LYS D CE    1 
ATOM   4017 N NZ    . LYS C 1 218 ? 17.536  -23.476 -35.932 1.00 78.55  ? 339  LYS D NZ    1 
ATOM   4018 N N     . ARG C 1 219 ? 17.720  -22.387 -29.060 1.00 52.87  ? 340  ARG D N     1 
ATOM   4019 C CA    . ARG C 1 219 ? 17.218  -23.111 -27.879 1.00 48.91  ? 340  ARG D CA    1 
ATOM   4020 C C     . ARG C 1 219 ? 16.446  -22.182 -26.977 1.00 48.67  ? 340  ARG D C     1 
ATOM   4021 O O     . ARG C 1 219 ? 15.388  -22.540 -26.434 1.00 45.55  ? 340  ARG D O     1 
ATOM   4022 C CB    . ARG C 1 219 ? 18.369  -23.662 -27.043 1.00 51.35  ? 340  ARG D CB    1 
ATOM   4023 C CG    . ARG C 1 219 ? 19.330  -24.601 -27.769 1.00 52.79  ? 340  ARG D CG    1 
ATOM   4024 C CD    . ARG C 1 219 ? 18.974  -26.049 -27.544 1.00 53.61  ? 340  ARG D CD    1 
ATOM   4025 N NE    . ARG C 1 219 ? 20.111  -26.890 -27.856 1.00 58.04  ? 340  ARG D NE    1 
ATOM   4026 C CZ    . ARG C 1 219 ? 21.046  -27.264 -26.988 1.00 62.27  ? 340  ARG D CZ    1 
ATOM   4027 N NH1   . ARG C 1 219 ? 20.986  -26.874 -25.714 1.00 66.51  ? 340  ARG D NH1   1 
ATOM   4028 N NH2   . ARG C 1 219 ? 22.048  -28.041 -27.405 1.00 61.54  ? 340  ARG D NH2   1 
ATOM   4029 N N     . ILE C 1 220 ? 16.988  -20.984 -26.795 1.00 44.56  ? 341  ILE D N     1 
ATOM   4030 C CA    . ILE C 1 220 ? 16.302  -20.005 -25.986 1.00 47.48  ? 341  ILE D CA    1 
ATOM   4031 C C     . ILE C 1 220 ? 14.876  -19.706 -26.521 1.00 49.15  ? 341  ILE D C     1 
ATOM   4032 O O     . ILE C 1 220 ? 13.930  -19.668 -25.737 1.00 46.54  ? 341  ILE D O     1 
ATOM   4033 C CB    . ILE C 1 220 ? 17.173  -18.744 -25.776 1.00 46.05  ? 341  ILE D CB    1 
ATOM   4034 C CG1   . ILE C 1 220 ? 18.306  -19.072 -24.800 1.00 43.64  ? 341  ILE D CG1   1 
ATOM   4035 C CG2   . ILE C 1 220 ? 16.339  -17.592 -25.224 1.00 47.18  ? 341  ILE D CG2   1 
ATOM   4036 C CD1   . ILE C 1 220 ? 19.478  -18.125 -24.898 1.00 43.95  ? 341  ILE D CD1   1 
ATOM   4037 N N     . SER C 1 221 ? 14.715  -19.545 -27.834 1.00 54.03  ? 342  SER D N     1 
ATOM   4038 C CA    . SER C 1 221 ? 13.394  -19.234 -28.411 1.00 61.21  ? 342  SER D CA    1 
ATOM   4039 C C     . SER C 1 221 ? 12.463  -20.431 -28.346 1.00 61.89  ? 342  SER D C     1 
ATOM   4040 O O     . SER C 1 221 ? 11.323  -20.312 -27.928 1.00 68.29  ? 342  SER D O     1 
ATOM   4041 C CB    . SER C 1 221 ? 13.509  -18.744 -29.850 1.00 63.11  ? 342  SER D CB    1 
ATOM   4042 O OG    . SER C 1 221 ? 14.558  -19.419 -30.522 1.00 68.29  ? 342  SER D OG    1 
ATOM   4043 N N     . ARG C 1 222 ? 12.958  -21.591 -28.737 1.00 64.40  ? 343  ARG D N     1 
ATOM   4044 C CA    . ARG C 1 222 ? 12.173  -22.831 -28.671 1.00 67.42  ? 343  ARG D CA    1 
ATOM   4045 C C     . ARG C 1 222 ? 11.885  -23.252 -27.224 1.00 63.13  ? 343  ARG D C     1 
ATOM   4046 O O     . ARG C 1 222 ? 11.050  -24.126 -26.975 1.00 57.96  ? 343  ARG D O     1 
ATOM   4047 C CB    . ARG C 1 222 ? 12.936  -23.929 -29.427 1.00 73.11  ? 343  ARG D CB    1 
ATOM   4048 C CG    . ARG C 1 222 ? 12.318  -25.321 -29.416 1.00 81.59  ? 343  ARG D CG    1 
ATOM   4049 C CD    . ARG C 1 222 ? 12.975  -26.232 -30.454 1.00 85.20  ? 343  ARG D CD    1 
ATOM   4050 N NE    . ARG C 1 222 ? 12.530  -25.874 -31.799 1.00 85.78  ? 343  ARG D NE    1 
ATOM   4051 C CZ    . ARG C 1 222 ? 13.160  -25.042 -32.627 1.00 90.02  ? 343  ARG D CZ    1 
ATOM   4052 N NH1   . ARG C 1 222 ? 14.308  -24.474 -32.286 1.00 95.75  ? 343  ARG D NH1   1 
ATOM   4053 N NH2   . ARG C 1 222 ? 12.638  -24.774 -33.821 1.00 85.22  ? 343  ARG D NH2   1 
ATOM   4054 N N     . VAL C 1 223 ? 12.575  -22.593 -26.290 1.00 61.77  ? 344  VAL D N     1 
ATOM   4055 C CA    . VAL C 1 223 ? 12.661  -22.986 -24.888 1.00 60.08  ? 344  VAL D CA    1 
ATOM   4056 C C     . VAL C 1 223 ? 12.868  -24.486 -24.721 1.00 60.95  ? 344  VAL D C     1 
ATOM   4057 O O     . VAL C 1 223 ? 12.136  -25.158 -24.009 1.00 61.04  ? 344  VAL D O     1 
ATOM   4058 C CB    . VAL C 1 223 ? 11.480  -22.463 -24.064 1.00 58.81  ? 344  VAL D CB    1 
ATOM   4059 C CG1   . VAL C 1 223 ? 11.728  -22.670 -22.580 1.00 59.94  ? 344  VAL D CG1   1 
ATOM   4060 C CG2   . VAL C 1 223 ? 11.301  -20.981 -24.323 1.00 62.52  ? 344  VAL D CG2   1 
ATOM   4061 N N     . GLU C 1 224 ? 13.908  -24.986 -25.377 1.00 64.29  ? 345  GLU D N     1 
ATOM   4062 C CA    . GLU C 1 224 ? 14.304  -26.385 -25.287 1.00 70.87  ? 345  GLU D CA    1 
ATOM   4063 C C     . GLU C 1 224 ? 15.436  -26.596 -24.266 1.00 61.63  ? 345  GLU D C     1 
ATOM   4064 O O     . GLU C 1 224 ? 16.589  -26.226 -24.519 1.00 54.15  ? 345  GLU D O     1 
ATOM   4065 C CB    . GLU C 1 224 ? 14.745  -26.885 -26.673 1.00 82.69  ? 345  GLU D CB    1 
ATOM   4066 C CG    . GLU C 1 224 ? 15.296  -28.313 -26.700 1.00 93.18  ? 345  GLU D CG    1 
ATOM   4067 C CD    . GLU C 1 224 ? 15.970  -28.664 -28.020 1.00 97.85  ? 345  GLU D CD    1 
ATOM   4068 O OE1   . GLU C 1 224 ? 15.320  -28.491 -29.081 1.00 97.97  ? 345  GLU D OE1   1 
ATOM   4069 O OE2   . GLU C 1 224 ? 17.143  -29.118 -27.987 1.00 91.30  ? 345  GLU D OE2   1 
ATOM   4070 N N     . PHE C 1 225 ? 15.103  -27.201 -23.126 1.00 54.57  ? 346  PHE D N     1 
ATOM   4071 C CA    . PHE C 1 225 ? 16.131  -27.650 -22.196 1.00 58.21  ? 346  PHE D CA    1 
ATOM   4072 C C     . PHE C 1 225 ? 15.812  -28.985 -21.510 1.00 56.92  ? 346  PHE D C     1 
ATOM   4073 O O     . PHE C 1 225 ? 14.739  -29.540 -21.670 1.00 55.76  ? 346  PHE D O     1 
ATOM   4074 C CB    . PHE C 1 225 ? 16.440  -26.559 -21.176 1.00 59.16  ? 346  PHE D CB    1 
ATOM   4075 C CG    . PHE C 1 225 ? 15.347  -26.323 -20.175 1.00 58.63  ? 346  PHE D CG    1 
ATOM   4076 C CD1   . PHE C 1 225 ? 14.251  -25.543 -20.495 1.00 62.36  ? 346  PHE D CD1   1 
ATOM   4077 C CD2   . PHE C 1 225 ? 15.446  -26.830 -18.900 1.00 55.83  ? 346  PHE D CD2   1 
ATOM   4078 C CE1   . PHE C 1 225 ? 13.267  -25.290 -19.565 1.00 58.95  ? 346  PHE D CE1   1 
ATOM   4079 C CE2   . PHE C 1 225 ? 14.467  -26.585 -17.967 1.00 54.62  ? 346  PHE D CE2   1 
ATOM   4080 C CZ    . PHE C 1 225 ? 13.376  -25.818 -18.298 1.00 57.60  ? 346  PHE D CZ    1 
ATOM   4081 N N     . THR C 1 226 ? 16.783  -29.539 -20.798 1.00 58.02  ? 347  THR D N     1 
ATOM   4082 C CA    . THR C 1 226 ? 16.544  -30.784 -20.094 1.00 61.08  ? 347  THR D CA    1 
ATOM   4083 C C     . THR C 1 226 ? 17.079  -30.664 -18.700 1.00 58.85  ? 347  THR D C     1 
ATOM   4084 O O     . THR C 1 226 ? 17.926  -29.813 -18.405 1.00 55.61  ? 347  THR D O     1 
ATOM   4085 C CB    . THR C 1 226 ? 17.189  -32.015 -20.775 1.00 67.25  ? 347  THR D CB    1 
ATOM   4086 O OG1   . THR C 1 226 ? 18.617  -31.933 -20.692 1.00 67.43  ? 347  THR D OG1   1 
ATOM   4087 C CG2   . THR C 1 226 ? 16.751  -32.138 -22.248 1.00 69.62  ? 347  THR D CG2   1 
ATOM   4088 N N     . PHE C 1 227 ? 16.560  -31.536 -17.852 1.00 56.63  ? 348  PHE D N     1 
ATOM   4089 C CA    . PHE C 1 227 ? 16.905  -31.573 -16.450 1.00 55.40  ? 348  PHE D CA    1 
ATOM   4090 C C     . PHE C 1 227 ? 17.686  -32.853 -16.204 1.00 55.10  ? 348  PHE D C     1 
ATOM   4091 O O     . PHE C 1 227 ? 17.199  -33.968 -16.512 1.00 52.77  ? 348  PHE D O     1 
ATOM   4092 C CB    . PHE C 1 227 ? 15.638  -31.609 -15.589 1.00 54.90  ? 348  PHE D CB    1 
ATOM   4093 C CG    . PHE C 1 227 ? 14.980  -30.262 -15.361 1.00 54.34  ? 348  PHE D CG    1 
ATOM   4094 C CD1   . PHE C 1 227 ? 15.629  -29.254 -14.636 1.00 51.72  ? 348  PHE D CD1   1 
ATOM   4095 C CD2   . PHE C 1 227 ? 13.665  -30.035 -15.789 1.00 49.14  ? 348  PHE D CD2   1 
ATOM   4096 C CE1   . PHE C 1 227 ? 14.990  -28.046 -14.399 1.00 49.87  ? 348  PHE D CE1   1 
ATOM   4097 C CE2   . PHE C 1 227 ? 13.032  -28.833 -15.546 1.00 46.13  ? 348  PHE D CE2   1 
ATOM   4098 C CZ    . PHE C 1 227 ? 13.690  -27.839 -14.853 1.00 46.68  ? 348  PHE D CZ    1 
ATOM   4099 N N     . PRO C 1 228 ? 18.895  -32.713 -15.654 1.00 51.37  ? 349  PRO D N     1 
ATOM   4100 C CA    . PRO C 1 228 ? 19.596  -33.899 -15.203 1.00 52.79  ? 349  PRO D CA    1 
ATOM   4101 C C     . PRO C 1 228 ? 18.787  -34.623 -14.127 1.00 57.73  ? 349  PRO D C     1 
ATOM   4102 O O     . PRO C 1 228 ? 18.004  -33.997 -13.422 1.00 60.01  ? 349  PRO D O     1 
ATOM   4103 C CB    . PRO C 1 228 ? 20.904  -33.334 -14.649 1.00 55.07  ? 349  PRO D CB    1 
ATOM   4104 C CG    . PRO C 1 228 ? 21.133  -32.082 -15.436 1.00 52.84  ? 349  PRO D CG    1 
ATOM   4105 C CD    . PRO C 1 228 ? 19.754  -31.521 -15.665 1.00 50.94  ? 349  PRO D CD    1 
ATOM   4106 N N     . ASP C 1 229 ? 18.973  -35.933 -14.014 1.00 63.64  ? 350  ASP D N     1 
ATOM   4107 C CA    . ASP C 1 229 ? 18.140  -36.773 -13.143 1.00 67.38  ? 350  ASP D CA    1 
ATOM   4108 C C     . ASP C 1 229 ? 18.142  -36.402 -11.657 1.00 64.39  ? 350  ASP D C     1 
ATOM   4109 O O     . ASP C 1 229 ? 17.193  -36.721 -10.927 1.00 53.30  ? 350  ASP D O     1 
ATOM   4110 C CB    . ASP C 1 229 ? 18.552  -38.242 -13.292 1.00 76.67  ? 350  ASP D CB    1 
ATOM   4111 C CG    . ASP C 1 229 ? 17.942  -38.901 -14.528 1.00 86.41  ? 350  ASP D CG    1 
ATOM   4112 O OD1   . ASP C 1 229 ? 17.687  -38.197 -15.537 1.00 91.87  ? 350  ASP D OD1   1 
ATOM   4113 O OD2   . ASP C 1 229 ? 17.714  -40.133 -14.481 1.00 90.51  ? 350  ASP D OD2   1 
ATOM   4114 N N     . PHE C 1 230 ? 19.203  -35.739 -11.204 1.00 63.33  ? 351  PHE D N     1 
ATOM   4115 C CA    . PHE C 1 230 ? 19.316  -35.369 -9.784  1.00 60.92  ? 351  PHE D CA    1 
ATOM   4116 C C     . PHE C 1 230 ? 18.569  -34.073 -9.388  1.00 55.52  ? 351  PHE D C     1 
ATOM   4117 O O     . PHE C 1 230 ? 18.545  -33.700 -8.205  1.00 52.42  ? 351  PHE D O     1 
ATOM   4118 C CB    . PHE C 1 230 ? 20.798  -35.293 -9.372  1.00 59.01  ? 351  PHE D CB    1 
ATOM   4119 C CG    . PHE C 1 230 ? 21.561  -34.208 -10.058 1.00 59.29  ? 351  PHE D CG    1 
ATOM   4120 C CD1   . PHE C 1 230 ? 21.442  -32.888 -9.639  1.00 57.40  ? 351  PHE D CD1   1 
ATOM   4121 C CD2   . PHE C 1 230 ? 22.392  -34.500 -11.130 1.00 61.15  ? 351  PHE D CD2   1 
ATOM   4122 C CE1   . PHE C 1 230 ? 22.139  -31.882 -10.279 1.00 58.63  ? 351  PHE D CE1   1 
ATOM   4123 C CE2   . PHE C 1 230 ? 23.100  -33.496 -11.766 1.00 62.49  ? 351  PHE D CE2   1 
ATOM   4124 C CZ    . PHE C 1 230 ? 22.975  -32.184 -11.339 1.00 61.09  ? 351  PHE D CZ    1 
ATOM   4125 N N     . VAL C 1 231 ? 17.985  -33.382 -10.365 1.00 50.11  ? 352  VAL D N     1 
ATOM   4126 C CA    . VAL C 1 231 ? 17.241  -32.166 -10.085 1.00 50.85  ? 352  VAL D CA    1 
ATOM   4127 C C     . VAL C 1 231 ? 15.867  -32.564 -9.559  1.00 50.47  ? 352  VAL D C     1 
ATOM   4128 O O     . VAL C 1 231 ? 15.097  -33.220 -10.259 1.00 47.95  ? 352  VAL D O     1 
ATOM   4129 C CB    . VAL C 1 231 ? 17.121  -31.268 -11.331 1.00 50.26  ? 352  VAL D CB    1 
ATOM   4130 C CG1   . VAL C 1 231 ? 16.254  -30.052 -11.060 1.00 50.41  ? 352  VAL D CG1   1 
ATOM   4131 C CG2   . VAL C 1 231 ? 18.497  -30.799 -11.755 1.00 51.99  ? 352  VAL D CG2   1 
ATOM   4132 N N     . THR C 1 232 ? 15.564  -32.175 -8.322  1.00 50.30  ? 353  THR D N     1 
ATOM   4133 C CA    . THR C 1 232 ? 14.327  -32.640 -7.672  1.00 51.43  ? 353  THR D CA    1 
ATOM   4134 C C     . THR C 1 232 ? 13.068  -32.044 -8.295  1.00 55.00  ? 353  THR D C     1 
ATOM   4135 O O     . THR C 1 232 ? 13.044  -30.879 -8.693  1.00 57.68  ? 353  THR D O     1 
ATOM   4136 C CB    . THR C 1 232 ? 14.300  -32.381 -6.150  1.00 48.01  ? 353  THR D CB    1 
ATOM   4137 O OG1   . THR C 1 232 ? 14.081  -30.981 -5.877  1.00 45.36  ? 353  THR D OG1   1 
ATOM   4138 C CG2   . THR C 1 232 ? 15.599  -32.908 -5.494  1.00 45.33  ? 353  THR D CG2   1 
ATOM   4139 N N     . GLU C 1 233 ? 12.034  -32.876 -8.365  1.00 57.79  ? 354  GLU D N     1 
ATOM   4140 C CA    . GLU C 1 233 ? 10.699  -32.514 -8.866  1.00 61.88  ? 354  GLU D CA    1 
ATOM   4141 C C     . GLU C 1 233 ? 10.287  -31.058 -8.559  1.00 57.92  ? 354  GLU D C     1 
ATOM   4142 O O     . GLU C 1 233 ? 9.737   -30.354 -9.421  1.00 54.06  ? 354  GLU D O     1 
ATOM   4143 C CB    . GLU C 1 233 ? 9.629   -33.476 -8.301  1.00 71.67  ? 354  GLU D CB    1 
ATOM   4144 C CG    . GLU C 1 233 ? 10.107  -34.809 -7.667  1.00 80.04  ? 354  GLU D CG    1 
ATOM   4145 C CD    . GLU C 1 233 ? 10.587  -34.708 -6.192  1.00 85.53  ? 354  GLU D CD    1 
ATOM   4146 O OE1   . GLU C 1 233 ? 10.783  -33.580 -5.657  1.00 82.99  ? 354  GLU D OE1   1 
ATOM   4147 O OE2   . GLU C 1 233 ? 10.774  -35.783 -5.556  1.00 82.15  ? 354  GLU D OE2   1 
ATOM   4148 N N     . GLY C 1 234 ? 10.570  -30.623 -7.329  1.00 56.27  ? 355  GLY D N     1 
ATOM   4149 C CA    . GLY C 1 234 ? 10.150  -29.320 -6.840  1.00 53.06  ? 355  GLY D CA    1 
ATOM   4150 C C     . GLY C 1 234 ? 10.986  -28.177 -7.368  1.00 51.14  ? 355  GLY D C     1 
ATOM   4151 O O     . GLY C 1 234 ? 10.509  -27.045 -7.448  1.00 49.92  ? 355  GLY D O     1 
ATOM   4152 N N     . ALA C 1 235 ? 12.244  -28.451 -7.703  1.00 47.02  ? 356  ALA D N     1 
ATOM   4153 C CA    . ALA C 1 235 ? 13.105  -27.421 -8.273  1.00 44.49  ? 356  ALA D CA    1 
ATOM   4154 C C     . ALA C 1 235 ? 12.706  -27.243 -9.712  1.00 44.76  ? 356  ALA D C     1 
ATOM   4155 O O     . ALA C 1 235 ? 12.798  -26.147 -10.281 1.00 43.47  ? 356  ALA D O     1 
ATOM   4156 C CB    . ALA C 1 235 ? 14.570  -27.817 -8.174  1.00 45.48  ? 356  ALA D CB    1 
ATOM   4157 N N     . ARG C 1 236 ? 12.251  -28.345 -10.295 1.00 45.41  ? 357  ARG D N     1 
ATOM   4158 C CA    . ARG C 1 236 ? 11.877  -28.370 -11.686 1.00 44.81  ? 357  ARG D CA    1 
ATOM   4159 C C     . ARG C 1 236 ? 10.650  -27.553 -11.814 1.00 43.91  ? 357  ARG D C     1 
ATOM   4160 O O     . ARG C 1 236 ? 10.516  -26.761 -12.752 1.00 43.63  ? 357  ARG D O     1 
ATOM   4161 C CB    . ARG C 1 236 ? 11.598  -29.791 -12.170 1.00 46.98  ? 357  ARG D CB    1 
ATOM   4162 C CG    . ARG C 1 236 ? 12.725  -30.770 -11.869 1.00 48.23  ? 357  ARG D CG    1 
ATOM   4163 C CD    . ARG C 1 236 ? 12.731  -31.934 -12.824 1.00 48.01  ? 357  ARG D CD    1 
ATOM   4164 N NE    . ARG C 1 236 ? 13.585  -32.994 -12.324 1.00 48.79  ? 357  ARG D NE    1 
ATOM   4165 C CZ    . ARG C 1 236 ? 14.151  -33.927 -13.084 1.00 50.56  ? 357  ARG D CZ    1 
ATOM   4166 N NH1   . ARG C 1 236 ? 13.972  -33.940 -14.393 1.00 50.01  ? 357  ARG D NH1   1 
ATOM   4167 N NH2   . ARG C 1 236 ? 14.927  -34.848 -12.530 1.00 54.97  ? 357  ARG D NH2   1 
ATOM   4168 N N     . ASP C 1 237 ? 9.739   -27.761 -10.869 1.00 46.65  ? 358  ASP D N     1 
ATOM   4169 C CA    . ASP C 1 237 ? 8.473   -27.059 -10.901 1.00 47.90  ? 358  ASP D CA    1 
ATOM   4170 C C     . ASP C 1 237 ? 8.778   -25.567 -11.026 1.00 45.87  ? 358  ASP D C     1 
ATOM   4171 O O     . ASP C 1 237 ? 8.396   -24.936 -12.009 1.00 42.74  ? 358  ASP D O     1 
ATOM   4172 C CB    . ASP C 1 237 ? 7.662   -27.345 -9.650  1.00 50.15  ? 358  ASP D CB    1 
ATOM   4173 C CG    . ASP C 1 237 ? 6.403   -26.513 -9.600  1.00 57.14  ? 358  ASP D CG    1 
ATOM   4174 O OD1   . ASP C 1 237 ? 5.382   -26.953 -10.179 1.00 62.31  ? 358  ASP D OD1   1 
ATOM   4175 O OD2   . ASP C 1 237 ? 6.446   -25.408 -9.012  1.00 55.26  ? 358  ASP D OD2   1 
ATOM   4176 N N     . LEU C 1 238 ? 9.532   -25.053 -10.050 1.00 45.42  ? 359  LEU D N     1 
ATOM   4177 C CA    . LEU C 1 238 ? 9.953   -23.650 -9.980  1.00 43.37  ? 359  LEU D CA    1 
ATOM   4178 C C     . LEU C 1 238 ? 10.642  -23.175 -11.226 1.00 40.61  ? 359  LEU D C     1 
ATOM   4179 O O     . LEU C 1 238 ? 10.237  -22.181 -11.840 1.00 41.22  ? 359  LEU D O     1 
ATOM   4180 C CB    . LEU C 1 238 ? 10.925  -23.465 -8.829  1.00 45.17  ? 359  LEU D CB    1 
ATOM   4181 C CG    . LEU C 1 238 ? 11.522  -22.074 -8.673  1.00 44.69  ? 359  LEU D CG    1 
ATOM   4182 C CD1   . LEU C 1 238 ? 10.431  -21.033 -8.616  1.00 44.06  ? 359  LEU D CD1   1 
ATOM   4183 C CD2   . LEU C 1 238 ? 12.336  -22.044 -7.401  1.00 48.39  ? 359  LEU D CD2   1 
ATOM   4184 N N     . ILE C 1 239 ? 11.691  -23.886 -11.599 1.00 38.93  ? 360  ILE D N     1 
ATOM   4185 C CA    . ILE C 1 239 ? 12.467  -23.499 -12.768 1.00 40.23  ? 360  ILE D CA    1 
ATOM   4186 C C     . ILE C 1 239 ? 11.603  -23.424 -13.995 1.00 40.72  ? 360  ILE D C     1 
ATOM   4187 O O     . ILE C 1 239 ? 11.821  -22.549 -14.824 1.00 41.46  ? 360  ILE D O     1 
ATOM   4188 C CB    . ILE C 1 239 ? 13.678  -24.427 -13.011 1.00 40.33  ? 360  ILE D CB    1 
ATOM   4189 C CG1   . ILE C 1 239 ? 14.839  -24.031 -12.099 1.00 38.87  ? 360  ILE D CG1   1 
ATOM   4190 C CG2   . ILE C 1 239 ? 14.171  -24.327 -14.440 1.00 40.35  ? 360  ILE D CG2   1 
ATOM   4191 C CD1   . ILE C 1 239 ? 15.861  -25.132 -11.920 1.00 39.90  ? 360  ILE D CD1   1 
ATOM   4192 N N     . SER C 1 240 ? 10.606  -24.309 -14.098 1.00 45.85  ? 361  SER D N     1 
ATOM   4193 C CA    . SER C 1 240 ? 9.761   -24.387 -15.304 1.00 45.39  ? 361  SER D CA    1 
ATOM   4194 C C     . SER C 1 240 ? 8.749   -23.280 -15.440 1.00 45.78  ? 361  SER D C     1 
ATOM   4195 O O     . SER C 1 240 ? 8.445   -22.875 -16.563 1.00 48.42  ? 361  SER D O     1 
ATOM   4196 C CB    . SER C 1 240 ? 9.055   -25.715 -15.383 1.00 46.96  ? 361  SER D CB    1 
ATOM   4197 O OG    . SER C 1 240 ? 10.013  -26.707 -15.684 1.00 53.98  ? 361  SER D OG    1 
ATOM   4198 N N     . ARG C 1 241 ? 8.238   -22.776 -14.318 1.00 48.93  ? 362  ARG D N     1 
ATOM   4199 C CA    . ARG C 1 241 ? 7.315   -21.621 -14.352 1.00 50.52  ? 362  ARG D CA    1 
ATOM   4200 C C     . ARG C 1 241 ? 8.087   -20.334 -14.710 1.00 46.55  ? 362  ARG D C     1 
ATOM   4201 O O     . ARG C 1 241 ? 7.541   -19.420 -15.336 1.00 47.55  ? 362  ARG D O     1 
ATOM   4202 C CB    . ARG C 1 241 ? 6.555   -21.417 -13.024 1.00 52.99  ? 362  ARG D CB    1 
ATOM   4203 C CG    . ARG C 1 241 ? 6.421   -22.644 -12.143 1.00 56.02  ? 362  ARG D CG    1 
ATOM   4204 C CD    . ARG C 1 241 ? 5.272   -22.543 -11.148 1.00 62.00  ? 362  ARG D CD    1 
ATOM   4205 N NE    . ARG C 1 241 ? 4.695   -23.861 -10.899 1.00 65.56  ? 362  ARG D NE    1 
ATOM   4206 C CZ    . ARG C 1 241 ? 3.998   -24.555 -11.803 1.00 71.92  ? 362  ARG D CZ    1 
ATOM   4207 N NH1   . ARG C 1 241 ? 3.787   -24.053 -13.022 1.00 72.61  ? 362  ARG D NH1   1 
ATOM   4208 N NH2   . ARG C 1 241 ? 3.509   -25.761 -11.501 1.00 71.27  ? 362  ARG D NH2   1 
ATOM   4209 N N     . LEU C 1 242 ? 9.356   -20.270 -14.320 1.00 43.42  ? 363  LEU D N     1 
ATOM   4210 C CA    . LEU C 1 242 ? 10.153  -19.078 -14.564 1.00 43.16  ? 363  LEU D CA    1 
ATOM   4211 C C     . LEU C 1 242 ? 10.630  -18.981 -16.004 1.00 43.35  ? 363  LEU D C     1 
ATOM   4212 O O     . LEU C 1 242 ? 10.722  -17.879 -16.553 1.00 44.51  ? 363  LEU D O     1 
ATOM   4213 C CB    . LEU C 1 242 ? 11.335  -19.037 -13.619 1.00 43.40  ? 363  LEU D CB    1 
ATOM   4214 C CG    . LEU C 1 242 ? 11.008  -18.719 -12.154 1.00 42.75  ? 363  LEU D CG    1 
ATOM   4215 C CD1   . LEU C 1 242 ? 12.139  -19.202 -11.257 1.00 39.88  ? 363  LEU D CD1   1 
ATOM   4216 C CD2   . LEU C 1 242 ? 10.760  -17.224 -11.968 1.00 42.61  ? 363  LEU D CD2   1 
ATOM   4217 N N     . LEU C 1 243 ? 10.933  -20.125 -16.605 1.00 41.45  ? 364  LEU D N     1 
ATOM   4218 C CA    . LEU C 1 243 ? 11.384  -20.181 -17.989 1.00 43.69  ? 364  LEU D CA    1 
ATOM   4219 C C     . LEU C 1 243 ? 10.179  -20.465 -18.924 1.00 45.93  ? 364  LEU D C     1 
ATOM   4220 O O     . LEU C 1 243 ? 10.023  -21.560 -19.521 1.00 42.05  ? 364  LEU D O     1 
ATOM   4221 C CB    . LEU C 1 243 ? 12.485  -21.242 -18.140 1.00 43.36  ? 364  LEU D CB    1 
ATOM   4222 C CG    . LEU C 1 243 ? 13.765  -21.091 -17.318 1.00 41.47  ? 364  LEU D CG    1 
ATOM   4223 C CD1   . LEU C 1 243 ? 14.639  -22.319 -17.440 1.00 41.96  ? 364  LEU D CD1   1 
ATOM   4224 C CD2   . LEU C 1 243 ? 14.548  -19.885 -17.771 1.00 43.68  ? 364  LEU D CD2   1 
ATOM   4225 N N     . LYS C 1 244 ? 9.311   -19.465 -19.004 1.00 45.97  ? 365  LYS D N     1 
ATOM   4226 C CA    . LYS C 1 244 ? 8.124   -19.539 -19.824 1.00 45.62  ? 365  LYS D CA    1 
ATOM   4227 C C     . LYS C 1 244 ? 8.332   -18.636 -20.982 1.00 46.87  ? 365  LYS D C     1 
ATOM   4228 O O     . LYS C 1 244 ? 8.867   -17.539 -20.823 1.00 43.68  ? 365  LYS D O     1 
ATOM   4229 C CB    . LYS C 1 244 ? 6.920   -19.064 -19.048 1.00 47.81  ? 365  LYS D CB    1 
ATOM   4230 C CG    . LYS C 1 244 ? 6.367   -20.120 -18.125 1.00 51.70  ? 365  LYS D CG    1 
ATOM   4231 C CD    . LYS C 1 244 ? 5.561   -21.131 -18.908 1.00 51.99  ? 365  LYS D CD    1 
ATOM   4232 C CE    . LYS C 1 244 ? 5.255   -22.352 -18.077 1.00 55.80  ? 365  LYS D CE    1 
ATOM   4233 N NZ    . LYS C 1 244 ? 4.461   -23.283 -18.918 1.00 60.16  ? 365  LYS D NZ    1 
ATOM   4234 N N     . HIS C 1 245 ? 7.919   -19.086 -22.162 1.00 51.71  ? 366  HIS D N     1 
ATOM   4235 C CA    . HIS C 1 245 ? 8.144   -18.288 -23.342 1.00 52.09  ? 366  HIS D CA    1 
ATOM   4236 C C     . HIS C 1 245 ? 7.472   -16.946 -23.161 1.00 50.24  ? 366  HIS D C     1 
ATOM   4237 O O     . HIS C 1 245 ? 8.124   -15.927 -23.238 1.00 48.13  ? 366  HIS D O     1 
ATOM   4238 C CB    . HIS C 1 245 ? 7.619   -18.954 -24.606 1.00 55.99  ? 366  HIS D CB    1 
ATOM   4239 C CG    . HIS C 1 245 ? 8.018   -18.231 -25.854 1.00 57.22  ? 366  HIS D CG    1 
ATOM   4240 N ND1   . HIS C 1 245 ? 7.640   -16.930 -26.117 1.00 61.98  ? 366  HIS D ND1   1 
ATOM   4241 C CD2   . HIS C 1 245 ? 8.786   -18.618 -26.894 1.00 58.04  ? 366  HIS D CD2   1 
ATOM   4242 C CE1   . HIS C 1 245 ? 8.153   -16.551 -27.272 1.00 63.32  ? 366  HIS D CE1   1 
ATOM   4243 N NE2   . HIS C 1 245 ? 8.853   -17.557 -27.763 1.00 60.88  ? 366  HIS D NE2   1 
ATOM   4244 N N     . ASN C 1 246 ? 6.162   -16.972 -22.936 1.00 51.50  ? 367  ASN D N     1 
ATOM   4245 C CA    . ASN C 1 246 ? 5.354   -15.772 -22.787 1.00 51.75  ? 367  ASN D CA    1 
ATOM   4246 C C     . ASN C 1 246 ? 5.571   -15.164 -21.404 1.00 53.48  ? 367  ASN D C     1 
ATOM   4247 O O     . ASN C 1 246 ? 5.243   -15.803 -20.389 1.00 55.78  ? 367  ASN D O     1 
ATOM   4248 C CB    . ASN C 1 246 ? 3.879   -16.137 -22.971 1.00 56.24  ? 367  ASN D CB    1 
ATOM   4249 C CG    . ASN C 1 246 ? 2.935   -14.976 -22.718 1.00 61.42  ? 367  ASN D CG    1 
ATOM   4250 O OD1   . ASN C 1 246 ? 3.343   -13.810 -22.706 1.00 64.08  ? 367  ASN D OD1   1 
ATOM   4251 N ND2   . ASN C 1 246 ? 1.654   -15.294 -22.515 1.00 62.14  ? 367  ASN D ND2   1 
ATOM   4252 N N     . PRO C 1 247 ? 6.119   -13.940 -21.346 1.00 46.98  ? 368  PRO D N     1 
ATOM   4253 C CA    . PRO C 1 247 ? 6.308   -13.329 -20.043 1.00 47.47  ? 368  PRO D CA    1 
ATOM   4254 C C     . PRO C 1 247 ? 5.078   -13.319 -19.135 1.00 52.18  ? 368  PRO D C     1 
ATOM   4255 O O     . PRO C 1 247 ? 5.241   -13.424 -17.926 1.00 61.94  ? 368  PRO D O     1 
ATOM   4256 C CB    . PRO C 1 247 ? 6.737   -11.900 -20.375 1.00 50.28  ? 368  PRO D CB    1 
ATOM   4257 C CG    . PRO C 1 247 ? 6.936   -11.840 -21.868 1.00 49.48  ? 368  PRO D CG    1 
ATOM   4258 C CD    . PRO C 1 247 ? 6.850   -13.222 -22.400 1.00 46.37  ? 368  PRO D CD    1 
ATOM   4259 N N     . SER C 1 248 ? 3.868   -13.218 -19.688 1.00 56.51  ? 369  SER D N     1 
ATOM   4260 C CA    . SER C 1 248 ? 2.627   -13.235 -18.872 1.00 57.89  ? 369  SER D CA    1 
ATOM   4261 C C     . SER C 1 248 ? 2.550   -14.426 -17.919 1.00 58.14  ? 369  SER D C     1 
ATOM   4262 O O     . SER C 1 248 ? 2.061   -14.291 -16.803 1.00 58.08  ? 369  SER D O     1 
ATOM   4263 C CB    . SER C 1 248 ? 1.351   -13.304 -19.745 1.00 60.84  ? 369  SER D CB    1 
ATOM   4264 O OG    . SER C 1 248 ? 1.249   -12.283 -20.730 1.00 61.09  ? 369  SER D OG    1 
ATOM   4265 N N     . GLN C 1 249 ? 2.993   -15.595 -18.379 1.00 59.13  ? 370  GLN D N     1 
ATOM   4266 C CA    . GLN C 1 249 ? 2.773   -16.850 -17.645 1.00 59.08  ? 370  GLN D CA    1 
ATOM   4267 C C     . GLN C 1 249 ? 3.811   -17.097 -16.562 1.00 54.59  ? 370  GLN D C     1 
ATOM   4268 O O     . GLN C 1 249 ? 3.672   -18.038 -15.792 1.00 61.78  ? 370  GLN D O     1 
ATOM   4269 C CB    . GLN C 1 249 ? 2.773   -18.058 -18.585 1.00 63.29  ? 370  GLN D CB    1 
ATOM   4270 C CG    . GLN C 1 249 ? 1.871   -17.961 -19.811 1.00 70.00  ? 370  GLN D CG    1 
ATOM   4271 C CD    . GLN C 1 249 ? 2.162   -19.074 -20.808 1.00 77.07  ? 370  GLN D CD    1 
ATOM   4272 O OE1   . GLN C 1 249 ? 2.575   -18.822 -21.946 1.00 79.17  ? 370  GLN D OE1   1 
ATOM   4273 N NE2   . GLN C 1 249 ? 1.982   -20.321 -20.370 1.00 79.46  ? 370  GLN D NE2   1 
ATOM   4274 N N     . ARG C 1 250 ? 4.862   -16.283 -16.515 1.00 48.81  ? 371  ARG D N     1 
ATOM   4275 C CA    . ARG C 1 250 ? 5.844   -16.355 -15.429 1.00 43.60  ? 371  ARG D CA    1 
ATOM   4276 C C     . ARG C 1 250 ? 5.181   -15.854 -14.164 1.00 40.74  ? 371  ARG D C     1 
ATOM   4277 O O     . ARG C 1 250 ? 4.354   -14.958 -14.241 1.00 40.40  ? 371  ARG D O     1 
ATOM   4278 C CB    . ARG C 1 250 ? 7.042   -15.453 -15.734 1.00 42.68  ? 371  ARG D CB    1 
ATOM   4279 C CG    . ARG C 1 250 ? 7.868   -15.961 -16.877 1.00 41.87  ? 371  ARG D CG    1 
ATOM   4280 C CD    . ARG C 1 250 ? 8.920   -14.985 -17.336 1.00 40.23  ? 371  ARG D CD    1 
ATOM   4281 N NE    . ARG C 1 250 ? 9.248   -15.302 -18.723 1.00 40.68  ? 371  ARG D NE    1 
ATOM   4282 C CZ    . ARG C 1 250 ? 9.747   -14.459 -19.628 1.00 40.67  ? 371  ARG D CZ    1 
ATOM   4283 N NH1   . ARG C 1 250 ? 10.037  -13.191 -19.351 1.00 40.21  ? 371  ARG D NH1   1 
ATOM   4284 N NH2   . ARG C 1 250 ? 9.970   -14.918 -20.839 1.00 43.81  ? 371  ARG D NH2   1 
ATOM   4285 N N     . PRO C 1 251 ? 5.569   -16.382 -13.001 1.00 38.27  ? 372  PRO D N     1 
ATOM   4286 C CA    . PRO C 1 251 ? 5.002   -15.927 -11.746 1.00 41.75  ? 372  PRO D CA    1 
ATOM   4287 C C     . PRO C 1 251 ? 5.488   -14.524 -11.357 1.00 46.73  ? 372  PRO D C     1 
ATOM   4288 O O     . PRO C 1 251 ? 6.192   -13.867 -12.134 1.00 45.93  ? 372  PRO D O     1 
ATOM   4289 C CB    . PRO C 1 251 ? 5.510   -16.969 -10.736 1.00 41.97  ? 372  PRO D CB    1 
ATOM   4290 C CG    . PRO C 1 251 ? 6.809   -17.395 -11.289 1.00 40.81  ? 372  PRO D CG    1 
ATOM   4291 C CD    . PRO C 1 251 ? 6.681   -17.321 -12.789 1.00 40.65  ? 372  PRO D CD    1 
ATOM   4292 N N     . MET C 1 252 ? 5.077   -14.067 -10.174 1.00 49.92  ? 373  MET D N     1 
ATOM   4293 C CA    . MET C 1 252 ? 5.558   -12.828 -9.596  1.00 49.24  ? 373  MET D CA    1 
ATOM   4294 C C     . MET C 1 252 ? 6.577   -13.238 -8.572  1.00 44.57  ? 373  MET D C     1 
ATOM   4295 O O     . MET C 1 252 ? 6.494   -14.335 -8.056  1.00 47.02  ? 373  MET D O     1 
ATOM   4296 C CB    . MET C 1 252 ? 4.431   -12.095 -8.854  1.00 55.79  ? 373  MET D CB    1 
ATOM   4297 C CG    . MET C 1 252 ? 3.232   -11.659 -9.673  1.00 57.12  ? 373  MET D CG    1 
ATOM   4298 S SD    . MET C 1 252 ? 1.793   -11.391 -8.595  1.00 74.39  ? 373  MET D SD    1 
ATOM   4299 C CE    . MET C 1 252 ? 2.466   -10.508 -7.168  1.00 75.83  ? 373  MET D CE    1 
ATOM   4300 N N     . LEU C 1 253 ? 7.472   -12.325 -8.215  1.00 45.24  ? 374  LEU D N     1 
ATOM   4301 C CA    . LEU C 1 253 ? 8.502   -12.539 -7.169  1.00 47.87  ? 374  LEU D CA    1 
ATOM   4302 C C     . LEU C 1 253 ? 8.006   -12.922 -5.751  1.00 50.85  ? 374  LEU D C     1 
ATOM   4303 O O     . LEU C 1 253 ? 8.775   -13.371 -4.902  1.00 50.39  ? 374  LEU D O     1 
ATOM   4304 C CB    . LEU C 1 253 ? 9.349   -11.269 -7.034  1.00 46.45  ? 374  LEU D CB    1 
ATOM   4305 C CG    . LEU C 1 253 ? 10.148  -10.805 -8.248  1.00 46.19  ? 374  LEU D CG    1 
ATOM   4306 C CD1   . LEU C 1 253 ? 10.633  -9.389  -7.967  1.00 50.31  ? 374  LEU D CD1   1 
ATOM   4307 C CD2   . LEU C 1 253 ? 11.312  -11.732 -8.533  1.00 44.25  ? 374  LEU D CD2   1 
ATOM   4308 N N     . ARG C 1 254 ? 6.735   -12.687 -5.481  1.00 57.53  ? 375  ARG D N     1 
ATOM   4309 C CA    . ARG C 1 254 ? 6.121   -13.121 -4.247  1.00 59.57  ? 375  ARG D CA    1 
ATOM   4310 C C     . ARG C 1 254 ? 5.888   -14.649 -4.324  1.00 57.67  ? 375  ARG D C     1 
ATOM   4311 O O     . ARG C 1 254 ? 6.244   -15.386 -3.410  1.00 54.62  ? 375  ARG D O     1 
ATOM   4312 C CB    . ARG C 1 254 ? 4.821   -12.346 -4.042  1.00 64.21  ? 375  ARG D CB    1 
ATOM   4313 C CG    . ARG C 1 254 ? 4.387   -12.228 -2.591  1.00 73.84  ? 375  ARG D CG    1 
ATOM   4314 C CD    . ARG C 1 254 ? 2.911   -11.863 -2.487  1.00 80.14  ? 375  ARG D CD    1 
ATOM   4315 N NE    . ARG C 1 254 ? 2.080   -12.786 -3.264  1.00 88.08  ? 375  ARG D NE    1 
ATOM   4316 C CZ    . ARG C 1 254 ? 0.838   -12.533 -3.670  1.00 96.53  ? 375  ARG D CZ    1 
ATOM   4317 N NH1   . ARG C 1 254 ? 0.241   -11.375 -3.373  1.00 98.84  ? 375  ARG D NH1   1 
ATOM   4318 N NH2   . ARG C 1 254 ? 0.185   -13.449 -4.378  1.00 95.12  ? 375  ARG D NH2   1 
ATOM   4319 N N     . GLU C 1 255 ? 5.329   -15.117 -5.435  1.00 58.66  ? 376  GLU D N     1 
ATOM   4320 C CA    . GLU C 1 255 ? 5.100   -16.545 -5.652  1.00 59.45  ? 376  GLU D CA    1 
ATOM   4321 C C     . GLU C 1 255 ? 6.410   -17.338 -5.599  1.00 62.35  ? 376  GLU D C     1 
ATOM   4322 O O     . GLU C 1 255 ? 6.393   -18.529 -5.284  1.00 69.50  ? 376  GLU D O     1 
ATOM   4323 C CB    . GLU C 1 255 ? 4.424   -16.809 -7.004  1.00 60.06  ? 376  GLU D CB    1 
ATOM   4324 C CG    . GLU C 1 255 ? 3.010   -16.270 -7.160  1.00 63.84  ? 376  GLU D CG    1 
ATOM   4325 C CD    . GLU C 1 255 ? 2.545   -16.268 -8.622  1.00 73.23  ? 376  GLU D CD    1 
ATOM   4326 O OE1   . GLU C 1 255 ? 2.356   -17.361 -9.200  1.00 80.28  ? 376  GLU D OE1   1 
ATOM   4327 O OE2   . GLU C 1 255 ? 2.381   -15.177 -9.216  1.00 74.94  ? 376  GLU D OE2   1 
ATOM   4328 N N     . VAL C 1 256 ? 7.532   -16.693 -5.927  1.00 56.10  ? 377  VAL D N     1 
ATOM   4329 C CA    . VAL C 1 256 ? 8.854   -17.335 -5.852  1.00 51.99  ? 377  VAL D CA    1 
ATOM   4330 C C     . VAL C 1 256 ? 9.317   -17.434 -4.404  1.00 53.70  ? 377  VAL D C     1 
ATOM   4331 O O     . VAL C 1 256 ? 9.819   -18.462 -3.967  1.00 53.17  ? 377  VAL D O     1 
ATOM   4332 C CB    . VAL C 1 256 ? 9.929   -16.544 -6.634  1.00 47.43  ? 377  VAL D CB    1 
ATOM   4333 C CG1   . VAL C 1 256 ? 11.312  -17.110 -6.364  1.00 46.11  ? 377  VAL D CG1   1 
ATOM   4334 C CG2   . VAL C 1 256 ? 9.634   -16.546 -8.127  1.00 45.94  ? 377  VAL D CG2   1 
ATOM   4335 N N     . LEU C 1 257 ? 9.164   -16.344 -3.666  1.00 56.83  ? 378  LEU D N     1 
ATOM   4336 C CA    . LEU C 1 257 ? 9.555   -16.325 -2.263  1.00 55.63  ? 378  LEU D CA    1 
ATOM   4337 C C     . LEU C 1 257 ? 8.690   -17.272 -1.441  1.00 51.75  ? 378  LEU D C     1 
ATOM   4338 O O     . LEU C 1 257 ? 9.182   -17.903 -0.537  1.00 48.90  ? 378  LEU D O     1 
ATOM   4339 C CB    . LEU C 1 257 ? 9.532   -14.894 -1.727  1.00 53.51  ? 378  LEU D CB    1 
ATOM   4340 C CG    . LEU C 1 257 ? 10.655  -14.057 -2.366  1.00 52.92  ? 378  LEU D CG    1 
ATOM   4341 C CD1   . LEU C 1 257 ? 10.338  -12.567 -2.446  1.00 54.65  ? 378  LEU D CD1   1 
ATOM   4342 C CD2   . LEU C 1 257 ? 11.975  -14.289 -1.640  1.00 51.25  ? 378  LEU D CD2   1 
ATOM   4343 N N     . GLU C 1 258 ? 7.425   -17.433 -1.808  1.00 54.46  ? 379  GLU D N     1 
ATOM   4344 C CA    . GLU C 1 258 ? 6.536   -18.369 -1.105  1.00 57.99  ? 379  GLU D CA    1 
ATOM   4345 C C     . GLU C 1 258 ? 6.665   -19.840 -1.572  1.00 54.01  ? 379  GLU D C     1 
ATOM   4346 O O     . GLU C 1 258 ? 6.295   -20.749 -0.838  1.00 63.92  ? 379  GLU D O     1 
ATOM   4347 C CB    . GLU C 1 258 ? 5.075   -17.907 -1.244  1.00 63.82  ? 379  GLU D CB    1 
ATOM   4348 C CG    . GLU C 1 258 ? 4.780   -16.512 -0.664  1.00 68.42  ? 379  GLU D CG    1 
ATOM   4349 C CD    . GLU C 1 258 ? 3.527   -15.842 -1.269  1.00 78.39  ? 379  GLU D CD    1 
ATOM   4350 O OE1   . GLU C 1 258 ? 3.111   -16.222 -2.399  1.00 82.34  ? 379  GLU D OE1   1 
ATOM   4351 O OE2   . GLU C 1 258 ? 2.958   -14.918 -0.622  1.00 75.55  ? 379  GLU D OE2   1 
ATOM   4352 N N     . HIS C 1 259 ? 7.197   -20.074 -2.770  1.00 47.67  ? 380  HIS D N     1 
ATOM   4353 C CA    . HIS C 1 259 ? 7.226   -21.412 -3.369  1.00 43.72  ? 380  HIS D CA    1 
ATOM   4354 C C     . HIS C 1 259 ? 7.845   -22.433 -2.421  1.00 44.09  ? 380  HIS D C     1 
ATOM   4355 O O     . HIS C 1 259 ? 8.935   -22.224 -1.901  1.00 47.23  ? 380  HIS D O     1 
ATOM   4356 C CB    . HIS C 1 259 ? 7.976   -21.404 -4.727  1.00 43.46  ? 380  HIS D CB    1 
ATOM   4357 C CG    . HIS C 1 259 ? 7.919   -22.712 -5.465  1.00 45.32  ? 380  HIS D CG    1 
ATOM   4358 N ND1   . HIS C 1 259 ? 8.710   -23.794 -5.132  1.00 45.02  ? 380  HIS D ND1   1 
ATOM   4359 C CD2   . HIS C 1 259 ? 7.154   -23.117 -6.507  1.00 45.79  ? 380  HIS D CD2   1 
ATOM   4360 C CE1   . HIS C 1 259 ? 8.432   -24.807 -5.929  1.00 44.38  ? 380  HIS D CE1   1 
ATOM   4361 N NE2   . HIS C 1 259 ? 7.493   -24.423 -6.774  1.00 45.56  ? 380  HIS D NE2   1 
ATOM   4362 N N     . PRO C 1 260 ? 7.168   -23.563 -2.223  1.00 44.09  ? 381  PRO D N     1 
ATOM   4363 C CA    . PRO C 1 260 ? 7.536   -24.471 -1.144  1.00 43.65  ? 381  PRO D CA    1 
ATOM   4364 C C     . PRO C 1 260 ? 8.966   -24.989 -1.187  1.00 42.50  ? 381  PRO D C     1 
ATOM   4365 O O     . PRO C 1 260 ? 9.561   -25.221 -0.136  1.00 47.54  ? 381  PRO D O     1 
ATOM   4366 C CB    . PRO C 1 260 ? 6.540   -25.638 -1.297  1.00 46.93  ? 381  PRO D CB    1 
ATOM   4367 C CG    . PRO C 1 260 ? 5.976   -25.523 -2.678  1.00 47.11  ? 381  PRO D CG    1 
ATOM   4368 C CD    . PRO C 1 260 ? 6.022   -24.060 -3.012  1.00 46.27  ? 381  PRO D CD    1 
ATOM   4369 N N     . TRP C 1 261 ? 9.499   -25.205 -2.378  1.00 40.83  ? 382  TRP D N     1 
ATOM   4370 C CA    . TRP C 1 261 ? 10.883  -25.636 -2.525  1.00 39.87  ? 382  TRP D CA    1 
ATOM   4371 C C     . TRP C 1 261 ? 11.884  -24.635 -1.930  1.00 41.42  ? 382  TRP D C     1 
ATOM   4372 O O     . TRP C 1 261 ? 12.889  -25.040 -1.329  1.00 40.55  ? 382  TRP D O     1 
ATOM   4373 C CB    . TRP C 1 261 ? 11.197  -25.893 -3.990  1.00 40.35  ? 382  TRP D CB    1 
ATOM   4374 C CG    . TRP C 1 261 ? 12.542  -26.443 -4.198  1.00 43.58  ? 382  TRP D CG    1 
ATOM   4375 C CD1   . TRP C 1 261 ? 12.928  -27.738 -4.062  1.00 44.44  ? 382  TRP D CD1   1 
ATOM   4376 C CD2   . TRP C 1 261 ? 13.712  -25.711 -4.558  1.00 46.45  ? 382  TRP D CD2   1 
ATOM   4377 N NE1   . TRP C 1 261 ? 14.271  -27.866 -4.321  1.00 44.27  ? 382  TRP D NE1   1 
ATOM   4378 C CE2   . TRP C 1 261 ? 14.776  -26.636 -4.634  1.00 44.82  ? 382  TRP D CE2   1 
ATOM   4379 C CE3   . TRP C 1 261 ? 13.968  -24.365 -4.819  1.00 46.71  ? 382  TRP D CE3   1 
ATOM   4380 C CZ2   . TRP C 1 261 ? 16.066  -26.260 -4.969  1.00 44.45  ? 382  TRP D CZ2   1 
ATOM   4381 C CZ3   . TRP C 1 261 ? 15.253  -23.993 -5.157  1.00 48.43  ? 382  TRP D CZ3   1 
ATOM   4382 C CH2   . TRP C 1 261 ? 16.291  -24.939 -5.225  1.00 45.96  ? 382  TRP D CH2   1 
ATOM   4383 N N     . ILE C 1 262 ? 11.596  -23.341 -2.081  1.00 42.35  ? 383  ILE D N     1 
ATOM   4384 C CA    . ILE C 1 262 ? 12.465  -22.284 -1.548  1.00 42.81  ? 383  ILE D CA    1 
ATOM   4385 C C     . ILE C 1 262 ? 12.476  -22.337 -0.022  1.00 45.40  ? 383  ILE D C     1 
ATOM   4386 O O     . ILE C 1 262 ? 13.548  -22.454 0.598   1.00 42.71  ? 383  ILE D O     1 
ATOM   4387 C CB    . ILE C 1 262 ? 12.034  -20.859 -2.013  1.00 41.67  ? 383  ILE D CB    1 
ATOM   4388 C CG1   . ILE C 1 262 ? 12.124  -20.696 -3.539  1.00 44.05  ? 383  ILE D CG1   1 
ATOM   4389 C CG2   . ILE C 1 262 ? 12.896  -19.793 -1.382  1.00 38.63  ? 383  ILE D CG2   1 
ATOM   4390 C CD1   . ILE C 1 262 ? 13.530  -20.749 -4.104  1.00 43.95  ? 383  ILE D CD1   1 
ATOM   4391 N N     . THR C 1 263 ? 11.273  -22.269 0.557   1.00 47.64  ? 384  THR D N     1 
ATOM   4392 C CA    . THR C 1 263 ? 11.073  -22.245 2.009   1.00 48.85  ? 384  THR D CA    1 
ATOM   4393 C C     . THR C 1 263 ? 11.541  -23.549 2.643   1.00 50.38  ? 384  THR D C     1 
ATOM   4394 O O     . THR C 1 263 ? 11.943  -23.575 3.792   1.00 50.66  ? 384  THR D O     1 
ATOM   4395 C CB    . THR C 1 263 ? 9.590   -22.038 2.363   1.00 51.40  ? 384  THR D CB    1 
ATOM   4396 O OG1   . THR C 1 263 ? 8.820   -23.154 1.886   1.00 55.24  ? 384  THR D OG1   1 
ATOM   4397 C CG2   . THR C 1 263 ? 9.045   -20.738 1.747   1.00 51.41  ? 384  THR D CG2   1 
ATOM   4398 N N     . ALA C 1 264 ? 11.486  -24.632 1.870   1.00 55.30  ? 385  ALA D N     1 
ATOM   4399 C CA    . ALA C 1 264 ? 11.987  -25.944 2.288   1.00 50.95  ? 385  ALA D CA    1 
ATOM   4400 C C     . ALA C 1 264 ? 13.507  -26.016 2.400   1.00 50.40  ? 385  ALA D C     1 
ATOM   4401 O O     . ALA C 1 264 ? 14.026  -26.898 3.072   1.00 51.82  ? 385  ALA D O     1 
ATOM   4402 C CB    . ALA C 1 264 ? 11.503  -27.024 1.317   1.00 47.40  ? 385  ALA D CB    1 
ATOM   4403 N N     . ASN C 1 265 ? 14.233  -25.131 1.725   1.00 50.24  ? 386  ASN D N     1 
ATOM   4404 C CA    . ASN C 1 265 ? 15.684  -25.305 1.633   1.00 50.88  ? 386  ASN D CA    1 
ATOM   4405 C C     . ASN C 1 265 ? 16.539  -24.094 1.981   1.00 52.39  ? 386  ASN D C     1 
ATOM   4406 O O     . ASN C 1 265 ? 17.728  -24.248 2.231   1.00 54.14  ? 386  ASN D O     1 
ATOM   4407 C CB    . ASN C 1 265 ? 16.047  -25.799 0.235   1.00 48.93  ? 386  ASN D CB    1 
ATOM   4408 C CG    . ASN C 1 265 ? 15.498  -27.182 -0.058  1.00 50.19  ? 386  ASN D CG    1 
ATOM   4409 O OD1   . ASN C 1 265 ? 16.080  -28.180 0.371   1.00 47.75  ? 386  ASN D OD1   1 
ATOM   4410 N ND2   . ASN C 1 265 ? 14.386  -27.254 -0.829  1.00 48.09  ? 386  ASN D ND2   1 
ATOM   4411 N N     . SER C 1 266 ? 15.954  -22.901 1.986   1.00 55.77  ? 387  SER D N     1 
ATOM   4412 C CA    . SER C 1 266 ? 16.698  -21.675 2.302   1.00 62.19  ? 387  SER D CA    1 
ATOM   4413 C C     . SER C 1 266 ? 17.266  -21.706 3.725   1.00 63.90  ? 387  SER D C     1 
ATOM   4414 O O     . SER C 1 266 ? 16.538  -21.946 4.676   1.00 59.69  ? 387  SER D O     1 
ATOM   4415 C CB    . SER C 1 266 ? 15.781  -20.449 2.149   1.00 66.68  ? 387  SER D CB    1 
ATOM   4416 O OG    . SER C 1 266 ? 16.531  -19.245 2.096   1.00 70.07  ? 387  SER D OG    1 
ATOM   4417 N N     . SER C 1 267 ? 18.560  -21.433 3.874   1.00 72.55  ? 388  SER D N     1 
ATOM   4418 C CA    . SER C 1 267 ? 19.190  -21.407 5.201   1.00 75.72  ? 388  SER D CA    1 
ATOM   4419 C C     . SER C 1 267 ? 18.591  -20.296 6.054   1.00 81.95  ? 388  SER D C     1 
ATOM   4420 O O     . SER C 1 267 ? 18.767  -20.284 7.277   1.00 84.94  ? 388  SER D O     1 
ATOM   4421 C CB    . SER C 1 267 ? 20.711  -21.210 5.105   1.00 73.85  ? 388  SER D CB    1 
ATOM   4422 O OG    . SER C 1 267 ? 21.067  -19.841 5.254   1.00 73.05  ? 388  SER D OG    1 
ATOM   4423 N N     . LYS C 1 268 ? 17.889  -19.368 5.404   1.00 88.21  ? 389  LYS D N     1 
ATOM   4424 C CA    . LYS C 1 268 ? 17.334  -18.203 6.071   1.00 102.38 ? 389  LYS D CA    1 
ATOM   4425 C C     . LYS C 1 268 ? 16.353  -17.501 5.123   1.00 107.69 ? 389  LYS D C     1 
ATOM   4426 O O     . LYS C 1 268 ? 16.562  -17.505 3.906   1.00 93.64  ? 389  LYS D O     1 
ATOM   4427 C CB    . LYS C 1 268 ? 18.483  -17.247 6.442   1.00 108.80 ? 389  LYS D CB    1 
ATOM   4428 C CG    . LYS C 1 268 ? 18.294  -16.413 7.702   1.00 106.41 ? 389  LYS D CG    1 
ATOM   4429 C CD    . LYS C 1 268 ? 19.639  -15.863 8.157   1.00 108.32 ? 389  LYS D CD    1 
ATOM   4430 C CE    . LYS C 1 268 ? 19.513  -14.516 8.843   1.00 106.56 ? 389  LYS D CE    1 
ATOM   4431 N NZ    . LYS C 1 268 ? 20.863  -13.977 9.154   1.00 101.50 ? 389  LYS D NZ    1 
ATOM   4432 N N     . PRO C 1 269 ? 15.284  -16.889 5.675   1.00 122.68 ? 390  PRO D N     1 
ATOM   4433 C CA    . PRO C 1 269 ? 14.400  -16.061 4.844   1.00 120.70 ? 390  PRO D CA    1 
ATOM   4434 C C     . PRO C 1 269 ? 15.083  -14.758 4.425   1.00 112.37 ? 390  PRO D C     1 
ATOM   4435 O O     . PRO C 1 269 ? 14.471  -13.923 3.763   1.00 100.61 ? 390  PRO D O     1 
ATOM   4436 C CB    . PRO C 1 269 ? 13.212  -15.774 5.772   1.00 124.91 ? 390  PRO D CB    1 
ATOM   4437 C CG    . PRO C 1 269 ? 13.785  -15.851 7.150   1.00 126.53 ? 390  PRO D CG    1 
ATOM   4438 C CD    . PRO C 1 269 ? 14.841  -16.921 7.086   1.00 126.91 ? 390  PRO D CD    1 
ATOM   4439 N N     . VAL D 2 4   ? 31.782  19.420  -28.177 1.00 93.20  ? 4    VAL E N     1 
ATOM   4440 C CA    . VAL D 2 4   ? 31.234  18.994  -26.859 1.00 97.15  ? 4    VAL E CA    1 
ATOM   4441 C C     . VAL D 2 4   ? 31.818  17.634  -26.453 1.00 100.74 ? 4    VAL E C     1 
ATOM   4442 O O     . VAL D 2 4   ? 31.561  16.611  -27.099 1.00 98.35  ? 4    VAL E O     1 
ATOM   4443 C CB    . VAL D 2 4   ? 29.679  18.912  -26.880 1.00 100.71 ? 4    VAL E CB    1 
ATOM   4444 C CG1   . VAL D 2 4   ? 29.126  18.434  -25.542 1.00 98.21  ? 4    VAL E CG1   1 
ATOM   4445 C CG2   . VAL D 2 4   ? 29.065  20.261  -27.240 1.00 104.27 ? 4    VAL E CG2   1 
ATOM   4446 N N     . LYS D 2 5   ? 32.629  17.646  -25.397 1.00 97.31  ? 5    LYS E N     1 
ATOM   4447 C CA    . LYS D 2 5   ? 32.904  16.443  -24.616 1.00 92.42  ? 5    LYS E CA    1 
ATOM   4448 C C     . LYS D 2 5   ? 31.840  16.358  -23.504 1.00 89.27  ? 5    LYS E C     1 
ATOM   4449 O O     . LYS D 2 5   ? 30.928  17.188  -23.445 1.00 91.37  ? 5    LYS E O     1 
ATOM   4450 C CB    . LYS D 2 5   ? 34.326  16.474  -24.040 1.00 92.51  ? 5    LYS E CB    1 
ATOM   4451 C CG    . LYS D 2 5   ? 34.585  17.557  -23.001 1.00 93.43  ? 5    LYS E CG    1 
ATOM   4452 C CD    . LYS D 2 5   ? 35.853  17.281  -22.204 1.00 94.60  ? 5    LYS E CD    1 
ATOM   4453 C CE    . LYS D 2 5   ? 37.107  17.430  -23.056 1.00 93.10  ? 5    LYS E CE    1 
ATOM   4454 N NZ    . LYS D 2 5   ? 38.353  17.180  -22.275 1.00 90.20  ? 5    LYS E NZ    1 
ATOM   4455 N N     . SER D 2 6   ? 31.936  15.362  -22.628 1.00 82.17  ? 6    SER E N     1 
ATOM   4456 C CA    . SER D 2 6   ? 30.931  15.209  -21.578 1.00 75.04  ? 6    SER E CA    1 
ATOM   4457 C C     . SER D 2 6   ? 31.365  15.978  -20.347 1.00 66.53  ? 6    SER E C     1 
ATOM   4458 O O     . SER D 2 6   ? 32.552  16.097  -20.053 1.00 65.85  ? 6    SER E O     1 
ATOM   4459 C CB    . SER D 2 6   ? 30.674  13.733  -21.254 1.00 80.67  ? 6    SER E CB    1 
ATOM   4460 O OG    . SER D 2 6   ? 29.984  13.083  -22.321 1.00 80.64  ? 6    SER E OG    1 
ATOM   4461 N N     . SER D 2 7   ? 30.385  16.526  -19.648 1.00 61.89  ? 7    SER E N     1 
ATOM   4462 C CA    . SER D 2 7   ? 30.628  17.303  -18.442 1.00 61.65  ? 7    SER E CA    1 
ATOM   4463 C C     . SER D 2 7   ? 30.801  16.370  -17.261 1.00 57.10  ? 7    SER E C     1 
ATOM   4464 O O     . SER D 2 7   ? 31.365  16.763  -16.254 1.00 58.80  ? 7    SER E O     1 
ATOM   4465 C CB    . SER D 2 7   ? 29.427  18.197  -18.169 1.00 63.14  ? 7    SER E CB    1 
ATOM   4466 O OG    . SER D 2 7   ? 28.238  17.419  -18.269 1.00 68.75  ? 7    SER E OG    1 
ATOM   4467 N N     . TYR D 2 8   ? 30.266  15.155  -17.391 1.00 51.71  ? 8    TYR E N     1 
ATOM   4468 C CA    . TYR D 2 8   ? 30.247  14.162  -16.330 1.00 49.04  ? 8    TYR E CA    1 
ATOM   4469 C C     . TYR D 2 8   ? 29.409  14.602  -15.124 1.00 48.69  ? 8    TYR E C     1 
ATOM   4470 O O     . TYR D 2 8   ? 29.699  14.255  -13.976 1.00 48.00  ? 8    TYR E O     1 
ATOM   4471 C CB    . TYR D 2 8   ? 31.672  13.738  -15.952 1.00 49.37  ? 8    TYR E CB    1 
ATOM   4472 C CG    . TYR D 2 8   ? 32.362  13.008  -17.107 1.00 50.16  ? 8    TYR E CG    1 
ATOM   4473 C CD1   . TYR D 2 8   ? 32.217  11.625  -17.271 1.00 48.72  ? 8    TYR E CD1   1 
ATOM   4474 C CD2   . TYR D 2 8   ? 33.124  13.702  -18.049 1.00 44.75  ? 8    TYR E CD2   1 
ATOM   4475 C CE1   . TYR D 2 8   ? 32.820  10.958  -18.331 1.00 46.68  ? 8    TYR E CE1   1 
ATOM   4476 C CE2   . TYR D 2 8   ? 33.719  13.048  -19.104 1.00 43.86  ? 8    TYR E CE2   1 
ATOM   4477 C CZ    . TYR D 2 8   ? 33.565  11.678  -19.239 1.00 46.05  ? 8    TYR E CZ    1 
ATOM   4478 O OH    . TYR D 2 8   ? 34.157  11.029  -20.289 1.00 49.21  ? 8    TYR E OH    1 
ATOM   4479 N N     . SER D 2 9   ? 28.360  15.364  -15.394 1.00 44.69  ? 9    SER E N     1 
ATOM   4480 C CA    . SER D 2 9   ? 27.439  15.746  -14.352 1.00 46.69  ? 9    SER E CA    1 
ATOM   4481 C C     . SER D 2 9   ? 26.393  14.663  -14.313 1.00 44.35  ? 9    SER E C     1 
ATOM   4482 O O     . SER D 2 9   ? 25.743  14.409  -15.301 1.00 43.54  ? 9    SER E O     1 
ATOM   4483 C CB    . SER D 2 9   ? 26.775  17.088  -14.652 1.00 49.23  ? 9    SER E CB    1 
ATOM   4484 O OG    . SER D 2 9   ? 27.748  18.111  -14.742 1.00 55.04  ? 9    SER E OG    1 
ATOM   4485 N N     . TYR D 2 10  ? 26.259  13.999  -13.175 1.00 45.96  ? 10   TYR E N     1 
ATOM   4486 C CA    . TYR D 2 10  ? 25.235  12.989  -12.992 1.00 42.55  ? 10   TYR E CA    1 
ATOM   4487 C C     . TYR D 2 10  ? 24.308  13.478  -11.911 1.00 41.78  ? 10   TYR E C     1 
ATOM   4488 O O     . TYR D 2 10  ? 24.689  14.313  -11.102 1.00 42.61  ? 10   TYR E O     1 
ATOM   4489 C CB    . TYR D 2 10  ? 25.851  11.666  -12.572 1.00 38.86  ? 10   TYR E CB    1 
ATOM   4490 C CG    . TYR D 2 10  ? 26.884  11.139  -13.517 1.00 37.73  ? 10   TYR E CG    1 
ATOM   4491 C CD1   . TYR D 2 10  ? 26.950  11.561  -14.856 1.00 39.21  ? 10   TYR E CD1   1 
ATOM   4492 C CD2   . TYR D 2 10  ? 27.781  10.180  -13.099 1.00 36.41  ? 10   TYR E CD2   1 
ATOM   4493 C CE1   . TYR D 2 10  ? 27.894  11.033  -15.726 1.00 36.93  ? 10   TYR E CE1   1 
ATOM   4494 C CE2   . TYR D 2 10  ? 28.728  9.648   -13.959 1.00 35.13  ? 10   TYR E CE2   1 
ATOM   4495 C CZ    . TYR D 2 10  ? 28.778  10.077  -15.255 1.00 35.80  ? 10   TYR E CZ    1 
ATOM   4496 O OH    . TYR D 2 10  ? 29.715  9.539   -16.070 1.00 37.94  ? 10   TYR E OH    1 
ATOM   4497 N N     . ASP D 2 11  ? 23.090  12.963  -11.928 1.00 41.64  ? 11   ASP E N     1 
ATOM   4498 C CA    . ASP D 2 11  ? 22.150  13.166  -10.860 1.00 44.52  ? 11   ASP E CA    1 
ATOM   4499 C C     . ASP D 2 11  ? 22.410  12.026  -9.909  1.00 42.41  ? 11   ASP E C     1 
ATOM   4500 O O     . ASP D 2 11  ? 21.651  11.055  -9.842  1.00 44.06  ? 11   ASP E O     1 
ATOM   4501 C CB    . ASP D 2 11  ? 20.698  13.166  -11.387 1.00 48.77  ? 11   ASP E CB    1 
ATOM   4502 C CG    . ASP D 2 11  ? 20.404  14.347  -12.358 1.00 52.31  ? 11   ASP E CG    1 
ATOM   4503 O OD1   . ASP D 2 11  ? 20.843  15.501  -12.083 1.00 50.98  ? 11   ASP E OD1   1 
ATOM   4504 O OD2   . ASP D 2 11  ? 19.711  14.117  -13.389 1.00 54.73  ? 11   ASP E OD2   1 
ATOM   4505 N N     . ALA D 2 12  ? 23.516  12.167  -9.189  1.00 43.85  ? 12   ALA E N     1 
ATOM   4506 C CA    . ALA D 2 12  ? 24.028  11.160  -8.252  1.00 43.77  ? 12   ALA E CA    1 
ATOM   4507 C C     . ALA D 2 12  ? 24.914  11.823  -7.172  1.00 45.39  ? 12   ALA E C     1 
ATOM   4508 O O     . ALA D 2 12  ? 25.632  12.795  -7.453  1.00 40.77  ? 12   ALA E O     1 
ATOM   4509 C CB    . ALA D 2 12  ? 24.832  10.119  -8.997  1.00 44.78  ? 12   ALA E CB    1 
ATOM   4510 N N     . PRO D 2 13  ? 24.879  11.284  -5.940  1.00 44.95  ? 13   PRO E N     1 
ATOM   4511 C CA    . PRO D 2 13  ? 25.547  11.967  -4.864  1.00 44.75  ? 13   PRO E CA    1 
ATOM   4512 C C     . PRO D 2 13  ? 27.032  12.134  -5.137  1.00 47.03  ? 13   PRO E C     1 
ATOM   4513 O O     . PRO D 2 13  ? 27.666  11.227  -5.679  1.00 44.32  ? 13   PRO E O     1 
ATOM   4514 C CB    . PRO D 2 13  ? 25.318  11.049  -3.646  1.00 46.48  ? 13   PRO E CB    1 
ATOM   4515 C CG    . PRO D 2 13  ? 24.258  10.081  -4.032  1.00 45.99  ? 13   PRO E CG    1 
ATOM   4516 C CD    . PRO D 2 13  ? 24.387  9.954   -5.523  1.00 49.07  ? 13   PRO E CD    1 
ATOM   4517 N N     . SER D 2 14  ? 27.550  13.305  -4.767  1.00 48.33  ? 14   SER E N     1 
ATOM   4518 C CA    . SER D 2 14  ? 28.959  13.643  -4.883  1.00 49.55  ? 14   SER E CA    1 
ATOM   4519 C C     . SER D 2 14  ? 29.460  14.322  -3.593  1.00 50.00  ? 14   SER E C     1 
ATOM   4520 O O     . SER D 2 14  ? 30.591  14.837  -3.540  1.00 48.43  ? 14   SER E O     1 
ATOM   4521 C CB    . SER D 2 14  ? 29.143  14.586  -6.080  1.00 54.16  ? 14   SER E CB    1 
ATOM   4522 O OG    . SER D 2 14  ? 30.419  14.435  -6.685  1.00 59.35  ? 14   SER E OG    1 
ATOM   4523 N N     . ASP D 2 15  ? 28.619  14.310  -2.557  1.00 51.91  ? 15   ASP E N     1 
ATOM   4524 C CA    . ASP D 2 15  ? 28.907  14.997  -1.302  1.00 55.29  ? 15   ASP E CA    1 
ATOM   4525 C C     . ASP D 2 15  ? 29.792  14.117  -0.416  1.00 53.72  ? 15   ASP E C     1 
ATOM   4526 O O     . ASP D 2 15  ? 29.609  12.912  -0.363  1.00 56.14  ? 15   ASP E O     1 
ATOM   4527 C CB    . ASP D 2 15  ? 27.595  15.347  -0.567  1.00 59.47  ? 15   ASP E CB    1 
ATOM   4528 C CG    . ASP D 2 15  ? 26.647  16.256  -1.405  1.00 72.15  ? 15   ASP E CG    1 
ATOM   4529 O OD1   . ASP D 2 15  ? 27.113  17.309  -1.947  1.00 67.25  ? 15   ASP E OD1   1 
ATOM   4530 O OD2   . ASP D 2 15  ? 25.430  15.909  -1.511  1.00 73.59  ? 15   ASP E OD2   1 
ATOM   4531 N N     . PHE D 2 16  ? 30.749  14.716  0.282   1.00 53.42  ? 16   PHE E N     1 
ATOM   4532 C CA    . PHE D 2 16  ? 31.483  14.006  1.327   1.00 53.59  ? 16   PHE E CA    1 
ATOM   4533 C C     . PHE D 2 16  ? 30.540  13.493  2.413   1.00 50.60  ? 16   PHE E C     1 
ATOM   4534 O O     . PHE D 2 16  ? 29.696  14.229  2.886   1.00 47.97  ? 16   PHE E O     1 
ATOM   4535 C CB    . PHE D 2 16  ? 32.512  14.927  1.972   1.00 57.51  ? 16   PHE E CB    1 
ATOM   4536 C CG    . PHE D 2 16  ? 33.496  14.207  2.847   1.00 61.49  ? 16   PHE E CG    1 
ATOM   4537 C CD1   . PHE D 2 16  ? 33.222  13.991  4.201   1.00 63.32  ? 16   PHE E CD1   1 
ATOM   4538 C CD2   . PHE D 2 16  ? 34.695  13.738  2.323   1.00 61.40  ? 16   PHE E CD2   1 
ATOM   4539 C CE1   . PHE D 2 16  ? 34.121  13.318  5.016   1.00 61.84  ? 16   PHE E CE1   1 
ATOM   4540 C CE2   . PHE D 2 16  ? 35.600  13.071  3.136   1.00 66.06  ? 16   PHE E CE2   1 
ATOM   4541 C CZ    . PHE D 2 16  ? 35.311  12.860  4.486   1.00 63.83  ? 16   PHE E CZ    1 
ATOM   4542 N N     . ILE D 2 17  ? 30.717  12.239  2.820   1.00 51.62  ? 17   ILE E N     1 
ATOM   4543 C CA    . ILE D 2 17  ? 29.864  11.591  3.823   1.00 53.75  ? 17   ILE E CA    1 
ATOM   4544 C C     . ILE D 2 17  ? 30.704  11.253  5.057   1.00 56.75  ? 17   ILE E C     1 
ATOM   4545 O O     . ILE D 2 17  ? 31.831  10.776  4.936   1.00 57.32  ? 17   ILE E O     1 
ATOM   4546 C CB    . ILE D 2 17  ? 29.240  10.255  3.291   1.00 53.84  ? 17   ILE E CB    1 
ATOM   4547 C CG1   . ILE D 2 17  ? 28.576  10.439  1.923   1.00 50.95  ? 17   ILE E CG1   1 
ATOM   4548 C CG2   . ILE D 2 17  ? 28.213  9.683   4.266   1.00 54.58  ? 17   ILE E CG2   1 
ATOM   4549 C CD1   . ILE D 2 17  ? 27.819  9.225   1.447   1.00 48.95  ? 17   ILE E CD1   1 
ATOM   4550 N N     . ASN D 2 18  ? 30.149  11.492  6.240   1.00 59.67  ? 18   ASN E N     1 
ATOM   4551 C CA    . ASN D 2 18  ? 30.724  10.972  7.473   1.00 65.29  ? 18   ASN E CA    1 
ATOM   4552 C C     . ASN D 2 18  ? 30.394  9.501   7.500   1.00 63.73  ? 18   ASN E C     1 
ATOM   4553 O O     . ASN D 2 18  ? 29.248  9.134   7.280   1.00 61.11  ? 18   ASN E O     1 
ATOM   4554 C CB    . ASN D 2 18  ? 30.116  11.696  8.702   1.00 72.62  ? 18   ASN E CB    1 
ATOM   4555 C CG    . ASN D 2 18  ? 30.479  11.044  10.044  1.00 71.34  ? 18   ASN E CG    1 
ATOM   4556 O OD1   . ASN D 2 18  ? 29.952  9.987   10.410  1.00 68.96  ? 18   ASN E OD1   1 
ATOM   4557 N ND2   . ASN D 2 18  ? 31.354  11.705  10.801  1.00 73.54  ? 18   ASN E ND2   1 
ATOM   4558 N N     . PHE D 2 19  ? 31.377  8.651   7.757   1.00 67.31  ? 19   PHE E N     1 
ATOM   4559 C CA    . PHE D 2 19  ? 31.079  7.238   7.976   1.00 70.10  ? 19   PHE E CA    1 
ATOM   4560 C C     . PHE D 2 19  ? 30.955  6.955   9.475   1.00 77.70  ? 19   PHE E C     1 
ATOM   4561 O O     . PHE D 2 19  ? 31.953  6.954   10.200  1.00 79.29  ? 19   PHE E O     1 
ATOM   4562 C CB    . PHE D 2 19  ? 32.121  6.363   7.299   1.00 69.00  ? 19   PHE E CB    1 
ATOM   4563 C CG    . PHE D 2 19  ? 32.058  6.419   5.792   1.00 69.20  ? 19   PHE E CG    1 
ATOM   4564 C CD1   . PHE D 2 19  ? 31.053  5.755   5.103   1.00 69.79  ? 19   PHE E CD1   1 
ATOM   4565 C CD2   . PHE D 2 19  ? 32.991  7.149   5.058   1.00 70.53  ? 19   PHE E CD2   1 
ATOM   4566 C CE1   . PHE D 2 19  ? 30.982  5.811   3.716   1.00 69.67  ? 19   PHE E CE1   1 
ATOM   4567 C CE2   . PHE D 2 19  ? 32.930  7.198   3.668   1.00 68.56  ? 19   PHE E CE2   1 
ATOM   4568 C CZ    . PHE D 2 19  ? 31.926  6.527   2.997   1.00 66.99  ? 19   PHE E CZ    1 
ATOM   4569 N N     . SER D 2 20  ? 29.699  6.784   9.914   1.00 84.94  ? 20   SER E N     1 
ATOM   4570 C CA    . SER D 2 20  ? 29.292  6.461   11.304  1.00 79.32  ? 20   SER E CA    1 
ATOM   4571 C C     . SER D 2 20  ? 28.257  7.452   11.828  1.00 72.46  ? 20   SER E C     1 
ATOM   4572 O O     . SER D 2 20  ? 27.453  7.976   11.066  1.00 71.37  ? 20   SER E O     1 
ATOM   4573 C CB    . SER D 2 20  ? 30.461  6.405   12.281  1.00 79.82  ? 20   SER E CB    1 
ATOM   4574 O OG    . SER D 2 20  ? 29.995  5.971   13.542  1.00 86.43  ? 20   SER E OG    1 
HETATM 4575 P PG    . ACP E 3 .   ? 3.059   16.193  -26.900 1.00 97.64  ? 1389 ACP A PG    1 
HETATM 4576 O O1G   . ACP E 3 .   ? 2.433   15.509  -28.234 1.00 82.99  ? 1389 ACP A O1G   1 
HETATM 4577 O O2G   . ACP E 3 .   ? 4.554   15.630  -26.611 1.00 81.86  ? 1389 ACP A O2G   1 
HETATM 4578 O O3G   . ACP E 3 .   ? 2.223   15.896  -25.709 1.00 97.24  ? 1389 ACP A O3G   1 
HETATM 4579 P PB    . ACP E 3 .   ? 4.590   18.666  -26.576 1.00 76.06  ? 1389 ACP A PB    1 
HETATM 4580 O O1B   . ACP E 3 .   ? 4.602   18.802  -25.104 1.00 72.38  ? 1389 ACP A O1B   1 
HETATM 4581 O O2B   . ACP E 3 .   ? 5.778   17.670  -27.018 1.00 81.76  ? 1389 ACP A O2B   1 
HETATM 4582 C C3B   . ACP E 3 .   ? 3.004   17.992  -27.120 1.00 80.37  ? 1389 ACP A C3B   1 
HETATM 4583 P PA    . ACP E 3 .   ? 5.088   20.217  -28.835 1.00 55.15  ? 1389 ACP A PA    1 
HETATM 4584 O O1A   . ACP E 3 .   ? 6.546   20.333  -29.150 1.00 55.02  ? 1389 ACP A O1A   1 
HETATM 4585 O O2A   . ACP E 3 .   ? 4.303   19.172  -29.579 1.00 55.79  ? 1389 ACP A O2A   1 
HETATM 4586 O O3A   . ACP E 3 .   ? 4.857   20.101  -27.249 1.00 63.85  ? 1389 ACP A O3A   1 
HETATM 4587 O "O5'" . ACP E 3 .   ? 4.409   21.655  -29.096 1.00 55.62  ? 1389 ACP A "O5'" 1 
HETATM 4588 C "C5'" . ACP E 3 .   ? 3.007   21.868  -28.991 1.00 52.86  ? 1389 ACP A "C5'" 1 
HETATM 4589 C "C4'" . ACP E 3 .   ? 2.519   22.458  -30.296 1.00 52.03  ? 1389 ACP A "C4'" 1 
HETATM 4590 O "O4'" . ACP E 3 .   ? 3.274   23.617  -30.609 1.00 53.83  ? 1389 ACP A "O4'" 1 
HETATM 4591 C "C3'" . ACP E 3 .   ? 2.723   21.502  -31.453 1.00 52.21  ? 1389 ACP A "C3'" 1 
HETATM 4592 O "O3'" . ACP E 3 .   ? 1.542   20.724  -31.631 1.00 55.98  ? 1389 ACP A "O3'" 1 
HETATM 4593 C "C2'" . ACP E 3 .   ? 3.039   22.377  -32.645 1.00 52.46  ? 1389 ACP A "C2'" 1 
HETATM 4594 O "O2'" . ACP E 3 .   ? 1.878   22.763  -33.411 1.00 55.54  ? 1389 ACP A "O2'" 1 
HETATM 4595 C "C1'" . ACP E 3 .   ? 3.630   23.610  -32.002 1.00 50.59  ? 1389 ACP A "C1'" 1 
HETATM 4596 N N9    . ACP E 3 .   ? 5.095   23.576  -32.184 1.00 45.25  ? 1389 ACP A N9    1 
HETATM 4597 C C8    . ACP E 3 .   ? 6.002   22.968  -31.416 1.00 42.22  ? 1389 ACP A C8    1 
HETATM 4598 N N7    . ACP E 3 .   ? 7.251   23.176  -31.889 1.00 40.69  ? 1389 ACP A N7    1 
HETATM 4599 C C5    . ACP E 3 .   ? 7.144   23.926  -32.979 1.00 37.49  ? 1389 ACP A C5    1 
HETATM 4600 C C6    . ACP E 3 .   ? 8.062   24.508  -33.949 1.00 36.07  ? 1389 ACP A C6    1 
HETATM 4601 N N6    . ACP E 3 .   ? 9.377   24.296  -33.828 1.00 36.71  ? 1389 ACP A N6    1 
HETATM 4602 N N1    . ACP E 3 .   ? 7.557   25.237  -34.957 1.00 35.77  ? 1389 ACP A N1    1 
HETATM 4603 C C2    . ACP E 3 .   ? 6.246   25.449  -35.078 1.00 36.41  ? 1389 ACP A C2    1 
HETATM 4604 N N3    . ACP E 3 .   ? 5.339   24.960  -34.216 1.00 38.08  ? 1389 ACP A N3    1 
HETATM 4605 C C4    . ACP E 3 .   ? 5.727   24.198  -33.170 1.00 41.37  ? 1389 ACP A C4    1 
HETATM 4606 P PG    . ACP F 3 .   ? 32.948  -6.569  -16.852 1.00 95.03  ? 1391 ACP D PG    1 
HETATM 4607 O O1G   . ACP F 3 .   ? 33.460  -7.420  -18.125 1.00 92.53  ? 1391 ACP D O1G   1 
HETATM 4608 O O2G   . ACP F 3 .   ? 33.301  -7.381  -15.503 1.00 90.77  ? 1391 ACP D O2G   1 
HETATM 4609 O O3G   . ACP F 3 .   ? 31.505  -6.219  -16.934 1.00 82.92  ? 1391 ACP D O3G   1 
HETATM 4610 P PB    . ACP F 3 .   ? 33.198  -4.264  -15.242 1.00 93.63  ? 1391 ACP D PB    1 
HETATM 4611 O O1B   . ACP F 3 .   ? 33.845  -2.931  -15.171 1.00 88.70  ? 1391 ACP D O1B   1 
HETATM 4612 O O2B   . ACP F 3 .   ? 31.576  -4.175  -15.286 1.00 81.34  ? 1391 ACP D O2B   1 
HETATM 4613 C C3B   . ACP F 3 .   ? 33.810  -5.000  -16.772 1.00 90.74  ? 1391 ACP D C3B   1 
HETATM 4614 P PA    . ACP F 3 .   ? 34.062  -4.607  -12.555 1.00 64.66  ? 1391 ACP D PA    1 
HETATM 4615 O O1A   . ACP F 3 .   ? 34.967  -3.415  -12.712 1.00 64.89  ? 1391 ACP D O1A   1 
HETATM 4616 O O2A   . ACP F 3 .   ? 32.843  -4.539  -11.692 1.00 65.10  ? 1391 ACP D O2A   1 
HETATM 4617 O O3A   . ACP F 3 .   ? 33.626  -5.199  -13.995 1.00 77.57  ? 1391 ACP D O3A   1 
HETATM 4618 O "O5'" . ACP F 3 .   ? 35.000  -5.778  -12.011 1.00 62.23  ? 1391 ACP D "O5'" 1 
HETATM 4619 C "C5'" . ACP F 3 .   ? 36.319  -5.542  -11.544 1.00 56.24  ? 1391 ACP D "C5'" 1 
HETATM 4620 C "C4'" . ACP F 3 .   ? 36.693  -6.759  -10.726 1.00 54.19  ? 1391 ACP D "C4'" 1 
HETATM 4621 O "O4'" . ACP F 3 .   ? 37.133  -6.408  -9.418  1.00 56.11  ? 1391 ACP D "O4'" 1 
HETATM 4622 C "C3'" . ACP F 3 .   ? 35.498  -7.655  -10.535 1.00 51.73  ? 1391 ACP D "C3'" 1 
HETATM 4623 O "O3'" . ACP F 3 .   ? 35.610  -8.672  -11.497 1.00 53.35  ? 1391 ACP D "O3'" 1 
HETATM 4624 C "C2'" . ACP F 3 .   ? 35.595  -8.176  -9.135  1.00 53.08  ? 1391 ACP D "C2'" 1 
HETATM 4625 O "O2'" . ACP F 3 .   ? 36.337  -9.412  -9.118  1.00 57.15  ? 1391 ACP D "O2'" 1 
HETATM 4626 C "C1'" . ACP F 3 .   ? 36.327  -7.039  -8.430  1.00 51.11  ? 1391 ACP D "C1'" 1 
HETATM 4627 N N9    . ACP F 3 .   ? 35.389  -6.045  -7.840  1.00 47.04  ? 1391 ACP D N9    1 
HETATM 4628 C C8    . ACP F 3 .   ? 34.614  -5.150  -8.488  1.00 44.69  ? 1391 ACP D C8    1 
HETATM 4629 N N7    . ACP F 3 .   ? 33.881  -4.404  -7.613  1.00 43.22  ? 1391 ACP D N7    1 
HETATM 4630 C C5    . ACP F 3 .   ? 34.186  -4.822  -6.376  1.00 42.91  ? 1391 ACP D C5    1 
HETATM 4631 C C6    . ACP F 3 .   ? 33.784  -4.483  -5.001  1.00 41.55  ? 1391 ACP D C6    1 
HETATM 4632 N N6    . ACP F 3 .   ? 32.900  -3.511  -4.737  1.00 40.47  ? 1391 ACP D N6    1 
HETATM 4633 N N1    . ACP F 3 .   ? 34.362  -5.173  -3.992  1.00 45.57  ? 1391 ACP D N1    1 
HETATM 4634 C C2    . ACP F 3 .   ? 35.265  -6.158  -4.196  1.00 44.29  ? 1391 ACP D C2    1 
HETATM 4635 N N3    . ACP F 3 .   ? 35.665  -6.521  -5.426  1.00 44.00  ? 1391 ACP D N3    1 
HETATM 4636 C C4    . ACP F 3 .   ? 35.181  -5.899  -6.530  1.00 45.56  ? 1391 ACP D C4    1 
HETATM 4637 S S     . SO4 G 4 .   ? 15.275  -0.329  -24.332 1.00 106.86 ? 1392 SO4 D S     1 
HETATM 4638 O O1    . SO4 G 4 .   ? 14.447  0.787   -23.796 1.00 90.49  ? 1392 SO4 D O1    1 
HETATM 4639 O O2    . SO4 G 4 .   ? 16.701  -0.216  -23.911 1.00 94.89  ? 1392 SO4 D O2    1 
HETATM 4640 O O3    . SO4 G 4 .   ? 15.255  -0.293  -25.807 1.00 107.00 ? 1392 SO4 D O3    1 
HETATM 4641 O O4    . SO4 G 4 .   ? 14.667  -1.606  -23.890 1.00 97.34  ? 1392 SO4 D O4    1 
HETATM 4642 O O     . HOH H 5 .   ? -0.073  19.890  -27.766 1.00 56.16  ? 2001 HOH A O     1 
HETATM 4643 O O     . HOH H 5 .   ? 13.775  28.684  -37.483 1.00 42.85  ? 2002 HOH A O     1 
HETATM 4644 O O     . HOH H 5 .   ? 15.261  8.002   -15.151 1.00 46.92  ? 2003 HOH A O     1 
HETATM 4645 O O     . HOH H 5 .   ? 7.777   15.718  -27.235 1.00 32.91  ? 2004 HOH A O     1 
HETATM 4646 O O     . HOH H 5 .   ? 18.049  18.392  -37.843 1.00 34.21  ? 2005 HOH A O     1 
HETATM 4647 O O     . HOH H 5 .   ? 15.994  20.755  -40.627 1.00 24.65  ? 2006 HOH A O     1 
HETATM 4648 O O     . HOH H 5 .   ? 25.903  20.956  -20.006 1.00 46.20  ? 2007 HOH A O     1 
HETATM 4649 O O     . HOH H 5 .   ? -10.829 15.602  -40.879 1.00 45.25  ? 2008 HOH A O     1 
HETATM 4650 O O     . HOH H 5 .   ? 23.957  -1.476  -37.461 1.00 42.29  ? 2009 HOH A O     1 
HETATM 4651 O O     . HOH H 5 .   ? -10.797 0.675   -23.753 1.00 45.10  ? 2010 HOH A O     1 
HETATM 4652 O O     . HOH H 5 .   ? 8.787   -6.897  -47.444 1.00 52.10  ? 2011 HOH A O     1 
HETATM 4653 O O     . HOH H 5 .   ? 2.838   -10.734 -40.691 1.00 39.77  ? 2012 HOH A O     1 
HETATM 4654 O O     . HOH H 5 .   ? 12.631  12.498  -54.026 1.00 40.86  ? 2013 HOH A O     1 
HETATM 4655 O O     . HOH I 5 .   ? 26.509  13.817  -18.297 1.00 44.07  ? 2001 HOH B O     1 
HETATM 4656 O O     . HOH I 5 .   ? 28.021  12.013  -24.101 1.00 67.00  ? 2002 HOH B O     1 
HETATM 4657 O O     . HOH I 5 .   ? 29.854  36.010  -38.935 1.00 46.00  ? 2003 HOH B O     1 
HETATM 4658 O O     . HOH J 5 .   ? 22.260  8.712   2.235   1.00 50.47  ? 2001 HOH D O     1 
HETATM 4659 O O     . HOH J 5 .   ? 24.108  -3.216  1.139   1.00 39.33  ? 2002 HOH D O     1 
HETATM 4660 O O     . HOH J 5 .   ? 12.904  -6.569  -0.940  1.00 35.29  ? 2003 HOH D O     1 
HETATM 4661 O O     . HOH J 5 .   ? 38.444  -12.702 -2.729  1.00 37.54  ? 2004 HOH D O     1 
HETATM 4662 O O     . HOH J 5 .   ? 25.558  -25.212 1.291   1.00 41.08  ? 2005 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   122 ?   ?   ?   A . n 
A 1 2   SER 2   123 ?   ?   ?   A . n 
A 1 3   LYS 3   124 ?   ?   ?   A . n 
A 1 4   LYS 4   125 125 LYS LYS A . n 
A 1 5   ARG 5   126 126 ARG ARG A . n 
A 1 6   GLN 6   127 127 GLN GLN A . n 
A 1 7   TRP 7   128 128 TRP TRP A . n 
A 1 8   ALA 8   129 129 ALA ALA A . n 
A 1 9   LEU 9   130 130 LEU LEU A . n 
A 1 10  GLU 10  131 131 GLU GLU A . n 
A 1 11  ASP 11  132 132 ASP ASP A . n 
A 1 12  PHE 12  133 133 PHE PHE A . n 
A 1 13  GLU 13  134 134 GLU GLU A . n 
A 1 14  ILE 14  135 135 ILE ILE A . n 
A 1 15  GLY 15  136 136 GLY GLY A . n 
A 1 16  ARG 16  137 137 ARG ARG A . n 
A 1 17  PRO 17  138 138 PRO PRO A . n 
A 1 18  LEU 18  139 139 LEU LEU A . n 
A 1 19  GLY 19  140 140 GLY GLY A . n 
A 1 20  LYS 20  141 141 LYS LYS A . n 
A 1 21  GLY 21  142 142 GLY GLY A . n 
A 1 22  LYS 22  143 143 LYS LYS A . n 
A 1 23  PHE 23  144 144 PHE PHE A . n 
A 1 24  GLY 24  145 145 GLY GLY A . n 
A 1 25  ASN 25  146 146 ASN ASN A . n 
A 1 26  VAL 26  147 147 VAL VAL A . n 
A 1 27  TYR 27  148 148 TYR TYR A . n 
A 1 28  LEU 28  149 149 LEU LEU A . n 
A 1 29  ALA 29  150 150 ALA ALA A . n 
A 1 30  ARG 30  151 151 ARG ARG A . n 
A 1 31  GLU 31  152 152 GLU GLU A . n 
A 1 32  LYS 32  153 153 LYS LYS A . n 
A 1 33  GLN 33  154 154 GLN GLN A . n 
A 1 34  SER 34  155 155 SER SER A . n 
A 1 35  LYS 35  156 156 LYS LYS A . n 
A 1 36  PHE 36  157 157 PHE PHE A . n 
A 1 37  ILE 37  158 158 ILE ILE A . n 
A 1 38  LEU 38  159 159 LEU LEU A . n 
A 1 39  ALA 39  160 160 ALA ALA A . n 
A 1 40  LEU 40  161 161 LEU LEU A . n 
A 1 41  LYS 41  162 162 LYS LYS A . n 
A 1 42  VAL 42  163 163 VAL VAL A . n 
A 1 43  LEU 43  164 164 LEU LEU A . n 
A 1 44  PHE 44  165 165 PHE PHE A . n 
A 1 45  LYS 45  166 166 LYS LYS A . n 
A 1 46  ALA 46  167 167 ALA ALA A . n 
A 1 47  GLN 47  168 168 GLN GLN A . n 
A 1 48  LEU 48  169 169 LEU LEU A . n 
A 1 49  GLU 49  170 170 GLU GLU A . n 
A 1 50  LYS 50  171 171 LYS LYS A . n 
A 1 51  ALA 51  172 172 ALA ALA A . n 
A 1 52  GLY 52  173 173 GLY GLY A . n 
A 1 53  VAL 53  174 174 VAL VAL A . n 
A 1 54  GLU 54  175 175 GLU GLU A . n 
A 1 55  HIS 55  176 176 HIS HIS A . n 
A 1 56  GLN 56  177 177 GLN GLN A . n 
A 1 57  LEU 57  178 178 LEU LEU A . n 
A 1 58  ARG 58  179 179 ARG ARG A . n 
A 1 59  ARG 59  180 180 ARG ARG A . n 
A 1 60  GLU 60  181 181 GLU GLU A . n 
A 1 61  VAL 61  182 182 VAL VAL A . n 
A 1 62  GLU 62  183 183 GLU GLU A . n 
A 1 63  ILE 63  184 184 ILE ILE A . n 
A 1 64  GLN 64  185 185 GLN GLN A . n 
A 1 65  SER 65  186 186 SER SER A . n 
A 1 66  HIS 66  187 187 HIS HIS A . n 
A 1 67  LEU 67  188 188 LEU LEU A . n 
A 1 68  ARG 68  189 189 ARG ARG A . n 
A 1 69  HIS 69  190 190 HIS HIS A . n 
A 1 70  PRO 70  191 191 PRO PRO A . n 
A 1 71  ASN 71  192 192 ASN ASN A . n 
A 1 72  ILE 72  193 193 ILE ILE A . n 
A 1 73  LEU 73  194 194 LEU LEU A . n 
A 1 74  ARG 74  195 195 ARG ARG A . n 
A 1 75  LEU 75  196 196 LEU LEU A . n 
A 1 76  TYR 76  197 197 TYR TYR A . n 
A 1 77  GLY 77  198 198 GLY GLY A . n 
A 1 78  TYR 78  199 199 TYR TYR A . n 
A 1 79  PHE 79  200 200 PHE PHE A . n 
A 1 80  HIS 80  201 201 HIS HIS A . n 
A 1 81  ASP 81  202 202 ASP ASP A . n 
A 1 82  ALA 82  203 203 ALA ALA A . n 
A 1 83  THR 83  204 204 THR THR A . n 
A 1 84  ARG 84  205 205 ARG ARG A . n 
A 1 85  VAL 85  206 206 VAL VAL A . n 
A 1 86  TYR 86  207 207 TYR TYR A . n 
A 1 87  LEU 87  208 208 LEU LEU A . n 
A 1 88  ILE 88  209 209 ILE ILE A . n 
A 1 89  LEU 89  210 210 LEU LEU A . n 
A 1 90  GLU 90  211 211 GLU GLU A . n 
A 1 91  TYR 91  212 212 TYR TYR A . n 
A 1 92  ALA 92  213 213 ALA ALA A . n 
A 1 93  PRO 93  214 214 PRO PRO A . n 
A 1 94  LEU 94  215 215 LEU LEU A . n 
A 1 95  GLY 95  216 216 GLY GLY A . n 
A 1 96  THR 96  217 217 THR THR A . n 
A 1 97  VAL 97  218 218 VAL VAL A . n 
A 1 98  TYR 98  219 219 TYR TYR A . n 
A 1 99  ARG 99  220 220 ARG ARG A . n 
A 1 100 GLU 100 221 221 GLU GLU A . n 
A 1 101 LEU 101 222 222 LEU LEU A . n 
A 1 102 GLN 102 223 223 GLN GLN A . n 
A 1 103 LYS 103 224 224 LYS LYS A . n 
A 1 104 LEU 104 225 225 LEU LEU A . n 
A 1 105 SER 105 226 226 SER SER A . n 
A 1 106 LYS 106 227 227 LYS LYS A . n 
A 1 107 PHE 107 228 228 PHE PHE A . n 
A 1 108 ASP 108 229 229 ASP ASP A . n 
A 1 109 GLU 109 230 230 GLU GLU A . n 
A 1 110 GLN 110 231 231 GLN GLN A . n 
A 1 111 ARG 111 232 232 ARG ARG A . n 
A 1 112 THR 112 233 233 THR THR A . n 
A 1 113 ALA 113 234 234 ALA ALA A . n 
A 1 114 THR 114 235 235 THR THR A . n 
A 1 115 TYR 115 236 236 TYR TYR A . n 
A 1 116 ILE 116 237 237 ILE ILE A . n 
A 1 117 THR 117 238 238 THR THR A . n 
A 1 118 GLU 118 239 239 GLU GLU A . n 
A 1 119 LEU 119 240 240 LEU LEU A . n 
A 1 120 ALA 120 241 241 ALA ALA A . n 
A 1 121 ASN 121 242 242 ASN ASN A . n 
A 1 122 ALA 122 243 243 ALA ALA A . n 
A 1 123 LEU 123 244 244 LEU LEU A . n 
A 1 124 SER 124 245 245 SER SER A . n 
A 1 125 TYR 125 246 246 TYR TYR A . n 
A 1 126 CYS 126 247 247 CYS CYS A . n 
A 1 127 HIS 127 248 248 HIS HIS A . n 
A 1 128 SER 128 249 249 SER SER A . n 
A 1 129 LYS 129 250 250 LYS LYS A . n 
A 1 130 ARG 130 251 251 ARG ARG A . n 
A 1 131 VAL 131 252 252 VAL VAL A . n 
A 1 132 ILE 132 253 253 ILE ILE A . n 
A 1 133 HIS 133 254 254 HIS HIS A . n 
A 1 134 ARG 134 255 255 ARG ARG A . n 
A 1 135 ASP 135 256 256 ASP ASP A . n 
A 1 136 ILE 136 257 257 ILE ILE A . n 
A 1 137 LYS 137 258 258 LYS LYS A . n 
A 1 138 PRO 138 259 259 PRO PRO A . n 
A 1 139 GLU 139 260 260 GLU GLU A . n 
A 1 140 ASN 140 261 261 ASN ASN A . n 
A 1 141 LEU 141 262 262 LEU LEU A . n 
A 1 142 LEU 142 263 263 LEU LEU A . n 
A 1 143 LEU 143 264 264 LEU LEU A . n 
A 1 144 GLY 144 265 265 GLY GLY A . n 
A 1 145 SER 145 266 266 SER SER A . n 
A 1 146 ALA 146 267 267 ALA ALA A . n 
A 1 147 GLY 147 268 268 GLY GLY A . n 
A 1 148 GLU 148 269 269 GLU GLU A . n 
A 1 149 LEU 149 270 270 LEU LEU A . n 
A 1 150 LYS 150 271 271 LYS LYS A . n 
A 1 151 ILE 151 272 272 ILE ILE A . n 
A 1 152 ALA 152 273 273 ALA ALA A . n 
A 1 153 ASP 153 274 274 ASP ASP A . n 
A 1 154 PHE 154 275 275 PHE PHE A . n 
A 1 155 GLY 155 276 276 GLY GLY A . n 
A 1 156 TRP 156 277 277 TRP TRP A . n 
A 1 157 SER 157 278 278 SER SER A . n 
A 1 158 VAL 158 279 279 VAL VAL A . n 
A 1 159 HIS 159 280 280 HIS HIS A . n 
A 1 160 ALA 160 281 281 ALA ALA A . n 
A 1 161 PRO 161 282 282 PRO PRO A . n 
A 1 162 SER 162 283 283 SER SER A . n 
A 1 163 SER 163 284 284 SER SER A . n 
A 1 164 ARG 164 285 285 ARG ARG A . n 
A 1 165 ARG 165 286 286 ARG ARG A . n 
A 1 166 THR 166 287 287 THR THR A . n 
A 1 167 THR 167 288 288 THR THR A . n 
A 1 168 LEU 168 289 289 LEU LEU A . n 
A 1 169 CYS 169 290 290 CYS CYS A . n 
A 1 170 GLY 170 291 291 GLY GLY A . n 
A 1 171 THR 171 292 292 THR THR A . n 
A 1 172 LEU 172 293 293 LEU LEU A . n 
A 1 173 ASP 173 294 294 ASP ASP A . n 
A 1 174 TYR 174 295 295 TYR TYR A . n 
A 1 175 LEU 175 296 296 LEU LEU A . n 
A 1 176 PRO 176 297 297 PRO PRO A . n 
A 1 177 PRO 177 298 298 PRO PRO A . n 
A 1 178 GLU 178 299 299 GLU GLU A . n 
A 1 179 MET 179 300 300 MET MET A . n 
A 1 180 ILE 180 301 301 ILE ILE A . n 
A 1 181 GLU 181 302 302 GLU GLU A . n 
A 1 182 GLY 182 303 303 GLY GLY A . n 
A 1 183 ARG 183 304 304 ARG ARG A . n 
A 1 184 MET 184 305 305 MET MET A . n 
A 1 185 HIS 185 306 306 HIS HIS A . n 
A 1 186 ASP 186 307 307 ASP ASP A . n 
A 1 187 GLU 187 308 308 GLU GLU A . n 
A 1 188 LYS 188 309 309 LYS LYS A . n 
A 1 189 VAL 189 310 310 VAL VAL A . n 
A 1 190 ASP 190 311 311 ASP ASP A . n 
A 1 191 LEU 191 312 312 LEU LEU A . n 
A 1 192 TRP 192 313 313 TRP TRP A . n 
A 1 193 SER 193 314 314 SER SER A . n 
A 1 194 LEU 194 315 315 LEU LEU A . n 
A 1 195 GLY 195 316 316 GLY GLY A . n 
A 1 196 VAL 196 317 317 VAL VAL A . n 
A 1 197 LEU 197 318 318 LEU LEU A . n 
A 1 198 CYS 198 319 319 CYS CYS A . n 
A 1 199 TYR 199 320 320 TYR TYR A . n 
A 1 200 GLU 200 321 321 GLU GLU A . n 
A 1 201 PHE 201 322 322 PHE PHE A . n 
A 1 202 LEU 202 323 323 LEU LEU A . n 
A 1 203 VAL 203 324 324 VAL VAL A . n 
A 1 204 GLY 204 325 325 GLY GLY A . n 
A 1 205 LYS 205 326 326 LYS LYS A . n 
A 1 206 PRO 206 327 327 PRO PRO A . n 
A 1 207 PRO 207 328 328 PRO PRO A . n 
A 1 208 PHE 208 329 329 PHE PHE A . n 
A 1 209 GLU 209 330 330 GLU GLU A . n 
A 1 210 ALA 210 331 331 ALA ALA A . n 
A 1 211 ASN 211 332 332 ASN ASN A . n 
A 1 212 THR 212 333 333 THR THR A . n 
A 1 213 TYR 213 334 334 TYR TYR A . n 
A 1 214 GLN 214 335 335 GLN GLN A . n 
A 1 215 GLU 215 336 336 GLU GLU A . n 
A 1 216 THR 216 337 337 THR THR A . n 
A 1 217 TYR 217 338 338 TYR TYR A . n 
A 1 218 LYS 218 339 339 LYS LYS A . n 
A 1 219 ARG 219 340 340 ARG ARG A . n 
A 1 220 ILE 220 341 341 ILE ILE A . n 
A 1 221 SER 221 342 342 SER SER A . n 
A 1 222 ARG 222 343 343 ARG ARG A . n 
A 1 223 VAL 223 344 344 VAL VAL A . n 
A 1 224 GLU 224 345 345 GLU GLU A . n 
A 1 225 PHE 225 346 346 PHE PHE A . n 
A 1 226 THR 226 347 347 THR THR A . n 
A 1 227 PHE 227 348 348 PHE PHE A . n 
A 1 228 PRO 228 349 349 PRO PRO A . n 
A 1 229 ASP 229 350 350 ASP ASP A . n 
A 1 230 PHE 230 351 351 PHE PHE A . n 
A 1 231 VAL 231 352 352 VAL VAL A . n 
A 1 232 THR 232 353 353 THR THR A . n 
A 1 233 GLU 233 354 354 GLU GLU A . n 
A 1 234 GLY 234 355 355 GLY GLY A . n 
A 1 235 ALA 235 356 356 ALA ALA A . n 
A 1 236 ARG 236 357 357 ARG ARG A . n 
A 1 237 ASP 237 358 358 ASP ASP A . n 
A 1 238 LEU 238 359 359 LEU LEU A . n 
A 1 239 ILE 239 360 360 ILE ILE A . n 
A 1 240 SER 240 361 361 SER SER A . n 
A 1 241 ARG 241 362 362 ARG ARG A . n 
A 1 242 LEU 242 363 363 LEU LEU A . n 
A 1 243 LEU 243 364 364 LEU LEU A . n 
A 1 244 LYS 244 365 365 LYS LYS A . n 
A 1 245 HIS 245 366 366 HIS HIS A . n 
A 1 246 ASN 246 367 367 ASN ASN A . n 
A 1 247 PRO 247 368 368 PRO PRO A . n 
A 1 248 SER 248 369 369 SER SER A . n 
A 1 249 GLN 249 370 370 GLN GLN A . n 
A 1 250 ARG 250 371 371 ARG ARG A . n 
A 1 251 PRO 251 372 372 PRO PRO A . n 
A 1 252 MET 252 373 373 MET MET A . n 
A 1 253 LEU 253 374 374 LEU LEU A . n 
A 1 254 ARG 254 375 375 ARG ARG A . n 
A 1 255 GLU 255 376 376 GLU GLU A . n 
A 1 256 VAL 256 377 377 VAL VAL A . n 
A 1 257 LEU 257 378 378 LEU LEU A . n 
A 1 258 GLU 258 379 379 GLU GLU A . n 
A 1 259 HIS 259 380 380 HIS HIS A . n 
A 1 260 PRO 260 381 381 PRO PRO A . n 
A 1 261 TRP 261 382 382 TRP TRP A . n 
A 1 262 ILE 262 383 383 ILE ILE A . n 
A 1 263 THR 263 384 384 THR THR A . n 
A 1 264 ALA 264 385 385 ALA ALA A . n 
A 1 265 ASN 265 386 386 ASN ASN A . n 
A 1 266 SER 266 387 387 SER SER A . n 
A 1 267 SER 267 388 388 SER SER A . n 
A 1 268 LYS 268 389 ?   ?   ?   A . n 
A 1 269 PRO 269 390 ?   ?   ?   A . n 
A 1 270 SER 270 391 ?   ?   ?   A . n 
A 1 271 ASN 271 392 ?   ?   ?   A . n 
A 1 272 CYS 272 393 ?   ?   ?   A . n 
A 1 273 GLN 273 394 ?   ?   ?   A . n 
A 1 274 ASN 274 395 ?   ?   ?   A . n 
A 1 275 LYS 275 396 ?   ?   ?   A . n 
A 1 276 GLU 276 397 ?   ?   ?   A . n 
A 1 277 SER 277 398 ?   ?   ?   A . n 
A 1 278 ALA 278 399 ?   ?   ?   A . n 
A 1 279 SER 279 400 ?   ?   ?   A . n 
A 1 280 LYS 280 401 ?   ?   ?   A . n 
A 1 281 GLN 281 402 ?   ?   ?   A . n 
A 1 282 SER 282 403 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   SER 2   2   ?   ?   ?   B . n 
B 2 3   GLN 3   3   ?   ?   ?   B . n 
B 2 4   VAL 4   4   ?   ?   ?   B . n 
B 2 5   LYS 5   5   ?   ?   ?   B . n 
B 2 6   SER 6   6   6   SER SER B . n 
B 2 7   SER 7   7   7   SER SER B . n 
B 2 8   TYR 8   8   8   TYR TYR B . n 
B 2 9   SER 9   9   9   SER SER B . n 
B 2 10  TYR 10  10  10  TYR TYR B . n 
B 2 11  ASP 11  11  11  ASP ASP B . n 
B 2 12  ALA 12  12  12  ALA ALA B . n 
B 2 13  PRO 13  13  13  PRO PRO B . n 
B 2 14  SER 14  14  14  SER SER B . n 
B 2 15  ASP 15  15  15  ASP ASP B . n 
B 2 16  PHE 16  16  16  PHE PHE B . n 
B 2 17  ILE 17  17  17  ILE ILE B . n 
B 2 18  ASN 18  18  18  ASN ASN B . n 
B 2 19  PHE 19  19  19  PHE PHE B . n 
B 2 20  SER 20  20  20  SER SER B . n 
B 2 21  SER 21  21  21  SER SER B . n 
B 2 22  LEU 22  22  22  LEU LEU B . n 
B 2 23  ASP 23  23  ?   ?   ?   B . n 
B 2 24  ASP 24  24  ?   ?   ?   B . n 
B 2 25  GLU 25  25  ?   ?   ?   B . n 
B 2 26  GLY 26  26  ?   ?   ?   B . n 
B 2 27  ASP 27  27  ?   ?   ?   B . n 
B 2 28  THR 28  28  ?   ?   ?   B . n 
B 2 29  GLN 29  29  ?   ?   ?   B . n 
B 2 30  ASN 30  30  ?   ?   ?   B . n 
B 2 31  ILE 31  31  ?   ?   ?   B . n 
B 2 32  ASP 32  32  ?   ?   ?   B . n 
B 2 33  SER 33  33  ?   ?   ?   B . n 
B 2 34  TRP 34  34  ?   ?   ?   B . n 
B 2 35  PHE 35  35  ?   ?   ?   B . n 
B 2 36  GLU 36  36  ?   ?   ?   B . n 
B 2 37  GLU 37  37  ?   ?   ?   B . n 
B 2 38  LYS 38  38  ?   ?   ?   B . n 
B 2 39  ALA 39  39  ?   ?   ?   B . n 
B 2 40  ASN 40  40  ?   ?   ?   B . n 
B 2 41  LEU 41  41  ?   ?   ?   B . n 
B 2 42  GLU 42  42  ?   ?   ?   B . n 
B 2 43  ASN 43  43  ?   ?   ?   B . n 
C 1 1   GLU 1   122 ?   ?   ?   D . n 
C 1 2   SER 2   123 ?   ?   ?   D . n 
C 1 3   LYS 3   124 ?   ?   ?   D . n 
C 1 4   LYS 4   125 125 LYS LYS D . n 
C 1 5   ARG 5   126 126 ARG ARG D . n 
C 1 6   GLN 6   127 127 GLN GLN D . n 
C 1 7   TRP 7   128 128 TRP TRP D . n 
C 1 8   ALA 8   129 129 ALA ALA D . n 
C 1 9   LEU 9   130 130 LEU LEU D . n 
C 1 10  GLU 10  131 131 GLU GLU D . n 
C 1 11  ASP 11  132 132 ASP ASP D . n 
C 1 12  PHE 12  133 133 PHE PHE D . n 
C 1 13  GLU 13  134 134 GLU GLU D . n 
C 1 14  ILE 14  135 135 ILE ILE D . n 
C 1 15  GLY 15  136 136 GLY GLY D . n 
C 1 16  ARG 16  137 137 ARG ARG D . n 
C 1 17  PRO 17  138 138 PRO PRO D . n 
C 1 18  LEU 18  139 139 LEU LEU D . n 
C 1 19  GLY 19  140 140 GLY GLY D . n 
C 1 20  LYS 20  141 141 LYS LYS D . n 
C 1 21  GLY 21  142 142 GLY GLY D . n 
C 1 22  LYS 22  143 143 LYS LYS D . n 
C 1 23  PHE 23  144 144 PHE PHE D . n 
C 1 24  GLY 24  145 145 GLY GLY D . n 
C 1 25  ASN 25  146 146 ASN ASN D . n 
C 1 26  VAL 26  147 147 VAL VAL D . n 
C 1 27  TYR 27  148 148 TYR TYR D . n 
C 1 28  LEU 28  149 149 LEU LEU D . n 
C 1 29  ALA 29  150 150 ALA ALA D . n 
C 1 30  ARG 30  151 151 ARG ARG D . n 
C 1 31  GLU 31  152 152 GLU GLU D . n 
C 1 32  LYS 32  153 153 LYS LYS D . n 
C 1 33  GLN 33  154 154 GLN GLN D . n 
C 1 34  SER 34  155 155 SER SER D . n 
C 1 35  LYS 35  156 156 LYS LYS D . n 
C 1 36  PHE 36  157 157 PHE PHE D . n 
C 1 37  ILE 37  158 158 ILE ILE D . n 
C 1 38  LEU 38  159 159 LEU LEU D . n 
C 1 39  ALA 39  160 160 ALA ALA D . n 
C 1 40  LEU 40  161 161 LEU LEU D . n 
C 1 41  LYS 41  162 162 LYS LYS D . n 
C 1 42  VAL 42  163 163 VAL VAL D . n 
C 1 43  LEU 43  164 164 LEU LEU D . n 
C 1 44  PHE 44  165 165 PHE PHE D . n 
C 1 45  LYS 45  166 166 LYS LYS D . n 
C 1 46  ALA 46  167 167 ALA ALA D . n 
C 1 47  GLN 47  168 168 GLN GLN D . n 
C 1 48  LEU 48  169 169 LEU LEU D . n 
C 1 49  GLU 49  170 170 GLU GLU D . n 
C 1 50  LYS 50  171 171 LYS LYS D . n 
C 1 51  ALA 51  172 172 ALA ALA D . n 
C 1 52  GLY 52  173 173 GLY GLY D . n 
C 1 53  VAL 53  174 174 VAL VAL D . n 
C 1 54  GLU 54  175 175 GLU GLU D . n 
C 1 55  HIS 55  176 176 HIS HIS D . n 
C 1 56  GLN 56  177 177 GLN GLN D . n 
C 1 57  LEU 57  178 178 LEU LEU D . n 
C 1 58  ARG 58  179 179 ARG ARG D . n 
C 1 59  ARG 59  180 180 ARG ARG D . n 
C 1 60  GLU 60  181 181 GLU GLU D . n 
C 1 61  VAL 61  182 182 VAL VAL D . n 
C 1 62  GLU 62  183 183 GLU GLU D . n 
C 1 63  ILE 63  184 184 ILE ILE D . n 
C 1 64  GLN 64  185 185 GLN GLN D . n 
C 1 65  SER 65  186 186 SER SER D . n 
C 1 66  HIS 66  187 187 HIS HIS D . n 
C 1 67  LEU 67  188 188 LEU LEU D . n 
C 1 68  ARG 68  189 189 ARG ARG D . n 
C 1 69  HIS 69  190 190 HIS HIS D . n 
C 1 70  PRO 70  191 191 PRO PRO D . n 
C 1 71  ASN 71  192 192 ASN ASN D . n 
C 1 72  ILE 72  193 193 ILE ILE D . n 
C 1 73  LEU 73  194 194 LEU LEU D . n 
C 1 74  ARG 74  195 195 ARG ARG D . n 
C 1 75  LEU 75  196 196 LEU LEU D . n 
C 1 76  TYR 76  197 197 TYR TYR D . n 
C 1 77  GLY 77  198 198 GLY GLY D . n 
C 1 78  TYR 78  199 199 TYR TYR D . n 
C 1 79  PHE 79  200 200 PHE PHE D . n 
C 1 80  HIS 80  201 201 HIS HIS D . n 
C 1 81  ASP 81  202 202 ASP ASP D . n 
C 1 82  ALA 82  203 203 ALA ALA D . n 
C 1 83  THR 83  204 204 THR THR D . n 
C 1 84  ARG 84  205 205 ARG ARG D . n 
C 1 85  VAL 85  206 206 VAL VAL D . n 
C 1 86  TYR 86  207 207 TYR TYR D . n 
C 1 87  LEU 87  208 208 LEU LEU D . n 
C 1 88  ILE 88  209 209 ILE ILE D . n 
C 1 89  LEU 89  210 210 LEU LEU D . n 
C 1 90  GLU 90  211 211 GLU GLU D . n 
C 1 91  TYR 91  212 212 TYR TYR D . n 
C 1 92  ALA 92  213 213 ALA ALA D . n 
C 1 93  PRO 93  214 214 PRO PRO D . n 
C 1 94  LEU 94  215 215 LEU LEU D . n 
C 1 95  GLY 95  216 216 GLY GLY D . n 
C 1 96  THR 96  217 217 THR THR D . n 
C 1 97  VAL 97  218 218 VAL VAL D . n 
C 1 98  TYR 98  219 219 TYR TYR D . n 
C 1 99  ARG 99  220 220 ARG ARG D . n 
C 1 100 GLU 100 221 221 GLU GLU D . n 
C 1 101 LEU 101 222 222 LEU LEU D . n 
C 1 102 GLN 102 223 223 GLN GLN D . n 
C 1 103 LYS 103 224 224 LYS LYS D . n 
C 1 104 LEU 104 225 225 LEU LEU D . n 
C 1 105 SER 105 226 226 SER SER D . n 
C 1 106 LYS 106 227 227 LYS LYS D . n 
C 1 107 PHE 107 228 228 PHE PHE D . n 
C 1 108 ASP 108 229 229 ASP ASP D . n 
C 1 109 GLU 109 230 230 GLU GLU D . n 
C 1 110 GLN 110 231 231 GLN GLN D . n 
C 1 111 ARG 111 232 232 ARG ARG D . n 
C 1 112 THR 112 233 233 THR THR D . n 
C 1 113 ALA 113 234 234 ALA ALA D . n 
C 1 114 THR 114 235 235 THR THR D . n 
C 1 115 TYR 115 236 236 TYR TYR D . n 
C 1 116 ILE 116 237 237 ILE ILE D . n 
C 1 117 THR 117 238 238 THR THR D . n 
C 1 118 GLU 118 239 239 GLU GLU D . n 
C 1 119 LEU 119 240 240 LEU LEU D . n 
C 1 120 ALA 120 241 241 ALA ALA D . n 
C 1 121 ASN 121 242 242 ASN ASN D . n 
C 1 122 ALA 122 243 243 ALA ALA D . n 
C 1 123 LEU 123 244 244 LEU LEU D . n 
C 1 124 SER 124 245 245 SER SER D . n 
C 1 125 TYR 125 246 246 TYR TYR D . n 
C 1 126 CYS 126 247 247 CYS CYS D . n 
C 1 127 HIS 127 248 248 HIS HIS D . n 
C 1 128 SER 128 249 249 SER SER D . n 
C 1 129 LYS 129 250 250 LYS LYS D . n 
C 1 130 ARG 130 251 251 ARG ARG D . n 
C 1 131 VAL 131 252 252 VAL VAL D . n 
C 1 132 ILE 132 253 253 ILE ILE D . n 
C 1 133 HIS 133 254 254 HIS HIS D . n 
C 1 134 ARG 134 255 255 ARG ARG D . n 
C 1 135 ASP 135 256 256 ASP ASP D . n 
C 1 136 ILE 136 257 257 ILE ILE D . n 
C 1 137 LYS 137 258 258 LYS LYS D . n 
C 1 138 PRO 138 259 259 PRO PRO D . n 
C 1 139 GLU 139 260 260 GLU GLU D . n 
C 1 140 ASN 140 261 261 ASN ASN D . n 
C 1 141 LEU 141 262 262 LEU LEU D . n 
C 1 142 LEU 142 263 263 LEU LEU D . n 
C 1 143 LEU 143 264 264 LEU LEU D . n 
C 1 144 GLY 144 265 265 GLY GLY D . n 
C 1 145 SER 145 266 266 SER SER D . n 
C 1 146 ALA 146 267 267 ALA ALA D . n 
C 1 147 GLY 147 268 268 GLY GLY D . n 
C 1 148 GLU 148 269 269 GLU GLU D . n 
C 1 149 LEU 149 270 270 LEU LEU D . n 
C 1 150 LYS 150 271 271 LYS LYS D . n 
C 1 151 ILE 151 272 272 ILE ILE D . n 
C 1 152 ALA 152 273 273 ALA ALA D . n 
C 1 153 ASP 153 274 274 ASP ASP D . n 
C 1 154 PHE 154 275 275 PHE PHE D . n 
C 1 155 GLY 155 276 276 GLY GLY D . n 
C 1 156 TRP 156 277 277 TRP TRP D . n 
C 1 157 SER 157 278 278 SER SER D . n 
C 1 158 VAL 158 279 279 VAL VAL D . n 
C 1 159 HIS 159 280 280 HIS HIS D . n 
C 1 160 ALA 160 281 281 ALA ALA D . n 
C 1 161 PRO 161 282 282 PRO PRO D . n 
C 1 162 SER 162 283 ?   ?   ?   D . n 
C 1 163 SER 163 284 ?   ?   ?   D . n 
C 1 164 ARG 164 285 ?   ?   ?   D . n 
C 1 165 ARG 165 286 ?   ?   ?   D . n 
C 1 166 THR 166 287 ?   ?   ?   D . n 
C 1 167 THR 167 288 ?   ?   ?   D . n 
C 1 168 LEU 168 289 289 LEU LEU D . n 
C 1 169 CYS 169 290 290 CYS CYS D . n 
C 1 170 GLY 170 291 291 GLY GLY D . n 
C 1 171 THR 171 292 292 THR THR D . n 
C 1 172 LEU 172 293 293 LEU LEU D . n 
C 1 173 ASP 173 294 294 ASP ASP D . n 
C 1 174 TYR 174 295 295 TYR TYR D . n 
C 1 175 LEU 175 296 296 LEU LEU D . n 
C 1 176 PRO 176 297 297 PRO PRO D . n 
C 1 177 PRO 177 298 298 PRO PRO D . n 
C 1 178 GLU 178 299 299 GLU GLU D . n 
C 1 179 MET 179 300 300 MET MET D . n 
C 1 180 ILE 180 301 301 ILE ILE D . n 
C 1 181 GLU 181 302 302 GLU GLU D . n 
C 1 182 GLY 182 303 303 GLY GLY D . n 
C 1 183 ARG 183 304 304 ARG ARG D . n 
C 1 184 MET 184 305 305 MET MET D . n 
C 1 185 HIS 185 306 306 HIS HIS D . n 
C 1 186 ASP 186 307 307 ASP ASP D . n 
C 1 187 GLU 187 308 308 GLU GLU D . n 
C 1 188 LYS 188 309 309 LYS LYS D . n 
C 1 189 VAL 189 310 310 VAL VAL D . n 
C 1 190 ASP 190 311 311 ASP ASP D . n 
C 1 191 LEU 191 312 312 LEU LEU D . n 
C 1 192 TRP 192 313 313 TRP TRP D . n 
C 1 193 SER 193 314 314 SER SER D . n 
C 1 194 LEU 194 315 315 LEU LEU D . n 
C 1 195 GLY 195 316 316 GLY GLY D . n 
C 1 196 VAL 196 317 317 VAL VAL D . n 
C 1 197 LEU 197 318 318 LEU LEU D . n 
C 1 198 CYS 198 319 319 CYS CYS D . n 
C 1 199 TYR 199 320 320 TYR TYR D . n 
C 1 200 GLU 200 321 321 GLU GLU D . n 
C 1 201 PHE 201 322 322 PHE PHE D . n 
C 1 202 LEU 202 323 323 LEU LEU D . n 
C 1 203 VAL 203 324 324 VAL VAL D . n 
C 1 204 GLY 204 325 325 GLY GLY D . n 
C 1 205 LYS 205 326 326 LYS LYS D . n 
C 1 206 PRO 206 327 327 PRO PRO D . n 
C 1 207 PRO 207 328 328 PRO PRO D . n 
C 1 208 PHE 208 329 329 PHE PHE D . n 
C 1 209 GLU 209 330 330 GLU GLU D . n 
C 1 210 ALA 210 331 331 ALA ALA D . n 
C 1 211 ASN 211 332 332 ASN ASN D . n 
C 1 212 THR 212 333 333 THR THR D . n 
C 1 213 TYR 213 334 334 TYR TYR D . n 
C 1 214 GLN 214 335 335 GLN GLN D . n 
C 1 215 GLU 215 336 336 GLU GLU D . n 
C 1 216 THR 216 337 337 THR THR D . n 
C 1 217 TYR 217 338 338 TYR TYR D . n 
C 1 218 LYS 218 339 339 LYS LYS D . n 
C 1 219 ARG 219 340 340 ARG ARG D . n 
C 1 220 ILE 220 341 341 ILE ILE D . n 
C 1 221 SER 221 342 342 SER SER D . n 
C 1 222 ARG 222 343 343 ARG ARG D . n 
C 1 223 VAL 223 344 344 VAL VAL D . n 
C 1 224 GLU 224 345 345 GLU GLU D . n 
C 1 225 PHE 225 346 346 PHE PHE D . n 
C 1 226 THR 226 347 347 THR THR D . n 
C 1 227 PHE 227 348 348 PHE PHE D . n 
C 1 228 PRO 228 349 349 PRO PRO D . n 
C 1 229 ASP 229 350 350 ASP ASP D . n 
C 1 230 PHE 230 351 351 PHE PHE D . n 
C 1 231 VAL 231 352 352 VAL VAL D . n 
C 1 232 THR 232 353 353 THR THR D . n 
C 1 233 GLU 233 354 354 GLU GLU D . n 
C 1 234 GLY 234 355 355 GLY GLY D . n 
C 1 235 ALA 235 356 356 ALA ALA D . n 
C 1 236 ARG 236 357 357 ARG ARG D . n 
C 1 237 ASP 237 358 358 ASP ASP D . n 
C 1 238 LEU 238 359 359 LEU LEU D . n 
C 1 239 ILE 239 360 360 ILE ILE D . n 
C 1 240 SER 240 361 361 SER SER D . n 
C 1 241 ARG 241 362 362 ARG ARG D . n 
C 1 242 LEU 242 363 363 LEU LEU D . n 
C 1 243 LEU 243 364 364 LEU LEU D . n 
C 1 244 LYS 244 365 365 LYS LYS D . n 
C 1 245 HIS 245 366 366 HIS HIS D . n 
C 1 246 ASN 246 367 367 ASN ASN D . n 
C 1 247 PRO 247 368 368 PRO PRO D . n 
C 1 248 SER 248 369 369 SER SER D . n 
C 1 249 GLN 249 370 370 GLN GLN D . n 
C 1 250 ARG 250 371 371 ARG ARG D . n 
C 1 251 PRO 251 372 372 PRO PRO D . n 
C 1 252 MET 252 373 373 MET MET D . n 
C 1 253 LEU 253 374 374 LEU LEU D . n 
C 1 254 ARG 254 375 375 ARG ARG D . n 
C 1 255 GLU 255 376 376 GLU GLU D . n 
C 1 256 VAL 256 377 377 VAL VAL D . n 
C 1 257 LEU 257 378 378 LEU LEU D . n 
C 1 258 GLU 258 379 379 GLU GLU D . n 
C 1 259 HIS 259 380 380 HIS HIS D . n 
C 1 260 PRO 260 381 381 PRO PRO D . n 
C 1 261 TRP 261 382 382 TRP TRP D . n 
C 1 262 ILE 262 383 383 ILE ILE D . n 
C 1 263 THR 263 384 384 THR THR D . n 
C 1 264 ALA 264 385 385 ALA ALA D . n 
C 1 265 ASN 265 386 386 ASN ASN D . n 
C 1 266 SER 266 387 387 SER SER D . n 
C 1 267 SER 267 388 388 SER SER D . n 
C 1 268 LYS 268 389 389 LYS LYS D . n 
C 1 269 PRO 269 390 390 PRO PRO D . n 
C 1 270 SER 270 391 ?   ?   ?   D . n 
C 1 271 ASN 271 392 ?   ?   ?   D . n 
C 1 272 CYS 272 393 ?   ?   ?   D . n 
C 1 273 GLN 273 394 ?   ?   ?   D . n 
C 1 274 ASN 274 395 ?   ?   ?   D . n 
C 1 275 LYS 275 396 ?   ?   ?   D . n 
C 1 276 GLU 276 397 ?   ?   ?   D . n 
C 1 277 SER 277 398 ?   ?   ?   D . n 
C 1 278 ALA 278 399 ?   ?   ?   D . n 
C 1 279 SER 279 400 ?   ?   ?   D . n 
C 1 280 LYS 280 401 ?   ?   ?   D . n 
C 1 281 GLN 281 402 ?   ?   ?   D . n 
C 1 282 SER 282 403 ?   ?   ?   D . n 
D 2 1   MET 1   1   ?   ?   ?   E . n 
D 2 2   SER 2   2   ?   ?   ?   E . n 
D 2 3   GLN 3   3   ?   ?   ?   E . n 
D 2 4   VAL 4   4   4   VAL VAL E . n 
D 2 5   LYS 5   5   5   LYS LYS E . n 
D 2 6   SER 6   6   6   SER SER E . n 
D 2 7   SER 7   7   7   SER SER E . n 
D 2 8   TYR 8   8   8   TYR TYR E . n 
D 2 9   SER 9   9   9   SER SER E . n 
D 2 10  TYR 10  10  10  TYR TYR E . n 
D 2 11  ASP 11  11  11  ASP ASP E . n 
D 2 12  ALA 12  12  12  ALA ALA E . n 
D 2 13  PRO 13  13  13  PRO PRO E . n 
D 2 14  SER 14  14  14  SER SER E . n 
D 2 15  ASP 15  15  15  ASP ASP E . n 
D 2 16  PHE 16  16  16  PHE PHE E . n 
D 2 17  ILE 17  17  17  ILE ILE E . n 
D 2 18  ASN 18  18  18  ASN ASN E . n 
D 2 19  PHE 19  19  19  PHE PHE E . n 
D 2 20  SER 20  20  20  SER SER E . n 
D 2 21  SER 21  21  ?   ?   ?   E . n 
D 2 22  LEU 22  22  ?   ?   ?   E . n 
D 2 23  ASP 23  23  ?   ?   ?   E . n 
D 2 24  ASP 24  24  ?   ?   ?   E . n 
D 2 25  GLU 25  25  ?   ?   ?   E . n 
D 2 26  GLY 26  26  ?   ?   ?   E . n 
D 2 27  ASP 27  27  ?   ?   ?   E . n 
D 2 28  THR 28  28  ?   ?   ?   E . n 
D 2 29  GLN 29  29  ?   ?   ?   E . n 
D 2 30  ASN 30  30  ?   ?   ?   E . n 
D 2 31  ILE 31  31  ?   ?   ?   E . n 
D 2 32  ASP 32  32  ?   ?   ?   E . n 
D 2 33  SER 33  33  ?   ?   ?   E . n 
D 2 34  TRP 34  34  ?   ?   ?   E . n 
D 2 35  PHE 35  35  ?   ?   ?   E . n 
D 2 36  GLU 36  36  ?   ?   ?   E . n 
D 2 37  GLU 37  37  ?   ?   ?   E . n 
D 2 38  LYS 38  38  ?   ?   ?   E . n 
D 2 39  ALA 39  39  ?   ?   ?   E . n 
D 2 40  ASN 40  40  ?   ?   ?   E . n 
D 2 41  LEU 41  41  ?   ?   ?   E . n 
D 2 42  GLU 42  42  ?   ?   ?   E . n 
D 2 43  ASN 43  43  ?   ?   ?   E . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 ACP 1  1389 1389 ACP ACP A . 
F 3 ACP 1  1391 1391 ACP ACP D . 
G 4 SO4 1  1392 1392 SO4 SO4 D . 
H 5 HOH 1  2001 2001 HOH HOH A . 
H 5 HOH 2  2002 2002 HOH HOH A . 
H 5 HOH 3  2003 2003 HOH HOH A . 
H 5 HOH 4  2004 2004 HOH HOH A . 
H 5 HOH 5  2005 2005 HOH HOH A . 
H 5 HOH 6  2006 2006 HOH HOH A . 
H 5 HOH 7  2007 2007 HOH HOH A . 
H 5 HOH 8  2008 2008 HOH HOH A . 
H 5 HOH 9  2009 2009 HOH HOH A . 
H 5 HOH 10 2010 2010 HOH HOH A . 
H 5 HOH 11 2011 2011 HOH HOH A . 
H 5 HOH 12 2012 2012 HOH HOH A . 
H 5 HOH 13 2013 2013 HOH HOH A . 
I 5 HOH 1  2001 2001 HOH HOH B . 
I 5 HOH 2  2002 2002 HOH HOH B . 
I 5 HOH 3  2003 2003 HOH HOH B . 
J 5 HOH 1  2001 2001 HOH HOH D . 
J 5 HOH 2  2002 2002 HOH HOH D . 
J 5 HOH 3  2003 2003 HOH HOH D . 
J 5 HOH 4  2004 2004 HOH HOH D . 
J 5 HOH 5  2005 2005 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10200 ? 
1 MORE         -56.4 ? 
1 'SSA (A^2)'  25930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-05-28 
2 'Structure model' 1 1 2014-06-11 
3 'Structure model' 1 2 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Data collection'          
3 3 'Structure model' 'Experimental preparation' 
4 3 'Structure model' Other                      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_PDB_rev        
2 3 'Structure model' database_PDB_rev_record 
3 3 'Structure model' exptl_crystal_grow      
4 3 'Structure model' pdbx_database_proc      
5 3 'Structure model' pdbx_database_status    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.method'                  
2 3 'Structure model' '_exptl_crystal_grow.temp'                    
3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC  refinement       5.7.0029 ? 1 ? ? ? ? 
iMOSFLM 'data reduction' .        ? 2 ? ? ? ? 
SCALA   'data scaling'   .        ? 3 ? ? ? ? 
MOLREP  phasing          .        ? 4 ? ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 126 ? ? -105.28 -72.25  
2  1 ASP A 202 ? ? -123.72 -163.96 
3  1 SER A 226 ? ? 72.31   -56.60  
4  1 LYS A 250 ? ? -97.80  31.74   
5  1 ARG A 255 ? ? -121.39 -68.05  
6  1 ALA A 273 ? ? -143.16 44.14   
7  1 ASP A 274 ? ? -117.33 -72.70  
8  1 GLU A 308 ? ? -29.80  -51.29  
9  1 PRO A 372 ? ? -60.96  -167.95 
10 1 ASP B 11  ? ? -68.65  64.76   
11 1 LYS D 141 ? ? -85.63  -94.91  
12 1 ASP D 202 ? ? -104.00 -168.40 
13 1 SER D 226 ? ? 78.89   -59.46  
14 1 SER D 249 ? ? -56.69  -8.94   
15 1 ARG D 255 ? ? 71.55   -101.13 
16 1 PHE D 275 ? ? -144.29 22.56   
17 1 CYS D 290 ? ? -140.51 -146.18 
18 1 THR D 292 ? ? -140.30 13.24   
19 1 MET D 305 ? ? 59.11   14.91   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 122 ? A GLU 1   
2  1 Y 1 A SER 123 ? A SER 2   
3  1 Y 1 A LYS 124 ? A LYS 3   
4  1 Y 1 A LYS 389 ? A LYS 268 
5  1 Y 1 A PRO 390 ? A PRO 269 
6  1 Y 1 A SER 391 ? A SER 270 
7  1 Y 1 A ASN 392 ? A ASN 271 
8  1 Y 1 A CYS 393 ? A CYS 272 
9  1 Y 1 A GLN 394 ? A GLN 273 
10 1 Y 1 A ASN 395 ? A ASN 274 
11 1 Y 1 A LYS 396 ? A LYS 275 
12 1 Y 1 A GLU 397 ? A GLU 276 
13 1 Y 1 A SER 398 ? A SER 277 
14 1 Y 1 A ALA 399 ? A ALA 278 
15 1 Y 1 A SER 400 ? A SER 279 
16 1 Y 1 A LYS 401 ? A LYS 280 
17 1 Y 1 A GLN 402 ? A GLN 281 
18 1 Y 1 A SER 403 ? A SER 282 
19 1 Y 1 B MET 1   ? B MET 1   
20 1 Y 1 B SER 2   ? B SER 2   
21 1 Y 1 B GLN 3   ? B GLN 3   
22 1 Y 1 B VAL 4   ? B VAL 4   
23 1 Y 1 B LYS 5   ? B LYS 5   
24 1 Y 1 B ASP 23  ? B ASP 23  
25 1 Y 1 B ASP 24  ? B ASP 24  
26 1 Y 1 B GLU 25  ? B GLU 25  
27 1 Y 1 B GLY 26  ? B GLY 26  
28 1 Y 1 B ASP 27  ? B ASP 27  
29 1 Y 1 B THR 28  ? B THR 28  
30 1 Y 1 B GLN 29  ? B GLN 29  
31 1 Y 1 B ASN 30  ? B ASN 30  
32 1 Y 1 B ILE 31  ? B ILE 31  
33 1 Y 1 B ASP 32  ? B ASP 32  
34 1 Y 1 B SER 33  ? B SER 33  
35 1 Y 1 B TRP 34  ? B TRP 34  
36 1 Y 1 B PHE 35  ? B PHE 35  
37 1 Y 1 B GLU 36  ? B GLU 36  
38 1 Y 1 B GLU 37  ? B GLU 37  
39 1 Y 1 B LYS 38  ? B LYS 38  
40 1 Y 1 B ALA 39  ? B ALA 39  
41 1 Y 1 B ASN 40  ? B ASN 40  
42 1 Y 1 B LEU 41  ? B LEU 41  
43 1 Y 1 B GLU 42  ? B GLU 42  
44 1 Y 1 B ASN 43  ? B ASN 43  
45 1 Y 1 D GLU 122 ? C GLU 1   
46 1 Y 1 D SER 123 ? C SER 2   
47 1 Y 1 D LYS 124 ? C LYS 3   
48 1 Y 1 D SER 283 ? C SER 162 
49 1 Y 1 D SER 284 ? C SER 163 
50 1 Y 1 D ARG 285 ? C ARG 164 
51 1 Y 1 D ARG 286 ? C ARG 165 
52 1 Y 1 D THR 287 ? C THR 166 
53 1 Y 1 D THR 288 ? C THR 167 
54 1 Y 1 D SER 391 ? C SER 270 
55 1 Y 1 D ASN 392 ? C ASN 271 
56 1 Y 1 D CYS 393 ? C CYS 272 
57 1 Y 1 D GLN 394 ? C GLN 273 
58 1 Y 1 D ASN 395 ? C ASN 274 
59 1 Y 1 D LYS 396 ? C LYS 275 
60 1 Y 1 D GLU 397 ? C GLU 276 
61 1 Y 1 D SER 398 ? C SER 277 
62 1 Y 1 D ALA 399 ? C ALA 278 
63 1 Y 1 D SER 400 ? C SER 279 
64 1 Y 1 D LYS 401 ? C LYS 280 
65 1 Y 1 D GLN 402 ? C GLN 281 
66 1 Y 1 D SER 403 ? C SER 282 
67 1 Y 1 E MET 1   ? D MET 1   
68 1 Y 1 E SER 2   ? D SER 2   
69 1 Y 1 E GLN 3   ? D GLN 3   
70 1 Y 1 E SER 21  ? D SER 21  
71 1 Y 1 E LEU 22  ? D LEU 22  
72 1 Y 1 E ASP 23  ? D ASP 23  
73 1 Y 1 E ASP 24  ? D ASP 24  
74 1 Y 1 E GLU 25  ? D GLU 25  
75 1 Y 1 E GLY 26  ? D GLY 26  
76 1 Y 1 E ASP 27  ? D ASP 27  
77 1 Y 1 E THR 28  ? D THR 28  
78 1 Y 1 E GLN 29  ? D GLN 29  
79 1 Y 1 E ASN 30  ? D ASN 30  
80 1 Y 1 E ILE 31  ? D ILE 31  
81 1 Y 1 E ASP 32  ? D ASP 32  
82 1 Y 1 E SER 33  ? D SER 33  
83 1 Y 1 E TRP 34  ? D TRP 34  
84 1 Y 1 E PHE 35  ? D PHE 35  
85 1 Y 1 E GLU 36  ? D GLU 36  
86 1 Y 1 E GLU 37  ? D GLU 37  
87 1 Y 1 E LYS 38  ? D LYS 38  
88 1 Y 1 E ALA 39  ? D ALA 39  
89 1 Y 1 E ASN 40  ? D ASN 40  
90 1 Y 1 E LEU 41  ? D LEU 41  
91 1 Y 1 E GLU 42  ? D GLU 42  
92 1 Y 1 E ASN 43  ? D ASN 43  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER' ACP 
4 'SULFATE ION'                                  SO4 
5 water                                          HOH 
#