data_4C6C
# 
_entry.id   4C6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4C6C         
PDBE  EBI-58404    
WWPDB D_1290058404 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4C6B unspecified 
'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD WITH INCOMPLETE ACTIVE SITE, OBTAINED RECOMBINANTLY FROM E. COLI.' 
PDB 4C6D unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 6.0' 
PDB 4C6E unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 5.5' 
PDB 4C6F unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 6.5' 
PDB 4C6I unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 7.0' 
PDB 4C6J unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 7.5' 
PDB 4C6K unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO SUBSTRATE AT PH 8.0' 
PDB 4C6L unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO THE INHIBITOR FLUOROOROTATE AT PH 6.0' 
PDB 4C6M unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD BOUND TO THE INHIBITOR FLUOROOROTATE AT PH 7.0' 
PDB 4C6N unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD E1637T MUTANT BOUND TO SUBSTRATE AT PH 6.0' 
PDB 4C6O unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD C1613S MUTANT IN APO-FORM AT PH 6.0' 
PDB 4C6P unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD C1613S MUTANT IN APO-FORM AT PH 7.0' 
PDB 4C6Q unspecified 'CRYSTAL STRUCTURE OF THE DIHYDROOROTASE DOMAIN OF HUMAN CAD C1613S MUTANT BOUND TO SUBSTRATE AT PH 7.0' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4C6C 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-09-18 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ramon-Maiques, S.' 1 
'Lallous, N.'       2 
'Grande-Garcia, A.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            22 
_citation.page_first                185 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24332717 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2013.10.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Grande-Garcia, A.' 1 
primary 'Lallous, N.'       2 
primary 'Diaz-Tejada, C.'   3 
primary 'Ramon-Maiques, S.' 4 
# 
_cell.entry_id           4C6C 
_cell.length_a           82.110 
_cell.length_b           158.800 
_cell.length_c           60.760 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4C6C 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CAD PROTEIN' 42916.020 1   3.4.2.3 ? 'RESIDUES 1456-1846' ? 
2 non-polymer syn 'ZINC ION'    65.409    4   ?       ? ?                    ? 
3 non-polymer syn 'FORMIC ACID' 46.025    4   ?       ? ?                    ? 
4 water       nat water         18.015    375 ?       ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        DIHYDROOROTASE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GPMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFAL
FLGASSENAGTLGTVAGSAAGL(KCX)LYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRS
VHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAP
HTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKA
HWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFAL
FLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHIC
HVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLE
EKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTP
FEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   MET n 
1 4   THR n 
1 5   SER n 
1 6   GLN n 
1 7   LYS n 
1 8   LEU n 
1 9   VAL n 
1 10  ARG n 
1 11  LEU n 
1 12  PRO n 
1 13  GLY n 
1 14  LEU n 
1 15  ILE n 
1 16  ASP n 
1 17  VAL n 
1 18  HIS n 
1 19  VAL n 
1 20  HIS n 
1 21  LEU n 
1 22  ARG n 
1 23  GLU n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  THR n 
1 28  HIS n 
1 29  LYS n 
1 30  GLU n 
1 31  ASP n 
1 32  PHE n 
1 33  ALA n 
1 34  SER n 
1 35  GLY n 
1 36  THR n 
1 37  ALA n 
1 38  ALA n 
1 39  ALA n 
1 40  LEU n 
1 41  ALA n 
1 42  GLY n 
1 43  GLY n 
1 44  ILE n 
1 45  THR n 
1 46  MET n 
1 47  VAL n 
1 48  CYS n 
1 49  ALA n 
1 50  MET n 
1 51  PRO n 
1 52  ASN n 
1 53  THR n 
1 54  ARG n 
1 55  PRO n 
1 56  PRO n 
1 57  ILE n 
1 58  ILE n 
1 59  ASP n 
1 60  ALA n 
1 61  PRO n 
1 62  ALA n 
1 63  LEU n 
1 64  ALA n 
1 65  LEU n 
1 66  ALA n 
1 67  GLN n 
1 68  LYS n 
1 69  LEU n 
1 70  ALA n 
1 71  GLU n 
1 72  ALA n 
1 73  GLY n 
1 74  ALA n 
1 75  ARG n 
1 76  CYS n 
1 77  ASP n 
1 78  PHE n 
1 79  ALA n 
1 80  LEU n 
1 81  PHE n 
1 82  LEU n 
1 83  GLY n 
1 84  ALA n 
1 85  SER n 
1 86  SER n 
1 87  GLU n 
1 88  ASN n 
1 89  ALA n 
1 90  GLY n 
1 91  THR n 
1 92  LEU n 
1 93  GLY n 
1 94  THR n 
1 95  VAL n 
1 96  ALA n 
1 97  GLY n 
1 98  SER n 
1 99  ALA n 
1 100 ALA n 
1 101 GLY n 
1 102 LEU n 
1 103 KCX n 
1 104 LEU n 
1 105 TYR n 
1 106 LEU n 
1 107 ASN n 
1 108 GLU n 
1 109 THR n 
1 110 PHE n 
1 111 SER n 
1 112 GLU n 
1 113 LEU n 
1 114 ARG n 
1 115 LEU n 
1 116 ASP n 
1 117 SER n 
1 118 VAL n 
1 119 VAL n 
1 120 GLN n 
1 121 TRP n 
1 122 MET n 
1 123 GLU n 
1 124 HIS n 
1 125 PHE n 
1 126 GLU n 
1 127 THR n 
1 128 TRP n 
1 129 PRO n 
1 130 SER n 
1 131 HIS n 
1 132 LEU n 
1 133 PRO n 
1 134 ILE n 
1 135 VAL n 
1 136 ALA n 
1 137 HIS n 
1 138 ALA n 
1 139 GLU n 
1 140 GLN n 
1 141 GLN n 
1 142 THR n 
1 143 VAL n 
1 144 ALA n 
1 145 ALA n 
1 146 VAL n 
1 147 LEU n 
1 148 MET n 
1 149 VAL n 
1 150 ALA n 
1 151 GLN n 
1 152 LEU n 
1 153 THR n 
1 154 GLN n 
1 155 ARG n 
1 156 SER n 
1 157 VAL n 
1 158 HIS n 
1 159 ILE n 
1 160 CYS n 
1 161 HIS n 
1 162 VAL n 
1 163 ALA n 
1 164 ARG n 
1 165 LYS n 
1 166 GLU n 
1 167 GLU n 
1 168 ILE n 
1 169 LEU n 
1 170 LEU n 
1 171 ILE n 
1 172 LYS n 
1 173 ALA n 
1 174 ALA n 
1 175 LYS n 
1 176 ALA n 
1 177 ARG n 
1 178 GLY n 
1 179 LEU n 
1 180 PRO n 
1 181 VAL n 
1 182 THR n 
1 183 CYS n 
1 184 GLU n 
1 185 VAL n 
1 186 ALA n 
1 187 PRO n 
1 188 HIS n 
1 189 HIS n 
1 190 LEU n 
1 191 PHE n 
1 192 LEU n 
1 193 SER n 
1 194 HIS n 
1 195 ASP n 
1 196 ASP n 
1 197 LEU n 
1 198 GLU n 
1 199 ARG n 
1 200 LEU n 
1 201 GLY n 
1 202 PRO n 
1 203 GLY n 
1 204 LYS n 
1 205 GLY n 
1 206 GLU n 
1 207 VAL n 
1 208 ARG n 
1 209 PRO n 
1 210 GLU n 
1 211 LEU n 
1 212 GLY n 
1 213 SER n 
1 214 ARG n 
1 215 GLN n 
1 216 ASP n 
1 217 VAL n 
1 218 GLU n 
1 219 ALA n 
1 220 LEU n 
1 221 TRP n 
1 222 GLU n 
1 223 ASN n 
1 224 MET n 
1 225 ALA n 
1 226 VAL n 
1 227 ILE n 
1 228 ASP n 
1 229 CYS n 
1 230 PHE n 
1 231 ALA n 
1 232 SER n 
1 233 ASP n 
1 234 HIS n 
1 235 ALA n 
1 236 PRO n 
1 237 HIS n 
1 238 THR n 
1 239 LEU n 
1 240 GLU n 
1 241 GLU n 
1 242 LYS n 
1 243 CYS n 
1 244 GLY n 
1 245 SER n 
1 246 ARG n 
1 247 PRO n 
1 248 PRO n 
1 249 PRO n 
1 250 GLY n 
1 251 PHE n 
1 252 PRO n 
1 253 GLY n 
1 254 LEU n 
1 255 GLU n 
1 256 THR n 
1 257 MET n 
1 258 LEU n 
1 259 PRO n 
1 260 LEU n 
1 261 LEU n 
1 262 LEU n 
1 263 THR n 
1 264 ALA n 
1 265 VAL n 
1 266 SER n 
1 267 GLU n 
1 268 GLY n 
1 269 ARG n 
1 270 LEU n 
1 271 SER n 
1 272 LEU n 
1 273 ASP n 
1 274 ASP n 
1 275 LEU n 
1 276 LEU n 
1 277 GLN n 
1 278 ARG n 
1 279 LEU n 
1 280 HIS n 
1 281 HIS n 
1 282 ASN n 
1 283 PRO n 
1 284 ARG n 
1 285 ARG n 
1 286 ILE n 
1 287 PHE n 
1 288 HIS n 
1 289 LEU n 
1 290 PRO n 
1 291 PRO n 
1 292 GLN n 
1 293 GLU n 
1 294 ASP n 
1 295 THR n 
1 296 TYR n 
1 297 VAL n 
1 298 GLU n 
1 299 VAL n 
1 300 ASP n 
1 301 LEU n 
1 302 GLU n 
1 303 HIS n 
1 304 GLU n 
1 305 TRP n 
1 306 THR n 
1 307 ILE n 
1 308 PRO n 
1 309 SER n 
1 310 HIS n 
1 311 MET n 
1 312 PRO n 
1 313 PHE n 
1 314 SER n 
1 315 LYS n 
1 316 ALA n 
1 317 HIS n 
1 318 TRP n 
1 319 THR n 
1 320 PRO n 
1 321 PHE n 
1 322 GLU n 
1 323 GLY n 
1 324 GLN n 
1 325 LYS n 
1 326 VAL n 
1 327 LYS n 
1 328 GLY n 
1 329 THR n 
1 330 VAL n 
1 331 ARG n 
1 332 ARG n 
1 333 VAL n 
1 334 VAL n 
1 335 LEU n 
1 336 ARG n 
1 337 GLY n 
1 338 GLU n 
1 339 VAL n 
1 340 ALA n 
1 341 TYR n 
1 342 ILE n 
1 343 ASP n 
1 344 GLY n 
1 345 GLN n 
1 346 VAL n 
1 347 LEU n 
1 348 VAL n 
1 349 PRO n 
1 350 PRO n 
1 351 GLY n 
1 352 TYR n 
1 353 GLY n 
1 354 GLN n 
1 355 ASP n 
1 356 VAL n 
1 357 ARG n 
1 358 LYS n 
1 359 TRP n 
1 360 PRO n 
1 361 GLN n 
1 362 GLY n 
1 363 ALA n 
1 364 VAL n 
1 365 PRO n 
1 366 GLN n 
1 367 LEU n 
1 368 PRO n 
1 369 PRO n 
1 370 SER n 
1 371 ALA n 
1 372 PRO n 
1 373 ALA n 
1 374 THR n 
1 375 SER n 
1 376 GLU n 
1 377 MET n 
1 378 THR n 
1 379 THR n 
1 380 THR n 
1 381 PRO n 
1 382 GLU n 
1 383 ARG n 
1 384 PRO n 
1 385 ARG n 
1 386 ARG n 
1 387 GLY n 
1 388 ILE n 
1 389 PRO n 
1 390 GLY n 
1 391 LEU n 
1 392 PRO n 
1 393 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               POPIN-M 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PYR1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P27708 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4C6C 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 393 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P27708 
_struct_ref_seq.db_align_beg                  1456 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1846 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1456 
_struct_ref_seq.pdbx_auth_seq_align_end       1846 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4C6C GLY A 1 ? UNP P27708 ? ? 'expression tag' 1454 1 
1 4C6C PRO A 2 ? UNP P27708 ? ? 'expression tag' 1455 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'               ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                       ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'    131.173 
KCX 'L-peptide linking' n 'LYSINE NZ-CARBOXYLIC ACID' ? 'C7 H14 N2 O4'   190.197 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'                  ? 'Zn 2'           65.409  
# 
_exptl.entry_id          4C6C 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   49 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-12-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4C6C 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.25 
_reflns.d_resolution_high            1.45 
_reflns.number_obs                   69725 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.20 
_reflns.B_iso_Wilson_estimate        13.56 
_reflns.pdbx_redundancy              9.5 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.45 
_reflns_shell.d_res_low              1.49 
_reflns_shell.percent_possible_all   90.6 
_reflns_shell.Rmerge_I_obs           0.58 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.20 
_reflns_shell.pdbx_redundancy        5.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4C6C 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     69725 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             41.055 
_refine.ls_d_res_high                            1.451 
_refine.ls_percent_reflns_obs                    99.00 
_refine.ls_R_factor_obs                          0.1238 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1225 
_refine.ls_R_factor_R_free                       0.1478 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3487 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4BY3' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.08 
_refine.pdbx_overall_phase_error                 12.50 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2769 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             375 
_refine_hist.number_atoms_total               3160 
_refine_hist.d_res_high                       1.451 
_refine_hist.d_res_low                        41.055 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 3049 'X-RAY DIFFRACTION' ? 
f_angle_d          1.336  ? ? 4195 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.331 ? ? 1169 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.083  ? ? 473  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 551  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.4514 1.4713  2339 0.1817 88.00  0.2361 . . 124 . . 
'X-RAY DIFFRACTION' . 1.4713 1.4923  2470 0.1558 93.00  0.1849 . . 130 . . 
'X-RAY DIFFRACTION' . 1.4923 1.5146  2533 0.1340 96.00  0.1726 . . 133 . . 
'X-RAY DIFFRACTION' . 1.5146 1.5382  2620 0.1269 99.00  0.1434 . . 138 . . 
'X-RAY DIFFRACTION' . 1.5382 1.5635  2644 0.1111 100.00 0.1621 . . 139 . . 
'X-RAY DIFFRACTION' . 1.5635 1.5904  2656 0.1017 100.00 0.1427 . . 140 . . 
'X-RAY DIFFRACTION' . 1.5904 1.6193  2634 0.1002 100.00 0.1340 . . 139 . . 
'X-RAY DIFFRACTION' . 1.6193 1.6505  2658 0.0937 100.00 0.1487 . . 140 . . 
'X-RAY DIFFRACTION' . 1.6505 1.6842  2659 0.0960 100.00 0.1407 . . 140 . . 
'X-RAY DIFFRACTION' . 1.6842 1.7208  2652 0.0890 100.00 0.1233 . . 139 . . 
'X-RAY DIFFRACTION' . 1.7208 1.7608  2647 0.0858 100.00 0.1192 . . 139 . . 
'X-RAY DIFFRACTION' . 1.7608 1.8049  2663 0.0897 100.00 0.1326 . . 141 . . 
'X-RAY DIFFRACTION' . 1.8049 1.8537  2646 0.0911 100.00 0.1090 . . 139 . . 
'X-RAY DIFFRACTION' . 1.8537 1.9082  2681 0.0948 100.00 0.1296 . . 141 . . 
'X-RAY DIFFRACTION' . 1.9082 1.9698  2657 0.0975 100.00 0.1240 . . 140 . . 
'X-RAY DIFFRACTION' . 1.9698 2.0402  2689 0.1019 100.00 0.1434 . . 141 . . 
'X-RAY DIFFRACTION' . 2.0402 2.1219  2661 0.0987 100.00 0.1177 . . 140 . . 
'X-RAY DIFFRACTION' . 2.1219 2.2184  2679 0.1010 100.00 0.1202 . . 141 . . 
'X-RAY DIFFRACTION' . 2.2184 2.3354  2678 0.1096 100.00 0.1496 . . 141 . . 
'X-RAY DIFFRACTION' . 2.3354 2.4817  2680 0.1136 100.00 0.1448 . . 141 . . 
'X-RAY DIFFRACTION' . 2.4817 2.6733  2683 0.1243 100.00 0.1520 . . 142 . . 
'X-RAY DIFFRACTION' . 2.6733 2.9422  2711 0.1420 100.00 0.1662 . . 142 . . 
'X-RAY DIFFRACTION' . 2.9422 3.3678  2723 0.1396 100.00 0.1480 . . 144 . . 
'X-RAY DIFFRACTION' . 3.3678 4.2424  2741 0.1259 100.00 0.1524 . . 144 . . 
'X-RAY DIFFRACTION' . 4.2424 41.0714 2834 0.1713 99.00  0.1758 . . 149 . . 
# 
_struct.entry_id                  4C6C 
_struct.title                     
'Crystal structure of the dihydroorotase domain of human CAD in apo- form obtained recombinantly from HEK293 cells.' 
_struct.pdbx_descriptor           'CAD PROTEIN (E.C.3.4.2.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4C6C 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE, DE NOVO PYRIMIDINE BIOSYNTHESIS, AMIDOHYDROLASE SUPERFAMILY, METALLOENZYME, ZINC BINDING, HISTIDINATE ANION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 31  ? GLY A 42  ? ASP A 1484 GLY A 1495 1 ? 12 
HELX_P HELX_P2  2  ASP A 59  ? ALA A 74  ? ASP A 1512 ALA A 1527 1 ? 16 
HELX_P HELX_P3  3  VAL A 95  ? ALA A 99  ? VAL A 1548 ALA A 1552 5 ? 5  
HELX_P HELX_P4  4  SER A 117 ? TRP A 128 ? SER A 1570 TRP A 1581 1 ? 12 
HELX_P HELX_P5  5  GLN A 140 ? THR A 153 ? GLN A 1593 THR A 1606 1 ? 14 
HELX_P HELX_P6  6  ARG A 164 ? ARG A 177 ? ARG A 1617 ARG A 1630 1 ? 14 
HELX_P HELX_P7  7  PRO A 187 ? LEU A 192 ? PRO A 1640 LEU A 1645 1 ? 6  
HELX_P HELX_P8  8  SER A 193 ? ASP A 195 ? SER A 1646 ASP A 1648 5 ? 3  
HELX_P HELX_P9  9  ASP A 196 ? GLY A 205 ? ASP A 1649 GLY A 1658 1 ? 10 
HELX_P HELX_P10 10 SER A 213 ? ASN A 223 ? SER A 1666 ASN A 1676 1 ? 11 
HELX_P HELX_P11 11 MET A 224 ? ILE A 227 ? MET A 1677 ILE A 1680 5 ? 4  
HELX_P HELX_P12 12 THR A 238 ? CYS A 243 ? THR A 1691 CYS A 1696 1 ? 6  
HELX_P HELX_P13 13 GLY A 253 ? GLU A 267 ? GLY A 1706 GLU A 1720 1 ? 15 
HELX_P HELX_P14 14 SER A 271 ? HIS A 280 ? SER A 1724 HIS A 1733 1 ? 10 
HELX_P HELX_P15 15 HIS A 280 ? HIS A 288 ? HIS A 1733 HIS A 1741 1 ? 9  
HELX_P HELX_P16 16 VAL A 356 ? ALA A 363 ? VAL A 1809 ALA A 1816 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 243 SG B ? ? 1_555 A CYS 243 SG  B ? A CYS 1696 A CYS 1696 3_454 ? ? ? ? ? ? ? 2.058 ? 
disulf2  disulf ? ? A CYS 243 SG A ? ? 1_555 A CYS 243 SG  A ? A CYS 1696 A CYS 1696 3_454 ? ? ? ? ? ? ? 2.136 ? 
covale1  covale ? ? A LEU 102 C  ? ? ? 1_555 A KCX 103 N   ? ? A LEU 1555 A KCX 1556 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2  covale ? ? A KCX 103 C  ? ? ? 1_555 A LEU 104 N   ? ? A KCX 1556 A LEU 1557 1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc1  metalc ? ? B ZN  .   ZN ? ? ? 1_555 A HIS 20  NE2 ? ? A ZN  2822 A HIS 1473 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc2  metalc ? ? B ZN  .   ZN ? ? ? 1_555 A KCX 103 OQ2 ? ? A ZN  2822 A KCX 1556 1_555 ? ? ? ? ? ? ? 2.137 ? 
metalc3  metalc ? ? B ZN  .   ZN ? ? ? 1_555 J HOH .   O   ? ? A ZN  2822 A HOH 2066 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc4  metalc ? ? B ZN  .   ZN ? ? ? 1_555 A HIS 18  NE2 ? ? A ZN  2822 A HIS 1471 1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc5  metalc ? ? B ZN  .   ZN ? ? ? 1_555 A ASP 233 OD1 ? ? A ZN  2822 A ASP 1686 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc6  metalc ? ? C ZN  .   ZN ? ? ? 1_555 A HIS 137 ND1 ? ? A ZN  2823 A HIS 1590 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc7  metalc ? ? C ZN  .   ZN ? ? ? 1_555 J HOH .   O   ? ? A ZN  2823 A HOH 2066 1_555 ? ? ? ? ? ? ? 1.976 ? 
metalc8  metalc ? ? C ZN  .   ZN ? ? ? 1_555 A HIS 161 NE2 ? ? A ZN  2823 A HIS 1614 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc9  metalc ? ? C ZN  .   ZN ? ? ? 1_555 A KCX 103 OQ1 ? ? A ZN  2823 A KCX 1556 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc10 metalc ? ? D ZN  .   ZN ? ? ? 1_555 A CYS 160 SG  ? ? A ZN  2824 A CYS 1613 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc11 metalc ? ? D ZN  .   ZN ? ? ? 1_555 J HOH .   O   ? ? A ZN  2824 A HOH 2065 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc12 metalc ? ? D ZN  .   ZN ? ? ? 1_555 A GLU 184 OE2 ? ? A ZN  2824 A GLU 1637 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc13 metalc ? ? D ZN  .   ZN ? ? ? 1_555 A HIS 18  ND1 ? ? A ZN  2824 A HIS 1471 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc14 metalc ? ? E ZN  .   ZN ? ? ? 1_555 J HOH .   O   ? ? A ZN  2825 A HOH 2290 1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc15 metalc ? ? E ZN  .   ZN ? ? ? 1_555 J HOH .   O   ? ? A ZN  2825 A HOH 2289 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc16 metalc ? ? E ZN  .   ZN ? ? ? 1_555 A HIS 288 ND1 ? ? A ZN  2825 A HIS 1741 3_554 ? ? ? ? ? ? ? 2.161 ? 
metalc17 metalc ? ? E ZN  .   ZN ? ? ? 1_555 A HIS 281 NE2 ? ? A ZN  2825 A HIS 1734 1_555 ? ? ? ? ? ? ? 2.079 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 23  A . ? GLU 1476 A PRO 24  A ? PRO 1477 A 1 6.45  
2 ARG 54  A . ? ARG 1507 A PRO 55  A ? PRO 1508 A 1 3.89  
3 ARG 208 A . ? ARG 1661 A PRO 209 A ? PRO 1662 A 1 -6.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 9   ? PRO A 12  ? VAL A 1462 PRO A 1465 
AA 2 TYR A 296 ? THR A 306 ? TYR A 1749 THR A 1759 
AA 3 LYS A 325 ? LEU A 335 ? LYS A 1778 LEU A 1788 
AA 4 GLU A 338 ? ILE A 342 ? GLU A 1791 ILE A 1795 
AA 5 GLN A 345 ? VAL A 346 ? GLN A 1798 VAL A 1799 
AB 1 LEU A 14  ? VAL A 19  ? LEU A 1467 VAL A 1472 
AB 2 ILE A 44  ? ALA A 49  ? ILE A 1497 ALA A 1502 
AB 3 ASP A 77  ? LEU A 80  ? ASP A 1530 LEU A 1533 
AC 1 LEU A 82  ? GLY A 83  ? LEU A 1535 GLY A 1536 
AC 2 LEU A 102 ? TYR A 105 ? LEU A 1555 TYR A 1558 
AC 3 ILE A 134 ? HIS A 137 ? ILE A 1587 HIS A 1590 
AC 4 VAL A 157 ? ILE A 159 ? VAL A 1610 ILE A 1612 
AC 5 VAL A 181 ? VAL A 185 ? VAL A 1634 VAL A 1638 
AC 6 CYS A 229 ? PHE A 230 ? CYS A 1682 PHE A 1683 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 11  ? N LEU A 1464 O VAL A 297 ? O VAL A 1750 
AA 2 3 N TRP A 305 ? N TRP A 1758 O VAL A 326 ? O VAL A 1779 
AA 3 4 N LEU A 335 ? N LEU A 1788 O GLU A 338 ? O GLU A 1791 
AA 4 5 N ILE A 342 ? N ILE A 1795 O GLN A 345 ? O GLN A 1798 
AB 1 2 O LEU A 14  ? O LEU A 1467 N THR A 45  ? N THR A 1498 
AB 2 3 N VAL A 47  ? N VAL A 1500 O ASP A 77  ? O ASP A 1530 
AC 1 2 O LEU A 82  ? O LEU A 1535 N KCX A 103 ? N KCX A 1556 
AC 2 3 N LEU A 104 ? N LEU A 1557 O VAL A 135 ? O VAL A 1588 
AC 3 4 N ALA A 136 ? N ALA A 1589 O HIS A 158 ? O HIS A 1611 
AC 4 5 N ILE A 159 ? N ILE A 1612 O THR A 182 ? O THR A 1635 
AC 5 6 N VAL A 185 ? N VAL A 1638 O CYS A 229 ? O CYS A 1682 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN A 2822'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 2823'  
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2824'  
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2825'  
AC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE FMT A 2826' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 2827' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE FMT A 2828' 
AC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE FMT A 2829' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 HIS A 18  ? HIS A 1471 . ? 1_555 ? 
2  AC1 6 HIS A 20  ? HIS A 1473 . ? 1_555 ? 
3  AC1 6 KCX A 103 ? KCX A 1556 . ? 1_555 ? 
4  AC1 6 ASP A 233 ? ASP A 1686 . ? 1_555 ? 
5  AC1 6 HOH J .   ? HOH A 2066 . ? 1_555 ? 
6  AC1 6 ZN  C .   ? ZN  A 2823 . ? 1_555 ? 
7  AC2 5 KCX A 103 ? KCX A 1556 . ? 1_555 ? 
8  AC2 5 HIS A 137 ? HIS A 1590 . ? 1_555 ? 
9  AC2 5 HIS A 161 ? HIS A 1614 . ? 1_555 ? 
10 AC2 5 HOH J .   ? HOH A 2066 . ? 1_555 ? 
11 AC2 5 ZN  B .   ? ZN  A 2822 . ? 1_555 ? 
12 AC3 4 HIS A 18  ? HIS A 1471 . ? 1_555 ? 
13 AC3 4 CYS A 160 ? CYS A 1613 . ? 1_555 ? 
14 AC3 4 GLU A 184 ? GLU A 1637 . ? 1_555 ? 
15 AC3 4 HOH J .   ? HOH A 2065 . ? 1_555 ? 
16 AC4 4 HIS A 281 ? HIS A 1734 . ? 1_555 ? 
17 AC4 4 HIS A 288 ? HIS A 1741 . ? 3_554 ? 
18 AC4 4 HOH J .   ? HOH A 2289 . ? 1_555 ? 
19 AC4 4 HOH J .   ? HOH A 2290 . ? 1_555 ? 
20 AC5 8 PRO A 133 ? PRO A 1586 . ? 1_555 ? 
21 AC5 8 ILE A 134 ? ILE A 1587 . ? 1_555 ? 
22 AC5 8 ARG A 155 ? ARG A 1608 . ? 1_555 ? 
23 AC5 8 SER A 156 ? SER A 1609 . ? 1_555 ? 
24 AC5 8 VAL A 157 ? VAL A 1610 . ? 1_555 ? 
25 AC5 8 HIS A 158 ? HIS A 1611 . ? 1_555 ? 
26 AC5 8 HOH J .   ? HOH A 2175 . ? 1_555 ? 
27 AC5 8 HOH J .   ? HOH A 2203 . ? 1_555 ? 
28 AC6 4 HIS A 281 ? HIS A 1734 . ? 1_555 ? 
29 AC6 4 HIS A 281 ? HIS A 1734 . ? 3_554 ? 
30 AC6 4 ARG A 284 ? ARG A 1737 . ? 3_554 ? 
31 AC6 4 ARG A 284 ? ARG A 1737 . ? 1_555 ? 
32 AC7 4 ARG A 10  ? ARG A 1463 . ? 3_554 ? 
33 AC7 4 THR A 295 ? THR A 1748 . ? 3_554 ? 
34 AC7 4 HOH J .   ? HOH A 2060 . ? 3_554 ? 
35 AC7 4 HOH J .   ? HOH A 2303 . ? 3_554 ? 
36 AC8 5 HIS A 20  ? HIS A 1473 . ? 1_555 ? 
37 AC8 5 ARG A 22  ? ARG A 1475 . ? 1_555 ? 
38 AC8 5 ASN A 52  ? ASN A 1505 . ? 1_555 ? 
39 AC8 5 HIS A 237 ? HIS A 1690 . ? 1_555 ? 
40 AC8 5 PRO A 249 ? PRO A 1702 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4C6C 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4C6C 
_atom_sites.fract_transf_matrix[1][1]   0.012179 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006297 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016458 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . LYS A 1 7   ? -12.351 -31.678 -38.514 1.00  41.55 ? 1460 LYS A N    1 
ATOM   2    C  CA   . LYS A 1 7   ? -11.194 -31.104 -37.838 1.00  40.73 ? 1460 LYS A CA   1 
ATOM   3    C  C    . LYS A 1 7   ? -11.573 -30.629 -36.433 1.00  39.15 ? 1460 LYS A C    1 
ATOM   4    O  O    . LYS A 1 7   ? -12.008 -29.494 -36.232 1.00  39.65 ? 1460 LYS A O    1 
ATOM   5    C  CB   . LYS A 1 7   ? -10.622 -29.950 -38.653 1.00  41.75 ? 1460 LYS A CB   1 
ATOM   6    H  HA   . LYS A 1 7   ? -10.499 -31.790 -37.752 1.00  48.88 ? 1460 LYS A HA   1 
ATOM   7    H  HB2  . LYS A 1 7   ? -9.863  -29.588 -38.191 1.00  50.10 ? 1460 LYS A HB2  1 
ATOM   8    H  HB3  . LYS A 1 7   ? -10.355 -30.279 -39.515 1.00  50.10 ? 1460 LYS A HB3  1 
ATOM   9    H  HB1  . LYS A 1 7   ? -11.297 -29.275 -38.754 1.00  50.10 ? 1460 LYS A HB1  1 
ATOM   10   N  N    . LEU A 1 8   ? -11.418 -31.510 -35.456 1.00  36.16 ? 1461 LEU A N    1 
ATOM   11   C  CA   . LEU A 1 8   ? -11.655 -31.125 -34.078 1.00  32.82 ? 1461 LEU A CA   1 
ATOM   12   C  C    . LEU A 1 8   ? -10.403 -30.434 -33.551 1.00  30.13 ? 1461 LEU A C    1 
ATOM   13   O  O    . LEU A 1 8   ? -9.339  -30.519 -34.164 1.00  31.60 ? 1461 LEU A O    1 
ATOM   14   C  CB   . LEU A 1 8   ? -11.979 -32.370 -33.241 1.00  33.82 ? 1461 LEU A CB   1 
ATOM   15   C  CG   . LEU A 1 8   ? -13.251 -33.127 -33.646 1.00  35.05 ? 1461 LEU A CG   1 
ATOM   16   C  CD1  . LEU A 1 8   ? -13.605 -34.222 -32.622 1.00  36.25 ? 1461 LEU A CD1  1 
ATOM   17   C  CD2  . LEU A 1 8   ? -14.417 -32.168 -33.824 1.00  34.21 ? 1461 LEU A CD2  1 
ATOM   18   H  H    . LEU A 1 8   ? -11.179 -32.329 -35.564 1.00  43.40 ? 1461 LEU A H    1 
ATOM   19   H  HA   . LEU A 1 8   ? -12.409 -30.501 -34.028 1.00  39.39 ? 1461 LEU A HA   1 
ATOM   20   H  HB2  . LEU A 1 8   ? -11.237 -32.990 -33.314 1.00  40.58 ? 1461 LEU A HB2  1 
ATOM   21   H  HB3  . LEU A 1 8   ? -12.085 -32.099 -32.316 1.00  40.58 ? 1461 LEU A HB3  1 
ATOM   22   H  HG   . LEU A 1 8   ? -13.095 -33.561 -34.499 1.00  42.06 ? 1461 LEU A HG   1 
ATOM   23   H  HD11 . LEU A 1 8   ? -13.748 -33.813 -31.765 1.00  43.51 ? 1461 LEU A HD11 1 
ATOM   24   H  HD12 . LEU A 1 8   ? -14.403 -34.671 -32.909 1.00  43.51 ? 1461 LEU A HD12 1 
ATOM   25   H  HD13 . LEU A 1 8   ? -12.878 -34.846 -32.570 1.00  43.51 ? 1461 LEU A HD13 1 
ATOM   26   H  HD21 . LEU A 1 8   ? -14.197 -31.534 -34.511 1.00  41.05 ? 1461 LEU A HD21 1 
ATOM   27   H  HD22 . LEU A 1 8   ? -15.196 -32.668 -34.076 1.00  41.05 ? 1461 LEU A HD22 1 
ATOM   28   H  HD23 . LEU A 1 8   ? -14.575 -31.711 -32.994 1.00  41.05 ? 1461 LEU A HD23 1 
ATOM   29   N  N    . VAL A 1 9   ? -10.530 -29.714 -32.447 1.00  25.79 ? 1462 VAL A N    1 
ATOM   30   C  CA   A VAL A 1 9   ? -9.383  -29.167 -31.733 0.67  24.24 ? 1462 VAL A CA   1 
ATOM   31   C  CA   B VAL A 1 9   ? -9.339  -29.250 -31.767 0.33  24.06 ? 1462 VAL A CA   1 
ATOM   32   C  C    . VAL A 1 9   ? -9.341  -29.776 -30.343 1.00  22.29 ? 1462 VAL A C    1 
ATOM   33   O  O    . VAL A 1 9   ? -10.372 -29.835 -29.672 1.00  21.72 ? 1462 VAL A O    1 
ATOM   34   C  CB   A VAL A 1 9   ? -9.475  -27.639 -31.566 0.67  25.15 ? 1462 VAL A CB   1 
ATOM   35   C  CB   B VAL A 1 9   ? -9.187  -27.722 -31.817 0.33  24.53 ? 1462 VAL A CB   1 
ATOM   36   C  CG1  A VAL A 1 9   ? -8.193  -27.106 -30.916 0.67  25.28 ? 1462 VAL A CG1  1 
ATOM   37   C  CG1  B VAL A 1 9   ? -9.616  -27.207 -33.175 0.33  25.07 ? 1462 VAL A CG1  1 
ATOM   38   C  CG2  A VAL A 1 9   ? -9.701  -26.970 -32.899 0.67  28.15 ? 1462 VAL A CG2  1 
ATOM   39   C  CG2  B VAL A 1 9   ? -9.977  -27.063 -30.723 0.33  24.88 ? 1462 VAL A CG2  1 
ATOM   40   H  H    A VAL A 1 9   ? -11.285 -29.524 -32.083 0.67  30.95 ? 1462 VAL A H    1 
ATOM   41   H  H    B VAL A 1 9   ? -11.274 -29.487 -32.081 0.33  30.95 ? 1462 VAL A H    1 
ATOM   42   H  HA   A VAL A 1 9   ? -8.554  -29.388 -32.206 0.67  29.09 ? 1462 VAL A HA   1 
ATOM   43   H  HA   B VAL A 1 9   ? -8.558  -29.634 -32.218 0.33  28.87 ? 1462 VAL A HA   1 
ATOM   44   H  HB   A VAL A 1 9   ? -10.230 -27.422 -30.980 0.67  30.18 ? 1462 VAL A HB   1 
ATOM   45   H  HB   B VAL A 1 9   ? -8.243  -27.491 -31.690 0.33  29.44 ? 1462 VAL A HB   1 
ATOM   46   H  HG11 A VAL A 1 9   ? -7.445  -27.322 -31.478 0.67  30.34 ? 1462 VAL A HG11 1 
ATOM   47   H  HG11 B VAL A 1 9   ? -10.535 -27.443 -33.322 0.33  30.09 ? 1462 VAL A HG11 1 
ATOM   48   H  HG12 A VAL A 1 9   ? -8.265  -26.153 -30.818 0.67  30.34 ? 1462 VAL A HG12 1 
ATOM   49   H  HG12 B VAL A 1 9   ? -9.516  -26.252 -33.193 0.33  30.09 ? 1462 VAL A HG12 1 
ATOM   50   H  HG13 A VAL A 1 9   ? -8.085  -27.516 -30.055 0.67  30.34 ? 1462 VAL A HG13 1 
ATOM   51   H  HG13 B VAL A 1 9   ? -9.063  -27.607 -33.850 0.33  30.09 ? 1462 VAL A HG13 1 
ATOM   52   H  HG21 A VAL A 1 9   ? -10.522 -27.295 -33.276 0.67  33.79 ? 1462 VAL A HG21 1 
ATOM   53   H  HG21 B VAL A 1 9   ? -9.659  -27.379 -29.874 0.33  29.86 ? 1462 VAL A HG21 1 
ATOM   54   H  HG22 A VAL A 1 9   ? -9.755  -26.021 -32.766 0.67  33.79 ? 1462 VAL A HG22 1 
ATOM   55   H  HG22 B VAL A 1 9   ? -9.860  -26.112 -30.783 0.33  29.86 ? 1462 VAL A HG22 1 
ATOM   56   H  HG23 A VAL A 1 9   ? -8.967  -27.179 -33.481 0.67  33.79 ? 1462 VAL A HG23 1 
ATOM   57   H  HG23 B VAL A 1 9   ? -10.904 -27.287 -30.830 0.33  29.86 ? 1462 VAL A HG23 1 
ATOM   58   N  N    . ARG A 1 10  ? -8.164  -30.223 -29.925 1.00  21.67 ? 1463 ARG A N    1 
ATOM   59   C  CA   . ARG A 1 10  ? -7.975  -30.805 -28.611 1.00  21.39 ? 1463 ARG A CA   1 
ATOM   60   C  C    . ARG A 1 10  ? -7.523  -29.724 -27.666 1.00  20.05 ? 1463 ARG A C    1 
ATOM   61   O  O    . ARG A 1 10  ? -6.521  -29.050 -27.911 1.00  22.72 ? 1463 ARG A O    1 
ATOM   62   C  CB   . ARG A 1 10  ? -6.924  -31.918 -28.660 1.00  24.43 ? 1463 ARG A CB   1 
ATOM   63   C  CG   . ARG A 1 10  ? -6.441  -32.405 -27.292 1.00  27.71 ? 1463 ARG A CG   1 
ATOM   64   C  CD   . ARG A 1 10  ? -5.354  -33.473 -27.435 1.00  29.97 ? 1463 ARG A CD   1 
ATOM   65   N  NE   . ARG A 1 10  ? -4.777  -33.865 -26.149 1.00  30.98 ? 1463 ARG A NE   1 
ATOM   66   C  CZ   . ARG A 1 10  ? -4.447  -35.110 -25.816 1.00  31.63 ? 1463 ARG A CZ   1 
ATOM   67   N  NH1  . ARG A 1 10  ? -4.645  -36.116 -26.663 1.00  32.74 ? 1463 ARG A NH1  1 
ATOM   68   N  NH2  . ARG A 1 10  ? -3.922  -35.356 -24.620 1.00  31.85 ? 1463 ARG A NH2  1 
ATOM   69   H  H    . ARG A 1 10  ? -7.446  -30.198 -30.397 1.00  26.00 ? 1463 ARG A H    1 
ATOM   70   H  HA   . ARG A 1 10  ? -8.820  -31.180 -28.285 1.00  25.67 ? 1463 ARG A HA   1 
ATOM   71   H  HB2  . ARG A 1 10  ? -7.302  -32.680 -29.126 1.00  29.32 ? 1463 ARG A HB2  1 
ATOM   72   H  HB3  . ARG A 1 10  ? -6.150  -31.590 -29.145 1.00  29.32 ? 1463 ARG A HB3  1 
ATOM   73   H  HG2  . ARG A 1 10  ? -6.071  -31.657 -26.798 1.00  33.26 ? 1463 ARG A HG2  1 
ATOM   74   H  HG3  . ARG A 1 10  ? -7.187  -32.792 -26.808 1.00  33.26 ? 1463 ARG A HG3  1 
ATOM   75   H  HD2  . ARG A 1 10  ? -5.739  -34.263 -27.845 1.00  35.96 ? 1463 ARG A HD2  1 
ATOM   76   H  HD3  . ARG A 1 10  ? -4.640  -33.124 -27.991 1.00  35.96 ? 1463 ARG A HD3  1 
ATOM   77   H  HE   . ARG A 1 10  ? -4.641  -33.247 -25.567 1.00  37.17 ? 1463 ARG A HE   1 
ATOM   78   H  HH11 . ARG A 1 10  ? -4.983  -35.964 -27.439 1.00  39.29 ? 1463 ARG A HH11 1 
ATOM   79   H  HH12 . ARG A 1 10  ? -4.430  -36.918 -26.437 1.00  39.29 ? 1463 ARG A HH12 1 
ATOM   80   H  HH21 . ARG A 1 10  ? -3.794  -34.711 -24.066 1.00  38.22 ? 1463 ARG A HH21 1 
ATOM   81   H  HH22 . ARG A 1 10  ? -3.712  -36.161 -24.400 1.00  38.22 ? 1463 ARG A HH22 1 
ATOM   82   N  N    . LEU A 1 11  ? -8.295  -29.549 -26.604 1.00  17.64 ? 1464 LEU A N    1 
ATOM   83   C  CA   . LEU A 1 11  ? -7.991  -28.619 -25.539 1.00  16.36 ? 1464 LEU A CA   1 
ATOM   84   C  C    . LEU A 1 11  ? -7.634  -29.417 -24.298 1.00  16.46 ? 1464 LEU A C    1 
ATOM   85   O  O    . LEU A 1 11  ? -8.039  -30.568 -24.154 1.00  16.33 ? 1464 LEU A O    1 
ATOM   86   C  CB   . LEU A 1 11  ? -9.223  -27.763 -25.224 1.00  16.68 ? 1464 LEU A CB   1 
ATOM   87   C  CG   . LEU A 1 11  ? -9.903  -27.061 -26.390 1.00  18.59 ? 1464 LEU A CG   1 
ATOM   88   C  CD1  . LEU A 1 11  ? -11.079 -26.250 -25.860 1.00  18.98 ? 1464 LEU A CD1  1 
ATOM   89   C  CD2  . LEU A 1 11  ? -8.940  -26.180 -27.169 1.00  20.00 ? 1464 LEU A CD2  1 
ATOM   90   H  H    . LEU A 1 11  ? -9.029  -29.978 -26.478 1.00  21.17 ? 1464 LEU A H    1 
ATOM   91   H  HA   . LEU A 1 11  ? -7.240  -28.040 -25.787 1.00  19.63 ? 1464 LEU A HA   1 
ATOM   92   H  HB2  . LEU A 1 11  ? -9.888  -28.335 -24.810 1.00  20.01 ? 1464 LEU A HB2  1 
ATOM   93   H  HB3  . LEU A 1 11  ? -8.958  -27.076 -24.594 1.00  20.01 ? 1464 LEU A HB3  1 
ATOM   94   H  HG   . LEU A 1 11  ? -10.253 -27.730 -26.999 1.00  22.31 ? 1464 LEU A HG   1 
ATOM   95   H  HD11 . LEU A 1 11  ? -10.753 -25.602 -25.232 1.00  22.77 ? 1464 LEU A HD11 1 
ATOM   96   H  HD12 . LEU A 1 11  ? -11.508 -25.806 -26.595 1.00  22.77 ? 1464 LEU A HD12 1 
ATOM   97   H  HD13 . LEU A 1 11  ? -11.698 -26.843 -25.429 1.00  22.77 ? 1464 LEU A HD13 1 
ATOM   98   H  HD21 . LEU A 1 11  ? -8.230  -26.725 -27.516 1.00  24.01 ? 1464 LEU A HD21 1 
ATOM   99   H  HD22 . LEU A 1 11  ? -9.415  -25.761 -27.891 1.00  24.01 ? 1464 LEU A HD22 1 
ATOM   100  H  HD23 . LEU A 1 11  ? -8.583  -25.512 -26.580 1.00  24.01 ? 1464 LEU A HD23 1 
ATOM   101  N  N    . PRO A 1 12  ? -6.888  -28.813 -23.382 1.00  16.07 ? 1465 PRO A N    1 
ATOM   102  C  CA   . PRO A 1 12  ? -6.658  -29.475 -22.094 1.00  16.29 ? 1465 PRO A CA   1 
ATOM   103  C  C    . PRO A 1 12  ? -7.939  -29.467 -21.266 1.00  15.97 ? 1465 PRO A C    1 
ATOM   104  O  O    . PRO A 1 12  ? -8.907  -28.823 -21.661 1.00  16.85 ? 1465 PRO A O    1 
ATOM   105  C  CB   . PRO A 1 12  ? -5.593  -28.589 -21.445 1.00  17.51 ? 1465 PRO A CB   1 
ATOM   106  C  CG   . PRO A 1 12  ? -5.835  -27.241 -22.041 1.00  19.15 ? 1465 PRO A CG   1 
ATOM   107  C  CD   . PRO A 1 12  ? -6.301  -27.462 -23.437 1.00  18.09 ? 1465 PRO A CD   1 
ATOM   108  H  HA   . PRO A 1 12  ? -6.324  -30.389 -22.211 1.00  19.55 ? 1465 PRO A HA   1 
ATOM   109  H  HB2  . PRO A 1 12  ? -5.720  -28.570 -20.483 1.00  21.02 ? 1465 PRO A HB2  1 
ATOM   110  H  HB3  . PRO A 1 12  ? -4.708  -28.914 -21.672 1.00  21.02 ? 1465 PRO A HB3  1 
ATOM   111  H  HG2  . PRO A 1 12  ? -6.515  -26.779 -21.526 1.00  22.98 ? 1465 PRO A HG2  1 
ATOM   112  H  HG3  . PRO A 1 12  ? -5.007  -26.734 -22.037 1.00  22.98 ? 1465 PRO A HG3  1 
ATOM   113  H  HD2  . PRO A 1 12  ? -6.977  -26.808 -23.676 1.00  21.71 ? 1465 PRO A HD2  1 
ATOM   114  H  HD3  . PRO A 1 12  ? -5.551  -27.442 -24.052 1.00  21.71 ? 1465 PRO A HD3  1 
ATOM   115  N  N    . GLY A 1 13  ? -7.936  -30.158 -20.134 1.00  15.87 ? 1466 GLY A N    1 
ATOM   116  C  CA   . GLY A 1 13  ? -9.075  -30.157 -19.231 1.00  15.82 ? 1466 GLY A CA   1 
ATOM   117  C  C    . GLY A 1 13  ? -9.283  -28.764 -18.658 1.00  14.83 ? 1466 GLY A C    1 
ATOM   118  O  O    . GLY A 1 13  ? -8.417  -28.224 -17.964 1.00  15.69 ? 1466 GLY A O    1 
ATOM   119  H  H    . GLY A 1 13  ? -7.278  -30.642 -19.865 1.00  19.04 ? 1466 GLY A H    1 
ATOM   120  H  HA2  . GLY A 1 13  ? -9.876  -30.425 -19.708 1.00  18.98 ? 1466 GLY A HA2  1 
ATOM   121  H  HA3  . GLY A 1 13  ? -8.920  -30.778 -18.502 1.00  18.98 ? 1466 GLY A HA3  1 
ATOM   122  N  N    . LEU A 1 14  ? -10.440 -28.176 -18.929 1.00  13.37 ? 1467 LEU A N    1 
ATOM   123  C  CA   . LEU A 1 14  ? -10.711 -26.809 -18.472 1.00  12.93 ? 1467 LEU A CA   1 
ATOM   124  C  C    . LEU A 1 14  ? -11.246 -26.800 -17.045 1.00  12.59 ? 1467 LEU A C    1 
ATOM   125  O  O    . LEU A 1 14  ? -11.831 -27.779 -16.567 1.00  13.04 ? 1467 LEU A O    1 
ATOM   126  C  CB   . LEU A 1 14  ? -11.677 -26.097 -19.422 1.00  13.55 ? 1467 LEU A CB   1 
ATOM   127  C  CG   . LEU A 1 14  ? -11.280 -26.150 -20.896 1.00  13.90 ? 1467 LEU A CG   1 
ATOM   128  C  CD1  . LEU A 1 14  ? -12.326 -25.434 -21.758 1.00  15.36 ? 1467 LEU A CD1  1 
ATOM   129  C  CD2  . LEU A 1 14  ? -9.882  -25.551 -21.118 1.00  14.12 ? 1467 LEU A CD2  1 
ATOM   130  H  H    . LEU A 1 14  ? -11.083 -28.538 -19.371 1.00  16.05 ? 1467 LEU A H    1 
ATOM   131  H  HA   . LEU A 1 14  ? -9.870  -26.306 -18.476 1.00  15.51 ? 1467 LEU A HA   1 
ATOM   132  H  HB2  . LEU A 1 14  ? -12.552 -26.509 -19.338 1.00  16.26 ? 1467 LEU A HB2  1 
ATOM   133  H  HB3  . LEU A 1 14  ? -11.730 -25.163 -19.166 1.00  16.26 ? 1467 LEU A HB3  1 
ATOM   134  H  HG   . LEU A 1 14  ? -11.252 -27.078 -21.178 1.00  16.68 ? 1467 LEU A HG   1 
ATOM   135  H  HD11 . LEU A 1 14  ? -12.385 -24.517 -21.478 1.00  18.44 ? 1467 LEU A HD11 1 
ATOM   136  H  HD12 . LEU A 1 14  ? -12.057 -25.479 -22.678 1.00  18.44 ? 1467 LEU A HD12 1 
ATOM   137  H  HD13 . LEU A 1 14  ? -13.175 -25.867 -21.642 1.00  18.44 ? 1467 LEU A HD13 1 
ATOM   138  H  HD21 . LEU A 1 14  ? -9.242  -26.052 -20.607 1.00  16.95 ? 1467 LEU A HD21 1 
ATOM   139  H  HD22 . LEU A 1 14  ? -9.666  -25.601 -22.052 1.00  16.95 ? 1467 LEU A HD22 1 
ATOM   140  H  HD23 . LEU A 1 14  ? -9.886  -24.635 -20.831 1.00  16.95 ? 1467 LEU A HD23 1 
ATOM   141  N  N    . ILE A 1 15  ? -11.016 -25.676 -16.372 1.00  12.13 ? 1468 ILE A N    1 
ATOM   142  C  CA   . ILE A 1 15  ? -11.258 -25.535 -14.957 1.00  11.83 ? 1468 ILE A CA   1 
ATOM   143  C  C    . ILE A 1 15  ? -12.184 -24.352 -14.726 1.00  11.95 ? 1468 ILE A C    1 
ATOM   144  O  O    . ILE A 1 15  ? -11.917 -23.261 -15.224 1.00  13.36 ? 1468 ILE A O    1 
ATOM   145  C  CB   . ILE A 1 15  ? -9.944  -25.284 -14.186 1.00  12.60 ? 1468 ILE A CB   1 
ATOM   146  C  CG1  . ILE A 1 15  ? -8.953  -26.431 -14.409 1.00  13.42 ? 1468 ILE A CG1  1 
ATOM   147  C  CG2  . ILE A 1 15  ? -10.236 -25.109 -12.708 1.00  13.82 ? 1468 ILE A CG2  1 
ATOM   148  C  CD1  . ILE A 1 15  ? -7.559  -26.144 -13.874 1.00  14.48 ? 1468 ILE A CD1  1 
ATOM   149  H  H    . ILE A 1 15  ? -10.708 -24.960 -16.736 1.00  14.56 ? 1468 ILE A H    1 
ATOM   150  H  HA   . ILE A 1 15  ? -11.684 -26.345 -14.607 1.00  14.19 ? 1468 ILE A HA   1 
ATOM   151  H  HB   . ILE A 1 15  ? -9.545  -24.465 -14.519 1.00  15.12 ? 1468 ILE A HB   1 
ATOM   152  H  HG12 . ILE A 1 15  ? -9.286  -27.224 -13.961 1.00  16.11 ? 1468 ILE A HG12 1 
ATOM   153  H  HG13 . ILE A 1 15  ? -8.877  -26.598 -15.361 1.00  16.11 ? 1468 ILE A HG13 1 
ATOM   154  H  HG21 . ILE A 1 15  ? -10.655 -25.906 -12.376 1.00  16.58 ? 1468 ILE A HG21 1 
ATOM   155  H  HG22 . ILE A 1 15  ? -9.411  -24.954 -12.243 1.00  16.58 ? 1468 ILE A HG22 1 
ATOM   156  H  HG23 . ILE A 1 15  ? -10.823 -24.358 -12.593 1.00  16.58 ? 1468 ILE A HG23 1 
ATOM   157  H  HD11 . ILE A 1 15  ? -7.614  -25.987 -12.929 1.00  17.38 ? 1468 ILE A HD11 1 
ATOM   158  H  HD12 . ILE A 1 15  ? -6.996  -26.902 -14.049 1.00  17.38 ? 1468 ILE A HD12 1 
ATOM   159  H  HD13 . ILE A 1 15  ? -7.209  -25.367 -14.316 1.00  17.38 ? 1468 ILE A HD13 1 
ATOM   160  N  N    . ASP A 1 16  ? -13.272 -24.568 -13.986 1.00  11.99 ? 1469 ASP A N    1 
ATOM   161  C  CA   . ASP A 1 16  ? -14.170 -23.474 -13.597 1.00  12.06 ? 1469 ASP A CA   1 
ATOM   162  C  C    . ASP A 1 16  ? -14.076 -23.272 -12.087 1.00  11.82 ? 1469 ASP A C    1 
ATOM   163  O  O    . ASP A 1 16  ? -14.520 -24.127 -11.302 1.00  12.21 ? 1469 ASP A O    1 
ATOM   164  C  CB   . ASP A 1 16  ? -15.613 -23.786 -14.001 1.00  12.13 ? 1469 ASP A CB   1 
ATOM   165  C  CG   . ASP A 1 16  ? -16.543 -22.618 -13.797 1.00  13.83 ? 1469 ASP A CG   1 
ATOM   166  O  OD1  . ASP A 1 16  ? -16.207 -21.691 -13.020 1.00  15.00 ? 1469 ASP A OD1  1 
ATOM   167  O  OD2  . ASP A 1 16  ? -17.632 -22.628 -14.413 1.00  16.09 ? 1469 ASP A OD2  1 
ATOM   168  H  H    . ASP A 1 16  ? -13.514 -25.340 -13.694 1.00  14.39 ? 1469 ASP A H    1 
ATOM   169  H  HA   . ASP A 1 16  ? -13.893 -22.646 -14.042 1.00  14.47 ? 1469 ASP A HA   1 
ATOM   170  H  HB2  . ASP A 1 16  ? -15.633 -24.024 -14.941 1.00  14.56 ? 1469 ASP A HB2  1 
ATOM   171  H  HB3  . ASP A 1 16  ? -15.938 -24.526 -13.464 1.00  14.56 ? 1469 ASP A HB3  1 
ATOM   172  N  N    . VAL A 1 17  ? -13.458 -22.160 -11.688 1.00  11.39 ? 1470 VAL A N    1 
ATOM   173  C  CA   . VAL A 1 17  ? -13.214 -21.906 -10.282 1.00  11.21 ? 1470 VAL A CA   1 
ATOM   174  C  C    . VAL A 1 17  ? -14.374 -21.264 -9.527  1.00  10.79 ? 1470 VAL A C    1 
ATOM   175  O  O    . VAL A 1 17  ? -14.192 -20.811 -8.396  1.00  12.00 ? 1470 VAL A O    1 
ATOM   176  C  CB   . VAL A 1 17  ? -11.914 -21.063 -10.076 1.00  11.58 ? 1470 VAL A CB   1 
ATOM   177  C  CG1  . VAL A 1 17  ? -10.731 -21.824 -10.656 1.00  12.68 ? 1470 VAL A CG1  1 
ATOM   178  C  CG2  . VAL A 1 17  ? -12.029 -19.668 -10.700 1.00  12.46 ? 1470 VAL A CG2  1 
ATOM   179  H  H    . VAL A 1 17  ? -13.173 -21.543 -12.214 1.00  13.67 ? 1470 VAL A H    1 
ATOM   180  H  HA   . VAL A 1 17  ? -13.053 -22.772 -9.854  1.00  13.45 ? 1470 VAL A HA   1 
ATOM   181  H  HB   . VAL A 1 17  ? -11.758 -20.951 -9.115  1.00  13.89 ? 1470 VAL A HB   1 
ATOM   182  H  HG11 . VAL A 1 17  ? -10.881 -21.969 -11.593 1.00  15.21 ? 1470 VAL A HG11 1 
ATOM   183  H  HG12 . VAL A 1 17  ? -9.933  -21.305 -10.528 1.00  15.21 ? 1470 VAL A HG12 1 
ATOM   184  H  HG13 . VAL A 1 17  ? -10.650 -22.666 -10.203 1.00  15.21 ? 1470 VAL A HG13 1 
ATOM   185  H  HG21 . VAL A 1 17  ? -12.762 -19.203 -10.289 1.00  14.95 ? 1470 VAL A HG21 1 
ATOM   186  H  HG22 . VAL A 1 17  ? -11.211 -19.190 -10.548 1.00  14.95 ? 1470 VAL A HG22 1 
ATOM   187  H  HG23 . VAL A 1 17  ? -12.186 -19.760 -11.642 1.00  14.95 ? 1470 VAL A HG23 1 
ATOM   188  N  N    . HIS A 1 18  ? -15.572 -21.211 -10.113 1.00  10.52 ? 1471 HIS A N    1 
ATOM   189  C  CA   . HIS A 1 18  ? -16.691 -20.604 -9.408  1.00  10.19 ? 1471 HIS A CA   1 
ATOM   190  C  C    . HIS A 1 18  ? -18.017 -21.226 -9.805  1.00  10.42 ? 1471 HIS A C    1 
ATOM   191  O  O    . HIS A 1 18  ? -18.684 -20.761 -10.729 1.00  11.25 ? 1471 HIS A O    1 
ATOM   192  C  CB   . HIS A 1 18  ? -16.714 -19.101 -9.684  1.00  11.24 ? 1471 HIS A CB   1 
ATOM   193  C  CG   . HIS A 1 18  ? -17.574 -18.325 -8.742  1.00  11.20 ? 1471 HIS A CG   1 
ATOM   194  N  ND1  . HIS A 1 18  ? -17.151 -17.152 -8.154  1.00  12.98 ? 1471 HIS A ND1  1 
ATOM   195  C  CD2  . HIS A 1 18  ? -18.833 -18.540 -8.293  1.00  10.42 ? 1471 HIS A CD2  1 
ATOM   196  C  CE1  . HIS A 1 18  ? -18.126 -16.672 -7.395  1.00  13.08 ? 1471 HIS A CE1  1 
ATOM   197  N  NE2  . HIS A 1 18  ? -19.152 -17.499 -7.453  1.00  11.49 ? 1471 HIS A NE2  1 
ATOM   198  H  H    . HIS A 1 18  ? -15.756 -21.512 -10.898 1.00  12.63 ? 1471 HIS A H    1 
ATOM   199  H  HA   . HIS A 1 18  ? -16.571 -20.735 -8.444  1.00  12.22 ? 1471 HIS A HA   1 
ATOM   200  H  HB2  . HIS A 1 18  ? -15.810 -18.757 -9.610  1.00  13.49 ? 1471 HIS A HB2  1 
ATOM   201  H  HB3  . HIS A 1 18  ? -17.049 -18.953 -10.582 1.00  13.49 ? 1471 HIS A HB3  1 
ATOM   202  H  HD2  . HIS A 1 18  ? -19.382 -19.257 -8.515  1.00  12.50 ? 1471 HIS A HD2  1 
ATOM   203  H  HE1  . HIS A 1 18  ? -18.084 -15.894 -6.887  1.00  15.69 ? 1471 HIS A HE1  1 
ATOM   204  N  N    . VAL A 1 19  ? -18.417 -22.283 -9.102  1.00  11.34 ? 1472 VAL A N    1 
ATOM   205  C  CA   . VAL A 1 19  ? -19.712 -22.901 -9.359  1.00  11.92 ? 1472 VAL A CA   1 
ATOM   206  C  C    . VAL A 1 19  ? -20.461 -23.096 -8.060  1.00  11.80 ? 1472 VAL A C    1 
ATOM   207  O  O    . VAL A 1 19  ? -19.851 -23.283 -7.002  1.00  12.88 ? 1472 VAL A O    1 
ATOM   208  C  CB   . VAL A 1 19  ? -19.593 -24.255 -10.102 1.00  12.84 ? 1472 VAL A CB   1 
ATOM   209  C  CG1  . VAL A 1 19  ? -18.825 -24.072 -11.381 1.00  13.21 ? 1472 VAL A CG1  1 
ATOM   210  C  CG2  . VAL A 1 19  ? -18.949 -25.322 -9.234  1.00  13.53 ? 1472 VAL A CG2  1 
ATOM   211  H  H    . VAL A 1 19  ? -17.961 -22.658 -8.477  1.00  13.61 ? 1472 VAL A H    1 
ATOM   212  H  HA   . VAL A 1 19  ? -20.242 -22.298 -9.921  1.00  14.30 ? 1472 VAL A HA   1 
ATOM   213  H  HB   . VAL A 1 19  ? -20.492 -24.565 -10.336 1.00  15.41 ? 1472 VAL A HB   1 
ATOM   214  H  HG11 . VAL A 1 19  ? -17.947 -23.742 -11.174 1.00  15.85 ? 1472 VAL A HG11 1 
ATOM   215  H  HG12 . VAL A 1 19  ? -18.759 -24.918 -11.829 1.00  15.85 ? 1472 VAL A HG12 1 
ATOM   216  H  HG13 . VAL A 1 19  ? -19.289 -23.442 -11.936 1.00  15.85 ? 1472 VAL A HG13 1 
ATOM   217  H  HG21 . VAL A 1 19  ? -19.487 -25.452 -8.449  1.00  16.23 ? 1472 VAL A HG21 1 
ATOM   218  H  HG22 . VAL A 1 19  ? -18.896 -26.141 -9.733  1.00  16.23 ? 1472 VAL A HG22 1 
ATOM   219  H  HG23 . VAL A 1 19  ? -18.069 -25.033 -8.984  1.00  16.23 ? 1472 VAL A HG23 1 
ATOM   220  N  N    . HIS A 1 20  ? -21.791 -23.046 -8.151  1.00  11.95 ? 1473 HIS A N    1 
ATOM   221  C  CA   . HIS A 1 20  ? -22.685 -23.357 -7.039  1.00  11.48 ? 1473 HIS A CA   1 
ATOM   222  C  C    . HIS A 1 20  ? -23.409 -24.649 -7.394  1.00  13.31 ? 1473 HIS A C    1 
ATOM   223  O  O    . HIS A 1 20  ? -24.212 -24.662 -8.319  1.00  14.08 ? 1473 HIS A O    1 
ATOM   224  C  CB   . HIS A 1 20  ? -23.700 -22.216 -6.839  1.00  11.79 ? 1473 HIS A CB   1 
ATOM   225  C  CG   . HIS A 1 20  ? -23.068 -20.911 -6.455  1.00  12.03 ? 1473 HIS A CG   1 
ATOM   226  N  ND1  . HIS A 1 20  ? -22.902 -20.535 -5.143  1.00  12.13 ? 1473 HIS A ND1  1 
ATOM   227  C  CD2  . HIS A 1 20  ? -22.529 -19.916 -7.199  1.00  11.69 ? 1473 HIS A CD2  1 
ATOM   228  C  CE1  . HIS A 1 20  ? -22.296 -19.364 -5.092  1.00  13.08 ? 1473 HIS A CE1  1 
ATOM   229  N  NE2  . HIS A 1 20  ? -22.079 -18.955 -6.325  1.00  12.04 ? 1473 HIS A NE2  1 
ATOM   230  H  H    . HIS A 1 20  ? -22.209 -22.827 -8.870  1.00  14.34 ? 1473 HIS A H    1 
ATOM   231  H  HA   . HIS A 1 20  ? -22.172 -23.486 -6.214  1.00  13.78 ? 1473 HIS A HA   1 
ATOM   232  H  HB2  . HIS A 1 20  ? -24.185 -22.079 -7.668  1.00  14.15 ? 1473 HIS A HB2  1 
ATOM   233  H  HB3  . HIS A 1 20  ? -24.317 -22.465 -6.134  1.00  14.15 ? 1473 HIS A HB3  1 
ATOM   234  H  HD1  . HIS A 1 20  ? -23.149 -20.997 -4.460  1.00  14.55 ? 1473 HIS A HD1  1 
ATOM   235  H  HD2  . HIS A 1 20  ? -22.493 -19.878 -8.127  1.00  14.03 ? 1473 HIS A HD2  1 
ATOM   236  H  HE1  . HIS A 1 20  ? -22.086 -18.893 -4.317  1.00  15.70 ? 1473 HIS A HE1  1 
ATOM   237  N  N    . LEU A 1 21  ? -23.108 -25.739 -6.693  1.00  13.09 ? 1474 LEU A N    1 
ATOM   238  C  CA   . LEU A 1 21  ? -23.688 -27.039 -7.031  1.00  14.59 ? 1474 LEU A CA   1 
ATOM   239  C  C    . LEU A 1 21  ? -24.821 -27.468 -6.110  1.00  15.15 ? 1474 LEU A C    1 
ATOM   240  O  O    . LEU A 1 21  ? -25.420 -28.527 -6.319  1.00  16.48 ? 1474 LEU A O    1 
ATOM   241  C  CB   . LEU A 1 21  ? -22.593 -28.108 -7.082  1.00  15.53 ? 1474 LEU A CB   1 
ATOM   242  C  CG   . LEU A 1 21  ? -21.475 -27.813 -8.086  1.00  16.09 ? 1474 LEU A CG   1 
ATOM   243  C  CD1  . LEU A 1 21  ? -20.486 -28.962 -8.178  1.00  17.80 ? 1474 LEU A CD1  1 
ATOM   244  C  CD2  . LEU A 1 21  ? -22.048 -27.486 -9.461  1.00  18.68 ? 1474 LEU A CD2  1 
ATOM   245  H  H    . LEU A 1 21  ? -22.574 -25.755 -6.019  1.00  15.71 ? 1474 LEU A H    1 
ATOM   246  H  HA   . LEU A 1 21  ? -24.065 -26.974 -7.934  1.00  17.51 ? 1474 LEU A HA   1 
ATOM   247  H  HB2  . LEU A 1 21  ? -22.189 -28.183 -6.204  1.00  18.63 ? 1474 LEU A HB2  1 
ATOM   248  H  HB3  . LEU A 1 21  ? -22.996 -28.955 -7.330  1.00  18.63 ? 1474 LEU A HB3  1 
ATOM   249  H  HG   . LEU A 1 21  ? -20.987 -27.032 -7.781  1.00  19.31 ? 1474 LEU A HG   1 
ATOM   250  H  HD11 . LEU A 1 21  ? -20.951 -29.752 -8.461  1.00  21.36 ? 1474 LEU A HD11 1 
ATOM   251  H  HD12 . LEU A 1 21  ? -19.804 -28.736 -8.816  1.00  21.36 ? 1474 LEU A HD12 1 
ATOM   252  H  HD13 . LEU A 1 21  ? -20.093 -29.105 -7.314  1.00  21.36 ? 1474 LEU A HD13 1 
ATOM   253  H  HD21 . LEU A 1 21  ? -22.614 -26.714 -9.388  1.00  22.41 ? 1474 LEU A HD21 1 
ATOM   254  H  HD22 . LEU A 1 21  ? -21.325 -27.307 -10.066 1.00  22.41 ? 1474 LEU A HD22 1 
ATOM   255  H  HD23 . LEU A 1 21  ? -22.557 -28.238 -9.773  1.00  22.41 ? 1474 LEU A HD23 1 
ATOM   256  N  N    . ARG A 1 22  ? -25.115 -26.639 -5.112  1.00  14.30 ? 1475 ARG A N    1 
ATOM   257  C  CA   . ARG A 1 22  ? -26.373 -26.699 -4.337  1.00  14.97 ? 1475 ARG A CA   1 
ATOM   258  C  C    . ARG A 1 22  ? -26.565 -27.892 -3.413  1.00  17.71 ? 1475 ARG A C    1 
ATOM   259  O  O    . ARG A 1 22  ? -27.605 -28.029 -2.781  1.00  21.58 ? 1475 ARG A O    1 
ATOM   260  C  CB   . ARG A 1 22  ? -27.593 -26.600 -5.260  1.00  14.89 ? 1475 ARG A CB   1 
ATOM   261  C  CG   . ARG A 1 22  ? -27.557 -25.411 -6.195  1.00  16.35 ? 1475 ARG A CG   1 
ATOM   262  C  CD   . ARG A 1 22  ? -27.486 -24.097 -5.440  1.00  16.43 ? 1475 ARG A CD   1 
ATOM   263  N  NE   . ARG A 1 22  ? -27.730 -22.951 -6.324  1.00  15.53 ? 1475 ARG A NE   1 
ATOM   264  C  CZ   . ARG A 1 22  ? -27.392 -21.696 -6.053  1.00  15.32 ? 1475 ARG A CZ   1 
ATOM   265  N  NH1  . ARG A 1 22  ? -26.741 -21.393 -4.937  1.00  16.24 ? 1475 ARG A NH1  1 
ATOM   266  N  NH2  . ARG A 1 22  ? -27.682 -20.744 -6.934  1.00  16.25 ? 1475 ARG A NH2  1 
ATOM   267  H  H    . ARG A 1 22  ? -24.590 -26.010 -4.851  1.00  17.16 ? 1475 ARG A H    1 
ATOM   268  H  HA   . ARG A 1 22  ? -26.396 -25.904 -3.764  1.00  17.96 ? 1475 ARG A HA   1 
ATOM   269  H  HB2  . ARG A 1 22  ? -27.639 -27.403 -5.803  1.00  17.87 ? 1475 ARG A HB2  1 
ATOM   270  H  HB3  . ARG A 1 22  ? -28.392 -26.525 -4.715  1.00  17.87 ? 1475 ARG A HB3  1 
ATOM   271  H  HG2  . ARG A 1 22  ? -26.773 -25.476 -6.763  1.00  19.62 ? 1475 ARG A HG2  1 
ATOM   272  H  HG3  . ARG A 1 22  ? -28.362 -25.407 -6.736  1.00  19.62 ? 1475 ARG A HG3  1 
ATOM   273  H  HD2  . ARG A 1 22  ? -28.162 -24.092 -4.744  1.00  19.71 ? 1475 ARG A HD2  1 
ATOM   274  H  HD3  . ARG A 1 22  ? -26.603 -23.999 -5.052  1.00  19.71 ? 1475 ARG A HD3  1 
ATOM   275  H  HE   . ARG A 1 22  ? -28.121 -23.105 -7.074  1.00  18.63 ? 1475 ARG A HE   1 
ATOM   276  H  HH11 . ARG A 1 22  ? -26.555 -22.009 -4.367  1.00  19.49 ? 1475 ARG A HH11 1 
ATOM   277  H  HH12 . ARG A 1 22  ? -26.521 -20.577 -4.776  1.00  19.49 ? 1475 ARG A HH12 1 
ATOM   278  H  HH21 . ARG A 1 22  ? -28.095 -20.942 -7.661  1.00  19.49 ? 1475 ARG A HH21 1 
ATOM   279  H  HH22 . ARG A 1 22  ? -27.456 -19.929 -6.776  1.00  19.49 ? 1475 ARG A HH22 1 
ATOM   280  N  N    . GLU A 1 23  ? -25.580 -28.763 -3.339  1.00  17.30 ? 1476 GLU A N    1 
ATOM   281  C  CA   . GLU A 1 23  ? -25.650 -29.911 -2.455  1.00  17.67 ? 1476 GLU A CA   1 
ATOM   282  C  C    . GLU A 1 23  ? -24.583 -29.707 -1.386  1.00  18.59 ? 1476 GLU A C    1 
ATOM   283  O  O    . GLU A 1 23  ? -23.436 -29.453 -1.707  1.00  19.81 ? 1476 GLU A O    1 
ATOM   284  C  CB   . GLU A 1 23  ? -25.394 -31.199 -3.253  1.00  17.13 ? 1476 GLU A CB   1 
ATOM   285  C  CG   . GLU A 1 23  ? -25.569 -32.478 -2.423  1.00  17.60 ? 1476 GLU A CG   1 
ATOM   286  C  CD   . GLU A 1 23  ? -25.424 -33.766 -3.216  1.00  18.20 ? 1476 GLU A CD   1 
ATOM   287  O  OE1  . GLU A 1 23  ? -25.118 -33.725 -4.420  1.00  18.75 ? 1476 GLU A OE1  1 
ATOM   288  O  OE2  . GLU A 1 23  ? -25.633 -34.840 -2.618  1.00  20.94 ? 1476 GLU A OE2  1 
ATOM   289  H  H    . GLU A 1 23  ? -24.853 -28.714 -3.795  1.00  20.77 ? 1476 GLU A H    1 
ATOM   290  H  HA   . GLU A 1 23  ? -26.532 -29.961 -2.030  1.00  21.20 ? 1476 GLU A HA   1 
ATOM   291  H  HB2  . GLU A 1 23  ? -26.018 -31.238 -3.994  1.00  20.56 ? 1476 GLU A HB2  1 
ATOM   292  H  HB3  . GLU A 1 23  ? -24.484 -31.184 -3.588  1.00  20.56 ? 1476 GLU A HB3  1 
ATOM   293  H  HG2  . GLU A 1 23  ? -24.899 -32.487 -1.722  1.00  21.12 ? 1476 GLU A HG2  1 
ATOM   294  H  HG3  . GLU A 1 23  ? -26.455 -32.473 -2.029  1.00  21.12 ? 1476 GLU A HG3  1 
ATOM   295  N  N    . PRO A 1 24  ? -24.953 -29.794 -0.104  1.00  18.98 ? 1477 PRO A N    1 
ATOM   296  C  CA   . PRO A 1 24  ? -26.256 -30.193 0.454   1.00  19.89 ? 1477 PRO A CA   1 
ATOM   297  C  C    . PRO A 1 24  ? -27.320 -29.088 0.451   1.00  19.81 ? 1477 PRO A C    1 
ATOM   298  O  O    . PRO A 1 24  ? -26.987 -27.896 0.432   1.00  19.64 ? 1477 PRO A O    1 
ATOM   299  C  CB   . PRO A 1 24  ? -25.904 -30.559 1.899   1.00  20.68 ? 1477 PRO A CB   1 
ATOM   300  C  CG   . PRO A 1 24  ? -24.729 -29.679 2.218   1.00  21.22 ? 1477 PRO A CG   1 
ATOM   301  C  CD   . PRO A 1 24  ? -23.933 -29.603 0.948   1.00  20.34 ? 1477 PRO A CD   1 
ATOM   302  H  HA   . PRO A 1 24  ? -26.602 -30.984 -0.010  1.00  23.87 ? 1477 PRO A HA   1 
ATOM   303  H  HB2  . PRO A 1 24  ? -26.654 -30.360 2.481   1.00  24.82 ? 1477 PRO A HB2  1 
ATOM   304  H  HB3  . PRO A 1 24  ? -25.660 -31.496 1.952   1.00  24.82 ? 1477 PRO A HB3  1 
ATOM   305  H  HG2  . PRO A 1 24  ? -25.042 -28.799 2.480   1.00  25.46 ? 1477 PRO A HG2  1 
ATOM   306  H  HG3  . PRO A 1 24  ? -24.204 -30.082 2.928   1.00  25.46 ? 1477 PRO A HG3  1 
ATOM   307  H  HD2  . PRO A 1 24  ? -23.517 -28.731 0.862   1.00  24.41 ? 1477 PRO A HD2  1 
ATOM   308  H  HD3  . PRO A 1 24  ? -23.277 -30.316 0.917   1.00  24.41 ? 1477 PRO A HD3  1 
ATOM   309  N  N    . GLY A 1 25  ? -28.590 -29.495 0.459   1.00  20.23 ? 1478 GLY A N    1 
ATOM   310  C  CA   . GLY A 1 25  ? -29.675 -28.617 0.878   1.00  20.74 ? 1478 GLY A CA   1 
ATOM   311  C  C    . GLY A 1 25  ? -30.504 -27.883 -0.164  1.00  22.75 ? 1478 GLY A C    1 
ATOM   312  O  O    . GLY A 1 25  ? -31.554 -27.318 0.173   1.00  25.02 ? 1478 GLY A O    1 
ATOM   313  H  H    . GLY A 1 25  ? -28.847 -30.281 0.224   1.00  24.27 ? 1478 GLY A H    1 
ATOM   314  H  HA2  . GLY A 1 25  ? -30.294 -29.144 1.408   1.00  24.88 ? 1478 GLY A HA2  1 
ATOM   315  H  HA3  . GLY A 1 25  ? -29.300 -27.942 1.464   1.00  24.88 ? 1478 GLY A HA3  1 
ATOM   316  N  N    . GLY A 1 26  ? -30.043 -27.868 -1.410  1.00  21.38 ? 1479 GLY A N    1 
ATOM   317  C  CA   . GLY A 1 26  ? -30.779 -27.216 -2.473  1.00  20.64 ? 1479 GLY A CA   1 
ATOM   318  C  C    . GLY A 1 26  ? -30.853 -28.078 -3.708  1.00  19.61 ? 1479 GLY A C    1 
ATOM   319  O  O    . GLY A 1 26  ? -30.770 -27.567 -4.829  1.00  18.85 ? 1479 GLY A O    1 
ATOM   320  H  H    . GLY A 1 26  ? -29.304 -28.229 -1.662  1.00  25.65 ? 1479 GLY A H    1 
ATOM   321  H  HA2  . GLY A 1 26  ? -31.682 -27.026 -2.174  1.00  24.76 ? 1479 GLY A HA2  1 
ATOM   322  H  HA3  . GLY A 1 26  ? -30.346 -26.380 -2.704  1.00  24.76 ? 1479 GLY A HA3  1 
ATOM   323  N  N    . THR A 1 27  ? -31.033 -29.385 -3.511  1.00  19.24 ? 1480 THR A N    1 
ATOM   324  C  CA   . THR A 1 27  ? -30.780 -30.338 -4.591  1.00  20.13 ? 1480 THR A CA   1 
ATOM   325  C  C    . THR A 1 27  ? -31.850 -30.373 -5.675  1.00  20.54 ? 1480 THR A C    1 
ATOM   326  O  O    . THR A 1 27  ? -31.646 -31.002 -6.711  1.00  21.81 ? 1480 THR A O    1 
ATOM   327  C  CB   . THR A 1 27  ? -30.501 -31.772 -4.076  1.00  20.69 ? 1480 THR A CB   1 
ATOM   328  O  OG1  . THR A 1 27  ? -31.639 -32.280 -3.357  1.00  22.23 ? 1480 THR A OG1  1 
ATOM   329  C  CG2  . THR A 1 27  ? -29.227 -31.799 -3.198  1.00  21.30 ? 1480 THR A CG2  1 
ATOM   330  H  H    . THR A 1 27  ? -31.297 -29.740 -2.774  1.00  23.09 ? 1480 THR A H    1 
ATOM   331  H  HA   . THR A 1 27  ? -29.957 -30.048 -5.036  1.00  24.15 ? 1480 THR A HA   1 
ATOM   332  H  HB   . THR A 1 27  ? -30.340 -32.347 -4.841  1.00  24.83 ? 1480 THR A HB   1 
ATOM   333  H  HG1  . THR A 1 27  ? -31.803 -31.798 -2.715  1.00  26.68 ? 1480 THR A HG1  1 
ATOM   334  H  HG21 . THR A 1 27  ? -29.338 -31.218 -2.442  1.00  25.57 ? 1480 THR A HG21 1 
ATOM   335  H  HG22 . THR A 1 27  ? -29.063 -32.691 -2.885  1.00  25.57 ? 1480 THR A HG22 1 
ATOM   336  H  HG23 . THR A 1 27  ? -28.470 -31.504 -3.710  1.00  25.57 ? 1480 THR A HG23 1 
ATOM   337  N  N    . HIS A 1 28  ? -32.975 -29.691 -5.456  1.00  19.73 ? 1481 HIS A N    1 
ATOM   338  C  CA   . HIS A 1 28  ? -33.945 -29.473 -6.534  1.00  19.88 ? 1481 HIS A CA   1 
ATOM   339  C  C    . HIS A 1 28  ? -33.395 -28.517 -7.594  1.00  19.58 ? 1481 HIS A C    1 
ATOM   340  O  O    . HIS A 1 28  ? -33.832 -28.535 -8.745  1.00  20.85 ? 1481 HIS A O    1 
ATOM   341  C  CB   . HIS A 1 28  ? -35.288 -28.962 -5.996  1.00  20.55 ? 1481 HIS A CB   1 
ATOM   342  C  CG   . HIS A 1 28  ? -35.215 -27.621 -5.337  1.00  21.21 ? 1481 HIS A CG   1 
ATOM   343  N  ND1  . HIS A 1 28  ? -34.602 -27.420 -4.118  1.00  22.06 ? 1481 HIS A ND1  1 
ATOM   344  C  CD2  . HIS A 1 28  ? -35.662 -26.405 -5.737  1.00  20.91 ? 1481 HIS A CD2  1 
ATOM   345  C  CE1  . HIS A 1 28  ? -34.667 -26.141 -3.798  1.00  22.28 ? 1481 HIS A CE1  1 
ATOM   346  N  NE2  . HIS A 1 28  ? -35.304 -25.503 -4.764  1.00  21.82 ? 1481 HIS A NE2  1 
ATOM   347  H  H    . HIS A 1 28  ? -33.200 -29.347 -4.701  1.00  23.68 ? 1481 HIS A H    1 
ATOM   348  H  HA   . HIS A 1 28  ? -34.114 -30.332 -6.975  1.00  23.86 ? 1481 HIS A HA   1 
ATOM   349  H  HB2  . HIS A 1 28  ? -35.914 -28.895 -6.734  1.00  24.66 ? 1481 HIS A HB2  1 
ATOM   350  H  HB3  . HIS A 1 28  ? -35.622 -29.595 -5.340  1.00  24.66 ? 1481 HIS A HB3  1 
ATOM   351  H  HD1  . HIS A 1 28  ? -34.225 -28.031 -3.645  1.00  26.47 ? 1481 HIS A HD1  1 
ATOM   352  H  HD2  . HIS A 1 28  ? -36.114 -26.216 -6.527  1.00  25.10 ? 1481 HIS A HD2  1 
ATOM   353  H  HE1  . HIS A 1 28  ? -34.331 -25.756 -3.021  1.00  26.74 ? 1481 HIS A HE1  1 
ATOM   354  H  HE2  . HIS A 1 28  ? -35.478 -24.661 -4.776  1.00  26.19 ? 1481 HIS A HE2  1 
ATOM   355  N  N    . LYS A 1 29  ? -32.424 -27.698 -7.207  1.00  17.97 ? 1482 LYS A N    1 
ATOM   356  C  CA   . LYS A 1 29  ? -31.847 -26.703 -8.114  1.00  17.09 ? 1482 LYS A CA   1 
ATOM   357  C  C    . LYS A 1 29  ? -30.727 -27.308 -8.944  1.00  16.85 ? 1482 LYS A C    1 
ATOM   358  O  O    . LYS A 1 29  ? -30.475 -26.884 -10.084 1.00  17.24 ? 1482 LYS A O    1 
ATOM   359  C  CB   . LYS A 1 29  ? -31.243 -25.544 -7.314  1.00  17.08 ? 1482 LYS A CB   1 
ATOM   360  C  CG   . LYS A 1 29  ? -32.189 -24.803 -6.377  1.00  17.24 ? 1482 LYS A CG   1 
ATOM   361  C  CD   . LYS A 1 29  ? -31.354 -23.879 -5.467  1.00  17.91 ? 1482 LYS A CD   1 
ATOM   362  C  CE   . LYS A 1 29  ? -32.197 -23.097 -4.470  1.00  18.66 ? 1482 LYS A CE   1 
ATOM   363  N  NZ   . LYS A 1 29  ? -33.032 -22.048 -5.076  1.00  19.57 ? 1482 LYS A NZ   1 
ATOM   364  H  H    . LYS A 1 29  ? -32.077 -27.696 -6.421  1.00  21.56 ? 1482 LYS A H    1 
ATOM   365  H  HA   . LYS A 1 29  ? -32.537 -26.352 -8.715  1.00  20.51 ? 1482 LYS A HA   1 
ATOM   366  H  HB2  . LYS A 1 29  ? -30.518 -25.894 -6.773  1.00  20.50 ? 1482 LYS A HB2  1 
ATOM   367  H  HB3  . LYS A 1 29  ? -30.891 -24.893 -7.941  1.00  20.50 ? 1482 LYS A HB3  1 
ATOM   368  H  HG2  . LYS A 1 29  ? -32.806 -24.261 -6.893  1.00  20.68 ? 1482 LYS A HG2  1 
ATOM   369  H  HG3  . LYS A 1 29  ? -32.668 -25.439 -5.822  1.00  20.68 ? 1482 LYS A HG3  1 
ATOM   370  H  HD2  . LYS A 1 29  ? -30.723 -24.419 -4.966  1.00  21.50 ? 1482 LYS A HD2  1 
ATOM   371  H  HD3  . LYS A 1 29  ? -30.877 -23.241 -6.021  1.00  21.50 ? 1482 LYS A HD3  1 
ATOM   372  H  HE2  . LYS A 1 29  ? -32.787 -23.714 -4.010  1.00  22.39 ? 1482 LYS A HE2  1 
ATOM   373  H  HE3  . LYS A 1 29  ? -31.606 -22.670 -3.831  1.00  22.39 ? 1482 LYS A HE3  1 
ATOM   374  H  HZ1  . LYS A 1 29  ? -33.597 -22.409 -5.661  1.00  23.48 ? 1482 LYS A HZ1  1 
ATOM   375  H  HZ2  . LYS A 1 29  ? -33.498 -21.628 -4.445  1.00  23.48 ? 1482 LYS A HZ2  1 
ATOM   376  H  HZ3  . LYS A 1 29  ? -32.518 -21.456 -5.498  1.00  23.48 ? 1482 LYS A HZ3  1 
ATOM   377  N  N    . GLU A 1 30  ? -30.022 -28.256 -8.323  1.00  16.84 ? 1483 GLU A N    1 
ATOM   378  C  CA   . GLU A 1 30  ? -28.804 -28.870 -8.859  1.00  16.08 ? 1483 GLU A CA   1 
ATOM   379  C  C    . GLU A 1 30  ? -28.280 -29.816 -7.779  1.00  16.38 ? 1483 GLU A C    1 
ATOM   380  O  O    . GLU A 1 30  ? -28.521 -29.599 -6.595  1.00  16.69 ? 1483 GLU A O    1 
ATOM   381  C  CB   . GLU A 1 30  ? -27.721 -27.814 -9.130  1.00  16.02 ? 1483 GLU A CB   1 
ATOM   382  C  CG   . GLU A 1 30  ? -26.667 -28.253 -10.123 1.00  15.69 ? 1483 GLU A CG   1 
ATOM   383  C  CD   . GLU A 1 30  ? -27.174 -28.191 -11.532 1.00  15.52 ? 1483 GLU A CD   1 
ATOM   384  O  OE1  . GLU A 1 30  ? -27.865 -29.140 -11.966 1.00  15.85 ? 1483 GLU A OE1  1 
ATOM   385  O  OE2  . GLU A 1 30  ? -26.932 -27.173 -12.198 1.00  15.71 ? 1483 GLU A OE2  1 
ATOM   386  H  H    . GLU A 1 30  ? -30.241 -28.574 -7.555  1.00  20.21 ? 1483 GLU A H    1 
ATOM   387  H  HA   . GLU A 1 30  ? -28.995 -29.372 -9.679  1.00  19.30 ? 1483 GLU A HA   1 
ATOM   388  H  HB2  . GLU A 1 30  ? -28.145 -27.016 -9.482  1.00  19.23 ? 1483 GLU A HB2  1 
ATOM   389  H  HB3  . GLU A 1 30  ? -27.273 -27.606 -8.295  1.00  19.23 ? 1483 GLU A HB3  1 
ATOM   390  H  HG2  . GLU A 1 30  ? -25.897 -27.668 -10.052 1.00  18.83 ? 1483 GLU A HG2  1 
ATOM   391  H  HG3  . GLU A 1 30  ? -26.411 -29.169 -9.933  1.00  18.83 ? 1483 GLU A HG3  1 
ATOM   392  N  N    . ASP A 1 31  ? -27.542 -30.844 -8.156  1.00  16.77 ? 1484 ASP A N    1 
ATOM   393  C  CA   . ASP A 1 31  ? -26.733 -31.547 -7.159  1.00  16.37 ? 1484 ASP A CA   1 
ATOM   394  C  C    . ASP A 1 31  ? -25.351 -31.833 -7.741  1.00  16.40 ? 1484 ASP A C    1 
ATOM   395  O  O    . ASP A 1 31  ? -25.039 -31.407 -8.866  1.00  16.03 ? 1484 ASP A O    1 
ATOM   396  C  CB   . ASP A 1 31  ? -27.444 -32.798 -6.573  1.00  17.04 ? 1484 ASP A CB   1 
ATOM   397  C  CG   . ASP A 1 31  ? -27.829 -33.836 -7.614  1.00  19.52 ? 1484 ASP A CG   1 
ATOM   398  O  OD1  . ASP A 1 31  ? -27.275 -33.870 -8.721  1.00  18.35 ? 1484 ASP A OD1  1 
ATOM   399  O  OD2  . ASP A 1 31  ? -28.722 -34.655 -7.298  1.00  23.35 ? 1484 ASP A OD2  1 
ATOM   400  H  H    . ASP A 1 31  ? -27.487 -31.153 -8.957  1.00  20.12 ? 1484 ASP A H    1 
ATOM   401  H  HA   . ASP A 1 31  ? -26.595 -30.933 -6.408  1.00  19.65 ? 1484 ASP A HA   1 
ATOM   402  H  HB2  . ASP A 1 31  ? -26.850 -33.224 -5.936  1.00  20.44 ? 1484 ASP A HB2  1 
ATOM   403  H  HB3  . ASP A 1 31  ? -28.256 -32.514 -6.125  1.00  20.44 ? 1484 ASP A HB3  1 
ATOM   404  N  N    . PHE A 1 32  ? -24.483 -32.488 -6.979  1.00  16.61 ? 1485 PHE A N    1 
ATOM   405  C  CA   . PHE A 1 32  ? -23.140 -32.747 -7.503  1.00  15.84 ? 1485 PHE A CA   1 
ATOM   406  C  C    . PHE A 1 32  ? -23.224 -33.525 -8.811  1.00  16.43 ? 1485 PHE A C    1 
ATOM   407  O  O    . PHE A 1 32  ? -22.530 -33.200 -9.773  1.00  16.46 ? 1485 PHE A O    1 
ATOM   408  C  CB   . PHE A 1 32  ? -22.258 -33.482 -6.496  1.00  16.29 ? 1485 PHE A CB   1 
ATOM   409  C  CG   . PHE A 1 32  ? -21.701 -32.593 -5.428  1.00  17.55 ? 1485 PHE A CG   1 
ATOM   410  C  CD1  . PHE A 1 32  ? -20.800 -31.602 -5.754  1.00  19.48 ? 1485 PHE A CD1  1 
ATOM   411  C  CD2  . PHE A 1 32  ? -22.068 -32.751 -4.097  1.00  18.60 ? 1485 PHE A CD2  1 
ATOM   412  C  CE1  . PHE A 1 32  ? -20.269 -30.765 -4.770  1.00  20.21 ? 1485 PHE A CE1  1 
ATOM   413  C  CE2  . PHE A 1 32  ? -21.555 -31.912 -3.122  1.00  19.98 ? 1485 PHE A CE2  1 
ATOM   414  C  CZ   . PHE A 1 32  ? -20.661 -30.918 -3.460  1.00  21.16 ? 1485 PHE A CZ   1 
ATOM   415  H  H    . PHE A 1 32  ? -24.633 -32.784 -6.186  1.00  19.93 ? 1485 PHE A H    1 
ATOM   416  H  HA   . PHE A 1 32  ? -22.711 -31.887 -7.698  1.00  19.01 ? 1485 PHE A HA   1 
ATOM   417  H  HB2  . PHE A 1 32  ? -22.785 -34.172 -6.064  1.00  19.55 ? 1485 PHE A HB2  1 
ATOM   418  H  HB3  . PHE A 1 32  ? -21.512 -33.884 -6.968  1.00  19.55 ? 1485 PHE A HB3  1 
ATOM   419  H  HD1  . PHE A 1 32  ? -20.543 -31.489 -6.641  1.00  23.38 ? 1485 PHE A HD1  1 
ATOM   420  H  HD2  . PHE A 1 32  ? -22.680 -33.411 -3.863  1.00  22.32 ? 1485 PHE A HD2  1 
ATOM   421  H  HE1  . PHE A 1 32  ? -19.668 -30.095 -5.003  1.00  24.25 ? 1485 PHE A HE1  1 
ATOM   422  H  HE2  . PHE A 1 32  ? -21.810 -32.023 -2.234  1.00  23.98 ? 1485 PHE A HE2  1 
ATOM   423  H  HZ   . PHE A 1 32  ? -20.307 -30.366 -2.800  1.00  25.39 ? 1485 PHE A HZ   1 
ATOM   424  N  N    . ALA A 1 33  ? -24.100 -34.519 -8.866  1.00  16.33 ? 1486 ALA A N    1 
ATOM   425  C  CA   . ALA A 1 33  ? -24.187 -35.337 -10.076 1.00  16.96 ? 1486 ALA A CA   1 
ATOM   426  C  C    . ALA A 1 33  ? -24.676 -34.536 -11.289 1.00  17.54 ? 1486 ALA A C    1 
ATOM   427  O  O    . ALA A 1 33  ? -24.105 -34.654 -12.377 1.00  18.01 ? 1486 ALA A O    1 
ATOM   428  C  CB   . ALA A 1 33  ? -25.066 -36.554 -9.845  1.00  18.08 ? 1486 ALA A CB   1 
ATOM   429  H  H    . ALA A 1 33  ? -24.644 -34.739 -8.237  1.00  19.59 ? 1486 ALA A H    1 
ATOM   430  H  HA   . ALA A 1 33  ? -23.288 -35.664 -10.288 1.00  20.35 ? 1486 ALA A HA   1 
ATOM   431  H  HB1  . ALA A 1 33  ? -25.947 -36.261 -9.602  1.00  21.70 ? 1486 ALA A HB1  1 
ATOM   432  H  HB2  . ALA A 1 33  ? -25.103 -37.070 -10.654 1.00  21.70 ? 1486 ALA A HB2  1 
ATOM   433  H  HB3  . ALA A 1 33  ? -24.689 -37.081 -9.137  1.00  21.70 ? 1486 ALA A HB3  1 
ATOM   434  N  N    . SER A 1 34  ? -25.715 -33.719 -11.128 1.00  16.64 ? 1487 SER A N    1 
ATOM   435  C  CA   . SER A 1 34  ? -26.239 -32.981 -12.280 1.00  16.78 ? 1487 SER A CA   1 
ATOM   436  C  C    . SER A 1 34  ? -25.342 -31.820 -12.667 1.00  16.08 ? 1487 SER A C    1 
ATOM   437  O  O    . SER A 1 34  ? -25.154 -31.530 -13.854 1.00  16.95 ? 1487 SER A O    1 
ATOM   438  C  CB   . SER A 1 34  ? -27.669 -32.491 -12.020 1.00  16.66 ? 1487 SER A CB   1 
ATOM   439  O  OG   . SER A 1 34  ? -27.721 -31.550 -10.957 1.00  16.70 ? 1487 SER A OG   1 
ATOM   440  H  H    . SER A 1 34  ? -26.126 -33.575 -10.387 1.00  19.97 ? 1487 SER A H    1 
ATOM   441  H  HA   . SER A 1 34  ? -26.274 -33.591 -13.046 1.00  20.14 ? 1487 SER A HA   1 
ATOM   442  H  HB2  . SER A 1 34  ? -28.007 -32.070 -12.827 1.00  19.99 ? 1487 SER A HB2  1 
ATOM   443  H  HB3  . SER A 1 34  ? -28.224 -33.253 -11.790 1.00  19.99 ? 1487 SER A HB3  1 
ATOM   444  H  HG   . SER A 1 34  ? -28.494 -31.304 -10.838 1.00  20.03 ? 1487 SER A HG   1 
ATOM   445  N  N    . GLY A 1 35  ? -24.797 -31.138 -11.666 1.00  14.99 ? 1488 GLY A N    1 
ATOM   446  C  CA   . GLY A 1 35  ? -23.952 -29.989 -11.931 1.00  14.76 ? 1488 GLY A CA   1 
ATOM   447  C  C    . GLY A 1 35  ? -22.646 -30.378 -12.597 1.00  15.00 ? 1488 GLY A C    1 
ATOM   448  O  O    . GLY A 1 35  ? -22.134 -29.670 -13.460 1.00  14.89 ? 1488 GLY A O    1 
ATOM   449  H  H    . GLY A 1 35  ? -24.902 -31.320 -10.832 1.00  17.99 ? 1488 GLY A H    1 
ATOM   450  H  HA2  . GLY A 1 35  ? -24.421 -29.370 -12.512 1.00  17.71 ? 1488 GLY A HA2  1 
ATOM   451  H  HA3  . GLY A 1 35  ? -23.749 -29.537 -11.098 1.00  17.71 ? 1488 GLY A HA3  1 
ATOM   452  N  N    . THR A 1 36  ? -22.092 -31.513 -12.196 1.00  15.08 ? 1489 THR A N    1 
ATOM   453  C  CA   . THR A 1 36  ? -20.857 -31.962 -12.833 1.00  14.93 ? 1489 THR A CA   1 
ATOM   454  C  C    . THR A 1 36  ? -21.128 -32.596 -14.203 1.00  15.30 ? 1489 THR A C    1 
ATOM   455  O  O    . THR A 1 36  ? -20.243 -32.577 -15.059 1.00  15.81 ? 1489 THR A O    1 
ATOM   456  C  CB   . THR A 1 36  ? -20.016 -32.896 -11.942 1.00  15.71 ? 1489 THR A CB   1 
ATOM   457  O  OG1  . THR A 1 36  ? -20.750 -34.093 -11.634 1.00  15.55 ? 1489 THR A OG1  1 
ATOM   458  C  CG2  . THR A 1 36  ? -19.581 -32.174 -10.654 1.00  16.79 ? 1489 THR A CG2  1 
ATOM   459  H  H    . THR A 1 36  ? -22.396 -32.029 -11.579 1.00  18.09 ? 1489 THR A H    1 
ATOM   460  H  HA   . THR A 1 36  ? -20.307 -31.168 -12.998 1.00  17.92 ? 1489 THR A HA   1 
ATOM   461  H  HB   . THR A 1 36  ? -19.212 -33.142 -12.425 1.00  18.85 ? 1489 THR A HB   1 
ATOM   462  H  HG1  . THR A 1 36  ? -21.441 -33.904 -11.236 1.00  18.65 ? 1489 THR A HG1  1 
ATOM   463  H  HG21 . THR A 1 36  ? -20.354 -31.893 -10.158 1.00  20.14 ? 1489 THR A HG21 1 
ATOM   464  H  HG22 . THR A 1 36  ? -19.058 -32.766 -10.107 1.00  20.14 ? 1489 THR A HG22 1 
ATOM   465  H  HG23 . THR A 1 36  ? -19.053 -31.403 -10.872 1.00  20.14 ? 1489 THR A HG23 1 
ATOM   466  N  N    . ALA A 1 37  ? -22.327 -33.148 -14.426 1.00  15.20 ? 1490 ALA A N    1 
ATOM   467  C  CA   . ALA A 1 37  ? -22.717 -33.523 -15.783 1.00  15.98 ? 1490 ALA A CA   1 
ATOM   468  C  C    . ALA A 1 37  ? -22.741 -32.270 -16.667 1.00  15.18 ? 1490 ALA A C    1 
ATOM   469  O  O    . ALA A 1 37  ? -22.232 -32.273 -17.788 1.00  16.10 ? 1490 ALA A O    1 
ATOM   470  C  CB   . ALA A 1 37  ? -24.068 -34.226 -15.797 1.00  17.16 ? 1490 ALA A CB   1 
ATOM   471  H  H    . ALA A 1 37  ? -22.917 -33.311 -13.822 1.00  18.24 ? 1490 ALA A H    1 
ATOM   472  H  HA   . ALA A 1 37  ? -22.049 -34.141 -16.149 1.00  19.18 ? 1490 ALA A HA   1 
ATOM   473  H  HB1  . ALA A 1 37  ? -24.732 -33.633 -15.437 1.00  20.59 ? 1490 ALA A HB1  1 
ATOM   474  H  HB2  . ALA A 1 37  ? -24.291 -34.457 -16.702 1.00  20.59 ? 1490 ALA A HB2  1 
ATOM   475  H  HB3  . ALA A 1 37  ? -24.013 -35.020 -15.260 1.00  20.59 ? 1490 ALA A HB3  1 
ATOM   476  N  N    . ALA A 1 38  ? -23.308 -31.193 -16.142 1.00  15.69 ? 1491 ALA A N    1 
ATOM   477  C  CA   . ALA A 1 38  ? -23.328 -29.924 -16.854 1.00  15.63 ? 1491 ALA A CA   1 
ATOM   478  C  C    . ALA A 1 38  ? -21.908 -29.431 -17.154 1.00  15.14 ? 1491 ALA A C    1 
ATOM   479  O  O    . ALA A 1 38  ? -21.622 -28.935 -18.240 1.00  14.63 ? 1491 ALA A O    1 
ATOM   480  C  CB   . ALA A 1 38  ? -24.076 -28.874 -16.032 1.00  15.55 ? 1491 ALA A CB   1 
ATOM   481  H  H    . ALA A 1 38  ? -23.690 -31.170 -15.372 1.00  18.83 ? 1491 ALA A H    1 
ATOM   482  H  HA   . ALA A 1 38  ? -23.798 -30.039 -17.706 1.00  18.75 ? 1491 ALA A HA   1 
ATOM   483  H  HB1  . ALA A 1 38  ? -23.630 -28.761 -15.189 1.00  18.65 ? 1491 ALA A HB1  1 
ATOM   484  H  HB2  . ALA A 1 38  ? -24.080 -28.044 -16.514 1.00  18.65 ? 1491 ALA A HB2  1 
ATOM   485  H  HB3  . ALA A 1 38  ? -24.977 -29.174 -15.888 1.00  18.65 ? 1491 ALA A HB3  1 
ATOM   486  N  N    . ALA A 1 39  ? -21.027 -29.551 -16.170 1.00  15.16 ? 1492 ALA A N    1 
ATOM   487  C  CA   . ALA A 1 39  ? -19.638 -29.164 -16.350 1.00  14.28 ? 1492 ALA A CA   1 
ATOM   488  C  C    . ALA A 1 39  ? -19.009 -29.948 -17.510 1.00  14.11 ? 1492 ALA A C    1 
ATOM   489  O  O    . ALA A 1 39  ? -18.414 -29.366 -18.429 1.00  14.61 ? 1492 ALA A O    1 
ATOM   490  C  CB   . ALA A 1 39  ? -18.842 -29.377 -15.061 1.00  14.32 ? 1492 ALA A CB   1 
ATOM   491  H  H    . ALA A 1 39  ? -21.210 -29.855 -15.387 1.00  18.19 ? 1492 ALA A H    1 
ATOM   492  H  HA   . ALA A 1 39  ? -19.600 -28.211 -16.574 1.00  17.13 ? 1492 ALA A HA   1 
ATOM   493  H  HB1  . ALA A 1 39  ? -18.880 -30.306 -14.821 1.00  17.18 ? 1492 ALA A HB1  1 
ATOM   494  H  HB2  . ALA A 1 39  ? -17.931 -29.114 -15.210 1.00  17.18 ? 1492 ALA A HB2  1 
ATOM   495  H  HB3  . ALA A 1 39  ? -19.228 -28.842 -14.364 1.00  17.18 ? 1492 ALA A HB3  1 
ATOM   496  N  N    . LEU A 1 40  ? -19.134 -31.265 -17.480 1.00  15.16 ? 1493 LEU A N    1 
ATOM   497  C  CA   . LEU A 1 40  ? -18.515 -32.081 -18.517 1.00  15.94 ? 1493 LEU A CA   1 
ATOM   498  C  C    . LEU A 1 40  ? -19.061 -31.713 -19.901 1.00  16.00 ? 1493 LEU A C    1 
ATOM   499  O  O    . LEU A 1 40  ? -18.299 -31.600 -20.863 1.00  16.23 ? 1493 LEU A O    1 
ATOM   500  C  CB   . LEU A 1 40  ? -18.735 -33.565 -18.233 1.00  16.34 ? 1493 LEU A CB   1 
ATOM   501  C  CG   . LEU A 1 40  ? -17.931 -34.105 -17.047 1.00  17.02 ? 1493 LEU A CG   1 
ATOM   502  C  CD1  . LEU A 1 40  ? -18.439 -35.509 -16.711 1.00  17.53 ? 1493 LEU A CD1  1 
ATOM   503  C  CD2  . LEU A 1 40  ? -16.457 -34.170 -17.357 1.00  17.21 ? 1493 LEU A CD2  1 
ATOM   504  H  H    . LEU A 1 40  ? -19.565 -31.707 -16.881 1.00  18.19 ? 1493 LEU A H    1 
ATOM   505  H  HA   . LEU A 1 40  ? -17.550 -31.914 -18.518 1.00  19.13 ? 1493 LEU A HA   1 
ATOM   506  H  HB2  . LEU A 1 40  ? -19.675 -33.710 -18.042 1.00  19.61 ? 1493 LEU A HB2  1 
ATOM   507  H  HB3  . LEU A 1 40  ? -18.478 -34.073 -19.019 1.00  19.61 ? 1493 LEU A HB3  1 
ATOM   508  H  HG   . LEU A 1 40  ? -18.062 -33.533 -16.275 1.00  20.42 ? 1493 LEU A HG   1 
ATOM   509  H  HD11 . LEU A 1 40  ? -18.319 -36.076 -17.477 1.00  21.04 ? 1493 LEU A HD11 1 
ATOM   510  H  HD12 . LEU A 1 40  ? -17.938 -35.853 -15.968 1.00  21.04 ? 1493 LEU A HD12 1 
ATOM   511  H  HD13 . LEU A 1 40  ? -19.370 -35.458 -16.484 1.00  21.04 ? 1493 LEU A HD13 1 
ATOM   512  H  HD21 . LEU A 1 40  ? -16.142 -33.287 -17.564 1.00  20.65 ? 1493 LEU A HD21 1 
ATOM   513  H  HD22 . LEU A 1 40  ? -15.992 -34.512 -16.590 1.00  20.65 ? 1493 LEU A HD22 1 
ATOM   514  H  HD23 . LEU A 1 40  ? -16.321 -34.751 -18.109 1.00  20.65 ? 1493 LEU A HD23 1 
ATOM   515  N  N    . ALA A 1 41  ? -20.375 -31.516 -20.005 1.00  15.68 ? 1494 ALA A N    1 
ATOM   516  C  CA   . ALA A 1 41  ? -20.976 -31.152 -21.286 1.00  17.05 ? 1494 ALA A CA   1 
ATOM   517  C  C    . ALA A 1 41  ? -20.489 -29.784 -21.790 1.00  16.95 ? 1494 ALA A C    1 
ATOM   518  O  O    . ALA A 1 41  ? -20.542 -29.495 -22.991 1.00  19.01 ? 1494 ALA A O    1 
ATOM   519  C  CB   . ALA A 1 41  ? -22.474 -31.159 -21.177 1.00  17.06 ? 1494 ALA A CB   1 
ATOM   520  H  H    . ALA A 1 41  ? -20.934 -31.586 -19.355 1.00  18.81 ? 1494 ALA A H    1 
ATOM   521  H  HA   . ALA A 1 41  ? -20.723 -31.823 -21.953 1.00  20.45 ? 1494 ALA A HA   1 
ATOM   522  H  HB1  . ALA A 1 41  ? -22.741 -30.524 -20.508 1.00  20.47 ? 1494 ALA A HB1  1 
ATOM   523  H  HB2  . ALA A 1 41  ? -22.849 -30.918 -22.027 1.00  20.47 ? 1494 ALA A HB2  1 
ATOM   524  H  HB3  . ALA A 1 41  ? -22.764 -32.039 -20.927 1.00  20.47 ? 1494 ALA A HB3  1 
ATOM   525  N  N    . GLY A 1 42  ? -20.027 -28.947 -20.863 1.00  15.68 ? 1495 GLY A N    1 
ATOM   526  C  CA   . GLY A 1 42  ? -19.462 -27.656 -21.198 1.00  15.89 ? 1495 GLY A CA   1 
ATOM   527  C  C    . GLY A 1 42  ? -17.953 -27.681 -21.346 1.00  15.70 ? 1495 GLY A C    1 
ATOM   528  O  O    . GLY A 1 42  ? -17.332 -26.627 -21.448 1.00  15.89 ? 1495 GLY A O    1 
ATOM   529  H  H    . GLY A 1 42  ? -20.033 -29.113 -20.019 1.00  18.81 ? 1495 GLY A H    1 
ATOM   530  H  HA2  . GLY A 1 42  ? -19.845 -27.347 -22.034 1.00  19.07 ? 1495 GLY A HA2  1 
ATOM   531  H  HA3  . GLY A 1 42  ? -19.689 -27.018 -20.504 1.00  19.07 ? 1495 GLY A HA3  1 
ATOM   532  N  N    . GLY A 1 43  ? -17.353 -28.872 -21.380 1.00  15.74 ? 1496 GLY A N    1 
ATOM   533  C  CA   . GLY A 1 43  ? -15.918 -28.980 -21.585 1.00  15.09 ? 1496 GLY A CA   1 
ATOM   534  C  C    . GLY A 1 43  ? -15.069 -28.693 -20.351 1.00  14.23 ? 1496 GLY A C    1 
ATOM   535  O  O    . GLY A 1 43  ? -13.857 -28.475 -20.459 1.00  15.82 ? 1496 GLY A O    1 
ATOM   536  H  H    . GLY A 1 43  ? -17.756 -29.626 -21.288 1.00  18.89 ? 1496 GLY A H    1 
ATOM   537  H  HA2  . GLY A 1 43  ? -15.710 -29.877 -21.888 1.00  18.11 ? 1496 GLY A HA2  1 
ATOM   538  H  HA3  . GLY A 1 43  ? -15.652 -28.359 -22.281 1.00  18.11 ? 1496 GLY A HA3  1 
ATOM   539  N  N    . ILE A 1 44  ? -15.703 -28.747 -19.182 1.00  14.14 ? 1497 ILE A N    1 
ATOM   540  C  CA   . ILE A 1 44  ? -15.056 -28.478 -17.906 1.00  13.36 ? 1497 ILE A CA   1 
ATOM   541  C  C    . ILE A 1 44  ? -14.823 -29.801 -17.161 1.00  14.27 ? 1497 ILE A C    1 
ATOM   542  O  O    . ILE A 1 44  ? -15.757 -30.581 -16.959 1.00  15.27 ? 1497 ILE A O    1 
ATOM   543  C  CB   . ILE A 1 44  ? -15.938 -27.525 -17.042 1.00  14.76 ? 1497 ILE A CB   1 
ATOM   544  C  CG1  . ILE A 1 44  ? -16.249 -26.232 -17.790 1.00  17.64 ? 1497 ILE A CG1  1 
ATOM   545  C  CG2  . ILE A 1 44  ? -15.295 -27.256 -15.689 1.00  15.42 ? 1497 ILE A CG2  1 
ATOM   546  C  CD1  . ILE A 1 44  ? -15.085 -25.469 -18.193 1.00  19.49 ? 1497 ILE A CD1  1 
ATOM   547  H  H    . ILE A 1 44  ? -16.536 -28.944 -19.104 1.00  16.97 ? 1497 ILE A H    1 
ATOM   548  H  HA   . ILE A 1 44  ? -14.189 -28.048 -18.060 1.00  16.03 ? 1497 ILE A HA   1 
ATOM   549  H  HB   . ILE A 1 44  ? -16.780 -27.977 -16.879 1.00  17.72 ? 1497 ILE A HB   1 
ATOM   550  H  HG12 . ILE A 1 44  ? -16.748 -26.451 -18.592 1.00  21.16 ? 1497 ILE A HG12 1 
ATOM   551  H  HG13 . ILE A 1 44  ? -16.787 -25.665 -17.216 1.00  21.16 ? 1497 ILE A HG13 1 
ATOM   552  H  HG21 . ILE A 1 44  ? -14.438 -26.846 -15.827 1.00  18.50 ? 1497 ILE A HG21 1 
ATOM   553  H  HG22 . ILE A 1 44  ? -15.862 -26.669 -15.185 1.00  18.50 ? 1497 ILE A HG22 1 
ATOM   554  H  HG23 . ILE A 1 44  ? -15.188 -28.089 -15.223 1.00  18.50 ? 1497 ILE A HG23 1 
ATOM   555  H  HD11 . ILE A 1 44  ? -14.544 -26.008 -18.775 1.00  23.39 ? 1497 ILE A HD11 1 
ATOM   556  H  HD12 . ILE A 1 44  ? -15.374 -24.677 -18.653 1.00  23.39 ? 1497 ILE A HD12 1 
ATOM   557  H  HD13 . ILE A 1 44  ? -14.583 -25.228 -17.410 1.00  23.39 ? 1497 ILE A HD13 1 
ATOM   558  N  N    . THR A 1 45  ? -13.570 -30.049 -16.766 1.00  13.43 ? 1498 THR A N    1 
ATOM   559  C  CA   . THR A 1 45  ? -13.195 -31.297 -16.111 1.00  13.56 ? 1498 THR A CA   1 
ATOM   560  C  C    . THR A 1 45  ? -12.856 -31.136 -14.630 1.00  12.95 ? 1498 THR A C    1 
ATOM   561  O  O    . THR A 1 45  ? -12.640 -32.133 -13.925 1.00  13.99 ? 1498 THR A O    1 
ATOM   562  C  CB   . THR A 1 45  ? -12.007 -31.966 -16.847 1.00  14.43 ? 1498 THR A CB   1 
ATOM   563  O  OG1  . THR A 1 45  ? -10.908 -31.047 -16.945 1.00  14.20 ? 1498 THR A OG1  1 
ATOM   564  C  CG2  . THR A 1 45  ? -12.422 -32.354 -18.239 1.00  16.29 ? 1498 THR A CG2  1 
ATOM   565  H  H    . THR A 1 45  ? -12.915 -29.501 -16.869 1.00  16.12 ? 1498 THR A H    1 
ATOM   566  H  HA   . THR A 1 45  ? -13.955 -31.912 -16.169 1.00  16.27 ? 1498 THR A HA   1 
ATOM   567  H  HB   . THR A 1 45  ? -11.729 -32.763 -16.368 1.00  17.32 ? 1498 THR A HB   1 
ATOM   568  H  HG1  . THR A 1 45  ? -10.663 -30.821 -16.196 1.00  17.03 ? 1498 THR A HG1  1 
ATOM   569  H  HG21 . THR A 1 45  ? -12.695 -31.575 -18.729 1.00  19.54 ? 1498 THR A HG21 1 
ATOM   570  H  HG22 . THR A 1 45  ? -11.687 -32.769 -18.696 1.00  19.54 ? 1498 THR A HG22 1 
ATOM   571  H  HG23 . THR A 1 45  ? -13.155 -32.972 -18.202 1.00  19.54 ? 1498 THR A HG23 1 
ATOM   572  N  N    . MET A 1 46  ? -12.804 -29.895 -14.152 1.00  13.56 ? 1499 MET A N    1 
ATOM   573  C  CA   . MET A 1 46  ? -12.547 -29.637 -12.738 1.00  12.43 ? 1499 MET A CA   1 
ATOM   574  C  C    . MET A 1 46  ? -13.326 -28.391 -12.323 1.00  11.96 ? 1499 MET A C    1 
ATOM   575  O  O    . MET A 1 46  ? -13.306 -27.384 -13.044 1.00  12.91 ? 1499 MET A O    1 
ATOM   576  C  CB   . MET A 1 46  ? -11.048 -29.439 -12.488 1.00  12.90 ? 1499 MET A CB   1 
ATOM   577  C  CG   . MET A 1 46  ? -10.662 -29.400 -11.010 1.00  13.53 ? 1499 MET A CG   1 
ATOM   578  S  SD   . MET A 1 46  ? -8.988  -28.837 -10.711 1.00  14.98 ? 1499 MET A SD   1 
ATOM   579  C  CE   . MET A 1 46  ? -8.069  -29.950 -11.756 1.00  15.63 ? 1499 MET A CE   1 
ATOM   580  H  H    . MET A 1 46  ? -12.913 -29.186 -14.625 1.00  16.27 ? 1499 MET A H    1 
ATOM   581  H  HA   . MET A 1 46  ? -12.851 -30.402 -12.207 1.00  14.92 ? 1499 MET A HA   1 
ATOM   582  H  HB2  . MET A 1 46  ? -10.564 -30.171 -12.900 1.00  15.48 ? 1499 MET A HB2  1 
ATOM   583  H  HB3  . MET A 1 46  ? -10.774 -28.599 -12.887 1.00  15.48 ? 1499 MET A HB3  1 
ATOM   584  H  HG2  . MET A 1 46  ? -11.264 -28.799 -10.546 1.00  16.24 ? 1499 MET A HG2  1 
ATOM   585  H  HG3  . MET A 1 46  ? -10.743 -30.294 -10.643 1.00  16.24 ? 1499 MET A HG3  1 
ATOM   586  H  HE1  . MET A 1 46  ? -8.359  -29.837 -12.664 1.00  18.75 ? 1499 MET A HE1  1 
ATOM   587  H  HE2  . MET A 1 46  ? -7.134  -29.746 -11.683 1.00  18.75 ? 1499 MET A HE2  1 
ATOM   588  H  HE3  . MET A 1 46  ? -8.231  -30.852 -11.470 1.00  18.75 ? 1499 MET A HE3  1 
ATOM   589  N  N    . VAL A 1 47  ? -14.002 -28.454 -11.182 1.00  12.66 ? 1500 VAL A N    1 
ATOM   590  C  CA   . VAL A 1 47  ? -14.786 -27.328 -10.690 1.00  12.86 ? 1500 VAL A CA   1 
ATOM   591  C  C    . VAL A 1 47  ? -14.430 -27.012 -9.245  1.00  12.12 ? 1500 VAL A C    1 
ATOM   592  O  O    . VAL A 1 47  ? -14.063 -27.911 -8.491  1.00  13.75 ? 1500 VAL A O    1 
ATOM   593  C  CB   . VAL A 1 47  ? -16.318 -27.574 -10.793 1.00  13.30 ? 1500 VAL A CB   1 
ATOM   594  C  CG1  . VAL A 1 47  ? -16.745 -27.727 -12.245 1.00  13.63 ? 1500 VAL A CG1  1 
ATOM   595  C  CG2  . VAL A 1 47  ? -16.750 -28.775 -9.965  1.00  14.69 ? 1500 VAL A CG2  1 
ATOM   596  H  H    . VAL A 1 47  ? -14.023 -29.144 -10.669 1.00  15.20 ? 1500 VAL A H    1 
ATOM   597  H  HA   . VAL A 1 47  ? -14.573 -26.538 -11.229 1.00  15.43 ? 1500 VAL A HA   1 
ATOM   598  H  HB   . VAL A 1 47  ? -16.781 -26.789 -10.433 1.00  15.96 ? 1500 VAL A HB   1 
ATOM   599  H  HG11 . VAL A 1 47  ? -16.281 -28.474 -12.630 1.00  16.35 ? 1500 VAL A HG11 1 
ATOM   600  H  HG12 . VAL A 1 47  ? -17.693 -27.877 -12.278 1.00  16.35 ? 1500 VAL A HG12 1 
ATOM   601  H  HG13 . VAL A 1 47  ? -16.524 -26.924 -12.722 1.00  16.35 ? 1500 VAL A HG13 1 
ATOM   602  H  HG21 . VAL A 1 47  ? -16.526 -28.617 -9.045  1.00  17.62 ? 1500 VAL A HG21 1 
ATOM   603  H  HG22 . VAL A 1 47  ? -17.698 -28.892 -10.056 1.00  17.62 ? 1500 VAL A HG22 1 
ATOM   604  H  HG23 . VAL A 1 47  ? -16.291 -29.556 -10.284 1.00  17.62 ? 1500 VAL A HG23 1 
ATOM   605  N  N    . CYS A 1 48  ? -14.524 -25.738 -8.856  1.00  12.35 ? 1501 CYS A N    1 
ATOM   606  C  CA   . CYS A 1 48  ? -14.386 -25.362 -7.451  1.00  11.66 ? 1501 CYS A CA   1 
ATOM   607  C  C    . CYS A 1 48  ? -15.740 -24.865 -6.982  1.00  11.58 ? 1501 CYS A C    1 
ATOM   608  O  O    . CYS A 1 48  ? -16.260 -23.865 -7.515  1.00  12.12 ? 1501 CYS A O    1 
ATOM   609  C  CB   . CYS A 1 48  ? -13.331 -24.272 -7.248  1.00  12.15 ? 1501 CYS A CB   1 
ATOM   610  S  SG   . CYS A 1 48  ? -11.679 -24.772 -7.742  1.00  15.00 ? 1501 CYS A SG   1 
ATOM   611  H  H    . CYS A 1 48  ? -14.666 -25.076 -9.387  1.00  14.81 ? 1501 CYS A H    1 
ATOM   612  H  HA   . CYS A 1 48  ? -14.136 -26.147 -6.921  1.00  13.99 ? 1501 CYS A HA   1 
ATOM   613  H  HB2  . CYS A 1 48  ? -13.577 -23.496 -7.775  1.00  14.58 ? 1501 CYS A HB2  1 
ATOM   614  H  HB3  . CYS A 1 48  ? -13.302 -24.036 -6.308  1.00  14.58 ? 1501 CYS A HB3  1 
ATOM   615  H  HG   . CYS A 1 48  ? -10.921 -23.862 -7.549  1.00  18.00 ? 1501 CYS A HG   1 
ATOM   616  N  N    . ALA A 1 49  ? -16.316 -25.574 -6.010  1.00  11.81 ? 1502 ALA A N    1 
ATOM   617  C  CA   . ALA A 1 49  ? -17.697 -25.351 -5.575  1.00  11.62 ? 1502 ALA A CA   1 
ATOM   618  C  C    . ALA A 1 49  ? -17.799 -24.431 -4.357  1.00  11.76 ? 1502 ALA A C    1 
ATOM   619  O  O    . ALA A 1 49  ? -17.088 -24.599 -3.358  1.00  12.27 ? 1502 ALA A O    1 
ATOM   620  C  CB   . ALA A 1 49  ? -18.360 -26.689 -5.264  1.00  13.61 ? 1502 ALA A CB   1 
ATOM   621  H  H    . ALA A 1 49  ? -15.920 -26.204 -5.579  1.00  14.18 ? 1502 ALA A H    1 
ATOM   622  H  HA   . ALA A 1 49  ? -18.195 -24.933 -6.309  1.00  13.94 ? 1502 ALA A HA   1 
ATOM   623  H  HB1  . ALA A 1 49  ? -17.869 -27.126 -4.565  1.00  16.33 ? 1502 ALA A HB1  1 
ATOM   624  H  HB2  . ALA A 1 49  ? -19.264 -26.531 -4.980  1.00  16.33 ? 1502 ALA A HB2  1 
ATOM   625  H  HB3  . ALA A 1 49  ? -18.356 -27.231 -6.056  1.00  16.33 ? 1502 ALA A HB3  1 
ATOM   626  N  N    . MET A 1 50  ? -18.707 -23.467 -4.452  1.00  11.54 ? 1503 MET A N    1 
ATOM   627  C  CA   . MET A 1 50  ? -18.886 -22.456 -3.427  1.00  11.99 ? 1503 MET A CA   1 
ATOM   628  C  C    . MET A 1 50  ? -19.618 -22.962 -2.187  1.00  12.80 ? 1503 MET A C    1 
ATOM   629  O  O    . MET A 1 50  ? -20.315 -23.961 -2.245  1.00  13.90 ? 1503 MET A O    1 
ATOM   630  C  CB   . MET A 1 50  ? -19.609 -21.257 -4.043  1.00  11.79 ? 1503 MET A CB   1 
ATOM   631  C  CG   . MET A 1 50  ? -18.695 -20.463 -4.978  1.00  13.77 ? 1503 MET A CG   1 
ATOM   632  S  SD   . MET A 1 50  ? -17.280 -19.784 -4.049  1.00  14.04 ? 1503 MET A SD   1 
ATOM   633  C  CE   . MET A 1 50  ? -16.292 -19.100 -5.367  1.00  14.48 ? 1503 MET A CE   1 
ATOM   634  H  H    . MET A 1 50  ? -19.243 -23.379 -5.119  1.00  13.85 ? 1503 MET A H    1 
ATOM   635  H  HA   . MET A 1 50  ? -17.999 -22.146 -3.149  1.00  14.39 ? 1503 MET A HA   1 
ATOM   636  H  HB2  . MET A 1 50  ? -20.368 -21.572 -4.558  1.00  14.14 ? 1503 MET A HB2  1 
ATOM   637  H  HB3  . MET A 1 50  ? -19.906 -20.665 -3.335  1.00  14.14 ? 1503 MET A HB3  1 
ATOM   638  H  HG2  . MET A 1 50  ? -18.355 -21.048 -5.673  1.00  16.53 ? 1503 MET A HG2  1 
ATOM   639  H  HG3  . MET A 1 50  ? -19.191 -19.725 -5.366  1.00  16.53 ? 1503 MET A HG3  1 
ATOM   640  H  HE1  . MET A 1 50  ? -16.805 -18.432 -5.827  1.00  17.37 ? 1503 MET A HE1  1 
ATOM   641  H  HE2  . MET A 1 50  ? -15.501 -18.706 -4.991  1.00  17.37 ? 1503 MET A HE2  1 
ATOM   642  H  HE3  . MET A 1 50  ? -16.051 -19.804 -5.973  1.00  17.37 ? 1503 MET A HE3  1 
ATOM   643  N  N    . PRO A 1 51  ? -19.432 -22.273 -1.049  1.00  11.94 ? 1504 PRO A N    1 
ATOM   644  C  CA   . PRO A 1 51  ? -19.833 -22.822 0.254   1.00  13.00 ? 1504 PRO A CA   1 
ATOM   645  C  C    . PRO A 1 51  ? -21.215 -22.407 0.742   1.00  13.92 ? 1504 PRO A C    1 
ATOM   646  O  O    . PRO A 1 51  ? -21.566 -22.755 1.878   1.00  13.77 ? 1504 PRO A O    1 
ATOM   647  C  CB   . PRO A 1 51  ? -18.754 -22.261 1.182   1.00  13.02 ? 1504 PRO A CB   1 
ATOM   648  C  CG   . PRO A 1 51  ? -18.478 -20.906 0.601   1.00  12.32 ? 1504 PRO A CG   1 
ATOM   649  C  CD   . PRO A 1 51  ? -18.544 -21.102 -0.896  1.00  12.02 ? 1504 PRO A CD   1 
ATOM   650  H  HA   . PRO A 1 51  ? -19.773 -23.800 0.243   1.00  15.60 ? 1504 PRO A HA   1 
ATOM   651  H  HB2  . PRO A 1 51  ? -19.098 -22.190 2.087   1.00  15.63 ? 1504 PRO A HB2  1 
ATOM   652  H  HB3  . PRO A 1 51  ? -17.963 -22.822 1.151   1.00  15.63 ? 1504 PRO A HB3  1 
ATOM   653  H  HG2  . PRO A 1 51  ? -19.156 -20.279 0.896   1.00  14.78 ? 1504 PRO A HG2  1 
ATOM   654  H  HG3  . PRO A 1 51  ? -17.594 -20.609 0.870   1.00  14.78 ? 1504 PRO A HG3  1 
ATOM   655  H  HD2  . PRO A 1 51  ? -18.935 -20.323 -1.322  1.00  14.42 ? 1504 PRO A HD2  1 
ATOM   656  H  HD3  . PRO A 1 51  ? -17.663 -21.297 -1.251  1.00  14.42 ? 1504 PRO A HD3  1 
ATOM   657  N  N    . ASN A 1 52  ? -22.000 -21.710 -0.081  1.00  14.05 ? 1505 ASN A N    1 
ATOM   658  C  CA   . ASN A 1 52  ? -23.288 -21.190 0.384   1.00  15.16 ? 1505 ASN A CA   1 
ATOM   659  C  C    . ASN A 1 52  ? -24.418 -22.194 0.228   1.00  15.77 ? 1505 ASN A C    1 
ATOM   660  O  O    . ASN A 1 52  ? -25.499 -21.866 -0.261  1.00  16.44 ? 1505 ASN A O    1 
ATOM   661  C  CB   . ASN A 1 52  ? -23.660 -19.876 -0.307  1.00  15.28 ? 1505 ASN A CB   1 
ATOM   662  C  CG   . ASN A 1 52  ? -23.854 -20.026 -1.803  1.00  16.50 ? 1505 ASN A CG   1 
ATOM   663  O  OD1  . ASN A 1 52  ? -23.348 -20.962 -2.414  1.00  16.21 ? 1505 ASN A OD1  1 
ATOM   664  N  ND2  . ASN A 1 52  ? -24.561 -19.090 -2.403  1.00  18.89 ? 1505 ASN A ND2  1 
ATOM   665  H  H    . ASN A 1 52  ? -21.814 -21.526 -0.901  1.00  16.86 ? 1505 ASN A H    1 
ATOM   666  H  HA   . ASN A 1 52  ? -23.207 -20.997 1.341   1.00  18.19 ? 1505 ASN A HA   1 
ATOM   667  H  HB2  . ASN A 1 52  ? -24.490 -19.545 0.071   1.00  18.33 ? 1505 ASN A HB2  1 
ATOM   668  H  HB3  . ASN A 1 52  ? -22.950 -19.231 -0.161  1.00  18.33 ? 1505 ASN A HB3  1 
ATOM   669  H  HD21 . ASN A 1 52  ? -24.886 -18.437 -1.947  1.00  22.67 ? 1505 ASN A HD21 1 
ATOM   670  H  HD22 . ASN A 1 52  ? -24.699 -19.131 -3.251  1.00  22.67 ? 1505 ASN A HD22 1 
ATOM   671  N  N    . THR A 1 53  ? -24.151 -23.417 0.679   1.00  15.65 ? 1506 THR A N    1 
ATOM   672  C  CA   . THR A 1 53  ? -25.114 -24.505 0.676   1.00  16.79 ? 1506 THR A CA   1 
ATOM   673  C  C    . THR A 1 53  ? -25.893 -24.504 1.990   1.00  17.89 ? 1506 THR A C    1 
ATOM   674  O  O    . THR A 1 53  ? -25.759 -23.572 2.804   1.00  17.69 ? 1506 THR A O    1 
ATOM   675  C  CB   . THR A 1 53  ? -24.359 -25.844 0.496   1.00  17.00 ? 1506 THR A CB   1 
ATOM   676  O  OG1  . THR A 1 53  ? -23.256 -25.915 1.417   1.00  17.54 ? 1506 THR A OG1  1 
ATOM   677  C  CG2  . THR A 1 53  ? -23.796 -25.924 -0.919  1.00  17.42 ? 1506 THR A CG2  1 
ATOM   678  H  H    . THR A 1 53  ? -23.387 -23.644 1.003   1.00  18.78 ? 1506 THR A H    1 
ATOM   679  H  HA   . THR A 1 53  ? -25.743 -24.393 -0.066  1.00  20.15 ? 1506 THR A HA   1 
ATOM   680  H  HB   . THR A 1 53  ? -24.962 -26.590 0.640   1.00  20.40 ? 1506 THR A HB   1 
ATOM   681  H  HG1  . THR A 1 53  ? -23.530 -25.866 2.188   1.00  21.05 ? 1506 THR A HG1  1 
ATOM   682  H  HG21 . THR A 1 53  ? -23.189 -25.196 -1.072  1.00  20.90 ? 1506 THR A HG21 1 
ATOM   683  H  HG22 . THR A 1 53  ? -23.326 -26.752 -1.039  1.00  20.90 ? 1506 THR A HG22 1 
ATOM   684  H  HG23 . THR A 1 53  ? -24.510 -25.875 -1.559  1.00  20.90 ? 1506 THR A HG23 1 
ATOM   685  N  N    . ARG A 1 54  ? -26.710 -25.538 2.189   1.00  20.05 ? 1507 ARG A N    1 
ATOM   686  C  CA   . ARG A 1 54  ? -27.474 -25.713 3.420   1.00  22.52 ? 1507 ARG A CA   1 
ATOM   687  C  C    . ARG A 1 54  ? -27.321 -27.114 3.964   1.00  22.40 ? 1507 ARG A C    1 
ATOM   688  O  O    . ARG A 1 54  ? -27.956 -28.027 3.459   1.00  23.00 ? 1507 ARG A O    1 
ATOM   689  C  CB   . ARG A 1 54  ? -28.950 -25.498 3.132   1.00  26.67 ? 1507 ARG A CB   1 
ATOM   690  C  CG   . ARG A 1 54  ? -29.401 -24.132 3.410   1.00  32.75 ? 1507 ARG A CG   1 
ATOM   691  C  CD   . ARG A 1 54  ? -29.464 -23.304 2.162   1.00  37.03 ? 1507 ARG A CD   1 
ATOM   692  N  NE   . ARG A 1 54  ? -30.720 -22.563 2.114   1.00  40.42 ? 1507 ARG A NE   1 
ATOM   693  C  CZ   . ARG A 1 54  ? -31.010 -21.537 2.912   1.00  42.62 ? 1507 ARG A CZ   1 
ATOM   694  N  NH1  . ARG A 1 54  ? -30.128 -21.121 3.818   1.00  43.56 ? 1507 ARG A NH1  1 
ATOM   695  N  NH2  . ARG A 1 54  ? -32.181 -20.921 2.805   1.00  43.23 ? 1507 ARG A NH2  1 
ATOM   696  H  H    . ARG A 1 54  ? -26.841 -26.162 1.612   1.00  24.06 ? 1507 ARG A H    1 
ATOM   697  H  HA   . ARG A 1 54  ? -27.179 -25.069 4.098   1.00  27.02 ? 1507 ARG A HA   1 
ATOM   698  H  HB2  . ARG A 1 54  ? -29.116 -25.682 2.194   1.00  32.00 ? 1507 ARG A HB2  1 
ATOM   699  H  HB3  . ARG A 1 54  ? -29.469 -26.102 3.684   1.00  32.00 ? 1507 ARG A HB3  1 
ATOM   700  H  HG2  . ARG A 1 54  ? -30.289 -24.162 3.799   1.00  39.31 ? 1507 ARG A HG2  1 
ATOM   701  H  HG3  . ARG A 1 54  ? -28.781 -23.709 4.024   1.00  39.31 ? 1507 ARG A HG3  1 
ATOM   702  H  HD2  . ARG A 1 54  ? -28.731 -22.668 2.157   1.00  44.43 ? 1507 ARG A HD2  1 
ATOM   703  H  HD3  . ARG A 1 54  ? -29.417 -23.883 1.386   1.00  44.43 ? 1507 ARG A HD3  1 
ATOM   704  H  HE   . ARG A 1 54  ? -31.276 -22.754 1.486   1.00  48.51 ? 1507 ARG A HE   1 
ATOM   705  H  HH11 . ARG A 1 54  ? -29.368 -21.518 3.892   1.00  51.88 ? 1507 ARG A HH11 1 
ATOM   706  H  HH12 . ARG A 1 54  ? -30.318 -20.458 4.330   1.00  51.88 ? 1507 ARG A HH12 1 
ATOM   707  H  HH21 . ARG A 1 54  ? -32.753 -21.185 2.220   1.00  52.27 ? 1507 ARG A HH21 1 
ATOM   708  H  HH22 . ARG A 1 54  ? -32.365 -20.257 3.319   1.00  52.27 ? 1507 ARG A HH22 1 
ATOM   709  N  N    . PRO A 1 55  ? -26.509 -27.298 5.010   1.00  22.24 ? 1508 PRO A N    1 
ATOM   710  C  CA   . PRO A 1 55  ? -25.780 -26.282 5.775   1.00  21.00 ? 1508 PRO A CA   1 
ATOM   711  C  C    . PRO A 1 55  ? -24.631 -25.656 4.981   1.00  19.62 ? 1508 PRO A C    1 
ATOM   712  O  O    . PRO A 1 55  ? -24.082 -26.298 4.099   1.00  19.63 ? 1508 PRO A O    1 
ATOM   713  C  CB   . PRO A 1 55  ? -25.231 -27.087 6.958   1.00  23.13 ? 1508 PRO A CB   1 
ATOM   714  C  CG   . PRO A 1 55  ? -25.045 -28.451 6.419   1.00  23.75 ? 1508 PRO A CG   1 
ATOM   715  C  CD   . PRO A 1 55  ? -26.201 -28.661 5.479   1.00  23.22 ? 1508 PRO A CD   1 
ATOM   716  H  HA   . PRO A 1 55  ? -26.386 -25.583 6.099   1.00  25.20 ? 1508 PRO A HA   1 
ATOM   717  H  HB2  . PRO A 1 55  ? -24.384 -26.712 7.247   1.00  27.76 ? 1508 PRO A HB2  1 
ATOM   718  H  HB3  . PRO A 1 55  ? -25.875 -27.087 7.683   1.00  27.76 ? 1508 PRO A HB3  1 
ATOM   719  H  HG2  . PRO A 1 55  ? -24.202 -28.502 5.943   1.00  28.50 ? 1508 PRO A HG2  1 
ATOM   720  H  HG3  . PRO A 1 55  ? -25.071 -29.095 7.144   1.00  28.50 ? 1508 PRO A HG3  1 
ATOM   721  H  HD2  . PRO A 1 55  ? -25.934 -29.223 4.735   1.00  27.87 ? 1508 PRO A HD2  1 
ATOM   722  H  HD3  . PRO A 1 55  ? -26.960 -29.035 5.954   1.00  27.87 ? 1508 PRO A HD3  1 
ATOM   723  N  N    . PRO A 1 56  ? -24.272 -24.405 5.300   1.00  18.22 ? 1509 PRO A N    1 
ATOM   724  C  CA   . PRO A 1 56  ? -23.148 -23.761 4.615   1.00  16.90 ? 1509 PRO A CA   1 
ATOM   725  C  C    . PRO A 1 56  ? -21.825 -24.347 5.074   1.00  16.25 ? 1509 PRO A C    1 
ATOM   726  O  O    . PRO A 1 56  ? -21.707 -24.829 6.208   1.00  16.66 ? 1509 PRO A O    1 
ATOM   727  C  CB   . PRO A 1 56  ? -23.285 -22.292 5.023   1.00  17.93 ? 1509 PRO A CB   1 
ATOM   728  C  CG   . PRO A 1 56  ? -24.003 -22.332 6.338   1.00  19.69 ? 1509 PRO A CG   1 
ATOM   729  C  CD   . PRO A 1 56  ? -24.926 -23.507 6.269   1.00  19.43 ? 1509 PRO A CD   1 
ATOM   730  H  HA   . PRO A 1 56  ? -23.235 -23.847 3.643   1.00  20.28 ? 1509 PRO A HA   1 
ATOM   731  H  HB2  . PRO A 1 56  ? -22.406 -21.895 5.123   1.00  21.52 ? 1509 PRO A HB2  1 
ATOM   732  H  HB3  . PRO A 1 56  ? -23.807 -21.814 4.360   1.00  21.52 ? 1509 PRO A HB3  1 
ATOM   733  H  HG2  . PRO A 1 56  ? -23.359 -22.446 7.055   1.00  23.63 ? 1509 PRO A HG2  1 
ATOM   734  H  HG3  . PRO A 1 56  ? -24.505 -21.511 6.458   1.00  23.63 ? 1509 PRO A HG3  1 
ATOM   735  H  HD2  . PRO A 1 56  ? -24.992 -23.936 7.137   1.00  23.31 ? 1509 PRO A HD2  1 
ATOM   736  H  HD3  . PRO A 1 56  ? -25.797 -23.233 5.942   1.00  23.31 ? 1509 PRO A HD3  1 
ATOM   737  N  N    . ILE A 1 57  ? -20.842 -24.319 4.186   1.00  15.29 ? 1510 ILE A N    1 
ATOM   738  C  CA   . ILE A 1 57  ? -19.569 -24.963 4.443   1.00  15.35 ? 1510 ILE A CA   1 
ATOM   739  C  C    . ILE A 1 57  ? -18.673 -23.981 5.188   1.00  15.87 ? 1510 ILE A C    1 
ATOM   740  O  O    . ILE A 1 57  ? -17.765 -23.374 4.622   1.00  16.41 ? 1510 ILE A O    1 
ATOM   741  C  CB   . ILE A 1 57  ? -18.924 -25.475 3.147   1.00  15.75 ? 1510 ILE A CB   1 
ATOM   742  C  CG1  . ILE A 1 57  ? -19.934 -26.276 2.302   1.00  16.89 ? 1510 ILE A CG1  1 
ATOM   743  C  CG2  . ILE A 1 57  ? -17.719 -26.340 3.474   1.00  16.25 ? 1510 ILE A CG2  1 
ATOM   744  C  CD1  . ILE A 1 57  ? -20.706 -27.341 3.054   1.00  18.19 ? 1510 ILE A CD1  1 
ATOM   745  H  H    . ILE A 1 57  ? -20.889 -23.929 3.421   1.00  18.35 ? 1510 ILE A H    1 
ATOM   746  H  HA   . ILE A 1 57  ? -19.719 -25.736 5.027   1.00  18.42 ? 1510 ILE A HA   1 
ATOM   747  H  HB   . ILE A 1 57  ? -18.625 -24.712 2.628   1.00  18.90 ? 1510 ILE A HB   1 
ATOM   748  H  HG12 . ILE A 1 57  ? -20.581 -25.658 1.927   1.00  20.27 ? 1510 ILE A HG12 1 
ATOM   749  H  HG13 . ILE A 1 57  ? -19.453 -26.717 1.584   1.00  20.27 ? 1510 ILE A HG13 1 
ATOM   750  H  HG21 . ILE A 1 57  ? -18.005 -27.086 4.005   1.00  19.50 ? 1510 ILE A HG21 1 
ATOM   751  H  HG22 . ILE A 1 57  ? -17.327 -26.651 2.655   1.00  19.50 ? 1510 ILE A HG22 1 
ATOM   752  H  HG23 . ILE A 1 57  ? -17.081 -25.814 3.963   1.00  19.50 ? 1510 ILE A HG23 1 
ATOM   753  H  HD11 . ILE A 1 57  ? -21.204 -26.925 3.761   1.00  21.83 ? 1510 ILE A HD11 1 
ATOM   754  H  HD12 . ILE A 1 57  ? -21.304 -27.781 2.446   1.00  21.83 ? 1510 ILE A HD12 1 
ATOM   755  H  HD13 . ILE A 1 57  ? -20.086 -27.976 3.420   1.00  21.83 ? 1510 ILE A HD13 1 
ATOM   756  N  N    . ILE A 1 58  ? -18.954 -23.844 6.477   1.00  16.43 ? 1511 ILE A N    1 
ATOM   757  C  CA   . ILE A 1 58  ? -18.301 -22.832 7.299   1.00  16.98 ? 1511 ILE A CA   1 
ATOM   758  C  C    . ILE A 1 58  ? -17.617 -23.417 8.528   1.00  18.10 ? 1511 ILE A C    1 
ATOM   759  O  O    . ILE A 1 58  ? -17.148 -22.688 9.389   1.00  18.30 ? 1511 ILE A O    1 
ATOM   760  C  CB   . ILE A 1 58  ? -19.284 -21.727 7.743   1.00  18.95 ? 1511 ILE A CB   1 
ATOM   761  C  CG1  . ILE A 1 58  ? -20.485 -22.309 8.488   1.00  19.56 ? 1511 ILE A CG1  1 
ATOM   762  C  CG2  . ILE A 1 58  ? -19.746 -20.939 6.544   1.00  19.93 ? 1511 ILE A CG2  1 
ATOM   763  C  CD1  . ILE A 1 58  ? -21.367 -21.247 9.081   1.00  22.17 ? 1511 ILE A CD1  1 
ATOM   764  H  H    . ILE A 1 58  ? -19.524 -24.327 6.903   1.00  19.72 ? 1511 ILE A H    1 
ATOM   765  H  HA   . ILE A 1 58  ? -17.607 -22.402 6.758   1.00  20.37 ? 1511 ILE A HA   1 
ATOM   766  H  HB   . ILE A 1 58  ? -18.815 -21.125 8.342   1.00  22.74 ? 1511 ILE A HB   1 
ATOM   767  H  HG12 . ILE A 1 58  ? -21.018 -22.832 7.869   1.00  23.47 ? 1511 ILE A HG12 1 
ATOM   768  H  HG13 . ILE A 1 58  ? -20.166 -22.873 9.210   1.00  23.47 ? 1511 ILE A HG13 1 
ATOM   769  H  HG21 . ILE A 1 58  ? -20.186 -21.533 5.932   1.00  23.92 ? 1511 ILE A HG21 1 
ATOM   770  H  HG22 . ILE A 1 58  ? -20.355 -20.257 6.836   1.00  23.92 ? 1511 ILE A HG22 1 
ATOM   771  H  HG23 . ILE A 1 58  ? -18.983 -20.539 6.121   1.00  23.92 ? 1511 ILE A HG23 1 
ATOM   772  H  HD11 . ILE A 1 58  ? -21.697 -20.685 8.375   1.00  26.61 ? 1511 ILE A HD11 1 
ATOM   773  H  HD12 . ILE A 1 58  ? -22.101 -21.668 9.534   1.00  26.61 ? 1511 ILE A HD12 1 
ATOM   774  H  HD13 . ILE A 1 58  ? -20.854 -20.726 9.702   1.00  26.61 ? 1511 ILE A HD13 1 
ATOM   775  N  N    . ASP A 1 59  ? -17.526 -24.735 8.589   1.00  18.78 ? 1512 ASP A N    1 
ATOM   776  C  CA   . ASP A 1 59  ? -16.809 -25.384 9.676   1.00  19.77 ? 1512 ASP A CA   1 
ATOM   777  C  C    . ASP A 1 59  ? -16.419 -26.783 9.243   1.00  18.67 ? 1512 ASP A C    1 
ATOM   778  O  O    . ASP A 1 59  ? -16.793 -27.232 8.161   1.00  18.88 ? 1512 ASP A O    1 
ATOM   779  C  CB   . ASP A 1 59  ? -17.599 -25.374 10.997  1.00  22.82 ? 1512 ASP A CB   1 
ATOM   780  C  CG   . ASP A 1 59  ? -18.877 -26.220 10.976  1.00  25.72 ? 1512 ASP A CG   1 
ATOM   781  O  OD1  . ASP A 1 59  ? -19.131 -27.040 10.065  1.00  23.84 ? 1512 ASP A OD1  1 
ATOM   782  O  OD2  . ASP A 1 59  ? -19.643 -26.071 11.957  1.00  31.11 ? 1512 ASP A OD2  1 
ATOM   783  H  H    . ASP A 1 59  ? -17.870 -25.276 8.016   1.00  22.54 ? 1512 ASP A H    1 
ATOM   784  H  HA   . ASP A 1 59  ? -15.978 -24.888 9.834   1.00  23.73 ? 1512 ASP A HA   1 
ATOM   785  H  HB2  . ASP A 1 59  ? -17.029 -25.718 11.703  1.00  27.38 ? 1512 ASP A HB2  1 
ATOM   786  H  HB3  . ASP A 1 59  ? -17.854 -24.460 11.200  1.00  27.38 ? 1512 ASP A HB3  1 
ATOM   787  N  N    . ALA A 1 60  ? -15.619 -27.446 10.058  1.00  19.72 ? 1513 ALA A N    1 
ATOM   788  C  CA   . ALA A 1 60  ? -15.066 -28.742 9.667   1.00  19.61 ? 1513 ALA A CA   1 
ATOM   789  C  C    . ALA A 1 60  ? -16.132 -29.821 9.456   1.00  19.78 ? 1513 ALA A C    1 
ATOM   790  O  O    . ALA A 1 60  ? -16.058 -30.572 8.484   1.00  20.37 ? 1513 ALA A O    1 
ATOM   791  C  CB   . ALA A 1 60  ? -14.026 -29.195 10.679  1.00  20.97 ? 1513 ALA A CB   1 
ATOM   792  H  H    . ALA A 1 60  ? -15.378 -27.176 10.839  1.00  23.66 ? 1513 ALA A H    1 
ATOM   793  H  HA   . ALA A 1 60  ? -14.603 -28.627 8.811   1.00  23.53 ? 1513 ALA A HA   1 
ATOM   794  H  HB1  . ALA A 1 60  ? -14.442 -29.273 11.541  1.00  25.16 ? 1513 ALA A HB1  1 
ATOM   795  H  HB2  . ALA A 1 60  ? -13.674 -30.045 10.406  1.00  25.16 ? 1513 ALA A HB2  1 
ATOM   796  H  HB3  . ALA A 1 60  ? -13.320 -28.544 10.714  1.00  25.16 ? 1513 ALA A HB3  1 
ATOM   797  N  N    . PRO A 1 61  ? -17.132 -29.906 10.351  1.00  20.16 ? 1514 PRO A N    1 
ATOM   798  C  CA   . PRO A 1 61  ? -18.131 -30.953 10.101  1.00  19.42 ? 1514 PRO A CA   1 
ATOM   799  C  C    . PRO A 1 61  ? -18.894 -30.746 8.790   1.00  18.04 ? 1514 PRO A C    1 
ATOM   800  O  O    . PRO A 1 61  ? -19.173 -31.735 8.106   1.00  19.30 ? 1514 PRO A O    1 
ATOM   801  C  CB   . PRO A 1 61  ? -19.090 -30.815 11.287  1.00  20.24 ? 1514 PRO A CB   1 
ATOM   802  C  CG   . PRO A 1 61  ? -18.272 -30.210 12.367  1.00  21.74 ? 1514 PRO A CG   1 
ATOM   803  C  CD   . PRO A 1 61  ? -17.295 -29.304 11.686  1.00  20.87 ? 1514 PRO A CD   1 
ATOM   804  H  HA   . PRO A 1 61  ? -17.716 -31.841 10.109  1.00  23.30 ? 1514 PRO A HA   1 
ATOM   805  H  HB2  . PRO A 1 61  ? -19.828 -30.233 11.047  1.00  24.29 ? 1514 PRO A HB2  1 
ATOM   806  H  HB3  . PRO A 1 61  ? -19.413 -31.691 11.550  1.00  24.29 ? 1514 PRO A HB3  1 
ATOM   807  H  HG2  . PRO A 1 61  ? -18.846 -29.705 12.964  1.00  26.09 ? 1514 PRO A HG2  1 
ATOM   808  H  HG3  . PRO A 1 61  ? -17.807 -30.909 12.852  1.00  26.09 ? 1514 PRO A HG3  1 
ATOM   809  H  HD2  . PRO A 1 61  ? -17.662 -28.409 11.610  1.00  25.05 ? 1514 PRO A HD2  1 
ATOM   810  H  HD3  . PRO A 1 61  ? -16.449 -29.302 12.161  1.00  25.05 ? 1514 PRO A HD3  1 
ATOM   811  N  N    . ALA A 1 62  ? -19.215 -29.499 8.430   1.00  17.18 ? 1515 ALA A N    1 
ATOM   812  C  CA   . ALA A 1 62  ? -19.931 -29.250 7.183   1.00  17.37 ? 1515 ALA A CA   1 
ATOM   813  C  C    . ALA A 1 62  ? -19.038 -29.559 5.988   1.00  17.13 ? 1515 ALA A C    1 
ATOM   814  O  O    . ALA A 1 62  ? -19.490 -30.114 4.994   1.00  17.94 ? 1515 ALA A O    1 
ATOM   815  C  CB   . ALA A 1 62  ? -20.444 -27.820 7.126   1.00  18.06 ? 1515 ALA A CB   1 
ATOM   816  H  H    . ALA A 1 62  ? -19.031 -28.792 8.885   1.00  20.61 ? 1515 ALA A H    1 
ATOM   817  H  HA   . ALA A 1 62  ? -20.706 -29.848 7.139   1.00  20.84 ? 1515 ALA A HA   1 
ATOM   818  H  HB1  . ALA A 1 62  ? -19.699 -27.218 7.183   1.00  21.67 ? 1515 ALA A HB1  1 
ATOM   819  H  HB2  . ALA A 1 62  ? -20.909 -27.688 6.296   1.00  21.67 ? 1515 ALA A HB2  1 
ATOM   820  H  HB3  . ALA A 1 62  ? -21.041 -27.674 7.863   1.00  21.67 ? 1515 ALA A HB3  1 
ATOM   821  N  N    . LEU A 1 63  ? -17.758 -29.218 6.084   1.00  17.60 ? 1516 LEU A N    1 
ATOM   822  C  CA   . LEU A 1 63  ? -16.825 -29.569 5.027   1.00  17.10 ? 1516 LEU A CA   1 
ATOM   823  C  C    . LEU A 1 63  ? -16.711 -31.087 4.854   1.00  17.46 ? 1516 LEU A C    1 
ATOM   824  O  O    . LEU A 1 63  ? -16.695 -31.593 3.731   1.00  17.92 ? 1516 LEU A O    1 
ATOM   825  C  CB   . LEU A 1 63  ? -15.455 -28.953 5.300   1.00  18.54 ? 1516 LEU A CB   1 
ATOM   826  C  CG   . LEU A 1 63  ? -14.379 -29.277 4.272   1.00  19.06 ? 1516 LEU A CG   1 
ATOM   827  C  CD1  . LEU A 1 63  ? -14.770 -28.730 2.898   1.00  19.93 ? 1516 LEU A CD1  1 
ATOM   828  C  CD2  . LEU A 1 63  ? -13.024 -28.715 4.708   1.00  20.76 ? 1516 LEU A CD2  1 
ATOM   829  H  H    . LEU A 1 63  ? -17.409 -28.789 6.743   1.00  21.12 ? 1516 LEU A H    1 
ATOM   830  H  HA   . LEU A 1 63  ? -17.156 -29.198 4.183   1.00  20.51 ? 1516 LEU A HA   1 
ATOM   831  H  HB2  . LEU A 1 63  ? -15.551 -27.988 5.326   1.00  22.25 ? 1516 LEU A HB2  1 
ATOM   832  H  HB3  . LEU A 1 63  ? -15.140 -29.271 6.160   1.00  22.25 ? 1516 LEU A HB3  1 
ATOM   833  H  HG   . LEU A 1 63  ? -14.293 -30.241 4.197   1.00  22.87 ? 1516 LEU A HG   1 
ATOM   834  H  HD11 . LEU A 1 63  ? -14.873 -27.777 2.959   1.00  23.92 ? 1516 LEU A HD11 1 
ATOM   835  H  HD12 . LEU A 1 63  ? -14.079 -28.945 2.268   1.00  23.92 ? 1516 LEU A HD12 1 
ATOM   836  H  HD13 . LEU A 1 63  ? -15.599 -29.132 2.626   1.00  23.92 ? 1516 LEU A HD13 1 
ATOM   837  H  HD21 . LEU A 1 63  ? -12.781 -29.106 5.551   1.00  24.91 ? 1516 LEU A HD21 1 
ATOM   838  H  HD22 . LEU A 1 63  ? -12.367 -28.934 4.043   1.00  24.91 ? 1516 LEU A HD22 1 
ATOM   839  H  HD23 . LEU A 1 63  ? -13.096 -27.762 4.797   1.00  24.91 ? 1516 LEU A HD23 1 
ATOM   840  N  N    . ALA A 1 64  ? -16.643 -31.819 5.961   1.00  17.08 ? 1517 ALA A N    1 
ATOM   841  C  CA   . ALA A 1 64  ? -16.574 -33.283 5.907   1.00  16.68 ? 1517 ALA A CA   1 
ATOM   842  C  C    . ALA A 1 64  ? -17.792 -33.865 5.201   1.00  15.91 ? 1517 ALA A C    1 
ATOM   843  O  O    . ALA A 1 64  ? -17.673 -34.782 4.384   1.00  17.25 ? 1517 ALA A O    1 
ATOM   844  C  CB   . ALA A 1 64  ? -16.440 -33.869 7.296   1.00  17.52 ? 1517 ALA A CB   1 
ATOM   845  H  H    . ALA A 1 64  ? -16.636 -31.495 6.758   1.00  20.50 ? 1517 ALA A H    1 
ATOM   846  H  HA   . ALA A 1 64  ? -15.779 -33.541 5.395   1.00  20.02 ? 1517 ALA A HA   1 
ATOM   847  H  HB1  . ALA A 1 64  ? -17.203 -33.612 7.818   1.00  21.02 ? 1517 ALA A HB1  1 
ATOM   848  H  HB2  . ALA A 1 64  ? -16.397 -34.826 7.228   1.00  21.02 ? 1517 ALA A HB2  1 
ATOM   849  H  HB3  . ALA A 1 64  ? -15.637 -33.533 7.701   1.00  21.02 ? 1517 ALA A HB3  1 
ATOM   850  N  N    . LEU A 1 65  ? -18.971 -33.371 5.545   1.00  16.21 ? 1518 LEU A N    1 
ATOM   851  C  CA   . LEU A 1 65  ? -20.183 -33.816 4.880   1.00  15.77 ? 1518 LEU A CA   1 
ATOM   852  C  C    . LEU A 1 65  ? -20.148 -33.513 3.385   1.00  15.13 ? 1518 LEU A C    1 
ATOM   853  O  O    . LEU A 1 65  ? -20.397 -34.381 2.548   1.00  16.18 ? 1518 LEU A O    1 
ATOM   854  C  CB   . LEU A 1 65  ? -21.403 -33.165 5.532   1.00  16.64 ? 1518 LEU A CB   1 
ATOM   855  C  CG   . LEU A 1 65  ? -22.731 -33.397 4.810   1.00  18.78 ? 1518 LEU A CG   1 
ATOM   856  C  CD1  . LEU A 1 65  ? -23.134 -34.879 4.829   1.00  19.47 ? 1518 LEU A CD1  1 
ATOM   857  C  CD2  . LEU A 1 65  ? -23.810 -32.468 5.411   1.00  21.13 ? 1518 LEU A CD2  1 
ATOM   858  H  H    . LEU A 1 65  ? -19.096 -32.779 6.157   1.00  19.45 ? 1518 LEU A H    1 
ATOM   859  H  HA   . LEU A 1 65  ? -20.266 -34.787 4.989   1.00  18.93 ? 1518 LEU A HA   1 
ATOM   860  H  HB2  . LEU A 1 65  ? -21.494 -33.516 6.431   1.00  19.97 ? 1518 LEU A HB2  1 
ATOM   861  H  HB3  . LEU A 1 65  ? -21.256 -32.207 5.570   1.00  19.97 ? 1518 LEU A HB3  1 
ATOM   862  H  HG   . LEU A 1 65  ? -22.619 -33.143 3.880   1.00  22.53 ? 1518 LEU A HG   1 
ATOM   863  H  HD11 . LEU A 1 65  ? -23.226 -35.165 5.741   1.00  23.37 ? 1518 LEU A HD11 1 
ATOM   864  H  HD12 . LEU A 1 65  ? -23.970 -34.981 4.368   1.00  23.37 ? 1518 LEU A HD12 1 
ATOM   865  H  HD13 . LEU A 1 65  ? -22.453 -35.394 4.391   1.00  23.37 ? 1518 LEU A HD13 1 
ATOM   866  H  HD21 . LEU A 1 65  ? -23.534 -31.555 5.298   1.00  25.36 ? 1518 LEU A HD21 1 
ATOM   867  H  HD22 . LEU A 1 65  ? -24.641 -32.618 4.954   1.00  25.36 ? 1518 LEU A HD22 1 
ATOM   868  H  HD23 . LEU A 1 65  ? -23.908 -32.667 6.345   1.00  25.36 ? 1518 LEU A HD23 1 
ATOM   869  N  N    . ALA A 1 66  ? -19.817 -32.276 3.042   1.00  15.94 ? 1519 ALA A N    1 
ATOM   870  C  CA   . ALA A 1 66  ? -19.822 -31.875 1.643   1.00  16.62 ? 1519 ALA A CA   1 
ATOM   871  C  C    . ALA A 1 66  ? -18.791 -32.672 0.847   1.00  16.91 ? 1519 ALA A C    1 
ATOM   872  O  O    . ALA A 1 66  ? -19.043 -33.046 -0.295  1.00  17.74 ? 1519 ALA A O    1 
ATOM   873  C  CB   . ALA A 1 66  ? -19.594 -30.374 1.505   1.00  17.87 ? 1519 ALA A CB   1 
ATOM   874  H  H    . ALA A 1 66  ? -19.588 -31.656 3.592   1.00  19.12 ? 1519 ALA A H    1 
ATOM   875  H  HA   . ALA A 1 66  ? -20.704 -32.075 1.265   1.00  19.95 ? 1519 ALA A HA   1 
ATOM   876  H  HB1  . ALA A 1 66  ? -18.744 -30.151 1.890   1.00  21.44 ? 1519 ALA A HB1  1 
ATOM   877  H  HB2  . ALA A 1 66  ? -19.602 -30.141 0.573   1.00  21.44 ? 1519 ALA A HB2  1 
ATOM   878  H  HB3  . ALA A 1 66  ? -20.295 -29.908 1.965   1.00  21.44 ? 1519 ALA A HB3  1 
ATOM   879  N  N    . GLN A 1 67  ? -17.636 -32.954 1.436   1.00  17.98 ? 1520 GLN A N    1 
ATOM   880  C  CA   A GLN A 1 67  ? -16.606 -33.741 0.763   0.61  18.92 ? 1520 GLN A CA   1 
ATOM   881  C  CA   B GLN A 1 67  ? -16.640 -33.721 0.717   0.39  18.51 ? 1520 GLN A CA   1 
ATOM   882  C  C    . GLN A 1 67  ? -17.149 -35.120 0.383   1.00  17.90 ? 1520 GLN A C    1 
ATOM   883  O  O    . GLN A 1 67  ? -16.917 -35.617 -0.713  1.00  17.69 ? 1520 GLN A O    1 
ATOM   884  C  CB   A GLN A 1 67  ? -15.383 -33.927 1.666   0.61  20.89 ? 1520 GLN A CB   1 
ATOM   885  C  CB   B GLN A 1 67  ? -15.350 -33.857 1.497   0.39  19.67 ? 1520 GLN A CB   1 
ATOM   886  C  CG   A GLN A 1 67  ? -14.413 -32.752 1.733   0.61  22.35 ? 1520 GLN A CG   1 
ATOM   887  C  CG   B GLN A 1 67  ? -14.602 -35.061 1.009   0.39  20.87 ? 1520 GLN A CG   1 
ATOM   888  C  CD   A GLN A 1 67  ? -13.339 -32.966 2.792   0.61  23.23 ? 1520 GLN A CD   1 
ATOM   889  C  CD   B GLN A 1 67  ? -13.169 -35.074 1.399   0.39  21.42 ? 1520 GLN A CD   1 
ATOM   890  O  OE1  A GLN A 1 67  ? -13.576 -33.621 3.813   0.61  24.57 ? 1520 GLN A OE1  1 
ATOM   891  O  OE1  B GLN A 1 67  ? -12.298 -35.248 0.545   0.39  20.14 ? 1520 GLN A OE1  1 
ATOM   892  N  NE2  A GLN A 1 67  ? -12.151 -32.453 2.538   0.61  24.99 ? 1520 GLN A NE2  1 
ATOM   893  N  NE2  B GLN A 1 67  ? -12.900 -34.928 2.701   0.39  22.24 ? 1520 GLN A NE2  1 
ATOM   894  H  H    A GLN A 1 67  ? -17.421 -32.700 2.229   0.61  21.58 ? 1520 GLN A H    1 
ATOM   895  H  H    B GLN A 1 67  ? -17.411 -32.718 2.232   0.39  21.58 ? 1520 GLN A H    1 
ATOM   896  H  HA   A GLN A 1 67  ? -16.323 -33.280 -0.054  0.61  22.70 ? 1520 GLN A HA   1 
ATOM   897  H  HA   B GLN A 1 67  ? -16.436 -33.265 -0.126  0.39  22.21 ? 1520 GLN A HA   1 
ATOM   898  H  HB2  A GLN A 1 67  ? -15.694 -34.096 2.569   0.61  25.07 ? 1520 GLN A HB2  1 
ATOM   899  H  HB2  B GLN A 1 67  ? -14.799 -33.071 1.358   0.39  23.60 ? 1520 GLN A HB2  1 
ATOM   900  H  HB3  A GLN A 1 67  ? -14.884 -34.696 1.348   0.61  25.07 ? 1520 GLN A HB3  1 
ATOM   901  H  HB3  B GLN A 1 67  ? -15.548 -33.975 2.439   0.39  23.60 ? 1520 GLN A HB3  1 
ATOM   902  H  HG2  A GLN A 1 67  ? -13.975 -32.651 0.873   0.61  26.82 ? 1520 GLN A HG2  1 
ATOM   903  H  HG2  B GLN A 1 67  ? -15.017 -35.857 1.377   0.39  25.05 ? 1520 GLN A HG2  1 
ATOM   904  H  HG3  A GLN A 1 67  ? -14.903 -31.946 1.957   0.61  26.82 ? 1520 GLN A HG3  1 
ATOM   905  H  HG3  B GLN A 1 67  ? -14.645 -35.085 0.040   0.39  25.05 ? 1520 GLN A HG3  1 
ATOM   906  H  HE21 A GLN A 1 67  ? -12.016 -32.023 1.806   0.61  29.99 ? 1520 GLN A HE21 1 
ATOM   907  H  HE21 B GLN A 1 67  ? -13.542 -34.833 3.265   0.39  26.69 ? 1520 GLN A HE21 1 
ATOM   908  H  HE22 A GLN A 1 67  ? -11.512 -32.547 3.106   0.61  29.99 ? 1520 GLN A HE22 1 
ATOM   909  H  HE22 B GLN A 1 67  ? -12.084 -34.930 2.974   0.39  26.69 ? 1520 GLN A HE22 1 
ATOM   910  N  N    . LYS A 1 68  ? -17.850 -35.760 1.316   1.00  16.33 ? 1521 LYS A N    1 
ATOM   911  C  CA   . LYS A 1 68  ? -18.341 -37.109 1.048   1.00  17.44 ? 1521 LYS A CA   1 
ATOM   912  C  C    . LYS A 1 68  ? -19.466 -37.065 0.027   1.00  16.77 ? 1521 LYS A C    1 
ATOM   913  O  O    . LYS A 1 68  ? -19.560 -37.931 -0.837  1.00  17.59 ? 1521 LYS A O    1 
ATOM   914  C  CB   . LYS A 1 68  ? -18.801 -37.798 2.328   1.00  19.04 ? 1521 LYS A CB   1 
ATOM   915  C  CG   . LYS A 1 68  ? -17.714 -37.970 3.392   1.00  21.38 ? 1521 LYS A CG   1 
ATOM   916  C  CD   . LYS A 1 68  ? -16.447 -38.550 2.850   1.00  23.35 ? 1521 LYS A CD   1 
ATOM   917  C  CE   . LYS A 1 68  ? -16.673 -39.887 2.227   1.00  23.74 ? 1521 LYS A CE   1 
ATOM   918  N  NZ   . LYS A 1 68  ? -15.401 -40.508 1.727   1.00  25.96 ? 1521 LYS A NZ   1 
ATOM   919  H  H    . LYS A 1 68  ? -18.050 -35.447 2.091   1.00  19.60 ? 1521 LYS A H    1 
ATOM   920  H  HA   . LYS A 1 68  ? -17.611 -37.641 0.667   1.00  20.93 ? 1521 LYS A HA   1 
ATOM   921  H  HB2  . LYS A 1 68  ? -19.516 -37.273 2.722   1.00  22.85 ? 1521 LYS A HB2  1 
ATOM   922  H  HB3  . LYS A 1 68  ? -19.133 -38.681 2.102   1.00  22.85 ? 1521 LYS A HB3  1 
ATOM   923  H  HG2  . LYS A 1 68  ? -17.506 -37.103 3.773   1.00  25.66 ? 1521 LYS A HG2  1 
ATOM   924  H  HG3  . LYS A 1 68  ? -18.042 -38.565 4.084   1.00  25.66 ? 1521 LYS A HG3  1 
ATOM   925  H  HD2  . LYS A 1 68  ? -16.089 -37.956 2.172   1.00  28.02 ? 1521 LYS A HD2  1 
ATOM   926  H  HD3  . LYS A 1 68  ? -15.810 -38.656 3.574   1.00  28.02 ? 1521 LYS A HD3  1 
ATOM   927  H  HE2  . LYS A 1 68  ? -17.060 -40.484 2.887   1.00  28.48 ? 1521 LYS A HE2  1 
ATOM   928  H  HE3  . LYS A 1 68  ? -17.276 -39.788 1.474   1.00  28.48 ? 1521 LYS A HE3  1 
ATOM   929  H  HZ1  . LYS A 1 68  ? -14.830 -40.617 2.401   1.00  31.15 ? 1521 LYS A HZ1  1 
ATOM   930  H  HZ2  . LYS A 1 68  ? -15.573 -41.302 1.363   1.00  31.15 ? 1521 LYS A HZ2  1 
ATOM   931  H  HZ3  . LYS A 1 68  ? -15.027 -39.983 1.113   1.00  31.15 ? 1521 LYS A HZ3  1 
ATOM   932  N  N    . LEU A 1 69  ? -20.332 -36.062 0.115   1.00  16.52 ? 1522 LEU A N    1 
ATOM   933  C  CA   . LEU A 1 69  ? -21.383 -35.930 -0.890  1.00  16.35 ? 1522 LEU A CA   1 
ATOM   934  C  C    . LEU A 1 69  ? -20.779 -35.721 -2.276  1.00  15.43 ? 1522 LEU A C    1 
ATOM   935  O  O    . LEU A 1 69  ? -21.264 -36.280 -3.256  1.00  16.73 ? 1522 LEU A O    1 
ATOM   936  C  CB   . LEU A 1 69  ? -22.336 -34.788 -0.538  1.00  17.15 ? 1522 LEU A CB   1 
ATOM   937  C  CG   . LEU A 1 69  ? -23.171 -34.985 0.731   1.00  18.56 ? 1522 LEU A CG   1 
ATOM   938  C  CD1  . LEU A 1 69  ? -23.931 -33.699 1.052   1.00  19.51 ? 1522 LEU A CD1  1 
ATOM   939  C  CD2  . LEU A 1 69  ? -24.126 -36.142 0.559   1.00  18.52 ? 1522 LEU A CD2  1 
ATOM   940  H  H    . LEU A 1 69  ? -20.336 -35.459 0.728   1.00  19.83 ? 1522 LEU A H    1 
ATOM   941  H  HA   . LEU A 1 69  ? -21.904 -36.760 -0.912  1.00  19.63 ? 1522 LEU A HA   1 
ATOM   942  H  HB2  . LEU A 1 69  ? -21.813 -33.979 -0.418  1.00  20.58 ? 1522 LEU A HB2  1 
ATOM   943  H  HB3  . LEU A 1 69  ? -22.953 -34.666 -1.276  1.00  20.58 ? 1522 LEU A HB3  1 
ATOM   944  H  HG   . LEU A 1 69  ? -22.582 -35.185 1.475   1.00  22.27 ? 1522 LEU A HG   1 
ATOM   945  H  HD11 . LEU A 1 69  ? -24.509 -33.486 0.315   1.00  23.41 ? 1522 LEU A HD11 1 
ATOM   946  H  HD12 . LEU A 1 69  ? -24.451 -33.834 1.848   1.00  23.41 ? 1522 LEU A HD12 1 
ATOM   947  H  HD13 . LEU A 1 69  ? -23.300 -32.989 1.189   1.00  23.41 ? 1522 LEU A HD13 1 
ATOM   948  H  HD21 . LEU A 1 69  ? -23.622 -36.940 0.385   1.00  22.23 ? 1522 LEU A HD21 1 
ATOM   949  H  HD22 . LEU A 1 69  ? -24.638 -36.246 1.365   1.00  22.23 ? 1522 LEU A HD22 1 
ATOM   950  H  HD23 . LEU A 1 69  ? -24.711 -35.956 -0.179  1.00  22.23 ? 1522 LEU A HD23 1 
ATOM   951  N  N    . ALA A 1 70  ? -19.736 -34.901 -2.368  1.00  15.72 ? 1523 ALA A N    1 
ATOM   952  C  CA   . ALA A 1 70  ? -19.077 -34.659 -3.642  1.00  15.55 ? 1523 ALA A CA   1 
ATOM   953  C  C    . ALA A 1 70  ? -18.372 -35.925 -4.137  1.00  16.31 ? 1523 ALA A C    1 
ATOM   954  O  O    . ALA A 1 70  ? -18.442 -36.271 -5.312  1.00  17.44 ? 1523 ALA A O    1 
ATOM   955  C  CB   . ALA A 1 70  ? -18.087 -33.511 -3.519  1.00  15.49 ? 1523 ALA A CB   1 
ATOM   956  H  H    . ALA A 1 70  ? -19.392 -34.474 -1.705  1.00  18.87 ? 1523 ALA A H    1 
ATOM   957  H  HA   . ALA A 1 70  ? -19.751 -34.408 -4.308  1.00  18.67 ? 1523 ALA A HA   1 
ATOM   958  H  HB1  . ALA A 1 70  ? -17.427 -33.737 -2.860  1.00  18.58 ? 1523 ALA A HB1  1 
ATOM   959  H  HB2  . ALA A 1 70  ? -17.665 -33.370 -4.370  1.00  18.58 ? 1523 ALA A HB2  1 
ATOM   960  H  HB3  . ALA A 1 70  ? -18.559 -32.719 -3.252  1.00  18.58 ? 1523 ALA A HB3  1 
ATOM   961  N  N    . GLU A 1 71  ? -17.681 -36.616 -3.248  1.00  16.59 ? 1524 GLU A N    1 
ATOM   962  C  CA   . GLU A 1 71  ? -16.979 -37.831 -3.666  1.00  17.98 ? 1524 GLU A CA   1 
ATOM   963  C  C    . GLU A 1 71  ? -17.933 -38.888 -4.216  1.00  18.99 ? 1524 GLU A C    1 
ATOM   964  O  O    . GLU A 1 71  ? -17.560 -39.659 -5.100  1.00  20.07 ? 1524 GLU A O    1 
ATOM   965  C  CB   . GLU A 1 71  ? -16.133 -38.393 -2.521  1.00  18.75 ? 1524 GLU A CB   1 
ATOM   966  C  CG   . GLU A 1 71  ? -14.871 -37.576 -2.290  1.00  20.31 ? 1524 GLU A CG   1 
ATOM   967  C  CD   . GLU A 1 71  ? -13.972 -38.151 -1.226  1.00  22.94 ? 1524 GLU A CD   1 
ATOM   968  O  OE1  . GLU A 1 71  ? -14.448 -38.948 -0.407  1.00  26.06 ? 1524 GLU A OE1  1 
ATOM   969  O  OE2  . GLU A 1 71  ? -12.776 -37.807 -1.207  1.00  22.51 ? 1524 GLU A OE2  1 
ATOM   970  H  H    . GLU A 1 71  ? -17.600 -36.416 -2.416  1.00  19.90 ? 1524 GLU A H    1 
ATOM   971  H  HA   . GLU A 1 71  ? -16.364 -37.593 -4.390  1.00  21.58 ? 1524 GLU A HA   1 
ATOM   972  H  HB2  . GLU A 1 71  ? -16.655 -38.381 -1.704  1.00  22.50 ? 1524 GLU A HB2  1 
ATOM   973  H  HB3  . GLU A 1 71  ? -15.869 -39.301 -2.737  1.00  22.50 ? 1524 GLU A HB3  1 
ATOM   974  H  HG2  . GLU A 1 71  ? -14.366 -37.536 -3.117  1.00  24.38 ? 1524 GLU A HG2  1 
ATOM   975  H  HG3  . GLU A 1 71  ? -15.124 -36.680 -2.014  1.00  24.38 ? 1524 GLU A HG3  1 
ATOM   976  N  N    . ALA A 1 72  ? -19.163 -38.895 -3.712  1.00  17.94 ? 1525 ALA A N    1 
ATOM   977  C  CA   . ALA A 1 72  ? -20.183 -39.872 -4.109  1.00  19.58 ? 1525 ALA A CA   1 
ATOM   978  C  C    . ALA A 1 72  ? -20.984 -39.448 -5.336  1.00  18.78 ? 1525 ALA A C    1 
ATOM   979  O  O    . ALA A 1 72  ? -21.491 -40.294 -6.087  1.00  19.69 ? 1525 ALA A O    1 
ATOM   980  C  CB   . ALA A 1 72  ? -21.128 -40.122 -2.949  1.00  20.78 ? 1525 ALA A CB   1 
ATOM   981  H  H    . ALA A 1 72  ? -19.441 -38.332 -3.124  1.00  21.53 ? 1525 ALA A H    1 
ATOM   982  H  HA   . ALA A 1 72  ? -19.740 -40.719 -4.321  1.00  23.50 ? 1525 ALA A HA   1 
ATOM   983  H  HB1  . ALA A 1 72  ? -21.550 -39.295 -2.707  1.00  24.94 ? 1525 ALA A HB1  1 
ATOM   984  H  HB2  . ALA A 1 72  ? -21.790 -40.762 -3.219  1.00  24.94 ? 1525 ALA A HB2  1 
ATOM   985  H  HB3  . ALA A 1 72  ? -20.625 -40.464 -2.206  1.00  24.94 ? 1525 ALA A HB3  1 
ATOM   986  N  N    . GLY A 1 73  ? -21.068 -38.140 -5.559  1.00  17.53 ? 1526 GLY A N    1 
ATOM   987  C  CA   . GLY A 1 73  ? -21.929 -37.610 -6.595  1.00  17.21 ? 1526 GLY A CA   1 
ATOM   988  C  C    . GLY A 1 73  ? -21.236 -36.993 -7.782  1.00  16.30 ? 1526 GLY A C    1 
ATOM   989  O  O    . GLY A 1 73  ? -21.790 -36.998 -8.878  1.00  17.75 ? 1526 GLY A O    1 
ATOM   990  H  H    . GLY A 1 73  ? -20.633 -37.541 -5.120  1.00  21.04 ? 1526 GLY A H    1 
ATOM   991  H  HA2  . GLY A 1 73  ? -22.496 -38.326 -6.923  1.00  20.65 ? 1526 GLY A HA2  1 
ATOM   992  H  HA3  . GLY A 1 73  ? -22.504 -36.933 -6.204  1.00  20.65 ? 1526 GLY A HA3  1 
ATOM   993  N  N    . ALA A 1 74  ? -20.045 -36.434 -7.581  1.00  16.45 ? 1527 ALA A N    1 
ATOM   994  C  CA   . ALA A 1 74  ? -19.366 -35.707 -8.652  1.00  15.99 ? 1527 ALA A CA   1 
ATOM   995  C  C    . ALA A 1 74  ? -18.929 -36.641 -9.788  1.00  16.08 ? 1527 ALA A C    1 
ATOM   996  O  O    . ALA A 1 74  ? -18.438 -37.747 -9.550  1.00  17.48 ? 1527 ALA A O    1 
ATOM   997  C  CB   . ALA A 1 74  ? -18.155 -34.959 -8.115  1.00  17.12 ? 1527 ALA A CB   1 
ATOM   998  H  H    . ALA A 1 74  ? -19.611 -36.460 -6.838  1.00  19.74 ? 1527 ALA A H    1 
ATOM   999  H  HA   . ALA A 1 74  ? -19.985 -35.047 -9.028  1.00  19.19 ? 1527 ALA A HA   1 
ATOM   1000 H  HB1  . ALA A 1 74  ? -17.544 -35.591 -7.729  1.00  20.54 ? 1527 ALA A HB1  1 
ATOM   1001 H  HB2  . ALA A 1 74  ? -17.730 -34.493 -8.839  1.00  20.54 ? 1527 ALA A HB2  1 
ATOM   1002 H  HB3  . ALA A 1 74  ? -18.446 -34.334 -7.448  1.00  20.54 ? 1527 ALA A HB3  1 
ATOM   1003 N  N    . ARG A 1 75  ? -19.074 -36.162 -11.020 1.00  16.25 ? 1528 ARG A N    1 
ATOM   1004 C  CA   . ARG A 1 75  ? -18.642 -36.899 -12.197 1.00  15.92 ? 1528 ARG A CA   1 
ATOM   1005 C  C    . ARG A 1 75  ? -17.335 -36.361 -12.756 1.00  16.71 ? 1528 ARG A C    1 
ATOM   1006 O  O    . ARG A 1 75  ? -16.652 -37.048 -13.511 1.00  18.38 ? 1528 ARG A O    1 
ATOM   1007 C  CB   . ARG A 1 75  ? -19.707 -36.832 -13.287 1.00  16.73 ? 1528 ARG A CB   1 
ATOM   1008 C  CG   . ARG A 1 75  ? -21.090 -37.278 -12.861 1.00  18.19 ? 1528 ARG A CG   1 
ATOM   1009 C  CD   . ARG A 1 75  ? -22.081 -36.943 -13.959 1.00  19.83 ? 1528 ARG A CD   1 
ATOM   1010 N  NE   . ARG A 1 75  ? -23.470 -37.208 -13.602 1.00  20.98 ? 1528 ARG A NE   1 
ATOM   1011 C  CZ   . ARG A 1 75  ? -24.103 -38.347 -13.847 1.00  22.01 ? 1528 ARG A CZ   1 
ATOM   1012 N  NH1  . ARG A 1 75  ? -23.471 -39.351 -14.441 1.00  22.93 ? 1528 ARG A NH1  1 
ATOM   1013 N  NH2  . ARG A 1 75  ? -25.380 -38.478 -13.493 1.00  23.10 ? 1528 ARG A NH2  1 
ATOM   1014 H  H    . ARG A 1 75  ? -19.426 -35.398 -11.201 1.00  19.50 ? 1528 ARG A H    1 
ATOM   1015 H  HA   . ARG A 1 75  ? -18.508 -37.840 -11.957 1.00  19.10 ? 1528 ARG A HA   1 
ATOM   1016 H  HB2  . ARG A 1 75  ? -19.777 -35.914 -13.593 1.00  20.08 ? 1528 ARG A HB2  1 
ATOM   1017 H  HB3  . ARG A 1 75  ? -19.431 -37.399 -14.024 1.00  20.08 ? 1528 ARG A HB3  1 
ATOM   1018 H  HG2  . ARG A 1 75  ? -21.095 -38.238 -12.719 1.00  21.83 ? 1528 ARG A HG2  1 
ATOM   1019 H  HG3  . ARG A 1 75  ? -21.351 -36.810 -12.053 1.00  21.83 ? 1528 ARG A HG3  1 
ATOM   1020 H  HD2  . ARG A 1 75  ? -22.005 -36.000 -14.171 1.00  23.80 ? 1528 ARG A HD2  1 
ATOM   1021 H  HD3  . ARG A 1 75  ? -21.870 -37.474 -14.743 1.00  23.80 ? 1528 ARG A HD3  1 
ATOM   1022 H  HE   . ARG A 1 75  ? -23.908 -36.584 -13.205 1.00  25.17 ? 1528 ARG A HE   1 
ATOM   1023 H  HH11 . ARG A 1 75  ? -22.648 -39.264 -14.673 1.00  27.52 ? 1528 ARG A HH11 1 
ATOM   1024 H  HH12 . ARG A 1 75  ? -23.886 -40.089 -14.595 1.00  27.52 ? 1528 ARG A HH12 1 
ATOM   1025 H  HH21 . ARG A 1 75  ? -25.787 -37.828 -13.105 1.00  27.72 ? 1528 ARG A HH21 1 
ATOM   1026 H  HH22 . ARG A 1 75  ? -25.794 -39.217 -13.643 1.00  27.72 ? 1528 ARG A HH22 1 
ATOM   1027 N  N    . CYS A 1 76  ? -17.024 -35.104 -12.430 1.00  15.57 ? 1529 CYS A N    1 
ATOM   1028 C  CA   . CYS A 1 76  ? -15.714 -34.546 -12.733 1.00  15.28 ? 1529 CYS A CA   1 
ATOM   1029 C  C    . CYS A 1 76  ? -14.987 -34.222 -11.433 1.00  14.68 ? 1529 CYS A C    1 
ATOM   1030 O  O    . CYS A 1 76  ? -15.537 -34.357 -10.344 1.00  15.59 ? 1529 CYS A O    1 
ATOM   1031 C  CB   . CYS A 1 76  ? -15.815 -33.309 -13.636 1.00  16.23 ? 1529 CYS A CB   1 
ATOM   1032 S  SG   . CYS A 1 76  ? -16.486 -31.823 -12.855 1.00  16.50 ? 1529 CYS A SG   1 
ATOM   1033 H  H    . CYS A 1 76  ? -17.556 -34.557 -12.033 1.00  18.68 ? 1529 CYS A H    1 
ATOM   1034 H  HA   . CYS A 1 76  ? -15.187 -35.221 -13.209 1.00  18.34 ? 1529 CYS A HA   1 
ATOM   1035 H  HB2  . CYS A 1 76  ? -14.926 -33.091 -13.958 1.00  19.48 ? 1529 CYS A HB2  1 
ATOM   1036 H  HB3  . CYS A 1 76  ? -16.387 -33.525 -14.389 1.00  19.48 ? 1529 CYS A HB3  1 
ATOM   1037 H  HG   . CYS A 1 76  ? -15.785 -31.516 -11.931 1.00  19.80 ? 1529 CYS A HG   1 
ATOM   1038 N  N    . ASP A 1 77  ? -13.736 -33.813 -11.537 1.00  14.76 ? 1530 ASP A N    1 
ATOM   1039 C  CA   . ASP A 1 77  ? -12.949 -33.560 -10.342 1.00  14.51 ? 1530 ASP A CA   1 
ATOM   1040 C  C    . ASP A 1 77  ? -13.297 -32.200 -9.741  1.00  13.90 ? 1530 ASP A C    1 
ATOM   1041 O  O    . ASP A 1 77  ? -13.899 -31.345 -10.402 1.00  13.45 ? 1530 ASP A O    1 
ATOM   1042 C  CB   . ASP A 1 77  ? -11.456 -33.735 -10.647 1.00  14.50 ? 1530 ASP A CB   1 
ATOM   1043 C  CG   . ASP A 1 77  ? -11.133 -35.141 -11.122 1.00  14.85 ? 1530 ASP A CG   1 
ATOM   1044 O  OD1  . ASP A 1 77  ? -11.807 -36.081 -10.642 1.00  16.01 ? 1530 ASP A OD1  1 
ATOM   1045 O  OD2  . ASP A 1 77  ? -10.232 -35.319 -11.963 1.00  15.11 ? 1530 ASP A OD2  1 
ATOM   1046 H  H    . ASP A 1 77  ? -13.322 -33.674 -12.278 1.00  17.71 ? 1530 ASP A H    1 
ATOM   1047 H  HA   . ASP A 1 77  ? -13.186 -34.237 -9.674  1.00  17.41 ? 1530 ASP A HA   1 
ATOM   1048 H  HB2  . ASP A 1 77  ? -11.198 -33.113 -11.345 1.00  17.40 ? 1530 ASP A HB2  1 
ATOM   1049 H  HB3  . ASP A 1 77  ? -10.944 -33.563 -9.841  1.00  17.40 ? 1530 ASP A HB3  1 
ATOM   1050 N  N    . PHE A 1 78  ? -12.958 -32.006 -8.471  1.00  14.05 ? 1531 PHE A N    1 
ATOM   1051 C  CA   . PHE A 1 78  ? -13.433 -30.829 -7.765  1.00  12.84 ? 1531 PHE A CA   1 
ATOM   1052 C  C    . PHE A 1 78  ? -12.557 -30.456 -6.578  1.00  13.67 ? 1531 PHE A C    1 
ATOM   1053 O  O    . PHE A 1 78  ? -11.744 -31.254 -6.097  1.00  13.94 ? 1531 PHE A O    1 
ATOM   1054 C  CB   . PHE A 1 78  ? -14.849 -31.088 -7.250  1.00  13.62 ? 1531 PHE A CB   1 
ATOM   1055 C  CG   . PHE A 1 78  ? -14.904 -32.202 -6.259  1.00  14.01 ? 1531 PHE A CG   1 
ATOM   1056 C  CD1  . PHE A 1 78  ? -14.688 -31.958 -4.915  1.00  15.70 ? 1531 PHE A CD1  1 
ATOM   1057 C  CD2  . PHE A 1 78  ? -15.135 -33.507 -6.672  1.00  14.85 ? 1531 PHE A CD2  1 
ATOM   1058 C  CE1  . PHE A 1 78  ? -14.695 -32.998 -3.987  1.00  16.44 ? 1531 PHE A CE1  1 
ATOM   1059 C  CE2  . PHE A 1 78  ? -15.145 -34.555 -5.752  1.00  15.51 ? 1531 PHE A CE2  1 
ATOM   1060 C  CZ   . PHE A 1 78  ? -14.935 -34.294 -4.402  1.00  15.26 ? 1531 PHE A CZ   1 
ATOM   1061 H  H    . PHE A 1 78  ? -12.463 -32.533 -8.004  1.00  16.86 ? 1531 PHE A H    1 
ATOM   1062 H  HA   . PHE A 1 78  ? -13.461 -30.068 -8.381  1.00  15.41 ? 1531 PHE A HA   1 
ATOM   1063 H  HB2  . PHE A 1 78  ? -15.180 -30.285 -6.818  1.00  16.34 ? 1531 PHE A HB2  1 
ATOM   1064 H  HB3  . PHE A 1 78  ? -15.419 -31.322 -7.998  1.00  16.34 ? 1531 PHE A HB3  1 
ATOM   1065 H  HD1  . PHE A 1 78  ? -14.521 -31.089 -4.628  1.00  18.84 ? 1531 PHE A HD1  1 
ATOM   1066 H  HD2  . PHE A 1 78  ? -15.271 -33.686 -7.574  1.00  17.82 ? 1531 PHE A HD2  1 
ATOM   1067 H  HE1  . PHE A 1 78  ? -14.557 -32.817 -3.086  1.00  19.73 ? 1531 PHE A HE1  1 
ATOM   1068 H  HE2  . PHE A 1 78  ? -15.309 -35.424 -6.039  1.00  18.61 ? 1531 PHE A HE2  1 
ATOM   1069 H  HZ   . PHE A 1 78  ? -14.951 -34.988 -3.783  1.00  18.31 ? 1531 PHE A HZ   1 
ATOM   1070 N  N    . ALA A 1 79  ? -12.721 -29.208 -6.142  1.00  13.41 ? 1532 ALA A N    1 
ATOM   1071 C  CA   . ALA A 1 79  ? -12.257 -28.778 -4.837  1.00  13.29 ? 1532 ALA A CA   1 
ATOM   1072 C  C    . ALA A 1 79  ? -13.396 -27.974 -4.236  1.00  12.77 ? 1532 ALA A C    1 
ATOM   1073 O  O    . ALA A 1 79  ? -14.192 -27.369 -4.965  1.00  13.47 ? 1532 ALA A O    1 
ATOM   1074 C  CB   . ALA A 1 79  ? -10.994 -27.951 -4.931  1.00  14.28 ? 1532 ALA A CB   1 
ATOM   1075 H  H    . ALA A 1 79  ? -13.105 -28.586 -6.596  1.00  16.09 ? 1532 ALA A H    1 
ATOM   1076 H  HA   . ALA A 1 79  ? -12.085 -29.558 -4.270  1.00  15.95 ? 1532 ALA A HA   1 
ATOM   1077 H  HB1  . ALA A 1 79  ? -11.171 -27.172 -5.464  1.00  17.13 ? 1532 ALA A HB1  1 
ATOM   1078 H  HB2  . ALA A 1 79  ? -10.726 -27.690 -4.047  1.00  17.13 ? 1532 ALA A HB2  1 
ATOM   1079 H  HB3  . ALA A 1 79  ? -10.305 -28.479 -5.341  1.00  17.13 ? 1532 ALA A HB3  1 
ATOM   1080 N  N    . LEU A 1 80  ? -13.487 -27.965 -2.914  1.00  13.01 ? 1533 LEU A N    1 
ATOM   1081 C  CA   . LEU A 1 80  ? -14.587 -27.285 -2.231  1.00  13.21 ? 1533 LEU A CA   1 
ATOM   1082 C  C    . LEU A 1 80  ? -14.077 -26.082 -1.455  1.00  11.91 ? 1533 LEU A C    1 
ATOM   1083 O  O    . LEU A 1 80  ? -13.109 -26.198 -0.698  1.00  13.26 ? 1533 LEU A O    1 
ATOM   1084 C  CB   . LEU A 1 80  ? -15.234 -28.240 -1.242  1.00  14.88 ? 1533 LEU A CB   1 
ATOM   1085 C  CG   . LEU A 1 80  ? -15.767 -29.546 -1.814  1.00  16.90 ? 1533 LEU A CG   1 
ATOM   1086 C  CD1  . LEU A 1 80  ? -16.440 -30.325 -0.697  1.00  20.28 ? 1533 LEU A CD1  1 
ATOM   1087 C  CD2  . LEU A 1 80  ? -16.726 -29.301 -2.972  1.00  17.36 ? 1533 LEU A CD2  1 
ATOM   1088 H  H    . LEU A 1 80  ? -12.926 -28.344 -2.385  1.00  15.61 ? 1533 LEU A H    1 
ATOM   1089 H  HA   . LEU A 1 80  ? -15.259 -26.989 -2.880  1.00  15.85 ? 1533 LEU A HA   1 
ATOM   1090 H  HB2  . LEU A 1 80  ? -14.577 -28.469 -0.566  1.00  17.85 ? 1533 LEU A HB2  1 
ATOM   1091 H  HB3  . LEU A 1 80  ? -15.980 -27.784 -0.823  1.00  17.85 ? 1533 LEU A HB3  1 
ATOM   1092 H  HG   . LEU A 1 80  ? -15.024 -30.075 -2.145  1.00  20.28 ? 1533 LEU A HG   1 
ATOM   1093 H  HD11 . LEU A 1 80  ? -17.161 -29.801 -0.341  1.00  24.34 ? 1533 LEU A HD11 1 
ATOM   1094 H  HD12 . LEU A 1 80  ? -16.778 -31.151 -1.052  1.00  24.34 ? 1533 LEU A HD12 1 
ATOM   1095 H  HD13 . LEU A 1 80  ? -15.795 -30.504 -0.009  1.00  24.34 ? 1533 LEU A HD13 1 
ATOM   1096 H  HD21 . LEU A 1 80  ? -16.261 -28.828 -3.667  1.00  20.83 ? 1533 LEU A HD21 1 
ATOM   1097 H  HD22 . LEU A 1 80  ? -17.038 -30.146 -3.304  1.00  20.83 ? 1533 LEU A HD22 1 
ATOM   1098 H  HD23 . LEU A 1 80  ? -17.467 -28.778 -2.658  1.00  20.83 ? 1533 LEU A HD23 1 
ATOM   1099 N  N    . PHE A 1 81  ? -14.700 -24.920 -1.661  1.00  12.16 ? 1534 PHE A N    1 
ATOM   1100 C  CA   . PHE A 1 81  ? -14.370 -23.745 -0.871  1.00  11.95 ? 1534 PHE A CA   1 
ATOM   1101 C  C    . PHE A 1 81  ? -14.926 -23.853 0.553   1.00  12.99 ? 1534 PHE A C    1 
ATOM   1102 O  O    . PHE A 1 81  ? -15.999 -24.443 0.788   1.00  13.90 ? 1534 PHE A O    1 
ATOM   1103 C  CB   . PHE A 1 81  ? -14.951 -22.471 -1.495  1.00  11.89 ? 1534 PHE A CB   1 
ATOM   1104 C  CG   . PHE A 1 81  ? -14.157 -21.919 -2.647  1.00  11.48 ? 1534 PHE A CG   1 
ATOM   1105 C  CD1  . PHE A 1 81  ? -13.054 -21.105 -2.416  1.00  13.70 ? 1534 PHE A CD1  1 
ATOM   1106 C  CD2  . PHE A 1 81  ? -14.530 -22.171 -3.959  1.00  12.77 ? 1534 PHE A CD2  1 
ATOM   1107 C  CE1  . PHE A 1 81  ? -12.324 -20.592 -3.465  1.00  14.04 ? 1534 PHE A CE1  1 
ATOM   1108 C  CE2  . PHE A 1 81  ? -13.801 -21.647 -5.018  1.00  14.06 ? 1534 PHE A CE2  1 
ATOM   1109 C  CZ   . PHE A 1 81  ? -12.699 -20.854 -4.763  1.00  14.58 ? 1534 PHE A CZ   1 
ATOM   1110 H  H    . PHE A 1 81  ? -15.313 -24.791 -2.250  1.00  14.59 ? 1534 PHE A H    1 
ATOM   1111 H  HA   . PHE A 1 81  ? -13.396 -23.650 -0.819  1.00  14.34 ? 1534 PHE A HA   1 
ATOM   1112 H  HB2  . PHE A 1 81  ? -15.844 -22.665 -1.820  1.00  14.27 ? 1534 PHE A HB2  1 
ATOM   1113 H  HB3  . PHE A 1 81  ? -14.994 -21.784 -0.812  1.00  14.27 ? 1534 PHE A HB3  1 
ATOM   1114 H  HD1  . PHE A 1 81  ? -12.792 -20.924 -1.542  1.00  16.43 ? 1534 PHE A HD1  1 
ATOM   1115 H  HD2  . PHE A 1 81  ? -15.270 -22.706 -4.131  1.00  15.33 ? 1534 PHE A HD2  1 
ATOM   1116 H  HE1  . PHE A 1 81  ? -11.584 -20.054 -3.296  1.00  16.85 ? 1534 PHE A HE1  1 
ATOM   1117 H  HE2  . PHE A 1 81  ? -14.053 -21.829 -5.895  1.00  16.87 ? 1534 PHE A HE2  1 
ATOM   1118 H  HZ   . PHE A 1 81  ? -12.207 -20.502 -5.469  1.00  17.49 ? 1534 PHE A HZ   1 
ATOM   1119 N  N    . LEU A 1 82  ? -14.203 -23.251 1.493   1.00  12.58 ? 1535 LEU A N    1 
ATOM   1120 C  CA   . LEU A 1 82  ? -14.768 -22.905 2.793   1.00  12.62 ? 1535 LEU A CA   1 
ATOM   1121 C  C    . LEU A 1 82  ? -15.321 -21.491 2.694   1.00  12.27 ? 1535 LEU A C    1 
ATOM   1122 O  O    . LEU A 1 82  ? -14.835 -20.685 1.900   1.00  13.45 ? 1535 LEU A O    1 
ATOM   1123 C  CB   . LEU A 1 82  ? -13.710 -22.962 3.880   1.00  12.59 ? 1535 LEU A CB   1 
ATOM   1124 C  CG   . LEU A 1 82  ? -13.429 -24.365 4.430   1.00  14.03 ? 1535 LEU A CG   1 
ATOM   1125 C  CD1  . LEU A 1 82  ? -12.057 -24.459 5.067   1.00  15.17 ? 1535 LEU A CD1  1 
ATOM   1126 C  CD2  . LEU A 1 82  ? -14.500 -24.725 5.437   1.00  15.45 ? 1535 LEU A CD2  1 
ATOM   1127 H  H    . LEU A 1 82  ? -13.377 -23.031 1.401   1.00  15.10 ? 1535 LEU A H    1 
ATOM   1128 H  HA   . LEU A 1 82  ? -15.496 -23.520 3.019   1.00  15.15 ? 1535 LEU A HA   1 
ATOM   1129 H  HB2  . LEU A 1 82  ? -12.878 -22.617 3.520   1.00  15.11 ? 1535 LEU A HB2  1 
ATOM   1130 H  HB3  . LEU A 1 82  ? -13.998 -22.408 4.622   1.00  15.11 ? 1535 LEU A HB3  1 
ATOM   1131 H  HG   . LEU A 1 82  ? -13.470 -25.006 3.703   1.00  16.83 ? 1535 LEU A HG   1 
ATOM   1132 H  HD11 . LEU A 1 82  ? -12.006 -23.831 5.791   1.00  18.20 ? 1535 LEU A HD11 1 
ATOM   1133 H  HD12 . LEU A 1 82  ? -11.926 -25.351 5.396   1.00  18.20 ? 1535 LEU A HD12 1 
ATOM   1134 H  HD13 . LEU A 1 82  ? -11.392 -24.252 4.406   1.00  18.20 ? 1535 LEU A HD13 1 
ATOM   1135 H  HD21 . LEU A 1 82  ? -15.356 -24.709 5.001   1.00  18.54 ? 1535 LEU A HD21 1 
ATOM   1136 H  HD22 . LEU A 1 82  ? -14.323 -25.603 5.780   1.00  18.54 ? 1535 LEU A HD22 1 
ATOM   1137 H  HD23 . LEU A 1 82  ? -14.485 -24.084 6.151   1.00  18.54 ? 1535 LEU A HD23 1 
ATOM   1138 N  N    . GLY A 1 83  ? -16.312 -21.190 3.533   1.00  12.29 ? 1536 GLY A N    1 
ATOM   1139 C  CA   . GLY A 1 83  ? -16.897 -19.865 3.605   1.00  13.50 ? 1536 GLY A CA   1 
ATOM   1140 C  C    . GLY A 1 83  ? -16.558 -19.165 4.901   1.00  13.25 ? 1536 GLY A C    1 
ATOM   1141 O  O    . GLY A 1 83  ? -16.602 -19.760 5.978   1.00  14.63 ? 1536 GLY A O    1 
ATOM   1142 H  H    . GLY A 1 83  ? -16.665 -21.752 4.080   1.00  14.75 ? 1536 GLY A H    1 
ATOM   1143 H  HA2  . GLY A 1 83  ? -16.571 -19.326 2.868   1.00  16.19 ? 1536 GLY A HA2  1 
ATOM   1144 H  HA3  . GLY A 1 83  ? -17.863 -19.933 3.534   1.00  16.19 ? 1536 GLY A HA3  1 
ATOM   1145 N  N    . ALA A 1 84  ? -16.233 -17.881 4.785   1.00  12.59 ? 1537 ALA A N    1 
ATOM   1146 C  CA   . ALA A 1 84  ? -15.989 -17.048 5.953   1.00  13.07 ? 1537 ALA A CA   1 
ATOM   1147 C  C    . ALA A 1 84  ? -17.310 -16.652 6.599   1.00  14.19 ? 1537 ALA A C    1 
ATOM   1148 O  O    . ALA A 1 84  ? -18.250 -16.258 5.904   1.00  15.01 ? 1537 ALA A O    1 
ATOM   1149 C  CB   . ALA A 1 84  ? -15.228 -15.815 5.547   1.00  13.33 ? 1537 ALA A CB   1 
ATOM   1150 H  H    . ALA A 1 84  ? -16.147 -17.468 4.036   1.00  15.10 ? 1537 ALA A H    1 
ATOM   1151 H  HA   . ALA A 1 84  ? -15.456 -17.545 6.608   1.00  15.68 ? 1537 ALA A HA   1 
ATOM   1152 H  HB1  . ALA A 1 84  ? -15.747 -15.325 4.905   1.00  16.00 ? 1537 ALA A HB1  1 
ATOM   1153 H  HB2  . ALA A 1 84  ? -15.073 -15.274 6.324   1.00  16.00 ? 1537 ALA A HB2  1 
ATOM   1154 H  HB3  . ALA A 1 84  ? -14.391 -16.079 5.159   1.00  16.00 ? 1537 ALA A HB3  1 
ATOM   1155 N  N    . SER A 1 85  ? -17.367 -16.718 7.925   1.00  14.06 ? 1538 SER A N    1 
ATOM   1156 C  CA   . SER A 1 85  ? -18.543 -16.278 8.661   1.00  14.39 ? 1538 SER A CA   1 
ATOM   1157 C  C    . SER A 1 85  ? -18.131 -15.294 9.746   1.00  14.78 ? 1538 SER A C    1 
ATOM   1158 O  O    . SER A 1 85  ? -16.944 -15.069 9.977   1.00  15.56 ? 1538 SER A O    1 
ATOM   1159 C  CB   . SER A 1 85  ? -19.252 -17.469 9.320   1.00  16.25 ? 1538 SER A CB   1 
ATOM   1160 O  OG   . SER A 1 85  ? -18.567 -17.855 10.500  1.00  17.26 ? 1538 SER A OG   1 
ATOM   1161 H  H    . SER A 1 85  ? -16.732 -17.016 8.423   1.00  16.87 ? 1538 SER A H    1 
ATOM   1162 H  HA   . SER A 1 85  ? -19.170 -15.834 8.052   1.00  17.27 ? 1538 SER A HA   1 
ATOM   1163 H  HB2  . SER A 1 85  ? -20.159 -17.212 9.549   1.00  19.50 ? 1538 SER A HB2  1 
ATOM   1164 H  HB3  . SER A 1 85  ? -19.263 -18.215 8.700   1.00  19.50 ? 1538 SER A HB3  1 
ATOM   1165 H  HG   . SER A 1 85  ? -18.948 -18.492 10.850  1.00  20.72 ? 1538 SER A HG   1 
ATOM   1166 N  N    . SER A 1 86  ? -19.115 -14.755 10.453  1.00  16.61 ? 1539 SER A N    1 
ATOM   1167 C  CA   . SER A 1 86  ? -18.835 -13.854 11.560  1.00  18.83 ? 1539 SER A CA   1 
ATOM   1168 C  C    . SER A 1 86  ? -18.298 -14.571 12.799  1.00  20.93 ? 1539 SER A C    1 
ATOM   1169 O  O    . SER A 1 86  ? -17.937 -13.911 13.775  1.00  22.50 ? 1539 SER A O    1 
ATOM   1170 C  CB   . SER A 1 86  ? -20.096 -13.070 11.934  1.00  21.35 ? 1539 SER A CB   1 
ATOM   1171 O  OG   . SER A 1 86  ? -21.092 -13.934 12.451  1.00  23.39 ? 1539 SER A OG   1 
ATOM   1172 H  H    . SER A 1 86  ? -19.952 -14.894 10.312  1.00  19.93 ? 1539 SER A H    1 
ATOM   1173 H  HA   . SER A 1 86  ? -18.157 -13.208 11.273  1.00  22.59 ? 1539 SER A HA   1 
ATOM   1174 H  HB2  . SER A 1 86  ? -19.869 -12.410 12.608  1.00  25.62 ? 1539 SER A HB2  1 
ATOM   1175 H  HB3  . SER A 1 86  ? -20.441 -12.629 11.141  1.00  25.62 ? 1539 SER A HB3  1 
ATOM   1176 H  HG   . SER A 1 86  ? -20.816 -14.706 12.459  1.00  28.06 ? 1539 SER A HG   1 
ATOM   1177 N  N    . GLU A 1 87  ? -18.219 -15.900 12.765  1.00  21.17 ? 1540 GLU A N    1 
ATOM   1178 C  CA   A GLU A 1 87  ? -17.837 -16.661 13.950  0.51  22.63 ? 1540 GLU A CA   1 
ATOM   1179 C  CA   B GLU A 1 87  ? -17.842 -16.668 13.947  0.49  22.54 ? 1540 GLU A CA   1 
ATOM   1180 C  C    . GLU A 1 87  ? -16.621 -17.558 13.745  1.00  21.39 ? 1540 GLU A C    1 
ATOM   1181 O  O    . GLU A 1 87  ? -16.048 -18.054 14.720  1.00  22.99 ? 1540 GLU A O    1 
ATOM   1182 C  CB   A GLU A 1 87  ? -19.016 -17.519 14.431  0.51  25.70 ? 1540 GLU A CB   1 
ATOM   1183 C  CB   B GLU A 1 87  ? -19.013 -17.550 14.395  0.49  25.40 ? 1540 GLU A CB   1 
ATOM   1184 C  CG   A GLU A 1 87  ? -20.252 -16.704 14.792  0.51  28.58 ? 1540 GLU A CG   1 
ATOM   1185 C  CG   B GLU A 1 87  ? -20.316 -16.794 14.578  0.49  27.99 ? 1540 GLU A CG   1 
ATOM   1186 C  CD   A GLU A 1 87  ? -21.374 -17.536 15.384  0.51  31.06 ? 1540 GLU A CD   1 
ATOM   1187 C  CD   B GLU A 1 87  ? -20.177 -15.628 15.536  0.49  30.08 ? 1540 GLU A CD   1 
ATOM   1188 O  OE1  A GLU A 1 87  ? -21.353 -18.777 15.240  0.51  31.79 ? 1540 GLU A OE1  1 
ATOM   1189 O  OE1  B GLU A 1 87  ? -19.550 -15.809 16.600  0.49  30.94 ? 1540 GLU A OE1  1 
ATOM   1190 O  OE2  A GLU A 1 87  ? -22.288 -16.939 15.989  0.51  32.73 ? 1540 GLU A OE2  1 
ATOM   1191 O  OE2  B GLU A 1 87  ? -20.682 -14.530 15.225  0.49  31.25 ? 1540 GLU A OE2  1 
ATOM   1192 H  H    A GLU A 1 87  ? -18.381 -16.382 12.071  0.51  25.41 ? 1540 GLU A H    1 
ATOM   1193 H  H    B GLU A 1 87  ? -18.379 -16.380 12.069  0.49  25.41 ? 1540 GLU A H    1 
ATOM   1194 H  HA   A GLU A 1 87  ? -17.619 -16.029 14.667  0.51  27.16 ? 1540 GLU A HA   1 
ATOM   1195 H  HA   B GLU A 1 87  ? -17.640 -16.044 14.676  0.49  27.05 ? 1540 GLU A HA   1 
ATOM   1196 H  HB2  A GLU A 1 87  ? -19.263 -18.137 13.725  0.51  30.84 ? 1540 GLU A HB2  1 
ATOM   1197 H  HB2  B GLU A 1 87  ? -19.161 -18.237 13.726  0.49  30.48 ? 1540 GLU A HB2  1 
ATOM   1198 H  HB3  A GLU A 1 87  ? -18.744 -18.012 15.220  0.51  30.84 ? 1540 GLU A HB3  1 
ATOM   1199 H  HB3  B GLU A 1 87  ? -18.788 -17.962 15.244  0.49  30.48 ? 1540 GLU A HB3  1 
ATOM   1200 H  HG2  A GLU A 1 87  ? -20.004 -16.031 15.445  0.51  34.30 ? 1540 GLU A HG2  1 
ATOM   1201 H  HG2  B GLU A 1 87  ? -20.604 -16.446 13.720  0.49  33.59 ? 1540 GLU A HG2  1 
ATOM   1202 H  HG3  A GLU A 1 87  ? -20.590 -16.276 13.990  0.51  34.30 ? 1540 GLU A HG3  1 
ATOM   1203 H  HG3  B GLU A 1 87  ? -20.986 -17.398 14.934  0.49  33.59 ? 1540 GLU A HG3  1 
ATOM   1204 N  N    . ASN A 1 88  ? -16.213 -17.781 12.498  1.00  17.94 ? 1541 ASN A N    1 
ATOM   1205 C  CA   . ASN A 1 88  ? -15.206 -18.818 12.275  1.00  16.41 ? 1541 ASN A CA   1 
ATOM   1206 C  C    . ASN A 1 88  ? -13.766 -18.397 12.018  1.00  15.94 ? 1541 ASN A C    1 
ATOM   1207 O  O    . ASN A 1 88  ? -12.913 -19.265 11.828  1.00  17.31 ? 1541 ASN A O    1 
ATOM   1208 C  CB   . ASN A 1 88  ? -15.660 -19.822 11.196  1.00  15.08 ? 1541 ASN A CB   1 
ATOM   1209 C  CG   . ASN A 1 88  ? -15.811 -19.195 9.823   1.00  14.72 ? 1541 ASN A CG   1 
ATOM   1210 O  OD1  . ASN A 1 88  ? -15.470 -18.031 9.614   1.00  14.94 ? 1541 ASN A OD1  1 
ATOM   1211 N  ND2  . ASN A 1 88  ? -16.284 -19.989 8.863   1.00  15.67 ? 1541 ASN A ND2  1 
ATOM   1212 H  H    . ASN A 1 88  ? -16.487 -17.368 11.795  1.00  21.53 ? 1541 ASN A H    1 
ATOM   1213 H  HA   . ASN A 1 88  ? -15.171 -19.336 13.107  1.00  19.69 ? 1541 ASN A HA   1 
ATOM   1214 H  HB2  . ASN A 1 88  ? -15.001 -20.531 11.129  1.00  18.09 ? 1541 ASN A HB2  1 
ATOM   1215 H  HB3  . ASN A 1 88  ? -16.519 -20.192 11.451  1.00  18.09 ? 1541 ASN A HB3  1 
ATOM   1216 H  HD21 . ASN A 1 88  ? -16.483 -20.807 9.040   1.00  18.81 ? 1541 ASN A HD21 1 
ATOM   1217 H  HD22 . ASN A 1 88  ? -16.389 -19.684 8.066   1.00  18.81 ? 1541 ASN A HD22 1 
ATOM   1218 N  N    . ALA A 1 89  ? -13.459 -17.102 12.017  1.00  15.78 ? 1542 ALA A N    1 
ATOM   1219 C  CA   . ALA A 1 89  ? -12.062 -16.692 11.859  1.00  16.59 ? 1542 ALA A CA   1 
ATOM   1220 C  C    . ALA A 1 89  ? -11.236 -17.304 12.979  1.00  18.21 ? 1542 ALA A C    1 
ATOM   1221 O  O    . ALA A 1 89  ? -11.619 -17.250 14.153  1.00  19.41 ? 1542 ALA A O    1 
ATOM   1222 C  CB   . ALA A 1 89  ? -11.913 -15.172 11.860  1.00  16.95 ? 1542 ALA A CB   1 
ATOM   1223 H  H    . ALA A 1 89  ? -14.021 -16.456 12.104  1.00  18.93 ? 1542 ALA A H    1 
ATOM   1224 H  HA   . ALA A 1 89  ? -11.721 -17.033 11.006  1.00  19.91 ? 1542 ALA A HA   1 
ATOM   1225 H  HB1  . ALA A 1 89  ? -12.240 -14.826 12.694  1.00  20.34 ? 1542 ALA A HB1  1 
ATOM   1226 H  HB2  . ALA A 1 89  ? -10.985 -14.949 11.755  1.00  20.34 ? 1542 ALA A HB2  1 
ATOM   1227 H  HB3  . ALA A 1 89  ? -12.422 -14.808 11.132  1.00  20.34 ? 1542 ALA A HB3  1 
ATOM   1228 N  N    . GLY A 1 90  ? -10.106 -17.890 12.616  1.00  18.46 ? 1543 GLY A N    1 
ATOM   1229 C  CA   . GLY A 1 90  ? -9.219  -18.503 13.588  1.00  19.92 ? 1543 GLY A CA   1 
ATOM   1230 C  C    . GLY A 1 90  ? -9.585  -19.923 13.975  1.00  20.67 ? 1543 GLY A C    1 
ATOM   1231 O  O    . GLY A 1 90  ? -8.945  -20.489 14.859  1.00  23.90 ? 1543 GLY A O    1 
ATOM   1232 H  H    . GLY A 1 90  ? -9.828  -17.947 11.804  1.00  22.15 ? 1543 GLY A H    1 
ATOM   1233 H  HA2  . GLY A 1 90  ? -8.318  -18.514 13.229  1.00  23.91 ? 1543 GLY A HA2  1 
ATOM   1234 H  HA3  . GLY A 1 90  ? -9.215  -17.964 14.395  1.00  23.91 ? 1543 GLY A HA3  1 
ATOM   1235 N  N    . THR A 1 91  ? -10.600 -20.491 13.327  1.00  18.59 ? 1544 THR A N    1 
ATOM   1236 C  CA   . THR A 1 91  ? -11.037 -21.850 13.635  1.00  18.25 ? 1544 THR A CA   1 
ATOM   1237 C  C    . THR A 1 91  ? -10.822 -22.850 12.505  1.00  18.85 ? 1544 THR A C    1 
ATOM   1238 O  O    . THR A 1 91  ? -11.024 -24.045 12.711  1.00  21.08 ? 1544 THR A O    1 
ATOM   1239 C  CB   . THR A 1 91  ? -12.539 -21.906 14.004  1.00  20.36 ? 1544 THR A CB   1 
ATOM   1240 O  OG1  . THR A 1 91  ? -13.334 -21.746 12.825  1.00  20.23 ? 1544 THR A OG1  1 
ATOM   1241 C  CG2  . THR A 1 91  ? -12.892 -20.842 15.024  1.00  21.73 ? 1544 THR A CG2  1 
ATOM   1242 H  H    . THR A 1 91  ? -11.053 -20.109 12.704  1.00  22.31 ? 1544 THR A H    1 
ATOM   1243 H  HA   . THR A 1 91  ? -10.531 -22.169 14.411  1.00  21.90 ? 1544 THR A HA   1 
ATOM   1244 H  HB   . THR A 1 91  ? -12.733 -22.771 14.398  1.00  24.43 ? 1544 THR A HB   1 
ATOM   1245 H  HG1  . THR A 1 91  ? -13.172 -21.024 12.473  1.00  24.28 ? 1544 THR A HG1  1 
ATOM   1246 H  HG21 . THR A 1 91  ? -12.700 -19.971 14.669  1.00  26.08 ? 1544 THR A HG21 1 
ATOM   1247 H  HG22 . THR A 1 91  ? -13.826 -20.892 15.240  1.00  26.08 ? 1544 THR A HG22 1 
ATOM   1248 H  HG23 . THR A 1 91  ? -12.379 -20.973 15.825  1.00  26.08 ? 1544 THR A HG23 1 
ATOM   1249 N  N    . LEU A 1 92  ? -10.406 -22.376 11.333  1.00  18.27 ? 1545 LEU A N    1 
ATOM   1250 C  CA   . LEU A 1 92  ? -10.337 -23.213 10.133  1.00  18.30 ? 1545 LEU A CA   1 
ATOM   1251 C  C    . LEU A 1 92  ? -8.942  -23.733 9.812   1.00  19.38 ? 1545 LEU A C    1 
ATOM   1252 O  O    . LEU A 1 92  ? -8.753  -24.391 8.788   1.00  19.44 ? 1545 LEU A O    1 
ATOM   1253 C  CB   . LEU A 1 92  ? -10.846 -22.425 8.929   1.00  18.52 ? 1545 LEU A CB   1 
ATOM   1254 C  CG   . LEU A 1 92  ? -12.271 -21.881 9.055   1.00  18.66 ? 1545 LEU A CG   1 
ATOM   1255 C  CD1  . LEU A 1 92  ? -12.612 -21.020 7.843   1.00  19.61 ? 1545 LEU A CD1  1 
ATOM   1256 C  CD2  . LEU A 1 92  ? -13.294 -23.008 9.224   1.00  20.25 ? 1545 LEU A CD2  1 
ATOM   1257 H  H    . LEU A 1 92  ? -10.155 -21.564 11.204  1.00  21.93 ? 1545 LEU A H    1 
ATOM   1258 H  HA   . LEU A 1 92  ? -10.925 -23.987 10.255  1.00  21.96 ? 1545 LEU A HA   1 
ATOM   1259 H  HB2  . LEU A 1 92  ? -10.258 -21.667 8.786   1.00  22.23 ? 1545 LEU A HB2  1 
ATOM   1260 H  HB3  . LEU A 1 92  ? -10.824 -23.004 8.151   1.00  22.23 ? 1545 LEU A HB3  1 
ATOM   1261 H  HG   . LEU A 1 92  ? -12.320 -21.317 9.842   1.00  22.40 ? 1545 LEU A HG   1 
ATOM   1262 H  HD11 . LEU A 1 92  ? -12.544 -21.557 7.050   1.00  23.53 ? 1545 LEU A HD11 1 
ATOM   1263 H  HD12 . LEU A 1 92  ? -13.507 -20.688 7.939   1.00  23.53 ? 1545 LEU A HD12 1 
ATOM   1264 H  HD13 . LEU A 1 92  ? -11.993 -20.287 7.797   1.00  23.53 ? 1545 LEU A HD13 1 
ATOM   1265 H  HD21 . LEU A 1 92  ? -13.084 -23.504 10.018  1.00  24.30 ? 1545 LEU A HD21 1 
ATOM   1266 H  HD22 . LEU A 1 92  ? -14.171 -22.624 9.299   1.00  24.30 ? 1545 LEU A HD22 1 
ATOM   1267 H  HD23 . LEU A 1 92  ? -13.253 -23.584 8.457   1.00  24.30 ? 1545 LEU A HD23 1 
ATOM   1268 N  N    . GLY A 1 93  ? -7.974  -23.464 10.680  1.00  21.29 ? 1546 GLY A N    1 
ATOM   1269 C  CA   . GLY A 1 93  ? -6.591  -23.794 10.385  1.00  22.97 ? 1546 GLY A CA   1 
ATOM   1270 C  C    . GLY A 1 93  ? -6.304  -25.247 10.054  1.00  23.64 ? 1546 GLY A C    1 
ATOM   1271 O  O    . GLY A 1 93  ? -5.499  -25.539 9.172   1.00  24.56 ? 1546 GLY A O    1 
ATOM   1272 H  H    . GLY A 1 93  ? -8.094  -23.091 11.446  1.00  25.55 ? 1546 GLY A H    1 
ATOM   1273 H  HA2  . GLY A 1 93  ? -6.299  -23.258 9.631   1.00  27.56 ? 1546 GLY A HA2  1 
ATOM   1274 H  HA3  . GLY A 1 93  ? -6.045  -23.553 11.149  1.00  27.56 ? 1546 GLY A HA3  1 
ATOM   1275 N  N    . THR A 1 94  ? -6.957  -26.165 10.751  1.00  24.02 ? 1547 THR A N    1 
ATOM   1276 C  CA   . THR A 1 94  ? -6.679  -27.586 10.557  1.00  25.56 ? 1547 THR A CA   1 
ATOM   1277 C  C    . THR A 1 94  ? -7.277  -28.133 9.265   1.00  23.82 ? 1547 THR A C    1 
ATOM   1278 O  O    . THR A 1 94  ? -6.763  -29.106 8.721   1.00  26.31 ? 1547 THR A O    1 
ATOM   1279 C  CB   . THR A 1 94  ? -7.147  -28.428 11.756  1.00  30.10 ? 1547 THR A CB   1 
ATOM   1280 O  OG1  . THR A 1 94  ? -8.568  -28.348 11.885  1.00  33.60 ? 1547 THR A OG1  1 
ATOM   1281 C  CG2  . THR A 1 94  ? -6.504  -27.941 13.021  1.00  30.70 ? 1547 THR A CG2  1 
ATOM   1282 H  H    . THR A 1 94  ? -7.562  -25.997 11.339  1.00  28.82 ? 1547 THR A H    1 
ATOM   1283 H  HA   . THR A 1 94  ? -5.707  -27.696 10.492  1.00  30.67 ? 1547 THR A HA   1 
ATOM   1284 H  HB   . THR A 1 94  ? -6.889  -29.353 11.618  1.00  36.12 ? 1547 THR A HB   1 
ATOM   1285 H  HG1  . THR A 1 94  ? -8.795  -27.569 12.002  1.00  40.32 ? 1547 THR A HG1  1 
ATOM   1286 H  HG21 . THR A 1 94  ? -6.740  -27.024 13.177  1.00  36.83 ? 1547 THR A HG21 1 
ATOM   1287 H  HG22 . THR A 1 94  ? -6.800  -28.471 13.765  1.00  36.83 ? 1547 THR A HG22 1 
ATOM   1288 H  HG23 . THR A 1 94  ? -5.549  -28.009 12.950  1.00  36.83 ? 1547 THR A HG23 1 
ATOM   1289 N  N    . VAL A 1 95  ? -8.337  -27.508 8.753   1.00  20.28 ? 1548 VAL A N    1 
ATOM   1290 C  CA   . VAL A 1 95  ? -8.951  -27.977 7.513   1.00  19.11 ? 1548 VAL A CA   1 
ATOM   1291 C  C    . VAL A 1 95  ? -8.694  -27.075 6.309   1.00  17.24 ? 1548 VAL A C    1 
ATOM   1292 O  O    . VAL A 1 95  ? -9.040  -27.432 5.187   1.00  17.97 ? 1548 VAL A O    1 
ATOM   1293 C  CB   . VAL A 1 95  ? -10.477 -28.216 7.668   1.00  20.53 ? 1548 VAL A CB   1 
ATOM   1294 C  CG1  . VAL A 1 95  ? -10.729 -29.366 8.651   1.00  22.42 ? 1548 VAL A CG1  1 
ATOM   1295 C  CG2  . VAL A 1 95  ? -11.192 -26.947 8.088   1.00  20.79 ? 1548 VAL A CG2  1 
ATOM   1296 H  H    . VAL A 1 95  ? -8.716  -26.819 9.100   1.00  24.33 ? 1548 VAL A H    1 
ATOM   1297 H  HA   . VAL A 1 95  ? -8.553  -28.846 7.300   1.00  22.93 ? 1548 VAL A HA   1 
ATOM   1298 H  HB   . VAL A 1 95  ? -10.840 -28.486 6.799   1.00  24.64 ? 1548 VAL A HB   1 
ATOM   1299 H  HG11 . VAL A 1 95  ? -10.353 -29.136 9.504   1.00  26.91 ? 1548 VAL A HG11 1 
ATOM   1300 H  HG12 . VAL A 1 95  ? -11.676 -29.502 8.736   1.00  26.91 ? 1548 VAL A HG12 1 
ATOM   1301 H  HG13 . VAL A 1 95  ? -10.313 -30.162 8.313   1.00  26.91 ? 1548 VAL A HG13 1 
ATOM   1302 H  HG21 . VAL A 1 95  ? -11.050 -26.273 7.419   1.00  24.95 ? 1548 VAL A HG21 1 
ATOM   1303 H  HG22 . VAL A 1 95  ? -12.131 -27.132 8.174   1.00  24.95 ? 1548 VAL A HG22 1 
ATOM   1304 H  HG23 . VAL A 1 95  ? -10.838 -26.653 8.930   1.00  24.95 ? 1548 VAL A HG23 1 
ATOM   1305 N  N    . ALA A 1 96  ? -8.078  -25.917 6.523   1.00  16.11 ? 1549 ALA A N    1 
ATOM   1306 C  CA   . ALA A 1 96  ? -7.927  -24.921 5.462   1.00  15.48 ? 1549 ALA A CA   1 
ATOM   1307 C  C    . ALA A 1 96  ? -7.258  -25.472 4.206   1.00  14.79 ? 1549 ALA A C    1 
ATOM   1308 O  O    . ALA A 1 96  ? -7.705  -25.217 3.087   1.00  15.55 ? 1549 ALA A O    1 
ATOM   1309 C  CB   . ALA A 1 96  ? -7.159  -23.719 5.987   1.00  15.05 ? 1549 ALA A CB   1 
ATOM   1310 H  H    . ALA A 1 96  ? -7.737  -25.681 7.276   1.00  19.33 ? 1549 ALA A H    1 
ATOM   1311 H  HA   . ALA A 1 96  ? -8.819  -24.608 5.204   1.00  18.58 ? 1549 ALA A HA   1 
ATOM   1312 H  HB1  . ALA A 1 96  ? -6.292  -24.007 6.283   1.00  18.06 ? 1549 ALA A HB1  1 
ATOM   1313 H  HB2  . ALA A 1 96  ? -7.067  -23.074 5.282   1.00  18.06 ? 1549 ALA A HB2  1 
ATOM   1314 H  HB3  . ALA A 1 96  ? -7.645  -23.335 6.721   1.00  18.06 ? 1549 ALA A HB3  1 
ATOM   1315 N  N    . GLY A 1 97  ? -6.197  -26.249 4.393   1.00  15.64 ? 1550 GLY A N    1 
ATOM   1316 C  CA   . GLY A 1 97  ? -5.447  -26.768 3.271   1.00  15.62 ? 1550 GLY A CA   1 
ATOM   1317 C  C    . GLY A 1 97  ? -6.206  -27.794 2.443   1.00  16.11 ? 1550 GLY A C    1 
ATOM   1318 O  O    . GLY A 1 97  ? -5.772  -28.141 1.349   1.00  17.99 ? 1550 GLY A O    1 
ATOM   1319 H  H    . GLY A 1 97  ? -5.895  -26.487 5.162   1.00  18.77 ? 1550 GLY A H    1 
ATOM   1320 H  HA2  . GLY A 1 97  ? -5.199  -26.034 2.687   1.00  18.74 ? 1550 GLY A HA2  1 
ATOM   1321 H  HA3  . GLY A 1 97  ? -4.634  -27.184 3.597   1.00  18.74 ? 1550 GLY A HA3  1 
ATOM   1322 N  N    . SER A 1 98  ? -7.305  -28.315 2.983   1.00  14.88 ? 1551 SER A N    1 
ATOM   1323 C  CA   A SER A 1 98  ? -8.106  -29.303 2.267   0.64  16.27 ? 1551 SER A CA   1 
ATOM   1324 C  CA   B SER A 1 98  ? -8.133  -29.300 2.291   0.36  15.39 ? 1551 SER A CA   1 
ATOM   1325 C  C    . SER A 1 98  ? -9.146  -28.640 1.369   1.00  14.96 ? 1551 SER A C    1 
ATOM   1326 O  O    . SER A 1 98  ? -9.810  -29.314 0.583   1.00  15.81 ? 1551 SER A O    1 
ATOM   1327 C  CB   A SER A 1 98  ? -8.773  -30.265 3.256   0.64  17.97 ? 1551 SER A CB   1 
ATOM   1328 C  CB   B SER A 1 98  ? -8.888  -30.154 3.308   0.36  15.83 ? 1551 SER A CB   1 
ATOM   1329 O  OG   A SER A 1 98  ? -9.870  -29.688 3.938   0.64  19.72 ? 1551 SER A OG   1 
ATOM   1330 O  OG   B SER A 1 98  ? -8.001  -30.927 4.093   0.36  16.39 ? 1551 SER A OG   1 
ATOM   1331 H  H    A SER A 1 98  ? -7.609  -28.113 3.762   0.64  17.85 ? 1551 SER A H    1 
ATOM   1332 H  H    B SER A 1 98  ? -7.598  -28.110 3.765   0.36  17.85 ? 1551 SER A H    1 
ATOM   1333 H  HA   A SER A 1 98  ? -7.512  -29.831 1.694   0.64  19.52 ? 1551 SER A HA   1 
ATOM   1334 H  HA   B SER A 1 98  ? -7.561  -29.888 1.755   0.36  18.47 ? 1551 SER A HA   1 
ATOM   1335 H  HB2  A SER A 1 98  ? -9.088  -31.041 2.766   0.64  21.56 ? 1551 SER A HB2  1 
ATOM   1336 H  HB2  B SER A 1 98  ? -9.397  -29.570 3.892   0.36  19.00 ? 1551 SER A HB2  1 
ATOM   1337 H  HB3  A SER A 1 98  ? -8.113  -30.541 3.911   0.64  21.56 ? 1551 SER A HB3  1 
ATOM   1338 H  HB3  B SER A 1 98  ? -9.488  -30.749 2.833   0.36  19.00 ? 1551 SER A HB3  1 
ATOM   1339 H  HG   A SER A 1 98  ? -9.978  -28.914 3.692   0.64  23.67 ? 1551 SER A HG   1 
ATOM   1340 H  HG   B SER A 1 98  ? -7.227  -30.783 3.865   0.36  19.67 ? 1551 SER A HG   1 
ATOM   1341 N  N    . ALA A 1 99  ? -9.285  -27.316 1.475   1.00  15.01 ? 1552 ALA A N    1 
ATOM   1342 C  CA   . ALA A 1 99  ? -10.292 -26.594 0.721   1.00  14.19 ? 1552 ALA A CA   1 
ATOM   1343 C  C    . ALA A 1 99  ? -9.679  -25.980 -0.529  1.00  13.79 ? 1552 ALA A C    1 
ATOM   1344 O  O    . ALA A 1 99  ? -8.461  -25.796 -0.608  1.00  15.00 ? 1552 ALA A O    1 
ATOM   1345 C  CB   . ALA A 1 99  ? -10.912 -25.499 1.591   1.00  15.33 ? 1552 ALA A CB   1 
ATOM   1346 H  H    . ALA A 1 99  ? -8.803  -26.817 1.983   1.00  18.02 ? 1552 ALA A H    1 
ATOM   1347 H  HA   . ALA A 1 99  ? -11.001 -27.213 0.448   1.00  17.03 ? 1552 ALA A HA   1 
ATOM   1348 H  HB1  . ALA A 1 99  ? -10.223 -24.891 1.867   1.00  18.39 ? 1552 ALA A HB1  1 
ATOM   1349 H  HB2  . ALA A 1 99  ? -11.575 -25.031 1.078   1.00  18.39 ? 1552 ALA A HB2  1 
ATOM   1350 H  HB3  . ALA A 1 99  ? -11.319 -25.905 2.360   1.00  18.39 ? 1552 ALA A HB3  1 
ATOM   1351 N  N    . ALA A 1 100 ? -10.531 -25.617 -1.479  1.00  13.59 ? 1553 ALA A N    1 
ATOM   1352 C  CA   . ALA A 1 100 ? -10.091 -24.833 -2.630  1.00  12.35 ? 1553 ALA A CA   1 
ATOM   1353 C  C    . ALA A 1 100 ? -9.458  -23.514 -2.167  1.00  12.38 ? 1553 ALA A C    1 
ATOM   1354 O  O    . ALA A 1 100 ? -8.460  -23.065 -2.722  1.00  14.42 ? 1553 ALA A O    1 
ATOM   1355 C  CB   . ALA A 1 100 ? -11.274 -24.540 -3.547  1.00  13.35 ? 1553 ALA A CB   1 
ATOM   1356 H  H    . ALA A 1 100 ? -11.369 -25.812 -1.484  1.00  16.31 ? 1553 ALA A H    1 
ATOM   1357 H  HA   . ALA A 1 100 ? -9.422  -25.340 -3.135  1.00  14.81 ? 1553 ALA A HA   1 
ATOM   1358 H  HB1  . ALA A 1 100 ? -11.934 -24.045 -3.056  1.00  16.02 ? 1553 ALA A HB1  1 
ATOM   1359 H  HB2  . ALA A 1 100 ? -10.968 -24.025 -4.297  1.00  16.02 ? 1553 ALA A HB2  1 
ATOM   1360 H  HB3  . ALA A 1 100 ? -11.647 -25.371 -3.851  1.00  16.02 ? 1553 ALA A HB3  1 
ATOM   1361 N  N    . GLY A 1 101 ? -10.058 -22.919 -1.143  1.00  12.73 ? 1554 GLY A N    1 
ATOM   1362 C  CA   . GLY A 1 101 ? -9.662  -21.614 -0.645  1.00  11.97 ? 1554 GLY A CA   1 
ATOM   1363 C  C    . GLY A 1 101 ? -10.741 -21.132 0.295   1.00  12.15 ? 1554 GLY A C    1 
ATOM   1364 O  O    . GLY A 1 101 ? -11.637 -21.909 0.657   1.00  12.99 ? 1554 GLY A O    1 
ATOM   1365 H  H    . GLY A 1 101 ? -10.716 -23.264 -0.710  1.00  15.27 ? 1554 GLY A H    1 
ATOM   1366 H  HA2  . GLY A 1 101 ? -8.821  -21.675 -0.166  1.00  14.36 ? 1554 GLY A HA2  1 
ATOM   1367 H  HA3  . GLY A 1 101 ? -9.570  -20.986 -1.379  1.00  14.36 ? 1554 GLY A HA3  1 
ATOM   1368 N  N    . LEU A 1 102 ? -10.651 -19.872 0.708   1.00  11.63 ? 1555 LEU A N    1 
ATOM   1369 C  CA   . LEU A 1 102 ? -11.662 -19.247 1.551   1.00  11.52 ? 1555 LEU A CA   1 
ATOM   1370 C  C    . LEU A 1 102 ? -12.447 -18.218 0.722   1.00  11.35 ? 1555 LEU A C    1 
ATOM   1371 O  O    . LEU A 1 102 ? -11.841 -17.367 0.055   1.00  12.46 ? 1555 LEU A O    1 
ATOM   1372 C  CB   . LEU A 1 102 ? -11.008 -18.551 2.740   1.00  12.27 ? 1555 LEU A CB   1 
ATOM   1373 C  CG   . LEU A 1 102 ? -11.945 -17.859 3.720   1.00  12.39 ? 1555 LEU A CG   1 
ATOM   1374 C  CD1  . LEU A 1 102 ? -12.759 -18.906 4.459   1.00  13.64 ? 1555 LEU A CD1  1 
ATOM   1375 C  CD2  . LEU A 1 102 ? -11.132 -16.991 4.694   1.00  14.10 ? 1555 LEU A CD2  1 
ATOM   1376 H  H    . LEU A 1 102 ? -9.999  -19.349 0.507   1.00  13.96 ? 1555 LEU A H    1 
ATOM   1377 H  HA   . LEU A 1 102 ? -12.285 -19.927 1.885   1.00  13.82 ? 1555 LEU A HA   1 
ATOM   1378 H  HB2  . LEU A 1 102 ? -10.505 -19.213 3.240   1.00  14.72 ? 1555 LEU A HB2  1 
ATOM   1379 H  HB3  . LEU A 1 102 ? -10.399 -17.877 2.399   1.00  14.72 ? 1555 LEU A HB3  1 
ATOM   1380 H  HG   . LEU A 1 102 ? -12.555 -17.284 3.232   1.00  14.86 ? 1555 LEU A HG   1 
ATOM   1381 H  HD11 . LEU A 1 102 ? -12.162 -19.487 4.936   1.00  16.37 ? 1555 LEU A HD11 1 
ATOM   1382 H  HD12 . LEU A 1 102 ? -13.348 -18.464 5.076   1.00  16.37 ? 1555 LEU A HD12 1 
ATOM   1383 H  HD13 . LEU A 1 102 ? -13.270 -19.411 3.823   1.00  16.37 ? 1555 LEU A HD13 1 
ATOM   1384 H  HD21 . LEU A 1 102 ? -10.646 -16.331 4.193   1.00  16.92 ? 1555 LEU A HD21 1 
ATOM   1385 H  HD22 . LEU A 1 102 ? -11.733 -16.561 5.305   1.00  16.92 ? 1555 LEU A HD22 1 
ATOM   1386 H  HD23 . LEU A 1 102 ? -10.519 -17.552 5.175   1.00  16.92 ? 1555 LEU A HD23 1 
HETATM 1387 N  N    . KCX A 1 103 ? -13.780 -18.304 0.791   1.00  10.95 ? 1556 KCX A N    1 
HETATM 1388 C  CA   . KCX A 1 103 ? -14.684 -17.442 0.222   1.00  10.76 ? 1556 KCX A CA   1 
HETATM 1389 C  CB   . KCX A 1 103 ? -15.787 -18.152 -0.561  1.00  11.94 ? 1556 KCX A CB   1 
HETATM 1390 C  CG   . KCX A 1 103 ? -16.903 -17.278 -1.110  1.00  11.91 ? 1556 KCX A CG   1 
HETATM 1391 C  CD   . KCX A 1 103 ? -16.424 -16.478 -2.301  1.00  12.91 ? 1556 KCX A CD   1 
HETATM 1392 C  CE   . KCX A 1 103 ? -17.544 -15.684 -2.985  1.00  12.77 ? 1556 KCX A CE   1 
HETATM 1393 N  NZ   . KCX A 1 103 ? -18.484 -16.632 -3.535  1.00  13.20 ? 1556 KCX A NZ   1 
HETATM 1394 C  C    . KCX A 1 103 ? -15.201 -16.432 1.075   1.00  10.53 ? 1556 KCX A C    1 
HETATM 1395 O  O    . KCX A 1 103 ? -15.795 -16.764 2.094   1.00  12.03 ? 1556 KCX A O    1 
HETATM 1396 C  CX   . KCX A 1 103 ? -19.474 -16.174 -4.455  1.00  12.69 ? 1556 KCX A CX   1 
HETATM 1397 O  OQ1  . KCX A 1 103 ? -19.389 -14.991 -4.910  1.00  12.25 ? 1556 KCX A OQ1  1 
HETATM 1398 O  OQ2  . KCX A 1 103 ? -20.410 -16.989 -4.767  1.00  13.99 ? 1556 KCX A OQ2  1 
HETATM 1399 H  H    . KCX A 1 103 ? -14.153 -18.991 1.255   1.00  13.15 ? 1556 KCX A H    1 
HETATM 1400 H  HA   . KCX A 1 103 ? -14.238 -17.006 -0.525  1.00  12.91 ? 1556 KCX A HA   1 
HETATM 1401 H  HB2  . KCX A 1 103 ? -15.379 -18.635 -1.301  1.00  14.33 ? 1556 KCX A HB2  1 
HETATM 1402 H  HB3  . KCX A 1 103 ? -16.197 -18.803 0.038   1.00  14.33 ? 1556 KCX A HB3  1 
HETATM 1403 H  HG2  . KCX A 1 103 ? -17.640 -17.850 -1.396  1.00  14.29 ? 1556 KCX A HG2  1 
HETATM 1404 H  HG3  . KCX A 1 103 ? -17.216 -16.671 -0.412  1.00  14.29 ? 1556 KCX A HG3  1 
HETATM 1405 H  HD2  . KCX A 1 103 ? -15.737 -15.857 -2.003  1.00  15.49 ? 1556 KCX A HD2  1 
HETATM 1406 H  HD3  . KCX A 1 103 ? -16.033 -17.090 -2.952  1.00  15.49 ? 1556 KCX A HD3  1 
HETATM 1407 H  HE2  . KCX A 1 103 ? -17.991 -15.109 -2.334  1.00  15.33 ? 1556 KCX A HE2  1 
HETATM 1408 H  HE3  . KCX A 1 103 ? -17.172 -15.146 -3.706  1.00  15.33 ? 1556 KCX A HE3  1 
HETATM 1409 H  HZ   . KCX A 1 103 ? -18.885 -17.089 -2.864  1.00  15.84 ? 1556 KCX A HZ   1 
ATOM   1410 N  N    . LEU A 1 104 ? -15.040 -15.152 0.741   1.00  11.23 ? 1557 LEU A N    1 
ATOM   1411 C  CA   . LEU A 1 104 ? -15.661 -14.052 1.486   1.00  12.46 ? 1557 LEU A CA   1 
ATOM   1412 C  C    . LEU A 1 104 ? -16.808 -13.469 0.671   1.00  12.49 ? 1557 LEU A C    1 
ATOM   1413 O  O    . LEU A 1 104 ? -16.593 -13.031 -0.468  1.00  12.86 ? 1557 LEU A O    1 
ATOM   1414 C  CB   . LEU A 1 104 ? -14.652 -12.925 1.747   1.00  15.23 ? 1557 LEU A CB   1 
ATOM   1415 C  CG   . LEU A 1 104 ? -13.726 -13.044 2.972   1.00  20.35 ? 1557 LEU A CG   1 
ATOM   1416 C  CD1  . LEU A 1 104 ? -12.927 -14.267 3.004   1.00  22.22 ? 1557 LEU A CD1  1 
ATOM   1417 C  CD2  . LEU A 1 104 ? -12.797 -11.833 2.973   1.00  24.06 ? 1557 LEU A CD2  1 
ATOM   1418 H  H    . LEU A 1 104 ? -14.566 -14.888 0.074   1.00  13.47 ? 1557 LEU A H    1 
ATOM   1419 H  HA   . LEU A 1 104 ? -16.008 -14.378 2.343   1.00  14.95 ? 1557 LEU A HA   1 
ATOM   1420 H  HB2  . LEU A 1 104 ? -14.079 -12.853 0.967   1.00  18.27 ? 1557 LEU A HB2  1 
ATOM   1421 H  HB3  . LEU A 1 104 ? -15.150 -12.099 1.849   1.00  18.27 ? 1557 LEU A HB3  1 
ATOM   1422 H  HG   . LEU A 1 104 ? -14.262 -13.013 3.780   1.00  24.42 ? 1557 LEU A HG   1 
ATOM   1423 H  HD11 . LEU A 1 104 ? -12.372 -14.297 2.221   1.00  26.66 ? 1557 LEU A HD11 1 
ATOM   1424 H  HD12 . LEU A 1 104 ? -12.382 -14.263 3.793   1.00  26.66 ? 1557 LEU A HD12 1 
ATOM   1425 H  HD13 . LEU A 1 104 ? -13.517 -15.024 3.016   1.00  26.66 ? 1557 LEU A HD13 1 
ATOM   1426 H  HD21 . LEU A 1 104 ? -13.327 -11.034 3.027   1.00  28.88 ? 1557 LEU A HD21 1 
ATOM   1427 H  HD22 . LEU A 1 104 ? -12.211 -11.890 3.732   1.00  28.88 ? 1557 LEU A HD22 1 
ATOM   1428 H  HD23 . LEU A 1 104 ? -12.284 -11.832 2.162   1.00  28.88 ? 1557 LEU A HD23 1 
ATOM   1429 N  N    . TYR A 1 105 ? -18.009 -13.474 1.232   1.00  12.54 ? 1558 TYR A N    1 
ATOM   1430 C  CA   A TYR A 1 105 ? -19.190 -12.847 0.638   0.63  13.17 ? 1558 TYR A CA   1 
ATOM   1431 C  CA   B TYR A 1 105 ? -19.125 -12.817 0.586   0.37  13.20 ? 1558 TYR A CA   1 
ATOM   1432 C  C    . TYR A 1 105 ? -19.312 -11.466 1.252   1.00  13.38 ? 1558 TYR A C    1 
ATOM   1433 O  O    . TYR A 1 105 ? -19.793 -11.353 2.377   1.00  14.73 ? 1558 TYR A O    1 
ATOM   1434 C  CB   A TYR A 1 105 ? -20.458 -13.658 0.968   0.63  13.83 ? 1558 TYR A CB   1 
ATOM   1435 C  CB   B TYR A 1 105 ? -20.395 -13.647 0.664   0.37  13.60 ? 1558 TYR A CB   1 
ATOM   1436 C  CG   A TYR A 1 105 ? -20.573 -14.913 0.160   0.63  14.65 ? 1558 TYR A CG   1 
ATOM   1437 C  CG   B TYR A 1 105 ? -21.363 -13.268 -0.421  0.37  13.71 ? 1558 TYR A CG   1 
ATOM   1438 C  CD1  A TYR A 1 105 ? -21.150 -14.894 -1.096  0.63  15.12 ? 1558 TYR A CD1  1 
ATOM   1439 C  CD1  B TYR A 1 105 ? -22.120 -12.114 -0.327  0.37  15.35 ? 1558 TYR A CD1  1 
ATOM   1440 C  CD2  A TYR A 1 105 ? -20.063 -16.113 0.634   0.63  14.78 ? 1558 TYR A CD2  1 
ATOM   1441 C  CD2  B TYR A 1 105 ? -21.493 -14.046 -1.557  0.37  14.22 ? 1558 TYR A CD2  1 
ATOM   1442 C  CE1  A TYR A 1 105 ? -21.223 -16.032 -1.859  0.63  14.24 ? 1558 TYR A CE1  1 
ATOM   1443 C  CE1  B TYR A 1 105 ? -22.995 -11.760 -1.324  0.37  16.47 ? 1558 TYR A CE1  1 
ATOM   1444 C  CE2  A TYR A 1 105 ? -20.130 -17.263 -0.120  0.63  14.53 ? 1558 TYR A CE2  1 
ATOM   1445 C  CE2  B TYR A 1 105 ? -22.375 -13.709 -2.557  0.37  14.37 ? 1558 TYR A CE2  1 
ATOM   1446 C  CZ   A TYR A 1 105 ? -20.705 -17.217 -1.365  0.63  14.25 ? 1558 TYR A CZ   1 
ATOM   1447 C  CZ   B TYR A 1 105 ? -23.122 -12.561 -2.440  0.37  15.53 ? 1558 TYR A CZ   1 
ATOM   1448 O  OH   A TYR A 1 105 ? -20.770 -18.360 -2.107  0.63  12.16 ? 1558 TYR A OH   1 
ATOM   1449 O  OH   B TYR A 1 105 ? -24.003 -12.214 -3.440  0.37  17.14 ? 1558 TYR A OH   1 
ATOM   1450 H  H    A TYR A 1 105 ? -18.174 -13.850 1.987   0.63  15.04 ? 1558 TYR A H    1 
ATOM   1451 H  H    B TYR A 1 105 ? -18.200 -13.850 1.981   0.37  15.04 ? 1558 TYR A H    1 
ATOM   1452 H  HA   A TYR A 1 105 ? -19.090 -12.769 -0.334  0.63  15.80 ? 1558 TYR A HA   1 
ATOM   1453 H  HA   B TYR A 1 105 ? -18.912 -12.668 -0.358  0.37  15.84 ? 1558 TYR A HA   1 
ATOM   1454 H  HB2  A TYR A 1 105 ? -20.439 -13.906 1.905   0.63  16.60 ? 1558 TYR A HB2  1 
ATOM   1455 H  HB2  B TYR A 1 105 ? -20.171 -14.585 0.558   0.37  16.32 ? 1558 TYR A HB2  1 
ATOM   1456 H  HB3  A TYR A 1 105 ? -21.238 -13.112 0.785   0.63  16.60 ? 1558 TYR A HB3  1 
ATOM   1457 H  HB3  B TYR A 1 105 ? -20.824 -13.497 1.521   0.37  16.32 ? 1558 TYR A HB3  1 
ATOM   1458 H  HD1  A TYR A 1 105 ? -21.486 -14.095 -1.432  0.63  18.15 ? 1558 TYR A HD1  1 
ATOM   1459 H  HD1  B TYR A 1 105 ? -22.040 -11.573 0.425   0.37  18.42 ? 1558 TYR A HD1  1 
ATOM   1460 H  HD2  A TYR A 1 105 ? -19.661 -16.140 1.472   0.63  17.73 ? 1558 TYR A HD2  1 
ATOM   1461 H  HD2  B TYR A 1 105 ? -20.991 -14.825 -1.636  0.37  17.06 ? 1558 TYR A HD2  1 
ATOM   1462 H  HE1  A TYR A 1 105 ? -21.615 -16.007 -2.702  0.63  17.09 ? 1558 TYR A HE1  1 
ATOM   1463 H  HE1  B TYR A 1 105 ? -23.506 -10.987 -1.244  0.37  19.76 ? 1558 TYR A HE1  1 
ATOM   1464 H  HE2  A TYR A 1 105 ? -19.786 -18.061 0.209   0.63  17.44 ? 1558 TYR A HE2  1 
ATOM   1465 H  HE2  B TYR A 1 105 ? -22.456 -14.247 -3.312  0.37  17.25 ? 1558 TYR A HE2  1 
ATOM   1466 H  HH   A TYR A 1 105 ? -20.370 -18.258 -2.815  0.63  14.59 ? 1558 TYR A HH   1 
ATOM   1467 H  HH   B TYR A 1 105 ? -24.563 -12.806 -3.538  0.37  20.57 ? 1558 TYR A HH   1 
ATOM   1468 N  N    . LEU A 1 106 ? -18.907 -10.428 0.534   1.00  12.93 ? 1559 LEU A N    1 
ATOM   1469 C  CA   . LEU A 1 106 ? -18.797 -9.094  1.138   1.00  13.58 ? 1559 LEU A CA   1 
ATOM   1470 C  C    . LEU A 1 106 ? -19.945 -8.157  0.860   1.00  16.72 ? 1559 LEU A C    1 
ATOM   1471 O  O    . LEU A 1 106 ? -19.997 -7.050  1.421   1.00  19.65 ? 1559 LEU A O    1 
ATOM   1472 C  CB   . LEU A 1 106 ? -17.482 -8.440  0.714   1.00  13.23 ? 1559 LEU A CB   1 
ATOM   1473 C  CG   . LEU A 1 106 ? -16.248 -9.254  1.134   1.00  13.33 ? 1559 LEU A CG   1 
ATOM   1474 C  CD1  . LEU A 1 106 ? -14.978 -8.495  0.756   1.00  14.05 ? 1559 LEU A CD1  1 
ATOM   1475 C  CD2  . LEU A 1 106 ? -16.265 -9.615  2.618   1.00  14.20 ? 1559 LEU A CD2  1 
ATOM   1476 H  H    . LEU A 1 106 ? -18.690 -10.462 -0.298  1.00  15.52 ? 1559 LEU A H    1 
ATOM   1477 H  HA   . LEU A 1 106 ? -18.756 -9.209  2.110   1.00  16.30 ? 1559 LEU A HA   1 
ATOM   1478 H  HB2  . LEU A 1 106 ? -17.469 -8.354  -0.252  1.00  15.88 ? 1559 LEU A HB2  1 
ATOM   1479 H  HB3  . LEU A 1 106 ? -17.417 -7.565  1.126   1.00  15.88 ? 1559 LEU A HB3  1 
ATOM   1480 H  HG   . LEU A 1 106 ? -16.247 -10.085 0.635   1.00  16.00 ? 1559 LEU A HG   1 
ATOM   1481 H  HD11 . LEU A 1 106 ? -14.974 -7.648  1.208   1.00  16.86 ? 1559 LEU A HD11 1 
ATOM   1482 H  HD12 . LEU A 1 106 ? -14.214 -9.012  1.023   1.00  16.86 ? 1559 LEU A HD12 1 
ATOM   1483 H  HD13 . LEU A 1 106 ? -14.966 -8.359  -0.194  1.00  16.86 ? 1559 LEU A HD13 1 
ATOM   1484 H  HD21 . LEU A 1 106 ? -17.048 -10.139 2.803   1.00  17.04 ? 1559 LEU A HD21 1 
ATOM   1485 H  HD22 . LEU A 1 106 ? -15.475 -10.120 2.825   1.00  17.04 ? 1559 LEU A HD22 1 
ATOM   1486 H  HD23 . LEU A 1 106 ? -16.282 -8.806  3.136   1.00  17.04 ? 1559 LEU A HD23 1 
ATOM   1487 N  N    . ASN A 1 107 ? -20.865 -8.588  0.013   1.00  16.70 ? 1560 ASN A N    1 
ATOM   1488 C  CA   . ASN A 1 107 ? -22.074 -7.834  -0.234  1.00  18.00 ? 1560 ASN A CA   1 
ATOM   1489 C  C    . ASN A 1 107 ? -23.252 -8.636  0.353   1.00  24.26 ? 1560 ASN A C    1 
ATOM   1490 O  O    . ASN A 1 107 ? -23.117 -9.180  1.434   1.00  26.01 ? 1560 ASN A O    1 
ATOM   1491 C  CB   . ASN A 1 107 ? -22.170 -7.533  -1.729  1.00  16.91 ? 1560 ASN A CB   1 
ATOM   1492 C  CG   . ASN A 1 107 ? -20.986 -6.697  -2.232  1.00  16.88 ? 1560 ASN A CG   1 
ATOM   1493 O  OD1  . ASN A 1 107 ? -20.152 -7.164  -2.993  1.00  15.85 ? 1560 ASN A OD1  1 
ATOM   1494 N  ND2  . ASN A 1 107 ? -20.925 -5.449  -1.802  1.00  18.10 ? 1560 ASN A ND2  1 
ATOM   1495 H  H    . ASN A 1 107 ? -20.811 -9.321  -0.433  1.00  20.04 ? 1560 ASN A H    1 
ATOM   1496 H  HA   . ASN A 1 107 ? -22.022 -6.980  0.244   1.00  21.60 ? 1560 ASN A HA   1 
ATOM   1497 H  HB2  . ASN A 1 107 ? -22.180 -8.369  -2.221  1.00  20.29 ? 1560 ASN A HB2  1 
ATOM   1498 H  HB3  . ASN A 1 107 ? -22.985 -7.036  -1.901  1.00  20.29 ? 1560 ASN A HB3  1 
ATOM   1499 H  HD21 . ASN A 1 107 ? -21.529 -5.147  -1.269  1.00  21.72 ? 1560 ASN A HD21 1 
ATOM   1500 H  HD22 . ASN A 1 107 ? -20.280 -4.939  -2.055  1.00  21.72 ? 1560 ASN A HD22 1 
ATOM   1501 N  N    . GLU A 1 108 ? -24.360 -8.785  -0.362  1.00  28.91 ? 1561 GLU A N    1 
ATOM   1502 C  CA   . GLU A 1 108 ? -25.625 -9.359  0.211   1.00  32.39 ? 1561 GLU A CA   1 
ATOM   1503 C  C    . GLU A 1 108 ? -25.649 -10.540 1.218   1.00  35.54 ? 1561 GLU A C    1 
ATOM   1504 O  O    . GLU A 1 108 ? -25.761 -10.291 2.422   1.00  36.07 ? 1561 GLU A O    1 
ATOM   1505 C  CB   . GLU A 1 108 ? -26.589 -9.617  -0.931  1.00  35.59 ? 1561 GLU A CB   1 
ATOM   1506 C  CG   . GLU A 1 108 ? -27.100 -8.315  -1.515  1.00  38.42 ? 1561 GLU A CG   1 
ATOM   1507 C  CD   . GLU A 1 108 ? -27.669 -7.394  -0.452  1.00  41.18 ? 1561 GLU A CD   1 
ATOM   1508 O  OE1  . GLU A 1 108 ? -26.894 -6.953  0.431   1.00  41.71 ? 1561 GLU A OE1  1 
ATOM   1509 O  OE2  . GLU A 1 108 ? -28.888 -7.099  -0.503  1.00  42.99 ? 1561 GLU A OE2  1 
ATOM   1510 H  H    . GLU A 1 108 ? -24.427 -8.566  -1.191  1.00  34.69 ? 1561 GLU A H    1 
ATOM   1511 H  HA   . GLU A 1 108 ? -26.029 -8.620  0.712   1.00  38.87 ? 1561 GLU A HA   1 
ATOM   1512 H  HB2  . GLU A 1 108 ? -26.134 -10.109 -1.632  1.00  42.71 ? 1561 GLU A HB2  1 
ATOM   1513 H  HB3  . GLU A 1 108 ? -27.349 -10.124 -0.603  1.00  42.71 ? 1561 GLU A HB3  1 
ATOM   1514 H  HG2  . GLU A 1 108 ? -26.367 -7.854  -1.953  1.00  46.11 ? 1561 GLU A HG2  1 
ATOM   1515 H  HG3  . GLU A 1 108 ? -27.803 -8.508  -2.155  1.00  46.11 ? 1561 GLU A HG3  1 
ATOM   1516 N  N    . THR A 1 109 ? -25.641 -11.795 0.743   1.00  35.39 ? 1562 THR A N    1 
ATOM   1517 C  CA   . THR A 1 109 ? -25.494 -13.001 1.588   1.00  32.75 ? 1562 THR A CA   1 
ATOM   1518 C  C    . THR A 1 109 ? -26.678 -13.433 2.476   1.00  34.18 ? 1562 THR A C    1 
ATOM   1519 O  O    . THR A 1 109 ? -27.546 -12.630 2.845   1.00  33.02 ? 1562 THR A O    1 
ATOM   1520 C  CB   . THR A 1 109 ? -24.229 -12.868 2.467   1.00  31.86 ? 1562 THR A CB   1 
ATOM   1521 H  H    . THR A 1 109 ? -25.723 -11.981 -0.092  1.00  42.47 ? 1562 THR A H    1 
ATOM   1522 H  HA   . THR A 1 109 ? -25.327 -13.752 0.981   1.00  39.30 ? 1562 THR A HA   1 
ATOM   1523 H  HB1  . THR A 1 109 ? -24.317 -12.092 3.026   1.00  38.23 ? 1562 THR A HB1  1 
ATOM   1524 H  HB3  . THR A 1 109 ? -23.461 -12.778 1.898   1.00  38.23 ? 1562 THR A HB3  1 
ATOM   1525 H  HB2  . THR A 1 109 ? -24.143 -13.655 3.011   1.00  38.23 ? 1562 THR A HB2  1 
ATOM   1526 N  N    . PHE A 1 110 ? -26.683 -14.719 2.830   1.00  35.38 ? 1563 PHE A N    1 
ATOM   1527 C  CA   . PHE A 1 110 ? -27.565 -15.227 3.875   1.00  34.13 ? 1563 PHE A CA   1 
ATOM   1528 C  C    . PHE A 1 110 ? -26.941 -15.124 5.272   1.00  33.89 ? 1563 PHE A C    1 
ATOM   1529 O  O    . PHE A 1 110 ? -25.708 -15.013 5.452   1.00  32.59 ? 1563 PHE A O    1 
ATOM   1530 C  CB   . PHE A 1 110 ? -27.979 -16.665 3.581   1.00  36.13 ? 1563 PHE A CB   1 
ATOM   1531 H  H    . PHE A 1 110 ? -26.180 -15.320 2.476   1.00  42.46 ? 1563 PHE A H    1 
ATOM   1532 H  HA   . PHE A 1 110 ? -28.380 -14.683 3.880   1.00  40.96 ? 1563 PHE A HA   1 
ATOM   1533 H  HB2  . PHE A 1 110 ? -28.558 -16.973 4.282   1.00  43.35 ? 1563 PHE A HB2  1 
ATOM   1534 H  HB3  . PHE A 1 110 ? -28.442 -16.690 2.740   1.00  43.35 ? 1563 PHE A HB3  1 
ATOM   1535 H  HB1  . PHE A 1 110 ? -27.193 -17.214 3.539   1.00  43.35 ? 1563 PHE A HB1  1 
ATOM   1536 N  N    . SER A 1 111 ? -27.808 -15.177 6.275   1.00  35.57 ? 1564 SER A N    1 
ATOM   1537 C  CA   . SER A 1 111 ? -27.388 -14.960 7.659   1.00  36.38 ? 1564 SER A CA   1 
ATOM   1538 C  C    . SER A 1 111 ? -25.990 -15.515 7.973   1.00  37.75 ? 1564 SER A C    1 
ATOM   1539 O  O    . SER A 1 111 ? -25.222 -14.873 8.697   1.00  39.52 ? 1564 SER A O    1 
ATOM   1540 C  CB   . SER A 1 111 ? -28.428 -15.552 8.621   1.00  35.96 ? 1564 SER A CB   1 
ATOM   1541 H  H    . SER A 1 111 ? -28.648 -15.336 6.183   1.00  42.68 ? 1564 SER A H    1 
ATOM   1542 H  HA   . SER A 1 111 ? -27.359 -13.995 7.822   1.00  43.66 ? 1564 SER A HA   1 
ATOM   1543 H  HB2  . SER A 1 111 ? -28.139 -15.403 9.524   1.00  43.16 ? 1564 SER A HB2  1 
ATOM   1544 H  HB3  . SER A 1 111 ? -29.273 -15.121 8.472   1.00  43.16 ? 1564 SER A HB3  1 
ATOM   1545 H  HB1  . SER A 1 111 ? -28.508 -16.494 8.454   1.00  43.16 ? 1564 SER A HB1  1 
ATOM   1546 N  N    . GLU A 1 112 ? -25.641 -16.682 7.427   1.00  36.70 ? 1565 GLU A N    1 
ATOM   1547 C  CA   . GLU A 1 112 ? -24.399 -17.339 7.856   1.00  33.82 ? 1565 GLU A CA   1 
ATOM   1548 C  C    . GLU A 1 112 ? -23.082 -16.874 7.221   1.00  29.44 ? 1565 GLU A C    1 
ATOM   1549 O  O    . GLU A 1 112 ? -22.066 -16.910 7.892   1.00  28.76 ? 1565 GLU A O    1 
ATOM   1550 C  CB   . GLU A 1 112 ? -24.526 -18.867 7.783   1.00  35.17 ? 1565 GLU A CB   1 
ATOM   1551 C  CG   . GLU A 1 112 ? -25.575 -19.394 8.727   1.00  37.15 ? 1565 GLU A CG   1 
ATOM   1552 C  CD   . GLU A 1 112 ? -25.753 -18.487 9.925   1.00  39.99 ? 1565 GLU A CD   1 
ATOM   1553 O  OE1  . GLU A 1 112 ? -24.800 -18.383 10.734  1.00  41.19 ? 1565 GLU A OE1  1 
ATOM   1554 O  OE2  . GLU A 1 112 ? -26.836 -17.858 10.039  1.00  41.73 ? 1565 GLU A OE2  1 
ATOM   1555 H  H    . GLU A 1 112 ? -26.088 -17.104 6.826   1.00  44.04 ? 1565 GLU A H    1 
ATOM   1556 H  HA   . GLU A 1 112 ? -24.304 -17.135 8.810   1.00  40.58 ? 1565 GLU A HA   1 
ATOM   1557 H  HB2  . GLU A 1 112 ? -24.776 -19.123 6.882   1.00  42.21 ? 1565 GLU A HB2  1 
ATOM   1558 H  HB3  . GLU A 1 112 ? -23.676 -19.269 8.021   1.00  42.21 ? 1565 GLU A HB3  1 
ATOM   1559 H  HG2  . GLU A 1 112 ? -26.424 -19.453 8.262   1.00  44.58 ? 1565 GLU A HG2  1 
ATOM   1560 H  HG3  . GLU A 1 112 ? -25.306 -20.270 9.047   1.00  44.58 ? 1565 GLU A HG3  1 
ATOM   1561 N  N    . LEU A 1 113 ? -23.083 -16.429 5.969   1.00  27.15 ? 1566 LEU A N    1 
ATOM   1562 C  CA   . LEU A 1 113 ? -21.856 -15.911 5.351   1.00  24.72 ? 1566 LEU A CA   1 
ATOM   1563 C  C    . LEU A 1 113 ? -21.780 -14.382 5.439   1.00  20.54 ? 1566 LEU A C    1 
ATOM   1564 O  O    . LEU A 1 113 ? -20.827 -13.753 4.996   1.00  18.13 ? 1566 LEU A O    1 
ATOM   1565 C  CB   . LEU A 1 113 ? -21.789 -16.367 3.905   1.00  27.29 ? 1566 LEU A CB   1 
ATOM   1566 C  CG   . LEU A 1 113 ? -21.772 -17.900 3.821   1.00  29.09 ? 1566 LEU A CG   1 
ATOM   1567 C  CD1  . LEU A 1 113 ? -22.296 -18.393 2.509   1.00  30.93 ? 1566 LEU A CD1  1 
ATOM   1568 C  CD2  . LEU A 1 113 ? -20.373 -18.395 4.025   1.00  28.86 ? 1566 LEU A CD2  1 
ATOM   1569 H  H    . LEU A 1 113 ? -23.772 -16.414 5.455   1.00  32.58 ? 1566 LEU A H    1 
ATOM   1570 H  HA   . LEU A 1 113 ? -21.080 -16.280 5.822   1.00  29.66 ? 1566 LEU A HA   1 
ATOM   1571 H  HB2  . LEU A 1 113 ? -22.568 -16.042 3.427   1.00  32.75 ? 1566 LEU A HB2  1 
ATOM   1572 H  HB3  . LEU A 1 113 ? -20.976 -16.029 3.497   1.00  32.75 ? 1566 LEU A HB3  1 
ATOM   1573 H  HG   . LEU A 1 113 ? -22.329 -18.265 4.527   1.00  34.91 ? 1566 LEU A HG   1 
ATOM   1574 H  HD11 . LEU A 1 113 ? -21.747 -18.043 1.803   1.00  37.12 ? 1566 LEU A HD11 1 
ATOM   1575 H  HD12 . LEU A 1 113 ? -22.267 -19.352 2.502   1.00  37.12 ? 1566 LEU A HD12 1 
ATOM   1576 H  HD13 . LEU A 1 113 ? -23.201 -18.091 2.401   1.00  37.12 ? 1566 LEU A HD13 1 
ATOM   1577 H  HD21 . LEU A 1 113 ? -20.066 -18.114 4.890   1.00  34.63 ? 1566 LEU A HD21 1 
ATOM   1578 H  HD22 . LEU A 1 113 ? -20.370 -19.353 3.972   1.00  34.63 ? 1566 LEU A HD22 1 
ATOM   1579 H  HD23 . LEU A 1 113 ? -19.809 -18.027 3.341   1.00  34.63 ? 1566 LEU A HD23 1 
ATOM   1580 N  N    . ARG A 1 114 ? -22.785 -13.790 6.047   1.00  20.11 ? 1567 ARG A N    1 
ATOM   1581 C  CA   . ARG A 1 114 ? -22.848 -12.346 6.157   1.00  20.34 ? 1567 ARG A CA   1 
ATOM   1582 C  C    . ARG A 1 114 ? -21.790 -11.835 7.115   1.00  19.81 ? 1567 ARG A C    1 
ATOM   1583 O  O    . ARG A 1 114 ? -21.696 -12.300 8.254   1.00  21.24 ? 1567 ARG A O    1 
ATOM   1584 C  CB   . ARG A 1 114 ? -24.234 -11.935 6.634   1.00  24.43 ? 1567 ARG A CB   1 
ATOM   1585 C  CG   . ARG A 1 114 ? -24.579 -10.495 6.322   1.00  29.49 ? 1567 ARG A CG   1 
ATOM   1586 C  CD   . ARG A 1 114 ? -26.008 -10.235 6.730   1.00  33.21 ? 1567 ARG A CD   1 
ATOM   1587 N  NE   . ARG A 1 114 ? -26.126 -10.388 8.170   1.00  37.46 ? 1567 ARG A NE   1 
ATOM   1588 C  CZ   . ARG A 1 114 ? -25.845 -9.421  9.038   1.00  40.40 ? 1567 ARG A CZ   1 
ATOM   1589 N  NH1  . ARG A 1 114 ? -25.447 -8.229  8.602   1.00  41.66 ? 1567 ARG A NH1  1 
ATOM   1590 N  NH2  . ARG A 1 114 ? -25.970 -9.645  10.344  1.00  41.18 ? 1567 ARG A NH2  1 
ATOM   1591 H  H    . ARG A 1 114 ? -23.448 -14.201 6.407   1.00  24.13 ? 1567 ARG A H    1 
ATOM   1592 H  HA   . ARG A 1 114 ? -22.690 -11.943 5.277   1.00  24.40 ? 1567 ARG A HA   1 
ATOM   1593 H  HB2  . ARG A 1 114 ? -24.894 -12.499 6.202   1.00  29.31 ? 1567 ARG A HB2  1 
ATOM   1594 H  HB3  . ARG A 1 114 ? -24.281 -12.050 7.596   1.00  29.31 ? 1567 ARG A HB3  1 
ATOM   1595 H  HG2  . ARG A 1 114 ? -23.998 -9.902  6.825   1.00  35.38 ? 1567 ARG A HG2  1 
ATOM   1596 H  HG3  . ARG A 1 114 ? -24.492 -10.336 5.369   1.00  35.38 ? 1567 ARG A HG3  1 
ATOM   1597 H  HD2  . ARG A 1 114 ? -26.258 -9.329  6.491   1.00  39.86 ? 1567 ARG A HD2  1 
ATOM   1598 H  HD3  . ARG A 1 114 ? -26.594 -10.878 6.300   1.00  39.86 ? 1567 ARG A HD3  1 
ATOM   1599 H  HE   . ARG A 1 114 ? -26.501 -11.101 8.470   1.00  44.96 ? 1567 ARG A HE   1 
ATOM   1600 H  HH11 . ARG A 1 114 ? -25.364 -8.085  7.758   1.00  50.00 ? 1567 ARG A HH11 1 
ATOM   1601 H  HH12 . ARG A 1 114 ? -25.268 -7.604  9.165   1.00  50.00 ? 1567 ARG A HH12 1 
ATOM   1602 H  HH21 . ARG A 1 114 ? -26.230 -10.414 10.626  1.00  49.42 ? 1567 ARG A HH21 1 
ATOM   1603 H  HH22 . ARG A 1 114 ? -25.794 -9.018  10.907  1.00  49.42 ? 1567 ARG A HH22 1 
ATOM   1604 N  N    . LEU A 1 115 ? -20.983 -10.888 6.652   1.00  19.70 ? 1568 LEU A N    1 
ATOM   1605 C  CA   . LEU A 1 115 ? -20.040 -10.202 7.515   1.00  19.88 ? 1568 LEU A CA   1 
ATOM   1606 C  C    . LEU A 1 115 ? -20.545 -8.774  7.659   1.00  23.22 ? 1568 LEU A C    1 
ATOM   1607 O  O    . LEU A 1 115 ? -20.976 -8.162  6.687   1.00  26.73 ? 1568 LEU A O    1 
ATOM   1608 C  CB   . LEU A 1 115 ? -18.619 -10.221 6.926   1.00  17.81 ? 1568 LEU A CB   1 
ATOM   1609 C  CG   . LEU A 1 115 ? -18.047 -11.603 6.565   1.00  17.38 ? 1568 LEU A CG   1 
ATOM   1610 C  CD1  . LEU A 1 115 ? -16.645 -11.500 5.989   1.00  18.31 ? 1568 LEU A CD1  1 
ATOM   1611 C  CD2  . LEU A 1 115 ? -18.055 -12.566 7.756   1.00  18.34 ? 1568 LEU A CD2  1 
ATOM   1612 H  H    . LEU A 1 115 ? -20.965 -10.624 5.834   1.00  23.65 ? 1568 LEU A H    1 
ATOM   1613 H  HA   . LEU A 1 115 ? -20.024 -10.625 8.399   1.00  23.85 ? 1568 LEU A HA   1 
ATOM   1614 H  HB2  . LEU A 1 115 ? -18.619 -9.689  6.115   1.00  21.38 ? 1568 LEU A HB2  1 
ATOM   1615 H  HB3  . LEU A 1 115 ? -18.016 -9.820  7.572   1.00  21.38 ? 1568 LEU A HB3  1 
ATOM   1616 H  HG   . LEU A 1 115 ? -18.611 -11.992 5.878   1.00  20.86 ? 1568 LEU A HG   1 
ATOM   1617 H  HD11 . LEU A 1 115 ? -16.069 -11.092 6.640   1.00  21.97 ? 1568 LEU A HD11 1 
ATOM   1618 H  HD12 . LEU A 1 115 ? -16.329 -12.382 5.779   1.00  21.97 ? 1568 LEU A HD12 1 
ATOM   1619 H  HD13 . LEU A 1 115 ? -16.673 -10.964 5.194   1.00  21.97 ? 1568 LEU A HD13 1 
ATOM   1620 H  HD21 . LEU A 1 115 ? -18.959 -12.684 8.056   1.00  22.01 ? 1568 LEU A HD21 1 
ATOM   1621 H  HD22 . LEU A 1 115 ? -17.690 -13.409 7.477   1.00  22.01 ? 1568 LEU A HD22 1 
ATOM   1622 H  HD23 . LEU A 1 115 ? -17.520 -12.195 8.461   1.00  22.01 ? 1568 LEU A HD23 1 
ATOM   1623 N  N    . ASP A 1 116 ? -20.517 -8.246  8.867   1.00  24.21 ? 1569 ASP A N    1 
ATOM   1624 C  CA   . ASP A 1 116 ? -21.116 -6.932  9.097   1.00  26.37 ? 1569 ASP A CA   1 
ATOM   1625 C  C    . ASP A 1 116 ? -20.086 -5.832  9.306   1.00  23.79 ? 1569 ASP A C    1 
ATOM   1626 O  O    . ASP A 1 116 ? -20.445 -4.654  9.391   1.00  25.42 ? 1569 ASP A O    1 
ATOM   1627 C  CB   . ASP A 1 116 ? -22.070 -6.979  10.290  1.00  30.08 ? 1569 ASP A CB   1 
ATOM   1628 C  CG   . ASP A 1 116 ? -21.449 -7.631  11.514  1.00  34.53 ? 1569 ASP A CG   1 
ATOM   1629 O  OD1  . ASP A 1 116 ? -20.677 -6.935  12.223  1.00  37.47 ? 1569 ASP A OD1  1 
ATOM   1630 O  OD2  . ASP A 1 116 ? -21.756 -8.823  11.777  1.00  36.77 ? 1569 ASP A OD2  1 
ATOM   1631 H  H    . ASP A 1 116 ? -20.167 -8.612  9.562   1.00  29.05 ? 1569 ASP A H    1 
ATOM   1632 H  HA   . ASP A 1 116 ? -21.644 -6.692  8.308   1.00  31.65 ? 1569 ASP A HA   1 
ATOM   1633 H  HB2  . ASP A 1 116 ? -22.322 -6.073  10.528  1.00  36.10 ? 1569 ASP A HB2  1 
ATOM   1634 H  HB3  . ASP A 1 116 ? -22.858 -7.489  10.044  1.00  36.10 ? 1569 ASP A HB3  1 
ATOM   1635 N  N    . SER A 1 117 ? -18.811 -6.202  9.366   1.00  19.38 ? 1570 SER A N    1 
ATOM   1636 C  CA   . SER A 1 117 ? -17.764 -5.221  9.607   1.00  17.39 ? 1570 SER A CA   1 
ATOM   1637 C  C    . SER A 1 117 ? -16.503 -5.556  8.839   1.00  14.73 ? 1570 SER A C    1 
ATOM   1638 O  O    . SER A 1 117 ? -16.122 -6.729  8.732   1.00  14.88 ? 1570 SER A O    1 
ATOM   1639 C  CB   . SER A 1 117 ? -17.407 -5.202  11.085  1.00  17.69 ? 1570 SER A CB   1 
ATOM   1640 O  OG   . SER A 1 117 ? -16.255 -4.406  11.318  1.00  18.92 ? 1570 SER A OG   1 
ATOM   1641 H  H    . SER A 1 117 ? -18.529 -7.009  9.271   1.00  23.25 ? 1570 SER A H    1 
ATOM   1642 H  HA   . SER A 1 117 ? -18.072 -4.330  9.342   1.00  20.87 ? 1570 SER A HA   1 
ATOM   1643 H  HB2  . SER A 1 117 ? -18.152 -4.833  11.585  1.00  21.23 ? 1570 SER A HB2  1 
ATOM   1644 H  HB3  . SER A 1 117 ? -17.228 -6.109  11.379  1.00  21.23 ? 1570 SER A HB3  1 
ATOM   1645 H  HG   . SER A 1 117 ? -16.073 -4.404  12.117  1.00  22.70 ? 1570 SER A HG   1 
ATOM   1646 N  N    . VAL A 1 118 ? -15.827 -4.530  8.334   1.00  14.53 ? 1571 VAL A N    1 
ATOM   1647 C  CA   A VAL A 1 118 ? -14.547 -4.725  7.673   0.67  14.14 ? 1571 VAL A CA   1 
ATOM   1648 C  CA   B VAL A 1 118 ? -14.553 -4.754  7.662   0.33  14.05 ? 1571 VAL A CA   1 
ATOM   1649 C  C    . VAL A 1 118 ? -13.537 -5.336  8.639   1.00  13.24 ? 1571 VAL A C    1 
ATOM   1650 O  O    . VAL A 1 118 ? -12.581 -5.998  8.228   1.00  14.02 ? 1571 VAL A O    1 
ATOM   1651 C  CB   A VAL A 1 118 ? -14.029 -3.404  7.096   0.67  15.87 ? 1571 VAL A CB   1 
ATOM   1652 C  CB   B VAL A 1 118 ? -14.000 -3.476  6.988   0.33  14.97 ? 1571 VAL A CB   1 
ATOM   1653 C  CG1  A VAL A 1 118 ? -12.620 -3.568  6.597   0.67  16.53 ? 1571 VAL A CG1  1 
ATOM   1654 C  CG1  B VAL A 1 118 ? -14.961 -3.007  5.908   0.33  15.53 ? 1571 VAL A CG1  1 
ATOM   1655 C  CG2  A VAL A 1 118 ? -14.940 -2.959  5.968   0.67  16.43 ? 1571 VAL A CG2  1 
ATOM   1656 C  CG2  B VAL A 1 118 ? -13.739 -2.378  8.010   0.33  14.66 ? 1571 VAL A CG2  1 
ATOM   1657 H  H    A VAL A 1 118 ? -16.089 -3.712  8.362   0.67  17.44 ? 1571 VAL A H    1 
ATOM   1658 H  H    B VAL A 1 118 ? -16.078 -3.708  8.366   0.33  17.44 ? 1571 VAL A H    1 
ATOM   1659 H  HA   A VAL A 1 118 ? -14.667 -5.351  6.928   0.67  16.97 ? 1571 VAL A HA   1 
ATOM   1660 H  HA   B VAL A 1 118 ? -14.691 -5.419  6.955   0.33  16.86 ? 1571 VAL A HA   1 
ATOM   1661 H  HB   A VAL A 1 118 ? -14.035 -2.716  7.794   0.67  19.04 ? 1571 VAL A HB   1 
ATOM   1662 H  HB   B VAL A 1 118 ? -13.147 -3.691  6.556   0.33  17.97 ? 1571 VAL A HB   1 
ATOM   1663 H  HG11 A VAL A 1 118 ? -12.608 -4.239  5.911   0.67  19.84 ? 1571 VAL A HG11 1 
ATOM   1664 H  HG11 B VAL A 1 118 ? -15.812 -2.816  6.309   0.33  18.64 ? 1571 VAL A HG11 1 
ATOM   1665 H  HG12 A VAL A 1 118 ? -12.316 -2.730  6.241   0.67  19.84 ? 1571 VAL A HG12 1 
ATOM   1666 H  HG12 B VAL A 1 118 ? -14.607 -2.214  5.498   0.33  18.64 ? 1571 VAL A HG12 1 
ATOM   1667 H  HG13 A VAL A 1 118 ? -12.059 -3.836  7.328   0.67  19.84 ? 1571 VAL A HG13 1 
ATOM   1668 H  HG13 B VAL A 1 118 ? -15.056 -3.701  5.251   0.33  18.64 ? 1571 VAL A HG13 1 
ATOM   1669 H  HG21 A VAL A 1 118 ? -15.828 -2.837  6.313   0.67  19.72 ? 1571 VAL A HG21 1 
ATOM   1670 H  HG21 B VAL A 1 118 ? -13.096 -2.693  8.649   0.33  17.59 ? 1571 VAL A HG21 1 
ATOM   1671 H  HG22 A VAL A 1 118 ? -14.611 -2.131  5.610   0.67  19.72 ? 1571 VAL A HG22 1 
ATOM   1672 H  HG22 B VAL A 1 118 ? -13.398 -1.604  7.556   0.33  17.59 ? 1571 VAL A HG22 1 
ATOM   1673 H  HG23 A VAL A 1 118 ? -14.943 -3.633  5.285   0.67  19.72 ? 1571 VAL A HG23 1 
ATOM   1674 H  HG23 B VAL A 1 118 ? -14.563 -2.162  8.453   0.33  17.59 ? 1571 VAL A HG23 1 
ATOM   1675 N  N    . VAL A 1 119 ? -13.733 -5.118  9.935   1.00  13.94 ? 1572 VAL A N    1 
ATOM   1676 C  CA   . VAL A 1 119 ? -12.819 -5.724  10.904  1.00  14.14 ? 1572 VAL A CA   1 
ATOM   1677 C  C    . VAL A 1 119 ? -12.905 -7.264  10.835  1.00  14.25 ? 1572 VAL A C    1 
ATOM   1678 O  O    . VAL A 1 119 ? -11.904 -7.964  11.001  1.00  14.47 ? 1572 VAL A O    1 
ATOM   1679 C  CB   . VAL A 1 119 ? -13.078 -5.230  12.329  1.00  16.28 ? 1572 VAL A CB   1 
ATOM   1680 C  CG1  . VAL A 1 119 ? -12.175 -5.972  13.329  1.00  18.64 ? 1572 VAL A CG1  1 
ATOM   1681 C  CG2  . VAL A 1 119 ? -12.866 -3.732  12.406  1.00  17.31 ? 1572 VAL A CG2  1 
ATOM   1682 H  H    . VAL A 1 119 ? -14.363 -4.640  10.272  1.00  16.73 ? 1572 VAL A H    1 
ATOM   1683 H  HA   . VAL A 1 119 ? -11.903 -5.470  10.667  1.00  16.97 ? 1572 VAL A HA   1 
ATOM   1684 H  HB   . VAL A 1 119 ? -14.011 -5.417  12.567  1.00  19.54 ? 1572 VAL A HB   1 
ATOM   1685 H  HG11 . VAL A 1 119 ? -11.257 -5.809  13.100  1.00  22.37 ? 1572 VAL A HG11 1 
ATOM   1686 H  HG12 . VAL A 1 119 ? -12.355 -5.646  14.214  1.00  22.37 ? 1572 VAL A HG12 1 
ATOM   1687 H  HG13 . VAL A 1 119 ? -12.363 -6.913  13.282  1.00  22.37 ? 1572 VAL A HG13 1 
ATOM   1688 H  HG21 . VAL A 1 119 ? -13.474 -3.299  11.803  1.00  20.77 ? 1572 VAL A HG21 1 
ATOM   1689 H  HG22 . VAL A 1 119 ? -13.033 -3.439  13.305  1.00  20.77 ? 1572 VAL A HG22 1 
ATOM   1690 H  HG23 . VAL A 1 119 ? -11.960 -3.532  12.159  1.00  20.77 ? 1572 VAL A HG23 1 
ATOM   1691 N  N    . GLN A 1 120 ? -14.091 -7.790  10.550  1.00  13.54 ? 1573 GLN A N    1 
ATOM   1692 C  CA   . GLN A 1 120 ? -14.242 -9.231  10.355  1.00  12.98 ? 1573 GLN A CA   1 
ATOM   1693 C  C    . GLN A 1 120 ? -13.482 -9.700  9.115   1.00  12.95 ? 1573 GLN A C    1 
ATOM   1694 O  O    . GLN A 1 120 ? -12.945 -10.817 9.099   1.00  13.36 ? 1573 GLN A O    1 
ATOM   1695 C  CB   . GLN A 1 120 ? -15.718 -9.625  10.249  1.00  15.11 ? 1573 GLN A CB   1 
ATOM   1696 C  CG   . GLN A 1 120 ? -16.464 -9.504  11.547  1.00  17.54 ? 1573 GLN A CG   1 
ATOM   1697 C  CD   . GLN A 1 120 ? -17.969 -9.503  11.337  1.00  21.64 ? 1573 GLN A CD   1 
ATOM   1698 O  OE1  . GLN A 1 120 ? -18.464 -9.057  10.291  1.00  24.04 ? 1573 GLN A OE1  1 
ATOM   1699 N  NE2  . GLN A 1 120 ? -18.704 -9.943  12.343  1.00  25.59 ? 1573 GLN A NE2  1 
ATOM   1700 H  H    . GLN A 1 120 ? -14.819 -7.341  10.465  1.00  16.24 ? 1573 GLN A H    1 
ATOM   1701 H  HA   . GLN A 1 120 ? -13.864 -9.695  11.131  1.00  15.58 ? 1573 GLN A HA   1 
ATOM   1702 H  HB2  . GLN A 1 120 ? -16.151 -9.048  9.601   1.00  18.14 ? 1573 GLN A HB2  1 
ATOM   1703 H  HB3  . GLN A 1 120 ? -15.775 -10.549 9.958   1.00  18.14 ? 1573 GLN A HB3  1 
ATOM   1704 H  HG2  . GLN A 1 120 ? -16.238 -10.256 12.116  1.00  21.04 ? 1573 GLN A HG2  1 
ATOM   1705 H  HG3  . GLN A 1 120 ? -16.219 -8.671  11.979  1.00  21.04 ? 1573 GLN A HG3  1 
ATOM   1706 H  HE21 . GLN A 1 120 ? -18.326 -10.210 13.068  1.00  30.71 ? 1573 GLN A HE21 1 
ATOM   1707 H  HE22 . GLN A 1 120 ? -19.561 -9.963  12.273  1.00  30.71 ? 1573 GLN A HE22 1 
ATOM   1708 N  N    . TRP A 1 121 ? -13.449 -8.874  8.072   1.00  12.27 ? 1574 TRP A N    1 
ATOM   1709 C  CA   . TRP A 1 121 ? -12.648 -9.221  6.903   1.00  12.05 ? 1574 TRP A CA   1 
ATOM   1710 C  C    . TRP A 1 121 ? -11.168 -9.279  7.299   1.00  12.62 ? 1574 TRP A C    1 
ATOM   1711 O  O    . TRP A 1 121 ? -10.445 -10.200 6.918   1.00  13.28 ? 1574 TRP A O    1 
ATOM   1712 C  CB   . TRP A 1 121 ? -12.770 -8.228  5.757   1.00  13.24 ? 1574 TRP A CB   1 
ATOM   1713 C  CG   . TRP A 1 121 ? -14.117 -7.701  5.373   1.00  12.43 ? 1574 TRP A CG   1 
ATOM   1714 C  CD1  . TRP A 1 121 ? -15.346 -7.986  5.913   1.00  12.73 ? 1574 TRP A CD1  1 
ATOM   1715 C  CD2  . TRP A 1 121 ? -14.343 -6.742  4.337   1.00  11.02 ? 1574 TRP A CD2  1 
ATOM   1716 N  NE1  . TRP A 1 121 ? -16.319 -7.245  5.271   1.00  13.44 ? 1574 TRP A NE1  1 
ATOM   1717 C  CE2  . TRP A 1 121 ? -15.721 -6.464  4.310   1.00  11.75 ? 1574 TRP A CE2  1 
ATOM   1718 C  CE3  . TRP A 1 121 ? -13.496 -6.071  3.446   1.00  11.45 ? 1574 TRP A CE3  1 
ATOM   1719 C  CZ2  . TRP A 1 121 ? -16.277 -5.561  3.413   1.00  12.03 ? 1574 TRP A CZ2  1 
ATOM   1720 C  CZ3  . TRP A 1 121 ? -14.050 -5.174  2.558   1.00  10.92 ? 1574 TRP A CZ3  1 
ATOM   1721 C  CH2  . TRP A 1 121 ? -15.430 -4.917  2.556   1.00  11.44 ? 1574 TRP A CH2  1 
ATOM   1722 H  H    . TRP A 1 121 ? -13.870 -8.126  8.016   1.00  14.72 ? 1574 TRP A H    1 
ATOM   1723 H  HA   . TRP A 1 121 ? -12.916 -10.105 6.576   1.00  14.46 ? 1574 TRP A HA   1 
ATOM   1724 H  HB2  . TRP A 1 121 ? -12.225 -7.457  5.980   1.00  15.89 ? 1574 TRP A HB2  1 
ATOM   1725 H  HB3  . TRP A 1 121 ? -12.402 -8.650  4.965   1.00  15.89 ? 1574 TRP A HB3  1 
ATOM   1726 H  HD1  . TRP A 1 121 ? -15.499 -8.581  6.612   1.00  15.28 ? 1574 TRP A HD1  1 
ATOM   1727 H  HE1  . TRP A 1 121 ? -17.160 -7.262  5.450   1.00  16.13 ? 1574 TRP A HE1  1 
ATOM   1728 H  HE3  . TRP A 1 121 ? -12.578 -6.220  3.460   1.00  13.74 ? 1574 TRP A HE3  1 
ATOM   1729 H  HZ2  . TRP A 1 121 ? -17.193 -5.401  3.395   1.00  14.43 ? 1574 TRP A HZ2  1 
ATOM   1730 H  HZ3  . TRP A 1 121 ? -13.499 -4.720  1.963   1.00  13.11 ? 1574 TRP A HZ3  1 
ATOM   1731 H  HH2  . TRP A 1 121 ? -15.779 -4.318  1.936   1.00  13.73 ? 1574 TRP A HH2  1 
ATOM   1732 N  N    . MET A 1 122 ? -10.707 -8.270  8.031   1.00  13.00 ? 1575 MET A N    1 
ATOM   1733 C  CA   A MET A 1 122 ? -9.320  -8.239  8.474   0.68  14.47 ? 1575 MET A CA   1 
ATOM   1734 C  CA   B MET A 1 122 ? -9.324  -8.222  8.486   0.32  13.28 ? 1575 MET A CA   1 
ATOM   1735 C  C    . MET A 1 122 ? -8.979  -9.474  9.283   1.00  13.98 ? 1575 MET A C    1 
ATOM   1736 O  O    . MET A 1 122 ? -7.919  -10.066 9.099   1.00  14.42 ? 1575 MET A O    1 
ATOM   1737 C  CB   A MET A 1 122 ? -9.032  -6.984  9.293   0.68  17.55 ? 1575 MET A CB   1 
ATOM   1738 C  CB   B MET A 1 122 ? -9.091  -6.978  9.346   0.32  13.61 ? 1575 MET A CB   1 
ATOM   1739 C  CG   A MET A 1 122 ? -8.913  -5.737  8.444   0.68  21.83 ? 1575 MET A CG   1 
ATOM   1740 C  CG   B MET A 1 122 ? -9.158  -5.662  8.575   0.32  14.11 ? 1575 MET A CG   1 
ATOM   1741 S  SD   A MET A 1 122 ? -8.318  -4.317  9.357   0.68  26.75 ? 1575 MET A SD   1 
ATOM   1742 S  SD   B MET A 1 122 ? -7.583  -5.246  7.779   0.32  14.60 ? 1575 MET A SD   1 
ATOM   1743 C  CE   A MET A 1 122 ? -9.846  -3.878  10.137  0.68  24.43 ? 1575 MET A CE   1 
ATOM   1744 C  CE   B MET A 1 122 ? -6.588  -4.946  9.234   0.32  13.65 ? 1575 MET A CE   1 
ATOM   1745 H  H    A MET A 1 122 ? -11.176 -7.594  8.284   0.68  15.60 ? 1575 MET A H    1 
ATOM   1746 H  H    B MET A 1 122 ? -11.180 -7.596  8.280   0.32  15.60 ? 1575 MET A H    1 
ATOM   1747 H  HA   A MET A 1 122 ? -8.742  -8.215  7.684   0.68  17.37 ? 1575 MET A HA   1 
ATOM   1748 H  HA   B MET A 1 122 ? -8.733  -8.167  7.706   0.32  15.94 ? 1575 MET A HA   1 
ATOM   1749 H  HB2  A MET A 1 122 ? -9.755  -6.847  9.925   0.68  21.06 ? 1575 MET A HB2  1 
ATOM   1750 H  HB2  B MET A 1 122 ? -9.769  -6.949  10.039  0.32  16.33 ? 1575 MET A HB2  1 
ATOM   1751 H  HB3  A MET A 1 122 ? -8.195  -7.103  9.768   0.68  21.06 ? 1575 MET A HB3  1 
ATOM   1752 H  HB3  B MET A 1 122 ? -8.211  -7.040  9.749   0.32  16.33 ? 1575 MET A HB3  1 
ATOM   1753 H  HG2  A MET A 1 122 ? -8.291  -5.908  7.719   0.68  26.20 ? 1575 MET A HG2  1 
ATOM   1754 H  HG2  B MET A 1 122 ? -9.835  -5.732  7.884   0.32  16.93 ? 1575 MET A HG2  1 
ATOM   1755 H  HG3  A MET A 1 122 ? -9.787  -5.517  8.085   0.68  26.20 ? 1575 MET A HG3  1 
ATOM   1756 H  HG3  B MET A 1 122 ? -9.383  -4.945  9.189   0.32  16.93 ? 1575 MET A HG3  1 
ATOM   1757 H  HE1  A MET A 1 122 ? -10.144 -4.615  10.676  0.68  29.32 ? 1575 MET A HE1  1 
ATOM   1758 H  HE1  B MET A 1 122 ? -6.564  -5.744  9.766   0.32  16.38 ? 1575 MET A HE1  1 
ATOM   1759 H  HE2  A MET A 1 122 ? -9.704  -3.105  10.687  0.68  29.32 ? 1575 MET A HE2  1 
ATOM   1760 H  HE2  B MET A 1 122 ? -5.699  -4.708  8.960   0.32  16.38 ? 1575 MET A HE2  1 
ATOM   1761 H  HE3  A MET A 1 122 ? -10.497 -3.684  9.459   0.68  29.32 ? 1575 MET A HE3  1 
ATOM   1762 H  HE3  B MET A 1 122 ? -6.979  -4.228  9.737   0.32  16.38 ? 1575 MET A HE3  1 
ATOM   1763 N  N    . GLU A 1 123 ? -9.874  -9.858  10.181  1.00  13.66 ? 1576 GLU A N    1 
ATOM   1764 C  CA   . GLU A 1 123 ? -9.639  -11.033 11.013  1.00  13.85 ? 1576 GLU A CA   1 
ATOM   1765 C  C    . GLU A 1 123 ? -9.443  -12.283 10.171  1.00  13.16 ? 1576 GLU A C    1 
ATOM   1766 O  O    . GLU A 1 123 ? -8.569  -13.102 10.463  1.00  14.08 ? 1576 GLU A O    1 
ATOM   1767 C  CB   . GLU A 1 123 ? -10.777 -11.229 12.006  1.00  14.91 ? 1576 GLU A CB   1 
ATOM   1768 C  CG   . GLU A 1 123 ? -10.753 -10.215 13.130  1.00  18.59 ? 1576 GLU A CG   1 
ATOM   1769 C  CD   . GLU A 1 123 ? -12.014 -10.222 13.978  1.00  22.28 ? 1576 GLU A CD   1 
ATOM   1770 O  OE1  . GLU A 1 123 ? -12.994 -10.883 13.591  1.00  22.76 ? 1576 GLU A OE1  1 
ATOM   1771 O  OE2  . GLU A 1 123 ? -12.031 -9.550  15.028  1.00  24.60 ? 1576 GLU A OE2  1 
ATOM   1772 H  H    . GLU A 1 123 ? -10.621 -9.460  10.330  1.00  16.39 ? 1576 GLU A H    1 
ATOM   1773 H  HA   . GLU A 1 123 ? -8.818  -10.891 11.528  1.00  16.61 ? 1576 GLU A HA   1 
ATOM   1774 H  HB2  . GLU A 1 123 ? -11.623 -11.140 11.540  1.00  17.90 ? 1576 GLU A HB2  1 
ATOM   1775 H  HB3  . GLU A 1 123 ? -10.705 -12.113 12.398  1.00  17.90 ? 1576 GLU A HB3  1 
ATOM   1776 H  HG2  . GLU A 1 123 ? -10.002 -10.409 13.712  1.00  22.31 ? 1576 GLU A HG2  1 
ATOM   1777 H  HG3  . GLU A 1 123 ? -10.655 -9.328  12.750  1.00  22.31 ? 1576 GLU A HG3  1 
ATOM   1778 N  N    . HIS A 1 124 ? -10.249 -12.433 9.126   1.00  12.73 ? 1577 HIS A N    1 
ATOM   1779 C  CA   . HIS A 1 124 ? -10.060 -13.564 8.221   1.00  12.12 ? 1577 HIS A CA   1 
ATOM   1780 C  C    . HIS A 1 124 ? -8.736  -13.495 7.472   1.00  12.20 ? 1577 HIS A C    1 
ATOM   1781 O  O    . HIS A 1 124 ? -8.030  -14.498 7.389   1.00  13.84 ? 1577 HIS A O    1 
ATOM   1782 C  CB   . HIS A 1 124 ? -11.234 -13.698 7.264   1.00  12.37 ? 1577 HIS A CB   1 
ATOM   1783 C  CG   . HIS A 1 124 ? -12.372 -14.441 7.872   1.00  13.43 ? 1577 HIS A CG   1 
ATOM   1784 N  ND1  . HIS A 1 124 ? -12.308 -15.792 8.135   1.00  13.87 ? 1577 HIS A ND1  1 
ATOM   1785 C  CD2  . HIS A 1 124 ? -13.586 -14.028 8.298   1.00  14.24 ? 1577 HIS A CD2  1 
ATOM   1786 C  CE1  . HIS A 1 124 ? -13.438 -16.181 8.695   1.00  14.62 ? 1577 HIS A CE1  1 
ATOM   1787 N  NE2  . HIS A 1 124 ? -14.226 -15.127 8.815   1.00  14.40 ? 1577 HIS A NE2  1 
ATOM   1788 H  H    . HIS A 1 124 ? -10.899 -11.909 8.921   1.00  15.27 ? 1577 HIS A H    1 
ATOM   1789 H  HA   . HIS A 1 124 ? -10.039 -14.381 8.761   1.00  14.54 ? 1577 HIS A HA   1 
ATOM   1790 H  HB2  . HIS A 1 124 ? -11.547 -12.813 7.020   1.00  14.84 ? 1577 HIS A HB2  1 
ATOM   1791 H  HB3  . HIS A 1 124 ? -10.946 -14.180 6.473   1.00  14.84 ? 1577 HIS A HB3  1 
ATOM   1792 H  HD1  . HIS A 1 124 ? -11.636 -16.302 7.964   1.00  16.64 ? 1577 HIS A HD1  1 
ATOM   1793 H  HD2  . HIS A 1 124 ? -13.918 -13.160 8.263   1.00  17.09 ? 1577 HIS A HD2  1 
ATOM   1794 H  HE1  . HIS A 1 124 ? -13.644 -17.048 8.962   1.00  17.55 ? 1577 HIS A HE1  1 
ATOM   1795 H  HE2  . HIS A 1 124 ? -15.022 -15.134 9.141   1.00  17.28 ? 1577 HIS A HE2  1 
ATOM   1796 N  N    . PHE A 1 125 ? -8.389  -12.325 6.931   1.00  12.85 ? 1578 PHE A N    1 
ATOM   1797 C  CA   . PHE A 1 125 ? -7.117  -12.193 6.234   1.00  12.86 ? 1578 PHE A CA   1 
ATOM   1798 C  C    . PHE A 1 125 ? -5.915  -12.452 7.163   1.00  13.02 ? 1578 PHE A C    1 
ATOM   1799 O  O    . PHE A 1 125 ? -4.877  -12.949 6.726   1.00  14.19 ? 1578 PHE A O    1 
ATOM   1800 C  CB   . PHE A 1 125 ? -6.988  -10.801 5.610   1.00  13.05 ? 1578 PHE A CB   1 
ATOM   1801 C  CG   . PHE A 1 125 ? -7.546  -10.700 4.206   1.00  12.33 ? 1578 PHE A CG   1 
ATOM   1802 C  CD1  . PHE A 1 125 ? -8.922  -10.645 3.981   1.00  13.05 ? 1578 PHE A CD1  1 
ATOM   1803 C  CD2  . PHE A 1 125 ? -6.697  -10.643 3.114   1.00  12.13 ? 1578 PHE A CD2  1 
ATOM   1804 C  CE1  . PHE A 1 125 ? -9.419  -10.546 2.697   1.00  14.06 ? 1578 PHE A CE1  1 
ATOM   1805 C  CE2  . PHE A 1 125 ? -7.189  -10.560 1.838   1.00  13.34 ? 1578 PHE A CE2  1 
ATOM   1806 C  CZ   . PHE A 1 125 ? -8.552  -10.517 1.623   1.00  13.58 ? 1578 PHE A CZ   1 
ATOM   1807 H  H    . PHE A 1 125 ? -8.864  -11.609 6.955   1.00  15.42 ? 1578 PHE A H    1 
ATOM   1808 H  HA   . PHE A 1 125 ? -7.084  -12.852 5.509   1.00  15.43 ? 1578 PHE A HA   1 
ATOM   1809 H  HB2  . PHE A 1 125 ? -7.467  -10.165 6.164   1.00  15.66 ? 1578 PHE A HB2  1 
ATOM   1810 H  HB3  . PHE A 1 125 ? -6.049  -10.562 5.572   1.00  15.66 ? 1578 PHE A HB3  1 
ATOM   1811 H  HD1  . PHE A 1 125 ? -5.777  -10.683 3.248   1.00  14.55 ? 1578 PHE A HD1  1 
ATOM   1812 H  HD2  . PHE A 1 125 ? -9.509  -10.676 4.701   1.00  15.66 ? 1578 PHE A HD2  1 
ATOM   1813 H  HE1  . PHE A 1 125 ? -6.604  -10.529 1.116   1.00  16.01 ? 1578 PHE A HE1  1 
ATOM   1814 H  HE2  . PHE A 1 125 ? -10.337 -10.519 2.555   1.00  16.88 ? 1578 PHE A HE2  1 
ATOM   1815 H  HZ   . PHE A 1 125 ? -8.885  -10.448 0.757   1.00  16.30 ? 1578 PHE A HZ   1 
ATOM   1816 N  N    . GLU A 1 126 ? -6.065  -12.132 8.443   1.00  12.67 ? 1579 GLU A N    1 
ATOM   1817 C  CA   . GLU A 1 126 ? -4.994  -12.349 9.412   1.00  14.90 ? 1579 GLU A CA   1 
ATOM   1818 C  C    . GLU A 1 126 ? -4.849  -13.799 9.866   1.00  15.76 ? 1579 GLU A C    1 
ATOM   1819 O  O    . GLU A 1 126 ? -3.745  -14.233 10.190  1.00  18.45 ? 1579 GLU A O    1 
ATOM   1820 C  CB   . GLU A 1 126 ? -5.222  -11.472 10.645  1.00  15.86 ? 1579 GLU A CB   1 
ATOM   1821 C  CG   . GLU A 1 126 ? -5.016  -10.012 10.362  1.00  18.18 ? 1579 GLU A CG   1 
ATOM   1822 C  CD   . GLU A 1 126 ? -5.633  -9.091  11.393  1.00  23.89 ? 1579 GLU A CD   1 
ATOM   1823 O  OE1  . GLU A 1 126 ? -6.419  -9.567  12.240  1.00  25.12 ? 1579 GLU A OE1  1 
ATOM   1824 O  OE2  . GLU A 1 126 ? -5.353  -7.872  11.327  1.00  27.90 ? 1579 GLU A OE2  1 
ATOM   1825 H  H    . GLU A 1 126 ? -6.778  -11.788 8.778   1.00  15.20 ? 1579 GLU A H    1 
ATOM   1826 H  HA   . GLU A 1 126 ? -4.144  -12.078 9.006   1.00  17.88 ? 1579 GLU A HA   1 
ATOM   1827 H  HB2  . GLU A 1 126 ? -6.134  -11.593 10.954  1.00  19.03 ? 1579 GLU A HB2  1 
ATOM   1828 H  HB3  . GLU A 1 126 ? -4.598  -11.735 11.340  1.00  19.03 ? 1579 GLU A HB3  1 
ATOM   1829 H  HG2  . GLU A 1 126 ? -4.064  -9.830  10.335  1.00  21.82 ? 1579 GLU A HG2  1 
ATOM   1830 H  HG3  . GLU A 1 126 ? -5.414  -9.801  9.502   1.00  21.82 ? 1579 GLU A HG3  1 
ATOM   1831 N  N    . THR A 1 127 ? -5.958  -14.544 9.876   1.00  14.83 ? 1580 THR A N    1 
ATOM   1832 C  CA   . THR A 1 127 ? -5.973  -15.885 10.463  1.00  14.14 ? 1580 THR A CA   1 
ATOM   1833 C  C    . THR A 1 127 ? -5.903  -17.018 9.439   1.00  15.25 ? 1580 THR A C    1 
ATOM   1834 O  O    . THR A 1 127 ? -5.334  -18.064 9.731   1.00  16.21 ? 1580 THR A O    1 
ATOM   1835 C  CB   . THR A 1 127 ? -7.216  -16.124 11.339  1.00  15.56 ? 1580 THR A CB   1 
ATOM   1836 O  OG1  . THR A 1 127 ? -8.407  -15.868 10.583  1.00  15.50 ? 1580 THR A OG1  1 
ATOM   1837 C  CG2  . THR A 1 127 ? -7.189  -15.255 12.563  1.00  16.98 ? 1580 THR A CG2  1 
ATOM   1838 H  H    . THR A 1 127 ? -6.713  -14.295 9.550   1.00  17.79 ? 1580 THR A H    1 
ATOM   1839 H  HA   . THR A 1 127 ? -5.189  -15.972 11.044  1.00  16.97 ? 1580 THR A HA   1 
ATOM   1840 H  HB   . THR A 1 127 ? -7.222  -17.049 11.630  1.00  18.68 ? 1580 THR A HB   1 
ATOM   1841 H  HG1  . THR A 1 127 ? -8.411  -15.091 10.322  1.00  18.60 ? 1580 THR A HG1  1 
ATOM   1842 H  HG21 . THR A 1 127 ? -7.171  -14.330 12.309  1.00  20.38 ? 1580 THR A HG21 1 
ATOM   1843 H  HG22 . THR A 1 127 ? -7.971  -15.417 13.097  1.00  20.38 ? 1580 THR A HG22 1 
ATOM   1844 H  HG23 . THR A 1 127 ? -6.409  -15.450 13.086  1.00  20.38 ? 1580 THR A HG23 1 
ATOM   1845 N  N    . TRP A 1 128 ? -6.508  -16.829 8.270   1.00  14.40 ? 1581 TRP A N    1 
ATOM   1846 C  CA   . TRP A 1 128 ? -6.476  -17.831 7.206   1.00  13.49 ? 1581 TRP A CA   1 
ATOM   1847 C  C    . TRP A 1 128 ? -5.015  -18.016 6.824   1.00  14.44 ? 1581 TRP A C    1 
ATOM   1848 O  O    . TRP A 1 128 ? -4.283  -17.047 6.780   1.00  14.97 ? 1581 TRP A O    1 
ATOM   1849 C  CB   . TRP A 1 128 ? -7.311  -17.336 6.026   1.00  12.92 ? 1581 TRP A CB   1 
ATOM   1850 C  CG   . TRP A 1 128 ? -7.421  -18.276 4.852   1.00  12.36 ? 1581 TRP A CG   1 
ATOM   1851 C  CD1  . TRP A 1 128 ? -6.840  -18.115 3.635   1.00  13.20 ? 1581 TRP A CD1  1 
ATOM   1852 C  CD2  . TRP A 1 128 ? -8.165  -19.516 4.778   1.00  13.09 ? 1581 TRP A CD2  1 
ATOM   1853 N  NE1  . TRP A 1 128 ? -7.167  -19.162 2.808   1.00  13.05 ? 1581 TRP A NE1  1 
ATOM   1854 C  CE2  . TRP A 1 128 ? -7.971  -20.035 3.486   1.00  12.92 ? 1581 TRP A CE2  1 
ATOM   1855 C  CE3  . TRP A 1 128 ? -8.974  -20.224 5.673   1.00  14.12 ? 1581 TRP A CE3  1 
ATOM   1856 C  CZ2  . TRP A 1 128 ? -8.549  -21.221 3.066   1.00  13.53 ? 1581 TRP A CZ2  1 
ATOM   1857 C  CZ3  . TRP A 1 128 ? -9.566  -21.392 5.246   1.00  15.15 ? 1581 TRP A CZ3  1 
ATOM   1858 C  CH2  . TRP A 1 128 ? -9.340  -21.887 3.956   1.00  14.03 ? 1581 TRP A CH2  1 
ATOM   1859 H  H    . TRP A 1 128 ? -6.949  -16.120 8.065   1.00  17.28 ? 1581 TRP A H    1 
ATOM   1860 H  HA   . TRP A 1 128 ? -6.839  -18.683 7.528   1.00  16.19 ? 1581 TRP A HA   1 
ATOM   1861 H  HB2  . TRP A 1 128 ? -8.211  -17.161 6.342   1.00  15.51 ? 1581 TRP A HB2  1 
ATOM   1862 H  HB3  . TRP A 1 128 ? -6.918  -16.512 5.700   1.00  15.51 ? 1581 TRP A HB3  1 
ATOM   1863 H  HD1  . TRP A 1 128 ? -6.290  -17.402 3.399   1.00  15.84 ? 1581 TRP A HD1  1 
ATOM   1864 H  HE1  . TRP A 1 128 ? -6.895  -19.261 1.998   1.00  15.66 ? 1581 TRP A HE1  1 
ATOM   1865 H  HE3  . TRP A 1 128 ? -9.126  -19.901 6.532   1.00  16.95 ? 1581 TRP A HE3  1 
ATOM   1866 H  HZ2  . TRP A 1 128 ? -8.414  -21.544 2.205   1.00  16.23 ? 1581 TRP A HZ2  1 
ATOM   1867 H  HZ3  . TRP A 1 128 ? -10.094 -21.879 5.837   1.00  18.18 ? 1581 TRP A HZ3  1 
ATOM   1868 H  HH2  . TRP A 1 128 ? -9.739  -22.686 3.700   1.00  16.84 ? 1581 TRP A HH2  1 
ATOM   1869 N  N    . PRO A 1 129 ? -4.569  -19.264 6.596   1.00  14.23 ? 1582 PRO A N    1 
ATOM   1870 C  CA   . PRO A 1 129 ? -3.146  -19.436 6.262   1.00  15.38 ? 1582 PRO A CA   1 
ATOM   1871 C  C    . PRO A 1 129 ? -2.733  -18.594 5.056   1.00  16.59 ? 1582 PRO A C    1 
ATOM   1872 O  O    . PRO A 1 129 ? -3.431  -18.564 4.045   1.00  16.13 ? 1582 PRO A O    1 
ATOM   1873 C  CB   . PRO A 1 129 ? -3.029  -20.941 6.003   1.00  15.82 ? 1582 PRO A CB   1 
ATOM   1874 C  CG   . PRO A 1 129 ? -4.155  -21.532 6.827   1.00  15.85 ? 1582 PRO A CG   1 
ATOM   1875 C  CD   . PRO A 1 129 ? -5.273  -20.552 6.696   1.00  14.32 ? 1582 PRO A CD   1 
ATOM   1876 H  HA   . PRO A 1 129 ? -2.587  -19.197 7.030   1.00  18.46 ? 1582 PRO A HA   1 
ATOM   1877 H  HB2  . PRO A 1 129 ? -3.155  -21.126 5.059   1.00  18.99 ? 1582 PRO A HB2  1 
ATOM   1878 H  HB3  . PRO A 1 129 ? -2.167  -21.264 6.309   1.00  18.99 ? 1582 PRO A HB3  1 
ATOM   1879 H  HG2  . PRO A 1 129 ? -4.409  -22.395 6.464   1.00  19.02 ? 1582 PRO A HG2  1 
ATOM   1880 H  HG3  . PRO A 1 129 ? -3.876  -21.615 7.752   1.00  19.02 ? 1582 PRO A HG3  1 
ATOM   1881 H  HD2  . PRO A 1 129 ? -5.783  -20.725 5.889   1.00  17.18 ? 1582 PRO A HD2  1 
ATOM   1882 H  HD3  . PRO A 1 129 ? -5.836  -20.572 7.486   1.00  17.18 ? 1582 PRO A HD3  1 
ATOM   1883 N  N    . SER A 1 130 ? -1.608  -17.892 5.173   1.00  19.33 ? 1583 SER A N    1 
ATOM   1884 C  CA   . SER A 1 130 ? -1.277  -16.866 4.192   1.00  21.36 ? 1583 SER A CA   1 
ATOM   1885 C  C    . SER A 1 130 ? -0.931  -17.447 2.821   1.00  20.13 ? 1583 SER A C    1 
ATOM   1886 O  O    . SER A 1 130 ? -0.935  -16.722 1.831   1.00  21.78 ? 1583 SER A O    1 
ATOM   1887 C  CB   . SER A 1 130 ? -0.111  -16.012 4.684   1.00  25.41 ? 1583 SER A CB   1 
ATOM   1888 O  OG   . SER A 1 130 ? 1.000   -16.855 4.821   1.00  28.64 ? 1583 SER A OG   1 
ATOM   1889 H  H    . SER A 1 130 ? -1.029  -17.989 5.801   1.00  23.19 ? 1583 SER A H    1 
ATOM   1890 H  HA   . SER A 1 130 ? -2.052  -16.277 4.079   1.00  25.64 ? 1583 SER A HA   1 
ATOM   1891 H  HB2  . SER A 1 130 ? 0.083   -15.320 4.033   1.00  30.49 ? 1583 SER A HB2  1 
ATOM   1892 H  HB3  . SER A 1 130 ? -0.333  -15.622 5.544   1.00  30.49 ? 1583 SER A HB3  1 
ATOM   1893 H  HG   . SER A 1 130 ? 1.647   -16.426 5.085   1.00  34.37 ? 1583 SER A HG   1 
ATOM   1894 N  N    . HIS A 1 131 ? -0.636  -18.744 2.756   1.00  17.87 ? 1584 HIS A N    1 
ATOM   1895 C  CA   . HIS A 1 131 ? -0.283  -19.372 1.483   1.00  17.22 ? 1584 HIS A CA   1 
ATOM   1896 C  C    . HIS A 1 131 ? -1.506  -19.889 0.726   1.00  15.51 ? 1584 HIS A C    1 
ATOM   1897 O  O    . HIS A 1 131 ? -1.380  -20.358 -0.407  1.00  16.18 ? 1584 HIS A O    1 
ATOM   1898 C  CB   . HIS A 1 131 ? 0.730   -20.512 1.680   1.00  18.67 ? 1584 HIS A CB   1 
ATOM   1899 C  CG   . HIS A 1 131 ? 0.184   -21.684 2.429   1.00  18.77 ? 1584 HIS A CG   1 
ATOM   1900 N  ND1  . HIS A 1 131 ? -0.097  -21.644 3.779   1.00  19.37 ? 1584 HIS A ND1  1 
ATOM   1901 C  CD2  . HIS A 1 131 ? -0.155  -22.924 2.013   1.00  19.07 ? 1584 HIS A CD2  1 
ATOM   1902 C  CE1  . HIS A 1 131 ? -0.574  -22.814 4.163   1.00  18.93 ? 1584 HIS A CE1  1 
ATOM   1903 N  NE2  . HIS A 1 131 ? -0.621  -23.607 3.110   1.00  19.34 ? 1584 HIS A NE2  1 
ATOM   1904 H  H    . HIS A 1 131 ? -0.632  -19.279 3.430   1.00  21.45 ? 1584 HIS A H    1 
ATOM   1905 H  HA   . HIS A 1 131 ? 0.145   -18.697 0.917   1.00  20.67 ? 1584 HIS A HA   1 
ATOM   1906 H  HB2  . HIS A 1 131 ? 1.019   -20.826 0.809   1.00  22.40 ? 1584 HIS A HB2  1 
ATOM   1907 H  HB3  . HIS A 1 131 ? 1.490   -20.172 2.176   1.00  22.40 ? 1584 HIS A HB3  1 
ATOM   1908 H  HD1  . HIS A 1 131 ? 0.026   -20.965 4.292   1.00  23.24 ? 1584 HIS A HD1  1 
ATOM   1909 H  HD2  . HIS A 1 131 ? -0.083  -23.255 1.146   1.00  22.89 ? 1584 HIS A HD2  1 
ATOM   1910 H  HE1  . HIS A 1 131 ? -0.834  -23.039 5.027   1.00  22.72 ? 1584 HIS A HE1  1 
ATOM   1911 H  HE2  . HIS A 1 131 ? -0.897  -24.422 3.110   1.00  23.20 ? 1584 HIS A HE2  1 
ATOM   1912 N  N    . LEU A 1 132 ? -2.687  -19.807 1.333   1.00  13.85 ? 1585 LEU A N    1 
ATOM   1913 C  CA   . LEU A 1 132 ? -3.883  -20.402 0.738   1.00  12.72 ? 1585 LEU A CA   1 
ATOM   1914 C  C    . LEU A 1 132 ? -4.773  -19.333 0.107   1.00  12.30 ? 1585 LEU A C    1 
ATOM   1915 O  O    . LEU A 1 132 ? -4.771  -18.178 0.545   1.00  12.60 ? 1585 LEU A O    1 
ATOM   1916 C  CB   . LEU A 1 132 ? -4.666  -21.188 1.784   1.00  13.55 ? 1585 LEU A CB   1 
ATOM   1917 C  CG   . LEU A 1 132 ? -3.921  -22.398 2.366   1.00  14.56 ? 1585 LEU A CG   1 
ATOM   1918 C  CD1  . LEU A 1 132 ? -4.725  -23.036 3.486   1.00  15.02 ? 1585 LEU A CD1  1 
ATOM   1919 C  CD2  . LEU A 1 132 ? -3.593  -23.432 1.268   1.00  15.55 ? 1585 LEU A CD2  1 
ATOM   1920 H  H    . LEU A 1 132 ? -2.823  -19.414 2.086   1.00  16.62 ? 1585 LEU A H    1 
ATOM   1921 H  HA   . LEU A 1 132 ? -3.612  -21.025 0.032   1.00  15.26 ? 1585 LEU A HA   1 
ATOM   1922 H  HB2  . LEU A 1 132 ? -4.882  -20.595 2.520   1.00  16.26 ? 1585 LEU A HB2  1 
ATOM   1923 H  HB3  . LEU A 1 132 ? -5.484  -21.515 1.378   1.00  16.26 ? 1585 LEU A HB3  1 
ATOM   1924 H  HG   . LEU A 1 132 ? -3.081  -22.093 2.743   1.00  17.48 ? 1585 LEU A HG   1 
ATOM   1925 H  HD11 . LEU A 1 132 ? -5.571  -23.326 3.136   1.00  18.03 ? 1585 LEU A HD11 1 
ATOM   1926 H  HD12 . LEU A 1 132 ? -4.238  -23.788 3.831   1.00  18.03 ? 1585 LEU A HD12 1 
ATOM   1927 H  HD13 . LEU A 1 132 ? -4.862  -22.387 4.180   1.00  18.03 ? 1585 LEU A HD13 1 
ATOM   1928 H  HD21 . LEU A 1 132 ? -3.040  -23.016 0.603   1.00  18.66 ? 1585 LEU A HD21 1 
ATOM   1929 H  HD22 . LEU A 1 132 ? -3.129  -24.173 1.664   1.00  18.66 ? 1585 LEU A HD22 1 
ATOM   1930 H  HD23 . LEU A 1 132 ? -4.413  -23.734 0.869   1.00  18.66 ? 1585 LEU A HD23 1 
ATOM   1931 N  N    . PRO A 1 133 ? -5.532  -19.704 -0.933  1.00  11.61 ? 1586 PRO A N    1 
ATOM   1932 C  CA   . PRO A 1 133 ? -6.323  -18.699 -1.651  1.00  12.58 ? 1586 PRO A CA   1 
ATOM   1933 C  C    . PRO A 1 133 ? -7.447  -18.072 -0.852  1.00  11.40 ? 1586 PRO A C    1 
ATOM   1934 O  O    . PRO A 1 133 ? -8.093  -18.732 -0.039  1.00  11.56 ? 1586 PRO A O    1 
ATOM   1935 C  CB   . PRO A 1 133 ? -6.910  -19.482 -2.827  1.00  11.79 ? 1586 PRO A CB   1 
ATOM   1936 C  CG   . PRO A 1 133 ? -6.008  -20.666 -2.999  1.00  12.29 ? 1586 PRO A CG   1 
ATOM   1937 C  CD   . PRO A 1 133 ? -5.580  -21.016 -1.602  1.00  12.04 ? 1586 PRO A CD   1 
ATOM   1938 H  HA   . PRO A 1 133 ? -5.738  -17.991 -1.995  1.00  15.10 ? 1586 PRO A HA   1 
ATOM   1939 H  HB2  . PRO A 1 133 ? -7.812  -19.767 -2.612  1.00  14.15 ? 1586 PRO A HB2  1 
ATOM   1940 H  HB3  . PRO A 1 133 ? -6.906  -18.929 -3.624  1.00  14.15 ? 1586 PRO A HB3  1 
ATOM   1941 H  HG2  . PRO A 1 133 ? -6.499  -21.399 -3.403  1.00  14.74 ? 1586 PRO A HG2  1 
ATOM   1942 H  HG3  . PRO A 1 133 ? -5.243  -20.421 -3.543  1.00  14.74 ? 1586 PRO A HG3  1 
ATOM   1943 H  HD2  . PRO A 1 133 ? -6.239  -21.589 -1.179  1.00  14.45 ? 1586 PRO A HD2  1 
ATOM   1944 H  HD3  . PRO A 1 133 ? -4.701  -21.426 -1.609  1.00  14.45 ? 1586 PRO A HD3  1 
ATOM   1945 N  N    . ILE A 1 134 ? -7.661  -16.782 -1.111  1.00  11.26 ? 1587 ILE A N    1 
ATOM   1946 C  CA   A ILE A 1 134 ? -8.846  -16.077 -0.656  0.010 11.36 ? 1587 ILE A CA   1 
ATOM   1947 C  CA   B ILE A 1 134 ? -8.850  -16.071 -0.654  0.99  11.04 ? 1587 ILE A CA   1 
ATOM   1948 C  C    . ILE A 1 134 ? -9.505  -15.435 -1.870  1.00  11.00 ? 1587 ILE A C    1 
ATOM   1949 O  O    . ILE A 1 134 ? -8.846  -14.727 -2.639  1.00  11.57 ? 1587 ILE A O    1 
ATOM   1950 C  CB   A ILE A 1 134 ? -8.511  -14.969 0.360   0.010 12.22 ? 1587 ILE A CB   1 
ATOM   1951 C  CB   B ILE A 1 134 ? -8.518  -14.959 0.358   0.99  12.32 ? 1587 ILE A CB   1 
ATOM   1952 C  CG1  A ILE A 1 134 ? -7.892  -15.566 1.626   0.010 12.81 ? 1587 ILE A CG1  1 
ATOM   1953 C  CG1  B ILE A 1 134 ? -7.899  -15.543 1.623   0.99  13.49 ? 1587 ILE A CG1  1 
ATOM   1954 C  CG2  A ILE A 1 134 ? -9.766  -14.179 0.711   0.010 12.49 ? 1587 ILE A CG2  1 
ATOM   1955 C  CG2  B ILE A 1 134 ? -9.792  -14.178 0.724   0.99  13.05 ? 1587 ILE A CG2  1 
ATOM   1956 C  CD1  A ILE A 1 134 ? -7.586  -14.536 2.700   0.010 13.18 ? 1587 ILE A CD1  1 
ATOM   1957 C  CD1  B ILE A 1 134 ? -7.608  -14.498 2.689   0.99  14.37 ? 1587 ILE A CD1  1 
ATOM   1958 H  H    A ILE A 1 134 ? -7.119  -16.287 -1.560  0.010 13.51 ? 1587 ILE A H    1 
ATOM   1959 H  H    B ILE A 1 134 ? -7.119  -16.289 -1.561  0.99  13.51 ? 1587 ILE A H    1 
ATOM   1960 H  HA   A ILE A 1 134 ? -9.476  -16.707 -0.247  0.010 13.63 ? 1587 ILE A HA   1 
ATOM   1961 H  HA   B ILE A 1 134 ? -9.480  -16.699 -0.244  0.99  13.25 ? 1587 ILE A HA   1 
ATOM   1962 H  HB   A ILE A 1 134 ? -7.868  -14.365 -0.043  0.010 14.67 ? 1587 ILE A HB   1 
ATOM   1963 H  HB   B ILE A 1 134 ? -7.882  -14.348 -0.047  0.99  14.79 ? 1587 ILE A HB   1 
ATOM   1964 H  HG12 A ILE A 1 134 ? -8.510  -16.212 2.002   0.010 15.38 ? 1587 ILE A HG12 1 
ATOM   1965 H  HG12 B ILE A 1 134 ? -8.512  -16.192 2.001   0.99  16.19 ? 1587 ILE A HG12 1 
ATOM   1966 H  HG13 A ILE A 1 134 ? -7.059  -16.005 1.390   0.010 15.38 ? 1587 ILE A HG13 1 
ATOM   1967 H  HG13 B ILE A 1 134 ? -7.062  -15.975 1.392   0.99  16.19 ? 1587 ILE A HG13 1 
ATOM   1968 H  HG21 A ILE A 1 134 ? -10.414 -14.776 1.093   0.010 14.99 ? 1587 ILE A HG21 1 
ATOM   1969 H  HG21 B ILE A 1 134 ? -10.428 -14.783 1.113   0.99  15.65 ? 1587 ILE A HG21 1 
ATOM   1970 H  HG22 A ILE A 1 134 ? -9.537  -13.495 1.344   0.010 14.99 ? 1587 ILE A HG22 1 
ATOM   1971 H  HG22 B ILE A 1 134 ? -9.565  -13.491 1.355   0.99  15.65 ? 1587 ILE A HG22 1 
ATOM   1972 H  HG23 A ILE A 1 134 ? -10.118 -13.781 -0.089  0.010 14.99 ? 1587 ILE A HG23 1 
ATOM   1973 H  HG23 B ILE A 1 134 ? -10.157 -13.785 -0.072  0.99  15.65 ? 1587 ILE A HG23 1 
ATOM   1974 H  HD11 A ILE A 1 134 ? -8.402  -14.098 2.954   0.010 15.81 ? 1587 ILE A HD11 1 
ATOM   1975 H  HD11 B ILE A 1 134 ? -8.430  -14.068 2.936   0.99  17.24 ? 1587 ILE A HD11 1 
ATOM   1976 H  HD12 A ILE A 1 134 ? -7.202  -14.980 3.459   0.010 15.81 ? 1587 ILE A HD12 1 
ATOM   1977 H  HD12 B ILE A 1 134 ? -7.222  -14.932 3.454   0.99  17.24 ? 1587 ILE A HD12 1 
ATOM   1978 H  HD13 A ILE A 1 134 ? -6.966  -13.893 2.348   0.010 15.81 ? 1587 ILE A HD13 1 
ATOM   1979 H  HD13 B ILE A 1 134 ? -6.993  -13.852 2.333   0.99  17.24 ? 1587 ILE A HD13 1 
ATOM   1980 N  N    . VAL A 1 135 ? -10.797 -15.678 -2.029  1.00  10.56 ? 1588 VAL A N    1 
ATOM   1981 C  CA   . VAL A 1 135 ? -11.561 -15.046 -3.104  1.00  10.62 ? 1588 VAL A CA   1 
ATOM   1982 C  C    . VAL A 1 135 ? -12.709 -14.274 -2.480  1.00  10.62 ? 1588 VAL A C    1 
ATOM   1983 O  O    . VAL A 1 135 ? -13.192 -14.632 -1.401  1.00  11.52 ? 1588 VAL A O    1 
ATOM   1984 C  CB   . VAL A 1 135 ? -12.095 -16.063 -4.139  1.00  12.76 ? 1588 VAL A CB   1 
ATOM   1985 C  CG1  . VAL A 1 135 ? -10.979 -17.014 -4.601  1.00  12.42 ? 1588 VAL A CG1  1 
ATOM   1986 C  CG2  . VAL A 1 135 ? -13.215 -16.869 -3.570  1.00  13.61 ? 1588 VAL A CG2  1 
ATOM   1987 H  H    . VAL A 1 135 ? -11.259 -16.204 -1.530  1.00  12.68 ? 1588 VAL A H    1 
ATOM   1988 H  HA   . VAL A 1 135 ? -10.985 -14.408 -3.575  1.00  12.74 ? 1588 VAL A HA   1 
ATOM   1989 H  HB   . VAL A 1 135 ? -12.431 -15.580 -4.923  1.00  15.31 ? 1588 VAL A HB   1 
ATOM   1990 H  HG11 . VAL A 1 135 ? -10.641 -17.491 -3.839  1.00  14.90 ? 1588 VAL A HG11 1 
ATOM   1991 H  HG12 . VAL A 1 135 ? -11.340 -17.631 -5.241  1.00  14.90 ? 1588 VAL A HG12 1 
ATOM   1992 H  HG13 . VAL A 1 135 ? -10.276 -16.498 -5.003  1.00  14.90 ? 1588 VAL A HG13 1 
ATOM   1993 H  HG21 . VAL A 1 135 ? -13.928 -16.279 -3.318  1.00  16.33 ? 1588 VAL A HG21 1 
ATOM   1994 H  HG22 . VAL A 1 135 ? -13.522 -17.489 -4.236  1.00  16.33 ? 1588 VAL A HG22 1 
ATOM   1995 H  HG23 . VAL A 1 135 ? -12.896 -17.346 -2.800  1.00  16.33 ? 1588 VAL A HG23 1 
ATOM   1996 N  N    . ALA A 1 136 ? -13.158 -13.228 -3.160  1.00  10.70 ? 1589 ALA A N    1 
ATOM   1997 C  CA   . ALA A 1 136 ? -14.220 -12.388 -2.619  1.00  10.92 ? 1589 ALA A CA   1 
ATOM   1998 C  C    . ALA A 1 136 ? -15.267 -12.022 -3.645  1.00  11.00 ? 1589 ALA A C    1 
ATOM   1999 O  O    . ALA A 1 136 ? -14.948 -11.615 -4.768  1.00  11.86 ? 1589 ALA A O    1 
ATOM   2000 C  CB   . ALA A 1 136 ? -13.641 -11.093 -2.001  1.00  12.07 ? 1589 ALA A CB   1 
ATOM   2001 H  H    . ALA A 1 136 ? -12.868 -12.983 -3.932  1.00  12.84 ? 1589 ALA A H    1 
ATOM   2002 H  HA   . ALA A 1 136 ? -14.670 -12.881 -1.902  1.00  13.10 ? 1589 ALA A HA   1 
ATOM   2003 H  HB1  . ALA A 1 136 ? -13.173 -10.604 -2.682  1.00  14.48 ? 1589 ALA A HB1  1 
ATOM   2004 H  HB2  . ALA A 1 136 ? -14.362 -10.563 -1.655  1.00  14.48 ? 1589 ALA A HB2  1 
ATOM   2005 H  HB3  . ALA A 1 136 ? -13.037 -11.328 -1.293  1.00  14.48 ? 1589 ALA A HB3  1 
ATOM   2006 N  N    . HIS A 1 137 ? -16.525 -12.127 -3.221  1.00  10.20 ? 1590 HIS A N    1 
ATOM   2007 C  CA   . HIS A 1 137 ? -17.628 -11.474 -3.906  1.00  10.83 ? 1590 HIS A CA   1 
ATOM   2008 C  C    . HIS A 1 137 ? -17.594 -10.041 -3.405  1.00  10.45 ? 1590 HIS A C    1 
ATOM   2009 O  O    . HIS A 1 137 ? -17.904 -9.775  -2.232  1.00  11.68 ? 1590 HIS A O    1 
ATOM   2010 C  CB   . HIS A 1 137 ? -18.972 -12.139 -3.578  1.00  11.02 ? 1590 HIS A CB   1 
ATOM   2011 C  CG   . HIS A 1 137 ? -20.124 -11.537 -4.323  1.00  11.56 ? 1590 HIS A CG   1 
ATOM   2012 N  ND1  . HIS A 1 137 ? -20.970 -12.283 -5.124  1.00  12.05 ? 1590 HIS A ND1  1 
ATOM   2013 C  CD2  . HIS A 1 137 ? -20.547 -10.251 -4.418  1.00  12.90 ? 1590 HIS A CD2  1 
ATOM   2014 C  CE1  . HIS A 1 137 ? -21.870 -11.479 -5.666  1.00  12.16 ? 1590 HIS A CE1  1 
ATOM   2015 N  NE2  . HIS A 1 137 ? -21.632 -10.242 -5.261  1.00  13.40 ? 1590 HIS A NE2  1 
ATOM   2016 H  H    . HIS A 1 137 ? -16.764 -12.577 -2.529  1.00  12.24 ? 1590 HIS A H    1 
ATOM   2017 H  HA   . HIS A 1 137 ? -17.485 -11.484 -4.875  1.00  13.00 ? 1590 HIS A HA   1 
ATOM   2018 H  HB2  . HIS A 1 137 ? -18.923 -13.079 -3.812  1.00  13.22 ? 1590 HIS A HB2  1 
ATOM   2019 H  HB3  . HIS A 1 137 ? -19.148 -12.043 -2.629  1.00  13.22 ? 1590 HIS A HB3  1 
ATOM   2020 H  HD2  . HIS A 1 137 ? -20.170 -9.513  -3.996  1.00  15.47 ? 1590 HIS A HD2  1 
ATOM   2021 H  HE1  . HIS A 1 137 ? -22.554 -11.739 -6.240  1.00  14.60 ? 1590 HIS A HE1  1 
ATOM   2022 H  HE2  . HIS A 1 137 ? -22.091 -9.547  -5.478  1.00  16.08 ? 1590 HIS A HE2  1 
ATOM   2023 N  N    . ALA A 1 138 ? -17.176 -9.139  -4.287  1.00  10.70 ? 1591 ALA A N    1 
ATOM   2024 C  CA   . ALA A 1 138 ? -16.873 -7.756  -3.905  1.00  11.72 ? 1591 ALA A CA   1 
ATOM   2025 C  C    . ALA A 1 138 ? -17.205 -6.834  -5.059  1.00  13.39 ? 1591 ALA A C    1 
ATOM   2026 O  O    . ALA A 1 138 ? -16.466 -6.746  -6.034  1.00  17.88 ? 1591 ALA A O    1 
ATOM   2027 C  CB   . ALA A 1 138 ? -15.396 -7.623  -3.535  1.00  12.47 ? 1591 ALA A CB   1 
ATOM   2028 H  H    . ALA A 1 138 ? -17.057 -9.302  -5.123  1.00  12.84 ? 1591 ALA A H    1 
ATOM   2029 H  HA   . ALA A 1 138 ? -17.417 -7.500  -3.131  1.00  14.06 ? 1591 ALA A HA   1 
ATOM   2030 H  HB1  . ALA A 1 138 ? -14.861 -7.869  -4.293  1.00  14.96 ? 1591 ALA A HB1  1 
ATOM   2031 H  HB2  . ALA A 1 138 ? -15.216 -6.713  -3.288  1.00  14.96 ? 1591 ALA A HB2  1 
ATOM   2032 H  HB3  . ALA A 1 138 ? -15.206 -8.207  -2.797  1.00  14.96 ? 1591 ALA A HB3  1 
ATOM   2033 N  N    . GLU A 1 139 ? -18.329 -6.156  -4.955  1.00  11.42 ? 1592 GLU A N    1 
ATOM   2034 C  CA   . GLU A 1 139 ? -18.803 -5.290  -6.033  1.00  12.34 ? 1592 GLU A CA   1 
ATOM   2035 C  C    . GLU A 1 139 ? -18.541 -3.817  -5.796  1.00  12.20 ? 1592 GLU A C    1 
ATOM   2036 O  O    . GLU A 1 139 ? -18.610 -3.334  -4.664  1.00  12.26 ? 1592 GLU A O    1 
ATOM   2037 C  CB   . GLU A 1 139 ? -20.290 -5.480  -6.217  1.00  13.31 ? 1592 GLU A CB   1 
ATOM   2038 C  CG   . GLU A 1 139 ? -20.709 -6.902  -6.481  1.00  14.63 ? 1592 GLU A CG   1 
ATOM   2039 C  CD   . GLU A 1 139 ? -22.167 -7.018  -6.826  1.00  16.12 ? 1592 GLU A CD   1 
ATOM   2040 O  OE1  . GLU A 1 139 ? -22.666 -6.135  -7.577  1.00  16.56 ? 1592 GLU A OE1  1 
ATOM   2041 O  OE2  . GLU A 1 139 ? -22.806 -7.995  -6.351  1.00  17.64 ? 1592 GLU A OE2  1 
ATOM   2042 H  H    . GLU A 1 139 ? -18.846 -6.175  -4.268  1.00  13.70 ? 1592 GLU A H    1 
ATOM   2043 H  HA   . GLU A 1 139 ? -18.358 -5.547  -6.867  1.00  14.80 ? 1592 GLU A HA   1 
ATOM   2044 H  HB2  . GLU A 1 139 ? -20.742 -5.185  -5.411  1.00  15.98 ? 1592 GLU A HB2  1 
ATOM   2045 H  HB3  . GLU A 1 139 ? -20.580 -4.943  -6.970  1.00  15.98 ? 1592 GLU A HB3  1 
ATOM   2046 H  HG2  . GLU A 1 139 ? -20.195 -7.251  -7.226  1.00  17.55 ? 1592 GLU A HG2  1 
ATOM   2047 H  HG3  . GLU A 1 139 ? -20.545 -7.434  -5.686  1.00  17.55 ? 1592 GLU A HG3  1 
ATOM   2048 N  N    . GLN A 1 140 ? -18.261 -3.123  -6.894  1.00  12.96 ? 1593 GLN A N    1 
ATOM   2049 C  CA   . GLN A 1 140 ? -18.116 -1.670  -6.901  1.00  12.58 ? 1593 GLN A CA   1 
ATOM   2050 C  C    . GLN A 1 140 ? -17.121 -1.250  -5.817  1.00  11.79 ? 1593 GLN A C    1 
ATOM   2051 O  O    . GLN A 1 140 ? -15.987 -1.756  -5.817  1.00  13.32 ? 1593 GLN A O    1 
ATOM   2052 C  CB   . GLN A 1 140 ? -19.469 -0.996  -6.796  1.00  14.84 ? 1593 GLN A CB   1 
ATOM   2053 C  CG   . GLN A 1 140 ? -20.367 -1.317  -7.966  1.00  17.51 ? 1593 GLN A CG   1 
ATOM   2054 C  CD   . GLN A 1 140 ? -21.601 -0.457  -7.977  1.00  20.90 ? 1593 GLN A CD   1 
ATOM   2055 O  OE1  . GLN A 1 140 ? -21.585 0.634   -8.525  1.00  24.35 ? 1593 GLN A OE1  1 
ATOM   2056 N  NE2  . GLN A 1 140 ? -22.658 -0.920  -7.333  1.00  22.31 ? 1593 GLN A NE2  1 
ATOM   2057 H  H    . GLN A 1 140 ? -18.147 -3.481  -7.668  1.00  15.55 ? 1593 GLN A H    1 
ATOM   2058 H  HA   . GLN A 1 140 ? -17.731 -1.407  -7.763  1.00  15.09 ? 1593 GLN A HA   1 
ATOM   2059 H  HB2  . GLN A 1 140 ? -19.911 -1.297  -5.987  1.00  17.81 ? 1593 GLN A HB2  1 
ATOM   2060 H  HB3  . GLN A 1 140 ? -19.342 -0.035  -6.769  1.00  17.81 ? 1593 GLN A HB3  1 
ATOM   2061 H  HG2  . GLN A 1 140 ? -19.883 -1.162  -8.792  1.00  21.01 ? 1593 GLN A HG2  1 
ATOM   2062 H  HG3  . GLN A 1 140 ? -20.645 -2.244  -7.910  1.00  21.01 ? 1593 GLN A HG3  1 
ATOM   2063 H  HE21 . GLN A 1 140 ? -22.619 -1.681  -6.934  1.00  26.77 ? 1593 GLN A HE21 1 
ATOM   2064 H  HE22 . GLN A 1 140 ? -23.385 -0.461  -7.314  1.00  26.77 ? 1593 GLN A HE22 1 
ATOM   2065 N  N    . GLN A 1 141 ? -17.480 -0.354  -4.898  1.00  11.91 ? 1594 GLN A N    1 
ATOM   2066 C  CA   . GLN A 1 141 ? -16.457 0.098   -3.961  1.00  12.38 ? 1594 GLN A CA   1 
ATOM   2067 C  C    . GLN A 1 141 ? -15.899 -1.004  -3.081  1.00  11.41 ? 1594 GLN A C    1 
ATOM   2068 O  O    . GLN A 1 141 ? -14.809 -0.862  -2.537  1.00  12.89 ? 1594 GLN A O    1 
ATOM   2069 C  CB   . GLN A 1 141 ? -16.919 1.217   -3.087  1.00  17.77 ? 1594 GLN A CB   1 
ATOM   2070 C  CG   . GLN A 1 141 ? -18.098 0.986   -2.282  1.00  20.97 ? 1594 GLN A CG   1 
ATOM   2071 C  CD   . GLN A 1 141 ? -18.444 2.289   -1.548  1.00  24.27 ? 1594 GLN A CD   1 
ATOM   2072 O  OE1  . GLN A 1 141 ? -17.975 2.485   -0.468  1.00  21.98 ? 1594 GLN A OE1  1 
ATOM   2073 N  NE2  . GLN A 1 141 ? -19.201 3.210   -2.180  1.00  28.86 ? 1594 GLN A NE2  1 
ATOM   2074 H  H    . GLN A 1 141 ? -18.262 -0.011  -4.798  1.00  14.29 ? 1594 GLN A H    1 
ATOM   2075 H  HA   . GLN A 1 141 ? -15.707 0.443   -4.488  1.00  14.85 ? 1594 GLN A HA   1 
ATOM   2076 H  HB2  . GLN A 1 141 ? -16.198 1.440   -2.478  1.00  21.33 ? 1594 GLN A HB2  1 
ATOM   2077 H  HB3  . GLN A 1 141 ? -17.106 1.983   -3.653  1.00  21.33 ? 1594 GLN A HB3  1 
ATOM   2078 H  HG2  . GLN A 1 141 ? -18.844 0.739   -2.852  1.00  25.16 ? 1594 GLN A HG2  1 
ATOM   2079 H  HG3  . GLN A 1 141 ? -17.920 0.294   -1.626  1.00  25.16 ? 1594 GLN A HG3  1 
ATOM   2080 H  HE21 . GLN A 1 141 ? -19.480 3.061   -2.980  1.00  34.63 ? 1594 GLN A HE21 1 
ATOM   2081 H  HE22 . GLN A 1 141 ? -19.404 3.946   -1.784  1.00  34.63 ? 1594 GLN A HE22 1 
ATOM   2082 N  N    . THR A 1 142 ? -16.631 -2.110  -2.964  1.00  11.11 ? 1595 THR A N    1 
ATOM   2083 C  CA   . THR A 1 142 ? -16.170 -3.209  -2.129  1.00  11.20 ? 1595 THR A CA   1 
ATOM   2084 C  C    . THR A 1 142 ? -14.853 -3.791  -2.675  1.00  11.49 ? 1595 THR A C    1 
ATOM   2085 O  O    . THR A 1 142 ? -14.058 -4.353  -1.916  1.00  11.81 ? 1595 THR A O    1 
ATOM   2086 C  CB   . THR A 1 142 ? -17.253 -4.305  -2.036  1.00  11.61 ? 1595 THR A CB   1 
ATOM   2087 O  OG1  . THR A 1 142 ? -18.494 -3.707  -1.684  1.00  12.58 ? 1595 THR A OG1  1 
ATOM   2088 C  CG2  . THR A 1 142 ? -16.927 -5.320  -0.980  1.00  12.27 ? 1595 THR A CG2  1 
ATOM   2089 H  H    . THR A 1 142 ? -17.386 -2.246  -3.352  1.00  13.33 ? 1595 THR A H    1 
ATOM   2090 H  HA   . THR A 1 142 ? -16.001 -2.873  -1.224  1.00  13.44 ? 1595 THR A HA   1 
ATOM   2091 H  HB   . THR A 1 142 ? -17.337 -4.758  -2.889  1.00  13.93 ? 1595 THR A HB   1 
ATOM   2092 H  HG1  . THR A 1 142 ? -18.711 -3.158  -2.253  1.00  15.10 ? 1595 THR A HG1  1 
ATOM   2093 H  HG21 . THR A 1 142 ? -16.862 -4.892  -0.123  1.00  14.72 ? 1595 THR A HG21 1 
ATOM   2094 H  HG22 . THR A 1 142 ? -17.615 -5.988  -0.944  1.00  14.72 ? 1595 THR A HG22 1 
ATOM   2095 H  HG23 . THR A 1 142 ? -16.090 -5.745  -1.181  1.00  14.72 ? 1595 THR A HG23 1 
ATOM   2096 N  N    . VAL A 1 143 ? -14.635 -3.707  -3.986  1.00  11.13 ? 1596 VAL A N    1 
ATOM   2097 C  CA   A VAL A 1 143 ? -13.378 -4.188  -4.546  0.31  10.70 ? 1596 VAL A CA   1 
ATOM   2098 C  CA   B VAL A 1 143 ? -13.378 -4.143  -4.600  0.69  11.06 ? 1596 VAL A CA   1 
ATOM   2099 C  C    . VAL A 1 143 ? -12.224 -3.347  -4.001  1.00  10.51 ? 1596 VAL A C    1 
ATOM   2100 O  O    . VAL A 1 143 ? -11.216 -3.902  -3.575  1.00  11.28 ? 1596 VAL A O    1 
ATOM   2101 C  CB   A VAL A 1 143 ? -13.375 -4.236  -6.094  0.31  10.66 ? 1596 VAL A CB   1 
ATOM   2102 C  CB   B VAL A 1 143 ? -13.394 -3.954  -6.131  0.69  12.19 ? 1596 VAL A CB   1 
ATOM   2103 C  CG1  A VAL A 1 143 ? -13.224 -2.850  -6.695  0.31  11.75 ? 1596 VAL A CG1  1 
ATOM   2104 C  CG1  B VAL A 1 143 ? -12.022 -4.296  -6.718  0.69  14.57 ? 1596 VAL A CG1  1 
ATOM   2105 C  CG2  A VAL A 1 143 ? -12.258 -5.138  -6.576  0.31  10.39 ? 1596 VAL A CG2  1 
ATOM   2106 C  CG2  B VAL A 1 143 ? -14.513 -4.785  -6.770  0.69  13.28 ? 1596 VAL A CG2  1 
ATOM   2107 H  H    A VAL A 1 143 ? -15.187 -3.382  -4.560  0.31  13.35 ? 1596 VAL A H    1 
ATOM   2108 H  H    B VAL A 1 143 ? -15.206 -3.397  -4.549  0.69  13.35 ? 1596 VAL A H    1 
ATOM   2109 H  HA   A VAL A 1 143 ? -13.238 -5.106  -4.232  0.31  12.84 ? 1596 VAL A HA   1 
ATOM   2110 H  HA   B VAL A 1 143 ? -13.233 -5.093  -4.407  0.69  13.27 ? 1596 VAL A HA   1 
ATOM   2111 H  HB   A VAL A 1 143 ? -14.226 -4.611  -6.405  0.31  12.79 ? 1596 VAL A HB   1 
ATOM   2112 H  HB   B VAL A 1 143 ? -13.575 -3.011  -6.328  0.69  14.62 ? 1596 VAL A HB   1 
ATOM   2113 H  HG11 A VAL A 1 143 ? -12.394 -2.470  -6.397  0.31  14.10 ? 1596 VAL A HG11 1 
ATOM   2114 H  HG11 B VAL A 1 143 ? -11.813 -5.210  -6.512  0.69  17.49 ? 1596 VAL A HG11 1 
ATOM   2115 H  HG12 A VAL A 1 143 ? -13.227 -2.922  -7.652  0.31  14.10 ? 1596 VAL A HG12 1 
ATOM   2116 H  HG12 B VAL A 1 143 ? -12.050 -4.172  -7.670  0.69  17.49 ? 1596 VAL A HG12 1 
ATOM   2117 H  HG13 A VAL A 1 143 ? -13.958 -2.303  -6.405  0.31  14.10 ? 1596 VAL A HG13 1 
ATOM   2118 H  HG13 B VAL A 1 143 ? -11.363 -3.714  -6.332  0.69  17.49 ? 1596 VAL A HG13 1 
ATOM   2119 H  HG21 A VAL A 1 143 ? -12.398 -6.021  -6.227  0.31  12.46 ? 1596 VAL A HG21 1 
ATOM   2120 H  HG21 B VAL A 1 143 ? -15.356 -4.502  -6.409  0.69  15.93 ? 1596 VAL A HG21 1 
ATOM   2121 H  HG22 A VAL A 1 143 ? -12.267 -5.160  -7.536  0.31  12.46 ? 1596 VAL A HG22 1 
ATOM   2122 H  HG22 B VAL A 1 143 ? -14.499 -4.649  -7.720  0.69  15.93 ? 1596 VAL A HG22 1 
ATOM   2123 H  HG23 A VAL A 1 143 ? -11.420 -4.790  -6.264  0.31  12.46 ? 1596 VAL A HG23 1 
ATOM   2124 H  HG23 B VAL A 1 143 ? -14.365 -5.712  -6.570  0.69  15.93 ? 1596 VAL A HG23 1 
ATOM   2125 N  N    . ALA A 1 144 ? -12.373 -2.022  -3.965  1.00  10.91 ? 1597 ALA A N    1 
ATOM   2126 C  CA   . ALA A 1 144 ? -11.334 -1.179  -3.378  1.00  10.26 ? 1597 ALA A CA   1 
ATOM   2127 C  C    . ALA A 1 144 ? -11.177 -1.474  -1.877  1.00  10.20 ? 1597 ALA A C    1 
ATOM   2128 O  O    . ALA A 1 144 ? -10.049 -1.521  -1.369  1.00  10.84 ? 1597 ALA A O    1 
ATOM   2129 C  CB   . ALA A 1 144 ? -11.655 0.306   -3.597  1.00  10.95 ? 1597 ALA A CB   1 
ATOM   2130 H  H    . ALA A 1 144 ? -13.055 -1.594  -4.269  1.00  13.09 ? 1597 ALA A H    1 
ATOM   2131 H  HA   . ALA A 1 144 ? -10.479 -1.372  -3.817  1.00  12.31 ? 1597 ALA A HA   1 
ATOM   2132 H  HB1  . ALA A 1 144 ? -12.497 0.508   -3.182  1.00  13.14 ? 1597 ALA A HB1  1 
ATOM   2133 H  HB2  . ALA A 1 144 ? -10.959 0.837   -3.203  1.00  13.14 ? 1597 ALA A HB2  1 
ATOM   2134 H  HB3  . ALA A 1 144 ? -11.705 0.479   -4.540  1.00  13.14 ? 1597 ALA A HB3  1 
ATOM   2135 N  N    . ALA A 1 145 ? -12.293 -1.672  -1.166  1.00  9.62  ? 1598 ALA A N    1 
ATOM   2136 C  CA   . ALA A 1 145 ? -12.216 -1.940  0.269   1.00  9.89  ? 1598 ALA A CA   1 
ATOM   2137 C  C    . ALA A 1 145 ? -11.474 -3.247  0.560   1.00  10.32 ? 1598 ALA A C    1 
ATOM   2138 O  O    . ALA A 1 145 ? -10.610 -3.286  1.442   1.00  10.99 ? 1598 ALA A O    1 
ATOM   2139 C  CB   . ALA A 1 145 ? -13.594 -1.974  0.885   1.00  11.01 ? 1598 ALA A CB   1 
ATOM   2140 H  H    . ALA A 1 145 ? -13.091 -1.656  -1.486  1.00  11.54 ? 1598 ALA A H    1 
ATOM   2141 H  HA   . ALA A 1 145 ? -11.717 -1.214  0.697   1.00  11.87 ? 1598 ALA A HA   1 
ATOM   2142 H  HB1  . ALA A 1 145 ? -14.107 -2.667  0.464   1.00  13.21 ? 1598 ALA A HB1  1 
ATOM   2143 H  HB2  . ALA A 1 145 ? -13.511 -2.152  1.825   1.00  13.21 ? 1598 ALA A HB2  1 
ATOM   2144 H  HB3  . ALA A 1 145 ? -14.018 -1.123  0.748   1.00  13.21 ? 1598 ALA A HB3  1 
ATOM   2145 N  N    . VAL A 1 146 ? -11.778 -4.330  -0.165  1.00  9.78  ? 1599 VAL A N    1 
ATOM   2146 C  CA   . VAL A 1 146 ? -11.120 -5.586  0.163   1.00  9.89  ? 1599 VAL A CA   1 
ATOM   2147 C  C    . VAL A 1 146 ? -9.657  -5.535  -0.290  1.00  10.21 ? 1599 VAL A C    1 
ATOM   2148 O  O    . VAL A 1 146 ? -8.798  -6.146  0.344   1.00  11.01 ? 1599 VAL A O    1 
ATOM   2149 C  CB   . VAL A 1 146 ? -11.859 -6.825  -0.415  1.00  10.71 ? 1599 VAL A CB   1 
ATOM   2150 C  CG1  . VAL A 1 146 ? -11.691 -6.946  -1.938  1.00  11.55 ? 1599 VAL A CG1  1 
ATOM   2151 C  CG2  . VAL A 1 146 ? -11.373 -8.084  0.287   1.00  11.59 ? 1599 VAL A CG2  1 
ATOM   2152 H  H    . VAL A 1 146 ? -12.335 -4.360  -0.820  1.00  11.73 ? 1599 VAL A H    1 
ATOM   2153 H  HA   . VAL A 1 146 ? -11.117 -5.683  1.139   1.00  11.87 ? 1599 VAL A HA   1 
ATOM   2154 H  HB   . VAL A 1 146 ? -12.817 -6.733  -0.229  1.00  12.85 ? 1599 VAL A HB   1 
ATOM   2155 H  HG11 . VAL A 1 146 ? -10.757 -7.029  -2.144  1.00  13.86 ? 1599 VAL A HG11 1 
ATOM   2156 H  HG12 . VAL A 1 146 ? -12.164 -7.723  -2.244  1.00  13.86 ? 1599 VAL A HG12 1 
ATOM   2157 H  HG13 . VAL A 1 146 ? -12.049 -6.159  -2.355  1.00  13.86 ? 1599 VAL A HG13 1 
ATOM   2158 H  HG21 . VAL A 1 146 ? -11.556 -8.008  1.226   1.00  13.91 ? 1599 VAL A HG21 1 
ATOM   2159 H  HG22 . VAL A 1 146 ? -11.835 -8.842  -0.077  1.00  13.91 ? 1599 VAL A HG22 1 
ATOM   2160 H  HG23 . VAL A 1 146 ? -10.428 -8.176  0.144   1.00  13.91 ? 1599 VAL A HG23 1 
ATOM   2161 N  N    . LEU A 1 147 ? -9.352  -4.790  -1.356  1.00  10.16 ? 1600 LEU A N    1 
ATOM   2162 C  CA   . LEU A 1 147 ? -7.947  -4.612  -1.739  1.00  10.42 ? 1600 LEU A CA   1 
ATOM   2163 C  C    . LEU A 1 147 ? -7.190  -3.903  -0.618  1.00  10.21 ? 1600 LEU A C    1 
ATOM   2164 O  O    . LEU A 1 147 ? -6.032  -4.217  -0.337  1.00  11.21 ? 1600 LEU A O    1 
ATOM   2165 C  CB   . LEU A 1 147 ? -7.826  -3.816  -3.030  1.00  12.31 ? 1600 LEU A CB   1 
ATOM   2166 C  CG   . LEU A 1 147 ? -7.997  -4.637  -4.295  1.00  16.40 ? 1600 LEU A CG   1 
ATOM   2167 C  CD1  . LEU A 1 147 ? -8.111  -3.776  -5.534  1.00  17.22 ? 1600 LEU A CD1  1 
ATOM   2168 C  CD2  . LEU A 1 147 ? -6.829  -5.598  -4.425  1.00  19.73 ? 1600 LEU A CD2  1 
ATOM   2169 H  H    . LEU A 1 147 ? -9.920  -4.387  -1.860  1.00  12.19 ? 1600 LEU A H    1 
ATOM   2170 H  HA   . LEU A 1 147 ? -7.537  -5.491  -1.880  1.00  12.50 ? 1600 LEU A HA   1 
ATOM   2171 H  HB2  . LEU A 1 147 ? -8.507  -3.125  -3.033  1.00  14.77 ? 1600 LEU A HB2  1 
ATOM   2172 H  HB3  . LEU A 1 147 ? -6.946  -3.407  -3.061  1.00  14.77 ? 1600 LEU A HB3  1 
ATOM   2173 H  HG   . LEU A 1 147 ? -8.809  -5.162  -4.221  1.00  19.68 ? 1600 LEU A HG   1 
ATOM   2174 H  HD11 . LEU A 1 147 ? -7.313  -3.250  -5.623  1.00  20.66 ? 1600 LEU A HD11 1 
ATOM   2175 H  HD12 . LEU A 1 147 ? -8.217  -4.344  -6.300  1.00  20.66 ? 1600 LEU A HD12 1 
ATOM   2176 H  HD13 . LEU A 1 147 ? -8.874  -3.200  -5.444  1.00  20.66 ? 1600 LEU A HD13 1 
ATOM   2177 H  HD21 . LEU A 1 147 ? -6.814  -6.177  -3.659  1.00  23.68 ? 1600 LEU A HD21 1 
ATOM   2178 H  HD22 . LEU A 1 147 ? -6.939  -6.117  -5.226  1.00  23.68 ? 1600 LEU A HD22 1 
ATOM   2179 H  HD23 . LEU A 1 147 ? -6.013  -5.094  -4.471  1.00  23.68 ? 1600 LEU A HD23 1 
ATOM   2180 N  N    . MET A 1 148 ? -7.828  -2.946  0.045   1.00  10.34 ? 1601 MET A N    1 
ATOM   2181 C  CA   . MET A 1 148 ? -7.165  -2.258  1.143   1.00  10.93 ? 1601 MET A CA   1 
ATOM   2182 C  C    . MET A 1 148 ? -6.873  -3.226  2.279   1.00  10.15 ? 1601 MET A C    1 
ATOM   2183 O  O    . MET A 1 148 ? -5.775  -3.225  2.851   1.00  11.44 ? 1601 MET A O    1 
ATOM   2184 C  CB   . MET A 1 148 ? -8.030  -1.098  1.662   1.00  11.32 ? 1601 MET A CB   1 
ATOM   2185 C  CG   . MET A 1 148 ? -7.317  -0.219  2.676   1.00  12.77 ? 1601 MET A CG   1 
ATOM   2186 S  SD   . MET A 1 148 ? -5.948  0.750   1.959   1.00  17.11 ? 1601 MET A SD   1 
ATOM   2187 C  CE   . MET A 1 148 ? -4.534  -0.118  2.605   1.00  18.56 ? 1601 MET A CE   1 
ATOM   2188 H  H    . MET A 1 148 ? -8.630  -2.681  -0.117  1.00  12.40 ? 1601 MET A H    1 
ATOM   2189 H  HA   . MET A 1 148 ? -6.320  -1.882  0.819   1.00  13.12 ? 1601 MET A HA   1 
ATOM   2190 H  HB2  . MET A 1 148 ? -8.288  -0.539  0.912   1.00  13.58 ? 1601 MET A HB2  1 
ATOM   2191 H  HB3  . MET A 1 148 ? -8.822  -1.463  2.088   1.00  13.58 ? 1601 MET A HB3  1 
ATOM   2192 H  HG2  . MET A 1 148 ? -7.956  0.404   3.056   1.00  15.33 ? 1601 MET A HG2  1 
ATOM   2193 H  HG3  . MET A 1 148 ? -6.950  -0.782  3.376   1.00  15.33 ? 1601 MET A HG3  1 
ATOM   2194 H  HE1  . MET A 1 148 ? -4.561  -1.028  2.301   1.00  22.27 ? 1601 MET A HE1  1 
ATOM   2195 H  HE2  . MET A 1 148 ? -3.735  0.310   2.289   1.00  22.27 ? 1601 MET A HE2  1 
ATOM   2196 H  HE3  . MET A 1 148 ? -4.563  -0.091  3.564   1.00  22.27 ? 1601 MET A HE3  1 
ATOM   2197 N  N    . VAL A 1 149 ? -7.855  -4.064  2.611   1.00  10.46 ? 1602 VAL A N    1 
ATOM   2198 C  CA   . VAL A 1 149 ? -7.643  -5.070  3.651   1.00  11.19 ? 1602 VAL A CA   1 
ATOM   2199 C  C    . VAL A 1 149 ? -6.500  -6.013  3.285   1.00  12.44 ? 1602 VAL A C    1 
ATOM   2200 O  O    . VAL A 1 149 ? -5.674  -6.349  4.139   1.00  12.73 ? 1602 VAL A O    1 
ATOM   2201 C  CB   . VAL A 1 149 ? -8.946  -5.833  3.941   1.00  12.00 ? 1602 VAL A CB   1 
ATOM   2202 C  CG1  . VAL A 1 149 ? -8.689  -7.082  4.783   1.00  12.99 ? 1602 VAL A CG1  1 
ATOM   2203 C  CG2  . VAL A 1 149 ? -9.938  -4.897  4.600   1.00  13.10 ? 1602 VAL A CG2  1 
ATOM   2204 H  H    . VAL A 1 149 ? -8.639  -4.073  2.257   1.00  12.55 ? 1602 VAL A H    1 
ATOM   2205 H  HA   . VAL A 1 149 ? -7.386  -4.609  4.477   1.00  13.43 ? 1602 VAL A HA   1 
ATOM   2206 H  HB   . VAL A 1 149 ? -9.334  -6.124  3.090   1.00  14.40 ? 1602 VAL A HB   1 
ATOM   2207 H  HG11 . VAL A 1 149 ? -8.293  -6.821  5.617   1.00  15.58 ? 1602 VAL A HG11 1 
ATOM   2208 H  HG12 . VAL A 1 149 ? -9.524  -7.529  4.942   1.00  15.58 ? 1602 VAL A HG12 1 
ATOM   2209 H  HG13 . VAL A 1 149 ? -8.093  -7.663  4.304   1.00  15.58 ? 1602 VAL A HG13 1 
ATOM   2210 H  HG21 . VAL A 1 149 ? -10.116 -4.163  4.007   1.00  15.72 ? 1602 VAL A HG21 1 
ATOM   2211 H  HG22 . VAL A 1 149 ? -10.750 -5.378  4.779   1.00  15.72 ? 1602 VAL A HG22 1 
ATOM   2212 H  HG23 . VAL A 1 149 ? -9.562  -4.571  5.421   1.00  15.72 ? 1602 VAL A HG23 1 
ATOM   2213 N  N    . ALA A 1 150 ? -6.451  -6.437  2.023   1.00  11.47 ? 1603 ALA A N    1 
ATOM   2214 C  CA   . ALA A 1 150 ? -5.364  -7.293  1.559   1.00  11.94 ? 1603 ALA A CA   1 
ATOM   2215 C  C    . ALA A 1 150 ? -4.006  -6.617  1.724   1.00  12.27 ? 1603 ALA A C    1 
ATOM   2216 O  O    . ALA A 1 150 ? -3.035  -7.264  2.106   1.00  12.68 ? 1603 ALA A O    1 
ATOM   2217 C  CB   . ALA A 1 150 ? -5.592  -7.711  0.105   1.00  11.90 ? 1603 ALA A CB   1 
ATOM   2218 H  H    . ALA A 1 150 ? -7.032  -6.244  1.419   1.00  13.77 ? 1603 ALA A H    1 
ATOM   2219 H  HA   . ALA A 1 150 ? -5.356  -8.108  2.103   1.00  14.33 ? 1603 ALA A HA   1 
ATOM   2220 H  HB1  . ALA A 1 150 ? -5.630  -6.924  -0.444  1.00  14.29 ? 1603 ALA A HB1  1 
ATOM   2221 H  HB2  . ALA A 1 150 ? -4.866  -8.272  -0.176  1.00  14.29 ? 1603 ALA A HB2  1 
ATOM   2222 H  HB3  . ALA A 1 150 ? -6.421  -8.193  0.045   1.00  14.29 ? 1603 ALA A HB3  1 
ATOM   2223 N  N    . GLN A 1 151 ? -3.927  -5.316  1.444   1.00  11.86 ? 1604 GLN A N    1 
ATOM   2224 C  CA   . GLN A 1 151 ? -2.655  -4.624  1.610   1.00  12.39 ? 1604 GLN A CA   1 
ATOM   2225 C  C    . GLN A 1 151 ? -2.275  -4.494  3.082   1.00  12.45 ? 1604 GLN A C    1 
ATOM   2226 O  O    . GLN A 1 151 ? -1.094  -4.617  3.434   1.00  13.00 ? 1604 GLN A O    1 
ATOM   2227 C  CB   . GLN A 1 151 ? -2.677  -3.244  0.968   1.00  13.73 ? 1604 GLN A CB   1 
ATOM   2228 C  CG   . GLN A 1 151 ? -3.007  -3.187  -0.505  1.00  15.92 ? 1604 GLN A CG   1 
ATOM   2229 C  CD   . GLN A 1 151 ? -2.640  -4.428  -1.267  1.00  18.23 ? 1604 GLN A CD   1 
ATOM   2230 O  OE1  . GLN A 1 151 ? -1.448  -4.750  -1.445  1.00  18.38 ? 1604 GLN A OE1  1 
ATOM   2231 N  NE2  . GLN A 1 151 ? -3.668  -5.135  -1.759  1.00  17.73 ? 1604 GLN A NE2  1 
ATOM   2232 H  H    . GLN A 1 151 ? -4.576  -4.826  1.164   1.00  14.23 ? 1604 GLN A H    1 
ATOM   2233 H  HA   . GLN A 1 151 ? -1.954  -5.147  1.167   1.00  14.86 ? 1604 GLN A HA   1 
ATOM   2234 H  HB2  . GLN A 1 151 ? -3.338  -2.705  1.431   1.00  16.48 ? 1604 GLN A HB2  1 
ATOM   2235 H  HB3  . GLN A 1 151 ? -1.801  -2.843  1.082   1.00  16.48 ? 1604 GLN A HB3  1 
ATOM   2236 H  HG2  . GLN A 1 151 ? -3.963  -3.052  -0.604  1.00  19.11 ? 1604 GLN A HG2  1 
ATOM   2237 H  HG3  . GLN A 1 151 ? -2.528  -2.444  -0.902  1.00  19.11 ? 1604 GLN A HG3  1 
ATOM   2238 H  HE21 . GLN A 1 151 ? -4.475  -4.869  -1.629  1.00  21.28 ? 1604 GLN A HE21 1 
ATOM   2239 H  HE22 . GLN A 1 151 ? -3.519  -5.856  -2.205  1.00  21.28 ? 1604 GLN A HE22 1 
ATOM   2240 N  N    . LEU A 1 152 ? -3.260  -4.212  3.932   1.00  12.87 ? 1605 LEU A N    1 
ATOM   2241 C  CA   . LEU A 1 152 ? -2.997  -4.038  5.355   1.00  13.29 ? 1605 LEU A CA   1 
ATOM   2242 C  C    . LEU A 1 152 ? -2.431  -5.325  5.934   1.00  14.71 ? 1605 LEU A C    1 
ATOM   2243 O  O    . LEU A 1 152 ? -1.586  -5.303  6.835   1.00  16.83 ? 1605 LEU A O    1 
ATOM   2244 C  CB   . LEU A 1 152 ? -4.269  -3.608  6.107   1.00  14.33 ? 1605 LEU A CB   1 
ATOM   2245 C  CG   . LEU A 1 152 ? -4.730  -2.172  5.831   1.00  16.73 ? 1605 LEU A CG   1 
ATOM   2246 C  CD1  . LEU A 1 152 ? -6.105  -1.885  6.440   1.00  18.34 ? 1605 LEU A CD1  1 
ATOM   2247 C  CD2  . LEU A 1 152 ? -3.683  -1.186  6.367   1.00  17.99 ? 1605 LEU A CD2  1 
ATOM   2248 H  H    . LEU A 1 152 ? -4.085  -4.117  3.710   1.00  15.44 ? 1605 LEU A H    1 
ATOM   2249 H  HA   . LEU A 1 152 ? -2.325  -3.333  5.470   1.00  15.95 ? 1605 LEU A HA   1 
ATOM   2250 H  HB2  . LEU A 1 152 ? -4.992  -4.202  5.852   1.00  17.20 ? 1605 LEU A HB2  1 
ATOM   2251 H  HB3  . LEU A 1 152 ? -4.105  -3.685  7.059   1.00  17.20 ? 1605 LEU A HB3  1 
ATOM   2252 H  HG   . LEU A 1 152 ? -4.797  -2.042  4.872   1.00  20.07 ? 1605 LEU A HG   1 
ATOM   2253 H  HD11 . LEU A 1 152 ? -6.058  -2.012  7.391   1.00  22.01 ? 1605 LEU A HD11 1 
ATOM   2254 H  HD12 . LEU A 1 152 ? -6.351  -0.978  6.243   1.00  22.01 ? 1605 LEU A HD12 1 
ATOM   2255 H  HD13 . LEU A 1 152 ? -6.747  -2.489  6.060   1.00  22.01 ? 1605 LEU A HD13 1 
ATOM   2256 H  HD21 . LEU A 1 152 ? -2.847  -1.349  5.924   1.00  21.59 ? 1605 LEU A HD21 1 
ATOM   2257 H  HD22 . LEU A 1 152 ? -3.979  -0.290  6.190   1.00  21.59 ? 1605 LEU A HD22 1 
ATOM   2258 H  HD23 . LEU A 1 152 ? -3.585  -1.319  7.312   1.00  21.59 ? 1605 LEU A HD23 1 
ATOM   2259 N  N    . THR A 1 153 ? -2.892  -6.452  5.403   1.00  15.28 ? 1606 THR A N    1 
ATOM   2260 C  CA   . THR A 1 153 ? -2.481  -7.763  5.886   1.00  16.38 ? 1606 THR A CA   1 
ATOM   2261 C  C    . THR A 1 153 ? -1.369  -8.401  5.016   1.00  17.50 ? 1606 THR A C    1 
ATOM   2262 O  O    . THR A 1 153 ? -0.989  -9.539  5.261   1.00  20.13 ? 1606 THR A O    1 
ATOM   2263 C  CB   . THR A 1 153 ? -3.699  -8.702  6.020   1.00  16.49 ? 1606 THR A CB   1 
ATOM   2264 O  OG1  . THR A 1 153 ? -4.324  -8.897  4.755   1.00  16.68 ? 1606 THR A OG1  1 
ATOM   2265 C  CG2  . THR A 1 153 ? -4.724  -8.106  6.945   1.00  17.91 ? 1606 THR A CG2  1 
ATOM   2266 H  H    . THR A 1 153 ? -3.452  -6.484  4.751   1.00  18.33 ? 1606 THR A H    1 
ATOM   2267 H  HA   . THR A 1 153 ? -2.109  -7.649  6.785   1.00  19.65 ? 1606 THR A HA   1 
ATOM   2268 H  HB   . THR A 1 153 ? -3.416  -9.557  6.380   1.00  19.79 ? 1606 THR A HB   1 
ATOM   2269 H  HG1  . THR A 1 153 ? -4.579  -8.177  4.455   1.00  20.01 ? 1606 THR A HG1  1 
ATOM   2270 H  HG21 . THR A 1 153 ? -5.023  -7.261  6.601   1.00  21.49 ? 1606 THR A HG21 1 
ATOM   2271 H  HG22 . THR A 1 153 ? -5.478  -8.696  7.022   1.00  21.49 ? 1606 THR A HG22 1 
ATOM   2272 H  HG23 . THR A 1 153 ? -4.342  -7.972  7.815   1.00  21.49 ? 1606 THR A HG23 1 
ATOM   2273 N  N    . GLN A 1 154 ? -0.897  -7.632  4.023   1.00  16.93 ? 1607 GLN A N    1 
ATOM   2274 C  CA   A GLN A 1 154 ? 0.236   -8.005  3.181   0.47  16.45 ? 1607 GLN A CA   1 
ATOM   2275 C  CA   B GLN A 1 154 ? 0.198   -7.964  3.107   0.53  16.38 ? 1607 GLN A CA   1 
ATOM   2276 C  C    . GLN A 1 154 ? 0.077   -9.345  2.469   1.00  15.49 ? 1607 GLN A C    1 
ATOM   2277 O  O    . GLN A 1 154 ? 0.990   -10.184 2.525   1.00  17.65 ? 1607 GLN A O    1 
ATOM   2278 C  CB   A GLN A 1 154 ? 1.513   -8.067  4.017   0.47  19.03 ? 1607 GLN A CB   1 
ATOM   2279 C  CB   B GLN A 1 154 ? 1.561   -7.758  3.773   0.53  19.07 ? 1607 GLN A CB   1 
ATOM   2280 C  CG   A GLN A 1 154 ? 1.813   -6.817  4.809   0.47  20.74 ? 1607 GLN A CG   1 
ATOM   2281 C  CG   B GLN A 1 154 ? 1.962   -6.282  3.906   0.53  21.66 ? 1607 GLN A CG   1 
ATOM   2282 C  CD   A GLN A 1 154 ? 3.096   -6.947  5.610   0.47  23.60 ? 1607 GLN A CD   1 
ATOM   2283 C  CD   B GLN A 1 154 ? 2.290   -5.608  2.561   0.53  22.64 ? 1607 GLN A CD   1 
ATOM   2284 O  OE1  A GLN A 1 154 ? 3.068   -7.164  6.819   0.47  25.18 ? 1607 GLN A OE1  1 
ATOM   2285 O  OE1  B GLN A 1 154 ? 3.386   -5.780  2.020   0.53  25.76 ? 1607 GLN A OE1  1 
ATOM   2286 N  NE2  A GLN A 1 154 ? 4.229   -6.832  4.932   0.47  25.16 ? 1607 GLN A NE2  1 
ATOM   2287 N  NE2  B GLN A 1 154 ? 1.334   -4.834  2.022   0.53  21.28 ? 1607 GLN A NE2  1 
ATOM   2288 H  H    A GLN A 1 154 ? -1.233  -6.867  3.818   0.47  20.32 ? 1607 GLN A H    1 
ATOM   2289 H  H    B GLN A 1 154 ? -1.227  -6.855  3.855   0.53  20.32 ? 1607 GLN A H    1 
ATOM   2290 H  HA   A GLN A 1 154 ? 0.360   -7.315  2.495   0.47  19.75 ? 1607 GLN A HA   1 
ATOM   2291 H  HA   B GLN A 1 154 ? 0.157   -7.321  2.368   0.53  19.66 ? 1607 GLN A HA   1 
ATOM   2292 H  HB2  A GLN A 1 154 ? 1.435   -8.801  4.646   0.47  22.84 ? 1607 GLN A HB2  1 
ATOM   2293 H  HB2  B GLN A 1 154 ? 1.535   -8.140  4.664   0.53  22.89 ? 1607 GLN A HB2  1 
ATOM   2294 H  HB3  A GLN A 1 154 ? 2.264   -8.224  3.424   0.47  22.84 ? 1607 GLN A HB3  1 
ATOM   2295 H  HB3  B GLN A 1 154 ? 2.239   -8.204  3.242   0.53  22.89 ? 1607 GLN A HB3  1 
ATOM   2296 H  HG2  A GLN A 1 154 ? 1.911   -6.069  4.200   0.47  24.89 ? 1607 GLN A HG2  1 
ATOM   2297 H  HG2  B GLN A 1 154 ? 1.230   -5.794  4.313   0.53  25.99 ? 1607 GLN A HG2  1 
ATOM   2298 H  HG3  A GLN A 1 154 ? 1.085   -6.650  5.429   0.47  24.89 ? 1607 GLN A HG3  1 
ATOM   2299 H  HG3  B GLN A 1 154 ? 2.751   -6.222  4.468   0.53  25.99 ? 1607 GLN A HG3  1 
ATOM   2300 H  HE21 A GLN A 1 154 ? 4.210   -6.691  4.084   0.47  30.20 ? 1607 GLN A HE21 1 
ATOM   2301 H  HE21 B GLN A 1 154 ? 0.582   -4.735  2.428   0.53  25.54 ? 1607 GLN A HE21 1 
ATOM   2302 H  HE22 A GLN A 1 154 ? 4.983   -6.898  5.340   0.47  30.20 ? 1607 GLN A HE22 1 
ATOM   2303 H  HE22 B GLN A 1 154 ? 1.474   -4.438  1.272   0.53  25.54 ? 1607 GLN A HE22 1 
ATOM   2304 N  N    . ARG A 1 155 ? -1.051  -9.552  1.817   1.00  12.69 ? 1608 ARG A N    1 
ATOM   2305 C  CA   . ARG A 1 155 ? -1.248  -10.766 1.054   1.00  12.03 ? 1608 ARG A CA   1 
ATOM   2306 C  C    . ARG A 1 155 ? -2.100  -10.509 -0.174  1.00  11.28 ? 1608 ARG A C    1 
ATOM   2307 O  O    . ARG A 1 155 ? -2.539  -9.375  -0.407  1.00  12.39 ? 1608 ARG A O    1 
ATOM   2308 C  CB   . ARG A 1 155 ? -1.847  -11.866 1.927   1.00  11.33 ? 1608 ARG A CB   1 
ATOM   2309 C  CG   . ARG A 1 155 ? -3.267  -11.599 2.402   1.00  12.35 ? 1608 ARG A CG   1 
ATOM   2310 C  CD   . ARG A 1 155 ? -3.996  -12.914 2.669   1.00  12.91 ? 1608 ARG A CD   1 
ATOM   2311 N  NE   . ARG A 1 155 ? -4.234  -13.587 1.392   1.00  12.84 ? 1608 ARG A NE   1 
ATOM   2312 C  CZ   . ARG A 1 155 ? -4.323  -14.895 1.207   1.00  12.51 ? 1608 ARG A CZ   1 
ATOM   2313 N  NH1  . ARG A 1 155 ? -4.236  -15.738 2.234   1.00  13.14 ? 1608 ARG A NH1  1 
ATOM   2314 N  NH2  . ARG A 1 155 ? -4.484  -15.352 -0.027  1.00  13.84 ? 1608 ARG A NH2  1 
ATOM   2315 H  H    . ARG A 1 155 ? -1.716  -9.007  1.801   1.00  15.23 ? 1608 ARG A H    1 
ATOM   2316 H  HA   . ARG A 1 155 ? -0.374  -11.082 0.743   1.00  14.44 ? 1608 ARG A HA   1 
ATOM   2317 H  HB2  . ARG A 1 155 ? -1.858  -12.692 1.419   1.00  13.59 ? 1608 ARG A HB2  1 
ATOM   2318 H  HB3  . ARG A 1 155 ? -1.290  -11.974 2.713   1.00  13.59 ? 1608 ARG A HB3  1 
ATOM   2319 H  HG2  . ARG A 1 155 ? -3.242  -11.089 3.226   1.00  14.82 ? 1608 ARG A HG2  1 
ATOM   2320 H  HG3  . ARG A 1 155 ? -3.752  -11.113 1.716   1.00  14.82 ? 1608 ARG A HG3  1 
ATOM   2321 H  HD2  . ARG A 1 155 ? -3.447  -13.487 3.227   1.00  15.49 ? 1608 ARG A HD2  1 
ATOM   2322 H  HD3  . ARG A 1 155 ? -4.851  -12.736 3.092   1.00  15.49 ? 1608 ARG A HD3  1 
ATOM   2323 H  HE   . ARG A 1 155 ? -4.324  -13.087 0.698   1.00  15.41 ? 1608 ARG A HE   1 
ATOM   2324 H  HH11 . ARG A 1 155 ? -4.115  -15.436 3.030   1.00  16.61 ? 1608 ARG A HH11 1 
ATOM   2325 H  HH12 . ARG A 1 155 ? -4.301  -16.585 2.102   1.00  16.61 ? 1608 ARG A HH12 1 
ATOM   2326 H  HH21 . ARG A 1 155 ? -4.549  -14.801 -0.684  1.00  15.77 ? 1608 ARG A HH21 1 
ATOM   2327 H  HH22 . ARG A 1 155 ? -4.565  -16.197 -0.165  1.00  15.77 ? 1608 ARG A HH22 1 
ATOM   2328 N  N    . SER A 1 156 ? -2.332  -11.563 -0.961  1.00  11.65 ? 1609 SER A N    1 
ATOM   2329 C  CA   . SER A 1 156 ? -3.068  -11.456 -2.204  1.00  11.39 ? 1609 SER A CA   1 
ATOM   2330 C  C    . SER A 1 156 ? -4.566  -11.651 -1.993  1.00  10.52 ? 1609 SER A C    1 
ATOM   2331 O  O    . SER A 1 156 ? -5.014  -12.150 -0.954  1.00  11.96 ? 1609 SER A O    1 
ATOM   2332 C  CB   . SER A 1 156 ? -2.573  -12.500 -3.195  1.00  12.38 ? 1609 SER A CB   1 
ATOM   2333 O  OG   . SER A 1 156 ? -2.780  -13.827 -2.715  1.00  13.81 ? 1609 SER A OG   1 
ATOM   2334 H  H    . SER A 1 156 ? -2.065  -12.361 -0.785  1.00  13.98 ? 1609 SER A H    1 
ATOM   2335 H  HA   . SER A 1 156 ? -2.924  -10.568 -2.593  1.00  13.67 ? 1609 SER A HA   1 
ATOM   2336 H  HB2  . SER A 1 156 ? -3.053  -12.391 -4.031  1.00  14.85 ? 1609 SER A HB2  1 
ATOM   2337 H  HB3  . SER A 1 156 ? -1.623  -12.365 -3.342  1.00  14.85 ? 1609 SER A HB3  1 
ATOM   2338 H  HG   . SER A 1 156 ? -2.506  -14.370 -3.264  1.00  16.58 ? 1609 SER A HG   1 
ATOM   2339 N  N    . VAL A 1 157 ? -5.331  -11.283 -3.013  1.00  10.91 ? 1610 VAL A N    1 
ATOM   2340 C  CA   . VAL A 1 157 ? -6.751  -11.566 -3.055  1.00  11.26 ? 1610 VAL A CA   1 
ATOM   2341 C  C    . VAL A 1 157 ? -7.172  -11.751 -4.504  1.00  11.41 ? 1610 VAL A C    1 
ATOM   2342 O  O    . VAL A 1 157 ? -6.585  -11.162 -5.412  1.00  10.90 ? 1610 VAL A O    1 
ATOM   2343 C  CB   . VAL A 1 157 ? -7.580  -10.457 -2.354  1.00  11.79 ? 1610 VAL A CB   1 
ATOM   2344 C  CG1  . VAL A 1 157 ? -7.457  -9.101  -3.080  1.00  12.38 ? 1610 VAL A CG1  1 
ATOM   2345 C  CG2  . VAL A 1 157 ? -9.031  -10.853 -2.227  1.00  11.90 ? 1610 VAL A CG2  1 
ATOM   2346 H  H    . VAL A 1 157 ? -5.041  -10.860 -3.704  1.00  13.09 ? 1610 VAL A H    1 
ATOM   2347 H  HA   . VAL A 1 157 ? -6.920  -12.408 -2.584  1.00  13.51 ? 1610 VAL A HA   1 
ATOM   2348 H  HB   . VAL A 1 157 ? -7.229  -10.337 -1.447  1.00  14.15 ? 1610 VAL A HB   1 
ATOM   2349 H  HG11 . VAL A 1 157 ? -7.777  -9.198  -3.979  1.00  14.86 ? 1610 VAL A HG11 1 
ATOM   2350 H  HG12 . VAL A 1 157 ? -7.984  -8.449  -2.613  1.00  14.86 ? 1610 VAL A HG12 1 
ATOM   2351 H  HG13 . VAL A 1 157 ? -6.535  -8.834  -3.087  1.00  14.86 ? 1610 VAL A HG13 1 
ATOM   2352 H  HG21 . VAL A 1 157 ? -9.090  -11.658 -1.708  1.00  14.28 ? 1610 VAL A HG21 1 
ATOM   2353 H  HG22 . VAL A 1 157 ? -9.510  -10.145 -1.790  1.00  14.28 ? 1610 VAL A HG22 1 
ATOM   2354 H  HG23 . VAL A 1 157 ? -9.392  -11.001 -3.104  1.00  14.28 ? 1610 VAL A HG23 1 
ATOM   2355 N  N    . HIS A 1 158 ? -8.186  -12.584 -4.705  1.00  10.31 ? 1611 HIS A N    1 
ATOM   2356 C  CA   . HIS A 1 158 ? -8.767  -12.829 -6.015  1.00  9.58  ? 1611 HIS A CA   1 
ATOM   2357 C  C    . HIS A 1 158 ? -10.205 -12.307 -5.996  1.00  10.31 ? 1611 HIS A C    1 
ATOM   2358 O  O    . HIS A 1 158 ? -10.984 -12.654 -5.104  1.00  11.44 ? 1611 HIS A O    1 
ATOM   2359 C  CB   . HIS A 1 158 ? -8.750  -14.336 -6.309  1.00  10.04 ? 1611 HIS A CB   1 
ATOM   2360 C  CG   . HIS A 1 158 ? -9.369  -14.711 -7.612  1.00  10.99 ? 1611 HIS A CG   1 
ATOM   2361 N  ND1  . HIS A 1 158 ? -8.696  -14.658 -8.822  1.00  11.36 ? 1611 HIS A ND1  1 
ATOM   2362 C  CD2  . HIS A 1 158 ? -10.617 -15.164 -7.896  1.00  11.85 ? 1611 HIS A CD2  1 
ATOM   2363 C  CE1  . HIS A 1 158 ? -9.496  -15.084 -9.778  1.00  12.05 ? 1611 HIS A CE1  1 
ATOM   2364 N  NE2  . HIS A 1 158 ? -10.660 -15.398 -9.252  1.00  12.73 ? 1611 HIS A NE2  1 
ATOM   2365 H  H    . HIS A 1 158 ? -8.565  -13.033 -4.077  1.00  12.38 ? 1611 HIS A H    1 
ATOM   2366 H  HA   . HIS A 1 158 ? -8.259  -12.356 -6.707  1.00  11.50 ? 1611 HIS A HA   1 
ATOM   2367 H  HB2  . HIS A 1 158 ? -7.829  -14.641 -6.321  1.00  12.04 ? 1611 HIS A HB2  1 
ATOM   2368 H  HB3  . HIS A 1 158 ? -9.238  -14.795 -5.607  1.00  12.04 ? 1611 HIS A HB3  1 
ATOM   2369 H  HD1  . HIS A 1 158 ? -7.879  -14.412 -8.928  1.00  13.63 ? 1611 HIS A HD1  1 
ATOM   2370 H  HD2  . HIS A 1 158 ? -11.302 -15.315 -7.287  1.00  14.22 ? 1611 HIS A HD2  1 
ATOM   2371 H  HE1  . HIS A 1 158 ? -9.278  -15.136 -10.680 1.00  14.46 ? 1611 HIS A HE1  1 
ATOM   2372 H  HE2  . HIS A 1 158 ? -11.345 -15.681 -9.688  1.00  15.27 ? 1611 HIS A HE2  1 
ATOM   2373 N  N    . ILE A 1 159 ? -10.544 -11.476 -6.974  1.00  9.74  ? 1612 ILE A N    1 
ATOM   2374 C  CA   . ILE A 1 159 ? -11.871 -10.881 -7.047  1.00  9.48  ? 1612 ILE A CA   1 
ATOM   2375 C  C    . ILE A 1 159 ? -12.760 -11.677 -7.996  1.00  9.93  ? 1612 ILE A C    1 
ATOM   2376 O  O    . ILE A 1 159 ? -12.434 -11.862 -9.173  1.00  11.16 ? 1612 ILE A O    1 
ATOM   2377 C  CB   . ILE A 1 159 ? -11.799 -9.423  -7.545  1.00  10.44 ? 1612 ILE A CB   1 
ATOM   2378 C  CG1  . ILE A 1 159 ? -10.781 -8.613  -6.732  1.00  11.98 ? 1612 ILE A CG1  1 
ATOM   2379 C  CG2  . ILE A 1 159 ? -13.188 -8.793  -7.532  1.00  11.04 ? 1612 ILE A CG2  1 
ATOM   2380 C  CD1  . ILE A 1 159 ? -11.103 -8.480  -5.255  1.00  12.74 ? 1612 ILE A CD1  1 
ATOM   2381 H  H    . ILE A 1 159 ? -10.019 -11.239 -7.612  1.00  11.69 ? 1612 ILE A H    1 
ATOM   2382 H  HA   . ILE A 1 159 ? -12.281 -10.886 -6.158  1.00  11.38 ? 1612 ILE A HA   1 
ATOM   2383 H  HB   . ILE A 1 159 ? -11.493 -9.440  -8.465  1.00  12.53 ? 1612 ILE A HB   1 
ATOM   2384 H  HG12 . ILE A 1 159 ? -9.915  -9.043  -6.805  1.00  14.37 ? 1612 ILE A HG12 1 
ATOM   2385 H  HG13 . ILE A 1 159 ? -10.732 -7.717  -7.102  1.00  14.37 ? 1612 ILE A HG13 1 
ATOM   2386 H  HG21 . ILE A 1 159 ? -13.529 -8.806  -6.635  1.00  13.25 ? 1612 ILE A HG21 1 
ATOM   2387 H  HG22 . ILE A 1 159 ? -13.123 -7.887  -7.845  1.00  13.25 ? 1612 ILE A HG22 1 
ATOM   2388 H  HG23 . ILE A 1 159 ? -13.765 -9.298  -8.110  1.00  13.25 ? 1612 ILE A HG23 1 
ATOM   2389 H  HD11 . ILE A 1 159 ? -11.141 -9.357  -4.864  1.00  15.29 ? 1612 ILE A HD11 1 
ATOM   2390 H  HD12 . ILE A 1 159 ? -10.416 -7.962  -4.830  1.00  15.29 ? 1612 ILE A HD12 1 
ATOM   2391 H  HD13 . ILE A 1 159 ? -11.951 -8.042  -5.158  1.00  15.29 ? 1612 ILE A HD13 1 
ATOM   2392 N  N    . CYS A 1 160 ? -13.877 -12.158 -7.469  1.00  9.88  ? 1613 CYS A N    1 
ATOM   2393 C  CA   . CYS A 1 160 ? -14.836 -12.930 -8.255  1.00  10.72 ? 1613 CYS A CA   1 
ATOM   2394 C  C    . CYS A 1 160 ? -15.595 -12.038 -9.228  1.00  10.56 ? 1613 CYS A C    1 
ATOM   2395 O  O    . CYS A 1 160 ? -15.714 -10.822 -9.023  1.00  12.33 ? 1613 CYS A O    1 
ATOM   2396 C  CB   . CYS A 1 160 ? -15.832 -13.651 -7.336  1.00  11.73 ? 1613 CYS A CB   1 
ATOM   2397 S  SG   . CYS A 1 160 ? -15.033 -14.893 -6.279  1.00  13.09 ? 1613 CYS A SG   1 
ATOM   2398 H  H    . CYS A 1 160 ? -14.108 -12.050 -6.647  1.00  11.86 ? 1613 CYS A H    1 
ATOM   2399 H  HA   . CYS A 1 160 ? -14.354 -13.607 -8.774  1.00  12.86 ? 1613 CYS A HA   1 
ATOM   2400 H  HB2  . CYS A 1 160 ? -16.261 -12.998 -6.762  1.00  14.08 ? 1613 CYS A HB2  1 
ATOM   2401 H  HB3  . CYS A 1 160 ? -16.495 -14.102 -7.881  1.00  14.08 ? 1613 CYS A HB3  1 
ATOM   2402 N  N    . HIS A 1 161 ? -16.101 -12.677 -10.286 1.00  10.74 ? 1614 HIS A N    1 
ATOM   2403 C  CA   . HIS A 1 161 ? -17.007 -12.090 -11.280 1.00  10.14 ? 1614 HIS A CA   1 
ATOM   2404 C  C    . HIS A 1 161 ? -16.982 -10.557 -11.361 1.00  10.82 ? 1614 HIS A C    1 
ATOM   2405 O  O    . HIS A 1 161 ? -17.883 -9.854  -10.882 1.00  12.61 ? 1614 HIS A O    1 
ATOM   2406 C  CB   . HIS A 1 161 ? -18.443 -12.611 -11.054 1.00  11.64 ? 1614 HIS A CB   1 
ATOM   2407 C  CG   . HIS A 1 161 ? -18.843 -12.661 -9.614  1.00  11.02 ? 1614 HIS A CG   1 
ATOM   2408 N  ND1  . HIS A 1 161 ? -18.692 -11.582 -8.769  1.00  11.44 ? 1614 HIS A ND1  1 
ATOM   2409 C  CD2  . HIS A 1 161 ? -19.383 -13.655 -8.865  1.00  10.81 ? 1614 HIS A CD2  1 
ATOM   2410 C  CE1  . HIS A 1 161 ? -19.124 -11.907 -7.563  1.00  11.20 ? 1614 HIS A CE1  1 
ATOM   2411 N  NE2  . HIS A 1 161 ? -19.550 -13.156 -7.592  1.00  11.09 ? 1614 HIS A NE2  1 
ATOM   2412 H  H    . HIS A 1 161 ? -15.921 -13.500 -10.457 1.00  12.88 ? 1614 HIS A H    1 
ATOM   2413 H  HA   . HIS A 1 161 ? -16.728 -12.418 -12.160 1.00  12.17 ? 1614 HIS A HA   1 
ATOM   2414 H  HB2  . HIS A 1 161 ? -19.065 -12.027 -11.515 1.00  13.97 ? 1614 HIS A HB2  1 
ATOM   2415 H  HB3  . HIS A 1 161 ? -18.510 -13.511 -11.411 1.00  13.97 ? 1614 HIS A HB3  1 
ATOM   2416 H  HD1  . HIS A 1 161 ? -18.369 -10.817 -8.991  1.00  13.73 ? 1614 HIS A HD1  1 
ATOM   2417 H  HD2  . HIS A 1 161 ? -19.603 -14.510 -9.157  1.00  12.97 ? 1614 HIS A HD2  1 
ATOM   2418 H  HE1  . HIS A 1 161 ? -19.128 -11.349 -6.819  1.00  13.44 ? 1614 HIS A HE1  1 
ATOM   2419 N  N    . VAL A 1 162 ? -15.929 -10.046 -11.978 1.00  10.70 ? 1615 VAL A N    1 
ATOM   2420 C  CA   . VAL A 1 162 ? -15.840 -8.620  -12.213 1.00  10.64 ? 1615 VAL A CA   1 
ATOM   2421 C  C    . VAL A 1 162 ? -16.838 -8.288  -13.335 1.00  11.04 ? 1615 VAL A C    1 
ATOM   2422 O  O    . VAL A 1 162 ? -16.839 -8.934  -14.396 1.00  12.10 ? 1615 VAL A O    1 
ATOM   2423 C  CB   . VAL A 1 162 ? -14.400 -8.226  -12.587 1.00  11.46 ? 1615 VAL A CB   1 
ATOM   2424 C  CG1  . VAL A 1 162 ? -14.333 -6.775  -13.045 1.00  12.49 ? 1615 VAL A CG1  1 
ATOM   2425 C  CG2  . VAL A 1 162 ? -13.440 -8.487  -11.405 1.00  12.04 ? 1615 VAL A CG2  1 
ATOM   2426 H  H    . VAL A 1 162 ? -15.259 -10.501 -12.267 1.00  12.84 ? 1615 VAL A H    1 
ATOM   2427 H  HA   . VAL A 1 162 ? -16.102 -8.133  -11.403 1.00  12.77 ? 1615 VAL A HA   1 
ATOM   2428 H  HB   . VAL A 1 162 ? -14.107 -8.786  -13.336 1.00  13.75 ? 1615 VAL A HB   1 
ATOM   2429 H  HG11 . VAL A 1 162 ? -14.637 -6.209  -12.332 1.00  14.99 ? 1615 VAL A HG11 1 
ATOM   2430 H  HG12 . VAL A 1 162 ? -13.425 -6.560  -13.270 1.00  14.99 ? 1615 VAL A HG12 1 
ATOM   2431 H  HG13 . VAL A 1 162 ? -14.897 -6.664  -13.814 1.00  14.99 ? 1615 VAL A HG13 1 
ATOM   2432 H  HG21 . VAL A 1 162 ? -13.463 -9.421  -11.184 1.00  14.45 ? 1615 VAL A HG21 1 
ATOM   2433 H  HG22 . VAL A 1 162 ? -12.551 -8.233  -11.663 1.00  14.45 ? 1615 VAL A HG22 1 
ATOM   2434 H  HG23 . VAL A 1 162 ? -13.724 -7.965  -10.651 1.00  14.45 ? 1615 VAL A HG23 1 
ATOM   2435 N  N    . ALA A 1 163 ? -17.672 -7.272  -13.112 1.00  11.16 ? 1616 ALA A N    1 
ATOM   2436 C  CA   . ALA A 1 163 ? -18.859 -7.048  -13.956 1.00  10.97 ? 1616 ALA A CA   1 
ATOM   2437 C  C    . ALA A 1 163 ? -18.996 -5.634  -14.508 1.00  12.35 ? 1616 ALA A C    1 
ATOM   2438 O  O    . ALA A 1 163 ? -19.864 -5.378  -15.327 1.00  13.62 ? 1616 ALA A O    1 
ATOM   2439 C  CB   . ALA A 1 163 ? -20.115 -7.377  -13.169 1.00  12.41 ? 1616 ALA A CB   1 
ATOM   2440 H  H    . ALA A 1 163 ? -17.577 -6.696  -12.481 1.00  13.40 ? 1616 ALA A H    1 
ATOM   2441 H  HA   . ALA A 1 163 ? -18.818 -7.661  -14.719 1.00  13.17 ? 1616 ALA A HA   1 
ATOM   2442 H  HB1  . ALA A 1 163 ? -20.157 -6.809  -12.396 1.00  14.89 ? 1616 ALA A HB1  1 
ATOM   2443 H  HB2  . ALA A 1 163 ? -20.881 -7.228  -13.727 1.00  14.89 ? 1616 ALA A HB2  1 
ATOM   2444 H  HB3  . ALA A 1 163 ? -20.081 -8.298  -12.898 1.00  14.89 ? 1616 ALA A HB3  1 
ATOM   2445 N  N    . ARG A 1 164 ? -18.142 -4.728  -14.052 1.00  12.04 ? 1617 ARG A N    1 
ATOM   2446 C  CA   A ARG A 1 164 ? -18.299 -3.313  -14.340 0.65  11.84 ? 1617 ARG A CA   1 
ATOM   2447 C  CA   B ARG A 1 164 ? -18.294 -3.305  -14.351 0.35  12.35 ? 1617 ARG A CA   1 
ATOM   2448 C  C    . ARG A 1 164 ? -17.009 -2.663  -14.817 1.00  11.73 ? 1617 ARG A C    1 
ATOM   2449 O  O    . ARG A 1 164 ? -15.914 -3.038  -14.383 1.00  11.93 ? 1617 ARG A O    1 
ATOM   2450 C  CB   A ARG A 1 164 ? -18.756 -2.584  -13.075 0.65  12.81 ? 1617 ARG A CB   1 
ATOM   2451 C  CB   B ARG A 1 164 ? -18.728 -2.527  -13.108 0.35  13.97 ? 1617 ARG A CB   1 
ATOM   2452 C  CG   A ARG A 1 164 ? -20.140 -2.943  -12.588 0.65  13.68 ? 1617 ARG A CG   1 
ATOM   2453 C  CG   B ARG A 1 164 ? -19.887 -3.101  -12.370 0.35  15.45 ? 1617 ARG A CG   1 
ATOM   2454 C  CD   A ARG A 1 164 ? -20.364 -2.316  -11.215 0.65  14.00 ? 1617 ARG A CD   1 
ATOM   2455 C  CD   B ARG A 1 164 ? -21.224 -2.636  -12.898 0.35  16.24 ? 1617 ARG A CD   1 
ATOM   2456 N  NE   A ARG A 1 164 ? -21.715 -2.556  -10.748 0.65  13.46 ? 1617 ARG A NE   1 
ATOM   2457 N  NE   B ARG A 1 164 ? -22.225 -3.385  -12.167 0.35  16.99 ? 1617 ARG A NE   1 
ATOM   2458 C  CZ   A ARG A 1 164 ? -22.124 -3.599  -10.035 0.65  12.42 ? 1617 ARG A CZ   1 
ATOM   2459 C  CZ   B ARG A 1 164 ? -22.820 -4.473  -12.630 0.35  14.54 ? 1617 ARG A CZ   1 
ATOM   2460 N  NH1  A ARG A 1 164 ? -21.289 -4.566  -9.627  0.65  14.28 ? 1617 ARG A NH1  1 
ATOM   2461 N  NH1  B ARG A 1 164 ? -22.615 -4.885  -13.872 0.35  18.45 ? 1617 ARG A NH1  1 
ATOM   2462 N  NH2  A ARG A 1 164 ? -23.406 -3.659  -9.714  0.65  10.88 ? 1617 ARG A NH2  1 
ATOM   2463 N  NH2  B ARG A 1 164 ? -23.663 -5.129  -11.853 0.35  6.76  ? 1617 ARG A NH2  1 
ATOM   2464 H  H    A ARG A 1 164 ? -17.456 -4.912  -13.567 0.65  14.45 ? 1617 ARG A H    1 
ATOM   2465 H  H    B ARG A 1 164 ? -17.459 -4.911  -13.562 0.35  14.45 ? 1617 ARG A H    1 
ATOM   2466 H  HA   A ARG A 1 164 ? -18.982 -3.193  -15.032 0.65  14.21 ? 1617 ARG A HA   1 
ATOM   2467 H  HA   B ARG A 1 164 ? -18.974 -3.186  -15.047 0.35  14.83 ? 1617 ARG A HA   1 
ATOM   2468 H  HB2  A ARG A 1 164 ? -18.134 -2.790  -12.360 0.65  15.38 ? 1617 ARG A HB2  1 
ATOM   2469 H  HB2  B ARG A 1 164 ? -17.980 -2.491  -12.492 0.35  16.77 ? 1617 ARG A HB2  1 
ATOM   2470 H  HB3  A ARG A 1 164 ? -18.747 -1.630  -13.249 0.65  15.38 ? 1617 ARG A HB3  1 
ATOM   2471 H  HB3  B ARG A 1 164 ? -18.970 -1.628  -13.377 0.35  16.77 ? 1617 ARG A HB3  1 
ATOM   2472 H  HG2  A ARG A 1 164 ? -20.804 -2.593  -13.203 0.65  16.42 ? 1617 ARG A HG2  1 
ATOM   2473 H  HG2  B ARG A 1 164 ? -19.859 -4.068  -12.443 0.35  18.54 ? 1617 ARG A HG2  1 
ATOM   2474 H  HG3  A ARG A 1 164 ? -20.220 -3.906  -12.508 0.65  16.42 ? 1617 ARG A HG3  1 
ATOM   2475 H  HG3  B ARG A 1 164 ? -19.827 -2.839  -11.438 0.35  18.54 ? 1617 ARG A HG3  1 
ATOM   2476 H  HD2  A ARG A 1 164 ? -19.747 -2.708  -10.577 0.65  16.80 ? 1617 ARG A HD2  1 
ATOM   2477 H  HD2  B ARG A 1 164 ? -21.343 -1.689  -12.726 0.35  19.48 ? 1617 ARG A HD2  1 
ATOM   2478 H  HD3  A ARG A 1 164 ? -20.227 -1.357  -11.272 0.65  16.80 ? 1617 ARG A HD3  1 
ATOM   2479 H  HD3  B ARG A 1 164 ? -21.301 -2.836  -13.844 0.35  19.48 ? 1617 ARG A HD3  1 
ATOM   2480 H  HE   A ARG A 1 164 ? -22.308 -1.967  -10.952 0.65  16.16 ? 1617 ARG A HE   1 
ATOM   2481 H  HE   B ARG A 1 164 ? -22.401 -3.142  -11.361 0.35  20.39 ? 1617 ARG A HE   1 
ATOM   2482 H  HH11 A ARG A 1 164 ? -20.456 -4.532  -9.837  0.65  13.06 ? 1617 ARG A HH11 1 
ATOM   2483 H  HH11 B ARG A 1 164 ? -22.053 -4.471  -14.375 0.35  8.12  ? 1617 ARG A HH11 1 
ATOM   2484 H  HH12 A ARG A 1 164 ? -21.589 -5.225  -9.162  0.65  13.06 ? 1617 ARG A HH12 1 
ATOM   2485 H  HH12 B ARG A 1 164 ? -23.022 -5.583  -14.166 0.35  8.12  ? 1617 ARG A HH12 1 
ATOM   2486 H  HH21 A ARG A 1 164 ? -23.943 -3.038  -9.968  0.65  17.14 ? 1617 ARG A HH21 1 
ATOM   2487 H  HH21 B ARG A 1 164 ? -23.818 -4.849  -11.055 0.35  22.14 ? 1617 ARG A HH21 1 
ATOM   2488 H  HH22 A ARG A 1 164 ? -23.702 -4.316  -9.243  0.65  17.14 ? 1617 ARG A HH22 1 
ATOM   2489 H  HH22 B ARG A 1 164 ? -24.088 -5.811  -12.159 0.35  22.14 ? 1617 ARG A HH22 1 
ATOM   2490 N  N    . LYS A 1 165 ? -17.162 -1.636  -15.652 1.00  11.84 ? 1618 LYS A N    1 
ATOM   2491 C  CA   . LYS A 1 165 ? -16.048 -0.779  -16.028 1.00  12.33 ? 1618 LYS A CA   1 
ATOM   2492 C  C    . LYS A 1 165 ? -15.330 -0.263  -14.777 1.00  13.32 ? 1618 LYS A C    1 
ATOM   2493 O  O    . LYS A 1 165 ? -14.101 -0.312  -14.690 1.00  12.52 ? 1618 LYS A O    1 
ATOM   2494 C  CB   . LYS A 1 165 ? -16.553 0.371   -16.887 1.00  13.67 ? 1618 LYS A CB   1 
ATOM   2495 C  CG   . LYS A 1 165 ? -15.489 1.378   -17.262 1.00  16.62 ? 1618 LYS A CG   1 
ATOM   2496 C  CD   . LYS A 1 165 ? -16.066 2.444   -18.170 1.00  20.18 ? 1618 LYS A CD   1 
ATOM   2497 C  CE   . LYS A 1 165 ? -15.012 3.393   -18.687 1.00  26.05 ? 1618 LYS A CE   1 
ATOM   2498 N  NZ   . LYS A 1 165 ? -15.611 4.471   -19.547 1.00  29.65 ? 1618 LYS A NZ   1 
ATOM   2499 H  H    . LYS A 1 165 ? -17.909 -1.416  -16.015 1.00  14.20 ? 1618 LYS A H    1 
ATOM   2500 H  HA   . LYS A 1 165 ? -15.406 -1.297  -16.557 1.00  14.79 ? 1618 LYS A HA   1 
ATOM   2501 H  HB2  . LYS A 1 165 ? -16.919 0.008   -17.709 1.00  16.41 ? 1618 LYS A HB2  1 
ATOM   2502 H  HB3  . LYS A 1 165 ? -17.247 0.842   -16.400 1.00  16.41 ? 1618 LYS A HB3  1 
ATOM   2503 H  HG2  . LYS A 1 165 ? -15.152 1.806   -16.460 1.00  19.95 ? 1618 LYS A HG2  1 
ATOM   2504 H  HG3  . LYS A 1 165 ? -14.771 0.928   -17.734 1.00  19.95 ? 1618 LYS A HG3  1 
ATOM   2505 H  HD2  . LYS A 1 165 ? -16.487 2.017   -18.932 1.00  24.21 ? 1618 LYS A HD2  1 
ATOM   2506 H  HD3  . LYS A 1 165 ? -16.720 2.962   -17.674 1.00  24.21 ? 1618 LYS A HD3  1 
ATOM   2507 H  HE2  . LYS A 1 165 ? -14.567 3.815   -17.937 1.00  31.26 ? 1618 LYS A HE2  1 
ATOM   2508 H  HE3  . LYS A 1 165 ? -14.372 2.898   -19.222 1.00  31.26 ? 1618 LYS A HE3  1 
ATOM   2509 H  HZ1  . LYS A 1 165 ? -16.201 4.943   -19.076 1.00  35.58 ? 1618 LYS A HZ1  1 
ATOM   2510 H  HZ2  . LYS A 1 165 ? -14.972 5.017   -19.839 1.00  35.58 ? 1618 LYS A HZ2  1 
ATOM   2511 H  HZ3  . LYS A 1 165 ? -16.024 4.108   -20.247 1.00  35.58 ? 1618 LYS A HZ3  1 
ATOM   2512 N  N    . GLU A 1 166 ? -16.092 0.216   -13.802 1.00  12.72 ? 1619 GLU A N    1 
ATOM   2513 C  CA   . GLU A 1 166 ? -15.519 0.704   -12.553 1.00  13.00 ? 1619 GLU A CA   1 
ATOM   2514 C  C    . GLU A 1 166 ? -14.565 -0.293  -11.897 1.00  12.26 ? 1619 GLU A C    1 
ATOM   2515 O  O    . GLU A 1 166 ? -13.478 0.060   -11.431 1.00  13.83 ? 1619 GLU A O    1 
ATOM   2516 C  CB   . GLU A 1 166 ? -16.681 1.024   -11.601 1.00  16.95 ? 1619 GLU A CB   1 
ATOM   2517 C  CG   . GLU A 1 166 ? -16.300 1.271   -10.181 1.00  17.91 ? 1619 GLU A CG   1 
ATOM   2518 C  CD   . GLU A 1 166 ? -17.512 1.523   -9.281  1.00  17.71 ? 1619 GLU A CD   1 
ATOM   2519 O  OE1  . GLU A 1 166 ? -18.663 1.173   -9.652  1.00  19.94 ? 1619 GLU A OE1  1 
ATOM   2520 O  OE2  . GLU A 1 166 ? -17.305 2.052   -8.174  1.00  18.43 ? 1619 GLU A OE2  1 
ATOM   2521 H  H    . GLU A 1 166 ? -16.949 0.269   -13.838 1.00  15.27 ? 1619 GLU A H    1 
ATOM   2522 H  HA   . GLU A 1 166 ? -15.025 1.533   -12.725 1.00  15.59 ? 1619 GLU A HA   1 
ATOM   2523 H  HB2  . GLU A 1 166 ? -17.131 1.820   -11.924 1.00  20.34 ? 1619 GLU A HB2  1 
ATOM   2524 H  HB3  . GLU A 1 166 ? -17.299 0.277   -11.611 1.00  20.34 ? 1619 GLU A HB3  1 
ATOM   2525 H  HG2  . GLU A 1 166 ? -15.829 0.494   -9.840  1.00  21.49 ? 1619 GLU A HG2  1 
ATOM   2526 H  HG3  . GLU A 1 166 ? -15.726 2.052   -10.139 1.00  21.49 ? 1619 GLU A HG3  1 
ATOM   2527 N  N    . GLU A 1 167 ? -14.986 -1.548  -11.856 1.00  11.30 ? 1620 GLU A N    1 
ATOM   2528 C  CA   . GLU A 1 167 ? -14.244 -2.582  -11.148 1.00  10.51 ? 1620 GLU A CA   1 
ATOM   2529 C  C    . GLU A 1 167 ? -13.003 -3.002  -11.916 1.00  10.31 ? 1620 GLU A C    1 
ATOM   2530 O  O    . GLU A 1 167 ? -11.920 -3.117  -11.325 1.00  11.75 ? 1620 GLU A O    1 
ATOM   2531 C  CB   . GLU A 1 167 ? -15.149 -3.790  -10.922 1.00  12.00 ? 1620 GLU A CB   1 
ATOM   2532 C  CG   . GLU A 1 167 ? -16.355 -3.505  -10.018 1.00  12.01 ? 1620 GLU A CG   1 
ATOM   2533 C  CD   . GLU A 1 167 ? -17.487 -4.522  -10.148 1.00  13.07 ? 1620 GLU A CD   1 
ATOM   2534 O  OE1  . GLU A 1 167 ? -17.456 -5.333  -11.096 1.00  13.99 ? 1620 GLU A OE1  1 
ATOM   2535 O  OE2  . GLU A 1 167 ? -18.441 -4.458  -9.328  1.00  13.97 ? 1620 GLU A OE2  1 
ATOM   2536 H  H    . GLU A 1 167 ? -15.705 -1.830  -12.235 1.00  13.56 ? 1620 GLU A H    1 
ATOM   2537 H  HA   . GLU A 1 167 ? -13.964 -2.239  -10.274 1.00  12.61 ? 1620 GLU A HA   1 
ATOM   2538 H  HB2  . GLU A 1 167 ? -15.487 -4.091  -11.780 1.00  14.41 ? 1620 GLU A HB2  1 
ATOM   2539 H  HB3  . GLU A 1 167 ? -14.629 -4.496  -10.508 1.00  14.41 ? 1620 GLU A HB3  1 
ATOM   2540 H  HG2  . GLU A 1 167 ? -16.059 -3.509  -9.094  1.00  14.41 ? 1620 GLU A HG2  1 
ATOM   2541 H  HG3  . GLU A 1 167 ? -16.714 -2.633  -10.244 1.00  14.41 ? 1620 GLU A HG3  1 
ATOM   2542 N  N    . ILE A 1 168 ? -13.129 -3.208  -13.223 1.00  10.65 ? 1621 ILE A N    1 
ATOM   2543 C  CA   . ILE A 1 168 ? -11.980 -3.651  -14.000 1.00  10.76 ? 1621 ILE A CA   1 
ATOM   2544 C  C    . ILE A 1 168 ? -10.917 -2.540  -14.052 1.00  10.65 ? 1621 ILE A C    1 
ATOM   2545 O  O    . ILE A 1 168 ? -9.727  -2.834  -14.029 1.00  11.99 ? 1621 ILE A O    1 
ATOM   2546 C  CB   . ILE A 1 168 ? -12.362 -4.169  -15.406 1.00  11.23 ? 1621 ILE A CB   1 
ATOM   2547 C  CG1  . ILE A 1 168 ? -11.261 -5.097  -15.963 1.00  12.09 ? 1621 ILE A CG1  1 
ATOM   2548 C  CG2  . ILE A 1 168 ? -12.673 -3.029  -16.357 1.00  12.21 ? 1621 ILE A CG2  1 
ATOM   2549 C  CD1  . ILE A 1 168 ? -11.123 -6.441  -15.246 1.00  14.00 ? 1621 ILE A CD1  1 
ATOM   2550 H  H    . ILE A 1 168 ? -13.853 -3.102  -13.675 1.00  12.78 ? 1621 ILE A H    1 
ATOM   2551 H  HA   . ILE A 1 168 ? -11.574 -4.406  -13.525 1.00  12.91 ? 1621 ILE A HA   1 
ATOM   2552 H  HB   . ILE A 1 168 ? -13.170 -4.698  -15.312 1.00  13.47 ? 1621 ILE A HB   1 
ATOM   2553 H  HG12 . ILE A 1 168 ? -11.457 -5.282  -16.895 1.00  14.51 ? 1621 ILE A HG12 1 
ATOM   2554 H  HG13 . ILE A 1 168 ? -10.409 -4.640  -15.894 1.00  14.51 ? 1621 ILE A HG13 1 
ATOM   2555 H  HG21 . ILE A 1 168 ? -11.897 -2.469  -16.437 1.00  14.66 ? 1621 ILE A HG21 1 
ATOM   2556 H  HG22 . ILE A 1 168 ? -12.904 -3.393  -17.215 1.00  14.66 ? 1621 ILE A HG22 1 
ATOM   2557 H  HG23 . ILE A 1 168 ? -13.409 -2.522  -16.007 1.00  14.66 ? 1621 ILE A HG23 1 
ATOM   2558 H  HD11 . ILE A 1 168 ? -11.953 -6.919  -15.316 1.00  16.80 ? 1621 ILE A HD11 1 
ATOM   2559 H  HD12 . ILE A 1 168 ? -10.419 -6.945  -15.661 1.00  16.80 ? 1621 ILE A HD12 1 
ATOM   2560 H  HD13 . ILE A 1 168 ? -10.913 -6.283  -14.323 1.00  16.80 ? 1621 ILE A HD13 1 
ATOM   2561 N  N    . LEU A 1 169 ? -11.329 -1.277  -14.101 1.00  10.84 ? 1622 LEU A N    1 
ATOM   2562 C  CA   . LEU A 1 169 ? -10.344 -0.192  -14.094 1.00  11.19 ? 1622 LEU A CA   1 
ATOM   2563 C  C    . LEU A 1 169 ? -9.650  -0.036  -12.744 1.00  11.37 ? 1622 LEU A C    1 
ATOM   2564 O  O    . LEU A 1 169 ? -8.464  0.309   -12.684 1.00  12.07 ? 1622 LEU A O    1 
ATOM   2565 C  CB   . LEU A 1 169 ? -10.967 1.132   -14.541 1.00  12.82 ? 1622 LEU A CB   1 
ATOM   2566 C  CG   . LEU A 1 169 ? -11.407 1.150   -16.001 1.00  13.86 ? 1622 LEU A CG   1 
ATOM   2567 C  CD1  . LEU A 1 169 ? -11.973 2.515   -16.358 1.00  14.58 ? 1622 LEU A CD1  1 
ATOM   2568 C  CD2  . LEU A 1 169 ? -10.245 0.756   -16.940 1.00  14.95 ? 1622 LEU A CD2  1 
ATOM   2569 H  H    . LEU A 1 169 ? -12.150 -1.022  -14.137 1.00  13.01 ? 1622 LEU A H    1 
ATOM   2570 H  HA   . LEU A 1 169 ? -9.648  -0.414  -14.747 1.00  13.43 ? 1622 LEU A HA   1 
ATOM   2571 H  HB2  . LEU A 1 169 ? -11.749 1.309   -13.994 1.00  15.39 ? 1622 LEU A HB2  1 
ATOM   2572 H  HB3  . LEU A 1 169 ? -10.315 1.840   -14.419 1.00  15.39 ? 1622 LEU A HB3  1 
ATOM   2573 H  HG   . LEU A 1 169 ? -12.114 0.497   -16.120 1.00  16.64 ? 1622 LEU A HG   1 
ATOM   2574 H  HD11 . LEU A 1 169 ? -11.295 3.180   -16.220 1.00  17.49 ? 1622 LEU A HD11 1 
ATOM   2575 H  HD12 . LEU A 1 169 ? -12.245 2.509   -17.278 1.00  17.49 ? 1622 LEU A HD12 1 
ATOM   2576 H  HD13 . LEU A 1 169 ? -12.729 2.696   -15.794 1.00  17.49 ? 1622 LEU A HD13 1 
ATOM   2577 H  HD21 . LEU A 1 169 ? -9.948  -0.129  -16.716 1.00  17.94 ? 1622 LEU A HD21 1 
ATOM   2578 H  HD22 . LEU A 1 169 ? -10.557 0.778   -17.848 1.00  17.94 ? 1622 LEU A HD22 1 
ATOM   2579 H  HD23 . LEU A 1 169 ? -9.526  1.382   -16.826 1.00  17.94 ? 1622 LEU A HD23 1 
ATOM   2580 N  N    . LEU A 1 170 ? -10.376 -0.288  -11.664 1.00  12.04 ? 1623 LEU A N    1 
ATOM   2581 C  CA   . LEU A 1 170 ? -9.761  -0.258  -10.347 1.00  11.86 ? 1623 LEU A CA   1 
ATOM   2582 C  C    . LEU A 1 170 ? -8.700  -1.355  -10.255 1.00  11.03 ? 1623 LEU A C    1 
ATOM   2583 O  O    . LEU A 1 170 ? -7.574  -1.116  -9.809  1.00  12.27 ? 1623 LEU A O    1 
ATOM   2584 C  CB   . LEU A 1 170 ? -10.812 -0.415  -9.255  1.00  14.41 ? 1623 LEU A CB   1 
ATOM   2585 C  CG   . LEU A 1 170 ? -10.403 -0.214  -7.791  1.00  18.81 ? 1623 LEU A CG   1 
ATOM   2586 C  CD1  . LEU A 1 170 ? -9.567  -1.326  -7.234  1.00  21.76 ? 1623 LEU A CD1  1 
ATOM   2587 C  CD2  . LEU A 1 170 ? -9.708  1.103   -7.564  1.00  17.83 ? 1623 LEU A CD2  1 
ATOM   2588 H  H    . LEU A 1 170 ? -11.215 -0.476  -11.666 1.00  14.45 ? 1623 LEU A H    1 
ATOM   2589 H  HA   . LEU A 1 170 ? -9.317  0.607   -10.220 1.00  14.23 ? 1623 LEU A HA   1 
ATOM   2590 H  HB2  . LEU A 1 170 ? -11.521 0.222   -9.435  1.00  17.30 ? 1623 LEU A HB2  1 
ATOM   2591 H  HB3  . LEU A 1 170 ? -11.173 -1.312  -9.322  1.00  17.30 ? 1623 LEU A HB3  1 
ATOM   2592 H  HG   . LEU A 1 170 ? -11.217 -0.191  -7.263  1.00  22.57 ? 1623 LEU A HG   1 
ATOM   2593 H  HD11 . LEU A 1 170 ? -8.761  -1.399  -7.750  1.00  26.11 ? 1623 LEU A HD11 1 
ATOM   2594 H  HD12 . LEU A 1 170 ? -9.354  -1.127  -6.319  1.00  26.11 ? 1623 LEU A HD12 1 
ATOM   2595 H  HD13 . LEU A 1 170 ? -10.064 -2.146  -7.284  1.00  26.11 ? 1623 LEU A HD13 1 
ATOM   2596 H  HD21 . LEU A 1 170 ? -10.301 1.816   -7.811  1.00  21.40 ? 1623 LEU A HD21 1 
ATOM   2597 H  HD22 . LEU A 1 170 ? -9.475  1.177   -6.636  1.00  21.40 ? 1623 LEU A HD22 1 
ATOM   2598 H  HD23 . LEU A 1 170 ? -8.915  1.135   -8.104  1.00  21.40 ? 1623 LEU A HD23 1 
ATOM   2599 N  N    . ILE A 1 171 ? -9.062  -2.569  -10.671 1.00  10.65 ? 1624 ILE A N    1 
ATOM   2600 C  CA   . ILE A 1 171 ? -8.115  -3.687  -10.635 1.00  10.53 ? 1624 ILE A CA   1 
ATOM   2601 C  C    . ILE A 1 171 ? -6.906  -3.408  -11.536 1.00  10.13 ? 1624 ILE A C    1 
ATOM   2602 O  O    . ILE A 1 171 ? -5.776  -3.717  -11.169 1.00  11.75 ? 1624 ILE A O    1 
ATOM   2603 C  CB   . ILE A 1 171 ? -8.836  -4.991  -11.000 1.00  10.67 ? 1624 ILE A CB   1 
ATOM   2604 C  CG1  . ILE A 1 171 ? -9.830  -5.337  -9.883  1.00  11.50 ? 1624 ILE A CG1  1 
ATOM   2605 C  CG2  . ILE A 1 171 ? -7.858  -6.143  -11.222 1.00  11.56 ? 1624 ILE A CG2  1 
ATOM   2606 C  CD1  . ILE A 1 171 ? -10.883 -6.339  -10.284 1.00  13.04 ? 1624 ILE A CD1  1 
ATOM   2607 H  H    . ILE A 1 171 ? -9.840  -2.771  -10.975 1.00  12.78 ? 1624 ILE A H    1 
ATOM   2608 H  HA   . ILE A 1 171 ? -7.781  -3.782  -9.719  1.00  12.63 ? 1624 ILE A HA   1 
ATOM   2609 H  HB   . ILE A 1 171 ? -9.333  -4.848  -11.820 1.00  12.80 ? 1624 ILE A HB   1 
ATOM   2610 H  HG12 . ILE A 1 171 ? -9.339  -5.708  -9.133  1.00  13.80 ? 1624 ILE A HG12 1 
ATOM   2611 H  HG13 . ILE A 1 171 ? -10.284 -4.525  -9.608  1.00  13.80 ? 1624 ILE A HG13 1 
ATOM   2612 H  HG21 . ILE A 1 171 ? -7.358  -6.288  -10.416 1.00  13.87 ? 1624 ILE A HG21 1 
ATOM   2613 H  HG22 . ILE A 1 171 ? -8.354  -6.934  -11.447 1.00  13.87 ? 1624 ILE A HG22 1 
ATOM   2614 H  HG23 . ILE A 1 171 ? -7.264  -5.914  -11.940 1.00  13.87 ? 1624 ILE A HG23 1 
ATOM   2615 H  HD11 . ILE A 1 171 ? -10.453 -7.155  -10.548 1.00  15.65 ? 1624 ILE A HD11 1 
ATOM   2616 H  HD12 . ILE A 1 171 ? -11.462 -6.500  -9.535  1.00  15.65 ? 1624 ILE A HD12 1 
ATOM   2617 H  HD13 . ILE A 1 171 ? -11.389 -5.983  -11.018 1.00  15.65 ? 1624 ILE A HD13 1 
ATOM   2618 N  N    . LYS A 1 172 ? -7.154  -2.836  -12.714 1.00  11.20 ? 1625 LYS A N    1 
ATOM   2619 C  CA   A LYS A 1 172 ? -6.089  -2.453  -13.630 0.52  10.99 ? 1625 LYS A CA   1 
ATOM   2620 C  CA   B LYS A 1 172 ? -6.097  -2.447  -13.634 0.48  11.01 ? 1625 LYS A CA   1 
ATOM   2621 C  C    . LYS A 1 172 ? -5.115  -1.489  -12.951 1.00  10.77 ? 1625 LYS A C    1 
ATOM   2622 O  O    . LYS A 1 172 ? -3.894  -1.656  -13.051 1.00  11.78 ? 1625 LYS A O    1 
ATOM   2623 C  CB   A LYS A 1 172 ? -6.669  -1.824  -14.903 0.52  11.49 ? 1625 LYS A CB   1 
ATOM   2624 C  CB   B LYS A 1 172 ? -6.720  -1.801  -14.874 0.48  11.53 ? 1625 LYS A CB   1 
ATOM   2625 C  CG   A LYS A 1 172 ? -5.636  -1.476  -15.970 0.52  13.23 ? 1625 LYS A CG   1 
ATOM   2626 C  CG   B LYS A 1 172 ? -5.767  -1.415  -15.991 0.48  13.12 ? 1625 LYS A CG   1 
ATOM   2627 C  CD   A LYS A 1 172 ? -6.268  -0.794  -17.177 0.52  15.04 ? 1625 LYS A CD   1 
ATOM   2628 C  CD   B LYS A 1 172 ? -6.549  -0.737  -17.107 0.48  15.07 ? 1625 LYS A CD   1 
ATOM   2629 C  CE   A LYS A 1 172 ? -5.244  -0.311  -18.194 0.52  17.49 ? 1625 LYS A CE   1 
ATOM   2630 C  CE   B LYS A 1 172 ? -5.706  -0.346  -18.291 0.48  15.94 ? 1625 LYS A CE   1 
ATOM   2631 N  NZ   A LYS A 1 172 ? -4.459  -1.428  -18.794 0.52  18.60 ? 1625 LYS A NZ   1 
ATOM   2632 N  NZ   B LYS A 1 172 ? -6.577  0.183   -19.375 0.48  16.49 ? 1625 LYS A NZ   1 
ATOM   2633 H  H    A LYS A 1 172 ? -7.943  -2.657  -13.005 0.52  13.44 ? 1625 LYS A H    1 
ATOM   2634 H  H    B LYS A 1 172 ? -7.945  -2.660  -13.004 0.48  13.44 ? 1625 LYS A H    1 
ATOM   2635 H  HA   A LYS A 1 172 ? -5.590  -3.255  -13.890 0.52  13.19 ? 1625 LYS A HA   1 
ATOM   2636 H  HA   B LYS A 1 172 ? -5.603  -3.244  -13.917 0.48  13.21 ? 1625 LYS A HA   1 
ATOM   2637 H  HB2  A LYS A 1 172 ? -7.299  -2.447  -15.297 0.52  13.79 ? 1625 LYS A HB2  1 
ATOM   2638 H  HB2  B LYS A 1 172 ? -7.364  -2.422  -15.248 0.48  13.84 ? 1625 LYS A HB2  1 
ATOM   2639 H  HB3  A LYS A 1 172 ? -7.128  -1.004  -14.662 0.52  13.79 ? 1625 LYS A HB3  1 
ATOM   2640 H  HB3  B LYS A 1 172 ? -7.178  -0.992  -14.596 0.48  13.84 ? 1625 LYS A HB3  1 
ATOM   2641 H  HG2  A LYS A 1 172 ? -4.978  -0.871  -15.591 0.52  15.87 ? 1625 LYS A HG2  1 
ATOM   2642 H  HG2  B LYS A 1 172 ? -5.103  -0.794  -15.654 0.48  15.74 ? 1625 LYS A HG2  1 
ATOM   2643 H  HG3  A LYS A 1 172 ? -5.205  -2.290  -16.274 0.52  15.87 ? 1625 LYS A HG3  1 
ATOM   2644 H  HG3  B LYS A 1 172 ? -5.343  -2.211  -16.347 0.48  15.74 ? 1625 LYS A HG3  1 
ATOM   2645 H  HD2  A LYS A 1 172 ? -6.856  -1.425  -17.622 0.52  18.05 ? 1625 LYS A HD2  1 
ATOM   2646 H  HD2  B LYS A 1 172 ? -7.237  -1.346  -17.420 0.48  18.08 ? 1625 LYS A HD2  1 
ATOM   2647 H  HD3  A LYS A 1 172 ? -6.775  -0.025  -16.875 0.52  18.05 ? 1625 LYS A HD3  1 
ATOM   2648 H  HD3  B LYS A 1 172 ? -6.959  0.069   -16.756 0.48  18.08 ? 1625 LYS A HD3  1 
ATOM   2649 H  HE2  A LYS A 1 172 ? -5.704  0.151   -18.911 0.52  20.99 ? 1625 LYS A HE2  1 
ATOM   2650 H  HE2  B LYS A 1 172 ? -5.081  0.348   -18.030 0.48  19.12 ? 1625 LYS A HE2  1 
ATOM   2651 H  HE3  A LYS A 1 172 ? -4.622  0.290   -17.755 0.52  20.99 ? 1625 LYS A HE3  1 
ATOM   2652 H  HE3  B LYS A 1 172 ? -5.234  -1.124  -18.626 0.48  19.12 ? 1625 LYS A HE3  1 
ATOM   2653 H  HZ1  A LYS A 1 172 ? -5.005  -1.994  -19.211 0.52  22.32 ? 1625 LYS A HZ1  1 
ATOM   2654 H  HZ1  B LYS A 1 172 ? -7.022  0.897   -19.086 0.48  19.78 ? 1625 LYS A HZ1  1 
ATOM   2655 H  HZ2  A LYS A 1 172 ? -3.873  -1.106  -19.381 0.52  22.32 ? 1625 LYS A HZ2  1 
ATOM   2656 H  HZ2  B LYS A 1 172 ? -6.082  0.415   -20.077 0.48  19.78 ? 1625 LYS A HZ2  1 
ATOM   2657 H  HZ3  A LYS A 1 172 ? -4.019  -1.867  -18.157 0.52  22.32 ? 1625 LYS A HZ3  1 
ATOM   2658 H  HZ3  B LYS A 1 172 ? -7.161  -0.440  -19.627 0.48  19.78 ? 1625 LYS A HZ3  1 
ATOM   2659 N  N    . ALA A 1 173 ? -5.643  -0.495  -12.240 1.00  11.01 ? 1626 ALA A N    1 
ATOM   2660 C  CA   . ALA A 1 173 ? -4.789  0.446   -11.521 1.00  11.61 ? 1626 ALA A CA   1 
ATOM   2661 C  C    . ALA A 1 173 ? -3.989  -0.241  -10.418 1.00  11.70 ? 1626 ALA A C    1 
ATOM   2662 O  O    . ALA A 1 173 ? -2.810  0.071   -10.208 1.00  12.25 ? 1626 ALA A O    1 
ATOM   2663 C  CB   . ALA A 1 173 ? -5.627  1.581   -10.932 1.00  12.02 ? 1626 ALA A CB   1 
ATOM   2664 H  H    . ALA A 1 173 ? -6.485  -0.344  -12.159 1.00  13.21 ? 1626 ALA A H    1 
ATOM   2665 H  HA   . ALA A 1 173 ? -4.152  0.840   -12.152 1.00  13.93 ? 1626 ALA A HA   1 
ATOM   2666 H  HB1  . ALA A 1 173 ? -6.272  1.211   -10.325 1.00  14.43 ? 1626 ALA A HB1  1 
ATOM   2667 H  HB2  . ALA A 1 173 ? -5.047  2.187   -10.464 1.00  14.43 ? 1626 ALA A HB2  1 
ATOM   2668 H  HB3  . ALA A 1 173 ? -6.074  2.042   -11.645 1.00  14.43 ? 1626 ALA A HB3  1 
ATOM   2669 N  N    . ALA A 1 174 ? -4.614  -1.190  -9.726  1.00  11.86 ? 1627 ALA A N    1 
ATOM   2670 C  CA   . ALA A 1 174 ? -3.916  -1.922  -8.666  1.00  11.19 ? 1627 ALA A CA   1 
ATOM   2671 C  C    . ALA A 1 174 ? -2.789  -2.759  -9.250  1.00  11.01 ? 1627 ALA A C    1 
ATOM   2672 O  O    . ALA A 1 174 ? -1.688  -2.809  -8.700  1.00  12.11 ? 1627 ALA A O    1 
ATOM   2673 C  CB   . ALA A 1 174 ? -4.889  -2.797  -7.916  1.00  11.78 ? 1627 ALA A CB   1 
ATOM   2674 H  H    . ALA A 1 174 ? -5.432  -1.429  -9.846  1.00  14.23 ? 1627 ALA A H    1 
ATOM   2675 H  HA   . ALA A 1 174 ? -3.527  -1.283  -8.033  1.00  13.43 ? 1627 ALA A HA   1 
ATOM   2676 H  HB1  . ALA A 1 174 ? -5.284  -3.421  -8.530  1.00  14.13 ? 1627 ALA A HB1  1 
ATOM   2677 H  HB2  . ALA A 1 174 ? -4.417  -3.269  -7.227  1.00  14.13 ? 1627 ALA A HB2  1 
ATOM   2678 H  HB3  . ALA A 1 174 ? -5.571  -2.244  -7.528  1.00  14.13 ? 1627 ALA A HB3  1 
ATOM   2679 N  N    . LYS A 1 175 ? -3.050  -3.407  -10.377 1.00  11.22 ? 1628 LYS A N    1 
ATOM   2680 C  CA   . LYS A 1 175 ? -2.009  -4.194  -11.026 1.00  11.63 ? 1628 LYS A CA   1 
ATOM   2681 C  C    . LYS A 1 175 ? -0.856  -3.315  -11.491 1.00  11.91 ? 1628 LYS A C    1 
ATOM   2682 O  O    . LYS A 1 175 ? 0.316   -3.717  -11.402 1.00  13.65 ? 1628 LYS A O    1 
ATOM   2683 C  CB   . LYS A 1 175 ? -2.582  -5.011  -12.187 1.00  11.06 ? 1628 LYS A CB   1 
ATOM   2684 C  CG   . LYS A 1 175 ? -3.452  -6.176  -11.712 1.00  11.21 ? 1628 LYS A CG   1 
ATOM   2685 C  CD   . LYS A 1 175 ? -3.873  -7.066  -12.866 1.00  11.95 ? 1628 LYS A CD   1 
ATOM   2686 C  CE   . LYS A 1 175 ? -4.688  -8.261  -12.400 1.00  12.15 ? 1628 LYS A CE   1 
ATOM   2687 N  NZ   . LYS A 1 175 ? -4.938  -9.187  -13.541 1.00  13.60 ? 1628 LYS A NZ   1 
ATOM   2688 H  H    . LYS A 1 175 ? -3.809  -3.408  -10.782 1.00  13.46 ? 1628 LYS A H    1 
ATOM   2689 H  HA   . LYS A 1 175 ? -1.648  -4.828  -10.371 1.00  13.95 ? 1628 LYS A HA   1 
ATOM   2690 H  HB2  . LYS A 1 175 ? -3.131  -4.433  -12.740 1.00  13.28 ? 1628 LYS A HB2  1 
ATOM   2691 H  HB3  . LYS A 1 175 ? -1.851  -5.375  -12.710 1.00  13.28 ? 1628 LYS A HB3  1 
ATOM   2692 H  HG2  . LYS A 1 175 ? -2.948  -6.715  -11.082 1.00  13.45 ? 1628 LYS A HG2  1 
ATOM   2693 H  HG3  . LYS A 1 175 ? -4.253  -5.827  -11.290 1.00  13.45 ? 1628 LYS A HG3  1 
ATOM   2694 H  HD2  . LYS A 1 175 ? -4.418  -6.551  -13.482 1.00  14.34 ? 1628 LYS A HD2  1 
ATOM   2695 H  HD3  . LYS A 1 175 ? -3.081  -7.397  -13.317 1.00  14.34 ? 1628 LYS A HD3  1 
ATOM   2696 H  HE2  . LYS A 1 175 ? -4.198  -8.742  -11.715 1.00  14.58 ? 1628 LYS A HE2  1 
ATOM   2697 H  HE3  . LYS A 1 175 ? -5.543  -7.958  -12.057 1.00  14.58 ? 1628 LYS A HE3  1 
ATOM   2698 H  HZ1  . LYS A 1 175 ? -4.164  -9.476  -13.872 1.00  16.32 ? 1628 LYS A HZ1  1 
ATOM   2699 H  HZ2  . LYS A 1 175 ? -5.415  -9.886  -13.267 1.00  16.32 ? 1628 LYS A HZ2  1 
ATOM   2700 H  HZ3  . LYS A 1 175 ? -5.387  -8.764  -14.183 1.00  16.32 ? 1628 LYS A HZ3  1 
ATOM   2701 N  N    . ALA A 1 176 ? -1.169  -2.110  -11.962 1.00  12.38 ? 1629 ALA A N    1 
ATOM   2702 C  CA   . ALA A 1 176 ? -0.119  -1.188  -12.396 1.00  12.60 ? 1629 ALA A CA   1 
ATOM   2703 C  C    . ALA A 1 176 ? 0.784   -0.761  -11.223 1.00  13.70 ? 1629 ALA A C    1 
ATOM   2704 O  O    . ALA A 1 176 ? 1.937   -0.403  -11.437 1.00  16.93 ? 1629 ALA A O    1 
ATOM   2705 C  CB   . ALA A 1 176 ? -0.732  0.032   -13.074 1.00  13.74 ? 1629 ALA A CB   1 
ATOM   2706 H  H    . ALA A 1 176 ? -1.969  -1.804  -12.041 1.00  14.86 ? 1629 ALA A H    1 
ATOM   2707 H  HA   . ALA A 1 176 ? 0.445   -1.643  -13.055 1.00  15.12 ? 1629 ALA A HA   1 
ATOM   2708 H  HB1  . ALA A 1 176 ? -1.309  0.479   -12.450 1.00  16.49 ? 1629 ALA A HB1  1 
ATOM   2709 H  HB2  . ALA A 1 176 ? -0.027  0.623   -13.350 1.00  16.49 ? 1629 ALA A HB2  1 
ATOM   2710 H  HB3  . ALA A 1 176 ? -1.236  -0.256  -13.838 1.00  16.49 ? 1629 ALA A HB3  1 
ATOM   2711 N  N    . ARG A 1 177 ? 0.254   -0.778  -10.004 1.00  13.98 ? 1630 ARG A N    1 
ATOM   2712 C  CA   A ARG A 1 177 ? 1.042   -0.462  -8.808  0.43  14.90 ? 1630 ARG A CA   1 
ATOM   2713 C  CA   B ARG A 1 177 ? 1.034   -0.463  -8.805  0.57  14.37 ? 1630 ARG A CA   1 
ATOM   2714 C  C    . ARG A 1 177 ? 1.697   -1.714  -8.217  1.00  14.79 ? 1630 ARG A C    1 
ATOM   2715 O  O    . ARG A 1 177 ? 2.267   -1.665  -7.132  1.00  17.80 ? 1630 ARG A O    1 
ATOM   2716 C  CB   A ARG A 1 177 ? 0.177   0.208   -7.727  0.43  17.68 ? 1630 ARG A CB   1 
ATOM   2717 C  CB   B ARG A 1 177 ? 0.149   0.210   -7.740  0.57  16.56 ? 1630 ARG A CB   1 
ATOM   2718 C  CG   A ARG A 1 177 ? -0.435  1.558   -8.092  0.43  20.64 ? 1630 ARG A CG   1 
ATOM   2719 C  CG   B ARG A 1 177 ? -0.280  1.644   -8.053  0.57  18.89 ? 1630 ARG A CG   1 
ATOM   2720 C  CD   A ARG A 1 177 ? 0.574   2.700   -8.169  0.43  23.60 ? 1630 ARG A CD   1 
ATOM   2721 C  CD   B ARG A 1 177 ? 0.884   2.624   -8.056  0.57  21.54 ? 1630 ARG A CD   1 
ATOM   2722 N  NE   A ARG A 1 177 ? 1.610   2.650   -7.139  0.43  26.12 ? 1630 ARG A NE   1 
ATOM   2723 N  NE   B ARG A 1 177 ? 0.444   4.018   -8.042  0.57  23.76 ? 1630 ARG A NE   1 
ATOM   2724 C  CZ   A ARG A 1 177 ? 1.447   2.990   -5.864  0.43  27.46 ? 1630 ARG A CZ   1 
ATOM   2725 C  CZ   B ARG A 1 177 ? 1.135   5.026   -8.565  0.57  24.79 ? 1630 ARG A CZ   1 
ATOM   2726 N  NH1  A ARG A 1 177 ? 0.271   3.390   -5.418  0.43  27.29 ? 1630 ARG A NH1  1 
ATOM   2727 N  NH1  B ARG A 1 177 ? 2.300   4.791   -9.157  0.57  24.15 ? 1630 ARG A NH1  1 
ATOM   2728 N  NH2  A ARG A 1 177 ? 2.469   2.918   -5.024  0.43  28.68 ? 1630 ARG A NH2  1 
ATOM   2729 N  NH2  B ARG A 1 177 ? 0.658   6.275   -8.503  0.57  26.72 ? 1630 ARG A NH2  1 
ATOM   2730 H  H    A ARG A 1 177 ? -0.567  -0.972  -9.838  0.43  16.78 ? 1630 ARG A H    1 
ATOM   2731 H  H    B ARG A 1 177 ? -0.568  -0.973  -9.840  0.57  16.78 ? 1630 ARG A H    1 
ATOM   2732 H  HA   A ARG A 1 177 ? 1.755   0.164   -9.054  0.43  17.88 ? 1630 ARG A HA   1 
ATOM   2733 H  HA   B ARG A 1 177 ? 1.744   0.168   -9.047  0.57  17.24 ? 1630 ARG A HA   1 
ATOM   2734 H  HB2  A ARG A 1 177 ? -0.555  -0.391  -7.509  0.43  21.22 ? 1630 ARG A HB2  1 
ATOM   2735 H  HB2  B ARG A 1 177 ? -0.657  -0.318  -7.633  0.57  19.87 ? 1630 ARG A HB2  1 
ATOM   2736 H  HB3  A ARG A 1 177 ? 0.726   0.344   -6.939  0.43  21.22 ? 1630 ARG A HB3  1 
ATOM   2737 H  HB3  B ARG A 1 177 ? 0.638   0.229   -6.903  0.57  19.87 ? 1630 ARG A HB3  1 
ATOM   2738 H  HG2  A ARG A 1 177 ? -0.861  1.482   -8.960  0.43  24.77 ? 1630 ARG A HG2  1 
ATOM   2739 H  HG2  B ARG A 1 177 ? -0.693  1.666   -8.930  0.57  22.66 ? 1630 ARG A HG2  1 
ATOM   2740 H  HG3  A ARG A 1 177 ? -1.096  1.792   -7.422  0.43  24.77 ? 1630 ARG A HG3  1 
ATOM   2741 H  HG3  B ARG A 1 177 ? -0.916  1.937   -7.380  0.57  22.66 ? 1630 ARG A HG3  1 
ATOM   2742 H  HD2  A ARG A 1 177 ? 1.015   2.669   -9.032  0.43  28.32 ? 1630 ARG A HD2  1 
ATOM   2743 H  HD2  B ARG A 1 177 ? 1.428   2.473   -7.267  0.57  25.84 ? 1630 ARG A HD2  1 
ATOM   2744 H  HD3  A ARG A 1 177 ? 0.101   3.541   -8.072  0.43  28.32 ? 1630 ARG A HD3  1 
ATOM   2745 H  HD3  B ARG A 1 177 ? 1.413   2.484   -8.857  0.57  25.84 ? 1630 ARG A HD3  1 
ATOM   2746 H  HE   A ARG A 1 177 ? 2.390   2.378   -7.377  0.43  31.34 ? 1630 ARG A HE   1 
ATOM   2747 H  HE   B ARG A 1 177 ? -0.311  4.198   -7.671  0.57  28.52 ? 1630 ARG A HE   1 
ATOM   2748 H  HH11 A ARG A 1 177 ? -0.398  3.444   -5.957  0.43  34.41 ? 1630 ARG A HH11 1 
ATOM   2749 H  HH11 B ARG A 1 177 ? 2.607   3.989   -9.197  0.57  32.07 ? 1630 ARG A HH11 1 
ATOM   2750 H  HH12 A ARG A 1 177 ? 0.175   3.604   -4.591  0.43  34.41 ? 1630 ARG A HH12 1 
ATOM   2751 H  HH12 B ARG A 1 177 ? 2.748   5.441   -9.498  0.57  32.07 ? 1630 ARG A HH12 1 
ATOM   2752 H  HH21 A ARG A 1 177 ? 3.238   2.653   -5.304  0.43  32.75 ? 1630 ARG A HH21 1 
ATOM   2753 H  HH21 B ARG A 1 177 ? -0.098  6.429   -8.122  0.57  28.98 ? 1630 ARG A HH21 1 
ATOM   2754 H  HH22 A ARG A 1 177 ? 2.362   3.129   -4.197  0.43  32.75 ? 1630 ARG A HH22 1 
ATOM   2755 H  HH22 B ARG A 1 177 ? 1.106   6.924   -8.846  0.57  28.98 ? 1630 ARG A HH22 1 
ATOM   2756 N  N    . GLY A 1 178 ? 1.600   -2.842  -8.921  1.00  13.11 ? 1631 GLY A N    1 
ATOM   2757 C  CA   . GLY A 1 178 ? 2.281   -4.065  -8.504  1.00  14.72 ? 1631 GLY A CA   1 
ATOM   2758 C  C    . GLY A 1 178 ? 1.593   -4.807  -7.375  1.00  14.33 ? 1631 GLY A C    1 
ATOM   2759 O  O    . GLY A 1 178 ? 2.212   -5.635  -6.715  1.00  16.03 ? 1631 GLY A O    1 
ATOM   2760 H  H    . GLY A 1 178 ? 1.145   -2.924  -9.646  1.00  15.74 ? 1631 GLY A H    1 
ATOM   2761 H  HA2  . GLY A 1 178 ? 2.348   -4.665  -9.262  1.00  17.67 ? 1631 GLY A HA2  1 
ATOM   2762 H  HA3  . GLY A 1 178 ? 3.180   -3.843  -8.214  1.00  17.67 ? 1631 GLY A HA3  1 
ATOM   2763 N  N    . LEU A 1 179 ? 0.314   -4.530  -7.143  1.00  12.42 ? 1632 LEU A N    1 
ATOM   2764 C  CA   . LEU A 1 179 ? -0.394  -5.194  -6.050  1.00  12.59 ? 1632 LEU A CA   1 
ATOM   2765 C  C    . LEU A 1 179 ? -0.803  -6.615  -6.437  1.00  11.31 ? 1632 LEU A C    1 
ATOM   2766 O  O    . LEU A 1 179 ? -1.159  -6.860  -7.579  1.00  11.63 ? 1632 LEU A O    1 
ATOM   2767 C  CB   . LEU A 1 179 ? -1.621  -4.385  -5.638  1.00  14.06 ? 1632 LEU A CB   1 
ATOM   2768 C  CG   . LEU A 1 179 ? -1.336  -2.946  -5.195  1.00  17.22 ? 1632 LEU A CG   1 
ATOM   2769 C  CD1  . LEU A 1 179 ? -2.632  -2.347  -4.684  1.00  17.99 ? 1632 LEU A CD1  1 
ATOM   2770 C  CD2  . LEU A 1 179 ? -0.239  -2.864  -4.166  1.00  19.89 ? 1632 LEU A CD2  1 
ATOM   2771 H  H    . LEU A 1 179 ? -0.161  -3.972  -7.594  1.00  14.90 ? 1632 LEU A H    1 
ATOM   2772 H  HA   . LEU A 1 179 ? 0.202   -5.252  -5.275  1.00  15.10 ? 1632 LEU A HA   1 
ATOM   2773 H  HB2  . LEU A 1 179 ? -2.229  -4.343  -6.393  1.00  16.87 ? 1632 LEU A HB2  1 
ATOM   2774 H  HB3  . LEU A 1 179 ? -2.053  -4.838  -4.898  1.00  16.87 ? 1632 LEU A HB3  1 
ATOM   2775 H  HG   . LEU A 1 179 ? -1.056  -2.430  -5.968  1.00  20.67 ? 1632 LEU A HG   1 
ATOM   2776 H  HD11 . LEU A 1 179 ? -2.947  -2.870  -3.943  1.00  21.58 ? 1632 LEU A HD11 1 
ATOM   2777 H  HD12 . LEU A 1 179 ? -2.469  -1.444  -4.402  1.00  21.58 ? 1632 LEU A HD12 1 
ATOM   2778 H  HD13 . LEU A 1 179 ? -3.281  -2.357  -5.392  1.00  21.58 ? 1632 LEU A HD13 1 
ATOM   2779 H  HD21 . LEU A 1 179 ? 0.567   -3.227  -4.540  1.00  23.86 ? 1632 LEU A HD21 1 
ATOM   2780 H  HD22 . LEU A 1 179 ? -0.105  -1.944  -3.926  1.00  23.86 ? 1632 LEU A HD22 1 
ATOM   2781 H  HD23 . LEU A 1 179 ? -0.499  -3.370  -3.392  1.00  23.86 ? 1632 LEU A HD23 1 
ATOM   2782 N  N    . PRO A 1 180 ? -0.797  -7.542  -5.467  1.00  11.75 ? 1633 PRO A N    1 
ATOM   2783 C  CA   . PRO A 1 180 ? -1.085  -8.943  -5.775  1.00  11.11 ? 1633 PRO A CA   1 
ATOM   2784 C  C    . PRO A 1 180 ? -2.579  -9.181  -5.756  1.00  12.09 ? 1633 PRO A C    1 
ATOM   2785 O  O    . PRO A 1 180 ? -3.171  -9.572  -4.759  1.00  13.13 ? 1633 PRO A O    1 
ATOM   2786 C  CB   . PRO A 1 180 ? -0.356  -9.700  -4.652  1.00  12.82 ? 1633 PRO A CB   1 
ATOM   2787 C  CG   . PRO A 1 180 ? -0.361  -8.733  -3.496  1.00  12.80 ? 1633 PRO A CG   1 
ATOM   2788 C  CD   . PRO A 1 180 ? -0.216  -7.381  -4.121  1.00  12.98 ? 1633 PRO A CD   1 
ATOM   2789 H  HA   . PRO A 1 180 ? -0.714  -9.195  -6.647  1.00  13.33 ? 1633 PRO A HA   1 
ATOM   2790 H  HB2  . PRO A 1 180 ? -0.844  -10.509 -4.429  1.00  15.38 ? 1633 PRO A HB2  1 
ATOM   2791 H  HB3  . PRO A 1 180 ? 0.551   -9.906  -4.927  1.00  15.38 ? 1633 PRO A HB3  1 
ATOM   2792 H  HG2  . PRO A 1 180 ? -1.201  -8.801  -3.016  1.00  15.36 ? 1633 PRO A HG2  1 
ATOM   2793 H  HG3  . PRO A 1 180 ? 0.387   -8.922  -2.908  1.00  15.36 ? 1633 PRO A HG3  1 
ATOM   2794 H  HD2  . PRO A 1 180 ? -0.717  -6.722  -3.615  1.00  15.57 ? 1633 PRO A HD2  1 
ATOM   2795 H  HD3  . PRO A 1 180 ? 0.721   -7.139  -4.186  1.00  15.57 ? 1633 PRO A HD3  1 
ATOM   2796 N  N    . VAL A 1 181 ? -3.182  -8.911  -6.897  1.00  11.22 ? 1634 VAL A N    1 
ATOM   2797 C  CA   A VAL A 1 181 ? -4.601  -9.106  -7.077  0.78  10.53 ? 1634 VAL A CA   1 
ATOM   2798 C  CA   B VAL A 1 181 ? -4.602  -9.088  -7.100  0.22  10.91 ? 1634 VAL A CA   1 
ATOM   2799 C  C    . VAL A 1 181 ? -4.811  -9.807  -8.414  1.00  10.02 ? 1634 VAL A C    1 
ATOM   2800 O  O    . VAL A 1 181 ? -4.145  -9.479  -9.417  1.00  12.12 ? 1634 VAL A O    1 
ATOM   2801 C  CB   A VAL A 1 181 ? -5.387  -7.768  -6.992  0.78  11.50 ? 1634 VAL A CB   1 
ATOM   2802 C  CB   B VAL A 1 181 ? -5.312  -7.744  -7.210  0.22  11.80 ? 1634 VAL A CB   1 
ATOM   2803 C  CG1  A VAL A 1 181 ? -4.836  -6.731  -7.970  0.78  11.84 ? 1634 VAL A CG1  1 
ATOM   2804 C  CG1  B VAL A 1 181 ? -6.817  -7.929  -7.059  0.22  12.44 ? 1634 VAL A CG1  1 
ATOM   2805 C  CG2  A VAL A 1 181 ? -6.869  -8.017  -7.277  0.78  13.04 ? 1634 VAL A CG2  1 
ATOM   2806 C  CG2  B VAL A 1 181 ? -4.764  -6.781  -6.187  0.22  11.58 ? 1634 VAL A CG2  1 
ATOM   2807 H  H    A VAL A 1 181 ? -2.781  -8.607  -7.595  0.78  13.47 ? 1634 VAL A H    1 
ATOM   2808 H  H    B VAL A 1 181 ? -2.773  -8.612  -7.593  0.22  13.47 ? 1634 VAL A H    1 
ATOM   2809 H  HA   A VAL A 1 181 ? -4.933  -9.697  -6.369  0.78  12.63 ? 1634 VAL A HA   1 
ATOM   2810 H  HA   B VAL A 1 181 ? -4.995  -9.611  -6.371  0.22  13.10 ? 1634 VAL A HA   1 
ATOM   2811 H  HB   A VAL A 1 181 ? -5.308  -7.405  -6.085  0.78  13.80 ? 1634 VAL A HB   1 
ATOM   2812 H  HB   B VAL A 1 181 ? -5.142  -7.367  -8.099  0.22  14.16 ? 1634 VAL A HB   1 
ATOM   2813 H  HG11 A VAL A 1 181 ? -4.908  -7.075  -8.863  0.78  14.21 ? 1634 VAL A HG11 1 
ATOM   2814 H  HG11 B VAL A 1 181 ? -6.999  -8.316  -6.200  0.22  14.92 ? 1634 VAL A HG11 1 
ATOM   2815 H  HG12 A VAL A 1 181 ? -5.346  -5.922  -7.888  0.78  14.21 ? 1634 VAL A HG12 1 
ATOM   2816 H  HG12 B VAL A 1 181 ? -7.245  -7.074  -7.131  0.22  14.92 ? 1634 VAL A HG12 1 
ATOM   2817 H  HG13 A VAL A 1 181 ? -3.915  -6.561  -7.758  0.78  14.21 ? 1634 VAL A HG13 1 
ATOM   2818 H  HG13 B VAL A 1 181 ? -7.130  -8.513  -7.755  0.22  14.92 ? 1634 VAL A HG13 1 
ATOM   2819 H  HG21 A VAL A 1 181 ? -7.213  -8.633  -6.626  0.78  15.65 ? 1634 VAL A HG21 1 
ATOM   2820 H  HG21 B VAL A 1 181 ? -3.825  -6.660  -6.344  0.22  13.90 ? 1634 VAL A HG21 1 
ATOM   2821 H  HG22 A VAL A 1 181 ? -7.342  -7.183  -7.222  0.78  15.65 ? 1634 VAL A HG22 1 
ATOM   2822 H  HG22 B VAL A 1 181 ? -5.222  -5.942  -6.271  0.22  13.90 ? 1634 VAL A HG22 1 
ATOM   2823 H  HG23 A VAL A 1 181 ? -6.959  -8.387  -8.158  0.78  15.65 ? 1634 VAL A HG23 1 
ATOM   2824 H  HG23 B VAL A 1 181 ? -4.905  -7.145  -5.310  0.22  13.90 ? 1634 VAL A HG23 1 
ATOM   2825 N  N    . THR A 1 182 ? -5.719  -10.777 -8.410  1.00  9.87  ? 1635 THR A N    1 
ATOM   2826 C  CA   . THR A 1 182 ? -6.167  -11.406 -9.641  1.00  10.24 ? 1635 THR A CA   1 
ATOM   2827 C  C    . THR A 1 182 ? -7.680  -11.331 -9.692  1.00  10.03 ? 1635 THR A C    1 
ATOM   2828 O  O    . THR A 1 182 ? -8.325  -10.986 -8.696  1.00  9.85  ? 1635 THR A O    1 
ATOM   2829 C  CB   . THR A 1 182 ? -5.692  -12.883 -9.764  1.00  11.07 ? 1635 THR A CB   1 
ATOM   2830 O  OG1  . THR A 1 182 ? -6.105  -13.610 -8.612  1.00  11.96 ? 1635 THR A OG1  1 
ATOM   2831 C  CG2  . THR A 1 182 ? -4.171  -12.949 -9.887  1.00  11.90 ? 1635 THR A CG2  1 
ATOM   2832 H  H    . THR A 1 182 ? -6.093  -11.089 -7.701  1.00  11.85 ? 1635 THR A H    1 
ATOM   2833 H  HA   . THR A 1 182 ? -5.811  -10.907 -10.405 1.00  12.28 ? 1635 THR A HA   1 
ATOM   2834 H  HB   . THR A 1 182 ? -6.082  -13.284 -10.556 1.00  13.28 ? 1635 THR A HB   1 
ATOM   2835 H  HG1  . THR A 1 182 ? -6.922  -13.594 -8.549  1.00  14.35 ? 1635 THR A HG1  1 
ATOM   2836 H  HG21 . THR A 1 182 ? -3.762  -12.558 -9.111  1.00  14.28 ? 1635 THR A HG21 1 
ATOM   2837 H  HG22 . THR A 1 182 ? -3.887  -13.863 -9.962  1.00  14.28 ? 1635 THR A HG22 1 
ATOM   2838 H  HG23 . THR A 1 182 ? -3.884  -12.468 -10.667 1.00  14.28 ? 1635 THR A HG23 1 
ATOM   2839 N  N    . CYS A 1 183 ? -8.260  -11.630 -10.848 1.00  10.96 ? 1636 CYS A N    1 
ATOM   2840 C  CA   . CYS A 1 183 ? -9.705  -11.570 -10.975 1.00  9.50  ? 1636 CYS A CA   1 
ATOM   2841 C  C    . CYS A 1 183 ? -10.229 -12.524 -12.031 1.00  10.23 ? 1636 CYS A C    1 
ATOM   2842 O  O    . CYS A 1 183 ? -9.475  -13.036 -12.854 1.00  10.64 ? 1636 CYS A O    1 
ATOM   2843 C  CB   . CYS A 1 183 ? -10.182 -10.156 -11.276 1.00  10.36 ? 1636 CYS A CB   1 
ATOM   2844 S  SG   . CYS A 1 183 ? -9.746  -9.524  -12.907 1.00  12.62 ? 1636 CYS A SG   1 
ATOM   2845 H  H    . CYS A 1 183 ? -7.844  -11.867 -11.562 1.00  13.16 ? 1636 CYS A H    1 
ATOM   2846 H  HA   . CYS A 1 183 ? -10.101 -11.836 -10.119 1.00  11.40 ? 1636 CYS A HA   1 
ATOM   2847 H  HB2  . CYS A 1 183 ? -11.149 -10.136 -11.205 1.00  12.44 ? 1636 CYS A HB2  1 
ATOM   2848 H  HB3  . CYS A 1 183 ? -9.796  -9.556  -10.619 1.00  12.44 ? 1636 CYS A HB3  1 
ATOM   2849 H  HG   . CYS A 1 183 ? -10.175 -8.409  -13.021 1.00  15.14 ? 1636 CYS A HG   1 
ATOM   2850 N  N    . GLU A 1 184 ? -11.528 -12.751 -11.994 1.00  9.91  ? 1637 GLU A N    1 
ATOM   2851 C  CA   . GLU A 1 184 ? -12.207 -13.549 -13.008 1.00  10.18 ? 1637 GLU A CA   1 
ATOM   2852 C  C    . GLU A 1 184 ? -13.432 -12.772 -13.509 1.00  10.42 ? 1637 GLU A C    1 
ATOM   2853 O  O    . GLU A 1 184 ? -13.938 -11.864 -12.840 1.00  11.09 ? 1637 GLU A O    1 
ATOM   2854 C  CB   . GLU A 1 184 ? -12.661 -14.881 -12.407 1.00  11.75 ? 1637 GLU A CB   1 
ATOM   2855 C  CG   . GLU A 1 184 ? -13.844 -14.685 -11.473 1.00  12.61 ? 1637 GLU A CG   1 
ATOM   2856 C  CD   . GLU A 1 184 ? -14.043 -15.742 -10.413 1.00  13.18 ? 1637 GLU A CD   1 
ATOM   2857 O  OE1  . GLU A 1 184 ? -13.103 -16.488 -10.077 1.00  13.84 ? 1637 GLU A OE1  1 
ATOM   2858 O  OE2  . GLU A 1 184 ? -15.160 -15.790 -9.864  1.00  14.25 ? 1637 GLU A OE2  1 
ATOM   2859 H  H    . GLU A 1 184 ? -12.052 -12.450 -11.382 1.00  11.89 ? 1637 GLU A H    1 
ATOM   2860 H  HA   . GLU A 1 184 ? -11.605 -13.724 -13.762 1.00  12.21 ? 1637 GLU A HA   1 
ATOM   2861 H  HB2  . GLU A 1 184 ? -12.931 -15.480 -13.121 1.00  14.10 ? 1637 GLU A HB2  1 
ATOM   2862 H  HB3  . GLU A 1 184 ? -11.932 -15.269 -11.899 1.00  14.10 ? 1637 GLU A HB3  1 
ATOM   2863 H  HG2  . GLU A 1 184 ? -13.734 -13.836 -11.016 1.00  15.14 ? 1637 GLU A HG2  1 
ATOM   2864 H  HG3  . GLU A 1 184 ? -14.653 -14.659 -12.008 1.00  15.14 ? 1637 GLU A HG3  1 
ATOM   2865 N  N    . VAL A 1 185 ? -13.905 -13.163 -14.685 1.00  9.82  ? 1638 VAL A N    1 
ATOM   2866 C  CA   . VAL A 1 185 ? -15.109 -12.615 -15.282 1.00  9.89  ? 1638 VAL A CA   1 
ATOM   2867 C  C    . VAL A 1 185 ? -16.015 -13.770 -15.747 1.00  10.55 ? 1638 VAL A C    1 
ATOM   2868 O  O    . VAL A 1 185 ? -15.542 -14.769 -16.280 1.00  11.37 ? 1638 VAL A O    1 
ATOM   2869 C  CB   . VAL A 1 185 ? -14.760 -11.668 -16.448 1.00  11.08 ? 1638 VAL A CB   1 
ATOM   2870 C  CG1  . VAL A 1 185 ? -15.998 -11.279 -17.241 1.00  12.78 ? 1638 VAL A CG1  1 
ATOM   2871 C  CG2  . VAL A 1 185 ? -14.084 -10.418 -15.901 1.00  11.81 ? 1638 VAL A CG2  1 
ATOM   2872 H  H    . VAL A 1 185 ? -13.530 -13.766 -15.171 1.00  11.78 ? 1638 VAL A H    1 
ATOM   2873 H  HA   . VAL A 1 185 ? -15.596 -12.099 -14.606 1.00  11.87 ? 1638 VAL A HA   1 
ATOM   2874 H  HB   . VAL A 1 185 ? -14.134 -12.117 -17.054 1.00  13.29 ? 1638 VAL A HB   1 
ATOM   2875 H  HG11 . VAL A 1 185 ? -16.615 -10.833 -16.657 1.00  15.33 ? 1638 VAL A HG11 1 
ATOM   2876 H  HG12 . VAL A 1 185 ? -15.739 -10.692 -17.955 1.00  15.33 ? 1638 VAL A HG12 1 
ATOM   2877 H  HG13 . VAL A 1 185 ? -16.401 -12.073 -17.600 1.00  15.33 ? 1638 VAL A HG13 1 
ATOM   2878 H  HG21 . VAL A 1 185 ? -13.282 -10.674 -15.440 1.00  14.17 ? 1638 VAL A HG21 1 
ATOM   2879 H  HG22 . VAL A 1 185 ? -13.870 -9.833  -16.632 1.00  14.17 ? 1638 VAL A HG22 1 
ATOM   2880 H  HG23 . VAL A 1 185 ? -14.684 -9.978  -15.295 1.00  14.17 ? 1638 VAL A HG23 1 
ATOM   2881 N  N    . ALA A 1 186 ? -17.308 -13.600 -15.539 1.00  10.73 ? 1639 ALA A N    1 
ATOM   2882 C  CA   . ALA A 1 186 ? -18.298 -14.592 -15.919 1.00  10.77 ? 1639 ALA A CA   1 
ATOM   2883 C  C    . ALA A 1 186 ? -18.902 -14.269 -17.275 1.00  11.80 ? 1639 ALA A C    1 
ATOM   2884 O  O    . ALA A 1 186 ? -18.959 -13.109 -17.678 1.00  12.17 ? 1639 ALA A O    1 
ATOM   2885 C  CB   . ALA A 1 186 ? -19.402 -14.645 -14.864 1.00  12.27 ? 1639 ALA A CB   1 
ATOM   2886 H  H    . ALA A 1 186 ? -17.646 -12.901 -15.169 1.00  12.87 ? 1639 ALA A H    1 
ATOM   2887 H  HA   . ALA A 1 186 ? -17.874 -15.474 -15.970 1.00  12.93 ? 1639 ALA A HA   1 
ATOM   2888 H  HB1  . ALA A 1 186 ? -19.817 -13.782 -14.804 1.00  14.73 ? 1639 ALA A HB1  1 
ATOM   2889 H  HB2  . ALA A 1 186 ? -20.050 -15.303 -15.124 1.00  14.73 ? 1639 ALA A HB2  1 
ATOM   2890 H  HB3  . ALA A 1 186 ? -19.014 -14.882 -14.019 1.00  14.73 ? 1639 ALA A HB3  1 
ATOM   2891 N  N    . PRO A 1 187 ? -19.353 -15.298 -17.996 1.00  12.34 ? 1640 PRO A N    1 
ATOM   2892 C  CA   . PRO A 1 187 ? -19.791 -15.074 -19.372 1.00  12.54 ? 1640 PRO A CA   1 
ATOM   2893 C  C    . PRO A 1 187 ? -20.973 -14.126 -19.511 1.00  12.55 ? 1640 PRO A C    1 
ATOM   2894 O  O    . PRO A 1 187 ? -21.048 -13.418 -20.508 1.00  12.68 ? 1640 PRO A O    1 
ATOM   2895 C  CB   . PRO A 1 187 ? -20.179 -16.472 -19.858 1.00  14.52 ? 1640 PRO A CB   1 
ATOM   2896 C  CG   . PRO A 1 187 ? -19.554 -17.386 -18.968 1.00  16.15 ? 1640 PRO A CG   1 
ATOM   2897 C  CD   . PRO A 1 187 ? -19.320 -16.727 -17.653 1.00  13.62 ? 1640 PRO A CD   1 
ATOM   2898 H  HA   . PRO A 1 187 ? -19.045 -14.741 -19.914 1.00  15.05 ? 1640 PRO A HA   1 
ATOM   2899 H  HB2  . PRO A 1 187 ? -21.143 -16.570 -19.825 1.00  17.43 ? 1640 PRO A HB2  1 
ATOM   2900 H  HB3  . PRO A 1 187 ? -19.854 -16.602 -20.763 1.00  17.43 ? 1640 PRO A HB3  1 
ATOM   2901 H  HG2  . PRO A 1 187 ? -20.133 -18.155 -18.852 1.00  19.38 ? 1640 PRO A HG2  1 
ATOM   2902 H  HG3  . PRO A 1 187 ? -18.708 -17.666 -19.351 1.00  19.38 ? 1640 PRO A HG3  1 
ATOM   2903 H  HD2  . PRO A 1 187 ? -20.033 -16.945 -17.033 1.00  16.35 ? 1640 PRO A HD2  1 
ATOM   2904 H  HD3  . PRO A 1 187 ? -18.450 -16.972 -17.300 1.00  16.35 ? 1640 PRO A HD3  1 
ATOM   2905 N  N    . HIS A 1 188 ? -21.887 -14.112 -18.550 1.00  12.31 ? 1641 HIS A N    1 
ATOM   2906 C  CA   . HIS A 1 188 ? -23.022 -13.206 -18.673 1.00  12.62 ? 1641 HIS A CA   1 
ATOM   2907 C  C    . HIS A 1 188 ? -22.612 -11.740 -18.658 1.00  12.64 ? 1641 HIS A C    1 
ATOM   2908 O  O    . HIS A 1 188 ? -23.341 -10.908 -19.191 1.00  14.41 ? 1641 HIS A O    1 
ATOM   2909 C  CB   . HIS A 1 188 ? -24.106 -13.484 -17.631 1.00  12.85 ? 1641 HIS A CB   1 
ATOM   2910 C  CG   . HIS A 1 188 ? -23.600 -13.841 -16.267 1.00  12.56 ? 1641 HIS A CG   1 
ATOM   2911 N  ND1  . HIS A 1 188 ? -23.083 -15.084 -15.959 1.00  13.47 ? 1641 HIS A ND1  1 
ATOM   2912 C  CD2  . HIS A 1 188 ? -23.592 -13.135 -15.114 1.00  13.17 ? 1641 HIS A CD2  1 
ATOM   2913 C  CE1  . HIS A 1 188 ? -22.784 -15.126 -14.675 1.00  13.79 ? 1641 HIS A CE1  1 
ATOM   2914 N  NE2  . HIS A 1 188 ? -23.084 -13.958 -14.137 1.00  13.07 ? 1641 HIS A NE2  1 
ATOM   2915 H  H    . HIS A 1 188 ? -21.877 -14.598 -17.841 1.00  14.77 ? 1641 HIS A H    1 
ATOM   2916 H  HA   . HIS A 1 188 ? -23.432 -13.369 -19.548 1.00  15.14 ? 1641 HIS A HA   1 
ATOM   2917 H  HB2  . HIS A 1 188 ? -24.656 -12.690 -17.540 1.00  15.42 ? 1641 HIS A HB2  1 
ATOM   2918 H  HB3  . HIS A 1 188 ? -24.652 -14.223 -17.943 1.00  15.42 ? 1641 HIS A HB3  1 
ATOM   2919 H  HD1  . HIS A 1 188 ? -22.990 -15.735 -16.513 1.00  16.17 ? 1641 HIS A HD1  1 
ATOM   2920 H  HD2  . HIS A 1 188 ? -23.894 -12.263 -14.998 1.00  15.81 ? 1641 HIS A HD2  1 
ATOM   2921 H  HE1  . HIS A 1 188 ? -22.404 -15.849 -14.229 1.00  16.55 ? 1641 HIS A HE1  1 
ATOM   2922 H  HE2  . HIS A 1 188 ? -22.956 -13.738 -13.315 1.00  15.68 ? 1641 HIS A HE2  1 
ATOM   2923 N  N    . HIS A 1 189 ? -21.467 -11.416 -18.055 1.00  11.81 ? 1642 HIS A N    1 
ATOM   2924 C  CA   . HIS A 1 189 ? -21.003 -10.024 -18.047 1.00  11.37 ? 1642 HIS A CA   1 
ATOM   2925 C  C    . HIS A 1 189 ? -20.233 -9.646  -19.298 1.00  11.69 ? 1642 HIS A C    1 
ATOM   2926 O  O    . HIS A 1 189 ? -19.916 -8.467  -19.504 1.00  12.66 ? 1642 HIS A O    1 
ATOM   2927 C  CB   . HIS A 1 189 ? -20.239 -9.743  -16.758 1.00  11.56 ? 1642 HIS A CB   1 
ATOM   2928 C  CG   . HIS A 1 189 ? -21.114 -9.852  -15.551 1.00  11.79 ? 1642 HIS A CG   1 
ATOM   2929 N  ND1  . HIS A 1 189 ? -20.863 -10.708 -14.503 1.00  12.21 ? 1642 HIS A ND1  1 
ATOM   2930 C  CD2  . HIS A 1 189 ? -22.283 -9.236  -15.262 1.00  12.30 ? 1642 HIS A CD2  1 
ATOM   2931 C  CE1  . HIS A 1 189 ? -21.825 -10.603 -13.609 1.00  12.12 ? 1642 HIS A CE1  1 
ATOM   2932 N  NE2  . HIS A 1 189 ? -22.710 -9.725  -14.052 1.00  12.16 ? 1642 HIS A NE2  1 
ATOM   2933 H  H    . HIS A 1 189 ? -20.948 -11.970 -17.650 1.00  14.17 ? 1642 HIS A H    1 
ATOM   2934 H  HA   . HIS A 1 189 ? -21.798 -9.450  -18.029 1.00  13.64 ? 1642 HIS A HA   1 
ATOM   2935 H  HB2  . HIS A 1 189 ? -19.519 -10.386 -16.668 1.00  13.87 ? 1642 HIS A HB2  1 
ATOM   2936 H  HB3  . HIS A 1 189 ? -19.880 -8.842  -16.791 1.00  13.87 ? 1642 HIS A HB3  1 
ATOM   2937 H  HD1  . HIS A 1 189 ? -20.179 -11.226 -14.437 1.00  14.65 ? 1642 HIS A HD1  1 
ATOM   2938 H  HD2  . HIS A 1 189 ? -22.721 -8.608  -15.789 1.00  14.76 ? 1642 HIS A HD2  1 
ATOM   2939 H  HE1  . HIS A 1 189 ? -21.878 -11.072 -12.808 1.00  14.54 ? 1642 HIS A HE1  1 
ATOM   2940 H  HE2  . HIS A 1 189 ? -23.423 -9.479  -13.637 1.00  14.60 ? 1642 HIS A HE2  1 
ATOM   2941 N  N    . LEU A 1 190 ? -19.963 -10.645 -20.140 1.00  11.99 ? 1643 LEU A N    1 
ATOM   2942 C  CA   . LEU A 1 190 ? -19.350 -10.427 -21.451 1.00  12.00 ? 1643 LEU A CA   1 
ATOM   2943 C  C    . LEU A 1 190 ? -20.328 -10.471 -22.611 1.00  12.84 ? 1643 LEU A C    1 
ATOM   2944 O  O    . LEU A 1 190 ? -20.044 -9.907  -23.674 1.00  13.86 ? 1643 LEU A O    1 
ATOM   2945 C  CB   . LEU A 1 190 ? -18.263 -11.466 -21.723 1.00  12.57 ? 1643 LEU A CB   1 
ATOM   2946 C  CG   . LEU A 1 190 ? -17.047 -11.359 -20.819 1.00  13.94 ? 1643 LEU A CG   1 
ATOM   2947 C  CD1  . LEU A 1 190 ? -16.169 -12.597 -21.010 1.00  15.62 ? 1643 LEU A CD1  1 
ATOM   2948 C  CD2  . LEU A 1 190 ? -16.243 -10.085 -21.107 1.00  14.41 ? 1643 LEU A CD2  1 
ATOM   2949 H  H    . LEU A 1 190 ? -20.128 -11.472 -19.972 1.00  14.39 ? 1643 LEU A H    1 
ATOM   2950 H  HA   . LEU A 1 190 ? -18.926 -9.543  -21.454 1.00  14.40 ? 1643 LEU A HA   1 
ATOM   2951 H  HB2  . LEU A 1 190 ? -18.643 -12.350 -21.602 1.00  15.09 ? 1643 LEU A HB2  1 
ATOM   2952 H  HB3  . LEU A 1 190 ? -17.959 -11.364 -22.638 1.00  15.09 ? 1643 LEU A HB3  1 
ATOM   2953 H  HG   . LEU A 1 190 ? -17.337 -11.333 -19.894 1.00  16.73 ? 1643 LEU A HG   1 
ATOM   2954 H  HD11 . LEU A 1 190 ? -15.891 -12.644 -21.928 1.00  18.74 ? 1643 LEU A HD11 1 
ATOM   2955 H  HD12 . LEU A 1 190 ? -15.402 -12.527 -20.438 1.00  18.74 ? 1643 LEU A HD12 1 
ATOM   2956 H  HD13 . LEU A 1 190 ? -16.678 -13.378 -20.782 1.00  18.74 ? 1643 LEU A HD13 1 
ATOM   2957 H  HD21 . LEU A 1 190 ? -16.806 -9.322  -20.959 1.00  17.29 ? 1643 LEU A HD21 1 
ATOM   2958 H  HD22 . LEU A 1 190 ? -15.486 -10.054 -20.518 1.00  17.29 ? 1643 LEU A HD22 1 
ATOM   2959 H  HD23 . LEU A 1 190 ? -15.948 -10.103 -22.021 1.00  17.29 ? 1643 LEU A HD23 1 
ATOM   2960 N  N    . PHE A 1 191 ? -21.449 -11.172 -22.422 1.00  13.48 ? 1644 PHE A N    1 
ATOM   2961 C  CA   . PHE A 1 191 ? -22.351 -11.500 -23.523 1.00  14.15 ? 1644 PHE A CA   1 
ATOM   2962 C  C    . PHE A 1 191 ? -23.794 -11.061 -23.301 1.00  15.45 ? 1644 PHE A C    1 
ATOM   2963 O  O    . PHE A 1 191 ? -24.626 -11.256 -24.190 1.00  17.75 ? 1644 PHE A O    1 
ATOM   2964 C  CB   . PHE A 1 191 ? -22.321 -13.011 -23.793 1.00  15.21 ? 1644 PHE A CB   1 
ATOM   2965 C  CG   . PHE A 1 191 ? -20.981 -13.513 -24.274 1.00  14.53 ? 1644 PHE A CG   1 
ATOM   2966 C  CD1  . PHE A 1 191 ? -20.534 -13.227 -25.551 1.00  16.42 ? 1644 PHE A CD1  1 
ATOM   2967 C  CD2  . PHE A 1 191 ? -20.158 -14.250 -23.442 1.00  14.15 ? 1644 PHE A CD2  1 
ATOM   2968 C  CE1  . PHE A 1 191 ? -19.308 -13.691 -25.997 1.00  17.18 ? 1644 PHE A CE1  1 
ATOM   2969 C  CE2  . PHE A 1 191 ? -18.913 -14.705 -23.878 1.00  14.72 ? 1644 PHE A CE2  1 
ATOM   2970 C  CZ   . PHE A 1 191 ? -18.494 -14.431 -25.155 1.00  15.22 ? 1644 PHE A CZ   1 
ATOM   2971 H  H    . PHE A 1 191 ? -21.710 -11.470 -21.659 1.00  16.18 ? 1644 PHE A H    1 
ATOM   2972 H  HA   . PHE A 1 191 ? -22.028 -11.050 -24.332 1.00  16.98 ? 1644 PHE A HA   1 
ATOM   2973 H  HB2  . PHE A 1 191 ? -22.537 -13.479 -22.971 1.00  18.26 ? 1644 PHE A HB2  1 
ATOM   2974 H  HB3  . PHE A 1 191 ? -22.979 -13.220 -24.474 1.00  18.26 ? 1644 PHE A HB3  1 
ATOM   2975 H  HD1  . PHE A 1 191 ? -21.074 -12.736 -26.126 1.00  19.71 ? 1644 PHE A HD1  1 
ATOM   2976 H  HD2  . PHE A 1 191 ? -20.438 -14.444 -22.577 1.00  16.98 ? 1644 PHE A HD2  1 
ATOM   2977 H  HE1  . PHE A 1 191 ? -19.024 -13.494 -26.860 1.00  20.62 ? 1644 PHE A HE1  1 
ATOM   2978 H  HE2  . PHE A 1 191 ? -18.375 -15.207 -23.309 1.00  17.66 ? 1644 PHE A HE2  1 
ATOM   2979 H  HZ   . PHE A 1 191 ? -17.667 -14.735 -25.452 1.00  18.26 ? 1644 PHE A HZ   1 
ATOM   2980 N  N    . LEU A 1 192 ? -24.090 -10.497 -22.131 1.00  14.95 ? 1645 LEU A N    1 
ATOM   2981 C  CA   . LEU A 1 192 ? -25.407 -9.927  -21.844 1.00  14.73 ? 1645 LEU A CA   1 
ATOM   2982 C  C    . LEU A 1 192 ? -25.218 -8.547  -21.232 1.00  14.52 ? 1645 LEU A C    1 
ATOM   2983 O  O    . LEU A 1 192 ? -24.167 -8.245  -20.668 1.00  15.41 ? 1645 LEU A O    1 
ATOM   2984 C  CB   . LEU A 1 192 ? -26.198 -10.806 -20.871 1.00  14.53 ? 1645 LEU A CB   1 
ATOM   2985 C  CG   . LEU A 1 192 ? -26.620 -12.197 -21.349 1.00  15.27 ? 1645 LEU A CG   1 
ATOM   2986 C  CD1  . LEU A 1 192 ? -27.142 -13.040 -20.194 1.00  14.91 ? 1645 LEU A CD1  1 
ATOM   2987 C  CD2  . LEU A 1 192 ? -27.688 -12.097 -22.449 1.00  16.61 ? 1645 LEU A CD2  1 
ATOM   2988 H  H    . LEU A 1 192 ? -23.536 -10.432 -21.476 1.00  17.94 ? 1645 LEU A H    1 
ATOM   2989 H  HA   . LEU A 1 192 ? -25.918 -9.836  -22.675 1.00  17.68 ? 1645 LEU A HA   1 
ATOM   2990 H  HB2  . LEU A 1 192 ? -25.658 -10.932 -20.075 1.00  17.44 ? 1645 LEU A HB2  1 
ATOM   2991 H  HB3  . LEU A 1 192 ? -27.010 -10.331 -20.631 1.00  17.44 ? 1645 LEU A HB3  1 
ATOM   2992 H  HG   . LEU A 1 192 ? -25.847 -12.648 -21.723 1.00  18.33 ? 1645 LEU A HG   1 
ATOM   2993 H  HD11 . LEU A 1 192 ? -27.903 -12.601 -19.806 1.00  17.89 ? 1645 LEU A HD11 1 
ATOM   2994 H  HD12 . LEU A 1 192 ? -27.397 -13.903 -20.528 1.00  17.89 ? 1645 LEU A HD12 1 
ATOM   2995 H  HD13 . LEU A 1 192 ? -26.448 -13.134 -19.538 1.00  17.89 ? 1645 LEU A HD13 1 
ATOM   2996 H  HD21 . LEU A 1 192 ? -27.326 -11.607 -23.192 1.00  19.93 ? 1645 LEU A HD21 1 
ATOM   2997 H  HD22 . LEU A 1 192 ? -27.932 -12.982 -22.729 1.00  19.93 ? 1645 LEU A HD22 1 
ATOM   2998 H  HD23 . LEU A 1 192 ? -28.456 -11.641 -22.098 1.00  19.93 ? 1645 LEU A HD23 1 
ATOM   2999 N  N    . SER A 1 193 ? -26.247 -7.718  -21.349 1.00  15.78 ? 1646 SER A N    1 
ATOM   3000 C  CA   . SER A 1 193 ? -26.206 -6.375  -20.793 1.00  16.29 ? 1646 SER A CA   1 
ATOM   3001 C  C    . SER A 1 193 ? -27.622 -5.912  -20.458 1.00  17.16 ? 1646 SER A C    1 
ATOM   3002 O  O    . SER A 1 193 ? -28.592 -6.648  -20.629 1.00  17.89 ? 1646 SER A O    1 
ATOM   3003 C  CB   . SER A 1 193 ? -25.580 -5.399  -21.793 1.00  17.87 ? 1646 SER A CB   1 
ATOM   3004 O  OG   . SER A 1 193 ? -26.496 -5.105  -22.852 1.00  19.90 ? 1646 SER A OG   1 
ATOM   3005 H  H    . SER A 1 193 ? -26.984 -7.911  -21.747 1.00  18.93 ? 1646 SER A H    1 
ATOM   3006 H  HA   . SER A 1 193 ? -25.671 -6.372  -19.972 1.00  19.55 ? 1646 SER A HA   1 
ATOM   3007 H  HB2  . SER A 1 193 ? -25.353 -4.576  -21.333 1.00  21.44 ? 1646 SER A HB2  1 
ATOM   3008 H  HB3  . SER A 1 193 ? -24.781 -5.801  -22.169 1.00  21.44 ? 1646 SER A HB3  1 
ATOM   3009 H  HG   . SER A 1 193 ? -27.199 -5.512  -22.736 1.00  23.88 ? 1646 SER A HG   1 
ATOM   3010 N  N    . HIS A 1 194 ? -27.735 -4.672  -20.009 1.00  19.15 ? 1647 HIS A N    1 
ATOM   3011 C  CA   . HIS A 1 194 ? -29.036 -4.022  -19.823 1.00  20.67 ? 1647 HIS A CA   1 
ATOM   3012 C  C    . HIS A 1 194 ? -29.944 -4.205  -21.019 1.00  22.26 ? 1647 HIS A C    1 
ATOM   3013 O  O    . HIS A 1 194 ? -31.164 -4.289  -20.875 1.00  23.11 ? 1647 HIS A O    1 
ATOM   3014 C  CB   . HIS A 1 194 ? -28.841 -2.516  -19.611 1.00  21.65 ? 1647 HIS A CB   1 
ATOM   3015 C  CG   . HIS A 1 194 ? -28.178 -2.161  -18.320 1.00  22.60 ? 1647 HIS A CG   1 
ATOM   3016 N  ND1  . HIS A 1 194 ? -27.744 -0.884  -18.037 1.00  24.08 ? 1647 HIS A ND1  1 
ATOM   3017 C  CD2  . HIS A 1 194 ? -27.876 -2.912  -17.235 1.00  23.86 ? 1647 HIS A CD2  1 
ATOM   3018 C  CE1  . HIS A 1 194 ? -27.198 -0.863  -16.834 1.00  24.57 ? 1647 HIS A CE1  1 
ATOM   3019 N  NE2  . HIS A 1 194 ? -27.259 -2.083  -16.328 1.00  24.51 ? 1647 HIS A NE2  1 
ATOM   3020 H  H    . HIS A 1 194 ? -27.066 -4.173  -19.801 1.00  22.98 ? 1647 HIS A H    1 
ATOM   3021 H  HA   . HIS A 1 194 ? -29.480 -4.394  -19.032 1.00  24.80 ? 1647 HIS A HA   1 
ATOM   3022 H  HB2  . HIS A 1 194 ? -28.291 -2.169  -20.331 1.00  25.98 ? 1647 HIS A HB2  1 
ATOM   3023 H  HB3  . HIS A 1 194 ? -29.710 -2.085  -19.625 1.00  25.98 ? 1647 HIS A HB3  1 
ATOM   3024 H  HD1  . HIS A 1 194 ? -27.815 -0.206  -18.562 1.00  28.90 ? 1647 HIS A HD1  1 
ATOM   3025 H  HD2  . HIS A 1 194 ? -28.044 -3.821  -17.128 1.00  28.64 ? 1647 HIS A HD2  1 
ATOM   3026 H  HE1  . HIS A 1 194 ? -26.829 -0.119  -16.416 1.00  29.49 ? 1647 HIS A HE1  1 
ATOM   3027 H  HE2  . HIS A 1 194 ? -26.972 -2.317  -15.552 1.00  29.42 ? 1647 HIS A HE2  1 
ATOM   3028 N  N    . ASP A 1 195 ? -29.367 -4.228  -22.211 1.00  22.81 ? 1648 ASP A N    1 
ATOM   3029 C  CA   . ASP A 1 195 ? -30.173 -4.351  -23.420 1.00  25.41 ? 1648 ASP A CA   1 
ATOM   3030 C  C    . ASP A 1 195 ? -30.965 -5.660  -23.429 1.00  24.54 ? 1648 ASP A C    1 
ATOM   3031 O  O    . ASP A 1 195 ? -31.955 -5.793  -24.151 1.00  27.00 ? 1648 ASP A O    1 
ATOM   3032 C  CB   . ASP A 1 195 ? -29.293 -4.283  -24.671 1.00  29.11 ? 1648 ASP A CB   1 
ATOM   3033 C  CG   . ASP A 1 195 ? -28.626 -2.929  -24.856 1.00  33.76 ? 1648 ASP A CG   1 
ATOM   3034 O  OD1  . ASP A 1 195 ? -28.995 -1.956  -24.163 1.00  36.09 ? 1648 ASP A OD1  1 
ATOM   3035 O  OD2  . ASP A 1 195 ? -27.724 -2.840  -25.716 1.00  35.75 ? 1648 ASP A OD2  1 
ATOM   3036 H  H    . ASP A 1 195 ? -28.520 -4.174  -22.350 1.00  27.38 ? 1648 ASP A H    1 
ATOM   3037 H  HA   . ASP A 1 195 ? -30.812 -3.609  -23.456 1.00  30.49 ? 1648 ASP A HA   1 
ATOM   3038 H  HB2  . ASP A 1 195 ? -28.595 -4.954  -24.603 1.00  34.93 ? 1648 ASP A HB2  1 
ATOM   3039 H  HB3  . ASP A 1 195 ? -29.842 -4.456  -25.452 1.00  34.93 ? 1648 ASP A HB3  1 
ATOM   3040 N  N    . ASP A 1 196 ? -30.532 -6.632  -22.632 1.00  21.94 ? 1649 ASP A N    1 
ATOM   3041 C  CA   . ASP A 1 196 ? -31.213 -7.930  -22.594 1.00  21.61 ? 1649 ASP A CA   1 
ATOM   3042 C  C    . ASP A 1 196 ? -32.295 -8.051  -21.523 1.00  22.41 ? 1649 ASP A C    1 
ATOM   3043 O  O    . ASP A 1 196 ? -33.029 -9.048  -21.489 1.00  22.77 ? 1649 ASP A O    1 
ATOM   3044 C  CB   . ASP A 1 196 ? -30.184 -9.041  -22.408 1.00  21.46 ? 1649 ASP A CB   1 
ATOM   3045 C  CG   . ASP A 1 196 ? -29.194 -9.086  -23.546 1.00  22.84 ? 1649 ASP A CG   1 
ATOM   3046 O  OD1  . ASP A 1 196 ? -29.587 -9.522  -24.651 1.00  26.56 ? 1649 ASP A OD1  1 
ATOM   3047 O  OD2  . ASP A 1 196 ? -28.034 -8.681  -23.350 1.00  22.62 ? 1649 ASP A OD2  1 
ATOM   3048 H  H    . ASP A 1 196 ? -29.854 -6.570  -22.106 1.00  26.33 ? 1649 ASP A H    1 
ATOM   3049 H  HA   . ASP A 1 196 ? -31.645 -8.074  -23.462 1.00  25.93 ? 1649 ASP A HA   1 
ATOM   3050 H  HB2  . ASP A 1 196 ? -29.693 -8.887  -21.586 1.00  25.75 ? 1649 ASP A HB2  1 
ATOM   3051 H  HB3  . ASP A 1 196 ? -30.641 -9.896  -22.371 1.00  25.75 ? 1649 ASP A HB3  1 
ATOM   3052 N  N    . LEU A 1 197 ? -32.422 -7.044  -20.666 1.00  21.95 ? 1650 LEU A N    1 
ATOM   3053 C  CA   . LEU A 1 197 ? -33.368 -7.131  -19.555 1.00  22.92 ? 1650 LEU A CA   1 
ATOM   3054 C  C    . LEU A 1 197 ? -34.828 -7.152  -20.010 1.00  24.62 ? 1650 LEU A C    1 
ATOM   3055 O  O    . LEU A 1 197 ? -35.670 -7.773  -19.355 1.00  25.38 ? 1650 LEU A O    1 
ATOM   3056 C  CB   . LEU A 1 197 ? -33.129 -6.002  -18.550 1.00  23.11 ? 1650 LEU A CB   1 
ATOM   3057 C  CG   . LEU A 1 197 ? -31.879 -6.189  -17.692 1.00  24.99 ? 1650 LEU A CG   1 
ATOM   3058 C  CD1  . LEU A 1 197 ? -31.660 -4.940  -16.859 1.00  26.12 ? 1650 LEU A CD1  1 
ATOM   3059 C  CD2  . LEU A 1 197 ? -32.010 -7.415  -16.802 1.00  26.14 ? 1650 LEU A CD2  1 
ATOM   3060 H  H    . LEU A 1 197 ? -31.980 -6.307  -20.702 1.00  26.34 ? 1650 LEU A H    1 
ATOM   3061 H  HA   . LEU A 1 197 ? -33.203 -7.974  -19.083 1.00  27.51 ? 1650 LEU A HA   1 
ATOM   3062 H  HB2  . LEU A 1 197 ? -33.032 -5.168  -19.036 1.00  27.74 ? 1650 LEU A HB2  1 
ATOM   3063 H  HB3  . LEU A 1 197 ? -33.892 -5.948  -17.954 1.00  27.74 ? 1650 LEU A HB3  1 
ATOM   3064 H  HG   . LEU A 1 197 ? -31.108 -6.311  -18.269 1.00  29.99 ? 1650 LEU A HG   1 
ATOM   3065 H  HD11 . LEU A 1 197 ? -32.426 -4.802  -16.297 1.00  31.35 ? 1650 LEU A HD11 1 
ATOM   3066 H  HD12 . LEU A 1 197 ? -30.875 -5.058  -16.320 1.00  31.35 ? 1650 LEU A HD12 1 
ATOM   3067 H  HD13 . LEU A 1 197 ? -31.545 -4.190  -17.447 1.00  31.35 ? 1650 LEU A HD13 1 
ATOM   3068 H  HD21 . LEU A 1 197 ? -32.129 -8.191  -17.355 1.00  31.36 ? 1650 LEU A HD21 1 
ATOM   3069 H  HD22 . LEU A 1 197 ? -31.212 -7.506  -16.277 1.00  31.36 ? 1650 LEU A HD22 1 
ATOM   3070 H  HD23 . LEU A 1 197 ? -32.770 -7.303  -16.227 1.00  31.36 ? 1650 LEU A HD23 1 
ATOM   3071 N  N    . GLU A 1 198 ? -35.142 -6.488  -21.121 1.00  25.47 ? 1651 GLU A N    1 
ATOM   3072 C  CA   . GLU A 1 198 ? -36.513 -6.517  -21.622 1.00  27.89 ? 1651 GLU A CA   1 
ATOM   3073 C  C    . GLU A 1 198 ? -36.907 -7.942  -21.979 1.00  27.44 ? 1651 GLU A C    1 
ATOM   3074 O  O    . GLU A 1 198 ? -38.013 -8.397  -21.652 1.00  30.06 ? 1651 GLU A O    1 
ATOM   3075 C  CB   . GLU A 1 198 ? -36.668 -5.616  -22.846 1.00  30.79 ? 1651 GLU A CB   1 
ATOM   3076 C  CG   . GLU A 1 198 ? -38.117 -5.495  -23.288 1.00  34.32 ? 1651 GLU A CG   1 
ATOM   3077 C  CD   . GLU A 1 198 ? -38.301 -4.708  -24.574 1.00  38.50 ? 1651 GLU A CD   1 
ATOM   3078 O  OE1  . GLU A 1 198 ? -37.347 -4.029  -25.014 1.00  40.91 ? 1651 GLU A OE1  1 
ATOM   3079 O  OE2  . GLU A 1 198 ? -39.416 -4.763  -25.138 1.00  40.23 ? 1651 GLU A OE2  1 
ATOM   3080 H  H    . GLU A 1 198 ? -34.594 -6.024  -21.593 1.00  30.56 ? 1651 GLU A H    1 
ATOM   3081 H  HA   . GLU A 1 198 ? -37.120 -6.195  -20.924 1.00  33.47 ? 1651 GLU A HA   1 
ATOM   3082 H  HB2  . GLU A 1 198 ? -36.343 -4.728  -22.630 1.00  36.95 ? 1651 GLU A HB2  1 
ATOM   3083 H  HB3  . GLU A 1 198 ? -36.158 -5.989  -23.582 1.00  36.95 ? 1651 GLU A HB3  1 
ATOM   3084 H  HG2  . GLU A 1 198 ? -38.476 -6.385  -23.431 1.00  41.18 ? 1651 GLU A HG2  1 
ATOM   3085 H  HG3  . GLU A 1 198 ? -38.620 -5.046  -22.591 1.00  41.18 ? 1651 GLU A HG3  1 
ATOM   3086 N  N    . ARG A 1 199 ? -36.001 -8.654  -22.644 1.00  25.83 ? 1652 ARG A N    1 
ATOM   3087 C  CA   . ARG A 1 199 ? -36.270 -10.032 -23.049 1.00  24.81 ? 1652 ARG A CA   1 
ATOM   3088 C  C    . ARG A 1 199 ? -36.331 -10.958 -21.839 1.00  24.78 ? 1652 ARG A C    1 
ATOM   3089 O  O    . ARG A 1 199 ? -37.224 -11.794 -21.738 1.00  25.45 ? 1652 ARG A O    1 
ATOM   3090 C  CB   . ARG A 1 199 ? -35.189 -10.526 -24.012 1.00  25.53 ? 1652 ARG A CB   1 
ATOM   3091 C  CG   . ARG A 1 199 ? -35.273 -12.023 -24.320 1.00  26.26 ? 1652 ARG A CG   1 
ATOM   3092 C  CD   . ARG A 1 199 ? -34.187 -12.478 -25.294 1.00  26.81 ? 1652 ARG A CD   1 
ATOM   3093 N  NE   . ARG A 1 199 ? -32.818 -12.260 -24.819 1.00  26.84 ? 1652 ARG A NE   1 
ATOM   3094 C  CZ   . ARG A 1 199 ? -32.126 -13.100 -24.048 1.00  27.70 ? 1652 ARG A CZ   1 
ATOM   3095 N  NH1  . ARG A 1 199 ? -32.661 -14.239 -23.621 1.00  27.99 ? 1652 ARG A NH1  1 
ATOM   3096 N  NH2  . ARG A 1 199 ? -30.875 -12.797 -23.701 1.00  27.71 ? 1652 ARG A NH2  1 
ATOM   3097 H  H    . ARG A 1 199 ? -35.225 -8.363  -22.872 1.00  31.00 ? 1652 ARG A H    1 
ATOM   3098 H  HA   . ARG A 1 199 ? -37.133 -10.072 -23.510 1.00  29.77 ? 1652 ARG A HA   1 
ATOM   3099 H  HB2  . ARG A 1 199 ? -35.274 -10.045 -24.850 1.00  30.64 ? 1652 ARG A HB2  1 
ATOM   3100 H  HB3  . ARG A 1 199 ? -34.318 -10.352 -23.620 1.00  30.64 ? 1652 ARG A HB3  1 
ATOM   3101 H  HG2  . ARG A 1 199 ? -35.168 -12.524 -23.496 1.00  31.51 ? 1652 ARG A HG2  1 
ATOM   3102 H  HG3  . ARG A 1 199 ? -36.136 -12.217 -24.719 1.00  31.51 ? 1652 ARG A HG3  1 
ATOM   3103 H  HD2  . ARG A 1 199 ? -34.294 -13.428 -25.458 1.00  32.17 ? 1652 ARG A HD2  1 
ATOM   3104 H  HD3  . ARG A 1 199 ? -34.291 -11.989 -26.126 1.00  32.17 ? 1652 ARG A HD3  1 
ATOM   3105 H  HE   . ARG A 1 199 ? -32.430 -11.530 -25.056 1.00  32.20 ? 1652 ARG A HE   1 
ATOM   3106 H  HH11 . ARG A 1 199 ? -33.465 -14.447 -23.845 1.00  33.26 ? 1652 ARG A HH11 1 
ATOM   3107 H  HH12 . ARG A 1 199 ? -32.202 -14.770 -23.123 1.00  33.26 ? 1652 ARG A HH12 1 
ATOM   3108 H  HH21 . ARG A 1 199 ? -30.522 -12.060 -23.968 1.00  33.59 ? 1652 ARG A HH21 1 
ATOM   3109 H  HH22 . ARG A 1 199 ? -30.428 -13.331 -23.197 1.00  33.59 ? 1652 ARG A HH22 1 
ATOM   3110 N  N    . LEU A 1 200 ? -35.357 -10.827 -20.938 1.00  23.73 ? 1653 LEU A N    1 
ATOM   3111 C  CA   . LEU A 1 200 ? -35.271 -11.717 -19.777 1.00  22.57 ? 1653 LEU A CA   1 
ATOM   3112 C  C    . LEU A 1 200 ? -36.407 -11.514 -18.778 1.00  23.40 ? 1653 LEU A C    1 
ATOM   3113 O  O    . LEU A 1 200 ? -36.905 -12.474 -18.173 1.00  24.11 ? 1653 LEU A O    1 
ATOM   3114 C  CB   . LEU A 1 200 ? -33.931 -11.537 -19.059 1.00  21.18 ? 1653 LEU A CB   1 
ATOM   3115 C  CG   . LEU A 1 200 ? -32.745 -12.074 -19.845 1.00  21.74 ? 1653 LEU A CG   1 
ATOM   3116 C  CD1  . LEU A 1 200 ? -31.457 -11.629 -19.185 1.00  22.07 ? 1653 LEU A CD1  1 
ATOM   3117 C  CD2  . LEU A 1 200 ? -32.819 -13.605 -19.929 1.00  23.05 ? 1653 LEU A CD2  1 
ATOM   3118 H  H    . LEU A 1 200 ? -34.735 -10.234 -20.974 1.00  28.47 ? 1653 LEU A H    1 
ATOM   3119 H  HA   . LEU A 1 200 ? -35.317 -12.644 -20.091 1.00  27.09 ? 1653 LEU A HA   1 
ATOM   3120 H  HB2  . LEU A 1 200 ? -33.782 -10.591 -18.905 1.00  25.42 ? 1653 LEU A HB2  1 
ATOM   3121 H  HB3  . LEU A 1 200 ? -33.964 -12.008 -18.211 1.00  25.42 ? 1653 LEU A HB3  1 
ATOM   3122 H  HG   . LEU A 1 200 ? -32.767 -11.716 -20.746 1.00  26.09 ? 1653 LEU A HG   1 
ATOM   3123 H  HD11 . LEU A 1 200 ? -31.431 -11.970 -18.288 1.00  26.48 ? 1653 LEU A HD11 1 
ATOM   3124 H  HD12 . LEU A 1 200 ? -30.714 -11.972 -19.687 1.00  26.48 ? 1653 LEU A HD12 1 
ATOM   3125 H  HD13 . LEU A 1 200 ? -31.428 -10.669 -19.172 1.00  26.48 ? 1653 LEU A HD13 1 
ATOM   3126 H  HD21 . LEU A 1 200 ? -33.634 -13.855 -20.371 1.00  27.66 ? 1653 LEU A HD21 1 
ATOM   3127 H  HD22 . LEU A 1 200 ? -32.064 -13.927 -20.427 1.00  27.66 ? 1653 LEU A HD22 1 
ATOM   3128 H  HD23 . LEU A 1 200 ? -32.804 -13.968 -19.040 1.00  27.66 ? 1653 LEU A HD23 1 
ATOM   3129 N  N    . GLY A 1 201 ? -36.824 -10.269 -18.607 1.00  22.68 ? 1654 GLY A N    1 
ATOM   3130 C  CA   . GLY A 1 201 ? -37.755 -9.935  -17.547 1.00  23.68 ? 1654 GLY A CA   1 
ATOM   3131 C  C    . GLY A 1 201 ? -37.022 -9.753  -16.229 1.00  23.60 ? 1654 GLY A C    1 
ATOM   3132 O  O    . GLY A 1 201 ? -35.824 -10.092 -16.107 1.00  22.79 ? 1654 GLY A O    1 
ATOM   3133 H  H    . GLY A 1 201 ? -36.583 -9.601  -19.091 1.00  27.22 ? 1654 GLY A H    1 
ATOM   3134 H  HA2  . GLY A 1 201 ? -38.219 -9.111  -17.764 1.00  28.41 ? 1654 GLY A HA2  1 
ATOM   3135 H  HA3  . GLY A 1 201 ? -38.408 -10.645 -17.447 1.00  28.41 ? 1654 GLY A HA3  1 
ATOM   3136 N  N    . PRO A 1 202 ? -37.730 -9.210  -15.225 1.00  23.80 ? 1655 PRO A N    1 
ATOM   3137 C  CA   . PRO A 1 202 ? -37.118 -8.837  -13.946 1.00  25.07 ? 1655 PRO A CA   1 
ATOM   3138 C  C    . PRO A 1 202 ? -36.765 -10.005 -13.055 1.00  25.46 ? 1655 PRO A C    1 
ATOM   3139 O  O    . PRO A 1 202 ? -35.900 -9.841  -12.194 1.00  28.46 ? 1655 PRO A O    1 
ATOM   3140 C  CB   . PRO A 1 202 ? -38.203 -7.995  -13.273 1.00  25.51 ? 1655 PRO A CB   1 
ATOM   3141 C  CG   . PRO A 1 202 ? -39.477 -8.470  -13.855 1.00  25.46 ? 1655 PRO A CG   1 
ATOM   3142 C  CD   . PRO A 1 202 ? -39.153 -8.829  -15.284 1.00  24.19 ? 1655 PRO A CD   1 
ATOM   3143 H  HA   . PRO A 1 202 ? -36.322 -8.285  -14.095 1.00  30.08 ? 1655 PRO A HA   1 
ATOM   3144 H  HB2  . PRO A 1 202 ? -38.186 -8.147  -12.315 1.00  30.62 ? 1655 PRO A HB2  1 
ATOM   3145 H  HB3  . PRO A 1 202 ? -38.061 -7.057  -13.475 1.00  30.62 ? 1655 PRO A HB3  1 
ATOM   3146 H  HG2  . PRO A 1 202 ? -39.788 -9.249  -13.369 1.00  30.55 ? 1655 PRO A HG2  1 
ATOM   3147 H  HG3  . PRO A 1 202 ? -40.136 -7.759  -13.822 1.00  30.55 ? 1655 PRO A HG3  1 
ATOM   3148 H  HD2  . PRO A 1 202 ? -39.693 -9.581  -15.575 1.00  29.03 ? 1655 PRO A HD2  1 
ATOM   3149 H  HD3  . PRO A 1 202 ? -39.273 -8.060  -15.862 1.00  29.03 ? 1655 PRO A HD3  1 
ATOM   3150 N  N    . GLY A 1 203 ? -37.400 -11.153 -13.248 1.00  23.33 ? 1656 GLY A N    1 
ATOM   3151 C  CA   . GLY A 1 203 ? -37.110 -12.306 -12.422 1.00  22.03 ? 1656 GLY A CA   1 
ATOM   3152 C  C    . GLY A 1 203 ? -35.923 -13.082 -12.947 1.00  21.33 ? 1656 GLY A C    1 
ATOM   3153 O  O    . GLY A 1 203 ? -34.927 -13.259 -12.243 1.00  20.94 ? 1656 GLY A O    1 
ATOM   3154 H  H    . GLY A 1 203 ? -38.000 -11.288 -13.849 1.00  27.99 ? 1656 GLY A H    1 
ATOM   3155 H  HA2  . GLY A 1 203 ? -36.916 -12.017 -11.517 1.00  26.44 ? 1656 GLY A HA2  1 
ATOM   3156 H  HA3  . GLY A 1 203 ? -37.881 -12.895 -12.402 1.00  26.44 ? 1656 GLY A HA3  1 
ATOM   3157 N  N    . LYS A 1 204 ? -36.030 -13.562 -14.181 1.00  20.65 ? 1657 LYS A N    1 
ATOM   3158 C  CA   . LYS A 1 204 ? -34.924 -14.262 -14.814 1.00  22.10 ? 1657 LYS A CA   1 
ATOM   3159 C  C    . LYS A 1 204 ? -33.683 -13.378 -14.812 1.00  21.93 ? 1657 LYS A C    1 
ATOM   3160 O  O    . LYS A 1 204 ? -32.575 -13.873 -14.647 1.00  23.75 ? 1657 LYS A O    1 
ATOM   3161 C  CB   . LYS A 1 204 ? -35.252 -14.624 -16.258 1.00  22.63 ? 1657 LYS A CB   1 
ATOM   3162 C  CG   . LYS A 1 204 ? -36.167 -15.816 -16.452 1.00  24.73 ? 1657 LYS A CG   1 
ATOM   3163 C  CD   . LYS A 1 204 ? -36.585 -15.836 -17.907 1.00  26.99 ? 1657 LYS A CD   1 
ATOM   3164 C  CE   . LYS A 1 204 ? -36.626 -17.182 -18.508 1.00  27.29 ? 1657 LYS A CE   1 
ATOM   3165 N  NZ   . LYS A 1 204 ? -37.117 -17.017 -19.903 1.00  25.56 ? 1657 LYS A NZ   1 
ATOM   3166 H  H    . LYS A 1 204 ? -36.733 -13.494 -14.672 1.00  24.78 ? 1657 LYS A H    1 
ATOM   3167 H  HA   . LYS A 1 204 ? -34.726 -15.085 -14.319 1.00  26.52 ? 1657 LYS A HA   1 
ATOM   3168 H  HB2  . LYS A 1 204 ? -35.680 -13.860 -16.674 1.00  27.16 ? 1657 LYS A HB2  1 
ATOM   3169 H  HB3  . LYS A 1 204 ? -34.421 -14.819 -16.720 1.00  27.16 ? 1657 LYS A HB3  1 
ATOM   3170 H  HG2  . LYS A 1 204 ? -35.692 -16.637 -16.247 1.00  29.68 ? 1657 LYS A HG2  1 
ATOM   3171 H  HG3  . LYS A 1 204 ? -36.957 -15.722 -15.897 1.00  29.68 ? 1657 LYS A HG3  1 
ATOM   3172 H  HD2  . LYS A 1 204 ? -37.473 -15.453 -17.981 1.00  32.39 ? 1657 LYS A HD2  1 
ATOM   3173 H  HD3  . LYS A 1 204 ? -35.955 -15.304 -18.419 1.00  32.39 ? 1657 LYS A HD3  1 
ATOM   3174 H  HE2  . LYS A 1 204 ? -35.736 -17.567 -18.527 1.00  32.75 ? 1657 LYS A HE2  1 
ATOM   3175 H  HE3  . LYS A 1 204 ? -37.243 -17.748 -18.018 1.00  32.75 ? 1657 LYS A HE3  1 
ATOM   3176 H  HZ1  . LYS A 1 204 ? -36.565 -16.488 -20.359 1.00  30.67 ? 1657 LYS A HZ1  1 
ATOM   3177 H  HZ2  . LYS A 1 204 ? -37.158 -17.809 -20.306 1.00  30.67 ? 1657 LYS A HZ2  1 
ATOM   3178 H  HZ3  . LYS A 1 204 ? -37.929 -16.652 -19.898 1.00  30.67 ? 1657 LYS A HZ3  1 
ATOM   3179 N  N    . GLY A 1 205 ? -33.869 -12.071 -15.010 1.00  20.88 ? 1658 GLY A N    1 
ATOM   3180 C  CA   . GLY A 1 205 ? -32.748 -11.147 -15.115 1.00  20.33 ? 1658 GLY A CA   1 
ATOM   3181 C  C    . GLY A 1 205 ? -31.987 -10.879 -13.824 1.00  20.43 ? 1658 GLY A C    1 
ATOM   3182 O  O    . GLY A 1 205 ? -30.928 -10.247 -13.852 1.00  21.10 ? 1658 GLY A O    1 
ATOM   3183 H  H    . GLY A 1 205 ? -34.640 -11.697 -15.087 1.00  25.06 ? 1658 GLY A H    1 
ATOM   3184 H  HA2  . GLY A 1 205 ? -32.116 -11.497 -15.763 1.00  24.40 ? 1658 GLY A HA2  1 
ATOM   3185 H  HA3  . GLY A 1 205 ? -33.075 -10.297 -15.447 1.00  24.40 ? 1658 GLY A HA3  1 
ATOM   3186 N  N    . GLU A 1 206 ? -32.514 -11.359 -12.697 1.00  19.99 ? 1659 GLU A N    1 
ATOM   3187 C  CA   . GLU A 1 206 ? -31.902 -11.127 -11.393 1.00  19.47 ? 1659 GLU A CA   1 
ATOM   3188 C  C    . GLU A 1 206 ? -30.602 -11.912 -11.282 1.00  17.08 ? 1659 GLU A C    1 
ATOM   3189 O  O    . GLU A 1 206 ? -30.592 -13.151 -11.336 1.00  17.26 ? 1659 GLU A O    1 
ATOM   3190 C  CB   . GLU A 1 206 ? -32.825 -11.562 -10.253 1.00  22.48 ? 1659 GLU A CB   1 
ATOM   3191 C  CG   . GLU A 1 206 ? -33.843 -10.540 -9.815  1.00  28.50 ? 1659 GLU A CG   1 
ATOM   3192 C  CD   . GLU A 1 206 ? -33.190 -9.303  -9.204  1.00  33.23 ? 1659 GLU A CD   1 
ATOM   3193 O  OE1  . GLU A 1 206 ? -32.345 -9.441  -8.291  1.00  35.07 ? 1659 GLU A OE1  1 
ATOM   3194 O  OE2  . GLU A 1 206 ? -33.524 -8.194  -9.643  1.00  37.01 ? 1659 GLU A OE2  1 
ATOM   3195 H  H    . GLU A 1 206 ? -33.234 -11.828 -12.664 1.00  23.99 ? 1659 GLU A H    1 
ATOM   3196 H  HA   . GLU A 1 206 ? -31.702 -10.174 -11.288 1.00  23.36 ? 1659 GLU A HA   1 
ATOM   3197 H  HB2  . GLU A 1 206 ? -33.311 -12.352 -10.536 1.00  26.97 ? 1659 GLU A HB2  1 
ATOM   3198 H  HB3  . GLU A 1 206 ? -32.279 -11.777 -9.481  1.00  26.97 ? 1659 GLU A HB3  1 
ATOM   3199 H  HG2  . GLU A 1 206 ? -34.362 -10.258 -10.585 1.00  34.20 ? 1659 GLU A HG2  1 
ATOM   3200 H  HG3  . GLU A 1 206 ? -34.424 -10.936 -9.147  1.00  34.20 ? 1659 GLU A HG3  1 
ATOM   3201 N  N    . VAL A 1 207 ? -29.504 -11.194 -11.096 1.00  16.41 ? 1660 VAL A N    1 
ATOM   3202 C  CA   . VAL A 1 207 ? -28.202 -11.823 -10.921 1.00  15.54 ? 1660 VAL A CA   1 
ATOM   3203 C  C    . VAL A 1 207 ? -27.333 -10.857 -10.118 1.00  15.89 ? 1660 VAL A C    1 
ATOM   3204 O  O    . VAL A 1 207 ? -27.591 -9.649  -10.125 1.00  16.07 ? 1660 VAL A O    1 
ATOM   3205 C  CB   . VAL A 1 207 ? -27.575 -12.195 -12.301 1.00  16.59 ? 1660 VAL A CB   1 
ATOM   3206 C  CG1  . VAL A 1 207 ? -27.398 -10.956 -13.181 1.00  16.83 ? 1660 VAL A CG1  1 
ATOM   3207 C  CG2  . VAL A 1 207 ? -26.269 -12.945 -12.119 1.00  16.94 ? 1660 VAL A CG2  1 
ATOM   3208 H  H    . VAL A 1 207 ? -29.485 -10.334 -11.067 1.00  19.70 ? 1660 VAL A H    1 
ATOM   3209 H  HA   . VAL A 1 207 ? -28.308 -12.646 -10.400 1.00  18.65 ? 1660 VAL A HA   1 
ATOM   3210 H  HB   . VAL A 1 207 ? -28.193 -12.796 -12.767 1.00  19.91 ? 1660 VAL A HB   1 
ATOM   3211 H  HG11 . VAL A 1 207 ? -26.817 -10.336 -12.733 1.00  20.19 ? 1660 VAL A HG11 1 
ATOM   3212 H  HG12 . VAL A 1 207 ? -27.012 -11.221 -14.019 1.00  20.19 ? 1660 VAL A HG12 1 
ATOM   3213 H  HG13 . VAL A 1 207 ? -28.257 -10.552 -13.328 1.00  20.19 ? 1660 VAL A HG13 1 
ATOM   3214 H  HG21 . VAL A 1 207 ? -26.438 -13.751 -11.625 1.00  20.33 ? 1660 VAL A HG21 1 
ATOM   3215 H  HG22 . VAL A 1 207 ? -25.909 -13.159 -12.983 1.00  20.33 ? 1660 VAL A HG22 1 
ATOM   3216 H  HG23 . VAL A 1 207 ? -25.654 -12.388 -11.637 1.00  20.33 ? 1660 VAL A HG23 1 
ATOM   3217 N  N    . ARG A 1 208 ? -26.347 -11.391 -9.400  1.00  15.94 ? 1661 ARG A N    1 
ATOM   3218 C  CA   . ARG A 1 208 ? -25.401 -10.575 -8.640  1.00  15.73 ? 1661 ARG A CA   1 
ATOM   3219 C  C    . ARG A 1 208 ? -24.003 -11.056 -8.970  1.00  15.04 ? 1661 ARG A C    1 
ATOM   3220 O  O    . ARG A 1 208 ? -23.688 -12.243 -8.818  1.00  16.76 ? 1661 ARG A O    1 
ATOM   3221 C  CB   . ARG A 1 208 ? -25.623 -10.707 -7.129  1.00  18.87 ? 1661 ARG A CB   1 
ATOM   3222 C  CG   . ARG A 1 208 ? -26.968 -10.245 -6.641  1.00  21.77 ? 1661 ARG A CG   1 
ATOM   3223 C  CD   . ARG A 1 208 ? -27.126 -8.757  -6.714  1.00  25.92 ? 1661 ARG A CD   1 
ATOM   3224 N  NE   . ARG A 1 208 ? -28.411 -8.365  -6.152  1.00  28.94 ? 1661 ARG A NE   1 
ATOM   3225 C  CZ   . ARG A 1 208 ? -29.576 -8.510  -6.772  1.00  31.24 ? 1661 ARG A CZ   1 
ATOM   3226 N  NH1  . ARG A 1 208 ? -29.634 -9.031  -7.998  1.00  32.34 ? 1661 ARG A NH1  1 
ATOM   3227 N  NH2  . ARG A 1 208 ? -30.689 -8.133  -6.158  1.00  32.23 ? 1661 ARG A NH2  1 
ATOM   3228 H  H    . ARG A 1 208 ? -26.202 -12.237 -9.336  1.00  19.13 ? 1661 ARG A H    1 
ATOM   3229 H  HA   . ARG A 1 208 ? -25.485 -9.633  -8.897  1.00  18.88 ? 1661 ARG A HA   1 
ATOM   3230 H  HB2  . ARG A 1 208 ? -25.527 -11.641 -6.884  1.00  22.64 ? 1661 ARG A HB2  1 
ATOM   3231 H  HB3  . ARG A 1 208 ? -24.949 -10.180 -6.672  1.00  22.64 ? 1661 ARG A HB3  1 
ATOM   3232 H  HG2  . ARG A 1 208 ? -27.660 -10.647 -7.190  1.00  26.13 ? 1661 ARG A HG2  1 
ATOM   3233 H  HG3  . ARG A 1 208 ? -27.079 -10.514 -5.716  1.00  26.13 ? 1661 ARG A HG3  1 
ATOM   3234 H  HD2  . ARG A 1 208 ? -26.421 -8.331  -6.201  1.00  31.11 ? 1661 ARG A HD2  1 
ATOM   3235 H  HD3  . ARG A 1 208 ? -27.093 -8.472  -7.641  1.00  31.11 ? 1661 ARG A HD3  1 
ATOM   3236 H  HE   . ARG A 1 208 ? -28.416 -8.016  -5.366  1.00  34.73 ? 1661 ARG A HE   1 
ATOM   3237 H  HH11 . ARG A 1 208 ? -28.912 -9.280  -8.394  1.00  38.81 ? 1661 ARG A HH11 1 
ATOM   3238 H  HH12 . ARG A 1 208 ? -30.393 -9.120  -8.393  1.00  38.81 ? 1661 ARG A HH12 1 
ATOM   3239 H  HH21 . ARG A 1 208 ? -30.650 -7.793  -5.369  1.00  38.68 ? 1661 ARG A HH21 1 
ATOM   3240 H  HH22 . ARG A 1 208 ? -31.448 -8.216  -6.554  1.00  38.68 ? 1661 ARG A HH22 1 
ATOM   3241 N  N    . PRO A 1 209 ? -23.146 -10.155 -9.443  1.00  13.61 ? 1662 PRO A N    1 
ATOM   3242 C  CA   . PRO A 1 209 ? -23.412 -8.763  -9.820  1.00  13.93 ? 1662 PRO A CA   1 
ATOM   3243 C  C    . PRO A 1 209 ? -24.435 -8.662  -10.931 1.00  14.87 ? 1662 PRO A C    1 
ATOM   3244 O  O    . PRO A 1 209 ? -24.524 -9.554  -11.770 1.00  14.83 ? 1662 PRO A O    1 
ATOM   3245 C  CB   . PRO A 1 209 ? -22.047 -8.284  -10.338 1.00  14.42 ? 1662 PRO A CB   1 
ATOM   3246 C  CG   . PRO A 1 209 ? -21.050 -9.203  -9.721  1.00  14.64 ? 1662 PRO A CG   1 
ATOM   3247 C  CD   . PRO A 1 209 ? -21.740 -10.527 -9.672  1.00  13.75 ? 1662 PRO A CD   1 
ATOM   3248 H  HA   . PRO A 1 209 ? -23.690 -8.229  -9.047  1.00  16.72 ? 1662 PRO A HA   1 
ATOM   3249 H  HB2  . PRO A 1 209 ? -22.023 -8.352  -11.305 1.00  17.31 ? 1662 PRO A HB2  1 
ATOM   3250 H  HB3  . PRO A 1 209 ? -21.893 -7.369  -10.054 1.00  17.31 ? 1662 PRO A HB3  1 
ATOM   3251 H  HG2  . PRO A 1 209 ? -20.256 -9.248  -10.277 1.00  17.57 ? 1662 PRO A HG2  1 
ATOM   3252 H  HG3  . PRO A 1 209 ? -20.829 -8.896  -8.828  1.00  17.57 ? 1662 PRO A HG3  1 
ATOM   3253 H  HD2  . PRO A 1 209 ? -21.645 -10.991 -10.519 1.00  16.50 ? 1662 PRO A HD2  1 
ATOM   3254 H  HD3  . PRO A 1 209 ? -21.404 -11.058 -8.933  1.00  16.50 ? 1662 PRO A HD3  1 
ATOM   3255 N  N    . GLU A 1 210 ? -25.198 -7.578  -10.942 1.00  14.54 ? 1663 GLU A N    1 
ATOM   3256 C  CA   A GLU A 1 210 ? -26.232 -7.378  -11.950 0.97  15.83 ? 1663 GLU A CA   1 
ATOM   3257 C  CA   B GLU A 1 210 ? -26.241 -7.414  -11.947 0.03  15.67 ? 1663 GLU A CA   1 
ATOM   3258 C  C    . GLU A 1 210 ? -25.636 -7.227  -13.339 1.00  15.33 ? 1663 GLU A C    1 
ATOM   3259 O  O    . GLU A 1 210 ? -24.425 -6.944  -13.497 1.00  15.96 ? 1663 GLU A O    1 
ATOM   3260 C  CB   A GLU A 1 210 ? -27.086 -6.152  -11.608 0.97  17.98 ? 1663 GLU A CB   1 
ATOM   3261 C  CB   B GLU A 1 210 ? -27.167 -6.241  -11.594 0.03  17.29 ? 1663 GLU A CB   1 
ATOM   3262 C  CG   A GLU A 1 210 ? -26.377 -4.825  -11.704 0.97  22.97 ? 1663 GLU A CG   1 
ATOM   3263 C  CG   B GLU A 1 210 ? -26.564 -4.860  -11.796 0.03  18.85 ? 1663 GLU A CG   1 
ATOM   3264 C  CD   A GLU A 1 210 ? -27.264 -3.662  -11.253 0.97  28.23 ? 1663 GLU A CD   1 
ATOM   3265 C  CD   B GLU A 1 210 ? -27.439 -3.749  -11.253 0.03  20.21 ? 1663 GLU A CD   1 
ATOM   3266 O  OE1  A GLU A 1 210 ? -28.241 -3.898  -10.512 0.97  30.31 ? 1663 GLU A OE1  1 
ATOM   3267 O  OE1  B GLU A 1 210 ? -28.451 -4.057  -10.589 0.03  20.71 ? 1663 GLU A OE1  1 
ATOM   3268 O  OE2  A GLU A 1 210 ? -26.973 -2.511  -11.618 0.97  31.35 ? 1663 GLU A OE2  1 
ATOM   3269 O  OE2  B GLU A 1 210 ? -27.105 -2.568  -11.477 0.03  20.75 ? 1663 GLU A OE2  1 
ATOM   3270 H  H    A GLU A 1 210 ? -25.138 -6.937  -10.371 0.97  17.45 ? 1663 GLU A H    1 
ATOM   3271 H  H    B GLU A 1 210 ? -25.135 -6.927  -10.383 0.03  17.45 ? 1663 GLU A H    1 
ATOM   3272 H  HA   A GLU A 1 210 ? -26.821 -8.161  -11.959 0.97  19.00 ? 1663 GLU A HA   1 
ATOM   3273 H  HA   B GLU A 1 210 ? -26.786 -8.228  -11.967 0.03  18.81 ? 1663 GLU A HA   1 
ATOM   3274 H  HB2  A GLU A 1 210 ? -27.841 -6.124  -12.217 0.97  21.57 ? 1663 GLU A HB2  1 
ATOM   3275 H  HB2  B GLU A 1 210 ? -27.961 -6.298  -12.148 0.03  20.75 ? 1663 GLU A HB2  1 
ATOM   3276 H  HB3  A GLU A 1 210 ? -27.408 -6.245  -10.698 0.97  21.57 ? 1663 GLU A HB3  1 
ATOM   3277 H  HB3  B GLU A 1 210 ? -27.417 -6.317  -10.660 0.03  20.75 ? 1663 GLU A HB3  1 
ATOM   3278 H  HG2  A GLU A 1 210 ? -25.591 -4.843  -11.136 0.97  27.56 ? 1663 GLU A HG2  1 
ATOM   3279 H  HG2  B GLU A 1 210 ? -25.710 -4.819  -11.339 0.03  22.62 ? 1663 GLU A HG2  1 
ATOM   3280 H  HG3  A GLU A 1 210 ? -26.119 -4.668  -12.626 0.97  27.56 ? 1663 GLU A HG3  1 
ATOM   3281 H  HG3  B GLU A 1 210 ? -26.439 -4.706  -12.746 0.03  22.62 ? 1663 GLU A HG3  1 
ATOM   3282 N  N    . LEU A 1 211 ? -26.466 -7.408  -14.356 1.00  15.34 ? 1664 LEU A N    1 
ATOM   3283 C  CA   . LEU A 1 211 ? -26.027 -7.141  -15.713 1.00  14.60 ? 1664 LEU A CA   1 
ATOM   3284 C  C    . LEU A 1 211 ? -25.624 -5.680  -15.827 1.00  14.83 ? 1664 LEU A C    1 
ATOM   3285 O  O    . LEU A 1 211 ? -26.243 -4.805  -15.219 1.00  16.25 ? 1664 LEU A O    1 
ATOM   3286 C  CB   . LEU A 1 211 ? -27.119 -7.468  -16.720 1.00  15.10 ? 1664 LEU A CB   1 
ATOM   3287 C  CG   . LEU A 1 211 ? -27.478 -8.946  -16.839 1.00  14.97 ? 1664 LEU A CG   1 
ATOM   3288 C  CD1  . LEU A 1 211 ? -28.512 -9.152  -17.935 1.00  16.06 ? 1664 LEU A CD1  1 
ATOM   3289 C  CD2  . LEU A 1 211 ? -26.235 -9.789  -17.100 1.00  15.43 ? 1664 LEU A CD2  1 
ATOM   3290 H  H    . LEU A 1 211 ? -27.279 -7.682  -14.288 1.00  18.41 ? 1664 LEU A H    1 
ATOM   3291 H  HA   . LEU A 1 211 ? -25.244 -7.695  -15.916 1.00  17.52 ? 1664 LEU A HA   1 
ATOM   3292 H  HB2  . LEU A 1 211 ? -27.925 -6.993  -16.464 1.00  18.12 ? 1664 LEU A HB2  1 
ATOM   3293 H  HB3  . LEU A 1 211 ? -26.829 -7.168  -17.595 1.00  18.12 ? 1664 LEU A HB3  1 
ATOM   3294 H  HG   . LEU A 1 211 ? -27.869 -9.243  -16.002 1.00  17.96 ? 1664 LEU A HG   1 
ATOM   3295 H  HD11 . LEU A 1 211 ? -28.147 -8.846  -18.769 1.00  19.27 ? 1664 LEU A HD11 1 
ATOM   3296 H  HD12 . LEU A 1 211 ? -28.723 -10.086 -17.993 1.00  19.27 ? 1664 LEU A HD12 1 
ATOM   3297 H  HD13 . LEU A 1 211 ? -29.301 -8.650  -17.718 1.00  19.27 ? 1664 LEU A HD13 1 
ATOM   3298 H  HD21 . LEU A 1 211 ? -25.621 -9.674  -16.371 1.00  18.52 ? 1664 LEU A HD21 1 
ATOM   3299 H  HD22 . LEU A 1 211 ? -26.492 -10.711 -17.170 1.00  18.52 ? 1664 LEU A HD22 1 
ATOM   3300 H  HD23 . LEU A 1 211 ? -25.828 -9.499  -17.920 1.00  18.52 ? 1664 LEU A HD23 1 
ATOM   3301 N  N    . GLY A 1 212 ? -24.562 -5.437  -16.586 1.00  15.28 ? 1665 GLY A N    1 
ATOM   3302 C  CA   . GLY A 1 212 ? -24.035 -4.101  -16.750 1.00  16.28 ? 1665 GLY A CA   1 
ATOM   3303 C  C    . GLY A 1 212 ? -24.550 -3.417  -17.993 1.00  15.51 ? 1665 GLY A C    1 
ATOM   3304 O  O    . GLY A 1 212 ? -25.281 -3.996  -18.806 1.00  16.67 ? 1665 GLY A O    1 
ATOM   3305 H  H    . GLY A 1 212 ? -24.128 -6.041  -17.019 1.00  18.33 ? 1665 GLY A H    1 
ATOM   3306 H  HA2  . GLY A 1 212 ? -24.278 -3.562  -15.981 1.00  19.53 ? 1665 GLY A HA2  1 
ATOM   3307 H  HA3  . GLY A 1 212 ? -23.067 -4.141  -16.802 1.00  19.53 ? 1665 GLY A HA3  1 
ATOM   3308 N  N    . SER A 1 213 ? -24.168 -2.158  -18.148 1.00  15.73 ? 1666 SER A N    1 
ATOM   3309 C  CA   . SER A 1 213 ? -24.470 -1.431  -19.367 1.00  16.04 ? 1666 SER A CA   1 
ATOM   3310 C  C    . SER A 1 213 ? -23.621 -1.937  -20.532 1.00  16.03 ? 1666 SER A C    1 
ATOM   3311 O  O    . SER A 1 213 ? -22.653 -2.679  -20.350 1.00  15.43 ? 1666 SER A O    1 
ATOM   3312 C  CB   . SER A 1 213 ? -24.151 0.041   -19.168 1.00  17.77 ? 1666 SER A CB   1 
ATOM   3313 O  OG   . SER A 1 213 ? -22.751 0.204   -19.048 1.00  17.63 ? 1666 SER A OG   1 
ATOM   3314 H  H    . SER A 1 213 ? -23.733 -1.704  -17.562 1.00  18.87 ? 1666 SER A H    1 
ATOM   3315 H  HA   . SER A 1 213 ? -25.419 -1.528  -19.594 1.00  19.25 ? 1666 SER A HA   1 
ATOM   3316 H  HB2  . SER A 1 213 ? -24.468 0.545   -19.934 1.00  21.32 ? 1666 SER A HB2  1 
ATOM   3317 H  HB3  . SER A 1 213 ? -24.581 0.356   -18.357 1.00  21.32 ? 1666 SER A HB3  1 
ATOM   3318 H  HG   . SER A 1 213 ? -22.569 0.996   -18.939 1.00  21.16 ? 1666 SER A HG   1 
ATOM   3319 N  N    . ARG A 1 214 ? -23.966 -1.495  -21.738 1.00  18.17 ? 1667 ARG A N    1 
ATOM   3320 C  CA   . ARG A 1 214 ? -23.137 -1.773  -22.908 1.00  19.45 ? 1667 ARG A CA   1 
ATOM   3321 C  C    . ARG A 1 214 ? -21.707 -1.285  -22.658 1.00  18.49 ? 1667 ARG A C    1 
ATOM   3322 O  O    . ARG A 1 214 ? -20.747 -1.915  -23.090 1.00  18.53 ? 1667 ARG A O    1 
ATOM   3323 C  CB   . ARG A 1 214 ? -23.719 -1.103  -24.148 1.00  22.53 ? 1667 ARG A CB   1 
ATOM   3324 H  H    . ARG A 1 214 ? -24.672 -1.033  -21.905 1.00  21.81 ? 1667 ARG A H    1 
ATOM   3325 H  HA   . ARG A 1 214 ? -23.110 -2.740  -23.064 1.00  23.34 ? 1667 ARG A HA   1 
ATOM   3326 H  HB2  . ARG A 1 214 ? -23.157 -1.300  -24.901 1.00  27.03 ? 1667 ARG A HB2  1 
ATOM   3327 H  HB3  . ARG A 1 214 ? -24.603 -1.443  -24.300 1.00  27.03 ? 1667 ARG A HB3  1 
ATOM   3328 H  HB1  . ARG A 1 214 ? -23.752 -0.155  -24.004 1.00  27.03 ? 1667 ARG A HB1  1 
ATOM   3329 N  N    . GLN A 1 215 ? -21.571 -0.157  -21.962 1.00  18.56 ? 1668 GLN A N    1 
ATOM   3330 C  CA   A GLN A 1 215 ? -20.262 0.404   -21.673 0.67  19.01 ? 1668 GLN A CA   1 
ATOM   3331 C  CA   B GLN A 1 215 ? -20.257 0.417   -21.653 0.33  18.81 ? 1668 GLN A CA   1 
ATOM   3332 C  C    . GLN A 1 215 ? -19.457 -0.468  -20.700 1.00  16.49 ? 1668 GLN A C    1 
ATOM   3333 O  O    . GLN A 1 215 ? -18.230 -0.577  -20.812 1.00  16.46 ? 1668 GLN A O    1 
ATOM   3334 C  CB   A GLN A 1 215 ? -20.429 1.830   -21.143 0.67  21.89 ? 1668 GLN A CB   1 
ATOM   3335 C  CB   B GLN A 1 215 ? -20.410 1.830   -21.066 0.33  21.32 ? 1668 GLN A CB   1 
ATOM   3336 C  CG   A GLN A 1 215 ? -20.957 2.835   -22.189 0.67  24.36 ? 1668 GLN A CG   1 
ATOM   3337 C  CG   B GLN A 1 215 ? -19.125 2.430   -20.499 0.33  23.63 ? 1668 GLN A CG   1 
ATOM   3338 C  CD   A GLN A 1 215 ? -22.427 2.631   -22.627 0.67  26.64 ? 1668 GLN A CD   1 
ATOM   3339 C  CD   B GLN A 1 215 ? -19.274 3.887   -20.082 0.33  25.53 ? 1668 GLN A CD   1 
ATOM   3340 O  OE1  A GLN A 1 215 ? -23.307 2.234   -21.843 0.67  25.62 ? 1668 GLN A OE1  1 
ATOM   3341 O  OE1  B GLN A 1 215 ? -19.200 4.216   -18.896 0.33  26.68 ? 1668 GLN A OE1  1 
ATOM   3342 N  NE2  A GLN A 1 215 ? -22.693 2.940   -23.897 0.67  28.91 ? 1668 GLN A NE2  1 
ATOM   3343 N  NE2  B GLN A 1 215 ? -19.469 4.769   -21.059 0.33  25.75 ? 1668 GLN A NE2  1 
ATOM   3344 H  H    A GLN A 1 215 ? -22.226 0.301   -21.646 0.67  22.27 ? 1668 GLN A H    1 
ATOM   3345 H  H    B GLN A 1 215 ? -22.230 0.301   -21.653 0.33  22.27 ? 1668 GLN A H    1 
ATOM   3346 H  HA   A GLN A 1 215 ? -19.755 0.457   -22.510 0.67  22.81 ? 1668 GLN A HA   1 
ATOM   3347 H  HA   B GLN A 1 215 ? -19.746 0.495   -22.486 0.33  22.58 ? 1668 GLN A HA   1 
ATOM   3348 H  HB2  A GLN A 1 215 ? -21.056 1.817   -20.404 0.67  26.27 ? 1668 GLN A HB2  1 
ATOM   3349 H  HB2  B GLN A 1 215 ? -20.727 2.423   -21.765 0.33  25.58 ? 1668 GLN A HB2  1 
ATOM   3350 H  HB3  A GLN A 1 215 ? -19.566 2.151   -20.836 0.67  26.27 ? 1668 GLN A HB3  1 
ATOM   3351 H  HB3  B GLN A 1 215 ? -21.060 1.797   -20.347 0.33  25.58 ? 1668 GLN A HB3  1 
ATOM   3352 H  HG2  A GLN A 1 215 ? -20.885 3.729   -21.819 0.67  29.23 ? 1668 GLN A HG2  1 
ATOM   3353 H  HG2  B GLN A 1 215 ? -18.859 1.922   -19.716 0.33  28.36 ? 1668 GLN A HG2  1 
ATOM   3354 H  HG3  A GLN A 1 215 ? -20.405 2.769   -22.984 0.67  29.23 ? 1668 GLN A HG3  1 
ATOM   3355 H  HG3  B GLN A 1 215 ? -18.431 2.383   -21.174 0.33  28.36 ? 1668 GLN A HG3  1 
ATOM   3356 H  HE21 A GLN A 1 215 ? -22.066 3.230   -24.409 0.67  34.69 ? 1668 GLN A HE21 1 
ATOM   3357 H  HE21 B GLN A 1 215 ? -19.504 4.504   -21.876 0.33  30.90 ? 1668 GLN A HE21 1 
ATOM   3358 H  HE22 A GLN A 1 215 ? -23.491 2.849   -24.203 0.67  34.69 ? 1668 GLN A HE22 1 
ATOM   3359 H  HE22 B GLN A 1 215 ? -19.559 5.604   -20.874 0.33  30.90 ? 1668 GLN A HE22 1 
ATOM   3360 N  N    . ASP A 1 216 ? -20.144 -1.087  -19.753 1.00  15.04 ? 1669 ASP A N    1 
ATOM   3361 C  CA   . ASP A 1 216 ? -19.502 -2.034  -18.854 1.00  13.12 ? 1669 ASP A CA   1 
ATOM   3362 C  C    . ASP A 1 216 ? -18.982 -3.229  -19.655 1.00  12.22 ? 1669 ASP A C    1 
ATOM   3363 O  O    . ASP A 1 216 ? -17.832 -3.654  -19.508 1.00  12.56 ? 1669 ASP A O    1 
ATOM   3364 C  CB   . ASP A 1 216 ? -20.481 -2.540  -17.784 1.00  13.08 ? 1669 ASP A CB   1 
ATOM   3365 C  CG   . ASP A 1 216 ? -20.788 -1.497  -16.708 1.00  14.76 ? 1669 ASP A CG   1 
ATOM   3366 O  OD1  . ASP A 1 216 ? -19.840 -0.821  -16.238 1.00  15.18 ? 1669 ASP A OD1  1 
ATOM   3367 O  OD2  . ASP A 1 216 ? -21.974 -1.395  -16.308 1.00  15.96 ? 1669 ASP A OD2  1 
ATOM   3368 H  H    . ASP A 1 216 ? -20.985 -0.977  -19.609 1.00  18.04 ? 1669 ASP A H    1 
ATOM   3369 H  HA   . ASP A 1 216 ? -18.744 -1.603  -18.407 1.00  15.75 ? 1669 ASP A HA   1 
ATOM   3370 H  HB2  . ASP A 1 216 ? -21.317 -2.782  -18.212 1.00  15.70 ? 1669 ASP A HB2  1 
ATOM   3371 H  HB3  . ASP A 1 216 ? -20.096 -3.315  -17.346 1.00  15.70 ? 1669 ASP A HB3  1 
ATOM   3372 N  N    . VAL A 1 217 ? -19.835 -3.779  -20.506 1.00  12.69 ? 1670 VAL A N    1 
ATOM   3373 C  CA   . VAL A 1 217 ? -19.438 -4.937  -21.296 1.00  13.33 ? 1670 VAL A CA   1 
ATOM   3374 C  C    . VAL A 1 217 ? -18.234 -4.602  -22.172 1.00  14.06 ? 1670 VAL A C    1 
ATOM   3375 O  O    . VAL A 1 217 ? -17.270 -5.358  -22.239 1.00  14.01 ? 1670 VAL A O    1 
ATOM   3376 C  CB   . VAL A 1 217 ? -20.598 -5.429  -22.159 1.00  14.39 ? 1670 VAL A CB   1 
ATOM   3377 C  CG1  . VAL A 1 217 ? -20.132 -6.512  -23.127 1.00  15.86 ? 1670 VAL A CG1  1 
ATOM   3378 C  CG2  . VAL A 1 217 ? -21.719 -5.956  -21.253 1.00  14.67 ? 1670 VAL A CG2  1 
ATOM   3379 H  H    . VAL A 1 217 ? -20.639 -3.507  -20.645 1.00  15.23 ? 1670 VAL A H    1 
ATOM   3380 H  HA   . VAL A 1 217 ? -19.180 -5.663  -20.690 1.00  16.00 ? 1670 VAL A HA   1 
ATOM   3381 H  HB   . VAL A 1 217 ? -20.952 -4.680  -22.682 1.00  17.27 ? 1670 VAL A HB   1 
ATOM   3382 H  HG11 . VAL A 1 217 ? -19.781 -7.250  -22.624 1.00  19.04 ? 1670 VAL A HG11 1 
ATOM   3383 H  HG12 . VAL A 1 217 ? -20.880 -6.801  -23.655 1.00  19.04 ? 1670 VAL A HG12 1 
ATOM   3384 H  HG13 . VAL A 1 217 ? -19.450 -6.149  -23.697 1.00  19.04 ? 1670 VAL A HG13 1 
ATOM   3385 H  HG21 . VAL A 1 217 ? -22.019 -5.245  -20.681 1.00  17.60 ? 1670 VAL A HG21 1 
ATOM   3386 H  HG22 . VAL A 1 217 ? -22.445 -6.263  -21.801 1.00  17.60 ? 1670 VAL A HG22 1 
ATOM   3387 H  HG23 . VAL A 1 217 ? -21.378 -6.681  -20.724 1.00  17.60 ? 1670 VAL A HG23 1 
ATOM   3388 N  N    . GLU A 1 218 ? -18.293 -3.452  -22.836 1.00  14.82 ? 1671 GLU A N    1 
ATOM   3389 C  CA   A GLU A 1 218 ? -17.217 -3.059  -23.725 0.50  16.16 ? 1671 GLU A CA   1 
ATOM   3390 C  CA   B GLU A 1 218 ? -17.226 -2.999  -23.713 0.50  16.18 ? 1671 GLU A CA   1 
ATOM   3391 C  C    . GLU A 1 218 ? -15.913 -2.857  -22.950 1.00  15.19 ? 1671 GLU A C    1 
ATOM   3392 O  O    . GLU A 1 218 ? -14.837 -3.214  -23.439 1.00  15.18 ? 1671 GLU A O    1 
ATOM   3393 C  CB   A GLU A 1 218 ? -17.608 -1.812  -24.524 0.50  18.31 ? 1671 GLU A CB   1 
ATOM   3394 C  CB   B GLU A 1 218 ? -17.602 -1.649  -24.315 0.50  18.30 ? 1671 GLU A CB   1 
ATOM   3395 C  CG   A GLU A 1 218 ? -18.606 -2.134  -25.629 0.50  21.35 ? 1671 GLU A CG   1 
ATOM   3396 C  CG   B GLU A 1 218 ? -16.534 -1.045  -25.196 0.50  21.88 ? 1671 GLU A CG   1 
ATOM   3397 C  CD   A GLU A 1 218 ? -19.145 -0.909  -26.344 0.50  24.61 ? 1671 GLU A CD   1 
ATOM   3398 C  CD   B GLU A 1 218 ? -16.957 0.289   -25.783 0.50  24.46 ? 1671 GLU A CD   1 
ATOM   3399 O  OE1  A GLU A 1 218 ? -18.621 0.200   -26.114 0.50  26.04 ? 1671 GLU A OE1  1 
ATOM   3400 O  OE1  B GLU A 1 218 ? -17.350 1.197   -25.013 0.50  25.85 ? 1671 GLU A OE1  1 
ATOM   3401 O  OE2  A GLU A 1 218 ? -20.108 -1.059  -27.128 0.50  25.95 ? 1671 GLU A OE2  1 
ATOM   3402 O  OE2  B GLU A 1 218 ? -16.908 0.427   -27.022 0.50  25.68 ? 1671 GLU A OE2  1 
ATOM   3403 H  H    A GLU A 1 218 ? -18.941 -2.889  -22.787 0.50  17.78 ? 1671 GLU A H    1 
ATOM   3404 H  H    B GLU A 1 218 ? -18.957 -2.907  -22.792 0.50  17.78 ? 1671 GLU A H    1 
ATOM   3405 H  HA   A GLU A 1 218 ? -17.067 -3.783  -24.368 0.50  19.40 ? 1671 GLU A HA   1 
ATOM   3406 H  HA   B GLU A 1 218 ? -17.099 -3.644  -24.440 0.50  19.42 ? 1671 GLU A HA   1 
ATOM   3407 H  HB2  A GLU A 1 218 ? -18.015 -1.166  -23.927 0.50  21.97 ? 1671 GLU A HB2  1 
ATOM   3408 H  HB2  B GLU A 1 218 ? -18.401 -1.760  -24.853 0.50  21.96 ? 1671 GLU A HB2  1 
ATOM   3409 H  HB3  A GLU A 1 218 ? -16.814 -1.435  -24.934 0.50  21.97 ? 1671 GLU A HB3  1 
ATOM   3410 H  HB3  B GLU A 1 218 ? -17.778 -1.025  -23.594 0.50  21.96 ? 1671 GLU A HB3  1 
ATOM   3411 H  HG2  A GLU A 1 218 ? -18.171 -2.694  -26.290 0.50  25.62 ? 1671 GLU A HG2  1 
ATOM   3412 H  HG2  B GLU A 1 218 ? -15.732 -0.902  -24.670 0.50  26.26 ? 1671 GLU A HG2  1 
ATOM   3413 H  HG3  A GLU A 1 218 ? -19.359 -2.606  -25.242 0.50  25.62 ? 1671 GLU A HG3  1 
ATOM   3414 H  HG3  B GLU A 1 218 ? -16.347 -1.652  -25.930 0.50  26.26 ? 1671 GLU A HG3  1 
ATOM   3415 N  N    . ALA A 1 219 ? -16.003 -2.314  -21.741 1.00  14.73 ? 1672 ALA A N    1 
ATOM   3416 C  CA   . ALA A 1 219 ? -14.822 -2.119  -20.909 1.00  14.21 ? 1672 ALA A CA   1 
ATOM   3417 C  C    . ALA A 1 219 ? -14.177 -3.436  -20.511 1.00  13.48 ? 1672 ALA A C    1 
ATOM   3418 O  O    . ALA A 1 219 ? -12.959 -3.529  -20.451 1.00  14.63 ? 1672 ALA A O    1 
ATOM   3419 C  CB   . ALA A 1 219 ? -15.152 -1.306  -19.681 1.00  14.29 ? 1672 ALA A CB   1 
ATOM   3420 H  H    . ALA A 1 219 ? -16.737 -2.050  -21.379 1.00  17.68 ? 1672 ALA A H    1 
ATOM   3421 H  HA   . ALA A 1 219 ? -14.160 -1.613  -21.426 1.00  17.06 ? 1672 ALA A HA   1 
ATOM   3422 H  HB1  . ALA A 1 219 ? -15.820 -1.771  -19.170 1.00  17.15 ? 1672 ALA A HB1  1 
ATOM   3423 H  HB2  . ALA A 1 219 ? -14.356 -1.196  -19.156 1.00  17.15 ? 1672 ALA A HB2  1 
ATOM   3424 H  HB3  . ALA A 1 219 ? -15.486 -0.449  -19.954 1.00  17.15 ? 1672 ALA A HB3  1 
ATOM   3425 N  N    . LEU A 1 220 ? -14.982 -4.460  -20.249 1.00  12.35 ? 1673 LEU A N    1 
ATOM   3426 C  CA   . LEU A 1 220 ? -14.389 -5.756  -19.923 1.00  12.07 ? 1673 LEU A CA   1 
ATOM   3427 C  C    . LEU A 1 220 ? -13.624 -6.323  -21.129 1.00  11.66 ? 1673 LEU A C    1 
ATOM   3428 O  O    . LEU A 1 220 ? -12.494 -6.800  -20.984 1.00  13.16 ? 1673 LEU A O    1 
ATOM   3429 C  CB   . LEU A 1 220 ? -15.449 -6.730  -19.410 1.00  12.29 ? 1673 LEU A CB   1 
ATOM   3430 C  CG   . LEU A 1 220 ? -16.164 -6.310  -18.124 1.00  12.32 ? 1673 LEU A CG   1 
ATOM   3431 C  CD1  . LEU A 1 220 ? -17.251 -7.313  -17.764 1.00  12.46 ? 1673 LEU A CD1  1 
ATOM   3432 C  CD2  . LEU A 1 220 ? -15.199 -6.191  -16.980 1.00  13.10 ? 1673 LEU A CD2  1 
ATOM   3433 H  H    . LEU A 1 220 ? -15.842 -4.436  -20.251 1.00  14.81 ? 1673 LEU A H    1 
ATOM   3434 H  HA   . LEU A 1 220 ? -13.739 -5.624  -19.201 1.00  14.49 ? 1673 LEU A HA   1 
ATOM   3435 H  HB2  . LEU A 1 220 ? -16.125 -6.837  -20.097 1.00  14.75 ? 1673 LEU A HB2  1 
ATOM   3436 H  HB3  . LEU A 1 220 ? -15.023 -7.585  -19.239 1.00  14.75 ? 1673 LEU A HB3  1 
ATOM   3437 H  HG   . LEU A 1 220 ? -16.582 -5.446  -18.260 1.00  14.78 ? 1673 LEU A HG   1 
ATOM   3438 H  HD11 . LEU A 1 220 ? -16.849 -8.175  -17.634 1.00  14.95 ? 1673 LEU A HD11 1 
ATOM   3439 H  HD12 . LEU A 1 220 ? -17.683 -7.028  -16.956 1.00  14.95 ? 1673 LEU A HD12 1 
ATOM   3440 H  HD13 . LEU A 1 220 ? -17.888 -7.353  -18.481 1.00  14.95 ? 1673 LEU A HD13 1 
ATOM   3441 H  HD21 . LEU A 1 220 ? -14.537 -5.530  -17.197 1.00  15.72 ? 1673 LEU A HD21 1 
ATOM   3442 H  HD22 . LEU A 1 220 ? -15.680 -5.927  -16.192 1.00  15.72 ? 1673 LEU A HD22 1 
ATOM   3443 H  HD23 . LEU A 1 220 ? -14.777 -7.042  -16.837 1.00  15.72 ? 1673 LEU A HD23 1 
ATOM   3444 N  N    . TRP A 1 221 ? -14.230 -6.271  -22.312 1.00  12.14 ? 1674 TRP A N    1 
ATOM   3445 C  CA   . TRP A 1 221 ? -13.540 -6.732  -23.511 1.00  12.82 ? 1674 TRP A CA   1 
ATOM   3446 C  C    . TRP A 1 221 ? -12.268 -5.933  -23.795 1.00  13.20 ? 1674 TRP A C    1 
ATOM   3447 O  O    . TRP A 1 221 ? -11.220 -6.503  -24.086 1.00  14.28 ? 1674 TRP A O    1 
ATOM   3448 C  CB   . TRP A 1 221 ? -14.472 -6.711  -24.720 1.00  13.59 ? 1674 TRP A CB   1 
ATOM   3449 C  CG   . TRP A 1 221 ? -15.442 -7.845  -24.714 1.00  13.50 ? 1674 TRP A CG   1 
ATOM   3450 C  CD1  . TRP A 1 221 ? -16.757 -7.795  -24.345 1.00  13.96 ? 1674 TRP A CD1  1 
ATOM   3451 C  CD2  . TRP A 1 221 ? -15.176 -9.209  -25.070 1.00  13.42 ? 1674 TRP A CD2  1 
ATOM   3452 N  NE1  . TRP A 1 221 ? -17.325 -9.044  -24.456 1.00  13.32 ? 1674 TRP A NE1  1 
ATOM   3453 C  CE2  . TRP A 1 221 ? -16.374 -9.927  -24.899 1.00  13.85 ? 1674 TRP A CE2  1 
ATOM   3454 C  CE3  . TRP A 1 221 ? -14.034 -9.892  -25.505 1.00  14.31 ? 1674 TRP A CE3  1 
ATOM   3455 C  CZ2  . TRP A 1 221 ? -16.465 -11.296 -25.155 1.00  14.40 ? 1674 TRP A CZ2  1 
ATOM   3456 C  CZ3  . TRP A 1 221 ? -14.125 -11.236 -25.767 1.00  15.15 ? 1674 TRP A CZ3  1 
ATOM   3457 C  CH2  . TRP A 1 221 ? -15.323 -11.934 -25.574 1.00  15.27 ? 1674 TRP A CH2  1 
ATOM   3458 H  H    . TRP A 1 221 ? -15.027 -5.978  -22.445 1.00  14.57 ? 1674 TRP A H    1 
ATOM   3459 H  HA   . TRP A 1 221 ? -13.270 -7.664  -23.370 1.00  15.39 ? 1674 TRP A HA   1 
ATOM   3460 H  HB2  . TRP A 1 221 ? -14.977 -5.883  -24.716 1.00  16.30 ? 1674 TRP A HB2  1 
ATOM   3461 H  HB3  . TRP A 1 221 ? -13.942 -6.773  -25.530 1.00  16.30 ? 1674 TRP A HB3  1 
ATOM   3462 H  HD1  . TRP A 1 221 ? -17.205 -7.028  -24.069 1.00  16.75 ? 1674 TRP A HD1  1 
ATOM   3463 H  HE1  . TRP A 1 221 ? -18.144 -9.239  -24.280 1.00  15.99 ? 1674 TRP A HE1  1 
ATOM   3464 H  HE3  . TRP A 1 221 ? -13.229 -9.441  -25.624 1.00  17.17 ? 1674 TRP A HE3  1 
ATOM   3465 H  HZ2  . TRP A 1 221 ? -17.264 -11.758 -25.037 1.00  17.27 ? 1674 TRP A HZ2  1 
ATOM   3466 H  HZ3  . TRP A 1 221 ? -13.371 -11.696 -26.056 1.00  18.18 ? 1674 TRP A HZ3  1 
ATOM   3467 H  HH2  . TRP A 1 221 ? -15.355 -12.843 -25.768 1.00  18.32 ? 1674 TRP A HH2  1 
ATOM   3468 N  N    . GLU A 1 222 ? -12.347 -4.612  -23.689 1.00  13.70 ? 1675 GLU A N    1 
ATOM   3469 C  CA   A GLU A 1 222 ? -11.197 -3.765  -23.964 0.56  14.89 ? 1675 GLU A CA   1 
ATOM   3470 C  CA   B GLU A 1 222 ? -11.204 -3.750  -23.954 0.44  14.65 ? 1675 GLU A CA   1 
ATOM   3471 C  C    . GLU A 1 222 ? -10.066 -4.038  -22.983 1.00  14.22 ? 1675 GLU A C    1 
ATOM   3472 O  O    . GLU A 1 222 ? -8.897  -3.857  -23.312 1.00  16.14 ? 1675 GLU A O    1 
ATOM   3473 C  CB   A GLU A 1 222 ? -11.593 -2.286  -23.936 0.56  18.19 ? 1675 GLU A CB   1 
ATOM   3474 C  CB   B GLU A 1 222 ? -11.618 -2.280  -23.857 0.44  17.25 ? 1675 GLU A CB   1 
ATOM   3475 C  CG   A GLU A 1 222 ? -12.448 -1.881  -25.127 0.56  21.95 ? 1675 GLU A CG   1 
ATOM   3476 C  CG   B GLU A 1 222 ? -10.468 -1.281  -23.972 0.44  20.08 ? 1675 GLU A CG   1 
ATOM   3477 C  CD   A GLU A 1 222 ? -12.855 -0.420  -25.125 0.56  25.56 ? 1675 GLU A CD   1 
ATOM   3478 C  CD   B GLU A 1 222 ? -9.943  -1.131  -25.390 0.44  23.54 ? 1675 GLU A CD   1 
ATOM   3479 O  OE1  A GLU A 1 222 ? -12.376 0.357   -24.267 0.56  27.34 ? 1675 GLU A OE1  1 
ATOM   3480 O  OE1  B GLU A 1 222 ? -10.404 -1.868  -26.288 0.44  24.86 ? 1675 GLU A OE1  1 
ATOM   3481 O  OE2  A GLU A 1 222 ? -13.660 -0.047  -26.002 0.56  27.66 ? 1675 GLU A OE2  1 
ATOM   3482 O  OE2  B GLU A 1 222 ? -9.071  -0.262  -25.607 0.44  25.73 ? 1675 GLU A OE2  1 
ATOM   3483 H  H    A GLU A 1 222 ? -13.056 -4.182  -23.459 0.56  16.44 ? 1675 GLU A H    1 
ATOM   3484 H  H    B GLU A 1 222 ? -13.059 -4.186  -23.462 0.44  16.44 ? 1675 GLU A H    1 
ATOM   3485 H  HA   A GLU A 1 222 ? -10.866 -3.968  -24.863 0.56  17.86 ? 1675 GLU A HA   1 
ATOM   3486 H  HA   B GLU A 1 222 ? -10.879 -3.917  -24.864 0.44  17.58 ? 1675 GLU A HA   1 
ATOM   3487 H  HB2  A GLU A 1 222 ? -12.101 -2.110  -23.128 0.56  21.83 ? 1675 GLU A HB2  1 
ATOM   3488 H  HB2  B GLU A 1 222 ? -12.246 -2.088  -24.570 0.44  20.70 ? 1675 GLU A HB2  1 
ATOM   3489 H  HB3  A GLU A 1 222 ? -10.789 -1.744  -23.946 0.56  21.83 ? 1675 GLU A HB3  1 
ATOM   3490 H  HB3  B GLU A 1 222 ? -12.046 -2.136  -22.998 0.44  20.70 ? 1675 GLU A HB3  1 
ATOM   3491 H  HG2  A GLU A 1 222 ? -11.949 -2.048  -25.941 0.56  26.34 ? 1675 GLU A HG2  1 
ATOM   3492 H  HG2  B GLU A 1 222 ? -10.777 -0.411  -23.675 0.44  24.09 ? 1675 GLU A HG2  1 
ATOM   3493 H  HG3  A GLU A 1 222 ? -13.259 -2.414  -25.124 0.56  26.34 ? 1675 GLU A HG3  1 
ATOM   3494 H  HG3  B GLU A 1 222 ? -9.735  -1.580  -23.413 0.44  24.09 ? 1675 GLU A HG3  1 
ATOM   3495 N  N    . ASN A 1 223 ? -10.423 -4.474  -21.776 1.00  12.36 ? 1676 ASN A N    1 
ATOM   3496 C  CA   . ASN A 1 223 ? -9.448  -4.762  -20.724 1.00  12.37 ? 1676 ASN A CA   1 
ATOM   3497 C  C    . ASN A 1 223 ? -9.257  -6.250  -20.462 1.00  12.31 ? 1676 ASN A C    1 
ATOM   3498 O  O    . ASN A 1 223 ? -8.976  -6.674  -19.335 1.00  12.42 ? 1676 ASN A O    1 
ATOM   3499 C  CB   . ASN A 1 223 ? -9.812  -4.017  -19.448 1.00  13.30 ? 1676 ASN A CB   1 
ATOM   3500 C  CG   . ASN A 1 223 ? -9.601  -2.547  -19.598 1.00  14.60 ? 1676 ASN A CG   1 
ATOM   3501 O  OD1  . ASN A 1 223 ? -8.459  -2.077  -19.592 1.00  16.37 ? 1676 ASN A OD1  1 
ATOM   3502 N  ND2  . ASN A 1 223 ? -10.700 -1.802  -19.775 1.00  16.39 ? 1676 ASN A ND2  1 
ATOM   3503 H  H    . ASN A 1 223 ? -11.238 -4.613  -21.538 1.00  14.83 ? 1676 ASN A H    1 
ATOM   3504 H  HA   . ASN A 1 223 ? -8.581  -4.413  -21.018 1.00  14.84 ? 1676 ASN A HA   1 
ATOM   3505 H  HB2  . ASN A 1 223 ? -10.747 -4.171  -19.242 1.00  15.96 ? 1676 ASN A HB2  1 
ATOM   3506 H  HB3  . ASN A 1 223 ? -9.251  -4.332  -18.722 1.00  15.96 ? 1676 ASN A HB3  1 
ATOM   3507 H  HD21 . ASN A 1 223 ? -11.474 -2.176  -19.797 1.00  19.67 ? 1676 ASN A HD21 1 
ATOM   3508 H  HD22 . ASN A 1 223 ? -10.631 -0.950  -19.867 1.00  19.67 ? 1676 ASN A HD22 1 
ATOM   3509 N  N    . MET A 1 224 ? -9.396  -7.042  -21.522 1.00  12.38 ? 1677 MET A N    1 
ATOM   3510 C  CA   . MET A 1 224 ? -9.159  -8.477  -21.434 1.00  12.46 ? 1677 MET A CA   1 
ATOM   3511 C  C    . MET A 1 224 ? -7.812  -8.807  -20.780 1.00  12.68 ? 1677 MET A C    1 
ATOM   3512 O  O    . MET A 1 224 ? -7.697  -9.784  -20.045 1.00  12.18 ? 1677 MET A O    1 
ATOM   3513 C  CB   . MET A 1 224 ? -9.265  -9.105  -22.827 1.00  14.52 ? 1677 MET A CB   1 
ATOM   3514 C  CG   . MET A 1 224 ? -9.134  -10.625 -22.858 1.00  15.47 ? 1677 MET A CG   1 
ATOM   3515 S  SD   . MET A 1 224 ? -10.414 -11.506 -21.946 1.00  16.73 ? 1677 MET A SD   1 
ATOM   3516 C  CE   . MET A 1 224 ? -11.871 -10.919 -22.807 1.00  17.92 ? 1677 MET A CE   1 
ATOM   3517 H  H    . MET A 1 224 ? -9.626  -6.771  -22.305 1.00  14.85 ? 1677 MET A H    1 
ATOM   3518 H  HA   . MET A 1 224 ? -9.869  -8.870  -20.885 1.00  14.95 ? 1677 MET A HA   1 
ATOM   3519 H  HB2  . MET A 1 224 ? -10.131 -8.878  -23.203 1.00  17.43 ? 1677 MET A HB2  1 
ATOM   3520 H  HB3  . MET A 1 224 ? -8.562  -8.739  -23.386 1.00  17.43 ? 1677 MET A HB3  1 
ATOM   3521 H  HG2  . MET A 1 224 ? -9.173  -10.922 -23.781 1.00  18.57 ? 1677 MET A HG2  1 
ATOM   3522 H  HG3  . MET A 1 224 ? -8.278  -10.870 -22.473 1.00  18.57 ? 1677 MET A HG3  1 
ATOM   3523 H  HE1  . MET A 1 224 ? -11.807 -11.167 -23.732 1.00  21.51 ? 1677 MET A HE1  1 
ATOM   3524 H  HE2  . MET A 1 224 ? -12.649 -11.321 -22.413 1.00  21.51 ? 1677 MET A HE2  1 
ATOM   3525 H  HE3  . MET A 1 224 ? -11.918 -9.964  -22.725 1.00  21.51 ? 1677 MET A HE3  1 
ATOM   3526 N  N    . ALA A 1 225 ? -6.792  -8.000  -21.036 1.00  12.70 ? 1678 ALA A N    1 
ATOM   3527 C  CA   . ALA A 1 225 ? -5.471  -8.259  -20.461 1.00  13.00 ? 1678 ALA A CA   1 
ATOM   3528 C  C    . ALA A 1 225 ? -5.478  -8.296  -18.928 1.00  12.57 ? 1678 ALA A C    1 
ATOM   3529 O  O    . ALA A 1 225 ? -4.600  -8.920  -18.316 1.00  14.69 ? 1678 ALA A O    1 
ATOM   3530 C  CB   . ALA A 1 225 ? -4.466  -7.203  -20.948 1.00  14.68 ? 1678 ALA A CB   1 
ATOM   3531 H  H    . ALA A 1 225 ? -6.833  -7.300  -21.533 1.00  15.24 ? 1678 ALA A H    1 
ATOM   3532 H  HA   . ALA A 1 225 ? -5.159  -9.133  -20.777 1.00  15.59 ? 1678 ALA A HA   1 
ATOM   3533 H  HB1  . ALA A 1 225 ? -4.768  -6.334  -20.673 1.00  17.62 ? 1678 ALA A HB1  1 
ATOM   3534 H  HB2  . ALA A 1 225 ? -3.606  -7.388  -20.562 1.00  17.62 ? 1678 ALA A HB2  1 
ATOM   3535 H  HB3  . ALA A 1 225 ? -4.410  -7.242  -21.905 1.00  17.62 ? 1678 ALA A HB3  1 
ATOM   3536 N  N    . VAL A 1 226 ? -6.436  -7.597  -18.323 1.00  11.24 ? 1679 VAL A N    1 
ATOM   3537 C  CA   . VAL A 1 226 ? -6.560  -7.490  -16.879 1.00  10.15 ? 1679 VAL A CA   1 
ATOM   3538 C  C    . VAL A 1 226 ? -7.293  -8.698  -16.275 1.00  9.86  ? 1679 VAL A C    1 
ATOM   3539 O  O    . VAL A 1 226 ? -7.225  -8.949  -15.069 1.00  11.98 ? 1679 VAL A O    1 
ATOM   3540 C  CB   . VAL A 1 226 ? -7.330  -6.171  -16.517 1.00  11.76 ? 1679 VAL A CB   1 
ATOM   3541 C  CG1  . VAL A 1 226 ? -7.442  -5.968  -15.009 1.00  13.16 ? 1679 VAL A CG1  1 
ATOM   3542 C  CG2  . VAL A 1 226 ? -6.623  -4.984  -17.127 1.00  13.74 ? 1679 VAL A CG2  1 
ATOM   3543 H  H    . VAL A 1 226 ? -7.046  -7.163  -18.747 1.00  13.49 ? 1679 VAL A H    1 
ATOM   3544 H  HA   . VAL A 1 226 ? -5.665  -7.444  -16.480 1.00  12.17 ? 1679 VAL A HA   1 
ATOM   3545 H  HB   . VAL A 1 226 ? -8.235  -6.213  -16.889 1.00  14.11 ? 1679 VAL A HB   1 
ATOM   3546 H  HG11 . VAL A 1 226 ? -6.560  -5.916  -14.635 1.00  15.79 ? 1679 VAL A HG11 1 
ATOM   3547 H  HG12 . VAL A 1 226 ? -7.919  -5.152  -14.839 1.00  15.79 ? 1679 VAL A HG12 1 
ATOM   3548 H  HG13 . VAL A 1 226 ? -7.917  -6.710  -14.629 1.00  15.79 ? 1679 VAL A HG13 1 
ATOM   3549 H  HG21 . VAL A 1 226 ? -6.599  -5.092  -18.081 1.00  16.49 ? 1679 VAL A HG21 1 
ATOM   3550 H  HG22 . VAL A 1 226 ? -7.103  -4.184  -16.900 1.00  16.49 ? 1679 VAL A HG22 1 
ATOM   3551 H  HG23 . VAL A 1 226 ? -5.729  -4.941  -16.780 1.00  16.49 ? 1679 VAL A HG23 1 
ATOM   3552 N  N    . ILE A 1 227 ? -8.006  -9.442  -17.109 1.00  9.74  ? 1680 ILE A N    1 
ATOM   3553 C  CA   . ILE A 1 227 ? -8.828  -10.565 -16.641 1.00  9.98  ? 1680 ILE A CA   1 
ATOM   3554 C  C    . ILE A 1 227 ? -7.954  -11.819 -16.571 1.00  9.90  ? 1680 ILE A C    1 
ATOM   3555 O  O    . ILE A 1 227 ? -7.446  -12.283 -17.587 1.00  12.48 ? 1680 ILE A O    1 
ATOM   3556 C  CB   . ILE A 1 227 ? -9.983  -10.820 -17.620 1.00  10.83 ? 1680 ILE A CB   1 
ATOM   3557 C  CG1  . ILE A 1 227 ? -10.867 -9.573  -17.723 1.00  11.43 ? 1680 ILE A CG1  1 
ATOM   3558 C  CG2  . ILE A 1 227 ? -10.799 -12.044 -17.169 1.00  11.78 ? 1680 ILE A CG2  1 
ATOM   3559 C  CD1  . ILE A 1 227 ? -11.974 -9.720  -18.776 1.00  12.65 ? 1680 ILE A CD1  1 
ATOM   3560 H  H    . ILE A 1 227 ? -8.035  -9.320  -17.960 1.00  11.69 ? 1680 ILE A H    1 
ATOM   3561 H  HA   . ILE A 1 227 ? -9.192  -10.374 -15.752 1.00  11.97 ? 1680 ILE A HA   1 
ATOM   3562 H  HB   . ILE A 1 227 ? -9.610  -11.005 -18.496 1.00  13.00 ? 1680 ILE A HB   1 
ATOM   3563 H  HG12 . ILE A 1 227 ? -11.289 -9.413  -16.865 1.00  13.71 ? 1680 ILE A HG12 1 
ATOM   3564 H  HG13 . ILE A 1 227 ? -10.316 -8.814  -17.970 1.00  13.71 ? 1680 ILE A HG13 1 
ATOM   3565 H  HG21 . ILE A 1 227 ? -11.154 -11.877 -16.292 1.00  14.14 ? 1680 ILE A HG21 1 
ATOM   3566 H  HG22 . ILE A 1 227 ? -11.516 -12.188 -17.791 1.00  14.14 ? 1680 ILE A HG22 1 
ATOM   3567 H  HG23 . ILE A 1 227 ? -10.223 -12.812 -17.148 1.00  14.14 ? 1680 ILE A HG23 1 
ATOM   3568 H  HD11 . ILE A 1 227 ? -12.533 -10.464 -18.540 1.00  15.18 ? 1680 ILE A HD11 1 
ATOM   3569 H  HD12 . ILE A 1 227 ? -12.494 -8.913  -18.797 1.00  15.18 ? 1680 ILE A HD12 1 
ATOM   3570 H  HD13 . ILE A 1 227 ? -11.570 -9.872  -19.634 1.00  15.18 ? 1680 ILE A HD13 1 
ATOM   3571 N  N    . ASP A 1 228 ? -7.783  -12.385 -15.378 1.00  9.55  ? 1681 ASP A N    1 
ATOM   3572 C  CA   . ASP A 1 228 ? -6.951  -13.578 -15.245 1.00  9.88  ? 1681 ASP A CA   1 
ATOM   3573 C  C    . ASP A 1 228 ? -7.679  -14.871 -15.588 1.00  9.73  ? 1681 ASP A C    1 
ATOM   3574 O  O    . ASP A 1 228 ? -7.074  -15.778 -16.166 1.00  11.34 ? 1681 ASP A O    1 
ATOM   3575 C  CB   . ASP A 1 228 ? -6.396  -13.695 -13.834 1.00  10.70 ? 1681 ASP A CB   1 
ATOM   3576 C  CG   . ASP A 1 228 ? -5.609  -12.478 -13.430 1.00  10.96 ? 1681 ASP A CG   1 
ATOM   3577 O  OD1  . ASP A 1 228 ? -4.411  -12.436 -13.795 1.00  14.51 ? 1681 ASP A OD1  1 
ATOM   3578 O  OD2  . ASP A 1 228 ? -6.190  -11.555 -12.806 1.00  11.80 ? 1681 ASP A OD2  1 
ATOM   3579 H  H    . ASP A 1 228 ? -8.130  -12.104 -14.643 1.00  11.46 ? 1681 ASP A H    1 
ATOM   3580 H  HA   . ASP A 1 228 ? -6.190  -13.497 -15.857 1.00  11.86 ? 1681 ASP A HA   1 
ATOM   3581 H  HB2  . ASP A 1 228 ? -7.132  -13.799 -13.211 1.00  12.84 ? 1681 ASP A HB2  1 
ATOM   3582 H  HB3  . ASP A 1 228 ? -5.807  -14.464 -13.787 1.00  12.84 ? 1681 ASP A HB3  1 
ATOM   3583 N  N    . CYS A 1 229 ? -8.956  -14.975 -15.205 1.00  10.09 ? 1682 CYS A N    1 
ATOM   3584 C  CA   . CYS A 1 229 ? -9.726  -16.197 -15.402 1.00  10.29 ? 1682 CYS A CA   1 
ATOM   3585 C  C    . CYS A 1 229 ? -11.110 -15.880 -15.936 1.00  9.93  ? 1682 CYS A C    1 
ATOM   3586 O  O    . CYS A 1 229 ? -11.644 -14.792 -15.709 1.00  11.22 ? 1682 CYS A O    1 
ATOM   3587 C  CB   . CYS A 1 229 ? -9.921  -16.970 -14.087 1.00  12.14 ? 1682 CYS A CB   1 
ATOM   3588 S  SG   . CYS A 1 229 ? -8.435  -17.413 -13.209 1.00  14.54 ? 1682 CYS A SG   1 
ATOM   3589 H  H    . CYS A 1 229 ? -9.399  -14.343 -14.825 1.00  12.11 ? 1682 CYS A H    1 
ATOM   3590 H  HA   . CYS A 1 229 ? -9.266  -16.778 -16.044 1.00  12.35 ? 1682 CYS A HA   1 
ATOM   3591 H  HB2  . CYS A 1 229 ? -10.457 -16.425 -13.491 1.00  14.57 ? 1682 CYS A HB2  1 
ATOM   3592 H  HB3  . CYS A 1 229 ? -10.396 -17.792 -14.285 1.00  14.57 ? 1682 CYS A HB3  1 
ATOM   3593 H  HG   . CYS A 1 229 ? -8.734  -18.007 -12.210 1.00  17.45 ? 1682 CYS A HG   1 
ATOM   3594 N  N    . PHE A 1 230 ? -11.702 -16.859 -16.607 1.00  10.28 ? 1683 PHE A N    1 
ATOM   3595 C  CA   . PHE A 1 230 ? -13.151 -16.898 -16.797 1.00  10.45 ? 1683 PHE A CA   1 
ATOM   3596 C  C    . PHE A 1 230 ? -13.678 -17.926 -15.824 1.00  11.70 ? 1683 PHE A C    1 
ATOM   3597 O  O    . PHE A 1 230 ? -13.034 -18.942 -15.593 1.00  13.73 ? 1683 PHE A O    1 
ATOM   3598 C  CB   . PHE A 1 230 ? -13.508 -17.320 -18.228 1.00  10.84 ? 1683 PHE A CB   1 
ATOM   3599 C  CG   . PHE A 1 230 ? -13.030 -16.358 -19.297 1.00  11.51 ? 1683 PHE A CG   1 
ATOM   3600 C  CD1  . PHE A 1 230 ? -13.254 -14.995 -19.178 1.00  11.70 ? 1683 PHE A CD1  1 
ATOM   3601 C  CD2  . PHE A 1 230 ? -12.414 -16.829 -20.442 1.00  11.43 ? 1683 PHE A CD2  1 
ATOM   3602 C  CE1  . PHE A 1 230 ? -12.832 -14.119 -20.164 1.00  12.44 ? 1683 PHE A CE1  1 
ATOM   3603 C  CE2  . PHE A 1 230 ? -11.997 -15.972 -21.438 1.00  11.56 ? 1683 PHE A CE2  1 
ATOM   3604 C  CZ   . PHE A 1 230 ? -12.201 -14.615 -21.300 1.00  11.90 ? 1683 PHE A CZ   1 
ATOM   3605 H  H    . PHE A 1 230 ? -11.285 -17.520 -16.967 1.00  12.33 ? 1683 PHE A H    1 
ATOM   3606 H  HA   . PHE A 1 230 ? -13.549 -16.024 -16.602 1.00  12.54 ? 1683 PHE A HA   1 
ATOM   3607 H  HB2  . PHE A 1 230 ? -13.105 -18.184 -18.407 1.00  13.00 ? 1683 PHE A HB2  1 
ATOM   3608 H  HB3  . PHE A 1 230 ? -14.473 -17.387 -18.301 1.00  13.00 ? 1683 PHE A HB3  1 
ATOM   3609 H  HD1  . PHE A 1 230 ? -13.672 -14.662 -18.417 1.00  14.04 ? 1683 PHE A HD1  1 
ATOM   3610 H  HD2  . PHE A 1 230 ? -12.270 -17.742 -20.539 1.00  13.71 ? 1683 PHE A HD2  1 
ATOM   3611 H  HE1  . PHE A 1 230 ? -12.976 -13.205 -20.070 1.00  14.92 ? 1683 PHE A HE1  1 
ATOM   3612 H  HE2  . PHE A 1 230 ? -11.572 -16.306 -22.195 1.00  13.87 ? 1683 PHE A HE2  1 
ATOM   3613 H  HZ   . PHE A 1 230 ? -11.919 -14.032 -21.967 1.00  14.28 ? 1683 PHE A HZ   1 
ATOM   3614 N  N    . ALA A 1 231 ? -14.839 -17.665 -15.254 1.00  11.22 ? 1684 ALA A N    1 
ATOM   3615 C  CA   . ALA A 1 231 ? -15.488 -18.624 -14.365 1.00  11.07 ? 1684 ALA A CA   1 
ATOM   3616 C  C    . ALA A 1 231 ? -16.975 -18.348 -14.451 1.00  12.02 ? 1684 ALA A C    1 
ATOM   3617 O  O    . ALA A 1 231 ? -17.381 -17.197 -14.518 1.00  13.37 ? 1684 ALA A O    1 
ATOM   3618 C  CB   . ALA A 1 231 ? -15.000 -18.468 -12.952 1.00  13.85 ? 1684 ALA A CB   1 
ATOM   3619 H  H    . ALA A 1 231 ? -15.280 -16.935 -15.364 1.00  13.46 ? 1684 ALA A H    1 
ATOM   3620 H  HA   . ALA A 1 231 ? -15.311 -19.539 -14.668 1.00  13.29 ? 1684 ALA A HA   1 
ATOM   3621 H  HB1  . ALA A 1 231 ? -15.200 -17.580 -12.649 1.00  16.62 ? 1684 ALA A HB1  1 
ATOM   3622 H  HB2  . ALA A 1 231 ? -15.446 -19.112 -12.396 1.00  16.62 ? 1684 ALA A HB2  1 
ATOM   3623 H  HB3  . ALA A 1 231 ? -14.052 -18.617 -12.931 1.00  16.62 ? 1684 ALA A HB3  1 
ATOM   3624 N  N    . SER A 1 232 ? -17.791 -19.384 -14.411 1.00  12.14 ? 1685 SER A N    1 
ATOM   3625 C  CA   . SER A 1 232 ? -19.181 -19.205 -14.796 1.00  12.49 ? 1685 SER A CA   1 
ATOM   3626 C  C    . SER A 1 232 ? -20.041 -18.498 -13.754 1.00  12.02 ? 1685 SER A C    1 
ATOM   3627 O  O    . SER A 1 232 ? -21.022 -17.872 -14.097 1.00  12.52 ? 1685 SER A O    1 
ATOM   3628 C  CB   . SER A 1 232 ? -19.823 -20.551 -15.115 1.00  14.13 ? 1685 SER A CB   1 
ATOM   3629 O  OG   . SER A 1 232 ? -19.824 -21.402 -13.987 1.00  15.87 ? 1685 SER A OG   1 
ATOM   3630 H  H    . SER A 1 232 ? -17.576 -20.182 -14.172 1.00  14.57 ? 1685 SER A H    1 
ATOM   3631 H  HA   . SER A 1 232 ? -19.208 -18.665 -15.613 1.00  14.98 ? 1685 SER A HA   1 
ATOM   3632 H  HB2  . SER A 1 232 ? -20.739 -20.403 -15.397 1.00  16.96 ? 1685 SER A HB2  1 
ATOM   3633 H  HB3  . SER A 1 232 ? -19.322 -20.976 -15.828 1.00  16.96 ? 1685 SER A HB3  1 
ATOM   3634 H  HG   . SER A 1 232 ? -20.172 -22.119 -14.178 1.00  19.04 ? 1685 SER A HG   1 
ATOM   3635 N  N    . ASP A 1 233 ? -19.700 -18.631 -12.481 1.00  12.45 ? 1686 ASP A N    1 
ATOM   3636 C  CA   . ASP A 1 233 ? -20.667 -18.371 -11.402 1.00  11.37 ? 1686 ASP A CA   1 
ATOM   3637 C  C    . ASP A 1 233 ? -21.976 -19.087 -11.709 1.00  10.89 ? 1686 ASP A C    1 
ATOM   3638 O  O    . ASP A 1 233 ? -23.067 -18.537 -11.568 1.00  11.63 ? 1686 ASP A O    1 
ATOM   3639 C  CB   . ASP A 1 233 ? -20.901 -16.877 -11.148 1.00  12.50 ? 1686 ASP A CB   1 
ATOM   3640 C  CG   . ASP A 1 233 ? -21.559 -16.596 -9.787  1.00  12.98 ? 1686 ASP A CG   1 
ATOM   3641 O  OD1  . ASP A 1 233 ? -21.600 -17.495 -8.901  1.00  12.32 ? 1686 ASP A OD1  1 
ATOM   3642 O  OD2  . ASP A 1 233 ? -22.029 -15.450 -9.593  1.00  13.95 ? 1686 ASP A OD2  1 
ATOM   3643 H  H    . ASP A 1 233 ? -18.920 -18.869 -12.207 1.00  14.93 ? 1686 ASP A H    1 
ATOM   3644 H  HA   . ASP A 1 233 ? -20.312 -18.755 -10.573 1.00  13.64 ? 1686 ASP A HA   1 
ATOM   3645 H  HB2  . ASP A 1 233 ? -20.048 -16.416 -11.169 1.00  15.00 ? 1686 ASP A HB2  1 
ATOM   3646 H  HB3  . ASP A 1 233 ? -21.484 -16.527 -11.840 1.00  15.00 ? 1686 ASP A HB3  1 
ATOM   3647 N  N    . HIS A 1 234 ? -21.850 -20.355 -12.086 1.00  11.80 ? 1687 HIS A N    1 
ATOM   3648 C  CA   . HIS A 1 234 ? -23.002 -21.225 -12.262 1.00  11.42 ? 1687 HIS A CA   1 
ATOM   3649 C  C    . HIS A 1 234 ? -23.827 -21.206 -10.983 1.00  11.57 ? 1687 HIS A C    1 
ATOM   3650 O  O    . HIS A 1 234 ? -23.379 -21.673 -9.940  1.00  12.58 ? 1687 HIS A O    1 
ATOM   3651 C  CB   . HIS A 1 234 ? -22.477 -22.639 -12.515 1.00  11.59 ? 1687 HIS A CB   1 
ATOM   3652 C  CG   . HIS A 1 234 ? -23.545 -23.651 -12.743 1.00  12.24 ? 1687 HIS A CG   1 
ATOM   3653 N  ND1  . HIS A 1 234 ? -24.146 -23.810 -13.961 1.00  13.41 ? 1687 HIS A ND1  1 
ATOM   3654 C  CD2  . HIS A 1 234 ? -24.105 -24.562 -11.925 1.00  12.50 ? 1687 HIS A CD2  1 
ATOM   3655 C  CE1  . HIS A 1 234 ? -25.037 -24.781 -13.898 1.00  13.76 ? 1687 HIS A CE1  1 
ATOM   3656 N  NE2  . HIS A 1 234 ? -25.034 -25.251 -12.662 1.00  13.44 ? 1687 HIS A NE2  1 
ATOM   3657 H  H    . HIS A 1 234 ? -21.097 -20.738 -12.247 1.00  14.16 ? 1687 HIS A H    1 
ATOM   3658 H  HA   . HIS A 1 234 ? -23.550 -20.931 -13.019 1.00  13.70 ? 1687 HIS A HA   1 
ATOM   3659 H  HB2  . HIS A 1 234 ? -21.911 -22.625 -13.303 1.00  13.91 ? 1687 HIS A HB2  1 
ATOM   3660 H  HB3  . HIS A 1 234 ? -21.961 -22.923 -11.745 1.00  13.91 ? 1687 HIS A HB3  1 
ATOM   3661 H  HD1  . HIS A 1 234 ? -23.964 -23.351 -14.666 1.00  16.09 ? 1687 HIS A HD1  1 
ATOM   3662 H  HD2  . HIS A 1 234 ? -23.901 -24.698 -11.027 1.00  15.00 ? 1687 HIS A HD2  1 
ATOM   3663 H  HE1  . HIS A 1 234 ? -25.580 -25.072 -14.595 1.00  16.51 ? 1687 HIS A HE1  1 
ATOM   3664 H  HE2  . HIS A 1 234 ? -25.533 -25.887 -12.368 1.00  16.12 ? 1687 HIS A HE2  1 
ATOM   3665 N  N    . ALA A 1 235 ? -25.036 -20.669 -11.069 1.00  11.70 ? 1688 ALA A N    1 
ATOM   3666 C  CA   . ALA A 1 235 ? -25.856 -20.384 -9.889  1.00  12.55 ? 1688 ALA A CA   1 
ATOM   3667 C  C    . ALA A 1 235 ? -27.280 -20.795 -10.195 1.00  13.50 ? 1688 ALA A C    1 
ATOM   3668 O  O    . ALA A 1 235 ? -28.155 -19.965 -10.456 1.00  15.34 ? 1688 ALA A O    1 
ATOM   3669 C  CB   . ALA A 1 235 ? -25.766 -18.921 -9.515  1.00  14.03 ? 1688 ALA A CB   1 
ATOM   3670 H  H    . ALA A 1 235 ? -25.414 -20.455 -11.811 1.00  14.04 ? 1688 ALA A H    1 
ATOM   3671 H  HA   . ALA A 1 235 ? -25.536 -20.918 -9.133  1.00  15.06 ? 1688 ALA A HA   1 
ATOM   3672 H  HB1  . ALA A 1 235 ? -26.080 -18.391 -10.251 1.00  16.83 ? 1688 ALA A HB1  1 
ATOM   3673 H  HB2  . ALA A 1 235 ? -26.312 -18.763 -8.741  1.00  16.83 ? 1688 ALA A HB2  1 
ATOM   3674 H  HB3  . ALA A 1 235 ? -24.851 -18.704 -9.321  1.00  16.83 ? 1688 ALA A HB3  1 
ATOM   3675 N  N    . PRO A 1 236 ? -27.507 -22.104 -10.231 1.00  13.91 ? 1689 PRO A N    1 
ATOM   3676 C  CA   . PRO A 1 236 ? -28.782 -22.628 -10.696 1.00  13.97 ? 1689 PRO A CA   1 
ATOM   3677 C  C    . PRO A 1 236 ? -29.890 -22.419 -9.683  1.00  14.40 ? 1689 PRO A C    1 
ATOM   3678 O  O    . PRO A 1 236 ? -29.698 -22.567 -8.474  1.00  14.48 ? 1689 PRO A O    1 
ATOM   3679 C  CB   . PRO A 1 236 ? -28.498 -24.121 -10.901 1.00  14.82 ? 1689 PRO A CB   1 
ATOM   3680 C  CG   . PRO A 1 236 ? -27.360 -24.422 -9.944  1.00  15.02 ? 1689 PRO A CG   1 
ATOM   3681 C  CD   . PRO A 1 236 ? -26.522 -23.157 -9.932  1.00  14.95 ? 1689 PRO A CD   1 
ATOM   3682 H  HA   . PRO A 1 236 ? -29.033 -22.219 -11.551 1.00  16.77 ? 1689 PRO A HA   1 
ATOM   3683 H  HB2  . PRO A 1 236 ? -29.286 -24.640 -10.674 1.00  17.79 ? 1689 PRO A HB2  1 
ATOM   3684 H  HB3  . PRO A 1 236 ? -28.230 -24.282 -11.819 1.00  17.79 ? 1689 PRO A HB3  1 
ATOM   3685 H  HG2  . PRO A 1 236 ? -27.715 -24.609 -9.060  1.00  18.02 ? 1689 PRO A HG2  1 
ATOM   3686 H  HG3  . PRO A 1 236 ? -26.844 -25.174 -10.274 1.00  18.02 ? 1689 PRO A HG3  1 
ATOM   3687 H  HD2  . PRO A 1 236 ? -26.131 -23.017 -9.055  1.00  17.94 ? 1689 PRO A HD2  1 
ATOM   3688 H  HD3  . PRO A 1 236 ? -25.844 -23.194 -10.624 1.00  17.94 ? 1689 PRO A HD3  1 
ATOM   3689 N  N    . HIS A 1 237 ? -31.051 -22.087 -10.226 1.00  14.14 ? 1690 HIS A N    1 
ATOM   3690 C  CA   . HIS A 1 237 ? -32.300 -22.001 -9.507  1.00  14.47 ? 1690 HIS A CA   1 
ATOM   3691 C  C    . HIS A 1 237 ? -33.327 -22.454 -10.525 1.00  15.06 ? 1690 HIS A C    1 
ATOM   3692 O  O    . HIS A 1 237 ? -33.104 -22.329 -11.731 1.00  15.92 ? 1690 HIS A O    1 
ATOM   3693 C  CB   . HIS A 1 237 ? -32.644 -20.563 -9.110  1.00  15.07 ? 1690 HIS A CB   1 
ATOM   3694 C  CG   . HIS A 1 237 ? -31.634 -19.901 -8.226  1.00  15.35 ? 1690 HIS A CG   1 
ATOM   3695 N  ND1  . HIS A 1 237 ? -31.508 -20.223 -6.907  1.00  16.25 ? 1690 HIS A ND1  1 
ATOM   3696 C  CD2  . HIS A 1 237 ? -30.747 -18.911 -8.457  1.00  15.34 ? 1690 HIS A CD2  1 
ATOM   3697 C  CE1  . HIS A 1 237 ? -30.560 -19.485 -6.347  1.00  16.43 ? 1690 HIS A CE1  1 
ATOM   3698 N  NE2  . HIS A 1 237 ? -30.084 -18.668 -7.277  1.00  16.27 ? 1690 HIS A NE2  1 
ATOM   3699 H  H    . HIS A 1 237 ? -31.138 -21.896 -11.060 1.00  16.96 ? 1690 HIS A H    1 
ATOM   3700 H  HA   . HIS A 1 237 ? -32.309 -22.590 -8.723  1.00  17.36 ? 1690 HIS A HA   1 
ATOM   3701 H  HB2  . HIS A 1 237 ? -32.723 -20.030 -9.916  1.00  18.08 ? 1690 HIS A HB2  1 
ATOM   3702 H  HB3  . HIS A 1 237 ? -33.491 -20.566 -8.636  1.00  18.08 ? 1690 HIS A HB3  1 
ATOM   3703 H  HD1  . HIS A 1 237 ? -31.964 -20.829 -6.502  1.00  19.50 ? 1690 HIS A HD1  1 
ATOM   3704 H  HD2  . HIS A 1 237 ? -30.603 -18.479 -9.268  1.00  18.40 ? 1690 HIS A HD2  1 
ATOM   3705 H  HE1  . HIS A 1 237 ? -30.285 -19.526 -5.459  1.00  19.72 ? 1690 HIS A HE1  1 
ATOM   3706 H  HE2  . HIS A 1 237 ? -29.459 -18.088 -7.163  1.00  19.53 ? 1690 HIS A HE2  1 
ATOM   3707 N  N    . THR A 1 238 ? -34.461 -22.958 -10.067 1.00  15.46 ? 1691 THR A N    1 
ATOM   3708 C  CA   . THR A 1 238 ? -35.451 -23.446 -11.002 1.00  17.01 ? 1691 THR A CA   1 
ATOM   3709 C  C    . THR A 1 238 ? -36.199 -22.271 -11.615 1.00  17.03 ? 1691 THR A C    1 
ATOM   3710 O  O    . THR A 1 238 ? -36.178 -21.145 -11.092 1.00  17.06 ? 1691 THR A O    1 
ATOM   3711 C  CB   . THR A 1 238 ? -36.468 -24.364 -10.314 1.00  19.05 ? 1691 THR A CB   1 
ATOM   3712 O  OG1  . THR A 1 238 ? -37.208 -23.596 -9.364  1.00  19.45 ? 1691 THR A OG1  1 
ATOM   3713 C  CG2  . THR A 1 238 ? -35.769 -25.531 -9.618  1.00  20.30 ? 1691 THR A CG2  1 
ATOM   3714 H  H    . THR A 1 238 ? -34.676 -23.026 -9.238  1.00  18.56 ? 1691 THR A H    1 
ATOM   3715 H  HA   . THR A 1 238 ? -35.010 -23.947 -11.719 1.00  20.41 ? 1691 THR A HA   1 
ATOM   3716 H  HB   . THR A 1 238 ? -37.076 -24.725 -10.978 1.00  22.86 ? 1691 THR A HB   1 
ATOM   3717 H  HG1  . THR A 1 238 ? -37.758 -24.072 -8.985  1.00  23.34 ? 1691 THR A HG1  1 
ATOM   3718 H  HG21 . THR A 1 238 ? -35.160 -25.199 -8.954  1.00  24.36 ? 1691 THR A HG21 1 
ATOM   3719 H  HG22 . THR A 1 238 ? -36.418 -26.096 -9.193  1.00  24.36 ? 1691 THR A HG22 1 
ATOM   3720 H  HG23 . THR A 1 238 ? -35.277 -26.048 -10.260 1.00  24.36 ? 1691 THR A HG23 1 
ATOM   3721 N  N    . LEU A 1 239 ? -36.866 -22.533 -12.727 1.00  17.43 ? 1692 LEU A N    1 
ATOM   3722 C  CA   . LEU A 1 239 ? -37.645 -21.506 -13.378 1.00  17.82 ? 1692 LEU A CA   1 
ATOM   3723 C  C    . LEU A 1 239 ? -38.739 -20.984 -12.436 1.00  17.78 ? 1692 LEU A C    1 
ATOM   3724 O  O    . LEU A 1 239 ? -39.003 -19.778 -12.386 1.00  18.44 ? 1692 LEU A O    1 
ATOM   3725 C  CB   . LEU A 1 239 ? -38.242 -22.033 -14.685 1.00  18.78 ? 1692 LEU A CB   1 
ATOM   3726 C  CG   . LEU A 1 239 ? -38.951 -20.954 -15.506 1.00  20.66 ? 1692 LEU A CG   1 
ATOM   3727 C  CD1  . LEU A 1 239 ? -37.981 -19.846 -15.935 1.00  21.51 ? 1692 LEU A CD1  1 
ATOM   3728 C  CD2  . LEU A 1 239 ? -39.658 -21.555 -16.709 1.00  21.87 ? 1692 LEU A CD2  1 
ATOM   3729 H  H    . LEU A 1 239 ? -36.881 -23.297 -13.122 1.00  20.92 ? 1692 LEU A H    1 
ATOM   3730 H  HA   . LEU A 1 239 ? -37.056 -20.754 -13.599 1.00  21.38 ? 1692 LEU A HA   1 
ATOM   3731 H  HB2  . LEU A 1 239 ? -37.529 -22.401 -15.230 1.00  22.54 ? 1692 LEU A HB2  1 
ATOM   3732 H  HB3  . LEU A 1 239 ? -38.890 -22.724 -14.478 1.00  22.54 ? 1692 LEU A HB3  1 
ATOM   3733 H  HG   . LEU A 1 239 ? -39.630 -20.543 -14.947 1.00  24.79 ? 1692 LEU A HG   1 
ATOM   3734 H  HD11 . LEU A 1 239 ? -37.284 -20.232 -16.471 1.00  25.81 ? 1692 LEU A HD11 1 
ATOM   3735 H  HD12 . LEU A 1 239 ? -38.462 -19.191 -16.446 1.00  25.81 ? 1692 LEU A HD12 1 
ATOM   3736 H  HD13 . LEU A 1 239 ? -37.605 -19.439 -15.151 1.00  25.81 ? 1692 LEU A HD13 1 
ATOM   3737 H  HD21 . LEU A 1 239 ? -40.309 -22.190 -16.403 1.00  26.24 ? 1692 LEU A HD21 1 
ATOM   3738 H  HD22 . LEU A 1 239 ? -40.091 -20.852 -17.199 1.00  26.24 ? 1692 LEU A HD22 1 
ATOM   3739 H  HD23 . LEU A 1 239 ? -39.010 -21.992 -17.266 1.00  26.24 ? 1692 LEU A HD23 1 
ATOM   3740 N  N    . GLU A 1 240 ? -39.387 -21.881 -11.693 1.00  17.96 ? 1693 GLU A N    1 
ATOM   3741 C  CA   . GLU A 1 240 ? -40.387 -21.474 -10.712 1.00  19.72 ? 1693 GLU A CA   1 
ATOM   3742 C  C    . GLU A 1 240 ? -39.840 -20.429 -9.739  1.00  18.63 ? 1693 GLU A C    1 
ATOM   3743 O  O    . GLU A 1 240 ? -40.526 -19.466 -9.394  1.00  19.81 ? 1693 GLU A O    1 
ATOM   3744 C  CB   . GLU A 1 240 ? -40.898 -22.691 -9.930  1.00  22.85 ? 1693 GLU A CB   1 
ATOM   3745 C  CG   . GLU A 1 240 ? -42.034 -22.365 -8.950  1.00  27.63 ? 1693 GLU A CG   1 
ATOM   3746 C  CD   . GLU A 1 240 ? -41.550 -21.904 -7.575  1.00  33.03 ? 1693 GLU A CD   1 
ATOM   3747 O  OE1  . GLU A 1 240 ? -40.535 -22.446 -7.082  1.00  34.36 ? 1693 GLU A OE1  1 
ATOM   3748 O  OE2  . GLU A 1 240 ? -42.193 -21.005 -6.983  1.00  35.87 ? 1693 GLU A OE2  1 
ATOM   3749 H  H    . GLU A 1 240 ? -39.264 -22.731 -11.739 1.00  21.55 ? 1693 GLU A H    1 
ATOM   3750 H  HA   . GLU A 1 240 ? -41.149 -21.077 -11.183 1.00  23.67 ? 1693 GLU A HA   1 
ATOM   3751 H  HB2  . GLU A 1 240 ? -41.230 -23.350 -10.559 1.00  27.42 ? 1693 GLU A HB2  1 
ATOM   3752 H  HB3  . GLU A 1 240 ? -40.164 -23.065 -9.418  1.00  27.42 ? 1693 GLU A HB3  1 
ATOM   3753 H  HG2  . GLU A 1 240 ? -42.577 -21.654 -9.326  1.00  33.15 ? 1693 GLU A HG2  1 
ATOM   3754 H  HG3  . GLU A 1 240 ? -42.575 -23.160 -8.823  1.00  33.15 ? 1693 GLU A HG3  1 
ATOM   3755 N  N    . GLU A 1 241 ? -38.611 -20.636 -9.286  1.00  17.69 ? 1694 GLU A N    1 
ATOM   3756 C  CA   . GLU A 1 241 ? -37.973 -19.710 -8.365  1.00  17.30 ? 1694 GLU A CA   1 
ATOM   3757 C  C    . GLU A 1 241 ? -37.647 -18.391 -9.060  1.00  16.82 ? 1694 GLU A C    1 
ATOM   3758 O  O    . GLU A 1 241 ? -37.933 -17.315 -8.527  1.00  18.07 ? 1694 GLU A O    1 
ATOM   3759 C  CB   . GLU A 1 241 ? -36.735 -20.373 -7.750  1.00  17.45 ? 1694 GLU A CB   1 
ATOM   3760 C  CG   . GLU A 1 241 ? -37.115 -21.497 -6.799  1.00  18.97 ? 1694 GLU A CG   1 
ATOM   3761 C  CD   . GLU A 1 241 ? -35.947 -22.355 -6.364  1.00  19.90 ? 1694 GLU A CD   1 
ATOM   3762 O  OE1  . GLU A 1 241 ? -34.951 -22.472 -7.115  1.00  19.88 ? 1694 GLU A OE1  1 
ATOM   3763 O  OE2  . GLU A 1 241 ? -36.035 -22.919 -5.253  1.00  21.15 ? 1694 GLU A OE2  1 
ATOM   3764 H  H    . GLU A 1 241 ? -38.122 -21.311 -9.498  1.00  21.23 ? 1694 GLU A H    1 
ATOM   3765 H  HA   . GLU A 1 241 ? -38.598 -19.514 -7.636  1.00  20.76 ? 1694 GLU A HA   1 
ATOM   3766 H  HB2  . GLU A 1 241 ? -36.187 -20.747 -8.458  1.00  20.95 ? 1694 GLU A HB2  1 
ATOM   3767 H  HB3  . GLU A 1 241 ? -36.232 -19.711 -7.251  1.00  20.95 ? 1694 GLU A HB3  1 
ATOM   3768 H  HG2  . GLU A 1 241 ? -37.512 -21.111 -6.003  1.00  22.76 ? 1694 GLU A HG2  1 
ATOM   3769 H  HG3  . GLU A 1 241 ? -37.758 -22.074 -7.240  1.00  22.76 ? 1694 GLU A HG3  1 
ATOM   3770 N  N    . LYS A 1 242 ? -37.057 -18.463 -10.250 1.00  16.42 ? 1695 LYS A N    1 
ATOM   3771 C  CA   . LYS A 1 242 ? -36.682 -17.253 -10.985 1.00  16.01 ? 1695 LYS A CA   1 
ATOM   3772 C  C    . LYS A 1 242 ? -37.875 -16.395 -11.389 1.00  17.49 ? 1695 LYS A C    1 
ATOM   3773 O  O    . LYS A 1 242 ? -37.756 -15.184 -11.474 1.00  18.49 ? 1695 LYS A O    1 
ATOM   3774 C  CB   . LYS A 1 242 ? -35.900 -17.605 -12.247 1.00  16.07 ? 1695 LYS A CB   1 
ATOM   3775 C  CG   . LYS A 1 242 ? -34.564 -18.288 -12.007 1.00  15.37 ? 1695 LYS A CG   1 
ATOM   3776 C  CD   . LYS A 1 242 ? -33.573 -17.429 -11.197 1.00  15.79 ? 1695 LYS A CD   1 
ATOM   3777 C  CE   . LYS A 1 242 ? -33.256 -16.100 -11.838 1.00  14.97 ? 1695 LYS A CE   1 
ATOM   3778 N  NZ   . LYS A 1 242 ? -32.066 -15.468 -11.208 1.00  14.75 ? 1695 LYS A NZ   1 
ATOM   3779 H  H    . LYS A 1 242 ? -36.862 -19.197 -10.655 1.00  19.71 ? 1695 LYS A H    1 
ATOM   3780 H  HA   . LYS A 1 242 ? -36.100 -16.707 -10.415 1.00  19.22 ? 1695 LYS A HA   1 
ATOM   3781 H  HB2  . LYS A 1 242 ? -36.440 -18.202 -12.788 1.00  19.28 ? 1695 LYS A HB2  1 
ATOM   3782 H  HB3  . LYS A 1 242 ? -35.726 -16.788 -12.740 1.00  19.28 ? 1695 LYS A HB3  1 
ATOM   3783 H  HG2  . LYS A 1 242 ? -34.716 -19.110 -11.515 1.00  18.45 ? 1695 LYS A HG2  1 
ATOM   3784 H  HG3  . LYS A 1 242 ? -34.155 -18.486 -12.863 1.00  18.45 ? 1695 LYS A HG3  1 
ATOM   3785 H  HD2  . LYS A 1 242 ? -33.953 -17.253 -10.322 1.00  18.95 ? 1695 LYS A HD2  1 
ATOM   3786 H  HD3  . LYS A 1 242 ? -32.740 -17.918 -11.102 1.00  18.95 ? 1695 LYS A HD3  1 
ATOM   3787 H  HE2  . LYS A 1 242 ? -33.068 -16.234 -12.780 1.00  17.96 ? 1695 LYS A HE2  1 
ATOM   3788 H  HE3  . LYS A 1 242 ? -34.013 -15.502 -11.728 1.00  17.96 ? 1695 LYS A HE3  1 
ATOM   3789 H  HZ1  . LYS A 1 242 ? -31.357 -15.998 -11.299 1.00  17.70 ? 1695 LYS A HZ1  1 
ATOM   3790 H  HZ2  . LYS A 1 242 ? -31.894 -14.686 -11.598 1.00  17.70 ? 1695 LYS A HZ2  1 
ATOM   3791 H  HZ3  . LYS A 1 242 ? -32.217 -15.332 -10.342 1.00  17.70 ? 1695 LYS A HZ3  1 
ATOM   3792 N  N    . CYS A 1 243 ? -39.010 -17.030 -11.642 1.00  18.50 ? 1696 CYS A N    1 
ATOM   3793 C  CA   A CYS A 1 243 ? -40.211 -16.348 -12.129 0.75  19.79 ? 1696 CYS A CA   1 
ATOM   3794 C  CA   B CYS A 1 243 ? -40.199 -16.334 -12.129 0.25  18.27 ? 1696 CYS A CA   1 
ATOM   3795 C  C    . CYS A 1 243 ? -41.199 -16.049 -11.004 1.00  20.28 ? 1696 CYS A C    1 
ATOM   3796 O  O    . CYS A 1 243 ? -42.291 -15.555 -11.261 1.00  23.22 ? 1696 CYS A O    1 
ATOM   3797 C  CB   A CYS A 1 243 ? -40.936 -17.214 -13.172 0.75  22.85 ? 1696 CYS A CB   1 
ATOM   3798 C  CB   B CYS A 1 243 ? -40.872 -17.184 -13.215 0.25  17.06 ? 1696 CYS A CB   1 
ATOM   3799 S  SG   A CYS A 1 243 ? -40.086 -17.533 -14.741 0.75  28.23 ? 1696 CYS A SG   1 
ATOM   3800 S  SG   B CYS A 1 243 ? -41.821 -16.277 -14.503 0.25  15.07 ? 1696 CYS A SG   1 
ATOM   3801 H  H    A CYS A 1 243 ? -39.117 -17.877 -11.538 0.75  22.20 ? 1696 CYS A H    1 
ATOM   3802 H  H    B CYS A 1 243 ? -39.122 -17.876 -11.540 0.25  22.20 ? 1696 CYS A H    1 
ATOM   3803 H  HA   A CYS A 1 243 ? -39.956 -15.502 -12.552 0.75  23.74 ? 1696 CYS A HA   1 
ATOM   3804 H  HA   B CYS A 1 243 ? -39.933 -15.480 -12.528 0.25  21.92 ? 1696 CYS A HA   1 
ATOM   3805 H  HB2  A CYS A 1 243 ? -41.119 -18.076 -12.769 0.75  27.41 ? 1696 CYS A HB2  1 
ATOM   3806 H  HB2  B CYS A 1 243 ? -40.183 -17.693 -13.672 0.25  20.47 ? 1696 CYS A HB2  1 
ATOM   3807 H  HB3  A CYS A 1 243 ? -41.776 -16.780 -13.389 0.75  27.41 ? 1696 CYS A HB3  1 
ATOM   3808 H  HB3  B CYS A 1 243 ? -41.488 -17.796 -12.783 0.25  20.47 ? 1696 CYS A HB3  1 
ATOM   3809 H  HG   A CYS A 1 243 ? -40.787 -18.218 -15.433 0.75  33.88 ? 1696 CYS A HG   1 
ATOM   3810 H  HG   B CYS A 1 243 ? -42.285 -17.068 -15.277 0.25  18.08 ? 1696 CYS A HG   1 
ATOM   3811 N  N    . GLY A 1 244 ? -40.837 -16.366 -9.765  1.00  20.65 ? 1697 GLY A N    1 
ATOM   3812 C  CA   . GLY A 1 244 ? -41.736 -16.191 -8.635  1.00  22.99 ? 1697 GLY A CA   1 
ATOM   3813 C  C    . GLY A 1 244 ? -41.627 -14.836 -7.963  1.00  25.86 ? 1697 GLY A C    1 
ATOM   3814 O  O    . GLY A 1 244 ? -40.996 -13.918 -8.489  1.00  28.18 ? 1697 GLY A O    1 
ATOM   3815 H  H    . GLY A 1 244 ? -40.068 -16.687 -9.553  1.00  24.78 ? 1697 GLY A H    1 
ATOM   3816 H  HA2  . GLY A 1 244 ? -42.651 -16.305 -8.936  1.00  27.59 ? 1697 GLY A HA2  1 
ATOM   3817 H  HA3  . GLY A 1 244 ? -41.549 -16.873 -7.971  1.00  27.59 ? 1697 GLY A HA3  1 
ATOM   3818 N  N    . SER A 1 245 ? -42.208 -14.726 -6.774  1.00  27.54 ? 1698 SER A N    1 
ATOM   3819 C  CA   . SER A 1 245 ? -42.351 -13.444 -6.105  1.00  31.09 ? 1698 SER A CA   1 
ATOM   3820 C  C    . SER A 1 245 ? -41.091 -12.915 -5.461  1.00  32.77 ? 1698 SER A C    1 
ATOM   3821 O  O    . SER A 1 245 ? -41.009 -11.722 -5.179  1.00  35.78 ? 1698 SER A O    1 
ATOM   3822 C  CB   . SER A 1 245 ? -43.448 -13.508 -5.037  1.00  32.34 ? 1698 SER A CB   1 
ATOM   3823 O  OG   . SER A 1 245 ? -43.189 -14.554 -4.116  1.00  34.45 ? 1698 SER A OG   1 
ATOM   3824 H  H    . SER A 1 245 ? -42.530 -15.389 -6.330  1.00  33.04 ? 1698 SER A H    1 
ATOM   3825 H  HA   . SER A 1 245 ? -42.634 -12.784 -6.771  1.00  37.31 ? 1698 SER A HA   1 
ATOM   3826 H  HB2  . SER A 1 245 ? -43.474 -12.664 -4.559  1.00  38.81 ? 1698 SER A HB2  1 
ATOM   3827 H  HB3  . SER A 1 245 ? -44.301 -13.671 -5.469  1.00  38.81 ? 1698 SER A HB3  1 
ATOM   3828 H  HG   . SER A 1 245 ? -43.781 -14.581 -3.548  1.00  41.34 ? 1698 SER A HG   1 
ATOM   3829 N  N    . ARG A 1 246 ? -40.115 -13.772 -5.191  1.00  29.81 ? 1699 ARG A N    1 
ATOM   3830 C  CA   . ARG A 1 246 ? -38.877 -13.254 -4.625  1.00  31.29 ? 1699 ARG A CA   1 
ATOM   3831 C  C    . ARG A 1 246 ? -37.728 -13.930 -5.310  1.00  27.82 ? 1699 ARG A C    1 
ATOM   3832 O  O    . ARG A 1 246 ? -37.062 -14.791 -4.730  1.00  28.15 ? 1699 ARG A O    1 
ATOM   3833 C  CB   . ARG A 1 246 ? -38.799 -13.465 -3.117  1.00  35.41 ? 1699 ARG A CB   1 
ATOM   3834 C  CG   . ARG A 1 246 ? -38.228 -12.252 -2.413  1.00  40.14 ? 1699 ARG A CG   1 
ATOM   3835 C  CD   . ARG A 1 246 ? -39.344 -11.344 -1.912  1.00  43.90 ? 1699 ARG A CD   1 
ATOM   3836 N  NE   . ARG A 1 246 ? -39.165 -9.944  -2.296  1.00  47.15 ? 1699 ARG A NE   1 
ATOM   3837 C  CZ   . ARG A 1 246 ? -39.888 -8.943  -1.800  1.00  49.10 ? 1699 ARG A CZ   1 
ATOM   3838 N  NH1  . ARG A 1 246 ? -40.829 -9.193  -0.898  1.00  50.03 ? 1699 ARG A NH1  1 
ATOM   3839 N  NH2  . ARG A 1 246 ? -39.671 -7.692  -2.197  1.00  49.56 ? 1699 ARG A NH2  1 
ATOM   3840 H  H    . ARG A 1 246 ? -40.139 -14.622 -5.319  1.00  35.77 ? 1699 ARG A H    1 
ATOM   3841 H  HA   . ARG A 1 246 ? -38.818 -12.292 -4.804  1.00  37.55 ? 1699 ARG A HA   1 
ATOM   3842 H  HB2  . ARG A 1 246 ? -39.691 -13.625 -2.771  1.00  42.49 ? 1699 ARG A HB2  1 
ATOM   3843 H  HB3  . ARG A 1 246 ? -38.225 -14.223 -2.929  1.00  42.49 ? 1699 ARG A HB3  1 
ATOM   3844 H  HG2  . ARG A 1 246 ? -37.702 -12.540 -1.651  1.00  48.17 ? 1699 ARG A HG2  1 
ATOM   3845 H  HG3  . ARG A 1 246 ? -37.679 -11.748 -3.034  1.00  48.17 ? 1699 ARG A HG3  1 
ATOM   3846 H  HD2  . ARG A 1 246 ? -40.188 -11.649 -2.281  1.00  52.67 ? 1699 ARG A HD2  1 
ATOM   3847 H  HD3  . ARG A 1 246 ? -39.372 -11.386 -0.943  1.00  52.67 ? 1699 ARG A HD3  1 
ATOM   3848 H  HE   . ARG A 1 246 ? -38.633 -9.770  -2.949  1.00  56.58 ? 1699 ARG A HE   1 
ATOM   3849 H  HH11 . ARG A 1 246 ? -40.973 -10.001 -0.639  1.00  59.48 ? 1699 ARG A HH11 1 
ATOM   3850 H  HH12 . ARG A 1 246 ? -41.298 -8.548  -0.574  1.00  59.48 ? 1699 ARG A HH12 1 
ATOM   3851 H  HH21 . ARG A 1 246 ? -39.061 -7.526  -2.781  1.00  60.03 ? 1699 ARG A HH21 1 
ATOM   3852 H  HH22 . ARG A 1 246 ? -40.141 -7.050  -1.871  1.00  60.03 ? 1699 ARG A HH22 1 
ATOM   3853 N  N    . PRO A 1 247 ? -37.493 -13.546 -6.566  1.00  25.08 ? 1700 PRO A N    1 
ATOM   3854 C  CA   . PRO A 1 247 ? -36.551 -14.312 -7.382  1.00  21.63 ? 1700 PRO A CA   1 
ATOM   3855 C  C    . PRO A 1 247 ? -35.148 -14.244 -6.809  1.00  20.53 ? 1700 PRO A C    1 
ATOM   3856 O  O    . PRO A 1 247 ? -34.643 -13.149 -6.537  1.00  22.12 ? 1700 PRO A O    1 
ATOM   3857 C  CB   . PRO A 1 247 ? -36.600 -13.629 -8.750  1.00  22.77 ? 1700 PRO A CB   1 
ATOM   3858 C  CG   . PRO A 1 247 ? -37.609 -12.541 -8.653  1.00  26.72 ? 1700 PRO A CG   1 
ATOM   3859 C  CD   . PRO A 1 247 ? -37.976 -12.332 -7.238  1.00  25.85 ? 1700 PRO A CD   1 
ATOM   3860 H  HA   . PRO A 1 247 ? -36.836 -15.246 -7.464  1.00  25.95 ? 1700 PRO A HA   1 
ATOM   3861 H  HB2  . PRO A 1 247 ? -35.726 -13.262 -8.958  1.00  27.33 ? 1700 PRO A HB2  1 
ATOM   3862 H  HB3  . PRO A 1 247 ? -36.864 -14.276 -9.423  1.00  27.33 ? 1700 PRO A HB3  1 
ATOM   3863 H  HG2  . PRO A 1 247 ? -37.229 -11.727 -9.018  1.00  32.07 ? 1700 PRO A HG2  1 
ATOM   3864 H  HG3  . PRO A 1 247 ? -38.394 -12.795 -9.163  1.00  32.07 ? 1700 PRO A HG3  1 
ATOM   3865 H  HD2  . PRO A 1 247 ? -37.525 -11.550 -6.885  1.00  31.02 ? 1700 PRO A HD2  1 
ATOM   3866 H  HD3  . PRO A 1 247 ? -38.939 -12.258 -7.147  1.00  31.02 ? 1700 PRO A HD3  1 
ATOM   3867 N  N    . PRO A 1 248 ? -34.513 -15.412 -6.625  1.00  17.91 ? 1701 PRO A N    1 
ATOM   3868 C  CA   . PRO A 1 248 ? -33.131 -15.428 -6.166  1.00  17.66 ? 1701 PRO A CA   1 
ATOM   3869 C  C    . PRO A 1 248 ? -32.223 -15.060 -7.314  1.00  17.10 ? 1701 PRO A C    1 
ATOM   3870 O  O    . PRO A 1 248 ? -32.538 -15.355 -8.464  1.00  17.04 ? 1701 PRO A O    1 
ATOM   3871 C  CB   . PRO A 1 248 ? -32.917 -16.886 -5.760  1.00  19.41 ? 1701 PRO A CB   1 
ATOM   3872 C  CG   . PRO A 1 248 ? -33.851 -17.641 -6.583  1.00  19.48 ? 1701 PRO A CG   1 
ATOM   3873 C  CD   . PRO A 1 248 ? -35.051 -16.772 -6.789  1.00  18.37 ? 1701 PRO A CD   1 
ATOM   3874 H  HA   . PRO A 1 248 ? -32.993 -14.829 -5.402  1.00  21.19 ? 1701 PRO A HA   1 
ATOM   3875 H  HB2  . PRO A 1 248 ? -32.003 -17.148 -5.948  1.00  23.29 ? 1701 PRO A HB2  1 
ATOM   3876 H  HB3  . PRO A 1 248 ? -33.121 -16.998 -4.818  1.00  23.29 ? 1701 PRO A HB3  1 
ATOM   3877 H  HG2  . PRO A 1 248 ? -33.434 -17.849 -7.433  1.00  23.38 ? 1701 PRO A HG2  1 
ATOM   3878 H  HG3  . PRO A 1 248 ? -34.100 -18.457 -6.120  1.00  23.38 ? 1701 PRO A HG3  1 
ATOM   3879 H  HD2  . PRO A 1 248 ? -35.405 -16.891 -7.685  1.00  22.05 ? 1701 PRO A HD2  1 
ATOM   3880 H  HD3  . PRO A 1 248 ? -35.722 -16.955 -6.113  1.00  22.05 ? 1701 PRO A HD3  1 
ATOM   3881 N  N    . PRO A 1 249 ? -31.091 -14.436 -7.011  1.00  17.59 ? 1702 PRO A N    1 
ATOM   3882 C  CA   . PRO A 1 249 ? -30.153 -14.041 -8.056  1.00  15.62 ? 1702 PRO A CA   1 
ATOM   3883 C  C    . PRO A 1 249 ? -29.338 -15.223 -8.564  1.00  15.05 ? 1702 PRO A C    1 
ATOM   3884 O  O    . PRO A 1 249 ? -28.990 -16.134 -7.806  1.00  17.53 ? 1702 PRO A O    1 
ATOM   3885 C  CB   . PRO A 1 249 ? -29.240 -13.060 -7.329  1.00  16.51 ? 1702 PRO A CB   1 
ATOM   3886 C  CG   . PRO A 1 249 ? -29.219 -13.609 -5.912  1.00  18.45 ? 1702 PRO A CG   1 
ATOM   3887 C  CD   . PRO A 1 249 ? -30.631 -14.038 -5.671  1.00  18.33 ? 1702 PRO A CD   1 
ATOM   3888 H  HA   . PRO A 1 249 ? -30.612 -13.594 -8.798  1.00  18.74 ? 1702 PRO A HA   1 
ATOM   3889 H  HB2  . PRO A 1 249 ? -28.354 -13.074 -7.723  1.00  19.81 ? 1702 PRO A HB2  1 
ATOM   3890 H  HB3  . PRO A 1 249 ? -29.622 -12.168 -7.353  1.00  19.81 ? 1702 PRO A HB3  1 
ATOM   3891 H  HG2  . PRO A 1 249 ? -28.613 -14.365 -5.859  1.00  22.14 ? 1702 PRO A HG2  1 
ATOM   3892 H  HG3  . PRO A 1 249 ? -28.958 -12.911 -5.291  1.00  22.14 ? 1702 PRO A HG3  1 
ATOM   3893 H  HD2  . PRO A 1 249 ? -30.657 -14.795 -5.065  1.00  21.99 ? 1702 PRO A HD2  1 
ATOM   3894 H  HD3  . PRO A 1 249 ? -31.159 -13.295 -5.338  1.00  21.99 ? 1702 PRO A HD3  1 
ATOM   3895 N  N    . GLY A 1 250 ? -29.035 -15.220 -9.848  1.00  14.53 ? 1703 GLY A N    1 
ATOM   3896 C  CA   . GLY A 1 250 ? -28.115 -16.203 -10.400 1.00  13.37 ? 1703 GLY A CA   1 
ATOM   3897 C  C    . GLY A 1 250 ? -28.571 -16.796 -11.717 1.00  12.90 ? 1703 GLY A C    1 
ATOM   3898 O  O    . GLY A 1 250 ? -29.760 -16.961 -11.969 1.00  13.46 ? 1703 GLY A O    1 
ATOM   3899 H  H    . GLY A 1 250 ? -29.347 -14.662 -10.424 1.00  17.44 ? 1703 GLY A H    1 
ATOM   3900 H  HA2  . GLY A 1 250 ? -27.250 -15.786 -10.539 1.00  16.05 ? 1703 GLY A HA2  1 
ATOM   3901 H  HA3  . GLY A 1 250 ? -28.003 -16.928 -9.765  1.00  16.05 ? 1703 GLY A HA3  1 
ATOM   3902 N  N    . PHE A 1 251 ? -27.592 -17.142 -12.542 1.00  13.01 ? 1704 PHE A N    1 
ATOM   3903 C  CA   . PHE A 1 251 ? -27.809 -17.827 -13.811 1.00  13.65 ? 1704 PHE A CA   1 
ATOM   3904 C  C    . PHE A 1 251 ? -27.061 -19.157 -13.817 1.00  12.87 ? 1704 PHE A C    1 
ATOM   3905 O  O    . PHE A 1 251 ? -25.910 -19.224 -13.369 1.00  13.40 ? 1704 PHE A O    1 
ATOM   3906 C  CB   . PHE A 1 251 ? -27.189 -17.040 -14.974 1.00  13.91 ? 1704 PHE A CB   1 
ATOM   3907 C  CG   . PHE A 1 251 ? -27.735 -15.645 -15.188 1.00  13.56 ? 1704 PHE A CG   1 
ATOM   3908 C  CD1  . PHE A 1 251 ? -29.021 -15.273 -14.814 1.00  14.13 ? 1704 PHE A CD1  1 
ATOM   3909 C  CD2  . PHE A 1 251 ? -26.950 -14.710 -15.836 1.00  15.52 ? 1704 PHE A CD2  1 
ATOM   3910 C  CE1  . PHE A 1 251 ? -29.482 -13.992 -15.073 1.00  15.18 ? 1704 PHE A CE1  1 
ATOM   3911 C  CE2  . PHE A 1 251 ? -27.420 -13.442 -16.097 1.00  15.33 ? 1704 PHE A CE2  1 
ATOM   3912 C  CZ   . PHE A 1 251 ? -28.678 -13.077 -15.709 1.00  15.51 ? 1704 PHE A CZ   1 
ATOM   3913 H  H    . PHE A 1 251 ? -26.762 -16.985 -12.382 1.00  15.61 ? 1704 PHE A H    1 
ATOM   3914 H  HA   . PHE A 1 251 ? -28.764 -17.976 -13.975 1.00  16.38 ? 1704 PHE A HA   1 
ATOM   3915 H  HB2  . PHE A 1 251 ? -26.236 -16.957 -14.813 1.00  16.69 ? 1704 PHE A HB2  1 
ATOM   3916 H  HB3  . PHE A 1 251 ? -27.336 -17.538 -15.793 1.00  16.69 ? 1704 PHE A HB3  1 
ATOM   3917 H  HD1  . PHE A 1 251 ? -29.574 -15.886 -14.385 1.00  16.95 ? 1704 PHE A HD1  1 
ATOM   3918 H  HD2  . PHE A 1 251 ? -26.093 -14.945 -16.109 1.00  18.62 ? 1704 PHE A HD2  1 
ATOM   3919 H  HE1  . PHE A 1 251 ? -30.340 -13.748 -14.808 1.00  18.21 ? 1704 PHE A HE1  1 
ATOM   3920 H  HE2  . PHE A 1 251 ? -26.870 -12.824 -16.522 1.00  18.39 ? 1704 PHE A HE2  1 
ATOM   3921 H  HZ   . PHE A 1 251 ? -28.988 -12.216 -15.875 1.00  18.61 ? 1704 PHE A HZ   1 
ATOM   3922 N  N    . PRO A 1 252 ? -27.663 -20.195 -14.420 1.00  13.46 ? 1705 PRO A N    1 
ATOM   3923 C  CA   . PRO A 1 252 ? -26.871 -21.383 -14.749 1.00  13.59 ? 1705 PRO A CA   1 
ATOM   3924 C  C    . PRO A 1 252 ? -25.947 -21.000 -15.908 1.00  13.39 ? 1705 PRO A C    1 
ATOM   3925 O  O    . PRO A 1 252 ? -26.286 -20.118 -16.698 1.00  15.06 ? 1705 PRO A O    1 
ATOM   3926 C  CB   . PRO A 1 252 ? -27.932 -22.396 -15.191 1.00  15.61 ? 1705 PRO A CB   1 
ATOM   3927 C  CG   . PRO A 1 252 ? -29.002 -21.563 -15.767 1.00  15.60 ? 1705 PRO A CG   1 
ATOM   3928 C  CD   . PRO A 1 252 ? -29.025 -20.271 -14.982 1.00  14.41 ? 1705 PRO A CD   1 
ATOM   3929 H  HA   . PRO A 1 252 ? -26.361 -21.713 -13.979 1.00  16.31 ? 1705 PRO A HA   1 
ATOM   3930 H  HB2  . PRO A 1 252 ? -27.561 -22.993 -15.859 1.00  18.73 ? 1705 PRO A HB2  1 
ATOM   3931 H  HB3  . PRO A 1 252 ? -28.255 -22.892 -14.423 1.00  18.73 ? 1705 PRO A HB3  1 
ATOM   3932 H  HG2  . PRO A 1 252 ? -28.805 -21.387 -16.700 1.00  18.72 ? 1705 PRO A HG2  1 
ATOM   3933 H  HG3  . PRO A 1 252 ? -29.850 -22.025 -15.682 1.00  18.72 ? 1705 PRO A HG3  1 
ATOM   3934 H  HD2  . PRO A 1 252 ? -29.190 -19.519 -15.571 1.00  17.29 ? 1705 PRO A HD2  1 
ATOM   3935 H  HD3  . PRO A 1 252 ? -29.683 -20.319 -14.271 1.00  17.29 ? 1705 PRO A HD3  1 
ATOM   3936 N  N    . GLY A 1 253 ? -24.787 -21.640 -16.003 1.00  13.35 ? 1706 GLY A N    1 
ATOM   3937 C  CA   . GLY A 1 253 ? -23.810 -21.256 -16.989 1.00  13.51 ? 1706 GLY A CA   1 
ATOM   3938 C  C    . GLY A 1 253 ? -22.757 -22.276 -17.405 1.00  13.15 ? 1706 GLY A C    1 
ATOM   3939 O  O    . GLY A 1 253 ? -22.018 -22.008 -18.347 1.00  14.21 ? 1706 GLY A O    1 
ATOM   3940 H  H    . GLY A 1 253 ? -24.550 -22.299 -15.505 1.00  16.02 ? 1706 GLY A H    1 
ATOM   3941 H  HA2  . GLY A 1 253 ? -24.281 -20.987 -17.793 1.00  16.21 ? 1706 GLY A HA2  1 
ATOM   3942 H  HA3  . GLY A 1 253 ? -23.337 -20.476 -16.657 1.00  16.21 ? 1706 GLY A HA3  1 
ATOM   3943 N  N    . LEU A 1 254 ? -22.678 -23.445 -16.766 1.00  12.71 ? 1707 LEU A N    1 
ATOM   3944 C  CA   . LEU A 1 254 ? -21.639 -24.400 -17.125 1.00  13.70 ? 1707 LEU A CA   1 
ATOM   3945 C  C    . LEU A 1 254 ? -21.754 -24.855 -18.565 1.00  13.40 ? 1707 LEU A C    1 
ATOM   3946 O  O    . LEU A 1 254 ? -20.750 -25.013 -19.242 1.00  14.35 ? 1707 LEU A O    1 
ATOM   3947 C  CB   . LEU A 1 254 ? -21.659 -25.606 -16.178 1.00  13.35 ? 1707 LEU A CB   1 
ATOM   3948 C  CG   . LEU A 1 254 ? -20.920 -25.360 -14.854 1.00  14.16 ? 1707 LEU A CG   1 
ATOM   3949 C  CD1  . LEU A 1 254 ? -21.339 -26.382 -13.818 1.00  15.42 ? 1707 LEU A CD1  1 
ATOM   3950 C  CD2  . LEU A 1 254 ? -19.405 -25.375 -15.060 1.00  14.94 ? 1707 LEU A CD2  1 
ATOM   3951 H  H    . LEU A 1 254 ? -23.203 -23.701 -16.135 1.00  15.25 ? 1707 LEU A H    1 
ATOM   3952 H  HA   . LEU A 1 254 ? -20.768 -23.962 -17.025 1.00  16.44 ? 1707 LEU A HA   1 
ATOM   3953 H  HB2  . LEU A 1 254 ? -22.581 -25.824 -15.967 1.00  16.03 ? 1707 LEU A HB2  1 
ATOM   3954 H  HB3  . LEU A 1 254 ? -21.235 -26.358 -16.619 1.00  16.03 ? 1707 LEU A HB3  1 
ATOM   3955 H  HG   . LEU A 1 254 ? -21.164 -24.483 -14.520 1.00  16.99 ? 1707 LEU A HG   1 
ATOM   3956 H  HD11 . LEU A 1 254 ? -21.126 -27.260 -14.142 1.00  18.50 ? 1707 LEU A HD11 1 
ATOM   3957 H  HD12 . LEU A 1 254 ? -20.866 -26.210 -13.001 1.00  18.50 ? 1707 LEU A HD12 1 
ATOM   3958 H  HD13 . LEU A 1 254 ? -22.285 -26.308 -13.671 1.00  18.50 ? 1707 LEU A HD13 1 
ATOM   3959 H  HD21 . LEU A 1 254 ? -19.168 -24.684 -15.682 1.00  17.93 ? 1707 LEU A HD21 1 
ATOM   3960 H  HD22 . LEU A 1 254 ? -18.974 -25.219 -14.217 1.00  17.93 ? 1707 LEU A HD22 1 
ATOM   3961 H  HD23 . LEU A 1 254 ? -19.146 -26.232 -15.407 1.00  17.93 ? 1707 LEU A HD23 1 
ATOM   3962 N  N    . GLU A 1 255 ? -22.971 -25.090 -19.037 1.00  14.30 ? 1708 GLU A N    1 
ATOM   3963 C  CA   . GLU A 1 255 ? -23.144 -25.678 -20.355 1.00  14.92 ? 1708 GLU A CA   1 
ATOM   3964 C  C    . GLU A 1 255 ? -23.004 -24.668 -21.478 1.00  15.07 ? 1708 GLU A C    1 
ATOM   3965 O  O    . GLU A 1 255 ? -22.794 -25.044 -22.628 1.00  16.79 ? 1708 GLU A O    1 
ATOM   3966 C  CB   . GLU A 1 255 ? -24.490 -26.401 -20.424 1.00  15.68 ? 1708 GLU A CB   1 
ATOM   3967 C  CG   . GLU A 1 255 ? -24.483 -27.686 -19.606 1.00  15.90 ? 1708 GLU A CG   1 
ATOM   3968 C  CD   . GLU A 1 255 ? -25.869 -28.239 -19.371 1.00  17.12 ? 1708 GLU A CD   1 
ATOM   3969 O  OE1  . GLU A 1 255 ? -26.524 -27.800 -18.405 1.00  17.90 ? 1708 GLU A OE1  1 
ATOM   3970 O  OE2  . GLU A 1 255 ? -26.312 -29.098 -20.156 1.00  18.75 ? 1708 GLU A OE2  1 
ATOM   3971 H  H    . GLU A 1 255 ? -23.704 -24.921 -18.619 1.00  17.16 ? 1708 GLU A H    1 
ATOM   3972 H  HA   . GLU A 1 255 ? -22.445 -26.352 -20.484 1.00  17.91 ? 1708 GLU A HA   1 
ATOM   3973 H  HB2  . GLU A 1 255 ? -25.183 -25.821 -20.070 1.00  18.81 ? 1708 GLU A HB2  1 
ATOM   3974 H  HB3  . GLU A 1 255 ? -24.683 -26.630 -21.346 1.00  18.81 ? 1708 GLU A HB3  1 
ATOM   3975 H  HG2  . GLU A 1 255 ? -23.968 -28.359 -20.079 1.00  19.08 ? 1708 GLU A HG2  1 
ATOM   3976 H  HG3  . GLU A 1 255 ? -24.081 -27.508 -18.741 1.00  19.08 ? 1708 GLU A HG3  1 
ATOM   3977 N  N    . THR A 1 256 ? -23.122 -23.387 -21.149 1.00  14.71 ? 1709 THR A N    1 
ATOM   3978 C  CA   . THR A 1 256 ? -23.064 -22.343 -22.170 1.00  14.80 ? 1709 THR A CA   1 
ATOM   3979 C  C    . THR A 1 256 ? -21.736 -21.569 -22.220 1.00  13.69 ? 1709 THR A C    1 
ATOM   3980 O  O    . THR A 1 256 ? -21.452 -20.906 -23.218 1.00  14.73 ? 1709 THR A O    1 
ATOM   3981 C  CB   . THR A 1 256 ? -24.223 -21.335 -22.008 1.00  13.89 ? 1709 THR A CB   1 
ATOM   3982 O  OG1  . THR A 1 256 ? -24.319 -20.914 -20.647 1.00  14.57 ? 1709 THR A OG1  1 
ATOM   3983 C  CG2  . THR A 1 256 ? -25.527 -21.977 -22.415 1.00  14.58 ? 1709 THR A CG2  1 
ATOM   3984 H  H    . THR A 1 256 ? -23.236 -23.095 -20.348 1.00  17.65 ? 1709 THR A H    1 
ATOM   3985 H  HA   . THR A 1 256 ? -23.177 -22.772 -23.044 1.00  17.76 ? 1709 THR A HA   1 
ATOM   3986 H  HB   . THR A 1 256 ? -24.067 -20.565 -22.577 1.00  16.67 ? 1709 THR A HB   1 
ATOM   3987 H  HG1  . THR A 1 256 ? -23.620 -20.555 -20.414 1.00  17.48 ? 1709 THR A HG1  1 
ATOM   3988 H  HG21 . THR A 1 256 ? -25.701 -22.743 -21.863 1.00  17.50 ? 1709 THR A HG21 1 
ATOM   3989 H  HG22 . THR A 1 256 ? -26.247 -21.350 -22.314 1.00  17.50 ? 1709 THR A HG22 1 
ATOM   3990 H  HG23 . THR A 1 256 ? -25.483 -22.257 -23.332 1.00  17.50 ? 1709 THR A HG23 1 
ATOM   3991 N  N    . MET A 1 257 ? -20.922 -21.632 -21.167 1.00  13.41 ? 1710 MET A N    1 
ATOM   3992 C  CA   . MET A 1 257 ? -19.732 -20.783 -21.095 1.00  12.57 ? 1710 MET A CA   1 
ATOM   3993 C  C    . MET A 1 257 ? -18.776 -21.025 -22.265 1.00  12.54 ? 1710 MET A C    1 
ATOM   3994 O  O    . MET A 1 257 ? -18.392 -20.084 -22.966 1.00  13.87 ? 1710 MET A O    1 
ATOM   3995 C  CB   . MET A 1 257 ? -19.008 -20.972 -19.765 1.00  13.23 ? 1710 MET A CB   1 
ATOM   3996 C  CG   . MET A 1 257 ? -17.686 -20.246 -19.684 1.00  13.91 ? 1710 MET A CG   1 
ATOM   3997 S  SD   . MET A 1 257 ? -17.029 -20.010 -18.017 1.00  14.10 ? 1710 MET A SD   1 
ATOM   3998 C  CE   . MET A 1 257 ? -16.678 -21.702 -17.551 1.00  14.63 ? 1710 MET A CE   1 
ATOM   3999 H  H    . MET A 1 257 ? -21.033 -22.150 -20.489 1.00  16.10 ? 1710 MET A H    1 
ATOM   4000 H  HA   . MET A 1 257 ? -20.024 -19.848 -21.132 1.00  15.09 ? 1710 MET A HA   1 
ATOM   4001 H  HB2  . MET A 1 257 ? -19.574 -20.639 -19.051 1.00  15.88 ? 1710 MET A HB2  1 
ATOM   4002 H  HB3  . MET A 1 257 ? -18.836 -21.917 -19.634 1.00  15.88 ? 1710 MET A HB3  1 
ATOM   4003 H  HG2  . MET A 1 257 ? -17.028 -20.750 -20.187 1.00  16.69 ? 1710 MET A HG2  1 
ATOM   4004 H  HG3  . MET A 1 257 ? -17.794 -19.367 -20.081 1.00  16.69 ? 1710 MET A HG3  1 
ATOM   4005 H  HE1  . MET A 1 257 ? -16.043 -22.071 -18.170 1.00  17.56 ? 1710 MET A HE1  1 
ATOM   4006 H  HE2  . MET A 1 257 ? -16.315 -21.712 -16.663 1.00  17.56 ? 1710 MET A HE2  1 
ATOM   4007 H  HE3  . MET A 1 257 ? -17.494 -22.208 -17.578 1.00  17.56 ? 1710 MET A HE3  1 
ATOM   4008 N  N    . LEU A 1 258 ? -18.379 -22.274 -22.479 1.00  13.57 ? 1711 LEU A N    1 
ATOM   4009 C  CA   . LEU A 1 258 ? -17.382 -22.546 -23.517 1.00  14.38 ? 1711 LEU A CA   1 
ATOM   4010 C  C    . LEU A 1 258 ? -17.928 -22.274 -24.939 1.00  14.55 ? 1711 LEU A C    1 
ATOM   4011 O  O    . LEU A 1 258 ? -17.258 -21.624 -25.737 1.00  15.36 ? 1711 LEU A O    1 
ATOM   4012 C  CB   . LEU A 1 258 ? -16.786 -23.945 -23.383 1.00  14.76 ? 1711 LEU A CB   1 
ATOM   4013 C  CG   . LEU A 1 258 ? -15.667 -24.268 -24.368 1.00  15.02 ? 1711 LEU A CG   1 
ATOM   4014 C  CD1  . LEU A 1 258 ? -14.496 -23.327 -24.214 1.00  16.02 ? 1711 LEU A CD1  1 
ATOM   4015 C  CD2  . LEU A 1 258 ? -15.220 -25.703 -24.185 1.00  16.63 ? 1711 LEU A CD2  1 
ATOM   4016 H  H    . LEU A 1 258 ? -18.660 -22.966 -22.052 1.00  16.28 ? 1711 LEU A H    1 
ATOM   4017 H  HA   . LEU A 1 258 ? -16.642 -21.918 -23.382 1.00  17.26 ? 1711 LEU A HA   1 
ATOM   4018 H  HB2  . LEU A 1 258 ? -16.425 -24.042 -22.488 1.00  17.71 ? 1711 LEU A HB2  1 
ATOM   4019 H  HB3  . LEU A 1 258 ? -17.493 -24.596 -23.520 1.00  17.71 ? 1711 LEU A HB3  1 
ATOM   4020 H  HG   . LEU A 1 258 ? -16.007 -24.175 -25.271 1.00  18.02 ? 1711 LEU A HG   1 
ATOM   4021 H  HD11 . LEU A 1 258 ? -14.150 -23.402 -23.322 1.00  19.23 ? 1711 LEU A HD11 1 
ATOM   4022 H  HD12 . LEU A 1 258 ? -13.818 -23.565 -24.851 1.00  19.23 ? 1711 LEU A HD12 1 
ATOM   4023 H  HD13 . LEU A 1 258 ? -14.795 -22.428 -24.375 1.00  19.23 ? 1711 LEU A HD13 1 
ATOM   4024 H  HD21 . LEU A 1 258 ? -15.966 -26.286 -24.345 1.00  19.96 ? 1711 LEU A HD21 1 
ATOM   4025 H  HD22 . LEU A 1 258 ? -14.516 -25.893 -24.810 1.00  19.96 ? 1711 LEU A HD22 1 
ATOM   4026 H  HD23 . LEU A 1 258 ? -14.901 -25.819 -23.287 1.00  19.96 ? 1711 LEU A HD23 1 
ATOM   4027 N  N    . PRO A 1 259 ? -19.164 -22.690 -25.240 1.00  14.66 ? 1712 PRO A N    1 
ATOM   4028 C  CA   . PRO A 1 259 ? -19.667 -22.334 -26.568 1.00  15.70 ? 1712 PRO A CA   1 
ATOM   4029 C  C    . PRO A 1 259 ? -19.722 -20.823 -26.809 1.00  15.04 ? 1712 PRO A C    1 
ATOM   4030 O  O    . PRO A 1 259 ? -19.403 -20.362 -27.917 1.00  16.07 ? 1712 PRO A O    1 
ATOM   4031 C  CB   . PRO A 1 259 ? -21.076 -22.939 -26.579 1.00  17.09 ? 1712 PRO A CB   1 
ATOM   4032 C  CG   . PRO A 1 259 ? -21.002 -24.069 -25.618 1.00  17.82 ? 1712 PRO A CG   1 
ATOM   4033 C  CD   . PRO A 1 259 ? -20.050 -23.643 -24.549 1.00  15.46 ? 1712 PRO A CD   1 
ATOM   4034 H  HA   . PRO A 1 259 ? -19.124 -22.757 -27.265 1.00  18.84 ? 1712 PRO A HA   1 
ATOM   4035 H  HB2  . PRO A 1 259 ? -21.721 -22.277 -26.284 1.00  20.51 ? 1712 PRO A HB2  1 
ATOM   4036 H  HB3  . PRO A 1 259 ? -21.291 -23.257 -27.470 1.00  20.51 ? 1712 PRO A HB3  1 
ATOM   4037 H  HG2  . PRO A 1 259 ? -21.881 -24.235 -25.244 1.00  21.38 ? 1712 PRO A HG2  1 
ATOM   4038 H  HG3  . PRO A 1 259 ? -20.670 -24.860 -26.073 1.00  21.38 ? 1712 PRO A HG3  1 
ATOM   4039 H  HD2  . PRO A 1 259 ? -20.527 -23.201 -23.829 1.00  18.55 ? 1712 PRO A HD2  1 
ATOM   4040 H  HD3  . PRO A 1 259 ? -19.542 -24.403 -24.226 1.00  18.55 ? 1712 PRO A HD3  1 
ATOM   4041 N  N    . LEU A 1 260 ? -20.107 -20.049 -25.799 1.00  14.17 ? 1713 LEU A N    1 
ATOM   4042 C  CA   . LEU A 1 260 ? -20.103 -18.593 -25.957 1.00  13.95 ? 1713 LEU A CA   1 
ATOM   4043 C  C    . LEU A 1 260 ? -18.685 -18.074 -26.245 1.00  12.55 ? 1713 LEU A C    1 
ATOM   4044 O  O    . LEU A 1 260 ? -18.464 -17.259 -27.140 1.00  14.82 ? 1713 LEU A O    1 
ATOM   4045 C  CB   . LEU A 1 260 ? -20.667 -17.901 -24.712 1.00  13.69 ? 1713 LEU A CB   1 
ATOM   4046 C  CG   . LEU A 1 260 ? -22.175 -18.073 -24.472 1.00  13.50 ? 1713 LEU A CG   1 
ATOM   4047 C  CD1  . LEU A 1 260 ? -22.503 -17.738 -23.025 1.00  14.91 ? 1713 LEU A CD1  1 
ATOM   4048 C  CD2  . LEU A 1 260 ? -22.932 -17.183 -25.425 1.00  15.33 ? 1713 LEU A CD2  1 
ATOM   4049 H  H    . LEU A 1 260 ? -20.369 -20.330 -25.030 1.00  17.00 ? 1713 LEU A H    1 
ATOM   4050 H  HA   . LEU A 1 260 ? -20.672 -18.354 -26.719 1.00  16.73 ? 1713 LEU A HA   1 
ATOM   4051 H  HB2  . LEU A 1 260 ? -20.208 -18.254 -23.933 1.00  16.43 ? 1713 LEU A HB2  1 
ATOM   4052 H  HB3  . LEU A 1 260 ? -20.492 -16.950 -24.786 1.00  16.43 ? 1713 LEU A HB3  1 
ATOM   4053 H  HG   . LEU A 1 260 ? -22.428 -18.994 -24.642 1.00  16.20 ? 1713 LEU A HG   1 
ATOM   4054 H  HD11 . LEU A 1 260 ? -22.250 -16.828 -22.851 1.00  17.89 ? 1713 LEU A HD11 1 
ATOM   4055 H  HD12 . LEU A 1 260 ? -23.446 -17.848 -22.886 1.00  17.89 ? 1713 LEU A HD12 1 
ATOM   4056 H  HD13 . LEU A 1 260 ? -22.015 -18.331 -22.449 1.00  17.89 ? 1713 LEU A HD13 1 
ATOM   4057 H  HD21 . LEU A 1 260 ? -22.714 -17.433 -26.326 1.00  18.40 ? 1713 LEU A HD21 1 
ATOM   4058 H  HD22 . LEU A 1 260 ? -23.873 -17.292 -25.272 1.00  18.40 ? 1713 LEU A HD22 1 
ATOM   4059 H  HD23 . LEU A 1 260 ? -22.678 -16.270 -25.268 1.00  18.40 ? 1713 LEU A HD23 1 
ATOM   4060 N  N    . LEU A 1 261 ? -17.713 -18.547 -25.481 1.00  12.75 ? 1714 LEU A N    1 
ATOM   4061 C  CA   . LEU A 1 261 ? -16.356 -18.069 -25.658 1.00  13.19 ? 1714 LEU A CA   1 
ATOM   4062 C  C    . LEU A 1 261 ? -15.729 -18.549 -26.974 1.00  13.63 ? 1714 LEU A C    1 
ATOM   4063 O  O    . LEU A 1 261 ? -14.962 -17.811 -27.594 1.00  14.43 ? 1714 LEU A O    1 
ATOM   4064 C  CB   . LEU A 1 261 ? -15.502 -18.467 -24.457 1.00  14.30 ? 1714 LEU A CB   1 
ATOM   4065 C  CG   . LEU A 1 261 ? -15.896 -17.748 -23.153 1.00  14.19 ? 1714 LEU A CG   1 
ATOM   4066 C  CD1  . LEU A 1 261 ? -15.331 -18.473 -21.960 1.00  14.93 ? 1714 LEU A CD1  1 
ATOM   4067 C  CD2  . LEU A 1 261 ? -15.411 -16.303 -23.170 1.00  15.78 ? 1714 LEU A CD2  1 
ATOM   4068 H  H    . LEU A 1 261 ? -17.812 -19.137 -24.863 1.00  15.30 ? 1714 LEU A H    1 
ATOM   4069 H  HA   . LEU A 1 261 ? -16.378 -17.089 -25.688 1.00  15.83 ? 1714 LEU A HA   1 
ATOM   4070 H  HB2  . LEU A 1 261 ? -15.595 -19.421 -24.310 1.00  17.16 ? 1714 LEU A HB2  1 
ATOM   4071 H  HB3  . LEU A 1 261 ? -14.575 -18.252 -24.647 1.00  17.16 ? 1714 LEU A HB3  1 
ATOM   4072 H  HG   . LEU A 1 261 ? -16.863 -17.741 -23.073 1.00  17.03 ? 1714 LEU A HG   1 
ATOM   4073 H  HD11 . LEU A 1 261 ? -14.374 -18.495 -22.032 1.00  17.92 ? 1714 LEU A HD11 1 
ATOM   4074 H  HD12 . LEU A 1 261 ? -15.589 -18.007 -21.161 1.00  17.92 ? 1714 LEU A HD12 1 
ATOM   4075 H  HD13 . LEU A 1 261 ? -15.680 -19.368 -21.945 1.00  17.92 ? 1714 LEU A HD13 1 
ATOM   4076 H  HD21 . LEU A 1 261 ? -15.811 -15.848 -23.914 1.00  18.94 ? 1714 LEU A HD21 1 
ATOM   4077 H  HD22 . LEU A 1 261 ? -15.668 -15.878 -22.349 1.00  18.94 ? 1714 LEU A HD22 1 
ATOM   4078 H  HD23 . LEU A 1 261 ? -14.455 -16.296 -23.257 1.00  18.94 ? 1714 LEU A HD23 1 
ATOM   4079 N  N    . LEU A 1 262 ? -16.037 -19.772 -27.392 1.00  14.95 ? 1715 LEU A N    1 
ATOM   4080 C  CA   . LEU A 1 262 ? -15.562 -20.264 -28.685 1.00  15.58 ? 1715 LEU A CA   1 
ATOM   4081 C  C    . LEU A 1 262 ? -16.109 -19.423 -29.824 1.00  15.87 ? 1715 LEU A C    1 
ATOM   4082 O  O    . LEU A 1 262 ? -15.423 -19.186 -30.815 1.00  16.07 ? 1715 LEU A O    1 
ATOM   4083 C  CB   . LEU A 1 262 ? -15.948 -21.739 -28.897 1.00  16.12 ? 1715 LEU A CB   1 
ATOM   4084 C  CG   . LEU A 1 262 ? -15.215 -22.743 -27.998 1.00  18.13 ? 1715 LEU A CG   1 
ATOM   4085 C  CD1  . LEU A 1 262 ? -15.788 -24.142 -28.227 1.00  19.43 ? 1715 LEU A CD1  1 
ATOM   4086 C  CD2  . LEU A 1 262 ? -13.725 -22.732 -28.251 1.00  18.20 ? 1715 LEU A CD2  1 
ATOM   4087 H  H    . LEU A 1 262 ? -16.515 -20.335 -26.951 1.00  17.94 ? 1715 LEU A H    1 
ATOM   4088 H  HA   . LEU A 1 262 ? -14.584 -20.202 -28.707 1.00  18.69 ? 1715 LEU A HA   1 
ATOM   4089 H  HB2  . LEU A 1 262 ? -16.898 -21.836 -28.728 1.00  19.35 ? 1715 LEU A HB2  1 
ATOM   4090 H  HB3  . LEU A 1 262 ? -15.756 -21.977 -29.817 1.00  19.35 ? 1715 LEU A HB3  1 
ATOM   4091 H  HG   . LEU A 1 262 ? -15.365 -22.505 -27.070 1.00  21.76 ? 1715 LEU A HG   1 
ATOM   4092 H  HD11 . LEU A 1 262 ? -15.665 -24.382 -29.149 1.00  23.32 ? 1715 LEU A HD11 1 
ATOM   4093 H  HD12 . LEU A 1 262 ? -15.325 -24.765 -27.662 1.00  23.32 ? 1715 LEU A HD12 1 
ATOM   4094 H  HD13 . LEU A 1 262 ? -16.723 -24.136 -28.011 1.00  23.32 ? 1715 LEU A HD13 1 
ATOM   4095 H  HD21 . LEU A 1 262 ? -13.384 -21.853 -28.071 1.00  21.83 ? 1715 LEU A HD21 1 
ATOM   4096 H  HD22 . LEU A 1 262 ? -13.305 -23.372 -27.671 1.00  21.83 ? 1715 LEU A HD22 1 
ATOM   4097 H  HD23 . LEU A 1 262 ? -13.562 -22.965 -29.168 1.00  21.83 ? 1715 LEU A HD23 1 
ATOM   4098 N  N    . THR A 1 263 ? -17.344 -18.959 -29.679 1.00  16.21 ? 1716 THR A N    1 
ATOM   4099 C  CA   . THR A 1 263 ? -17.943 -18.094 -30.693 1.00  16.82 ? 1716 THR A CA   1 
ATOM   4100 C  C    . THR A 1 263 ? -17.115 -16.814 -30.792 1.00  16.42 ? 1716 THR A C    1 
ATOM   4101 O  O    . THR A 1 263 ? -16.795 -16.344 -31.887 1.00  17.88 ? 1716 THR A O    1 
ATOM   4102 C  CB   . THR A 1 263 ? -19.400 -17.744 -30.339 1.00  17.22 ? 1716 THR A CB   1 
ATOM   4103 O  OG1  . THR A 1 263 ? -20.160 -18.944 -30.173 1.00  18.17 ? 1716 THR A OG1  1 
ATOM   4104 C  CG2  . THR A 1 263 ? -20.047 -16.914 -31.432 1.00  18.01 ? 1716 THR A CG2  1 
ATOM   4105 H  H    . THR A 1 263 ? -17.855 -19.128 -29.008 1.00  19.45 ? 1716 THR A H    1 
ATOM   4106 H  HA   . THR A 1 263 ? -17.930 -18.546 -31.562 1.00  20.19 ? 1716 THR A HA   1 
ATOM   4107 H  HB   . THR A 1 263 ? -19.418 -17.233 -29.515 1.00  20.66 ? 1716 THR A HB   1 
ATOM   4108 H  HG1  . THR A 1 263 ? -19.840 -19.397 -29.569 1.00  21.81 ? 1716 THR A HG1  1 
ATOM   4109 H  HG21 . THR A 1 263 ? -20.046 -17.402 -32.259 1.00  21.61 ? 1716 THR A HG21 1 
ATOM   4110 H  HG22 . THR A 1 263 ? -20.953 -16.706 -31.193 1.00  21.61 ? 1716 THR A HG22 1 
ATOM   4111 H  HG23 . THR A 1 263 ? -19.561 -16.095 -31.553 1.00  21.61 ? 1716 THR A HG23 1 
ATOM   4112 N  N    . ALA A 1 264 ? -16.757 -16.262 -29.639 1.00  15.19 ? 1717 ALA A N    1 
ATOM   4113 C  CA   . ALA A 1 264 ? -15.941 -15.059 -29.604 1.00  15.46 ? 1717 ALA A CA   1 
ATOM   4114 C  C    . ALA A 1 264 ? -14.563 -15.297 -30.213 1.00  15.20 ? 1717 ALA A C    1 
ATOM   4115 O  O    . ALA A 1 264 ? -14.028 -14.424 -30.905 1.00  16.95 ? 1717 ALA A O    1 
ATOM   4116 C  CB   . ALA A 1 264 ? -15.822 -14.547 -28.192 1.00  16.02 ? 1717 ALA A CB   1 
ATOM   4117 H  H    . ALA A 1 264 ? -16.975 -16.565 -28.864 1.00  18.22 ? 1717 ALA A H    1 
ATOM   4118 H  HA   . ALA A 1 264 ? -16.385 -14.365 -30.135 1.00  18.55 ? 1717 ALA A HA   1 
ATOM   4119 H  HB1  . ALA A 1 264 ? -15.413 -15.223 -27.648 1.00  19.23 ? 1717 ALA A HB1  1 
ATOM   4120 H  HB2  . ALA A 1 264 ? -15.281 -13.754 -28.192 1.00  19.23 ? 1717 ALA A HB2  1 
ATOM   4121 H  HB3  . ALA A 1 264 ? -16.700 -14.344 -27.859 1.00  19.23 ? 1717 ALA A HB3  1 
ATOM   4122 N  N    . VAL A 1 265 ? -13.982 -16.473 -29.979 1.00  15.42 ? 1718 VAL A N    1 
ATOM   4123 C  CA   . VAL A 1 265 ? -12.704 -16.796 -30.612 1.00  17.25 ? 1718 VAL A CA   1 
ATOM   4124 C  C    . VAL A 1 265 ? -12.859 -16.826 -32.138 1.00  19.22 ? 1718 VAL A C    1 
ATOM   4125 O  O    . VAL A 1 265 ? -12.011 -16.300 -32.872 1.00  20.69 ? 1718 VAL A O    1 
ATOM   4126 C  CB   . VAL A 1 265 ? -12.124 -18.143 -30.111 1.00  17.17 ? 1718 VAL A CB   1 
ATOM   4127 C  CG1  . VAL A 1 265 ? -10.936 -18.550 -30.958 1.00  18.85 ? 1718 VAL A CG1  1 
ATOM   4128 C  CG2  . VAL A 1 265 ? -11.722 -18.053 -28.666 1.00  16.59 ? 1718 VAL A CG2  1 
ATOM   4129 H  H    . VAL A 1 265 ? -14.299 -17.089 -29.469 1.00  18.51 ? 1718 VAL A H    1 
ATOM   4130 H  HA   . VAL A 1 265 ? -12.058 -16.093 -30.391 1.00  20.71 ? 1718 VAL A HA   1 
ATOM   4131 H  HB   . VAL A 1 265 ? -12.810 -18.838 -30.195 1.00  20.60 ? 1718 VAL A HB   1 
ATOM   4132 H  HG11 . VAL A 1 265 ? -10.261 -17.870 -30.894 1.00  22.63 ? 1718 VAL A HG11 1 
ATOM   4133 H  HG12 . VAL A 1 265 ? -10.592 -19.385 -30.633 1.00  22.63 ? 1718 VAL A HG12 1 
ATOM   4134 H  HG13 . VAL A 1 265 ? -11.220 -18.645 -31.870 1.00  22.63 ? 1718 VAL A HG13 1 
ATOM   4135 H  HG21 . VAL A 1 265 ? -12.494 -17.831 -28.140 1.00  19.91 ? 1718 VAL A HG21 1 
ATOM   4136 H  HG22 . VAL A 1 265 ? -11.368 -18.901 -28.387 1.00  19.91 ? 1718 VAL A HG22 1 
ATOM   4137 H  HG23 . VAL A 1 265 ? -11.053 -17.371 -28.570 1.00  19.91 ? 1718 VAL A HG23 1 
ATOM   4138 N  N    . SER A 1 266 ? -13.956 -17.407 -32.619 1.00  20.99 ? 1719 SER A N    1 
ATOM   4139 C  CA   A SER A 1 266 ? -14.149 -17.524 -34.058 0.28  22.66 ? 1719 SER A CA   1 
ATOM   4140 C  CA   B SER A 1 266 ? -14.222 -17.530 -34.056 0.72  22.41 ? 1719 SER A CA   1 
ATOM   4141 C  C    . SER A 1 266 ? -14.397 -16.164 -34.709 1.00  23.35 ? 1719 SER A C    1 
ATOM   4142 O  O    . SER A 1 266 ? -14.135 -15.993 -35.897 1.00  25.73 ? 1719 SER A O    1 
ATOM   4143 C  CB   A SER A 1 266 ? -15.276 -18.505 -34.372 0.28  24.18 ? 1719 SER A CB   1 
ATOM   4144 C  CB   B SER A 1 266 ? -15.469 -18.403 -34.315 0.72  24.50 ? 1719 SER A CB   1 
ATOM   4145 O  OG   A SER A 1 266 ? -14.873 -19.823 -34.043 0.28  25.29 ? 1719 SER A OG   1 
ATOM   4146 O  OG   B SER A 1 266 ? -16.698 -17.688 -34.144 0.72  25.88 ? 1719 SER A OG   1 
ATOM   4147 H  H    A SER A 1 266 ? -14.592 -17.735 -32.142 0.28  25.18 ? 1719 SER A H    1 
ATOM   4148 H  H    B SER A 1 266 ? -14.575 -17.744 -32.126 0.72  25.18 ? 1719 SER A H    1 
ATOM   4149 H  HA   A SER A 1 266 ? -13.328 -17.889 -34.450 0.28  27.19 ? 1719 SER A HA   1 
ATOM   4150 H  HA   B SER A 1 266 ? -13.456 -17.969 -34.481 0.72  26.89 ? 1719 SER A HA   1 
ATOM   4151 H  HB2  A SER A 1 266 ? -16.058 -18.271 -33.848 0.28  29.02 ? 1719 SER A HB2  1 
ATOM   4152 H  HB2  B SER A 1 266 ? -15.430 -18.735 -35.226 0.72  29.40 ? 1719 SER A HB2  1 
ATOM   4153 H  HB3  A SER A 1 266 ? -15.482 -18.461 -35.319 0.28  29.02 ? 1719 SER A HB3  1 
ATOM   4154 H  HB3  B SER A 1 266 ? -15.457 -19.150 -33.696 0.72  29.40 ? 1719 SER A HB3  1 
ATOM   4155 H  HG   A SER A 1 266 ? -15.477 -20.352 -34.211 0.28  30.35 ? 1719 SER A HG   1 
ATOM   4156 H  HG   B SER A 1 266 ? -16.543 -16.912 -33.930 0.72  31.06 ? 1719 SER A HG   1 
ATOM   4157 N  N    . GLU A 1 267 ? -14.857 -15.196 -33.922 1.00  22.79 ? 1720 GLU A N    1 
ATOM   4158 C  CA   . GLU A 1 267 ? -15.069 -13.834 -34.401 1.00  24.27 ? 1720 GLU A CA   1 
ATOM   4159 C  C    . GLU A 1 267 ? -13.827 -12.954 -34.241 1.00  24.32 ? 1720 GLU A C    1 
ATOM   4160 O  O    . GLU A 1 267 ? -13.839 -11.772 -34.609 1.00  25.92 ? 1720 GLU A O    1 
ATOM   4161 C  CB   . GLU A 1 267 ? -16.251 -13.210 -33.660 1.00  25.70 ? 1720 GLU A CB   1 
ATOM   4162 C  CG   . GLU A 1 267 ? -17.578 -13.850 -34.029 1.00  27.99 ? 1720 GLU A CG   1 
ATOM   4163 C  CD   . GLU A 1 267 ? -18.752 -13.321 -33.238 1.00  31.52 ? 1720 GLU A CD   1 
ATOM   4164 O  OE1  . GLU A 1 267 ? -18.547 -12.498 -32.323 1.00  33.72 ? 1720 GLU A OE1  1 
ATOM   4165 O  OE2  . GLU A 1 267 ? -19.891 -13.744 -33.534 1.00  32.31 ? 1720 GLU A OE2  1 
ATOM   4166 H  H    . GLU A 1 267 ? -15.056 -15.305 -33.093 1.00  27.34 ? 1720 GLU A H    1 
ATOM   4167 H  HA   . GLU A 1 267 ? -15.294 -13.865 -35.354 1.00  29.13 ? 1720 GLU A HA   1 
ATOM   4168 H  HB2  . GLU A 1 267 ? -16.120 -13.321 -32.705 1.00  30.84 ? 1720 GLU A HB2  1 
ATOM   4169 H  HB3  . GLU A 1 267 ? -16.301 -12.267 -33.881 1.00  30.84 ? 1720 GLU A HB3  1 
ATOM   4170 H  HG2  . GLU A 1 267 ? -17.754 -13.683 -34.968 1.00  33.59 ? 1720 GLU A HG2  1 
ATOM   4171 H  HG3  . GLU A 1 267 ? -17.519 -14.805 -33.870 1.00  33.59 ? 1720 GLU A HG3  1 
ATOM   4172 N  N    . GLY A 1 268 ? -12.759 -13.526 -33.695 1.00  22.61 ? 1721 GLY A N    1 
ATOM   4173 C  CA   . GLY A 1 268 ? -11.515 -12.801 -33.519 1.00  22.16 ? 1721 GLY A CA   1 
ATOM   4174 C  C    . GLY A 1 268 ? -11.529 -11.848 -32.339 1.00  20.10 ? 1721 GLY A C    1 
ATOM   4175 O  O    . GLY A 1 268 ? -10.709 -10.938 -32.280 1.00  21.87 ? 1721 GLY A O    1 
ATOM   4176 H  H    . GLY A 1 268 ? -12.733 -14.339 -33.416 1.00  27.13 ? 1721 GLY A H    1 
ATOM   4177 H  HA2  . GLY A 1 268 ? -10.792 -13.434 -33.389 1.00  26.59 ? 1721 GLY A HA2  1 
ATOM   4178 H  HA3  . GLY A 1 268 ? -11.329 -12.288 -34.321 1.00  26.59 ? 1721 GLY A HA3  1 
ATOM   4179 N  N    . ARG A 1 269 ? -12.442 -12.043 -31.392 1.00  17.19 ? 1722 ARG A N    1 
ATOM   4180 C  CA   . ARG A 1 269 ? -12.536 -11.136 -30.243 1.00  17.55 ? 1722 ARG A CA   1 
ATOM   4181 C  C    . ARG A 1 269 ? -11.496 -11.435 -29.178 1.00  17.74 ? 1722 ARG A C    1 
ATOM   4182 O  O    . ARG A 1 269 ? -11.136 -10.556 -28.390 1.00  19.21 ? 1722 ARG A O    1 
ATOM   4183 C  CB   . ARG A 1 269 ? -13.916 -11.199 -29.622 1.00  18.91 ? 1722 ARG A CB   1 
ATOM   4184 C  CG   . ARG A 1 269 ? -15.030 -10.890 -30.593 1.00  19.64 ? 1722 ARG A CG   1 
ATOM   4185 C  CD   . ARG A 1 269 ? -16.378 -10.957 -29.915 1.00  20.56 ? 1722 ARG A CD   1 
ATOM   4186 N  NE   . ARG A 1 269 ? -16.603 -9.837  -29.025 1.00  21.03 ? 1722 ARG A NE   1 
ATOM   4187 C  CZ   . ARG A 1 269 ? -17.702 -9.680  -28.295 1.00  22.39 ? 1722 ARG A CZ   1 
ATOM   4188 N  NH1  . ARG A 1 269 ? -18.650 -10.600 -28.331 1.00  23.08 ? 1722 ARG A NH1  1 
ATOM   4189 N  NH2  . ARG A 1 269 ? -17.850 -8.600  -27.540 1.00  22.88 ? 1722 ARG A NH2  1 
ATOM   4190 H  H    . ARG A 1 269 ? -13.014 -12.685 -31.387 1.00  20.63 ? 1722 ARG A H    1 
ATOM   4191 H  HA   . ARG A 1 269 ? -12.389 -10.218 -30.554 1.00  21.06 ? 1722 ARG A HA   1 
ATOM   4192 H  HB2  . ARG A 1 269 ? -14.063 -12.093 -29.275 1.00  22.70 ? 1722 ARG A HB2  1 
ATOM   4193 H  HB3  . ARG A 1 269 ? -13.964 -10.553 -28.900 1.00  22.70 ? 1722 ARG A HB3  1 
ATOM   4194 H  HG2  . ARG A 1 269 ? -14.910 -9.994  -30.946 1.00  23.57 ? 1722 ARG A HG2  1 
ATOM   4195 H  HG3  . ARG A 1 269 ? -15.017 -11.540 -31.313 1.00  23.57 ? 1722 ARG A HG3  1 
ATOM   4196 H  HD2  . ARG A 1 269 ? -17.074 -10.950 -30.591 1.00  24.68 ? 1722 ARG A HD2  1 
ATOM   4197 H  HD3  . ARG A 1 269 ? -16.430 -11.773 -29.393 1.00  24.68 ? 1722 ARG A HD3  1 
ATOM   4198 H  HE   . ARG A 1 269 ? -16.028 -9.198  -29.028 1.00  25.23 ? 1722 ARG A HE   1 
ATOM   4199 H  HH11 . ARG A 1 269 ? -18.558 -11.293 -28.832 1.00  27.45 ? 1722 ARG A HH11 1 
ATOM   4200 H  HH12 . ARG A 1 269 ? -19.360 -10.504 -27.856 1.00  27.45 ? 1722 ARG A HH12 1 
ATOM   4201 H  HH21 . ARG A 1 269 ? -17.227 -8.008  -27.511 1.00  27.69 ? 1722 ARG A HH21 1 
ATOM   4202 H  HH22 . ARG A 1 269 ? -18.553 -8.509  -27.054 1.00  27.69 ? 1722 ARG A HH22 1 
ATOM   4203 N  N    . LEU A 1 270 ? -11.042 -12.683 -29.143 1.00  16.67 ? 1723 LEU A N    1 
ATOM   4204 C  CA   . LEU A 1 270 ? -9.886  -13.083 -28.347 1.00  17.30 ? 1723 LEU A CA   1 
ATOM   4205 C  C    . LEU A 1 270 ? -9.328  -14.331 -29.011 1.00  16.91 ? 1723 LEU A C    1 
ATOM   4206 O  O    . LEU A 1 270 ? -9.983  -14.933 -29.867 1.00  16.74 ? 1723 LEU A O    1 
ATOM   4207 C  CB   . LEU A 1 270 ? -10.232 -13.353 -26.877 1.00  17.64 ? 1723 LEU A CB   1 
ATOM   4208 C  CG   . LEU A 1 270 ? -10.980 -14.656 -26.562 1.00  18.27 ? 1723 LEU A CG   1 
ATOM   4209 C  CD1  . LEU A 1 270 ? -11.058 -14.856 -25.040 1.00  19.74 ? 1723 LEU A CD1  1 
ATOM   4210 C  CD2  . LEU A 1 270 ? -12.361 -14.667 -27.187 1.00  19.23 ? 1723 LEU A CD2  1 
ATOM   4211 H  H    . LEU A 1 270 ? -11.395 -13.332 -29.583 1.00  20.00 ? 1723 LEU A H    1 
ATOM   4212 H  HA   . LEU A 1 270 ? -9.204  -12.379 -28.382 1.00  20.75 ? 1723 LEU A HA   1 
ATOM   4213 H  HB2  . LEU A 1 270 ? -9.405  -13.370 -26.371 1.00  21.17 ? 1723 LEU A HB2  1 
ATOM   4214 H  HB3  . LEU A 1 270 ? -10.786 -12.623 -26.559 1.00  21.17 ? 1723 LEU A HB3  1 
ATOM   4215 H  HG   . LEU A 1 270 ? -10.481 -15.400 -26.934 1.00  21.92 ? 1723 LEU A HG   1 
ATOM   4216 H  HD11 . LEU A 1 270 ? -11.527 -14.113 -24.652 1.00  23.69 ? 1723 LEU A HD11 1 
ATOM   4217 H  HD12 . LEU A 1 270 ? -11.527 -15.672 -24.856 1.00  23.69 ? 1723 LEU A HD12 1 
ATOM   4218 H  HD13 . LEU A 1 270 ? -10.167 -14.902 -24.686 1.00  23.69 ? 1723 LEU A HD13 1 
ATOM   4219 H  HD21 . LEU A 1 270 ? -12.273 -14.583 -28.139 1.00  23.07 ? 1723 LEU A HD21 1 
ATOM   4220 H  HD22 . LEU A 1 270 ? -12.796 -15.494 -26.969 1.00  23.07 ? 1723 LEU A HD22 1 
ATOM   4221 H  HD23 . LEU A 1 270 ? -12.867 -13.929 -26.839 1.00  23.07 ? 1723 LEU A HD23 1 
ATOM   4222 N  N    . SER A 1 271 ? -8.106  -14.698 -28.651 1.00  15.61 ? 1724 SER A N    1 
ATOM   4223 C  CA   . SER A 1 271 ? -7.464  -15.844 -29.280 1.00  14.93 ? 1724 SER A CA   1 
ATOM   4224 C  C    . SER A 1 271 ? -7.740  -17.132 -28.510 1.00  14.78 ? 1724 SER A C    1 
ATOM   4225 O  O    . SER A 1 271 ? -8.211  -17.113 -27.368 1.00  14.88 ? 1724 SER A O    1 
ATOM   4226 C  CB   . SER A 1 271 ? -5.957  -15.621 -29.351 1.00  14.53 ? 1724 SER A CB   1 
ATOM   4227 O  OG   . SER A 1 271 ? -5.428  -15.620 -28.047 1.00  14.61 ? 1724 SER A OG   1 
ATOM   4228 H  H    . SER A 1 271 ? -7.630  -14.305 -28.052 1.00  18.73 ? 1724 SER A H    1 
ATOM   4229 H  HA   . SER A 1 271 ? -7.806  -15.949 -30.192 1.00  17.91 ? 1724 SER A HA   1 
ATOM   4230 H  HB2  . SER A 1 271 ? -5.550  -16.337 -29.862 1.00  17.44 ? 1724 SER A HB2  1 
ATOM   4231 H  HB3  . SER A 1 271 ? -5.779  -14.764 -29.770 1.00  17.44 ? 1724 SER A HB3  1 
ATOM   4232 H  HG   . SER A 1 271 ? -4.617  -15.500 -28.073 1.00  17.53 ? 1724 SER A HG   1 
ATOM   4233 N  N    . LEU A 1 272 ? -7.428  -18.257 -29.143 1.00  14.15 ? 1725 LEU A N    1 
ATOM   4234 C  CA   . LEU A 1 272 ? -7.528  -19.529 -28.459 1.00  14.13 ? 1725 LEU A CA   1 
ATOM   4235 C  C    . LEU A 1 272 ? -6.627  -19.514 -27.221 1.00  13.51 ? 1725 LEU A C    1 
ATOM   4236 O  O    . LEU A 1 272 ? -7.019  -19.972 -26.150 1.00  14.30 ? 1725 LEU A O    1 
ATOM   4237 C  CB   . LEU A 1 272 ? -7.166  -20.676 -29.397 1.00  15.63 ? 1725 LEU A CB   1 
ATOM   4238 C  CG   . LEU A 1 272 ? -7.258  -22.073 -28.792 1.00  18.11 ? 1725 LEU A CG   1 
ATOM   4239 C  CD1  . LEU A 1 272 ? -8.703  -22.347 -28.389 1.00  20.27 ? 1725 LEU A CD1  1 
ATOM   4240 C  CD2  . LEU A 1 272 ? -6.733  -23.102 -29.808 1.00  19.70 ? 1725 LEU A CD2  1 
ATOM   4241 H  H    . LEU A 1 272 ? -7.160  -18.307 -29.958 1.00  16.98 ? 1725 LEU A H    1 
ATOM   4242 H  HA   . LEU A 1 272 ? -8.452  -19.661 -28.160 1.00  16.96 ? 1725 LEU A HA   1 
ATOM   4243 H  HB2  . LEU A 1 272 ? -7.766  -20.649 -30.159 1.00  18.76 ? 1725 LEU A HB2  1 
ATOM   4244 H  HB3  . LEU A 1 272 ? -6.253  -20.549 -29.698 1.00  18.76 ? 1725 LEU A HB3  1 
ATOM   4245 H  HG   . LEU A 1 272 ? -6.705  -22.117 -27.996 1.00  21.74 ? 1725 LEU A HG   1 
ATOM   4246 H  HD11 . LEU A 1 272 ? -9.261  -22.291 -29.169 1.00  24.32 ? 1725 LEU A HD11 1 
ATOM   4247 H  HD12 . LEU A 1 272 ? -8.760  -23.226 -28.009 1.00  24.32 ? 1725 LEU A HD12 1 
ATOM   4248 H  HD13 . LEU A 1 272 ? -8.977  -21.692 -27.743 1.00  24.32 ? 1725 LEU A HD13 1 
ATOM   4249 H  HD21 . LEU A 1 272 ? -5.819  -22.897 -30.016 1.00  23.63 ? 1725 LEU A HD21 1 
ATOM   4250 H  HD22 . LEU A 1 272 ? -6.793  -23.979 -29.423 1.00  23.63 ? 1725 LEU A HD22 1 
ATOM   4251 H  HD23 . LEU A 1 272 ? -7.268  -23.056 -30.604 1.00  23.63 ? 1725 LEU A HD23 1 
ATOM   4252 N  N    . ASP A 1 273 ? -5.421  -18.969 -27.344 1.00  12.88 ? 1726 ASP A N    1 
ATOM   4253 C  CA   . ASP A 1 273 ? -4.548  -18.904 -26.184 1.00  12.44 ? 1726 ASP A CA   1 
ATOM   4254 C  C    . ASP A 1 273 ? -5.164  -18.044 -25.077 1.00  11.76 ? 1726 ASP A C    1 
ATOM   4255 O  O    . ASP A 1 273 ? -5.080  -18.379 -23.904 1.00  13.01 ? 1726 ASP A O    1 
ATOM   4256 C  CB   . ASP A 1 273 ? -3.185  -18.339 -26.549 1.00  14.02 ? 1726 ASP A CB   1 
ATOM   4257 C  CG   . ASP A 1 273 ? -2.263  -18.272 -25.358 1.00  16.78 ? 1726 ASP A CG   1 
ATOM   4258 O  OD1  . ASP A 1 273 ? -1.997  -19.340 -24.760 1.00  17.48 ? 1726 ASP A OD1  1 
ATOM   4259 O  OD2  . ASP A 1 273 ? -1.834  -17.153 -24.997 1.00  19.64 ? 1726 ASP A OD2  1 
ATOM   4260 H  H    . ASP A 1 273 ? -5.094  -18.640 -28.067 1.00  15.46 ? 1726 ASP A H    1 
ATOM   4261 H  HA   . ASP A 1 273 ? -4.418  -19.809 -25.830 1.00  14.93 ? 1726 ASP A HA   1 
ATOM   4262 H  HB2  . ASP A 1 273 ? -2.773  -18.908 -27.218 1.00  16.82 ? 1726 ASP A HB2  1 
ATOM   4263 H  HB3  . ASP A 1 273 ? -3.295  -17.440 -26.897 1.00  16.82 ? 1726 ASP A HB3  1 
ATOM   4264 N  N    . ASP A 1 274 ? -5.767  -16.919 -25.443 1.00  12.89 ? 1727 ASP A N    1 
ATOM   4265 C  CA   . ASP A 1 274 ? -6.379  -16.055 -24.432 1.00  12.93 ? 1727 ASP A CA   1 
ATOM   4266 C  C    . ASP A 1 274 ? -7.404  -16.877 -23.636 1.00  12.95 ? 1727 ASP A C    1 
ATOM   4267 O  O    . ASP A 1 274 ? -7.504  -16.764 -22.409 1.00  13.53 ? 1727 ASP A O    1 
ATOM   4268 C  CB   . ASP A 1 274 ? -7.112  -14.863 -25.074 1.00  14.66 ? 1727 ASP A CB   1 
ATOM   4269 C  CG   . ASP A 1 274 ? -6.187  -13.827 -25.714 1.00  17.51 ? 1727 ASP A CG   1 
ATOM   4270 O  OD1  . ASP A 1 274 ? -5.006  -13.715 -25.334 1.00  19.47 ? 1727 ASP A OD1  1 
ATOM   4271 O  OD2  . ASP A 1 274 ? -6.677  -13.090 -26.607 1.00  17.94 ? 1727 ASP A OD2  1 
ATOM   4272 H  H    . ASP A 1 274 ? -5.836  -16.634 -26.252 1.00  15.47 ? 1727 ASP A H    1 
ATOM   4273 H  HA   . ASP A 1 274 ? -5.693  -15.717 -23.818 1.00  15.52 ? 1727 ASP A HA   1 
ATOM   4274 H  HB2  . ASP A 1 274 ? -7.703  -15.198 -25.766 1.00  17.59 ? 1727 ASP A HB2  1 
ATOM   4275 H  HB3  . ASP A 1 274 ? -7.631  -14.412 -24.390 1.00  17.59 ? 1727 ASP A HB3  1 
ATOM   4276 N  N    . LEU A 1 275 ? -8.181  -17.681 -24.349 1.00  12.89 ? 1728 LEU A N    1 
ATOM   4277 C  CA   A LEU A 1 275 ? -9.192  -18.515 -23.729 0.72  13.72 ? 1728 LEU A CA   1 
ATOM   4278 C  CA   B LEU A 1 275 ? -9.198  -18.531 -23.738 0.28  13.50 ? 1728 LEU A CA   1 
ATOM   4279 C  C    . LEU A 1 275 ? -8.559  -19.562 -22.813 1.00  13.91 ? 1728 LEU A C    1 
ATOM   4280 O  O    . LEU A 1 275 ? -8.994  -19.747 -21.666 1.00  14.20 ? 1728 LEU A O    1 
ATOM   4281 C  CB   A LEU A 1 275 ? -10.042 -19.172 -24.821 0.72  14.91 ? 1728 LEU A CB   1 
ATOM   4282 C  CB   B LEU A 1 275 ? -10.015 -19.228 -24.836 0.28  14.02 ? 1728 LEU A CB   1 
ATOM   4283 C  CG   A LEU A 1 275 ? -11.136 -20.121 -24.364 0.72  15.32 ? 1728 LEU A CG   1 
ATOM   4284 C  CG   B LEU A 1 275 ? -11.253 -20.046 -24.462 0.28  14.11 ? 1728 LEU A CG   1 
ATOM   4285 C  CD1  A LEU A 1 275 ? -12.030 -19.411 -23.389 0.72  16.12 ? 1728 LEU A CD1  1 
ATOM   4286 C  CD1  B LEU A 1 275 ? -12.125 -20.243 -25.694 0.28  14.45 ? 1728 LEU A CD1  1 
ATOM   4287 C  CD2  A LEU A 1 275 ? -11.954 -20.639 -25.536 0.72  16.52 ? 1728 LEU A CD2  1 
ATOM   4288 C  CD2  B LEU A 1 275 ? -10.886 -21.403 -23.856 0.28  14.10 ? 1728 LEU A CD2  1 
ATOM   4289 H  H    A LEU A 1 275 ? -8.140  -17.760 -25.204 0.72  15.47 ? 1728 LEU A H    1 
ATOM   4290 H  H    B LEU A 1 275 ? -8.140  -17.754 -25.205 0.28  15.47 ? 1728 LEU A H    1 
ATOM   4291 H  HA   A LEU A 1 275 ? -9.780  -17.952 -23.185 0.72  16.46 ? 1728 LEU A HA   1 
ATOM   4292 H  HA   B LEU A 1 275 ? -9.807  -17.977 -23.206 0.28  16.20 ? 1728 LEU A HA   1 
ATOM   4293 H  HB2  A LEU A 1 275 ? -10.469 -18.469 -25.335 0.72  17.89 ? 1728 LEU A HB2  1 
ATOM   4294 H  HB2  B LEU A 1 275 ? -10.314 -18.544 -25.455 0.28  16.83 ? 1728 LEU A HB2  1 
ATOM   4295 H  HB3  A LEU A 1 275 ? -9.450  -19.677 -25.401 0.72  17.89 ? 1728 LEU A HB3  1 
ATOM   4296 H  HB3  B LEU A 1 275 ? -9.417  -19.831 -25.304 0.28  16.83 ? 1728 LEU A HB3  1 
ATOM   4297 H  HG   A LEU A 1 275 ? -10.735 -20.880 -23.912 0.72  18.38 ? 1728 LEU A HG   1 
ATOM   4298 H  HG   B LEU A 1 275 ? -11.769 -19.554 -23.805 0.28  16.93 ? 1728 LEU A HG   1 
ATOM   4299 H  HD11 A LEU A 1 275 ? -12.421 -18.648 -23.822 0.72  19.34 ? 1728 LEU A HD11 1 
ATOM   4300 H  HD11 B LEU A 1 275 ? -11.619 -20.710 -26.363 0.28  17.34 ? 1728 LEU A HD11 1 
ATOM   4301 H  HD12 A LEU A 1 275 ? -12.720 -20.014 -23.103 0.72  19.34 ? 1728 LEU A HD12 1 
ATOM   4302 H  HD12 B LEU A 1 275 ? -12.898 -20.757 -25.450 0.28  17.34 ? 1728 LEU A HD12 1 
ATOM   4303 H  HD13 A LEU A 1 275 ? -11.508 -19.128 -22.635 0.72  19.34 ? 1728 LEU A HD13 1 
ATOM   4304 H  HD13 B LEU A 1 275 ? -12.394 -19.384 -26.027 0.28  17.34 ? 1728 LEU A HD13 1 
ATOM   4305 H  HD21 A LEU A 1 275 ? -11.372 -21.108 -26.139 0.72  19.82 ? 1728 LEU A HD21 1 
ATOM   4306 H  HD21 B LEU A 1 275 ? -10.366 -21.259 -23.061 0.28  16.92 ? 1728 LEU A HD21 1 
ATOM   4307 H  HD22 A LEU A 1 275 ? -12.632 -21.233 -25.205 0.72  19.82 ? 1728 LEU A HD22 1 
ATOM   4308 H  HD22 B LEU A 1 275 ? -11.692 -21.876 -23.639 0.28  16.92 ? 1728 LEU A HD22 1 
ATOM   4309 H  HD23 A LEU A 1 275 ? -12.361 -19.895 -25.986 0.72  19.82 ? 1728 LEU A HD23 1 
ATOM   4310 H  HD23 B LEU A 1 275 ? -10.374 -21.903 -24.496 0.28  16.92 ? 1728 LEU A HD23 1 
ATOM   4311 N  N    . LEU A 1 276 ? -7.516  -20.226 -23.299 1.00  13.37 ? 1729 LEU A N    1 
ATOM   4312 C  CA   . LEU A 1 276 ? -6.877  -21.275 -22.517 1.00  13.11 ? 1729 LEU A CA   1 
ATOM   4313 C  C    . LEU A 1 276 ? -6.080  -20.765 -21.310 1.00  12.22 ? 1729 LEU A C    1 
ATOM   4314 O  O    . LEU A 1 276 ? -6.010  -21.450 -20.292 1.00  13.21 ? 1729 LEU A O    1 
ATOM   4315 C  CB   . LEU A 1 276 ? -6.031  -22.150 -23.416 1.00  15.40 ? 1729 LEU A CB   1 
ATOM   4316 C  CG   . LEU A 1 276 ? -6.872  -22.924 -24.431 1.00  16.52 ? 1729 LEU A CG   1 
ATOM   4317 C  CD1  . LEU A 1 276 ? -5.957  -23.738 -25.334 1.00  19.19 ? 1729 LEU A CD1  1 
ATOM   4318 C  CD2  . LEU A 1 276 ? -7.920  -23.811 -23.751 1.00  18.23 ? 1729 LEU A CD2  1 
ATOM   4319 H  H    . LEU A 1 276 ? -7.163  -20.090 -24.071 1.00  16.05 ? 1729 LEU A H    1 
ATOM   4320 H  HA   . LEU A 1 276 ? -7.586  -21.847 -22.159 1.00  15.73 ? 1729 LEU A HA   1 
ATOM   4321 H  HB2  . LEU A 1 276 ? -5.405  -21.593 -23.905 1.00  18.48 ? 1729 LEU A HB2  1 
ATOM   4322 H  HB3  . LEU A 1 276 ? -5.549  -22.792 -22.871 1.00  18.48 ? 1729 LEU A HB3  1 
ATOM   4323 H  HG   . LEU A 1 276 ? -7.344  -22.288 -24.990 1.00  19.83 ? 1729 LEU A HG   1 
ATOM   4324 H  HD11 . LEU A 1 276 ? -5.454  -24.353 -24.795 1.00  23.02 ? 1729 LEU A HD11 1 
ATOM   4325 H  HD12 . LEU A 1 276 ? -6.493  -24.221 -25.967 1.00  23.02 ? 1729 LEU A HD12 1 
ATOM   4326 H  HD13 . LEU A 1 276 ? -5.362  -23.143 -25.794 1.00  23.02 ? 1729 LEU A HD13 1 
ATOM   4327 H  HD21 . LEU A 1 276 ? -8.506  -23.258 -23.230 1.00  21.87 ? 1729 LEU A HD21 1 
ATOM   4328 H  HD22 . LEU A 1 276 ? -8.421  -24.275 -24.426 1.00  21.87 ? 1729 LEU A HD22 1 
ATOM   4329 H  HD23 . LEU A 1 276 ? -7.473  -24.443 -23.183 1.00  21.87 ? 1729 LEU A HD23 1 
ATOM   4330 N  N    . GLN A 1 277 ? -5.503  -19.570 -21.393 1.00  11.33 ? 1730 GLN A N    1 
ATOM   4331 C  CA   . GLN A 1 277 ? -4.915  -18.987 -20.193 1.00  11.56 ? 1730 GLN A CA   1 
ATOM   4332 C  C    . GLN A 1 277 ? -5.998  -18.834 -19.126 1.00  10.68 ? 1730 GLN A C    1 
ATOM   4333 O  O    . GLN A 1 277 ? -5.778  -19.089 -17.934 1.00  11.63 ? 1730 GLN A O    1 
ATOM   4334 C  CB   . GLN A 1 277 ? -4.274  -17.630 -20.484 1.00  11.87 ? 1730 GLN A CB   1 
ATOM   4335 C  CG   . GLN A 1 277 ? -3.112  -17.697 -21.458 1.00  12.06 ? 1730 GLN A CG   1 
ATOM   4336 C  CD   . GLN A 1 277 ? -1.972  -18.557 -20.969 1.00  12.31 ? 1730 GLN A CD   1 
ATOM   4337 O  OE1  . GLN A 1 277 ? -1.668  -18.596 -19.777 1.00  13.13 ? 1730 GLN A OE1  1 
ATOM   4338 N  NE2  . GLN A 1 277 ? -1.339  -19.263 -21.885 1.00  13.02 ? 1730 GLN A NE2  1 
ATOM   4339 H  H    . GLN A 1 277 ? -5.440  -19.091 -22.105 1.00  13.60 ? 1730 GLN A H    1 
ATOM   4340 H  HA   . GLN A 1 277 ? -4.222  -19.587 -19.846 1.00  13.87 ? 1730 GLN A HA   1 
ATOM   4341 H  HB2  . GLN A 1 277 ? -4.946  -17.042 -20.864 1.00  14.24 ? 1730 GLN A HB2  1 
ATOM   4342 H  HB3  . GLN A 1 277 ? -3.943  -17.256 -19.653 1.00  14.24 ? 1730 GLN A HB3  1 
ATOM   4343 H  HG2  . GLN A 1 277 ? -3.426  -18.069 -22.297 1.00  14.48 ? 1730 GLN A HG2  1 
ATOM   4344 H  HG3  . GLN A 1 277 ? -2.769  -16.801 -21.601 1.00  14.48 ? 1730 GLN A HG3  1 
ATOM   4345 H  HE21 . GLN A 1 277 ? -1.583  -19.216 -22.708 1.00  15.62 ? 1730 GLN A HE21 1 
ATOM   4346 H  HE22 . GLN A 1 277 ? -0.681  -19.769 -21.659 1.00  15.62 ? 1730 GLN A HE22 1 
ATOM   4347 N  N    . ARG A 1 278 ? -7.176  -18.408 -19.568 1.00  10.12 ? 1731 ARG A N    1 
ATOM   4348 C  CA   . ARG A 1 278 ? -8.219  -18.007 -18.632 1.00  10.42 ? 1731 ARG A CA   1 
ATOM   4349 C  C    . ARG A 1 278 ? -9.091  -19.153 -18.118 1.00  11.15 ? 1731 ARG A C    1 
ATOM   4350 O  O    . ARG A 1 278 ? -9.706  -19.015 -17.061 1.00  11.25 ? 1731 ARG A O    1 
ATOM   4351 C  CB   . ARG A 1 278 ? -9.048  -16.872 -19.242 1.00  10.65 ? 1731 ARG A CB   1 
ATOM   4352 C  CG   . ARG A 1 278 ? -8.229  -15.592 -19.312 1.00  10.56 ? 1731 ARG A CG   1 
ATOM   4353 C  CD   . ARG A 1 278 ? -8.813  -14.529 -20.223 1.00  10.70 ? 1731 ARG A CD   1 
ATOM   4354 N  NE   . ARG A 1 278 ? -7.983  -13.328 -20.177 1.00  10.90 ? 1731 ARG A NE   1 
ATOM   4355 C  CZ   . ARG A 1 278 ? -6.814  -13.193 -20.797 1.00  11.47 ? 1731 ARG A CZ   1 
ATOM   4356 N  NH1  . ARG A 1 278 ? -6.348  -14.158 -21.582 1.00  14.63 ? 1731 ARG A NH1  1 
ATOM   4357 N  NH2  . ARG A 1 278 ? -6.103  -12.073 -20.645 1.00  14.08 ? 1731 ARG A NH2  1 
ATOM   4358 H  H    . ARG A 1 278 ? -7.396  -18.343 -20.397 1.00  12.15 ? 1731 ARG A H    1 
ATOM   4359 H  HA   . ARG A 1 278 ? -7.773  -17.630 -17.845 1.00  12.50 ? 1731 ARG A HA   1 
ATOM   4360 H  HB2  . ARG A 1 278 ? -9.316  -17.115 -20.142 1.00  12.78 ? 1731 ARG A HB2  1 
ATOM   4361 H  HB3  . ARG A 1 278 ? -9.828  -16.708 -18.689 1.00  12.78 ? 1731 ARG A HB3  1 
ATOM   4362 H  HG2  . ARG A 1 278 ? -8.165  -15.215 -18.420 1.00  12.67 ? 1731 ARG A HG2  1 
ATOM   4363 H  HG3  . ARG A 1 278 ? -7.342  -15.808 -19.640 1.00  12.67 ? 1731 ARG A HG3  1 
ATOM   4364 H  HD2  . ARG A 1 278 ? -8.832  -14.857 -21.135 1.00  12.84 ? 1731 ARG A HD2  1 
ATOM   4365 H  HD3  . ARG A 1 278 ? -9.706  -14.299 -19.924 1.00  12.84 ? 1731 ARG A HD3  1 
ATOM   4366 H  HE   . ARG A 1 278 ? -8.270  -12.661 -19.717 1.00  13.08 ? 1731 ARG A HE   1 
ATOM   4367 H  HH11 . ARG A 1 278 ? -6.791  -14.889 -21.675 1.00  17.55 ? 1731 ARG A HH11 1 
ATOM   4368 H  HH12 . ARG A 1 278 ? -5.596  -14.057 -21.987 1.00  17.55 ? 1731 ARG A HH12 1 
ATOM   4369 H  HH21 . ARG A 1 278 ? -6.405  -11.436 -20.152 1.00  16.90 ? 1731 ARG A HH21 1 
ATOM   4370 H  HH22 . ARG A 1 278 ? -5.361  -11.974 -21.069 1.00  16.90 ? 1731 ARG A HH22 1 
ATOM   4371 N  N    . LEU A 1 279 ? -9.104  -20.286 -18.827 1.00  10.82 ? 1732 LEU A N    1 
ATOM   4372 C  CA   . LEU A 1 279 ? -9.874  -21.457 -18.408 1.00  10.89 ? 1732 LEU A CA   1 
ATOM   4373 C  C    . LEU A 1 279 ? -8.994  -22.660 -18.064 1.00  10.92 ? 1732 LEU A C    1 
ATOM   4374 O  O    . LEU A 1 279 ? -9.508  -23.750 -17.823 1.00  12.54 ? 1732 LEU A O    1 
ATOM   4375 C  CB   . LEU A 1 279 ? -10.919 -21.840 -19.474 1.00  12.76 ? 1732 LEU A CB   1 
ATOM   4376 C  CG   . LEU A 1 279 ? -12.214 -21.028 -19.422 1.00  13.80 ? 1732 LEU A CG   1 
ATOM   4377 C  CD1  . LEU A 1 279 ? -13.124 -21.433 -20.551 1.00  16.45 ? 1732 LEU A CD1  1 
ATOM   4378 C  CD2  . LEU A 1 279 ? -12.953 -21.176 -18.109 1.00  13.50 ? 1732 LEU A CD2  1 
ATOM   4379 H  H    . LEU A 1 279 ? -8.670  -20.401 -19.561 1.00  12.98 ? 1732 LEU A H    1 
ATOM   4380 H  HA   . LEU A 1 279 ? -10.367 -21.220 -17.594 1.00  13.07 ? 1732 LEU A HA   1 
ATOM   4381 H  HB2  . LEU A 1 279 ? -10.526 -21.710 -20.352 1.00  15.31 ? 1732 LEU A HB2  1 
ATOM   4382 H  HB3  . LEU A 1 279 ? -11.153 -22.774 -19.357 1.00  15.31 ? 1732 LEU A HB3  1 
ATOM   4383 H  HG   . LEU A 1 279 ? -11.999 -20.089 -19.537 1.00  16.56 ? 1732 LEU A HG   1 
ATOM   4384 H  HD11 . LEU A 1 279 ? -13.329 -22.367 -20.467 1.00  19.73 ? 1732 LEU A HD11 1 
ATOM   4385 H  HD12 . LEU A 1 279 ? -13.931 -20.915 -20.503 1.00  19.73 ? 1732 LEU A HD12 1 
ATOM   4386 H  HD13 . LEU A 1 279 ? -12.678 -21.269 -21.385 1.00  19.73 ? 1732 LEU A HD13 1 
ATOM   4387 H  HD21 . LEU A 1 279 ? -12.385 -20.873 -17.396 1.00  16.20 ? 1732 LEU A HD21 1 
ATOM   4388 H  HD22 . LEU A 1 279 ? -13.752 -20.645 -18.139 1.00  16.20 ? 1732 LEU A HD22 1 
ATOM   4389 H  HD23 . LEU A 1 279 ? -13.177 -22.100 -17.979 1.00  16.20 ? 1732 LEU A HD23 1 
ATOM   4390 N  N    . HIS A 1 280 ? -7.677  -22.478 -18.003 1.00  11.60 ? 1733 HIS A N    1 
ATOM   4391 C  CA   . HIS A 1 280 ? -6.810  -23.610 -17.705 1.00  10.76 ? 1733 HIS A CA   1 
ATOM   4392 C  C    . HIS A 1 280 ? -5.579  -23.162 -16.918 1.00  10.69 ? 1733 HIS A C    1 
ATOM   4393 O  O    . HIS A 1 280 ? -5.449  -23.481 -15.721 1.00  11.54 ? 1733 HIS A O    1 
ATOM   4394 C  CB   . HIS A 1 280 ? -6.455  -24.354 -18.996 1.00  11.96 ? 1733 HIS A CB   1 
ATOM   4395 C  CG   . HIS A 1 280 ? -5.569  -25.541 -18.790 1.00  12.74 ? 1733 HIS A CG   1 
ATOM   4396 N  ND1  . HIS A 1 280 ? -6.020  -26.740 -18.274 1.00  13.09 ? 1733 HIS A ND1  1 
ATOM   4397 C  CD2  . HIS A 1 280 ? -4.251  -25.715 -19.042 1.00  14.02 ? 1733 HIS A CD2  1 
ATOM   4398 C  CE1  . HIS A 1 280 ? -5.016  -27.600 -18.222 1.00  14.14 ? 1733 HIS A CE1  1 
ATOM   4399 N  NE2  . HIS A 1 280 ? -3.931  -27.001 -18.677 1.00  14.36 ? 1733 HIS A NE2  1 
ATOM   4400 H  H    . HIS A 1 280 ? -7.271  -21.730 -18.127 1.00  13.92 ? 1733 HIS A H    1 
ATOM   4401 H  HA   . HIS A 1 280 ? -7.306  -24.235 -17.137 1.00  12.91 ? 1733 HIS A HA   1 
ATOM   4402 H  HB2  . HIS A 1 280 ? -7.275  -24.666 -19.412 1.00  14.35 ? 1733 HIS A HB2  1 
ATOM   4403 H  HB3  . HIS A 1 280 ? -5.997  -23.743 -19.593 1.00  14.35 ? 1733 HIS A HB3  1 
ATOM   4404 H  HD1  . HIS A 1 280 ? -6.829  -26.904 -18.031 1.00  15.71 ? 1733 HIS A HD1  1 
ATOM   4405 H  HD2  . HIS A 1 280 ? -3.670  -25.082 -19.396 1.00  16.82 ? 1733 HIS A HD2  1 
ATOM   4406 H  HE1  . HIS A 1 280 ? -5.064  -28.474 -17.907 1.00  16.97 ? 1733 HIS A HE1  1 
ATOM   4407 H  HE2  . HIS A 1 280 ? -3.151  -27.358 -18.737 1.00  17.24 ? 1733 HIS A HE2  1 
ATOM   4408 N  N    . HIS A 1 281 ? -4.688  -22.403 -17.551 1.00  11.05 ? 1734 HIS A N    1 
ATOM   4409 C  CA   . HIS A 1 281 ? -3.419  -22.131 -16.914 1.00  11.19 ? 1734 HIS A CA   1 
ATOM   4410 C  C    . HIS A 1 281 ? -3.515  -21.211 -15.697 1.00  11.41 ? 1734 HIS A C    1 
ATOM   4411 O  O    . HIS A 1 281 ? -2.874  -21.458 -14.663 1.00  11.15 ? 1734 HIS A O    1 
ATOM   4412 C  CB   . HIS A 1 281 ? -2.443  -21.531 -17.918 1.00  11.02 ? 1734 HIS A CB   1 
ATOM   4413 C  CG   . HIS A 1 281 ? -1.962  -22.497 -18.953 1.00  12.59 ? 1734 HIS A CG   1 
ATOM   4414 N  ND1  . HIS A 1 281 ? -1.142  -23.555 -18.641 1.00  13.62 ? 1734 HIS A ND1  1 
ATOM   4415 C  CD2  . HIS A 1 281 ? -2.132  -22.537 -20.298 1.00  14.22 ? 1734 HIS A CD2  1 
ATOM   4416 C  CE1  . HIS A 1 281 ? -0.837  -24.218 -19.746 1.00  15.69 ? 1734 HIS A CE1  1 
ATOM   4417 N  NE2  . HIS A 1 281 ? -1.430  -23.623 -20.766 1.00  16.07 ? 1734 HIS A NE2  1 
ATOM   4418 H  H    . HIS A 1 281 ? -4.794  -22.046 -18.327 1.00  13.26 ? 1734 HIS A H    1 
ATOM   4419 H  HA   . HIS A 1 281 ? -3.040  -22.981 -16.608 1.00  13.42 ? 1734 HIS A HA   1 
ATOM   4420 H  HB2  . HIS A 1 281 ? -2.881  -20.798 -18.379 1.00  13.23 ? 1734 HIS A HB2  1 
ATOM   4421 H  HB3  . HIS A 1 281 ? -1.667  -21.201 -17.439 1.00  13.23 ? 1734 HIS A HB3  1 
ATOM   4422 H  HD1  . HIS A 1 281 ? -0.867  -23.754 -17.850 1.00  16.35 ? 1734 HIS A HD1  1 
ATOM   4423 H  HD2  . HIS A 1 281 ? -2.636  -21.944 -20.808 1.00  17.07 ? 1734 HIS A HD2  1 
ATOM   4424 H  HE1  . HIS A 1 281 ? -0.308  -24.981 -19.795 1.00  18.83 ? 1734 HIS A HE1  1 
ATOM   4425 N  N    . ASN A 1 282 ? -4.266  -20.121 -15.820 1.00  11.08 ? 1735 ASN A N    1 
ATOM   4426 C  CA   . ASN A 1 282 ? -4.387  -19.198 -14.686 1.00  10.34 ? 1735 ASN A CA   1 
ATOM   4427 C  C    . ASN A 1 282 ? -5.192  -19.775 -13.508 1.00  10.22 ? 1735 ASN A C    1 
ATOM   4428 O  O    . ASN A 1 282 ? -4.781  -19.634 -12.363 1.00  11.38 ? 1735 ASN A O    1 
ATOM   4429 C  CB   . ASN A 1 282 ? -4.894  -17.830 -15.124 1.00  10.85 ? 1735 ASN A CB   1 
ATOM   4430 C  CG   . ASN A 1 282 ? -3.846  -17.068 -15.928 1.00  11.75 ? 1735 ASN A CG   1 
ATOM   4431 O  OD1  . ASN A 1 282 ? -2.647  -17.292 -15.773 1.00  13.20 ? 1735 ASN A OD1  1 
ATOM   4432 N  ND2  . ASN A 1 282 ? -4.297  -16.166 -16.784 1.00  12.40 ? 1735 ASN A ND2  1 
ATOM   4433 H  H    . ASN A 1 282 ? -4.704  -19.894 -16.524 1.00  13.30 ? 1735 ASN A H    1 
ATOM   4434 H  HA   . ASN A 1 282 ? -3.481  -19.050 -14.343 1.00  12.41 ? 1735 ASN A HA   1 
ATOM   4435 H  HB2  . ASN A 1 282 ? -5.679  -17.944 -15.682 1.00  13.03 ? 1735 ASN A HB2  1 
ATOM   4436 H  HB3  . ASN A 1 282 ? -5.114  -17.305 -14.339 1.00  13.03 ? 1735 ASN A HB3  1 
ATOM   4437 H  HD21 . ASN A 1 282 ? -5.143  -16.035 -16.864 1.00  14.88 ? 1735 ASN A HD21 1 
ATOM   4438 H  HD22 . ASN A 1 282 ? -3.744  -15.711 -17.260 1.00  14.88 ? 1735 ASN A HD22 1 
ATOM   4439 N  N    . PRO A 1 283 ? -6.311  -20.472 -13.787 1.00  10.99 ? 1736 PRO A N    1 
ATOM   4440 C  CA   . PRO A 1 283 ? -6.945  -21.179 -12.663 1.00  11.67 ? 1736 PRO A CA   1 
ATOM   4441 C  C    . PRO A 1 283 ? -5.974  -22.126 -11.937 1.00  11.74 ? 1736 PRO A C    1 
ATOM   4442 O  O    . PRO A 1 283 ? -5.965  -22.156 -10.712 1.00  12.59 ? 1736 PRO A O    1 
ATOM   4443 C  CB   . PRO A 1 283 ? -8.094  -21.943 -13.334 1.00  13.21 ? 1736 PRO A CB   1 
ATOM   4444 C  CG   . PRO A 1 283 ? -8.470  -21.086 -14.502 1.00  12.41 ? 1736 PRO A CG   1 
ATOM   4445 C  CD   . PRO A 1 283 ? -7.162  -20.473 -14.990 1.00  11.37 ? 1736 PRO A CD   1 
ATOM   4446 H  HA   . PRO A 1 283 ? -7.314  -20.537 -12.022 1.00  14.01 ? 1736 PRO A HA   1 
ATOM   4447 H  HB2  . PRO A 1 283 ? -7.783  -22.813 -13.630 1.00  15.85 ? 1736 PRO A HB2  1 
ATOM   4448 H  HB3  . PRO A 1 283 ? -8.837  -22.031 -12.716 1.00  15.85 ? 1736 PRO A HB3  1 
ATOM   4449 H  HG2  . PRO A 1 283 ? -8.871  -21.635 -15.194 1.00  14.90 ? 1736 PRO A HG2  1 
ATOM   4450 H  HG3  . PRO A 1 283 ? -9.086  -20.394 -14.214 1.00  14.90 ? 1736 PRO A HG3  1 
ATOM   4451 H  HD2  . PRO A 1 283 ? -6.767  -21.027 -15.683 1.00  13.64 ? 1736 PRO A HD2  1 
ATOM   4452 H  HD3  . PRO A 1 283 ? -7.309  -19.566 -15.301 1.00  13.64 ? 1736 PRO A HD3  1 
ATOM   4453 N  N    . ARG A 1 284 ? -5.183  -22.897 -12.674 1.00  11.78 ? 1737 ARG A N    1 
ATOM   4454 C  CA   . ARG A 1 284 ? -4.213  -23.795 -12.046 1.00  12.23 ? 1737 ARG A CA   1 
ATOM   4455 C  C    . ARG A 1 284 ? -3.288  -23.030 -11.124 1.00  11.92 ? 1737 ARG A C    1 
ATOM   4456 O  O    . ARG A 1 284 ? -3.041  -23.442 -9.995  1.00  12.88 ? 1737 ARG A O    1 
ATOM   4457 C  CB   . ARG A 1 284 ? -3.317  -24.477 -13.077 1.00  14.39 ? 1737 ARG A CB   1 
ATOM   4458 C  CG   . ARG A 1 284 ? -3.807  -25.724 -13.708 1.00  16.29 ? 1737 ARG A CG   1 
ATOM   4459 C  CD   . ARG A 1 284 ? -2.729  -26.194 -14.665 1.00  15.81 ? 1737 ARG A CD   1 
ATOM   4460 N  NE   . ARG A 1 284 ? -2.999  -27.494 -15.247 1.00  16.40 ? 1737 ARG A NE   1 
ATOM   4461 C  CZ   . ARG A 1 284 ? -2.224  -28.023 -16.171 1.00  16.29 ? 1737 ARG A CZ   1 
ATOM   4462 N  NH1  . ARG A 1 284 ? -1.174  -27.326 -16.603 1.00  14.94 ? 1737 ARG A NH1  1 
ATOM   4463 N  NH2  . ARG A 1 284 ? -2.498  -29.222 -16.671 1.00  17.38 ? 1737 ARG A NH2  1 
ATOM   4464 H  H    . ARG A 1 284 ? -5.185  -22.922 -13.534 1.00  14.14 ? 1737 ARG A H    1 
ATOM   4465 H  HA   . ARG A 1 284 ? -4.681  -24.482 -11.527 1.00  14.67 ? 1737 ARG A HA   1 
ATOM   4466 H  HB2  . ARG A 1 284 ? -3.154  -23.845 -13.794 1.00  17.27 ? 1737 ARG A HB2  1 
ATOM   4467 H  HB3  . ARG A 1 284 ? -2.475  -24.691 -12.646 1.00  17.27 ? 1737 ARG A HB3  1 
ATOM   4468 H  HG2  . ARG A 1 284 ? -3.950  -26.406 -13.032 1.00  19.55 ? 1737 ARG A HG2  1 
ATOM   4469 H  HG3  . ARG A 1 284 ? -4.620  -25.550 -14.206 1.00  19.55 ? 1737 ARG A HG3  1 
ATOM   4470 H  HD2  . ARG A 1 284 ? -2.654  -25.553 -15.390 1.00  18.97 ? 1737 ARG A HD2  1 
ATOM   4471 H  HD3  . ARG A 1 284 ? -1.888  -26.251 -14.186 1.00  18.97 ? 1737 ARG A HD3  1 
ATOM   4472 H  HE   . ARG A 1 284 ? -3.544  -28.015 -14.832 1.00  19.68 ? 1737 ARG A HE   1 
ATOM   4473 H  HH11 . ARG A 1 284 ? -1.005  -26.551 -16.269 1.00  17.93 ? 1737 ARG A HH11 1 
ATOM   4474 H  HH12 . ARG A 1 284 ? -0.659  -27.654 -17.209 1.00  17.93 ? 1737 ARG A HH12 1 
ATOM   4475 H  HH21 . ARG A 1 284 ? -3.183  -29.659 -16.388 1.00  20.85 ? 1737 ARG A HH21 1 
ATOM   4476 H  HH22 . ARG A 1 284 ? -1.995  -29.559 -17.281 1.00  20.85 ? 1737 ARG A HH22 1 
ATOM   4477 N  N    . ARG A 1 285 ? -2.760  -21.909 -11.607 1.00  11.38 ? 1738 ARG A N    1 
ATOM   4478 C  CA   . ARG A 1 285 ? -1.680  -21.247 -10.882 1.00  10.93 ? 1738 ARG A CA   1 
ATOM   4479 C  C    . ARG A 1 285 ? -2.159  -20.398 -9.718  1.00  11.52 ? 1738 ARG A C    1 
ATOM   4480 O  O    . ARG A 1 285 ? -1.451  -20.238 -8.734  1.00  12.89 ? 1738 ARG A O    1 
ATOM   4481 C  CB   . ARG A 1 285 ? -0.768  -20.440 -11.813 1.00  11.16 ? 1738 ARG A CB   1 
ATOM   4482 C  CG   . ARG A 1 285 ? -1.287  -19.068 -12.209 1.00  11.89 ? 1738 ARG A CG   1 
ATOM   4483 C  CD   . ARG A 1 285 ? -0.443  -18.502 -13.342 1.00  12.85 ? 1738 ARG A CD   1 
ATOM   4484 N  NE   . ARG A 1 285 ? -0.730  -17.111 -13.643 1.00  14.61 ? 1738 ARG A NE   1 
ATOM   4485 C  CZ   . ARG A 1 285 ? -0.207  -16.075 -12.999 1.00  18.20 ? 1738 ARG A CZ   1 
ATOM   4486 N  NH1  . ARG A 1 285 ? 0.644   -16.271 -12.002 1.00  17.22 ? 1738 ARG A NH1  1 
ATOM   4487 N  NH2  . ARG A 1 285 ? -0.538  -14.830 -13.352 1.00  20.75 ? 1738 ARG A NH2  1 
ATOM   4488 H  H    . ARG A 1 285 ? -3.001  -21.519 -12.335 1.00  13.65 ? 1738 ARG A H    1 
ATOM   4489 H  HA   . ARG A 1 285 ? -1.120  -21.951 -10.493 1.00  13.12 ? 1738 ARG A HA   1 
ATOM   4490 H  HB2  . ARG A 1 285 ? 0.085   -20.311 -11.370 1.00  13.39 ? 1738 ARG A HB2  1 
ATOM   4491 H  HB3  . ARG A 1 285 ? -0.636  -20.947 -12.629 1.00  13.39 ? 1738 ARG A HB3  1 
ATOM   4492 H  HG2  . ARG A 1 285 ? -2.205  -19.143 -12.515 1.00  14.27 ? 1738 ARG A HG2  1 
ATOM   4493 H  HG3  . ARG A 1 285 ? -1.229  -18.467 -11.450 1.00  14.27 ? 1738 ARG A HG3  1 
ATOM   4494 H  HD2  . ARG A 1 285 ? 0.493   -18.566 -13.097 1.00  15.43 ? 1738 ARG A HD2  1 
ATOM   4495 H  HD3  . ARG A 1 285 ? -0.609  -19.021 -14.145 1.00  15.43 ? 1738 ARG A HD3  1 
ATOM   4496 H  HE   . ARG A 1 285 ? -1.278  -16.946 -14.285 1.00  17.53 ? 1738 ARG A HE   1 
ATOM   4497 H  HH11 . ARG A 1 285 ? 0.859   -17.071 -11.771 1.00  20.66 ? 1738 ARG A HH11 1 
ATOM   4498 H  HH12 . ARG A 1 285 ? 0.981   -15.598 -11.586 1.00  20.66 ? 1738 ARG A HH12 1 
ATOM   4499 H  HH21 . ARG A 1 285 ? -1.090  -14.699 -13.998 1.00  24.90 ? 1738 ARG A HH21 1 
ATOM   4500 H  HH22 . ARG A 1 285 ? -0.198  -14.160 -12.934 1.00  24.90 ? 1738 ARG A HH22 1 
ATOM   4501 N  N    . ILE A 1 286 ? -3.361  -19.853 -9.827  1.00  11.25 ? 1739 ILE A N    1 
ATOM   4502 C  CA   . ILE A 1 286 ? -3.877  -19.009 -8.767  1.00  11.30 ? 1739 ILE A CA   1 
ATOM   4503 C  C    . ILE A 1 286 ? -4.361  -19.859 -7.609  1.00  11.97 ? 1739 ILE A C    1 
ATOM   4504 O  O    . ILE A 1 286 ? -4.157  -19.516 -6.452  1.00  13.34 ? 1739 ILE A O    1 
ATOM   4505 C  CB   . ILE A 1 286 ? -5.000  -18.117 -9.294  1.00  11.76 ? 1739 ILE A CB   1 
ATOM   4506 C  CG1  . ILE A 1 286 ? -4.436  -17.110 -10.296 1.00  13.42 ? 1739 ILE A CG1  1 
ATOM   4507 C  CG2  . ILE A 1 286 ? -5.737  -17.447 -8.155  1.00  13.40 ? 1739 ILE A CG2  1 
ATOM   4508 C  CD1  . ILE A 1 286 ? -5.505  -16.393 -11.101 1.00  13.88 ? 1739 ILE A CD1  1 
ATOM   4509 H  H    . ILE A 1 286 ? -3.891  -19.955 -10.497 1.00  13.50 ? 1739 ILE A H    1 
ATOM   4510 H  HA   . ILE A 1 286 ? -3.157  -18.431 -8.439  1.00  13.56 ? 1739 ILE A HA   1 
ATOM   4511 H  HB   . ILE A 1 286 ? -5.632  -18.682 -9.765  1.00  14.12 ? 1739 ILE A HB   1 
ATOM   4512 H  HG12 . ILE A 1 286 ? -3.926  -16.440 -9.814  1.00  16.11 ? 1739 ILE A HG12 1 
ATOM   4513 H  HG13 . ILE A 1 286 ? -3.858  -17.579 -10.919 1.00  16.11 ? 1739 ILE A HG13 1 
ATOM   4514 H  HG21 . ILE A 1 286 ? -5.119  -16.909 -7.656  1.00  16.09 ? 1739 ILE A HG21 1 
ATOM   4515 H  HG22 . ILE A 1 286 ? -6.435  -16.895 -8.517  1.00  16.09 ? 1739 ILE A HG22 1 
ATOM   4516 H  HG23 . ILE A 1 286 ? -6.116  -18.123 -7.588  1.00  16.09 ? 1739 ILE A HG23 1 
ATOM   4517 H  HD11 . ILE A 1 286 ? -6.080  -15.915 -10.499 1.00  16.66 ? 1739 ILE A HD11 1 
ATOM   4518 H  HD12 . ILE A 1 286 ? -5.081  -15.780 -11.706 1.00  16.66 ? 1739 ILE A HD12 1 
ATOM   4519 H  HD13 . ILE A 1 286 ? -6.013  -17.042 -11.593 1.00  16.66 ? 1739 ILE A HD13 1 
ATOM   4520 N  N    . PHE A 1 287 ? -4.980  -20.992 -7.934  1.00  12.12 ? 1740 PHE A N    1 
ATOM   4521 C  CA   . PHE A 1 287 ? -5.542  -21.870 -6.915  1.00  12.76 ? 1740 PHE A CA   1 
ATOM   4522 C  C    . PHE A 1 287 ? -4.684  -23.097 -6.618  1.00  12.51 ? 1740 PHE A C    1 
ATOM   4523 O  O    . PHE A 1 287 ? -5.060  -23.925 -5.787  1.00  14.86 ? 1740 PHE A O    1 
ATOM   4524 C  CB   . PHE A 1 287 ? -6.963  -22.273 -7.311  1.00  13.28 ? 1740 PHE A CB   1 
ATOM   4525 C  CG   . PHE A 1 287 ? -7.872  -21.105 -7.359  1.00  12.54 ? 1740 PHE A CG   1 
ATOM   4526 C  CD1  . PHE A 1 287 ? -8.494  -20.681 -6.210  1.00  14.07 ? 1740 PHE A CD1  1 
ATOM   4527 C  CD2  . PHE A 1 287 ? -8.042  -20.378 -8.526  1.00  13.11 ? 1740 PHE A CD2  1 
ATOM   4528 C  CE1  . PHE A 1 287 ? -9.302  -19.563 -6.217  1.00  15.34 ? 1740 PHE A CE1  1 
ATOM   4529 C  CE2  . PHE A 1 287 ? -8.853  -19.247 -8.540  1.00  13.51 ? 1740 PHE A CE2  1 
ATOM   4530 C  CZ   . PHE A 1 287 ? -9.479  -18.842 -7.386  1.00  14.69 ? 1740 PHE A CZ   1 
ATOM   4531 H  H    . PHE A 1 287 ? -5.087  -21.275 -8.739  1.00  14.54 ? 1740 PHE A H    1 
ATOM   4532 H  HA   . PHE A 1 287 ? -5.610  -21.360 -6.081  1.00  15.31 ? 1740 PHE A HA   1 
ATOM   4533 H  HB2  . PHE A 1 287 ? -6.946  -22.680 -8.192  1.00  15.93 ? 1740 PHE A HB2  1 
ATOM   4534 H  HB3  . PHE A 1 287 ? -7.310  -22.902 -6.659  1.00  15.93 ? 1740 PHE A HB3  1 
ATOM   4535 H  HD1  . PHE A 1 287 ? -8.371  -21.155 -5.419  1.00  16.89 ? 1740 PHE A HD1  1 
ATOM   4536 H  HD2  . PHE A 1 287 ? -7.609  -20.646 -9.305  1.00  15.73 ? 1740 PHE A HD2  1 
ATOM   4537 H  HE1  . PHE A 1 287 ? -9.729  -19.294 -5.436  1.00  18.40 ? 1740 PHE A HE1  1 
ATOM   4538 H  HE2  . PHE A 1 287 ? -8.975  -18.770 -9.329  1.00  16.21 ? 1740 PHE A HE2  1 
ATOM   4539 H  HZ   . PHE A 1 287 ? -10.035 -18.097 -7.394  1.00  17.63 ? 1740 PHE A HZ   1 
ATOM   4540 N  N    . HIS A 1 288 ? -3.533  -23.203 -7.287  1.00  12.71 ? 1741 HIS A N    1 
ATOM   4541 C  CA   . HIS A 1 288 ? -2.644  -24.360 -7.120  1.00  13.29 ? 1741 HIS A CA   1 
ATOM   4542 C  C    . HIS A 1 288 ? -3.408  -25.663 -7.304  1.00  12.55 ? 1741 HIS A C    1 
ATOM   4543 O  O    . HIS A 1 288 ? -3.349  -26.582 -6.490  1.00  14.70 ? 1741 HIS A O    1 
ATOM   4544 C  CB   . HIS A 1 288 ? -1.905  -24.298 -5.783  1.00  15.54 ? 1741 HIS A CB   1 
ATOM   4545 C  CG   . HIS A 1 288 ? -0.928  -23.166 -5.728  1.00  22.80 ? 1741 HIS A CG   1 
ATOM   4546 N  ND1  . HIS A 1 288 ? 0.254   -23.181 -6.444  1.00  26.28 ? 1741 HIS A ND1  1 
ATOM   4547 C  CD2  . HIS A 1 288 ? -0.979  -21.966 -5.111  1.00  25.43 ? 1741 HIS A CD2  1 
ATOM   4548 C  CE1  . HIS A 1 288 ? 0.896   -22.043 -6.247  1.00  28.38 ? 1741 HIS A CE1  1 
ATOM   4549 N  NE2  . HIS A 1 288 ? 0.171   -21.293 -5.434  1.00  28.20 ? 1741 HIS A NE2  1 
ATOM   4550 H  H    . HIS A 1 288 ? -3.243  -22.617 -7.846  1.00  15.25 ? 1741 HIS A H    1 
ATOM   4551 H  HA   . HIS A 1 288 ? -1.964  -24.325 -7.825  1.00  15.94 ? 1741 HIS A HA   1 
ATOM   4552 H  HB2  . HIS A 1 288 ? -2.549  -24.175 -5.068  1.00  18.65 ? 1741 HIS A HB2  1 
ATOM   4553 H  HB3  . HIS A 1 288 ? -1.415  -25.125 -5.651  1.00  18.65 ? 1741 HIS A HB3  1 
ATOM   4554 H  HD1  . HIS A 1 288 ? 0.529   -23.828 -6.938  1.00  31.54 ? 1741 HIS A HD1  1 
ATOM   4555 H  HD2  . HIS A 1 288 ? -1.660  -21.659 -4.556  1.00  30.52 ? 1741 HIS A HD2  1 
ATOM   4556 H  HE1  . HIS A 1 288 ? 1.723   -21.816 -6.605  1.00  34.06 ? 1741 HIS A HE1  1 
ATOM   4557 H  HE2  . HIS A 1 288 ? 0.384   -20.508 -5.156  1.00  33.84 ? 1741 HIS A HE2  1 
ATOM   4558 N  N    . LEU A 1 289 ? -4.144  -25.714 -8.402  1.00  12.83 ? 1742 LEU A N    1 
ATOM   4559 C  CA   . LEU A 1 289 ? -4.879  -26.917 -8.751  1.00  13.57 ? 1742 LEU A CA   1 
ATOM   4560 C  C    . LEU A 1 289 ? -3.983  -27.804 -9.601  1.00  14.93 ? 1742 LEU A C    1 
ATOM   4561 O  O    . LEU A 1 289 ? -3.247  -27.328 -10.459 1.00  16.20 ? 1742 LEU A O    1 
ATOM   4562 C  CB   . LEU A 1 289 ? -6.163  -26.550 -9.493  1.00  13.87 ? 1742 LEU A CB   1 
ATOM   4563 C  CG   . LEU A 1 289 ? -7.116  -25.684 -8.669  1.00  14.14 ? 1742 LEU A CG   1 
ATOM   4564 C  CD1  . LEU A 1 289 ? -8.206  -25.063 -9.538  1.00  15.31 ? 1742 LEU A CD1  1 
ATOM   4565 C  CD2  . LEU A 1 289 ? -7.749  -26.503 -7.542  1.00  14.77 ? 1742 LEU A CD2  1 
ATOM   4566 H  H    . LEU A 1 289 ? -4.235  -25.067 -8.961  1.00  15.39 ? 1742 LEU A H    1 
ATOM   4567 H  HA   . LEU A 1 289 ? -5.118  -27.405 -7.935  1.00  16.29 ? 1742 LEU A HA   1 
ATOM   4568 H  HB2  . LEU A 1 289 ? -5.931  -26.058 -10.295 1.00  16.65 ? 1742 LEU A HB2  1 
ATOM   4569 H  HB3  . LEU A 1 289 ? -6.631  -27.366 -9.730  1.00  16.65 ? 1742 LEU A HB3  1 
ATOM   4570 H  HG   . LEU A 1 289 ? -6.612  -24.962 -8.264  1.00  16.97 ? 1742 LEU A HG   1 
ATOM   4571 H  HD11 . LEU A 1 289 ? -8.712  -25.765 -9.954  1.00  18.37 ? 1742 LEU A HD11 1 
ATOM   4572 H  HD12 . LEU A 1 289 ? -8.781  -24.529 -8.984  1.00  18.37 ? 1742 LEU A HD12 1 
ATOM   4573 H  HD13 . LEU A 1 289 ? -7.795  -24.513 -10.209 1.00  18.37 ? 1742 LEU A HD13 1 
ATOM   4574 H  HD21 . LEU A 1 289 ? -7.054  -26.837 -6.971  1.00  17.72 ? 1742 LEU A HD21 1 
ATOM   4575 H  HD22 . LEU A 1 289 ? -8.342  -25.938 -7.041  1.00  17.72 ? 1742 LEU A HD22 1 
ATOM   4576 H  HD23 . LEU A 1 289 ? -8.239  -27.234 -7.925  1.00  17.72 ? 1742 LEU A HD23 1 
ATOM   4577 N  N    . PRO A 1 290 ? -4.024  -29.111 -9.349  1.00  14.39 ? 1743 PRO A N    1 
ATOM   4578 C  CA   . PRO A 1 290 ? -3.074  -30.023 -9.993  1.00  14.56 ? 1743 PRO A CA   1 
ATOM   4579 C  C    . PRO A 1 290 ? -3.487  -30.359 -11.414 1.00  14.62 ? 1743 PRO A C    1 
ATOM   4580 O  O    . PRO A 1 290 ? -4.674  -30.229 -11.749 1.00  15.33 ? 1743 PRO A O    1 
ATOM   4581 C  CB   . PRO A 1 290 ? -3.177  -31.280 -9.128  1.00  15.62 ? 1743 PRO A CB   1 
ATOM   4582 C  CG   . PRO A 1 290 ? -4.625  -31.271 -8.660  1.00  16.06 ? 1743 PRO A CG   1 
ATOM   4583 C  CD   . PRO A 1 290 ? -4.927  -29.796 -8.419  1.00  15.31 ? 1743 PRO A CD   1 
ATOM   4584 H  HA   . PRO A 1 290 ? -2.161  -29.666 -9.973  1.00  17.48 ? 1743 PRO A HA   1 
ATOM   4585 H  HB2  . PRO A 1 290 ? -2.989  -32.067 -9.662  1.00  18.75 ? 1743 PRO A HB2  1 
ATOM   4586 H  HB3  . PRO A 1 290 ? -2.568  -31.216 -8.375  1.00  18.75 ? 1743 PRO A HB3  1 
ATOM   4587 H  HG2  . PRO A 1 290 ? -5.199  -31.633 -9.353  1.00  19.28 ? 1743 PRO A HG2  1 
ATOM   4588 H  HG3  . PRO A 1 290 ? -4.710  -31.780 -7.838  1.00  19.28 ? 1743 PRO A HG3  1 
ATOM   4589 H  HD2  . PRO A 1 290 ? -5.851  -29.600 -8.638  1.00  18.37 ? 1743 PRO A HD2  1 
ATOM   4590 H  HD3  . PRO A 1 290 ? -4.718  -29.553 -7.504  1.00  18.37 ? 1743 PRO A HD3  1 
ATOM   4591 N  N    . PRO A 1 291 ? -2.535  -30.817 -12.237 1.00  14.48 ? 1744 PRO A N    1 
ATOM   4592 C  CA   . PRO A 1 291 ? -2.891  -31.364 -13.547 1.00  15.55 ? 1744 PRO A CA   1 
ATOM   4593 C  C    . PRO A 1 291 ? -3.792  -32.585 -13.418 1.00  16.03 ? 1744 PRO A C    1 
ATOM   4594 O  O    . PRO A 1 291 ? -3.773  -33.300 -12.406 1.00  16.91 ? 1744 PRO A O    1 
ATOM   4595 C  CB   . PRO A 1 291 ? -1.548  -31.804 -14.136 1.00  16.63 ? 1744 PRO A CB   1 
ATOM   4596 C  CG   . PRO A 1 291 ? -0.509  -31.071 -13.356 1.00  17.16 ? 1744 PRO A CG   1 
ATOM   4597 C  CD   . PRO A 1 291 ? -1.089  -30.870 -11.983 1.00  16.22 ? 1744 PRO A CD   1 
ATOM   4598 H  HA   . PRO A 1 291 ? -3.309  -30.686 -14.118 1.00  18.66 ? 1744 PRO A HA   1 
ATOM   4599 H  HB2  . PRO A 1 291 ? -1.443  -32.762 -14.029 1.00  19.95 ? 1744 PRO A HB2  1 
ATOM   4600 H  HB3  . PRO A 1 291 ? -1.507  -31.558 -15.074 1.00  19.95 ? 1744 PRO A HB3  1 
ATOM   4601 H  HG2  . PRO A 1 291 ? 0.299   -31.606 -13.309 1.00  20.59 ? 1744 PRO A HG2  1 
ATOM   4602 H  HG3  . PRO A 1 291 ? -0.328  -30.217 -13.778 1.00  20.59 ? 1744 PRO A HG3  1 
ATOM   4603 H  HD2  . PRO A 1 291 ? -0.873  -31.622 -11.410 1.00  19.47 ? 1744 PRO A HD2  1 
ATOM   4604 H  HD3  . PRO A 1 291 ? -0.780  -30.032 -11.604 1.00  19.47 ? 1744 PRO A HD3  1 
ATOM   4605 N  N    . GLN A 1 292 ? -4.575  -32.833 -14.458 1.00  15.53 ? 1745 GLN A N    1 
ATOM   4606 C  CA   . GLN A 1 292 ? -5.352  -34.061 -14.556 1.00  16.15 ? 1745 GLN A CA   1 
ATOM   4607 C  C    . GLN A 1 292 ? -4.710  -34.904 -15.642 1.00  17.63 ? 1745 GLN A C    1 
ATOM   4608 O  O    . GLN A 1 292 ? -4.655  -34.502 -16.798 1.00  18.18 ? 1745 GLN A O    1 
ATOM   4609 C  CB   . GLN A 1 292 ? -6.808  -33.735 -14.893 1.00  15.25 ? 1745 GLN A CB   1 
ATOM   4610 C  CG   . GLN A 1 292 ? -7.504  -32.937 -13.799 1.00  15.46 ? 1745 GLN A CG   1 
ATOM   4611 C  CD   . GLN A 1 292 ? -8.874  -32.464 -14.193 1.00  14.59 ? 1745 GLN A CD   1 
ATOM   4612 O  OE1  . GLN A 1 292 ? -9.014  -31.538 -14.988 1.00  16.01 ? 1745 GLN A OE1  1 
ATOM   4613 N  NE2  . GLN A 1 292 ? -9.901  -33.067 -13.607 1.00  14.22 ? 1745 GLN A NE2  1 
ATOM   4614 H  H    . GLN A 1 292 ? -4.675  -32.301 -15.127 1.00  18.64 ? 1745 GLN A H    1 
ATOM   4615 H  HA   . GLN A 1 292 ? -5.320  -34.550 -13.707 1.00  19.37 ? 1745 GLN A HA   1 
ATOM   4616 H  HB2  . GLN A 1 292 ? -6.834  -33.212 -15.709 1.00  18.31 ? 1745 GLN A HB2  1 
ATOM   4617 H  HB3  . GLN A 1 292 ? -7.297  -34.565 -15.015 1.00  18.31 ? 1745 GLN A HB3  1 
ATOM   4618 H  HG2  . GLN A 1 292 ? -7.596  -33.496 -13.011 1.00  18.55 ? 1745 GLN A HG2  1 
ATOM   4619 H  HG3  . GLN A 1 292 ? -6.968  -32.156 -13.589 1.00  18.55 ? 1745 GLN A HG3  1 
ATOM   4620 H  HE21 . GLN A 1 292 ? -9.762  -33.693 -13.035 1.00  17.06 ? 1745 GLN A HE21 1 
ATOM   4621 H  HE22 . GLN A 1 292 ? -10.705 -32.831 -13.800 1.00  17.06 ? 1745 GLN A HE22 1 
ATOM   4622 N  N    . GLU A 1 293 ? -4.185  -36.063 -15.265 1.00  18.72 ? 1746 GLU A N    1 
ATOM   4623 C  CA   . GLU A 1 293 ? -3.561  -36.951 -16.233 1.00  20.02 ? 1746 GLU A CA   1 
ATOM   4624 C  C    . GLU A 1 293 ? -4.572  -37.419 -17.266 1.00  18.42 ? 1746 GLU A C    1 
ATOM   4625 O  O    . GLU A 1 293 ? -5.743  -37.629 -16.954 1.00  18.42 ? 1746 GLU A O    1 
ATOM   4626 C  CB   . GLU A 1 293 ? -2.977  -38.179 -15.527 1.00  23.67 ? 1746 GLU A CB   1 
ATOM   4627 C  CG   . GLU A 1 293 ? -1.875  -37.876 -14.519 1.00  28.62 ? 1746 GLU A CG   1 
ATOM   4628 C  CD   . GLU A 1 293 ? -1.326  -39.147 -13.859 1.00  33.40 ? 1746 GLU A CD   1 
ATOM   4629 O  OE1  . GLU A 1 293 ? -1.558  -40.253 -14.393 1.00  37.98 ? 1746 GLU A OE1  1 
ATOM   4630 O  OE2  . GLU A 1 293 ? -0.660  -39.049 -12.802 1.00  33.92 ? 1746 GLU A OE2  1 
ATOM   4631 H  H    . GLU A 1 293 ? -4.178  -36.358 -14.458 1.00  22.46 ? 1746 GLU A H    1 
ATOM   4632 H  HA   . GLU A 1 293 ? -2.836  -36.479 -16.694 1.00  24.03 ? 1746 GLU A HA   1 
ATOM   4633 H  HB2  . GLU A 1 293 ? -3.692  -38.631 -15.052 1.00  28.40 ? 1746 GLU A HB2  1 
ATOM   4634 H  HB3  . GLU A 1 293 ? -2.606  -38.773 -16.198 1.00  28.40 ? 1746 GLU A HB3  1 
ATOM   4635 H  HG2  . GLU A 1 293 ? -1.142  -37.431 -14.974 1.00  34.34 ? 1746 GLU A HG2  1 
ATOM   4636 H  HG3  . GLU A 1 293 ? -2.231  -37.303 -13.822 1.00  34.34 ? 1746 GLU A HG3  1 
ATOM   4637 N  N    . ASP A 1 294 ? -4.096  -37.625 -18.488 1.00  19.18 ? 1747 ASP A N    1 
ATOM   4638 C  CA   A ASP A 1 294 ? -4.878  -38.234 -19.559 0.41  19.83 ? 1747 ASP A CA   1 
ATOM   4639 C  CA   B ASP A 1 294 ? -4.893  -38.269 -19.532 0.59  19.42 ? 1747 ASP A CA   1 
ATOM   4640 C  C    . ASP A 1 294 ? -6.269  -37.631 -19.637 1.00  18.84 ? 1747 ASP A C    1 
ATOM   4641 O  O    . ASP A 1 294 ? -7.290  -38.338 -19.633 1.00  19.67 ? 1747 ASP A O    1 
ATOM   4642 C  CB   A ASP A 1 294 ? -4.960  -39.753 -19.393 0.41  21.95 ? 1747 ASP A CB   1 
ATOM   4643 C  CB   B ASP A 1 294 ? -5.043  -39.775 -19.256 0.59  20.91 ? 1747 ASP A CB   1 
ATOM   4644 C  CG   A ASP A 1 294 ? -5.192  -40.455 -20.708 0.41  24.12 ? 1747 ASP A CG   1 
ATOM   4645 C  CG   B ASP A 1 294 ? -3.713  -40.488 -19.200 0.59  22.52 ? 1747 ASP A CG   1 
ATOM   4646 O  OD1  A ASP A 1 294 ? -5.242  -39.753 -21.744 0.41  25.23 ? 1747 ASP A OD1  1 
ATOM   4647 O  OD1  B ASP A 1 294 ? -2.914  -40.309 -20.138 0.59  23.04 ? 1747 ASP A OD1  1 
ATOM   4648 O  OD2  A ASP A 1 294 ? -5.326  -41.695 -20.715 0.41  24.91 ? 1747 ASP A OD2  1 
ATOM   4649 O  OD2  B ASP A 1 294 ? -3.458  -41.220 -18.217 0.59  23.49 ? 1747 ASP A OD2  1 
ATOM   4650 H  H    A ASP A 1 294 ? -3.298  -37.414 -18.729 0.41  23.01 ? 1747 ASP A H    1 
ATOM   4651 H  H    B ASP A 1 294 ? -3.306  -37.400 -18.743 0.59  23.01 ? 1747 ASP A H    1 
ATOM   4652 H  HA   A ASP A 1 294 ? -4.430  -38.054 -20.412 0.41  23.80 ? 1747 ASP A HA   1 
ATOM   4653 H  HA   B ASP A 1 294 ? -4.440  -38.161 -20.395 0.59  23.30 ? 1747 ASP A HA   1 
ATOM   4654 H  HB2  A ASP A 1 294 ? -4.126  -40.078 -19.020 0.41  26.34 ? 1747 ASP A HB2  1 
ATOM   4655 H  HB2  B ASP A 1 294 ? -5.486  -39.898 -18.402 0.59  25.10 ? 1747 ASP A HB2  1 
ATOM   4656 H  HB3  A ASP A 1 294 ? -5.698  -39.969 -18.801 0.41  26.34 ? 1747 ASP A HB3  1 
ATOM   4657 H  HB3  B ASP A 1 294 ? -5.570  -40.176 -19.964 0.59  25.10 ? 1747 ASP A HB3  1 
ATOM   4658 N  N    . THR A 1 295 ? -6.295  -36.302 -19.732 1.00  18.47 ? 1748 THR A N    1 
ATOM   4659 C  CA   . THR A 1 295 ? -7.536  -35.553 -19.682 1.00  17.59 ? 1748 THR A CA   1 
ATOM   4660 C  C    . THR A 1 295 ? -7.514  -34.512 -20.788 1.00  17.40 ? 1748 THR A C    1 
ATOM   4661 O  O    . THR A 1 295 ? -6.551  -33.741 -20.916 1.00  18.78 ? 1748 THR A O    1 
ATOM   4662 C  CB   . THR A 1 295 ? -7.694  -34.875 -18.298 1.00  16.50 ? 1748 THR A CB   1 
ATOM   4663 O  OG1  . THR A 1 295 ? -7.836  -35.888 -17.291 1.00  16.52 ? 1748 THR A OG1  1 
ATOM   4664 C  CG2  . THR A 1 295 ? -8.917  -33.955 -18.251 1.00  16.41 ? 1748 THR A CG2  1 
ATOM   4665 H  H    . THR A 1 295 ? -5.595  -35.811 -19.827 1.00  22.16 ? 1748 THR A H    1 
ATOM   4666 H  HA   . THR A 1 295 ? -8.294  -36.156 -19.829 1.00  21.11 ? 1748 THR A HA   1 
ATOM   4667 H  HB   . THR A 1 295 ? -6.905  -34.343 -18.109 1.00  19.80 ? 1748 THR A HB   1 
ATOM   4668 H  HG1  . THR A 1 295 ? -7.174  -36.371 -17.283 1.00  19.82 ? 1748 THR A HG1  1 
ATOM   4669 H  HG21 . THR A 1 295 ? -9.714  -34.461 -18.426 1.00  19.69 ? 1748 THR A HG21 1 
ATOM   4670 H  HG22 . THR A 1 295 ? -8.990  -33.550 -17.384 1.00  19.69 ? 1748 THR A HG22 1 
ATOM   4671 H  HG23 . THR A 1 295 ? -8.834  -33.264 -18.912 1.00  19.69 ? 1748 THR A HG23 1 
ATOM   4672 N  N    . TYR A 1 296 ? -8.569  -34.497 -21.594 1.00  17.21 ? 1749 TYR A N    1 
ATOM   4673 C  CA   . TYR A 1 296 ? -8.672  -33.515 -22.658 1.00  17.92 ? 1749 TYR A CA   1 
ATOM   4674 C  C    . TYR A 1 296 ? -10.100 -33.347 -23.152 1.00  16.89 ? 1749 TYR A C    1 
ATOM   4675 O  O    . TYR A 1 296 ? -10.988 -34.136 -22.833 1.00  18.25 ? 1749 TYR A O    1 
ATOM   4676 C  CB   . TYR A 1 296 ? -7.733  -33.840 -23.814 1.00  21.41 ? 1749 TYR A CB   1 
ATOM   4677 C  CG   . TYR A 1 296 ? -7.920  -35.211 -24.381 1.00  24.36 ? 1749 TYR A CG   1 
ATOM   4678 C  CD1  . TYR A 1 296 ? -7.248  -36.305 -23.847 1.00  26.02 ? 1749 TYR A CD1  1 
ATOM   4679 C  CD2  . TYR A 1 296 ? -8.768  -35.426 -25.456 1.00  26.27 ? 1749 TYR A CD2  1 
ATOM   4680 C  CE1  . TYR A 1 296 ? -7.411  -37.572 -24.370 1.00  27.71 ? 1749 TYR A CE1  1 
ATOM   4681 C  CE2  . TYR A 1 296 ? -8.933  -36.701 -25.995 1.00  28.12 ? 1749 TYR A CE2  1 
ATOM   4682 C  CZ   . TYR A 1 296 ? -8.256  -37.758 -25.444 1.00  28.77 ? 1749 TYR A CZ   1 
ATOM   4683 O  OH   . TYR A 1 296 ? -8.425  -38.999 -25.979 1.00  32.10 ? 1749 TYR A OH   1 
ATOM   4684 H  H    . TYR A 1 296 ? -9.232  -35.042 -21.545 1.00  20.66 ? 1749 TYR A H    1 
ATOM   4685 H  HA   . TYR A 1 296 ? -8.391  -32.648 -22.297 1.00  21.51 ? 1749 TYR A HA   1 
ATOM   4686 H  HB2  . TYR A 1 296 ? -7.884  -33.201 -24.528 1.00  25.69 ? 1749 TYR A HB2  1 
ATOM   4687 H  HB3  . TYR A 1 296 ? -6.817  -33.772 -23.501 1.00  25.69 ? 1749 TYR A HB3  1 
ATOM   4688 H  HD1  . TYR A 1 296 ? -9.223  -34.707 -25.831 1.00  31.52 ? 1749 TYR A HD1  1 
ATOM   4689 H  HD2  . TYR A 1 296 ? -6.675  -36.180 -23.125 1.00  31.22 ? 1749 TYR A HD2  1 
ATOM   4690 H  HE1  . TYR A 1 296 ? -9.503  -36.834 -26.718 1.00  33.74 ? 1749 TYR A HE1  1 
ATOM   4691 H  HE2  . TYR A 1 296 ? -6.952  -38.293 -24.004 1.00  33.25 ? 1749 TYR A HE2  1 
ATOM   4692 H  HH   . TYR A 1 296 ? -8.726  -39.511 -25.413 1.00  38.52 ? 1749 TYR A HH   1 
ATOM   4693 N  N    . VAL A 1 297 ? -10.301 -32.268 -23.905 1.00  17.03 ? 1750 VAL A N    1 
ATOM   4694 C  CA   . VAL A 1 297 ? -11.605 -31.891 -24.416 1.00  17.21 ? 1750 VAL A CA   1 
ATOM   4695 C  C    . VAL A 1 297 ? -11.494 -31.658 -25.910 1.00  18.46 ? 1750 VAL A C    1 
ATOM   4696 O  O    . VAL A 1 297 ? -10.636 -30.899 -26.347 1.00  20.03 ? 1750 VAL A O    1 
ATOM   4697 C  CB   . VAL A 1 297 ? -12.068 -30.580 -23.730 1.00  17.54 ? 1750 VAL A CB   1 
ATOM   4698 C  CG1  . VAL A 1 297 ? -13.420 -30.124 -24.262 1.00  18.84 ? 1750 VAL A CG1  1 
ATOM   4699 C  CG2  . VAL A 1 297 ? -12.108 -30.773 -22.227 1.00  17.79 ? 1750 VAL A CG2  1 
ATOM   4700 H  H    . VAL A 1 297 ? -9.674  -31.727 -24.138 1.00  20.43 ? 1750 VAL A H    1 
ATOM   4701 H  HA   . VAL A 1 297 ? -12.259 -32.599 -24.243 1.00  20.65 ? 1750 VAL A HA   1 
ATOM   4702 H  HB   . VAL A 1 297 ? -11.416 -29.874 -23.924 1.00  21.04 ? 1750 VAL A HB   1 
ATOM   4703 H  HG11 . VAL A 1 297 ? -14.070 -30.809 -24.090 1.00  22.60 ? 1750 VAL A HG11 1 
ATOM   4704 H  HG12 . VAL A 1 297 ? -13.674 -29.313 -23.816 1.00  22.60 ? 1750 VAL A HG12 1 
ATOM   4705 H  HG13 . VAL A 1 297 ? -13.348 -29.970 -25.207 1.00  22.60 ? 1750 VAL A HG13 1 
ATOM   4706 H  HG21 . VAL A 1 297 ? -11.229 -31.004 -21.918 1.00  21.35 ? 1750 VAL A HG21 1 
ATOM   4707 H  HG22 . VAL A 1 297 ? -12.396 -29.955 -21.815 1.00  21.35 ? 1750 VAL A HG22 1 
ATOM   4708 H  HG23 . VAL A 1 297 ? -12.725 -31.479 -22.019 1.00  21.35 ? 1750 VAL A HG23 1 
ATOM   4709 N  N    . GLU A 1 298 ? -12.353 -32.300 -26.694 1.00  18.32 ? 1751 GLU A N    1 
ATOM   4710 C  CA   . GLU A 1 298 ? -12.350 -32.115 -28.140 1.00  19.83 ? 1751 GLU A CA   1 
ATOM   4711 C  C    . GLU A 1 298 ? -13.542 -31.282 -28.539 1.00  19.86 ? 1751 GLU A C    1 
ATOM   4712 O  O    . GLU A 1 298 ? -14.674 -31.606 -28.195 1.00  20.29 ? 1751 GLU A O    1 
ATOM   4713 C  CB   . GLU A 1 298 ? -12.363 -33.463 -28.856 1.00  22.87 ? 1751 GLU A CB   1 
ATOM   4714 C  CG   . GLU A 1 298 ? -11.074 -34.226 -28.634 1.00  27.09 ? 1751 GLU A CG   1 
ATOM   4715 C  CD   . GLU A 1 298 ? -11.087 -35.641 -29.184 1.00  31.98 ? 1751 GLU A CD   1 
ATOM   4716 O  OE1  . GLU A 1 298 ? -12.176 -36.196 -29.441 1.00  33.80 ? 1751 GLU A OE1  1 
ATOM   4717 O  OE2  . GLU A 1 298 ? -9.990  -36.209 -29.345 1.00  33.67 ? 1751 GLU A OE2  1 
ATOM   4718 H  H    . GLU A 1 298 ? -12.950 -32.850 -26.411 1.00  21.98 ? 1751 GLU A H    1 
ATOM   4719 H  HA   . GLU A 1 298 ? -11.537 -31.634 -28.403 1.00  23.79 ? 1751 GLU A HA   1 
ATOM   4720 H  HB2  . GLU A 1 298 ? -13.095 -33.999 -28.515 1.00  27.44 ? 1751 GLU A HB2  1 
ATOM   4721 H  HB3  . GLU A 1 298 ? -12.469 -33.317 -29.809 1.00  27.44 ? 1751 GLU A HB3  1 
ATOM   4722 H  HG2  . GLU A 1 298 ? -10.350 -33.747 -29.068 1.00  32.51 ? 1751 GLU A HG2  1 
ATOM   4723 H  HG3  . GLU A 1 298 ? -10.905 -34.282 -27.681 1.00  32.51 ? 1751 GLU A HG3  1 
ATOM   4724 N  N    . VAL A 1 299 ? -13.272 -30.166 -29.214 1.00  19.88 ? 1752 VAL A N    1 
ATOM   4725 C  CA   . VAL A 1 299 ? -14.326 -29.252 -29.620 1.00  20.34 ? 1752 VAL A CA   1 
ATOM   4726 C  C    . VAL A 1 299 ? -14.360 -29.127 -31.131 1.00  21.18 ? 1752 VAL A C    1 
ATOM   4727 O  O    . VAL A 1 299 ? -13.342 -29.319 -31.816 1.00  21.31 ? 1752 VAL A O    1 
ATOM   4728 C  CB   . VAL A 1 299 ? -14.158 -27.844 -28.980 1.00  21.19 ? 1752 VAL A CB   1 
ATOM   4729 C  CG1  . VAL A 1 299 ? -14.196 -27.928 -27.474 1.00  20.58 ? 1752 VAL A CG1  1 
ATOM   4730 C  CG2  . VAL A 1 299 ? -12.863 -27.186 -29.415 1.00  21.93 ? 1752 VAL A CG2  1 
ATOM   4731 H  H    . VAL A 1 299 ? -12.482 -29.917 -29.447 1.00  23.86 ? 1752 VAL A H    1 
ATOM   4732 H  HA   . VAL A 1 299 ? -15.188 -29.614 -29.328 1.00  24.41 ? 1752 VAL A HA   1 
ATOM   4733 H  HB   . VAL A 1 299 ? -14.900 -27.272 -29.269 1.00  25.43 ? 1752 VAL A HB   1 
ATOM   4734 H  HG11 . VAL A 1 299 ? -13.481 -28.495 -27.175 1.00  24.70 ? 1752 VAL A HG11 1 
ATOM   4735 H  HG12 . VAL A 1 299 ? -14.090 -27.047 -27.109 1.00  24.70 ? 1752 VAL A HG12 1 
ATOM   4736 H  HG13 . VAL A 1 299 ? -15.040 -28.296 -27.203 1.00  24.70 ? 1752 VAL A HG13 1 
ATOM   4737 H  HG21 . VAL A 1 299 ? -12.866 -27.091 -30.370 1.00  26.32 ? 1752 VAL A HG21 1 
ATOM   4738 H  HG22 . VAL A 1 299 ? -12.797 -26.322 -29.000 1.00  26.32 ? 1752 VAL A HG22 1 
ATOM   4739 H  HG23 . VAL A 1 299 ? -12.126 -27.737 -29.142 1.00  26.32 ? 1752 VAL A HG23 1 
ATOM   4740 N  N    . ASP A 1 300 ? -15.553 -28.837 -31.635 1.00  22.11 ? 1753 ASP A N    1 
ATOM   4741 C  CA   . ASP A 1 300 ? -15.806 -28.645 -33.057 1.00  23.87 ? 1753 ASP A CA   1 
ATOM   4742 C  C    . ASP A 1 300 ? -16.092 -27.166 -33.225 1.00  23.36 ? 1753 ASP A C    1 
ATOM   4743 O  O    . ASP A 1 300 ? -17.096 -26.665 -32.714 1.00  23.84 ? 1753 ASP A O    1 
ATOM   4744 C  CB   . ASP A 1 300 ? -17.024 -29.479 -33.473 1.00  26.49 ? 1753 ASP A CB   1 
ATOM   4745 C  CG   . ASP A 1 300 ? -17.458 -29.232 -34.912 1.00  29.92 ? 1753 ASP A CG   1 
ATOM   4746 O  OD1  . ASP A 1 300 ? -16.854 -28.390 -35.608 1.00  30.85 ? 1753 ASP A OD1  1 
ATOM   4747 O  OD2  . ASP A 1 300 ? -18.420 -29.899 -35.353 1.00  32.33 ? 1753 ASP A OD2  1 
ATOM   4748 H  H    . ASP A 1 300 ? -16.259 -28.742 -31.153 1.00  26.53 ? 1753 ASP A H    1 
ATOM   4749 H  HA   . ASP A 1 300 ? -15.025 -28.900 -33.591 1.00  28.64 ? 1753 ASP A HA   1 
ATOM   4750 H  HB2  . ASP A 1 300 ? -16.806 -30.420 -33.384 1.00  31.79 ? 1753 ASP A HB2  1 
ATOM   4751 H  HB3  . ASP A 1 300 ? -17.770 -29.256 -32.894 1.00  31.79 ? 1753 ASP A HB3  1 
ATOM   4752 N  N    . LEU A 1 301 ? -15.218 -26.460 -33.925 1.00  23.84 ? 1754 LEU A N    1 
ATOM   4753 C  CA   . LEU A 1 301 ? -15.325 -25.012 -33.999 1.00  24.61 ? 1754 LEU A CA   1 
ATOM   4754 C  C    . LEU A 1 301 ? -16.232 -24.550 -35.126 1.00  26.02 ? 1754 LEU A C    1 
ATOM   4755 O  O    . LEU A 1 301 ? -16.511 -23.364 -35.236 1.00  28.49 ? 1754 LEU A O    1 
ATOM   4756 C  CB   . LEU A 1 301 ? -13.938 -24.375 -34.170 1.00  25.48 ? 1754 LEU A CB   1 
ATOM   4757 C  CG   . LEU A 1 301 ? -12.944 -24.622 -33.024 1.00  27.32 ? 1754 LEU A CG   1 
ATOM   4758 C  CD1  . LEU A 1 301 ? -11.641 -23.865 -33.242 1.00  29.78 ? 1754 LEU A CD1  1 
ATOM   4759 C  CD2  . LEU A 1 301 ? -13.561 -24.250 -31.687 1.00  27.71 ? 1754 LEU A CD2  1 
ATOM   4760 H  H    . LEU A 1 301 ? -14.557 -26.792 -34.364 1.00  28.61 ? 1754 LEU A H    1 
ATOM   4761 H  HA   . LEU A 1 301 ? -15.703 -24.682 -33.158 1.00  29.53 ? 1754 LEU A HA   1 
ATOM   4762 H  HB2  . LEU A 1 301 ? -13.538 -24.725 -34.981 1.00  30.57 ? 1754 LEU A HB2  1 
ATOM   4763 H  HB3  . LEU A 1 301 ? -14.051 -23.415 -34.254 1.00  30.57 ? 1754 LEU A HB3  1 
ATOM   4764 H  HG   . LEU A 1 301 ? -12.733 -25.568 -32.996 1.00  32.78 ? 1754 LEU A HG   1 
ATOM   4765 H  HD11 . LEU A 1 301 ? -11.830 -22.925 -33.289 1.00  35.74 ? 1754 LEU A HD11 1 
ATOM   4766 H  HD12 . LEU A 1 301 ? -11.049 -24.044 -32.508 1.00  35.74 ? 1754 LEU A HD12 1 
ATOM   4767 H  HD13 . LEU A 1 301 ? -11.243 -24.160 -34.064 1.00  35.74 ? 1754 LEU A HD13 1 
ATOM   4768 H  HD21 . LEU A 1 301 ? -14.344 -24.786 -31.545 1.00  33.26 ? 1754 LEU A HD21 1 
ATOM   4769 H  HD22 . LEU A 1 301 ? -12.920 -24.413 -30.991 1.00  33.26 ? 1754 LEU A HD22 1 
ATOM   4770 H  HD23 . LEU A 1 301 ? -13.799 -23.320 -31.701 1.00  33.26 ? 1754 LEU A HD23 1 
ATOM   4771 N  N    . GLU A 1 302 ? -16.711 -25.481 -35.943 1.00  26.28 ? 1755 GLU A N    1 
ATOM   4772 C  CA   . GLU A 1 302 ? -17.471 -25.125 -37.131 1.00  28.07 ? 1755 GLU A CA   1 
ATOM   4773 C  C    . GLU A 1 302 ? -18.969 -25.127 -36.891 1.00  29.03 ? 1755 GLU A C    1 
ATOM   4774 O  O    . GLU A 1 302 ? -19.714 -24.454 -37.595 1.00  30.79 ? 1755 GLU A O    1 
ATOM   4775 C  CB   . GLU A 1 302 ? -17.140 -26.082 -38.249 1.00  28.73 ? 1755 GLU A CB   1 
ATOM   4776 H  H    . GLU A 1 302 ? -16.610 -26.327 -35.830 1.00  31.54 ? 1755 GLU A H    1 
ATOM   4777 H  HA   . GLU A 1 302 ? -17.211 -24.224 -37.417 1.00  33.69 ? 1755 GLU A HA   1 
ATOM   4778 H  HB2  . GLU A 1 302 ? -17.645 -25.839 -39.028 1.00  34.48 ? 1755 GLU A HB2  1 
ATOM   4779 H  HB3  . GLU A 1 302 ? -16.200 -26.028 -38.437 1.00  34.48 ? 1755 GLU A HB3  1 
ATOM   4780 H  HB1  . GLU A 1 302 ? -17.368 -26.973 -37.974 1.00  34.48 ? 1755 GLU A HB1  1 
ATOM   4781 N  N    . HIS A 1 303 ? -19.410 -25.889 -35.900 1.00  28.64 ? 1756 HIS A N    1 
ATOM   4782 C  CA   . HIS A 1 303 ? -20.832 -26.157 -35.731 1.00  28.90 ? 1756 HIS A CA   1 
ATOM   4783 C  C    . HIS A 1 303 ? -21.622 -24.948 -35.217 1.00  26.67 ? 1756 HIS A C    1 
ATOM   4784 O  O    . HIS A 1 303 ? -21.414 -24.493 -34.092 1.00  26.08 ? 1756 HIS A O    1 
ATOM   4785 C  CB   . HIS A 1 303 ? -21.030 -27.337 -34.781 1.00  30.10 ? 1756 HIS A CB   1 
ATOM   4786 C  CG   . HIS A 1 303 ? -22.449 -27.783 -34.681 1.00  31.61 ? 1756 HIS A CG   1 
ATOM   4787 N  ND1  . HIS A 1 303 ? -23.201 -27.649 -33.533 1.00  32.25 ? 1756 HIS A ND1  1 
ATOM   4788 C  CD2  . HIS A 1 303 ? -23.268 -28.341 -35.602 1.00  31.90 ? 1756 HIS A CD2  1 
ATOM   4789 C  CE1  . HIS A 1 303 ? -24.418 -28.116 -33.750 1.00  32.04 ? 1756 HIS A CE1  1 
ATOM   4790 N  NE2  . HIS A 1 303 ? -24.485 -28.539 -34.998 1.00  32.75 ? 1756 HIS A NE2  1 
ATOM   4791 H  H    . HIS A 1 303 ? -18.907 -26.264 -35.312 1.00  34.37 ? 1756 HIS A H    1 
ATOM   4792 H  HA   . HIS A 1 303 ? -21.208 -26.409 -36.600 1.00  34.68 ? 1756 HIS A HA   1 
ATOM   4793 H  HB2  . HIS A 1 303 ? -20.503 -28.087 -35.098 1.00  36.11 ? 1756 HIS A HB2  1 
ATOM   4794 H  HB3  . HIS A 1 303 ? -20.735 -27.078 -33.894 1.00  36.11 ? 1756 HIS A HB3  1 
ATOM   4795 H  HD1  . HIS A 1 303 ? -22.920 -27.317 -32.791 1.00  38.70 ? 1756 HIS A HD1  1 
ATOM   4796 H  HD2  . HIS A 1 303 ? -23.047 -28.552 -36.481 1.00  38.29 ? 1756 HIS A HD2  1 
ATOM   4797 H  HE1  . HIS A 1 303 ? -25.110 -28.141 -33.129 1.00  38.44 ? 1756 HIS A HE1  1 
ATOM   4798 H  HE2  . HIS A 1 303 ? -25.177 -28.888 -35.371 1.00  39.30 ? 1756 HIS A HE2  1 
ATOM   4799 N  N    . GLU A 1 304 ? -22.551 -24.464 -36.040 1.00  26.04 ? 1757 GLU A N    1 
ATOM   4800 C  CA   . GLU A 1 304 ? -23.413 -23.343 -35.673 1.00  26.03 ? 1757 GLU A CA   1 
ATOM   4801 C  C    . GLU A 1 304 ? -24.723 -23.848 -35.096 1.00  24.65 ? 1757 GLU A C    1 
ATOM   4802 O  O    . GLU A 1 304 ? -25.375 -24.703 -35.687 1.00  26.10 ? 1757 GLU A O    1 
ATOM   4803 C  CB   . GLU A 1 304 ? -23.726 -22.497 -36.896 1.00  28.71 ? 1757 GLU A CB   1 
ATOM   4804 C  CG   . GLU A 1 304 ? -22.525 -21.891 -37.575 1.00  32.50 ? 1757 GLU A CG   1 
ATOM   4805 C  CD   . GLU A 1 304 ? -22.925 -21.093 -38.800 1.00  36.81 ? 1757 GLU A CD   1 
ATOM   4806 O  OE1  . GLU A 1 304 ? -23.420 -21.707 -39.768 1.00  38.62 ? 1757 GLU A OE1  1 
ATOM   4807 O  OE2  . GLU A 1 304 ? -22.764 -19.852 -38.785 1.00  39.32 ? 1757 GLU A OE2  1 
ATOM   4808 H  H    . GLU A 1 304 ? -22.703 -24.772 -36.828 1.00  31.25 ? 1757 GLU A H    1 
ATOM   4809 H  HA   . GLU A 1 304 ? -22.965 -22.783 -35.004 1.00  31.24 ? 1757 GLU A HA   1 
ATOM   4810 H  HB2  . GLU A 1 304 ? -24.181 -23.054 -37.548 1.00  34.45 ? 1757 GLU A HB2  1 
ATOM   4811 H  HB3  . GLU A 1 304 ? -24.308 -21.770 -36.627 1.00  34.45 ? 1757 GLU A HB3  1 
ATOM   4812 H  HG2  . GLU A 1 304 ? -22.075 -21.295 -36.957 1.00  39.00 ? 1757 GLU A HG2  1 
ATOM   4813 H  HG3  . GLU A 1 304 ? -21.925 -22.599 -37.857 1.00  39.00 ? 1757 GLU A HG3  1 
ATOM   4814 N  N    . TRP A 1 305 ? -25.111 -23.299 -33.951 1.00  23.29 ? 1758 TRP A N    1 
ATOM   4815 C  CA   . TRP A 1 305 ? -26.367 -23.663 -33.313 1.00  22.05 ? 1758 TRP A CA   1 
ATOM   4816 C  C    . TRP A 1 305 ? -26.921 -22.495 -32.510 1.00  21.54 ? 1758 TRP A C    1 
ATOM   4817 O  O    . TRP A 1 305 ? -26.226 -21.507 -32.279 1.00  22.58 ? 1758 TRP A O    1 
ATOM   4818 C  CB   . TRP A 1 305 ? -26.200 -24.912 -32.441 1.00  21.28 ? 1758 TRP A CB   1 
ATOM   4819 C  CG   . TRP A 1 305 ? -25.125 -24.871 -31.376 1.00  20.99 ? 1758 TRP A CG   1 
ATOM   4820 C  CD1  . TRP A 1 305 ? -23.769 -24.886 -31.572 1.00  21.21 ? 1758 TRP A CD1  1 
ATOM   4821 C  CD2  . TRP A 1 305 ? -25.320 -24.862 -29.955 1.00  20.06 ? 1758 TRP A CD2  1 
ATOM   4822 N  NE1  . TRP A 1 305 ? -23.114 -24.876 -30.361 1.00  21.41 ? 1758 TRP A NE1  1 
ATOM   4823 C  CE2  . TRP A 1 305 ? -24.044 -24.868 -29.355 1.00  20.39 ? 1758 TRP A CE2  1 
ATOM   4824 C  CE3  . TRP A 1 305 ? -26.450 -24.853 -29.131 1.00  20.82 ? 1758 TRP A CE3  1 
ATOM   4825 C  CZ2  . TRP A 1 305 ? -23.868 -24.848 -27.975 1.00  20.13 ? 1758 TRP A CZ2  1 
ATOM   4826 C  CZ3  . TRP A 1 305 ? -26.270 -24.836 -27.756 1.00  21.13 ? 1758 TRP A CZ3  1 
ATOM   4827 C  CH2  . TRP A 1 305 ? -24.985 -24.832 -27.194 1.00  21.36 ? 1758 TRP A CH2  1 
ATOM   4828 H  H    . TRP A 1 305 ? -24.659 -22.708 -33.520 1.00  27.95 ? 1758 TRP A H    1 
ATOM   4829 H  HA   . TRP A 1 305 ? -27.020 -23.877 -34.011 1.00  26.46 ? 1758 TRP A HA   1 
ATOM   4830 H  HB2  . TRP A 1 305 ? -27.042 -25.078 -31.989 1.00  25.53 ? 1758 TRP A HB2  1 
ATOM   4831 H  HB3  . TRP A 1 305 ? -25.996 -25.660 -33.023 1.00  25.53 ? 1758 TRP A HB3  1 
ATOM   4832 H  HD1  . TRP A 1 305 ? -23.351 -24.904 -32.402 1.00  25.45 ? 1758 TRP A HD1  1 
ATOM   4833 H  HE1  . TRP A 1 305 ? -22.260 -24.877 -30.253 1.00  25.69 ? 1758 TRP A HE1  1 
ATOM   4834 H  HE3  . TRP A 1 305 ? -27.305 -24.857 -29.497 1.00  24.98 ? 1758 TRP A HE3  1 
ATOM   4835 H  HZ2  . TRP A 1 305 ? -23.018 -24.842 -27.598 1.00  24.16 ? 1758 TRP A HZ2  1 
ATOM   4836 H  HZ3  . TRP A 1 305 ? -27.014 -24.829 -27.198 1.00  25.35 ? 1758 TRP A HZ3  1 
ATOM   4837 H  HH2  . TRP A 1 305 ? -24.894 -24.820 -26.268 1.00  25.63 ? 1758 TRP A HH2  1 
ATOM   4838 N  N    . THR A 1 306 ? -28.177 -22.612 -32.095 1.00  21.73 ? 1759 THR A N    1 
ATOM   4839 C  CA   . THR A 1 306 ? -28.840 -21.568 -31.334 1.00  21.23 ? 1759 THR A CA   1 
ATOM   4840 C  C    . THR A 1 306 ? -29.139 -22.115 -29.950 1.00  21.09 ? 1759 THR A C    1 
ATOM   4841 O  O    . THR A 1 306 ? -29.664 -23.217 -29.816 1.00  22.46 ? 1759 THR A O    1 
ATOM   4842 C  CB   . THR A 1 306 ? -30.137 -21.126 -32.031 1.00  22.91 ? 1759 THR A CB   1 
ATOM   4843 O  OG1  . THR A 1 306 ? -29.816 -20.611 -33.325 1.00  24.90 ? 1759 THR A OG1  1 
ATOM   4844 C  CG2  . THR A 1 306 ? -30.868 -20.063 -31.227 1.00  23.47 ? 1759 THR A CG2  1 
ATOM   4845 H  H    . THR A 1 306 ? -28.673 -23.298 -32.246 1.00  26.08 ? 1759 THR A H    1 
ATOM   4846 H  HA   . THR A 1 306 ? -28.247 -20.793 -31.247 1.00  25.48 ? 1759 THR A HA   1 
ATOM   4847 H  HB   . THR A 1 306 ? -30.725 -21.891 -32.128 1.00  27.50 ? 1759 THR A HB   1 
ATOM   4848 H  HG1  . THR A 1 306 ? -30.499 -20.371 -33.709 1.00  29.88 ? 1759 THR A HG1  1 
ATOM   4849 H  HG21 . THR A 1 306 ? -30.308 -19.290 -31.119 1.00  28.17 ? 1759 THR A HG21 1 
ATOM   4850 H  HG22 . THR A 1 306 ? -31.673 -19.803 -31.682 1.00  28.17 ? 1759 THR A HG22 1 
ATOM   4851 H  HG23 . THR A 1 306 ? -31.097 -20.406 -30.360 1.00  28.17 ? 1759 THR A HG23 1 
ATOM   4852 N  N    . ILE A 1 307 ? -28.777 -21.363 -28.919 1.00  19.88 ? 1760 ILE A N    1 
ATOM   4853 C  CA   A ILE A 1 307 ? -29.005 -21.827 -27.561 0.72  19.00 ? 1760 ILE A CA   1 
ATOM   4854 C  CA   B ILE A 1 307 ? -29.013 -21.795 -27.545 0.28  19.63 ? 1760 ILE A CA   1 
ATOM   4855 C  C    . ILE A 1 307 ? -30.508 -21.986 -27.325 1.00  20.05 ? 1760 ILE A C    1 
ATOM   4856 O  O    . ILE A 1 307 ? -31.290 -21.079 -27.604 1.00  21.01 ? 1760 ILE A O    1 
ATOM   4857 C  CB   A ILE A 1 307 ? -28.336 -20.899 -26.523 0.72  18.44 ? 1760 ILE A CB   1 
ATOM   4858 C  CB   B ILE A 1 307 ? -28.498 -20.764 -26.522 0.28  19.55 ? 1760 ILE A CB   1 
ATOM   4859 C  CG1  A ILE A 1 307 ? -26.820 -20.944 -26.735 0.72  19.20 ? 1760 ILE A CG1  1 
ATOM   4860 C  CG1  B ILE A 1 307 ? -27.025 -20.440 -26.777 0.28  20.03 ? 1760 ILE A CG1  1 
ATOM   4861 C  CG2  A ILE A 1 307 ? -28.698 -21.328 -25.110 0.72  19.01 ? 1760 ILE A CG2  1 
ATOM   4862 C  CG2  B ILE A 1 307 ? -28.694 -21.283 -25.104 0.28  19.71 ? 1760 ILE A CG2  1 
ATOM   4863 C  CD1  A ILE A 1 307 ? -26.039 -20.034 -25.815 0.72  18.62 ? 1760 ILE A CD1  1 
ATOM   4864 C  CD1  B ILE A 1 307 ? -26.102 -21.630 -26.649 0.28  19.71 ? 1760 ILE A CD1  1 
ATOM   4865 H  H    A ILE A 1 307 ? -28.403 -20.591 -28.978 0.72  23.86 ? 1760 ILE A H    1 
ATOM   4866 H  H    B ILE A 1 307 ? -28.392 -20.597 -28.986 0.28  23.86 ? 1760 ILE A H    1 
ATOM   4867 H  HA   A ILE A 1 307 ? -28.598 -22.713 -27.465 0.72  22.80 ? 1760 ILE A HA   1 
ATOM   4868 H  HA   B ILE A 1 307 ? -28.560 -22.650 -27.385 0.28  23.56 ? 1760 ILE A HA   1 
ATOM   4869 H  HB   A ILE A 1 307 ? -28.648 -19.991 -26.665 0.72  22.13 ? 1760 ILE A HB   1 
ATOM   4870 H  HB   B ILE A 1 307 ? -29.013 -19.948 -26.624 0.28  23.46 ? 1760 ILE A HB   1 
ATOM   4871 H  HG12 A ILE A 1 307 ? -26.512 -21.851 -26.585 0.72  23.04 ? 1760 ILE A HG12 1 
ATOM   4872 H  HG12 B ILE A 1 307 ? -26.934 -20.091 -27.677 0.28  24.03 ? 1760 ILE A HG12 1 
ATOM   4873 H  HG13 A ILE A 1 307 ? -26.626 -20.678 -27.647 0.72  23.04 ? 1760 ILE A HG13 1 
ATOM   4874 H  HG13 B ILE A 1 307 ? -26.737 -19.772 -26.135 0.28  24.03 ? 1760 ILE A HG13 1 
ATOM   4875 H  HG21 A ILE A 1 307 ? -28.394 -22.228 -24.970 0.72  22.81 ? 1760 ILE A HG21 1 
ATOM   4876 H  HG21 B ILE A 1 307 ? -28.205 -22.102 -25.002 0.28  23.65 ? 1760 ILE A HG21 1 
ATOM   4877 H  HG22 A ILE A 1 307 ? -28.271 -20.737 -24.486 0.72  22.81 ? 1760 ILE A HG22 1 
ATOM   4878 H  HG22 B ILE A 1 307 ? -28.368 -20.627 -24.484 0.28  23.65 ? 1760 ILE A HG22 1 
ATOM   4879 H  HG23 A ILE A 1 307 ? -29.651 -21.284 -25.005 0.72  22.81 ? 1760 ILE A HG23 1 
ATOM   4880 H  HG23 B ILE A 1 307 ? -29.630 -21.438 -24.955 0.28  23.65 ? 1760 ILE A HG23 1 
ATOM   4881 H  HD11 A ILE A 1 307 ? -26.209 -20.290 -24.905 0.72  22.34 ? 1760 ILE A HD11 1 
ATOM   4882 H  HD11 B ILE A 1 307 ? -26.364 -22.298 -27.287 0.28  23.65 ? 1760 ILE A HD11 1 
ATOM   4883 H  HD12 A ILE A 1 307 ? -25.104 -20.121 -26.011 0.72  22.34 ? 1760 ILE A HD12 1 
ATOM   4884 H  HD12 B ILE A 1 307 ? -25.201 -21.346 -26.823 0.28  23.65 ? 1760 ILE A HD12 1 
ATOM   4885 H  HD13 A ILE A 1 307 ? -26.322 -19.128 -25.958 0.72  22.34 ? 1760 ILE A HD13 1 
ATOM   4886 H  HD13 B ILE A 1 307 ? -26.169 -21.983 -25.759 0.28  23.65 ? 1760 ILE A HD13 1 
ATOM   4887 N  N    . PRO A 1 308 ? -30.917 -23.164 -26.837 1.00  20.79 ? 1761 PRO A N    1 
ATOM   4888 C  CA   . PRO A 1 308 ? -32.338 -23.454 -26.617 1.00  21.77 ? 1761 PRO A CA   1 
ATOM   4889 C  C    . PRO A 1 308 ? -32.840 -22.911 -25.283 1.00  20.81 ? 1761 PRO A C    1 
ATOM   4890 O  O    . PRO A 1 308 ? -32.092 -22.241 -24.574 1.00  21.66 ? 1761 PRO A O    1 
ATOM   4891 C  CB   . PRO A 1 308 ? -32.371 -24.985 -26.628 1.00  22.06 ? 1761 PRO A CB   1 
ATOM   4892 C  CG   . PRO A 1 308 ? -31.043 -25.373 -26.092 1.00  22.04 ? 1761 PRO A CG   1 
ATOM   4893 C  CD   . PRO A 1 308 ? -30.078 -24.363 -26.647 1.00  21.73 ? 1761 PRO A CD   1 
ATOM   4894 H  HA   . PRO A 1 308 ? -32.885 -23.103 -27.350 1.00  26.12 ? 1761 PRO A HA   1 
ATOM   4895 H  HB2  . PRO A 1 308 ? -33.084 -25.304 -26.054 1.00  26.47 ? 1761 PRO A HB2  1 
ATOM   4896 H  HB3  . PRO A 1 308 ? -32.485 -25.306 -27.536 1.00  26.47 ? 1761 PRO A HB3  1 
ATOM   4897 H  HG2  . PRO A 1 308 ? -31.059 -25.334 -25.123 1.00  26.45 ? 1761 PRO A HG2  1 
ATOM   4898 H  HG3  . PRO A 1 308 ? -30.817 -26.266 -26.396 1.00  26.45 ? 1761 PRO A HG3  1 
ATOM   4899 H  HD2  . PRO A 1 308 ? -29.370 -24.184 -26.009 1.00  26.07 ? 1761 PRO A HD2  1 
ATOM   4900 H  HD3  . PRO A 1 308 ? -29.723 -24.666 -27.498 1.00  26.07 ? 1761 PRO A HD3  1 
ATOM   4901 N  N    . SER A 1 309 ? -34.100 -23.189 -24.950 1.00  21.02 ? 1762 SER A N    1 
ATOM   4902 C  CA   . SER A 1 309 ? -34.698 -22.633 -23.742 1.00  21.12 ? 1762 SER A CA   1 
ATOM   4903 C  C    . SER A 1 309 ? -34.146 -23.286 -22.475 1.00  20.92 ? 1762 SER A C    1 
ATOM   4904 O  O    . SER A 1 309 ? -34.215 -22.696 -21.399 1.00  21.33 ? 1762 SER A O    1 
ATOM   4905 C  CB   . SER A 1 309 ? -36.223 -22.743 -23.793 1.00  23.29 ? 1762 SER A CB   1 
ATOM   4906 O  OG   . SER A 1 309 ? -36.625 -24.089 -23.940 1.00  25.59 ? 1762 SER A OG   1 
ATOM   4907 H  H    . SER A 1 309 ? -34.626 -23.694 -25.406 1.00  25.22 ? 1762 SER A H    1 
ATOM   4908 H  HA   . SER A 1 309 ? -34.475 -21.680 -23.699 1.00  25.34 ? 1762 SER A HA   1 
ATOM   4909 H  HB2  . SER A 1 309 ? -36.593 -22.392 -22.968 1.00  27.95 ? 1762 SER A HB2  1 
ATOM   4910 H  HB3  . SER A 1 309 ? -36.552 -22.232 -24.549 1.00  27.95 ? 1762 SER A HB3  1 
ATOM   4911 H  HG   . SER A 1 309 ? -37.443 -24.136 -23.966 1.00  30.71 ? 1762 SER A HG   1 
ATOM   4912 N  N    . HIS A 1 310 ? -33.572 -24.481 -22.597 1.00  20.70 ? 1763 HIS A N    1 
ATOM   4913 C  CA   . HIS A 1 310 ? -32.812 -25.062 -21.497 1.00  21.05 ? 1763 HIS A CA   1 
ATOM   4914 C  C    . HIS A 1 310 ? -31.736 -25.986 -22.044 1.00  20.96 ? 1763 HIS A C    1 
ATOM   4915 O  O    . HIS A 1 310 ? -31.932 -26.627 -23.078 1.00  22.48 ? 1763 HIS A O    1 
ATOM   4916 C  CB   . HIS A 1 310 ? -33.709 -25.810 -20.504 1.00  22.55 ? 1763 HIS A CB   1 
ATOM   4917 C  CG   . HIS A 1 310 ? -34.311 -27.071 -21.045 1.00  25.39 ? 1763 HIS A CG   1 
ATOM   4918 N  ND1  . HIS A 1 310 ? -35.527 -27.098 -21.692 1.00  25.91 ? 1763 HIS A ND1  1 
ATOM   4919 C  CD2  . HIS A 1 310 ? -33.876 -28.353 -21.009 1.00  26.63 ? 1763 HIS A CD2  1 
ATOM   4920 C  CE1  . HIS A 1 310 ? -35.809 -28.339 -22.047 1.00  26.45 ? 1763 HIS A CE1  1 
ATOM   4921 N  NE2  . HIS A 1 310 ? -34.821 -29.120 -21.644 1.00  27.56 ? 1763 HIS A NE2  1 
ATOM   4922 H  H    . HIS A 1 310 ? -33.607 -24.972 -23.302 1.00  24.84 ? 1763 HIS A H    1 
ATOM   4923 H  HA   . HIS A 1 310 ? -32.365 -24.340 -21.008 1.00  25.26 ? 1763 HIS A HA   1 
ATOM   4924 H  HB2  . HIS A 1 310 ? -33.181 -26.046 -19.725 1.00  27.06 ? 1763 HIS A HB2  1 
ATOM   4925 H  HB3  . HIS A 1 310 ? -34.437 -25.225 -20.240 1.00  27.06 ? 1763 HIS A HB3  1 
ATOM   4926 H  HD1  . HIS A 1 310 ? -36.021 -26.412 -21.848 1.00  31.10 ? 1763 HIS A HD1  1 
ATOM   4927 H  HD2  . HIS A 1 310 ? -33.081 -28.656 -20.633 1.00  31.96 ? 1763 HIS A HD2  1 
ATOM   4928 H  HE1  . HIS A 1 310 ? -36.572 -28.615 -22.502 1.00  31.74 ? 1763 HIS A HE1  1 
ATOM   4929 H  HE2  . HIS A 1 310 ? -34.779 -29.971 -21.759 1.00  33.07 ? 1763 HIS A HE2  1 
ATOM   4930 N  N    . MET A 1 311 ? -30.594 -26.042 -21.364 1.00  19.93 ? 1764 MET A N    1 
ATOM   4931 C  CA   . MET A 1 311 ? -29.549 -26.991 -21.730 1.00  19.95 ? 1764 MET A CA   1 
ATOM   4932 C  C    . MET A 1 311 ? -29.885 -28.348 -21.115 1.00  20.59 ? 1764 MET A C    1 
ATOM   4933 O  O    . MET A 1 311 ? -30.671 -28.436 -20.187 1.00  21.37 ? 1764 MET A O    1 
ATOM   4934 C  CB   . MET A 1 311 ? -28.186 -26.478 -21.259 1.00  20.25 ? 1764 MET A CB   1 
ATOM   4935 C  CG   . MET A 1 311 ? -27.804 -25.155 -21.891 1.00  22.34 ? 1764 MET A CG   1 
ATOM   4936 S  SD   . MET A 1 311 ? -27.756 -25.191 -23.698 1.00  25.41 ? 1764 MET A SD   1 
ATOM   4937 C  CE   . MET A 1 311 ? -26.267 -26.143 -23.980 1.00  25.36 ? 1764 MET A CE   1 
ATOM   4938 H  H    . MET A 1 311 ? -30.401 -25.544 -20.690 1.00  23.92 ? 1764 MET A H    1 
ATOM   4939 H  HA   . MET A 1 311 ? -29.521 -27.079 -22.706 1.00  23.94 ? 1764 MET A HA   1 
ATOM   4940 H  HB2  . MET A 1 311 ? -28.211 -26.355 -20.297 1.00  24.31 ? 1764 MET A HB2  1 
ATOM   4941 H  HB3  . MET A 1 311 ? -27.506 -27.129 -21.492 1.00  24.31 ? 1764 MET A HB3  1 
ATOM   4942 H  HG2  . MET A 1 311 ? -28.452 -24.484 -21.625 1.00  26.81 ? 1764 MET A HG2  1 
ATOM   4943 H  HG3  . MET A 1 311 ? -26.922 -24.903 -21.576 1.00  26.81 ? 1764 MET A HG3  1 
ATOM   4944 H  HE1  . MET A 1 311 ? -26.371 -27.010 -23.580 1.00  30.43 ? 1764 MET A HE1  1 
ATOM   4945 H  HE2  . MET A 1 311 ? -26.130 -26.234 -24.926 1.00  30.43 ? 1764 MET A HE2  1 
ATOM   4946 H  HE3  . MET A 1 311 ? -25.523 -25.685 -23.583 1.00  30.43 ? 1764 MET A HE3  1 
ATOM   4947 N  N    . PRO A 1 312 ? -29.298 -29.422 -21.648 1.00  21.26 ? 1765 PRO A N    1 
ATOM   4948 C  CA   . PRO A 1 312 ? -29.723 -30.767 -21.245 1.00  22.01 ? 1765 PRO A CA   1 
ATOM   4949 C  C    . PRO A 1 312 ? -29.503 -31.165 -19.783 1.00  20.74 ? 1765 PRO A C    1 
ATOM   4950 O  O    . PRO A 1 312 ? -30.309 -31.963 -19.290 1.00  23.33 ? 1765 PRO A O    1 
ATOM   4951 C  CB   . PRO A 1 312 ? -28.903 -31.681 -22.165 1.00  23.44 ? 1765 PRO A CB   1 
ATOM   4952 C  CG   . PRO A 1 312 ? -28.542 -30.833 -23.336 1.00  23.90 ? 1765 PRO A CG   1 
ATOM   4953 C  CD   . PRO A 1 312 ? -28.429 -29.435 -22.837 1.00  22.60 ? 1765 PRO A CD   1 
ATOM   4954 H  HA   . PRO A 1 312 ? -30.672 -30.885 -21.457 1.00  26.42 ? 1765 PRO A HA   1 
ATOM   4955 H  HB2  . PRO A 1 312 ? -28.107 -31.982 -21.701 1.00  28.13 ? 1765 PRO A HB2  1 
ATOM   4956 H  HB3  . PRO A 1 312 ? -29.445 -32.436 -22.443 1.00  28.13 ? 1765 PRO A HB3  1 
ATOM   4957 H  HG2  . PRO A 1 312 ? -27.695 -31.132 -23.700 1.00  28.68 ? 1765 PRO A HG2  1 
ATOM   4958 H  HG3  . PRO A 1 312 ? -29.240 -30.897 -24.007 1.00  28.68 ? 1765 PRO A HG3  1 
ATOM   4959 H  HD2  . PRO A 1 312 ? -27.513 -29.239 -22.588 1.00  27.12 ? 1765 PRO A HD2  1 
ATOM   4960 H  HD3  . PRO A 1 312 ? -28.758 -28.812 -23.503 1.00  27.12 ? 1765 PRO A HD3  1 
ATOM   4961 N  N    . PHE A 1 313 ? -28.478 -30.650 -19.101 1.00  20.07 ? 1766 PHE A N    1 
ATOM   4962 C  CA   . PHE A 1 313 ? -28.057 -31.266 -17.841 1.00  18.81 ? 1766 PHE A CA   1 
ATOM   4963 C  C    . PHE A 1 313 ? -28.401 -30.523 -16.552 1.00  18.51 ? 1766 PHE A C    1 
ATOM   4964 O  O    . PHE A 1 313 ? -28.854 -31.128 -15.598 1.00  21.38 ? 1766 PHE A O    1 
ATOM   4965 C  CB   . PHE A 1 313 ? -26.565 -31.614 -17.893 1.00  19.02 ? 1766 PHE A CB   1 
ATOM   4966 C  CG   . PHE A 1 313 ? -26.272 -32.701 -18.871 1.00  20.50 ? 1766 PHE A CG   1 
ATOM   4967 C  CD1  . PHE A 1 313 ? -26.624 -34.014 -18.584 1.00  21.54 ? 1766 PHE A CD1  1 
ATOM   4968 C  CD2  . PHE A 1 313 ? -25.733 -32.414 -20.108 1.00  21.68 ? 1766 PHE A CD2  1 
ATOM   4969 C  CE1  . PHE A 1 313 ? -26.388 -35.028 -19.495 1.00  22.67 ? 1766 PHE A CE1  1 
ATOM   4970 C  CE2  . PHE A 1 313 ? -25.511 -33.419 -21.026 1.00  22.96 ? 1766 PHE A CE2  1 
ATOM   4971 C  CZ   . PHE A 1 313 ? -25.841 -34.730 -20.720 1.00  22.95 ? 1766 PHE A CZ   1 
ATOM   4972 H  H    . PHE A 1 313 ? -28.020 -29.963 -19.339 1.00  24.08 ? 1766 PHE A H    1 
ATOM   4973 H  HA   . PHE A 1 313 ? -28.528 -32.124 -17.780 1.00  22.57 ? 1766 PHE A HA   1 
ATOM   4974 H  HB2  . PHE A 1 313 ? -26.064 -30.827 -18.159 1.00  22.83 ? 1766 PHE A HB2  1 
ATOM   4975 H  HB3  . PHE A 1 313 ? -26.277 -31.912 -17.016 1.00  22.83 ? 1766 PHE A HB3  1 
ATOM   4976 H  HD1  . PHE A 1 313 ? -26.998 -34.218 -17.757 1.00  25.85 ? 1766 PHE A HD1  1 
ATOM   4977 H  HD2  . PHE A 1 313 ? -25.512 -31.536 -20.323 1.00  26.02 ? 1766 PHE A HD2  1 
ATOM   4978 H  HE1  . PHE A 1 313 ? -26.615 -35.906 -19.287 1.00  27.21 ? 1766 PHE A HE1  1 
ATOM   4979 H  HE2  . PHE A 1 313 ? -25.131 -33.218 -21.850 1.00  27.55 ? 1766 PHE A HE2  1 
ATOM   4980 H  HZ   . PHE A 1 313 ? -25.679 -35.408 -21.336 1.00  27.54 ? 1766 PHE A HZ   1 
ATOM   4981 N  N    . SER A 1 314 ? -28.183 -29.221 -16.488 1.00  17.21 ? 1767 SER A N    1 
ATOM   4982 C  CA   A SER A 1 314 ? -28.437 -28.522 -15.236 0.02  16.69 ? 1767 SER A CA   1 
ATOM   4983 C  CA   B SER A 1 314 ? -28.456 -28.491 -15.253 0.98  16.93 ? 1767 SER A CA   1 
ATOM   4984 C  C    . SER A 1 314 ? -29.917 -28.604 -14.865 1.00  16.57 ? 1767 SER A C    1 
ATOM   4985 O  O    . SER A 1 314 ? -30.807 -28.435 -15.712 1.00  17.47 ? 1767 SER A O    1 
ATOM   4986 C  CB   A SER A 1 314 ? -27.960 -27.068 -15.302 0.02  16.49 ? 1767 SER A CB   1 
ATOM   4987 C  CB   B SER A 1 314 ? -28.118 -27.016 -15.405 0.98  16.01 ? 1767 SER A CB   1 
ATOM   4988 O  OG   A SER A 1 314 ? -28.607 -26.352 -16.338 0.02  16.45 ? 1767 SER A OG   1 
ATOM   4989 O  OG   B SER A 1 314 ? -28.487 -26.311 -14.232 0.98  17.05 ? 1767 SER A OG   1 
ATOM   4990 H  H    A SER A 1 314 ? -27.897 -28.728 -17.132 0.02  20.65 ? 1767 SER A H    1 
ATOM   4991 H  H    B SER A 1 314 ? -27.881 -28.738 -17.132 0.98  20.65 ? 1767 SER A H    1 
ATOM   4992 H  HA   A SER A 1 314 ? -27.930 -28.966 -14.525 0.02  20.02 ? 1767 SER A HA   1 
ATOM   4993 H  HA   B SER A 1 314 ? -27.913 -28.861 -14.527 0.98  20.32 ? 1767 SER A HA   1 
ATOM   4994 H  HB2  A SER A 1 314 ? -28.152 -26.637 -14.455 0.02  19.79 ? 1767 SER A HB2  1 
ATOM   4995 H  HB2  B SER A 1 314 ? -27.163 -26.921 -15.546 0.98  19.21 ? 1767 SER A HB2  1 
ATOM   4996 H  HB3  A SER A 1 314 ? -27.004 -27.060 -15.466 0.02  19.79 ? 1767 SER A HB3  1 
ATOM   4997 H  HB3  B SER A 1 314 ? -28.606 -26.654 -16.161 0.98  19.21 ? 1767 SER A HB3  1 
ATOM   4998 H  HG   A SER A 1 314 ? -29.134 -26.842 -16.731 0.02  19.74 ? 1767 SER A HG   1 
ATOM   4999 H  HG   B SER A 1 314 ? -28.816 -26.828 -13.686 0.98  20.46 ? 1767 SER A HG   1 
ATOM   5000 N  N    . LYS A 1 315 ? -30.178 -28.867 -13.587 1.00  16.98 ? 1768 LYS A N    1 
ATOM   5001 C  CA   . LYS A 1 315 ? -31.547 -28.940 -13.095 1.00  18.07 ? 1768 LYS A CA   1 
ATOM   5002 C  C    . LYS A 1 315 ? -32.229 -27.578 -13.112 1.00  17.82 ? 1768 LYS A C    1 
ATOM   5003 O  O    . LYS A 1 315 ? -33.440 -27.485 -12.917 1.00  19.65 ? 1768 LYS A O    1 
ATOM   5004 C  CB   . LYS A 1 315 ? -31.600 -29.510 -11.672 1.00  19.71 ? 1768 LYS A CB   1 
ATOM   5005 C  CG   . LYS A 1 315 ? -31.154 -30.938 -11.522 1.00  21.63 ? 1768 LYS A CG   1 
ATOM   5006 C  CD   . LYS A 1 315 ? -31.457 -31.433 -10.096 1.00  24.70 ? 1768 LYS A CD   1 
ATOM   5007 C  CE   . LYS A 1 315 ? -30.742 -32.713 -9.724  1.00  26.88 ? 1768 LYS A CE   1 
ATOM   5008 N  NZ   . LYS A 1 315 ? -31.261 -33.244 -8.427  1.00  28.68 ? 1768 LYS A NZ   1 
ATOM   5009 H  H    . LYS A 1 315 ? -29.579 -29.007 -12.985 1.00  20.37 ? 1768 LYS A H    1 
ATOM   5010 H  HA   . LYS A 1 315 ? -32.059 -29.539 -13.677 1.00  21.68 ? 1768 LYS A HA   1 
ATOM   5011 H  HB2  . LYS A 1 315 ? -31.031 -28.968 -11.104 1.00  23.65 ? 1768 LYS A HB2  1 
ATOM   5012 H  HB3  . LYS A 1 315 ? -32.515 -29.458 -11.355 1.00  23.65 ? 1768 LYS A HB3  1 
ATOM   5013 H  HG2  . LYS A 1 315 ? -31.636 -31.496 -12.152 1.00  25.96 ? 1768 LYS A HG2  1 
ATOM   5014 H  HG3  . LYS A 1 315 ? -30.198 -30.997 -11.674 1.00  25.96 ? 1768 LYS A HG3  1 
ATOM   5015 H  HD2  . LYS A 1 315 ? -31.186 -30.748 -9.464  1.00  29.64 ? 1768 LYS A HD2  1 
ATOM   5016 H  HD3  . LYS A 1 315 ? -32.411 -31.593 -10.017 1.00  29.64 ? 1768 LYS A HD3  1 
ATOM   5017 H  HE2  . LYS A 1 315 ? -30.894 -33.379 -10.412 1.00  32.26 ? 1768 LYS A HE2  1 
ATOM   5018 H  HE3  . LYS A 1 315 ? -29.793 -32.536 -9.627  1.00  32.26 ? 1768 LYS A HE3  1 
ATOM   5019 H  HZ1  . LYS A 1 315 ? -32.132 -33.413 -8.495  1.00  34.41 ? 1768 LYS A HZ1  1 
ATOM   5020 H  HZ2  . LYS A 1 315 ? -30.835 -33.996 -8.216  1.00  34.41 ? 1768 LYS A HZ2  1 
ATOM   5021 H  HZ3  . LYS A 1 315 ? -31.131 -32.646 -7.781  1.00  34.41 ? 1768 LYS A HZ3  1 
ATOM   5022 N  N    . ALA A 1 316 ? -31.479 -26.510 -13.366 1.00  17.28 ? 1769 ALA A N    1 
ATOM   5023 C  CA   . ALA A 1 316 ? -32.095 -25.189 -13.451 1.00  16.88 ? 1769 ALA A CA   1 
ATOM   5024 C  C    . ALA A 1 316 ? -33.167 -25.192 -14.527 1.00  18.03 ? 1769 ALA A C    1 
ATOM   5025 O  O    . ALA A 1 316 ? -34.214 -24.556 -14.378 1.00  18.06 ? 1769 ALA A O    1 
ATOM   5026 C  CB   . ALA A 1 316 ? -31.045 -24.140 -13.765 1.00  16.28 ? 1769 ALA A CB   1 
ATOM   5027 H  H    . ALA A 1 316 ? -30.629 -26.520 -13.492 1.00  20.73 ? 1769 ALA A H    1 
ATOM   5028 H  HA   . ALA A 1 316 ? -32.514 -24.965 -12.594 1.00  20.26 ? 1769 ALA A HA   1 
ATOM   5029 H  HB1  . ALA A 1 316 ? -30.632 -24.353 -14.605 1.00  19.54 ? 1769 ALA A HB1  1 
ATOM   5030 H  HB2  . ALA A 1 316 ? -31.468 -23.280 -13.816 1.00  19.54 ? 1769 ALA A HB2  1 
ATOM   5031 H  HB3  . ALA A 1 316 ? -30.386 -24.139 -13.066 1.00  19.54 ? 1769 ALA A HB3  1 
ATOM   5032 N  N    . HIS A 1 317 ? -32.900 -25.911 -15.612 1.00  18.63 ? 1770 HIS A N    1 
ATOM   5033 C  CA   . HIS A 1 317 ? -33.887 -26.101 -16.674 1.00  18.88 ? 1770 HIS A CA   1 
ATOM   5034 C  C    . HIS A 1 317 ? -34.331 -24.778 -17.298 1.00  18.23 ? 1770 HIS A C    1 
ATOM   5035 O  O    . HIS A 1 317 ? -35.467 -24.637 -17.725 1.00  19.89 ? 1770 HIS A O    1 
ATOM   5036 C  CB   . HIS A 1 317 ? -35.104 -26.875 -16.156 1.00  20.79 ? 1770 HIS A CB   1 
ATOM   5037 C  CG   . HIS A 1 317 ? -35.821 -27.643 -17.219 1.00  24.61 ? 1770 HIS A CG   1 
ATOM   5038 N  ND1  . HIS A 1 317 ? -35.364 -28.847 -17.710 1.00  27.05 ? 1770 HIS A ND1  1 
ATOM   5039 C  CD2  . HIS A 1 317 ? -36.943 -27.354 -17.914 1.00  25.44 ? 1770 HIS A CD2  1 
ATOM   5040 C  CE1  . HIS A 1 317 ? -36.196 -29.285 -18.641 1.00  27.86 ? 1770 HIS A CE1  1 
ATOM   5041 N  NE2  . HIS A 1 317 ? -37.160 -28.394 -18.788 1.00  27.98 ? 1770 HIS A NE2  1 
ATOM   5042 H  H    . HIS A 1 317 ? -32.149 -26.303 -15.759 1.00  22.36 ? 1770 HIS A H    1 
ATOM   5043 H  HA   . HIS A 1 317 ? -33.478 -26.638 -17.385 1.00  22.65 ? 1770 HIS A HA   1 
ATOM   5044 H  HB2  . HIS A 1 317 ? -34.810 -27.505 -15.481 1.00  24.95 ? 1770 HIS A HB2  1 
ATOM   5045 H  HB3  . HIS A 1 317 ? -35.733 -26.246 -15.769 1.00  24.95 ? 1770 HIS A HB3  1 
ATOM   5046 H  HD1  . HIS A 1 317 ? -34.661 -29.261 -17.438 1.00  32.46 ? 1770 HIS A HD1  1 
ATOM   5047 H  HD2  . HIS A 1 317 ? -37.478 -26.601 -17.810 1.00  30.53 ? 1770 HIS A HD2  1 
ATOM   5048 H  HE1  . HIS A 1 317 ? -36.109 -30.077 -19.120 1.00  33.43 ? 1770 HIS A HE1  1 
ATOM   5049 H  HE2  . HIS A 1 317 ? -37.816 -28.454 -19.340 1.00  33.57 ? 1770 HIS A HE2  1 
ATOM   5050 N  N    . TRP A 1 318 ? -33.404 -23.828 -17.386 1.00  17.75 ? 1771 TRP A N    1 
ATOM   5051 C  CA   . TRP A 1 318 ? -33.632 -22.581 -18.110 1.00  15.46 ? 1771 TRP A CA   1 
ATOM   5052 C  C    . TRP A 1 318 ? -32.256 -21.996 -18.412 1.00  15.62 ? 1771 TRP A C    1 
ATOM   5053 O  O    . TRP A 1 318 ? -31.266 -22.431 -17.837 1.00  16.38 ? 1771 TRP A O    1 
ATOM   5054 C  CB   . TRP A 1 318 ? -34.498 -21.585 -17.298 1.00  16.06 ? 1771 TRP A CB   1 
ATOM   5055 C  CG   . TRP A 1 318 ? -33.753 -20.870 -16.210 1.00  15.22 ? 1771 TRP A CG   1 
ATOM   5056 C  CD1  . TRP A 1 318 ? -33.415 -21.354 -14.974 1.00  16.20 ? 1771 TRP A CD1  1 
ATOM   5057 C  CD2  . TRP A 1 318 ? -33.236 -19.532 -16.263 1.00  15.25 ? 1771 TRP A CD2  1 
ATOM   5058 N  NE1  . TRP A 1 318 ? -32.710 -20.407 -14.268 1.00  16.37 ? 1771 TRP A NE1  1 
ATOM   5059 C  CE2  . TRP A 1 318 ? -32.599 -19.277 -15.034 1.00  15.74 ? 1771 TRP A CE2  1 
ATOM   5060 C  CE3  . TRP A 1 318 ? -33.263 -18.524 -17.231 1.00  16.43 ? 1771 TRP A CE3  1 
ATOM   5061 C  CZ2  . TRP A 1 318 ? -31.974 -18.064 -14.753 1.00  15.58 ? 1771 TRP A CZ2  1 
ATOM   5062 C  CZ3  . TRP A 1 318 ? -32.660 -17.307 -16.946 1.00  15.99 ? 1771 TRP A CZ3  1 
ATOM   5063 C  CH2  . TRP A 1 318 ? -32.019 -17.087 -15.719 1.00  15.70 ? 1771 TRP A CH2  1 
ATOM   5064 H  H    . TRP A 1 318 ? -32.623 -23.884 -17.029 1.00  21.30 ? 1771 TRP A H    1 
ATOM   5065 H  HA   . TRP A 1 318 ? -34.085 -22.770 -18.958 1.00  18.56 ? 1771 TRP A HA   1 
ATOM   5066 H  HB2  . TRP A 1 318 ? -34.851 -20.915 -17.903 1.00  19.27 ? 1771 TRP A HB2  1 
ATOM   5067 H  HB3  . TRP A 1 318 ? -35.228 -22.072 -16.885 1.00  19.27 ? 1771 TRP A HB3  1 
ATOM   5068 H  HD1  . TRP A 1 318 ? -33.608 -22.210 -14.667 1.00  19.44 ? 1771 TRP A HD1  1 
ATOM   5069 H  HE1  . TRP A 1 318 ? -32.401 -20.504 -13.472 1.00  19.65 ? 1771 TRP A HE1  1 
ATOM   5070 H  HE3  . TRP A 1 318 ? -33.678 -18.666 -18.051 1.00  19.72 ? 1771 TRP A HE3  1 
ATOM   5071 H  HZ2  . TRP A 1 318 ? -31.565 -17.911 -13.931 1.00  18.69 ? 1771 TRP A HZ2  1 
ATOM   5072 H  HZ3  . TRP A 1 318 ? -32.663 -16.634 -17.588 1.00  19.18 ? 1771 TRP A HZ3  1 
ATOM   5073 H  HH2  . TRP A 1 318 ? -31.621 -16.262 -15.554 1.00  18.84 ? 1771 TRP A HH2  1 
ATOM   5074 N  N    . THR A 1 319 ? -32.193 -21.001 -19.288 1.00  15.30 ? 1772 THR A N    1 
ATOM   5075 C  CA   . THR A 1 319 ? -30.936 -20.280 -19.515 1.00  15.01 ? 1772 THR A CA   1 
ATOM   5076 C  C    . THR A 1 319 ? -31.182 -18.861 -20.014 1.00  15.00 ? 1772 THR A C    1 
ATOM   5077 O  O    . THR A 1 319 ? -32.044 -18.646 -20.861 1.00  16.55 ? 1772 THR A O    1 
ATOM   5078 C  CB   . THR A 1 319 ? -29.997 -21.027 -20.512 1.00  15.58 ? 1772 THR A CB   1 
ATOM   5079 O  OG1  . THR A 1 319 ? -28.875 -20.187 -20.833 1.00  16.11 ? 1772 THR A OG1  1 
ATOM   5080 C  CG2  . THR A 1 319 ? -30.717 -21.394 -21.787 1.00  16.81 ? 1772 THR A CG2  1 
ATOM   5081 H  H    . THR A 1 319 ? -32.854 -20.721 -19.762 1.00  18.36 ? 1772 THR A H    1 
ATOM   5082 H  HA   . THR A 1 319 ? -30.461 -20.212 -18.660 1.00  18.01 ? 1772 THR A HA   1 
ATOM   5083 H  HB   . THR A 1 319 ? -29.677 -21.844 -20.098 1.00  18.70 ? 1772 THR A HB   1 
ATOM   5084 H  HG1  . THR A 1 319 ? -28.457 -20.006 -20.151 1.00  19.33 ? 1772 THR A HG1  1 
ATOM   5085 H  HG21 . THR A 1 319 ? -31.042 -20.601 -22.220 1.00  20.17 ? 1772 THR A HG21 1 
ATOM   5086 H  HG22 . THR A 1 319 ? -30.118 -21.852 -22.382 1.00  20.17 ? 1772 THR A HG22 1 
ATOM   5087 H  HG23 . THR A 1 319 ? -31.461 -21.969 -21.590 1.00  20.17 ? 1772 THR A HG23 1 
ATOM   5088 N  N    . PRO A 1 320 ? -30.413 -17.883 -19.494 1.00  15.72 ? 1773 PRO A N    1 
ATOM   5089 C  CA   . PRO A 1 320 ? -30.597 -16.509 -19.970 1.00  16.18 ? 1773 PRO A CA   1 
ATOM   5090 C  C    . PRO A 1 320 ? -30.035 -16.281 -21.373 1.00  15.77 ? 1773 PRO A C    1 
ATOM   5091 O  O    . PRO A 1 320 ? -30.278 -15.222 -21.951 1.00  16.56 ? 1773 PRO A O    1 
ATOM   5092 C  CB   . PRO A 1 320 ? -29.826 -15.683 -18.936 1.00  15.74 ? 1773 PRO A CB   1 
ATOM   5093 C  CG   . PRO A 1 320 ? -28.714 -16.611 -18.485 1.00  15.87 ? 1773 PRO A CG   1 
ATOM   5094 C  CD   . PRO A 1 320 ? -29.391 -17.967 -18.435 1.00  15.46 ? 1773 PRO A CD   1 
ATOM   5095 H  HA   . PRO A 1 320 ? -31.544 -16.261 -19.949 1.00  19.42 ? 1773 PRO A HA   1 
ATOM   5096 H  HB2  . PRO A 1 320 ? -29.464 -14.886 -19.354 1.00  18.89 ? 1773 PRO A HB2  1 
ATOM   5097 H  HB3  . PRO A 1 320 ? -30.408 -15.454 -18.195 1.00  18.89 ? 1773 PRO A HB3  1 
ATOM   5098 H  HG2  . PRO A 1 320 ? -27.993 -16.606 -19.134 1.00  19.04 ? 1773 PRO A HG2  1 
ATOM   5099 H  HG3  . PRO A 1 320 ? -28.396 -16.347 -17.607 1.00  19.04 ? 1773 PRO A HG3  1 
ATOM   5100 H  HD2  . PRO A 1 320 ? -28.754 -18.670 -18.635 1.00  18.56 ? 1773 PRO A HD2  1 
ATOM   5101 H  HD3  . PRO A 1 320 ? -29.810 -18.103 -17.571 1.00  18.56 ? 1773 PRO A HD3  1 
ATOM   5102 N  N    . PHE A 1 321 ? -29.287 -17.247 -21.906 1.00  15.09 ? 1774 PHE A N    1 
ATOM   5103 C  CA   . PHE A 1 321 ? -28.689 -17.101 -23.225 1.00  16.06 ? 1774 PHE A CA   1 
ATOM   5104 C  C    . PHE A 1 321 ? -29.573 -17.667 -24.331 1.00  17.72 ? 1774 PHE A C    1 
ATOM   5105 O  O    . PHE A 1 321 ? -29.159 -17.694 -25.487 1.00  18.07 ? 1774 PHE A O    1 
ATOM   5106 C  CB   . PHE A 1 321 ? -27.301 -17.750 -23.273 1.00  16.42 ? 1774 PHE A CB   1 
ATOM   5107 C  CG   . PHE A 1 321 ? -26.340 -17.181 -22.263 1.00  15.14 ? 1774 PHE A CG   1 
ATOM   5108 C  CD1  . PHE A 1 321 ? -25.701 -15.964 -22.477 1.00  15.20 ? 1774 PHE A CD1  1 
ATOM   5109 C  CD2  . PHE A 1 321 ? -26.096 -17.855 -21.080 1.00  15.21 ? 1774 PHE A CD2  1 
ATOM   5110 C  CE1  . PHE A 1 321 ? -24.834 -15.472 -21.550 1.00  15.72 ? 1774 PHE A CE1  1 
ATOM   5111 C  CE2  . PHE A 1 321 ? -25.228 -17.360 -20.156 1.00  14.76 ? 1774 PHE A CE2  1 
ATOM   5112 C  CZ   . PHE A 1 321 ? -24.596 -16.163 -20.389 1.00  15.05 ? 1774 PHE A CZ   1 
ATOM   5113 H  H    . PHE A 1 321 ? -29.113 -17.996 -21.521 1.00  18.11 ? 1774 PHE A H    1 
ATOM   5114 H  HA   . PHE A 1 321 ? -28.572 -16.145 -23.406 1.00  19.27 ? 1774 PHE A HA   1 
ATOM   5115 H  HB2  . PHE A 1 321 ? -27.392 -18.699 -23.096 1.00  19.70 ? 1774 PHE A HB2  1 
ATOM   5116 H  HB3  . PHE A 1 321 ? -26.921 -17.613 -24.155 1.00  19.70 ? 1774 PHE A HB3  1 
ATOM   5117 H  HD1  . PHE A 1 321 ? -25.853 -15.494 -23.265 1.00  18.25 ? 1774 PHE A HD1  1 
ATOM   5118 H  HD2  . PHE A 1 321 ? -26.517 -18.670 -20.922 1.00  18.25 ? 1774 PHE A HD2  1 
ATOM   5119 H  HE1  . PHE A 1 321 ? -24.405 -14.661 -21.702 1.00  18.86 ? 1774 PHE A HE1  1 
ATOM   5120 H  HE2  . PHE A 1 321 ? -25.068 -17.827 -19.368 1.00  17.71 ? 1774 PHE A HE2  1 
ATOM   5121 H  HZ   . PHE A 1 321 ? -24.007 -15.818 -19.757 1.00  18.06 ? 1774 PHE A HZ   1 
ATOM   5122 N  N    . GLU A 1 322 ? -30.782 -18.103 -23.985 1.00  17.72 ? 1775 GLU A N    1 
ATOM   5123 C  CA   . GLU A 1 322 ? -31.719 -18.610 -24.981 1.00  18.33 ? 1775 GLU A CA   1 
ATOM   5124 C  C    . GLU A 1 322 ? -31.805 -17.667 -26.183 1.00  19.91 ? 1775 GLU A C    1 
ATOM   5125 O  O    . GLU A 1 322 ? -31.975 -16.456 -26.022 1.00  20.41 ? 1775 GLU A O    1 
ATOM   5126 C  CB   . GLU A 1 322 ? -33.119 -18.796 -24.373 1.00  19.72 ? 1775 GLU A CB   1 
ATOM   5127 C  CG   . GLU A 1 322 ? -34.111 -19.359 -25.361 1.00  21.30 ? 1775 GLU A CG   1 
ATOM   5128 C  CD   . GLU A 1 322 ? -35.526 -19.428 -24.834 1.00  24.51 ? 1775 GLU A CD   1 
ATOM   5129 O  OE1  . GLU A 1 322 ? -35.734 -19.148 -23.635 1.00  25.37 ? 1775 GLU A OE1  1 
ATOM   5130 O  OE2  . GLU A 1 322 ? -36.427 -19.772 -25.633 1.00  25.39 ? 1775 GLU A OE2  1 
ATOM   5131 H  H    . GLU A 1 322 ? -31.082 -18.116 -23.180 1.00  21.26 ? 1775 GLU A H    1 
ATOM   5132 H  HA   . GLU A 1 322 ? -31.407 -19.483 -25.300 1.00  22.00 ? 1775 GLU A HA   1 
ATOM   5133 H  HB2  . GLU A 1 322 ? -33.060 -19.409 -23.624 1.00  23.66 ? 1775 GLU A HB2  1 
ATOM   5134 H  HB3  . GLU A 1 322 ? -33.450 -17.935 -24.072 1.00  23.66 ? 1775 GLU A HB3  1 
ATOM   5135 H  HG2  . GLU A 1 322 ? -34.117 -18.798 -26.152 1.00  25.56 ? 1775 GLU A HG2  1 
ATOM   5136 H  HG3  . GLU A 1 322 ? -33.839 -20.260 -25.598 1.00  25.56 ? 1775 GLU A HG3  1 
ATOM   5137 N  N    . GLY A 1 323 ? -31.664 -18.227 -27.381 1.00  20.06 ? 1776 GLY A N    1 
ATOM   5138 C  CA   . GLY A 1 323 ? -31.807 -17.478 -28.618 1.00  21.05 ? 1776 GLY A CA   1 
ATOM   5139 C  C    . GLY A 1 323 ? -30.508 -16.955 -29.197 1.00  22.32 ? 1776 GLY A C    1 
ATOM   5140 O  O    . GLY A 1 323 ? -30.456 -16.545 -30.352 1.00  24.19 ? 1776 GLY A O    1 
ATOM   5141 H  H    . GLY A 1 323 ? -31.481 -19.058 -27.503 1.00  24.07 ? 1776 GLY A H    1 
ATOM   5142 H  HA2  . GLY A 1 323 ? -32.224 -18.046 -29.284 1.00  25.27 ? 1776 GLY A HA2  1 
ATOM   5143 H  HA3  . GLY A 1 323 ? -32.391 -16.719 -28.462 1.00  25.27 ? 1776 GLY A HA3  1 
ATOM   5144 N  N    . GLN A 1 324 ? -29.445 -16.959 -28.406 1.00  21.60 ? 1777 GLN A N    1 
ATOM   5145 C  CA   . GLN A 1 324 ? -28.165 -16.521 -28.932 1.00  21.54 ? 1777 GLN A CA   1 
ATOM   5146 C  C    . GLN A 1 324 ? -27.587 -17.571 -29.867 1.00  20.74 ? 1777 GLN A C    1 
ATOM   5147 O  O    . GLN A 1 324 ? -27.665 -18.778 -29.620 1.00  20.90 ? 1777 GLN A O    1 
ATOM   5148 C  CB   . GLN A 1 324 ? -27.167 -16.200 -27.817 1.00  22.60 ? 1777 GLN A CB   1 
ATOM   5149 C  CG   . GLN A 1 324 ? -27.555 -14.989 -26.955 1.00  24.24 ? 1777 GLN A CG   1 
ATOM   5150 C  CD   . GLN A 1 324 ? -26.404 -14.444 -26.124 1.00  26.26 ? 1777 GLN A CD   1 
ATOM   5151 O  OE1  . GLN A 1 324 ? -25.306 -14.987 -26.139 1.00  28.93 ? 1777 GLN A OE1  1 
ATOM   5152 N  NE2  . GLN A 1 324 ? -26.650 -13.356 -25.401 1.00  26.24 ? 1777 GLN A NE2  1 
ATOM   5153 H  H    . GLN A 1 324 ? -29.437 -17.204 -27.581 1.00  25.92 ? 1777 GLN A H    1 
ATOM   5154 H  HA   . GLN A 1 324 ? -28.304 -15.702 -29.453 1.00  25.85 ? 1777 GLN A HA   1 
ATOM   5155 H  HB2  . GLN A 1 324 ? -27.097 -16.969 -27.230 1.00  27.12 ? 1777 GLN A HB2  1 
ATOM   5156 H  HB3  . GLN A 1 324 ? -26.303 -16.013 -28.217 1.00  27.12 ? 1777 GLN A HB3  1 
ATOM   5157 H  HG2  . GLN A 1 324 ? -27.866 -14.277 -27.537 1.00  29.09 ? 1777 GLN A HG2  1 
ATOM   5158 H  HG3  . GLN A 1 324 ? -28.264 -15.251 -26.347 1.00  29.09 ? 1777 GLN A HG3  1 
ATOM   5159 H  HE21 . GLN A 1 324 ? -27.430 -12.995 -25.418 1.00  31.49 ? 1777 GLN A HE21 1 
ATOM   5160 H  HE22 . GLN A 1 324 ? -26.028 -13.012 -24.915 1.00  31.49 ? 1777 GLN A HE22 1 
ATOM   5161 N  N    . LYS A 1 325 ? -27.013 -17.087 -30.953 1.00  21.93 ? 1778 LYS A N    1 
ATOM   5162 C  CA   A LYS A 1 325 ? -26.390 -17.946 -31.945 0.45  23.52 ? 1778 LYS A CA   1 
ATOM   5163 C  CA   B LYS A 1 325 ? -26.389 -17.949 -31.937 0.55  23.48 ? 1778 LYS A CA   1 
ATOM   5164 C  C    . LYS A 1 325 ? -24.926 -18.120 -31.582 1.00  22.45 ? 1778 LYS A C    1 
ATOM   5165 O  O    . LYS A 1 325 ? -24.223 -17.141 -31.315 1.00  23.84 ? 1778 LYS A O    1 
ATOM   5166 C  CB   A LYS A 1 325 ? -26.535 -17.336 -33.342 0.45  25.61 ? 1778 LYS A CB   1 
ATOM   5167 C  CB   B LYS A 1 325 ? -26.533 -17.345 -33.330 0.55  25.46 ? 1778 LYS A CB   1 
ATOM   5168 C  CG   A LYS A 1 325 ? -27.989 -17.105 -33.749 0.45  27.97 ? 1778 LYS A CG   1 
ATOM   5169 C  CG   B LYS A 1 325 ? -27.983 -17.214 -33.785 0.55  27.67 ? 1778 LYS A CG   1 
ATOM   5170 C  CD   A LYS A 1 325 ? -28.115 -16.638 -35.187 0.45  30.21 ? 1778 LYS A CD   1 
ATOM   5171 C  CD   B LYS A 1 325 ? -28.070 -16.638 -35.181 0.55  29.87 ? 1778 LYS A CD   1 
ATOM   5172 C  CE   A LYS A 1 325 ? -29.534 -16.183 -35.494 0.45  31.81 ? 1778 LYS A CE   1 
ATOM   5173 C  CE   B LYS A 1 325 ? -27.300 -17.500 -36.172 0.55  31.52 ? 1778 LYS A CE   1 
ATOM   5174 N  NZ   A LYS A 1 325 ? -29.815 -16.169 -36.955 0.45  33.28 ? 1778 LYS A NZ   1 
ATOM   5175 N  NZ   B LYS A 1 325 ? -27.285 -16.912 -37.539 0.55  32.79 ? 1778 LYS A NZ   1 
ATOM   5176 H  H    A LYS A 1 325 ? -26.969 -16.250 -31.143 0.45  26.31 ? 1778 LYS A H    1 
ATOM   5177 H  H    B LYS A 1 325 ? -26.971 -16.250 -31.146 0.55  26.31 ? 1778 LYS A H    1 
ATOM   5178 H  HA   A LYS A 1 325 ? -26.822 -18.825 -31.939 0.45  28.22 ? 1778 LYS A HA   1 
ATOM   5179 H  HA   B LYS A 1 325 ? -26.821 -18.828 -31.929 0.55  28.18 ? 1778 LYS A HA   1 
ATOM   5180 H  HB2  A LYS A 1 325 ? -26.080 -16.479 -33.360 0.45  30.74 ? 1778 LYS A HB2  1 
ATOM   5181 H  HB2  B LYS A 1 325 ? -26.139 -16.459 -33.331 0.55  30.55 ? 1778 LYS A HB2  1 
ATOM   5182 H  HB3  A LYS A 1 325 ? -26.135 -17.936 -33.990 0.45  30.74 ? 1778 LYS A HB3  1 
ATOM   5183 H  HB3  B LYS A 1 325 ? -26.071 -17.912 -33.968 0.55  30.55 ? 1778 LYS A HB3  1 
ATOM   5184 H  HG2  A LYS A 1 325 ? -28.480 -17.937 -33.658 0.45  33.57 ? 1778 LYS A HG2  1 
ATOM   5185 H  HG2  B LYS A 1 325 ? -28.398 -18.091 -33.791 0.55  33.21 ? 1778 LYS A HG2  1 
ATOM   5186 H  HG3  A LYS A 1 325 ? -28.375 -16.425 -33.175 0.45  33.57 ? 1778 LYS A HG3  1 
ATOM   5187 H  HG3  B LYS A 1 325 ? -28.457 -16.621 -33.181 0.55  33.21 ? 1778 LYS A HG3  1 
ATOM   5188 H  HD2  A LYS A 1 325 ? -27.516 -15.890 -35.335 0.45  36.25 ? 1778 LYS A HD2  1 
ATOM   5189 H  HD2  B LYS A 1 325 ? -28.998 -16.607 -35.460 0.55  35.85 ? 1778 LYS A HD2  1 
ATOM   5190 H  HD3  A LYS A 1 325 ? -27.894 -17.370 -35.783 0.45  36.25 ? 1778 LYS A HD3  1 
ATOM   5191 H  HD3  B LYS A 1 325 ? -27.685 -15.748 -35.187 0.55  35.85 ? 1778 LYS A HD3  1 
ATOM   5192 H  HE2  A LYS A 1 325 ? -30.161 -16.790 -35.071 0.45  38.17 ? 1778 LYS A HE2  1 
ATOM   5193 H  HE2  B LYS A 1 325 ? -26.382 -17.587 -35.871 0.55  37.83 ? 1778 LYS A HE2  1 
ATOM   5194 H  HE3  A LYS A 1 325 ? -29.660 -15.283 -35.154 0.45  38.17 ? 1778 LYS A HE3  1 
ATOM   5195 H  HE3  B LYS A 1 325 ? -27.718 -18.373 -36.224 0.55  37.83 ? 1778 LYS A HE3  1 
ATOM   5196 H  HZ1  A LYS A 1 325 ? -29.712 -16.987 -37.292 0.45  39.94 ? 1778 LYS A HZ1  1 
ATOM   5197 H  HZ1  B LYS A 1 325 ? -26.900 -16.109 -37.521 0.55  39.34 ? 1778 LYS A HZ1  1 
ATOM   5198 H  HZ2  A LYS A 1 325 ? -30.650 -15.899 -37.102 0.45  39.94 ? 1778 LYS A HZ2  1 
ATOM   5199 H  HZ2  B LYS A 1 325 ? -26.828 -17.439 -38.092 0.55  39.34 ? 1778 LYS A HZ2  1 
ATOM   5200 H  HZ3  A LYS A 1 325 ? -29.255 -15.614 -37.367 0.45  39.94 ? 1778 LYS A HZ3  1 
ATOM   5201 H  HZ3  B LYS A 1 325 ? -28.117 -16.826 -37.843 0.55  39.34 ? 1778 LYS A HZ3  1 
ATOM   5202 N  N    . VAL A 1 326 ? -24.475 -19.368 -31.563 1.00  20.08 ? 1779 VAL A N    1 
ATOM   5203 C  CA   . VAL A 1 326 ? -23.112 -19.673 -31.182 1.00  20.19 ? 1779 VAL A CA   1 
ATOM   5204 C  C    . VAL A 1 326 ? -22.482 -20.563 -32.236 1.00  19.90 ? 1779 VAL A C    1 
ATOM   5205 O  O    . VAL A 1 326 ? -23.162 -21.148 -33.067 1.00  21.02 ? 1779 VAL A O    1 
ATOM   5206 C  CB   . VAL A 1 326 ? -23.036 -20.348 -29.792 1.00  20.14 ? 1779 VAL A CB   1 
ATOM   5207 C  CG1  . VAL A 1 326 ? -23.376 -19.348 -28.712 1.00  20.45 ? 1779 VAL A CG1  1 
ATOM   5208 C  CG2  . VAL A 1 326 ? -23.954 -21.562 -29.717 1.00  21.09 ? 1779 VAL A CG2  1 
ATOM   5209 H  H    . VAL A 1 326 ? -24.945 -20.058 -31.769 1.00  24.10 ? 1779 VAL A H    1 
ATOM   5210 H  HA   . VAL A 1 326 ? -22.598 -18.840 -31.142 1.00  24.23 ? 1779 VAL A HA   1 
ATOM   5211 H  HB   . VAL A 1 326 ? -22.118 -20.655 -29.639 1.00  24.17 ? 1779 VAL A HB   1 
ATOM   5212 H  HG11 . VAL A 1 326 ? -24.266 -19.019 -28.860 1.00  24.54 ? 1779 VAL A HG11 1 
ATOM   5213 H  HG12 . VAL A 1 326 ? -23.325 -19.782 -27.857 1.00  24.54 ? 1779 VAL A HG12 1 
ATOM   5214 H  HG13 . VAL A 1 326 ? -22.749 -18.622 -28.750 1.00  24.54 ? 1779 VAL A HG13 1 
ATOM   5215 H  HG21 . VAL A 1 326 ? -23.687 -22.197 -30.385 1.00  25.31 ? 1779 VAL A HG21 1 
ATOM   5216 H  HG22 . VAL A 1 326 ? -23.882 -21.954 -28.844 1.00  25.31 ? 1779 VAL A HG22 1 
ATOM   5217 H  HG23 . VAL A 1 326 ? -24.858 -21.280 -29.876 1.00  25.31 ? 1779 VAL A HG23 1 
ATOM   5218 N  N    . LYS A 1 327 ? -21.161 -20.627 -32.218 1.00  20.26 ? 1780 LYS A N    1 
ATOM   5219 C  CA   . LYS A 1 327 ? -20.418 -21.434 -33.169 1.00  21.31 ? 1780 LYS A CA   1 
ATOM   5220 C  C    . LYS A 1 327 ? -19.320 -22.067 -32.363 1.00  22.63 ? 1780 LYS A C    1 
ATOM   5221 O  O    . LYS A 1 327 ? -18.484 -21.370 -31.788 1.00  23.35 ? 1780 LYS A O    1 
ATOM   5222 C  CB   . LYS A 1 327 ? -19.836 -20.569 -34.288 1.00  23.69 ? 1780 LYS A CB   1 
ATOM   5223 C  CG   . LYS A 1 327 ? -19.177 -21.348 -35.404 1.00  26.91 ? 1780 LYS A CG   1 
ATOM   5224 C  CD   . LYS A 1 327 ? -18.682 -20.397 -36.470 1.00  30.44 ? 1780 LYS A CD   1 
ATOM   5225 C  CE   . LYS A 1 327 ? -18.187 -21.134 -37.689 1.00  33.75 ? 1780 LYS A CE   1 
ATOM   5226 N  NZ   . LYS A 1 327 ? -17.707 -20.183 -38.721 1.00  35.94 ? 1780 LYS A NZ   1 
ATOM   5227 H  H    . LYS A 1 327 ? -20.664 -20.205 -31.657 1.00  24.32 ? 1780 LYS A H    1 
ATOM   5228 H  HA   . LYS A 1 327 ? -20.990 -22.131 -33.553 1.00  25.57 ? 1780 LYS A HA   1 
ATOM   5229 H  HB2  . LYS A 1 327 ? -20.552 -20.044 -34.678 1.00  28.42 ? 1780 LYS A HB2  1 
ATOM   5230 H  HB3  . LYS A 1 327 ? -19.168 -19.978 -33.907 1.00  28.42 ? 1780 LYS A HB3  1 
ATOM   5231 H  HG2  . LYS A 1 327 ? -18.419 -21.841 -35.054 1.00  32.29 ? 1780 LYS A HG2  1 
ATOM   5232 H  HG3  . LYS A 1 327 ? -19.822 -21.952 -35.804 1.00  32.29 ? 1780 LYS A HG3  1 
ATOM   5233 H  HD2  . LYS A 1 327 ? -19.410 -19.815 -36.742 1.00  36.53 ? 1780 LYS A HD2  1 
ATOM   5234 H  HD3  . LYS A 1 327 ? -17.948 -19.872 -36.114 1.00  36.53 ? 1780 LYS A HD3  1 
ATOM   5235 H  HE2  . LYS A 1 327 ? -17.450 -21.712 -37.438 1.00  40.50 ? 1780 LYS A HE2  1 
ATOM   5236 H  HE3  . LYS A 1 327 ? -18.913 -21.656 -38.067 1.00  40.50 ? 1780 LYS A HE3  1 
ATOM   5237 H  HZ1  . LYS A 1 327 ? -17.039 -19.693 -38.396 1.00  43.13 ? 1780 LYS A HZ1  1 
ATOM   5238 H  HZ2  . LYS A 1 327 ? -17.418 -20.629 -39.434 1.00  43.13 ? 1780 LYS A HZ2  1 
ATOM   5239 H  HZ3  . LYS A 1 327 ? -18.370 -19.642 -38.967 1.00  43.13 ? 1780 LYS A HZ3  1 
ATOM   5240 N  N    . GLY A 1 328 ? -19.348 -23.387 -32.288 1.00  22.37 ? 1781 GLY A N    1 
ATOM   5241 C  CA   . GLY A 1 328 ? -18.481 -24.120 -31.386 1.00  22.80 ? 1781 GLY A CA   1 
ATOM   5242 C  C    . GLY A 1 328 ? -19.279 -25.016 -30.454 1.00  21.41 ? 1781 GLY A C    1 
ATOM   5243 O  O    . GLY A 1 328 ? -20.245 -24.602 -29.810 1.00  20.65 ? 1781 GLY A O    1 
ATOM   5244 H  H    . GLY A 1 328 ? -19.867 -23.888 -32.757 1.00  26.85 ? 1781 GLY A H    1 
ATOM   5245 H  HA2  . GLY A 1 328 ? -17.868 -24.671 -31.898 1.00  27.36 ? 1781 GLY A HA2  1 
ATOM   5246 H  HA3  . GLY A 1 328 ? -17.965 -23.496 -30.851 1.00  27.36 ? 1781 GLY A HA3  1 
ATOM   5247 N  N    . THR A 1 329 ? -18.858 -26.265 -30.365 1.00  19.93 ? 1782 THR A N    1 
ATOM   5248 C  CA   A THR A 1 329 ? -19.503 -27.191 -29.466 0.74  20.67 ? 1782 THR A CA   1 
ATOM   5249 C  CA   B THR A 1 329 ? -19.535 -27.260 -29.538 0.26  20.25 ? 1782 THR A CA   1 
ATOM   5250 C  C    . THR A 1 329 ? -18.531 -28.244 -28.951 1.00  20.01 ? 1782 THR A C    1 
ATOM   5251 O  O    . THR A 1 329 ? -17.532 -28.576 -29.598 1.00  20.18 ? 1782 THR A O    1 
ATOM   5252 C  CB   A THR A 1 329 ? -20.688 -27.856 -30.138 0.74  24.61 ? 1782 THR A CB   1 
ATOM   5253 C  CB   B THR A 1 329 ? -20.553 -28.087 -30.354 0.26  21.79 ? 1782 THR A CB   1 
ATOM   5254 O  OG1  A THR A 1 329 ? -21.564 -28.374 -29.131 0.74  27.75 ? 1782 THR A OG1  1 
ATOM   5255 O  OG1  B THR A 1 329 ? -21.048 -27.323 -31.459 0.26  21.60 ? 1782 THR A OG1  1 
ATOM   5256 C  CG2  A THR A 1 329 ? -20.219 -28.969 -31.068 0.74  23.59 ? 1782 THR A CG2  1 
ATOM   5257 C  CG2  B THR A 1 329 ? -21.713 -28.522 -29.472 0.26  22.79 ? 1782 THR A CG2  1 
ATOM   5258 H  H    A THR A 1 329 ? -18.204 -26.598 -30.813 0.74  23.92 ? 1782 THR A H    1 
ATOM   5259 H  H    B THR A 1 329 ? -18.170 -26.572 -30.780 0.26  23.92 ? 1782 THR A H    1 
ATOM   5260 H  HA   A THR A 1 329 ? -19.840 -26.693 -28.692 0.74  24.81 ? 1782 THR A HA   1 
ATOM   5261 H  HA   B THR A 1 329 ? -20.007 -26.815 -28.803 0.26  24.30 ? 1782 THR A HA   1 
ATOM   5262 H  HB   A THR A 1 329 ? -21.164 -27.199 -30.668 0.74  29.53 ? 1782 THR A HB   1 
ATOM   5263 H  HB   B THR A 1 329 ? -20.116 -28.885 -30.690 0.26  26.14 ? 1782 THR A HB   1 
ATOM   5264 H  HG1  A THR A 1 329 ? -21.168 -28.924 -28.670 0.74  33.30 ? 1782 THR A HG1  1 
ATOM   5265 H  HG1  B THR A 1 329 ? -21.419 -26.644 -31.187 0.26  25.92 ? 1782 THR A HG1  1 
ATOM   5266 H  HG21 A THR A 1 329 ? -19.736 -29.632 -30.569 0.74  28.30 ? 1782 THR A HG21 1 
ATOM   5267 H  HG21 B THR A 1 329 ? -22.160 -27.751 -29.114 0.26  27.35 ? 1782 THR A HG21 1 
ATOM   5268 H  HG22 A THR A 1 329 ? -20.975 -29.385 -31.489 0.74  28.30 ? 1782 THR A HG22 1 
ATOM   5269 H  HG22 B THR A 1 329 ? -22.341 -29.035 -29.985 0.26  27.35 ? 1782 THR A HG22 1 
ATOM   5270 H  HG23 A THR A 1 329 ? -19.643 -28.608 -31.746 0.74  28.30 ? 1782 THR A HG23 1 
ATOM   5271 H  HG23 B THR A 1 329 ? -21.390 -29.060 -28.746 0.26  27.35 ? 1782 THR A HG23 1 
ATOM   5272 N  N    . VAL A 1 330 ? -18.804 -28.726 -27.749 1.00  19.27 ? 1783 VAL A N    1 
ATOM   5273 C  CA   . VAL A 1 330 ? -18.013 -29.799 -27.159 1.00  20.13 ? 1783 VAL A CA   1 
ATOM   5274 C  C    . VAL A 1 330 ? -18.451 -31.148 -27.741 1.00  20.67 ? 1783 VAL A C    1 
ATOM   5275 O  O    . VAL A 1 330 ? -19.634 -31.502 -27.699 1.00  21.55 ? 1783 VAL A O    1 
ATOM   5276 C  CB   . VAL A 1 330 ? -18.189 -29.805 -25.640 1.00  21.06 ? 1783 VAL A CB   1 
ATOM   5277 C  CG1  . VAL A 1 330 ? -17.435 -30.951 -25.015 1.00  21.69 ? 1783 VAL A CG1  1 
ATOM   5278 C  CG2  . VAL A 1 330 ? -17.713 -28.468 -25.063 1.00  20.88 ? 1783 VAL A CG2  1 
ATOM   5279 H  H    . VAL A 1 330 ? -19.446 -28.447 -27.249 1.00  23.12 ? 1783 VAL A H    1 
ATOM   5280 H  HA   . VAL A 1 330 ? -17.065 -29.662 -27.365 1.00  24.15 ? 1783 VAL A HA   1 
ATOM   5281 H  HB   . VAL A 1 330 ? -19.139 -29.911 -25.425 1.00  25.27 ? 1783 VAL A HB   1 
ATOM   5282 H  HG11 . VAL A 1 330 ? -16.502 -30.860 -25.222 1.00  26.03 ? 1783 VAL A HG11 1 
ATOM   5283 H  HG12 . VAL A 1 330 ? -17.564 -30.928 -24.064 1.00  26.03 ? 1783 VAL A HG12 1 
ATOM   5284 H  HG13 . VAL A 1 330 ? -17.771 -31.777 -25.372 1.00  26.03 ? 1783 VAL A HG13 1 
ATOM   5285 H  HG21 . VAL A 1 330 ? -18.235 -27.759 -25.446 1.00  25.05 ? 1783 VAL A HG21 1 
ATOM   5286 H  HG22 . VAL A 1 330 ? -17.826 -28.480 -24.110 1.00  25.05 ? 1783 VAL A HG22 1 
ATOM   5287 H  HG23 . VAL A 1 330 ? -16.786 -28.346 -25.281 1.00  25.05 ? 1783 VAL A HG23 1 
ATOM   5288 N  N    . ARG A 1 331 ? -17.503 -31.901 -28.299 1.00  20.83 ? 1784 ARG A N    1 
ATOM   5289 C  CA   A ARG A 1 331 ? -17.809 -33.194 -28.912 0.67  21.62 ? 1784 ARG A CA   1 
ATOM   5290 C  CA   B ARG A 1 331 ? -17.815 -33.191 -28.911 0.33  21.91 ? 1784 ARG A CA   1 
ATOM   5291 C  C    . ARG A 1 331 ? -17.481 -34.358 -27.994 1.00  22.07 ? 1784 ARG A C    1 
ATOM   5292 O  O    . ARG A 1 331 ? -18.245 -35.317 -27.897 1.00  23.97 ? 1784 ARG A O    1 
ATOM   5293 C  CB   A ARG A 1 331 ? -17.025 -33.380 -30.209 0.67  22.92 ? 1784 ARG A CB   1 
ATOM   5294 C  CB   B ARG A 1 331 ? -17.051 -33.370 -30.223 0.33  23.26 ? 1784 ARG A CB   1 
ATOM   5295 C  CG   A ARG A 1 331 ? -17.320 -32.365 -31.286 0.67  24.38 ? 1784 ARG A CG   1 
ATOM   5296 C  CG   B ARG A 1 331 ? -17.457 -32.426 -31.336 0.33  24.77 ? 1784 ARG A CG   1 
ATOM   5297 C  CD   A ARG A 1 331 ? -18.786 -32.346 -31.657 0.67  24.15 ? 1784 ARG A CD   1 
ATOM   5298 C  CD   B ARG A 1 331 ? -18.949 -32.475 -31.620 0.33  25.77 ? 1784 ARG A CD   1 
ATOM   5299 N  NE   A ARG A 1 331 ? -19.300 -33.664 -32.015 0.67  24.30 ? 1784 ARG A NE   1 
ATOM   5300 N  NE   B ARG A 1 331 ? -19.269 -31.872 -32.914 0.33  26.95 ? 1784 ARG A NE   1 
ATOM   5301 C  CZ   A ARG A 1 331 ? -19.170 -34.234 -33.208 0.67  25.71 ? 1784 ARG A CZ   1 
ATOM   5302 C  CZ   B ARG A 1 331 ? -20.493 -31.539 -33.314 0.33  27.66 ? 1784 ARG A CZ   1 
ATOM   5303 N  NH1  A ARG A 1 331 ? -18.519 -33.615 -34.185 0.67  25.61 ? 1784 ARG A NH1  1 
ATOM   5304 N  NH1  B ARG A 1 331 ? -21.540 -31.737 -32.522 0.33  27.79 ? 1784 ARG A NH1  1 
ATOM   5305 N  NH2  A ARG A 1 331 ? -19.684 -35.441 -33.415 0.67  27.26 ? 1784 ARG A NH2  1 
ATOM   5306 N  NH2  B ARG A 1 331 ? -20.669 -30.995 -34.510 0.33  28.42 ? 1784 ARG A NH2  1 
ATOM   5307 H  H    A ARG A 1 331 ? -16.671 -31.685 -28.335 0.67  24.99 ? 1784 ARG A H    1 
ATOM   5308 H  H    B ARG A 1 331 ? -16.671 -31.686 -28.335 0.33  24.99 ? 1784 ARG A H    1 
ATOM   5309 H  HA   A ARG A 1 331 ? -18.765 -33.231 -29.124 0.67  25.95 ? 1784 ARG A HA   1 
ATOM   5310 H  HA   B ARG A 1 331 ? -18.774 -33.226 -29.111 0.33  26.29 ? 1784 ARG A HA   1 
ATOM   5311 H  HB2  A ARG A 1 331 ? -16.078 -33.325 -30.008 0.67  27.51 ? 1784 ARG A HB2  1 
ATOM   5312 H  HB2  B ARG A 1 331 ? -16.107 -33.231 -30.051 0.33  27.91 ? 1784 ARG A HB2  1 
ATOM   5313 H  HB3  A ARG A 1 331 ? -17.230 -34.256 -30.570 0.67  27.51 ? 1784 ARG A HB3  1 
ATOM   5314 H  HB3  B ARG A 1 331 ? -17.193 -34.275 -30.541 0.33  27.91 ? 1784 ARG A HB3  1 
ATOM   5315 H  HG2  A ARG A 1 331 ? -17.077 -31.482 -30.967 0.67  29.25 ? 1784 ARG A HG2  1 
ATOM   5316 H  HG2  B ARG A 1 331 ? -17.229 -31.518 -31.082 0.33  29.73 ? 1784 ARG A HG2  1 
ATOM   5317 H  HG3  A ARG A 1 331 ? -16.810 -32.585 -32.081 0.67  29.25 ? 1784 ARG A HG3  1 
ATOM   5318 H  HG3  B ARG A 1 331 ? -16.988 -32.673 -32.149 0.33  29.73 ? 1784 ARG A HG3  1 
ATOM   5319 H  HD2  A ARG A 1 331 ? -19.298 -32.020 -30.901 0.67  28.99 ? 1784 ARG A HD2  1 
ATOM   5320 H  HD2  B ARG A 1 331 ? -19.241 -33.400 -31.635 0.33  30.93 ? 1784 ARG A HD2  1 
ATOM   5321 H  HD3  A ARG A 1 331 ? -18.910 -31.759 -32.419 0.67  28.99 ? 1784 ARG A HD3  1 
ATOM   5322 H  HD3  B ARG A 1 331 ? -19.422 -31.984 -30.931 0.33  30.93 ? 1784 ARG A HD3  1 
ATOM   5323 H  HE   A ARG A 1 331 ? -19.719 -34.106 -31.408 0.67  29.15 ? 1784 ARG A HE   1 
ATOM   5324 H  HE   B ARG A 1 331 ? -18.618 -31.723 -33.456 0.33  32.34 ? 1784 ARG A HE   1 
ATOM   5325 H  HH11 A ARG A 1 331 ? -18.185 -32.834 -34.051 0.67  32.71 ? 1784 ARG A HH11 1 
ATOM   5326 H  HH11 B ARG A 1 331 ? -21.430 -32.089 -31.745 0.33  34.11 ? 1784 ARG A HH11 1 
ATOM   5327 H  HH12 A ARG A 1 331 ? -18.437 -33.992 -34.953 0.67  32.71 ? 1784 ARG A HH12 1 
ATOM   5328 H  HH12 B ARG A 1 331 ? -22.328 -31.518 -32.788 0.33  34.11 ? 1784 ARG A HH12 1 
ATOM   5329 H  HH21 A ARG A 1 331 ? -20.103 -35.844 -32.781 0.67  30.73 ? 1784 ARG A HH21 1 
ATOM   5330 H  HH21 B ARG A 1 331 ? -19.993 -30.863 -35.026 0.33  33.35 ? 1784 ARG A HH21 1 
ATOM   5331 H  HH22 A ARG A 1 331 ? -19.600 -35.819 -34.183 0.67  30.73 ? 1784 ARG A HH22 1 
ATOM   5332 H  HH22 B ARG A 1 331 ? -21.458 -30.777 -34.771 0.33  33.35 ? 1784 ARG A HH22 1 
ATOM   5333 N  N    . ARG A 1 332 ? -16.329 -34.286 -27.343 1.00  21.47 ? 1785 ARG A N    1 
ATOM   5334 C  CA   A ARG A 1 332 ? -15.872 -35.380 -26.506 0.55  21.70 ? 1785 ARG A CA   1 
ATOM   5335 C  CA   B ARG A 1 332 ? -15.876 -35.379 -26.498 0.45  21.61 ? 1785 ARG A CA   1 
ATOM   5336 C  C    . ARG A 1 332 ? -15.025 -34.864 -25.355 1.00  20.54 ? 1785 ARG A C    1 
ATOM   5337 O  O    . ARG A 1 332 ? -14.259 -33.924 -25.521 1.00  21.24 ? 1785 ARG A O    1 
ATOM   5338 C  CB   A ARG A 1 332 ? -15.067 -36.374 -27.342 0.55  23.79 ? 1785 ARG A CB   1 
ATOM   5339 C  CB   B ARG A 1 332 ? -15.085 -36.396 -27.324 0.45  23.43 ? 1785 ARG A CB   1 
ATOM   5340 C  CG   A ARG A 1 332 ? -14.868 -37.712 -26.666 0.55  25.49 ? 1785 ARG A CG   1 
ATOM   5341 C  CG   B ARG A 1 332 ? -15.897 -37.006 -28.446 0.45  25.09 ? 1785 ARG A CG   1 
ATOM   5342 C  CD   A ARG A 1 332 ? -14.292 -38.730 -27.636 0.55  27.47 ? 1785 ARG A CD   1 
ATOM   5343 C  CD   B ARG A 1 332 ? -15.205 -38.194 -29.079 0.45  26.67 ? 1785 ARG A CD   1 
ATOM   5344 N  NE   A ARG A 1 332 ? -12.854 -38.547 -27.775 0.55  28.93 ? 1785 ARG A NE   1 
ATOM   5345 N  NE   B ARG A 1 332 ? -15.942 -38.676 -30.241 0.45  27.81 ? 1785 ARG A NE   1 
ATOM   5346 C  CZ   A ARG A 1 332 ? -11.946 -39.478 -27.517 0.55  30.19 ? 1785 ARG A CZ   1 
ATOM   5347 C  CZ   B ARG A 1 332 ? -15.676 -39.803 -30.891 0.45  28.21 ? 1785 ARG A CZ   1 
ATOM   5348 N  NH1  A ARG A 1 332 ? -12.310 -40.695 -27.122 0.55  31.66 ? 1785 ARG A NH1  1 
ATOM   5349 N  NH1  B ARG A 1 332 ? -14.681 -40.589 -30.506 0.45  27.54 ? 1785 ARG A NH1  1 
ATOM   5350 N  NH2  A ARG A 1 332 ? -10.660 -39.183 -27.658 0.55  30.85 ? 1785 ARG A NH2  1 
ATOM   5351 N  NH2  B ARG A 1 332 ? -16.404 -40.137 -31.944 0.45  28.45 ? 1785 ARG A NH2  1 
ATOM   5352 H  H    A ARG A 1 332 ? -15.794 -33.613 -27.369 0.55  25.76 ? 1785 ARG A H    1 
ATOM   5353 H  H    B ARG A 1 332 ? -15.791 -33.616 -27.373 0.45  25.76 ? 1785 ARG A H    1 
ATOM   5354 H  HA   A ARG A 1 332 ? -16.647 -35.848 -26.132 0.55  26.04 ? 1785 ARG A HA   1 
ATOM   5355 H  HA   B ARG A 1 332 ? -16.655 -35.835 -26.117 0.45  25.93 ? 1785 ARG A HA   1 
ATOM   5356 H  HB2  A ARG A 1 332 ? -15.534 -36.530 -28.178 0.55  28.54 ? 1785 ARG A HB2  1 
ATOM   5357 H  HB2  B ARG A 1 332 ? -14.316 -35.954 -27.716 0.45  28.11 ? 1785 ARG A HB2  1 
ATOM   5358 H  HB3  A ARG A 1 332 ? -14.191 -35.997 -27.520 0.55  28.54 ? 1785 ARG A HB3  1 
ATOM   5359 H  HB3  B ARG A 1 332 ? -14.793 -37.115 -26.742 0.45  28.11 ? 1785 ARG A HB3  1 
ATOM   5360 H  HG2  A ARG A 1 332 ? -14.248 -37.610 -25.926 0.55  30.59 ? 1785 ARG A HG2  1 
ATOM   5361 H  HG2  B ARG A 1 332 ? -16.749 -37.306 -28.095 0.45  30.10 ? 1785 ARG A HG2  1 
ATOM   5362 H  HG3  A ARG A 1 332 ? -15.722 -38.042 -26.347 0.55  30.59 ? 1785 ARG A HG3  1 
ATOM   5363 H  HG3  B ARG A 1 332 ? -16.037 -36.337 -29.135 0.45  30.10 ? 1785 ARG A HG3  1 
ATOM   5364 H  HD2  A ARG A 1 332 ? -14.457 -39.625 -27.301 0.55  32.96 ? 1785 ARG A HD2  1 
ATOM   5365 H  HD2  B ARG A 1 332 ? -14.317 -37.932 -29.368 0.45  32.00 ? 1785 ARG A HD2  1 
ATOM   5366 H  HD3  A ARG A 1 332 ? -14.702 -38.613 -28.508 0.55  32.96 ? 1785 ARG A HD3  1 
ATOM   5367 H  HD3  B ARG A 1 332 ? -15.149 -38.915 -28.432 0.45  32.00 ? 1785 ARG A HD3  1 
ATOM   5368 H  HE   A ARG A 1 332 ? -12.574 -37.780 -28.044 0.55  34.72 ? 1785 ARG A HE   1 
ATOM   5369 H  HE   B ARG A 1 332 ? -16.597 -38.196 -30.525 0.45  33.38 ? 1785 ARG A HE   1 
ATOM   5370 H  HH11 A ARG A 1 332 ? -13.144 -40.884 -27.024 0.55  37.02 ? 1785 ARG A HH11 1 
ATOM   5371 H  HH11 B ARG A 1 332 ? -14.202 -40.374 -29.825 0.45  34.14 ? 1785 ARG A HH11 1 
ATOM   5372 H  HH12 A ARG A 1 332 ? -11.712 -41.292 -26.961 0.55  37.02 ? 1785 ARG A HH12 1 
ATOM   5373 H  HH12 B ARG A 1 332 ? -14.517 -41.316 -30.935 0.45  34.14 ? 1785 ARG A HH12 1 
ATOM   5374 H  HH21 A ARG A 1 332 ? -10.425 -38.398 -27.919 0.55  37.99 ? 1785 ARG A HH21 1 
ATOM   5375 H  HH21 B ARG A 1 332 ? -17.051 -39.630 -32.197 0.45  33.04 ? 1785 ARG A HH21 1 
ATOM   5376 H  HH22 A ARG A 1 332 ? -10.062 -39.782 -27.505 0.55  37.99 ? 1785 ARG A HH22 1 
ATOM   5377 H  HH22 B ARG A 1 332 ? -16.238 -40.867 -32.367 0.45  33.04 ? 1785 ARG A HH22 1 
ATOM   5378 N  N    . VAL A 1 333 ? -15.176 -35.491 -24.193 1.00  18.67 ? 1786 VAL A N    1 
ATOM   5379 C  CA   . VAL A 1 333 ? -14.348 -35.194 -23.037 1.00  17.49 ? 1786 VAL A CA   1 
ATOM   5380 C  C    . VAL A 1 333 ? -13.807 -36.514 -22.519 1.00  17.98 ? 1786 VAL A C    1 
ATOM   5381 O  O    . VAL A 1 333 ? -14.564 -37.464 -22.324 1.00  19.75 ? 1786 VAL A O    1 
ATOM   5382 C  CB   . VAL A 1 333 ? -15.145 -34.513 -21.918 1.00  17.43 ? 1786 VAL A CB   1 
ATOM   5383 C  CG1  . VAL A 1 333 ? -14.247 -34.233 -20.708 1.00  17.71 ? 1786 VAL A CG1  1 
ATOM   5384 C  CG2  . VAL A 1 333 ? -15.743 -33.211 -22.413 1.00  17.39 ? 1786 VAL A CG2  1 
ATOM   5385 H  H    . VAL A 1 333 ? -15.763 -36.103 -24.050 1.00  22.41 ? 1786 VAL A H    1 
ATOM   5386 H  HA   . VAL A 1 333 ? -13.599 -34.618 -23.296 1.00  20.98 ? 1786 VAL A HA   1 
ATOM   5387 H  HB   . VAL A 1 333 ? -15.875 -35.101 -21.633 1.00  20.92 ? 1786 VAL A HB   1 
ATOM   5388 H  HG11 . VAL A 1 333 ? -13.529 -33.657 -20.979 1.00  21.26 ? 1786 VAL A HG11 1 
ATOM   5389 H  HG12 . VAL A 1 333 ? -14.769 -33.808 -20.024 1.00  21.26 ? 1786 VAL A HG12 1 
ATOM   5390 H  HG13 . VAL A 1 333 ? -13.895 -35.065 -20.382 1.00  21.26 ? 1786 VAL A HG13 1 
ATOM   5391 H  HG21 . VAL A 1 333 ? -16.329 -33.397 -23.150 1.00  20.86 ? 1786 VAL A HG21 1 
ATOM   5392 H  HG22 . VAL A 1 333 ? -16.236 -32.802 -21.698 1.00  20.86 ? 1786 VAL A HG22 1 
ATOM   5393 H  HG23 . VAL A 1 333 ? -15.034 -32.629 -22.696 1.00  20.86 ? 1786 VAL A HG23 1 
ATOM   5394 N  N    . VAL A 1 334 ? -12.496 -36.559 -22.314 1.00  18.15 ? 1787 VAL A N    1 
ATOM   5395 C  CA   . VAL A 1 334 ? -11.838 -37.692 -21.692 1.00  18.48 ? 1787 VAL A CA   1 
ATOM   5396 C  C    . VAL A 1 334 ? -11.292 -37.213 -20.353 1.00  17.50 ? 1787 VAL A C    1 
ATOM   5397 O  O    . VAL A 1 334 ? -10.590 -36.206 -20.300 1.00  17.60 ? 1787 VAL A O    1 
ATOM   5398 C  CB   . VAL A 1 334 ? -10.707 -38.229 -22.584 1.00  19.67 ? 1787 VAL A CB   1 
ATOM   5399 C  CG1  . VAL A 1 334 ? -9.866  -39.252 -21.830 1.00  20.42 ? 1787 VAL A CG1  1 
ATOM   5400 C  CG2  . VAL A 1 334 ? -11.293 -38.848 -23.850 1.00  19.80 ? 1787 VAL A CG2  1 
ATOM   5401 H  H    . VAL A 1 334 ? -11.956 -35.926 -22.533 1.00  21.79 ? 1787 VAL A H    1 
ATOM   5402 H  HA   . VAL A 1 334 ? -12.486 -38.410 -21.533 1.00  22.18 ? 1787 VAL A HA   1 
ATOM   5403 H  HB   . VAL A 1 334 ? -10.123 -37.487 -22.848 1.00  23.60 ? 1787 VAL A HB   1 
ATOM   5404 H  HG11 . VAL A 1 334 ? -10.428 -39.982 -21.563 1.00  24.51 ? 1787 VAL A HG11 1 
ATOM   5405 H  HG12 . VAL A 1 334 ? -9.169  -39.570 -22.408 1.00  24.51 ? 1787 VAL A HG12 1 
ATOM   5406 H  HG13 . VAL A 1 334 ? -9.483  -38.832 -21.056 1.00  24.51 ? 1787 VAL A HG13 1 
ATOM   5407 H  HG21 . VAL A 1 334 ? -11.786 -38.176 -24.327 1.00  23.77 ? 1787 VAL A HG21 1 
ATOM   5408 H  HG22 . VAL A 1 334 ? -10.576 -39.178 -24.397 1.00  23.77 ? 1787 VAL A HG22 1 
ATOM   5409 H  HG23 . VAL A 1 334 ? -11.876 -39.570 -23.603 1.00  23.77 ? 1787 VAL A HG23 1 
ATOM   5410 N  N    . LEU A 1 335 ? -11.659 -37.905 -19.275 1.00  17.76 ? 1788 LEU A N    1 
ATOM   5411 C  CA   . LEU A 1 335 ? -11.210 -37.551 -17.935 1.00  17.27 ? 1788 LEU A CA   1 
ATOM   5412 C  C    . LEU A 1 335 ? -10.462 -38.710 -17.299 1.00  17.74 ? 1788 LEU A C    1 
ATOM   5413 O  O    . LEU A 1 335 ? -11.046 -39.774 -17.041 1.00  18.19 ? 1788 LEU A O    1 
ATOM   5414 C  CB   . LEU A 1 335 ? -12.387 -37.152 -17.048 1.00  17.59 ? 1788 LEU A CB   1 
ATOM   5415 C  CG   . LEU A 1 335 ? -12.029 -36.817 -15.597 1.00  16.62 ? 1788 LEU A CG   1 
ATOM   5416 C  CD1  . LEU A 1 335 ? -10.983 -35.699 -15.507 1.00  17.30 ? 1788 LEU A CD1  1 
ATOM   5417 C  CD2  . LEU A 1 335 ? -13.269 -36.388 -14.866 1.00  17.40 ? 1788 LEU A CD2  1 
ATOM   5418 H  H    . LEU A 1 335 ? -12.175 -38.592 -19.298 1.00  21.31 ? 1788 LEU A H    1 
ATOM   5419 H  HA   . LEU A 1 335 ? -10.599 -36.788 -17.993 1.00  20.73 ? 1788 LEU A HA   1 
ATOM   5420 H  HB2  . LEU A 1 335 ? -12.810 -36.368 -17.433 1.00  21.11 ? 1788 LEU A HB2  1 
ATOM   5421 H  HB3  . LEU A 1 335 ? -13.021 -37.886 -17.030 1.00  21.11 ? 1788 LEU A HB3  1 
ATOM   5422 H  HG   . LEU A 1 335 ? -11.673 -37.607 -15.161 1.00  19.94 ? 1788 LEU A HG   1 
ATOM   5423 H  HD11 . LEU A 1 335 ? -11.335 -34.908 -15.923 1.00  20.76 ? 1788 LEU A HD11 1 
ATOM   5424 H  HD12 . LEU A 1 335 ? -10.792 -35.524 -14.582 1.00  20.76 ? 1788 LEU A HD12 1 
ATOM   5425 H  HD13 . LEU A 1 335 ? -10.185 -35.980 -15.960 1.00  20.76 ? 1788 LEU A HD13 1 
ATOM   5426 H  HD21 . LEU A 1 335 ? -13.907 -37.106 -14.886 1.00  20.87 ? 1788 LEU A HD21 1 
ATOM   5427 H  HD22 . LEU A 1 335 ? -13.039 -36.180 -13.957 1.00  20.87 ? 1788 LEU A HD22 1 
ATOM   5428 H  HD23 . LEU A 1 335 ? -13.634 -35.613 -15.298 1.00  20.87 ? 1788 LEU A HD23 1 
ATOM   5429 N  N    . ARG A 1 336 ? -9.172  -38.489 -17.073 1.00  18.39 ? 1789 ARG A N    1 
ATOM   5430 C  CA   . ARG A 1 336 ? -8.301  -39.485 -16.454 1.00  18.06 ? 1789 ARG A CA   1 
ATOM   5431 C  C    . ARG A 1 336 ? -8.455  -40.847 -17.132 1.00  19.32 ? 1789 ARG A C    1 
ATOM   5432 O  O    . ARG A 1 336 ? -8.594  -41.889 -16.485 1.00  20.87 ? 1789 ARG A O    1 
ATOM   5433 C  CB   . ARG A 1 336 ? -8.535  -39.534 -14.944 1.00  17.61 ? 1789 ARG A CB   1 
ATOM   5434 C  CG   . ARG A 1 336 ? -8.025  -38.278 -14.246 1.00  17.60 ? 1789 ARG A CG   1 
ATOM   5435 C  CD   . ARG A 1 336 ? -8.180  -38.326 -12.747 1.00  18.09 ? 1789 ARG A CD   1 
ATOM   5436 N  NE   . ARG A 1 336 ? -9.542  -38.097 -12.296 1.00  17.89 ? 1789 ARG A NE   1 
ATOM   5437 C  CZ   . ARG A 1 336 ? -10.423 -39.046 -11.982 1.00  17.30 ? 1789 ARG A CZ   1 
ATOM   5438 N  NH1  . ARG A 1 336 ? -10.129 -40.338 -12.126 1.00  18.50 ? 1789 ARG A NH1  1 
ATOM   5439 N  NH2  . ARG A 1 336 ? -11.628 -38.697 -11.569 1.00  17.81 ? 1789 ARG A NH2  1 
ATOM   5440 H  H    . ARG A 1 336 ? -8.769  -37.755 -17.272 1.00  22.07 ? 1789 ARG A H    1 
ATOM   5441 H  HA   . ARG A 1 336 ? -7.373  -39.202 -16.590 1.00  21.67 ? 1789 ARG A HA   1 
ATOM   5442 H  HB2  . ARG A 1 336 ? -9.487  -39.611 -14.772 1.00  21.14 ? 1789 ARG A HB2  1 
ATOM   5443 H  HB3  . ARG A 1 336 ? -8.066  -40.298 -14.574 1.00  21.14 ? 1789 ARG A HB3  1 
ATOM   5444 H  HG2  . ARG A 1 336 ? -7.083  -38.168 -14.446 1.00  21.11 ? 1789 ARG A HG2  1 
ATOM   5445 H  HG3  . ARG A 1 336 ? -8.524  -37.512 -14.573 1.00  21.11 ? 1789 ARG A HG3  1 
ATOM   5446 H  HD2  . ARG A 1 336 ? -7.906  -39.202 -12.432 1.00  21.70 ? 1789 ARG A HD2  1 
ATOM   5447 H  HD3  . ARG A 1 336 ? -7.616  -37.643 -12.352 1.00  21.70 ? 1789 ARG A HD3  1 
ATOM   5448 H  HE   . ARG A 1 336 ? -9.801  -37.280 -12.226 1.00  21.47 ? 1789 ARG A HE   1 
ATOM   5449 H  HH11 . ARG A 1 336 ? -9.347  -40.573 -12.394 1.00  22.20 ? 1789 ARG A HH11 1 
ATOM   5450 H  HH12 . ARG A 1 336 ? -10.714 -40.937 -11.929 1.00  22.20 ? 1789 ARG A HH12 1 
ATOM   5451 H  HH21 . ARG A 1 336 ? -11.829 -37.865 -11.486 1.00  21.37 ? 1789 ARG A HH21 1 
ATOM   5452 H  HH22 . ARG A 1 336 ? -12.210 -39.301 -11.381 1.00  21.37 ? 1789 ARG A HH22 1 
ATOM   5453 N  N    . GLY A 1 337 ? -8.425  -40.815 -18.459 1.00  19.88 ? 1790 GLY A N    1 
ATOM   5454 C  CA   . GLY A 1 337 ? -8.344  -42.023 -19.253 1.00  21.09 ? 1790 GLY A CA   1 
ATOM   5455 C  C    . GLY A 1 337 ? -9.669  -42.682 -19.578 1.00  22.18 ? 1790 GLY A C    1 
ATOM   5456 O  O    . GLY A 1 337 ? -9.683  -43.730 -20.224 1.00  24.82 ? 1790 GLY A O    1 
ATOM   5457 H  H    . GLY A 1 337 ? -8.450  -40.093 -18.926 1.00  23.86 ? 1790 GLY A H    1 
ATOM   5458 H  HA2  . GLY A 1 337 ? -7.902  -41.817 -20.092 1.00  25.31 ? 1790 GLY A HA2  1 
ATOM   5459 H  HA3  . GLY A 1 337 ? -7.798  -42.671 -18.781 1.00  25.31 ? 1790 GLY A HA3  1 
ATOM   5460 N  N    . GLU A 1 338 ? -10.778 -42.090 -19.134 1.00  22.19 ? 1791 GLU A N    1 
ATOM   5461 C  CA   . GLU A 1 338 ? -12.109 -42.627 -19.430 1.00  21.33 ? 1791 GLU A CA   1 
ATOM   5462 C  C    . GLU A 1 338 ? -12.924 -41.630 -20.250 1.00  20.84 ? 1791 GLU A C    1 
ATOM   5463 O  O    . GLU A 1 338 ? -12.828 -40.426 -20.033 1.00  19.91 ? 1791 GLU A O    1 
ATOM   5464 C  CB   . GLU A 1 338 ? -12.863 -42.959 -18.138 1.00  23.17 ? 1791 GLU A CB   1 
ATOM   5465 C  CG   . GLU A 1 338 ? -12.217 -44.029 -17.269 1.00  25.62 ? 1791 GLU A CG   1 
ATOM   5466 C  CD   . GLU A 1 338 ? -12.152 -45.389 -17.937 1.00  30.94 ? 1791 GLU A CD   1 
ATOM   5467 O  OE1  . GLU A 1 338 ? -13.051 -45.719 -18.738 1.00  32.67 ? 1791 GLU A OE1  1 
ATOM   5468 O  OE2  . GLU A 1 338 ? -11.188 -46.129 -17.659 1.00  33.85 ? 1791 GLU A OE2  1 
ATOM   5469 H  H    . GLU A 1 338 ? -10.788 -41.375 -18.657 1.00  26.63 ? 1791 GLU A H    1 
ATOM   5470 H  HA   . GLU A 1 338 ? -12.017 -43.451 -19.952 1.00  25.60 ? 1791 GLU A HA   1 
ATOM   5471 H  HB2  . GLU A 1 338 ? -12.931 -42.151 -17.604 1.00  27.81 ? 1791 GLU A HB2  1 
ATOM   5472 H  HB3  . GLU A 1 338 ? -13.752 -43.269 -18.371 1.00  27.81 ? 1791 GLU A HB3  1 
ATOM   5473 H  HG2  . GLU A 1 338 ? -11.310 -43.757 -17.059 1.00  30.74 ? 1791 GLU A HG2  1 
ATOM   5474 H  HG3  . GLU A 1 338 ? -12.731 -44.123 -16.452 1.00  30.74 ? 1791 GLU A HG3  1 
ATOM   5475 N  N    . VAL A 1 339 ? -13.723 -42.117 -21.192 1.00  21.74 ? 1792 VAL A N    1 
ATOM   5476 C  CA   . VAL A 1 339 ? -14.619 -41.240 -21.936 1.00  21.56 ? 1792 VAL A CA   1 
ATOM   5477 C  C    . VAL A 1 339 ? -15.711 -40.752 -21.001 1.00  21.28 ? 1792 VAL A C    1 
ATOM   5478 O  O    . VAL A 1 339 ? -16.480 -41.546 -20.453 1.00  23.40 ? 1792 VAL A O    1 
ATOM   5479 C  CB   . VAL A 1 339 ? -15.245 -41.946 -23.156 1.00  23.61 ? 1792 VAL A CB   1 
ATOM   5480 C  CG1  . VAL A 1 339 ? -16.186 -41.004 -23.877 1.00  24.23 ? 1792 VAL A CG1  1 
ATOM   5481 C  CG2  . VAL A 1 339 ? -14.167 -42.462 -24.102 1.00  23.82 ? 1792 VAL A CG2  1 
ATOM   5482 H  H    . VAL A 1 339 ? -13.765 -42.946 -21.418 1.00  26.09 ? 1792 VAL A H    1 
ATOM   5483 H  HA   . VAL A 1 339 ? -14.117 -40.462 -22.256 1.00  25.87 ? 1792 VAL A HA   1 
ATOM   5484 H  HB   . VAL A 1 339 ? -15.767 -42.715 -22.846 1.00  28.34 ? 1792 VAL A HB   1 
ATOM   5485 H  HG11 . VAL A 1 339 ? -15.693 -40.235 -24.172 1.00  29.07 ? 1792 VAL A HG11 1 
ATOM   5486 H  HG12 . VAL A 1 339 ? -16.566 -41.460 -24.632 1.00  29.07 ? 1792 VAL A HG12 1 
ATOM   5487 H  HG13 . VAL A 1 339 ? -16.882 -40.736 -23.272 1.00  29.07 ? 1792 VAL A HG13 1 
ATOM   5488 H  HG21 . VAL A 1 339 ? -13.612 -43.087 -23.631 1.00  28.58 ? 1792 VAL A HG21 1 
ATOM   5489 H  HG22 . VAL A 1 339 ? -14.588 -42.895 -24.848 1.00  28.58 ? 1792 VAL A HG22 1 
ATOM   5490 H  HG23 . VAL A 1 339 ? -13.640 -41.721 -24.407 1.00  28.58 ? 1792 VAL A HG23 1 
ATOM   5491 N  N    . ALA A 1 340 ? -15.761 -39.438 -20.785 1.00  19.27 ? 1793 ALA A N    1 
ATOM   5492 C  CA   . ALA A 1 340 ? -16.694 -38.854 -19.821 1.00  18.84 ? 1793 ALA A CA   1 
ATOM   5493 C  C    . ALA A 1 340 ? -17.923 -38.252 -20.479 1.00  18.81 ? 1793 ALA A C    1 
ATOM   5494 O  O    . ALA A 1 340 ? -18.983 -38.151 -19.862 1.00  19.56 ? 1793 ALA A O    1 
ATOM   5495 C  CB   . ALA A 1 340 ? -15.984 -37.798 -18.976 1.00  19.60 ? 1793 ALA A CB   1 
ATOM   5496 H  H    . ALA A 1 340 ? -15.263 -38.862 -21.185 1.00  23.13 ? 1793 ALA A H    1 
ATOM   5497 H  HA   . ALA A 1 340 ? -16.999 -39.562 -19.215 1.00  22.60 ? 1793 ALA A HA   1 
ATOM   5498 H  HB1  . ALA A 1 340 ? -15.651 -37.108 -19.555 1.00  23.52 ? 1793 ALA A HB1  1 
ATOM   5499 H  HB2  . ALA A 1 340 ? -16.610 -37.426 -18.350 1.00  23.52 ? 1793 ALA A HB2  1 
ATOM   5500 H  HB3  . ALA A 1 340 ? -15.257 -38.211 -18.505 1.00  23.52 ? 1793 ALA A HB3  1 
ATOM   5501 N  N    . TYR A 1 341 ? -17.782 -37.839 -21.729 1.00  19.16 ? 1794 TYR A N    1 
ATOM   5502 C  CA   . TYR A 1 341 ? -18.870 -37.179 -22.439 1.00  18.71 ? 1794 TYR A CA   1 
ATOM   5503 C  C    . TYR A 1 341 ? -18.668 -37.329 -23.935 1.00  19.41 ? 1794 TYR A C    1 
ATOM   5504 O  O    . TYR A 1 341 ? -17.563 -37.139 -24.433 1.00  20.50 ? 1794 TYR A O    1 
ATOM   5505 C  CB   . TYR A 1 341 ? -18.892 -35.684 -22.079 1.00  19.68 ? 1794 TYR A CB   1 
ATOM   5506 C  CG   . TYR A 1 341 ? -19.902 -34.854 -22.845 1.00  19.98 ? 1794 TYR A CG   1 
ATOM   5507 C  CD1  . TYR A 1 341 ? -21.240 -34.808 -22.445 1.00  20.46 ? 1794 TYR A CD1  1 
ATOM   5508 C  CD2  . TYR A 1 341 ? -19.531 -34.113 -23.955 1.00  20.22 ? 1794 TYR A CD2  1 
ATOM   5509 C  CE1  . TYR A 1 341 ? -22.177 -34.057 -23.139 1.00  20.63 ? 1794 TYR A CE1  1 
ATOM   5510 C  CE2  . TYR A 1 341 ? -20.473 -33.341 -24.653 1.00  21.97 ? 1794 TYR A CE2  1 
ATOM   5511 C  CZ   . TYR A 1 341 ? -21.786 -33.317 -24.234 1.00  21.94 ? 1794 TYR A CZ   1 
ATOM   5512 O  OH   . TYR A 1 341 ? -22.724 -32.563 -24.917 1.00  23.21 ? 1794 TYR A OH   1 
ATOM   5513 H  H    . TYR A 1 341 ? -17.064 -37.929 -22.193 1.00  22.99 ? 1794 TYR A H    1 
ATOM   5514 H  HA   . TYR A 1 341 ? -19.728 -37.581 -22.190 1.00  22.45 ? 1794 TYR A HA   1 
ATOM   5515 H  HB2  . TYR A 1 341 ? -19.098 -35.597 -21.135 1.00  23.62 ? 1794 TYR A HB2  1 
ATOM   5516 H  HB3  . TYR A 1 341 ? -18.014 -35.311 -22.255 1.00  23.62 ? 1794 TYR A HB3  1 
ATOM   5517 H  HD1  . TYR A 1 341 ? -18.645 -34.122 -24.238 1.00  24.26 ? 1794 TYR A HD1  1 
ATOM   5518 H  HD2  . TYR A 1 341 ? -21.510 -35.301 -21.704 1.00  24.55 ? 1794 TYR A HD2  1 
ATOM   5519 H  HE1  . TYR A 1 341 ? -20.212 -32.847 -25.396 1.00  26.36 ? 1794 TYR A HE1  1 
ATOM   5520 H  HE2  . TYR A 1 341 ? -23.062 -34.037 -22.854 1.00  24.76 ? 1794 TYR A HE2  1 
ATOM   5521 H  HH   . TYR A 1 341 ? -23.052 -32.002 -24.417 1.00  27.85 ? 1794 TYR A HH   1 
ATOM   5522 N  N    . ILE A 1 342 ? -19.734 -37.678 -24.642 1.00  19.84 ? 1795 ILE A N    1 
ATOM   5523 C  CA   . ILE A 1 342 ? -19.763 -37.593 -26.100 1.00  21.49 ? 1795 ILE A CA   1 
ATOM   5524 C  C    . ILE A 1 342 ? -21.117 -37.099 -26.548 1.00  22.37 ? 1795 ILE A C    1 
ATOM   5525 O  O    . ILE A 1 342 ? -22.133 -37.715 -26.249 1.00  22.51 ? 1795 ILE A O    1 
ATOM   5526 C  CB   . ILE A 1 342 ? -19.591 -38.951 -26.798 1.00  23.46 ? 1795 ILE A CB   1 
ATOM   5527 C  CG1  . ILE A 1 342 ? -18.235 -39.565 -26.512 1.00  24.91 ? 1795 ILE A CG1  1 
ATOM   5528 C  CG2  . ILE A 1 342 ? -19.760 -38.798 -28.308 1.00  24.94 ? 1795 ILE A CG2  1 
ATOM   5529 C  CD1  . ILE A 1 342 ? -18.052 -40.918 -27.185 1.00  25.79 ? 1795 ILE A CD1  1 
ATOM   5530 H  H    . ILE A 1 342 ? -20.466 -37.972 -24.298 1.00  23.80 ? 1795 ILE A H    1 
ATOM   5531 H  HA   . ILE A 1 342 ? -19.071 -36.975 -26.418 1.00  25.78 ? 1795 ILE A HA   1 
ATOM   5532 H  HB   . ILE A 1 342 ? -20.277 -39.554 -26.471 1.00  28.16 ? 1795 ILE A HB   1 
ATOM   5533 H  HG12 . ILE A 1 342 ? -17.543 -38.970 -26.840 1.00  29.90 ? 1795 ILE A HG12 1 
ATOM   5534 H  HG13 . ILE A 1 342 ? -18.140 -39.690 -25.555 1.00  29.90 ? 1795 ILE A HG13 1 
ATOM   5535 H  HG21 . ILE A 1 342 ? -19.096 -38.187 -28.635 1.00  29.93 ? 1795 ILE A HG21 1 
ATOM   5536 H  HG22 . ILE A 1 342 ? -19.649 -39.656 -28.723 1.00  29.93 ? 1795 ILE A HG22 1 
ATOM   5537 H  HG23 . ILE A 1 342 ? -20.639 -38.456 -28.490 1.00  29.93 ? 1795 ILE A HG23 1 
ATOM   5538 H  HD11 . ILE A 1 342 ? -18.137 -40.808 -28.135 1.00  30.95 ? 1795 ILE A HD11 1 
ATOM   5539 H  HD12 . ILE A 1 342 ? -17.180 -41.257 -26.971 1.00  30.95 ? 1795 ILE A HD12 1 
ATOM   5540 H  HD13 . ILE A 1 342 ? -18.727 -41.520 -26.863 1.00  30.95 ? 1795 ILE A HD13 1 
ATOM   5541 N  N    . ASP A 1 343 ? -21.125 -36.010 -27.298 1.00  23.41 ? 1796 ASP A N    1 
ATOM   5542 C  CA   . ASP A 1 343 ? -22.312 -35.556 -28.015 1.00  25.10 ? 1796 ASP A CA   1 
ATOM   5543 C  C    . ASP A 1 343 ? -23.644 -35.709 -27.299 1.00  25.41 ? 1796 ASP A C    1 
ATOM   5544 O  O    . ASP A 1 343 ? -24.556 -36.351 -27.796 1.00  25.67 ? 1796 ASP A O    1 
ATOM   5545 C  CB   . ASP A 1 343 ? -22.386 -36.268 -29.352 1.00  26.13 ? 1796 ASP A CB   1 
ATOM   5546 C  CG   . ASP A 1 343 ? -21.202 -35.944 -30.231 1.00  27.68 ? 1796 ASP A CG   1 
ATOM   5547 O  OD1  . ASP A 1 343 ? -20.630 -34.840 -30.080 1.00  29.06 ? 1796 ASP A OD1  1 
ATOM   5548 O  OD2  . ASP A 1 343 ? -20.834 -36.790 -31.066 1.00  27.35 ? 1796 ASP A OD2  1 
ATOM   5549 H  H    . ASP A 1 343 ? -20.440 -35.502 -27.412 1.00  28.09 ? 1796 ASP A H    1 
ATOM   5550 H  HA   . ASP A 1 343 ? -22.200 -34.601 -28.204 1.00  30.12 ? 1796 ASP A HA   1 
ATOM   5551 H  HB2  . ASP A 1 343 ? -22.398 -37.227 -29.203 1.00  31.36 ? 1796 ASP A HB2  1 
ATOM   5552 H  HB3  . ASP A 1 343 ? -23.191 -35.992 -29.816 1.00  31.36 ? 1796 ASP A HB3  1 
ATOM   5553 N  N    . GLY A 1 344 ? -23.771 -35.074 -26.149 1.00  27.01 ? 1797 GLY A N    1 
ATOM   5554 C  CA   . GLY A 1 344 ? -25.039 -35.008 -25.467 1.00  28.87 ? 1797 GLY A CA   1 
ATOM   5555 C  C    . GLY A 1 344 ? -25.232 -36.108 -24.456 1.00  30.14 ? 1797 GLY A C    1 
ATOM   5556 O  O    . GLY A 1 344 ? -26.275 -36.170 -23.816 1.00  33.78 ? 1797 GLY A O    1 
ATOM   5557 H  H    . GLY A 1 344 ? -23.129 -34.671 -25.742 1.00  32.41 ? 1797 GLY A H    1 
ATOM   5558 H  HA2  . GLY A 1 344 ? -25.111 -34.157 -25.007 1.00  34.65 ? 1797 GLY A HA2  1 
ATOM   5559 H  HA3  . GLY A 1 344 ? -25.756 -35.064 -26.118 1.00  34.65 ? 1797 GLY A HA3  1 
ATOM   5560 N  N    . GLN A 1 345 ? -24.252 -36.989 -24.308 1.00  27.36 ? 1798 GLN A N    1 
ATOM   5561 C  CA   . GLN A 1 345 ? -24.379 -38.048 -23.317 1.00  27.65 ? 1798 GLN A CA   1 
ATOM   5562 C  C    . GLN A 1 345 ? -23.184 -38.100 -22.383 1.00  25.46 ? 1798 GLN A C    1 
ATOM   5563 O  O    . GLN A 1 345 ? -22.033 -38.162 -22.821 1.00  25.31 ? 1798 GLN A O    1 
ATOM   5564 C  CB   . GLN A 1 345 ? -24.599 -39.404 -23.988 1.00  30.51 ? 1798 GLN A CB   1 
ATOM   5565 C  CG   . GLN A 1 345 ? -24.725 -40.539 -22.980 1.00  33.68 ? 1798 GLN A CG   1 
ATOM   5566 C  CD   . GLN A 1 345 ? -25.801 -41.535 -23.336 1.00  35.57 ? 1798 GLN A CD   1 
ATOM   5567 O  OE1  . GLN A 1 345 ? -26.027 -41.830 -24.505 1.00  37.41 ? 1798 GLN A OE1  1 
ATOM   5568 N  NE2  . GLN A 1 345 ? -26.470 -42.066 -22.326 1.00  36.78 ? 1798 GLN A NE2  1 
ATOM   5569 H  H    . GLN A 1 345 ? -23.519 -36.998 -24.758 1.00  32.83 ? 1798 GLN A H    1 
ATOM   5570 H  HA   . GLN A 1 345 ? -25.170 -37.862 -22.769 1.00  33.18 ? 1798 GLN A HA   1 
ATOM   5571 H  HB2  . GLN A 1 345 ? -25.418 -39.372 -24.508 1.00  36.61 ? 1798 GLN A HB2  1 
ATOM   5572 H  HB3  . GLN A 1 345 ? -23.845 -39.598 -24.566 1.00  36.61 ? 1798 GLN A HB3  1 
ATOM   5573 H  HG2  . GLN A 1 345 ? -23.881 -41.015 -22.936 1.00  40.42 ? 1798 GLN A HG2  1 
ATOM   5574 H  HG3  . GLN A 1 345 ? -24.940 -40.166 -22.111 1.00  40.42 ? 1798 GLN A HG3  1 
ATOM   5575 H  HE21 . GLN A 1 345 ? -26.282 -41.838 -21.518 1.00  44.13 ? 1798 GLN A HE21 1 
ATOM   5576 H  HE22 . GLN A 1 345 ? -27.093 -42.639 -22.477 1.00  44.13 ? 1798 GLN A HE22 1 
ATOM   5577 N  N    . VAL A 1 346 ? -23.475 -38.073 -21.089 1.00  24.19 ? 1799 VAL A N    1 
ATOM   5578 C  CA   . VAL A 1 346 ? -22.445 -38.218 -20.071 1.00  23.02 ? 1799 VAL A CA   1 
ATOM   5579 C  C    . VAL A 1 346 ? -22.260 -39.709 -19.794 1.00  24.15 ? 1799 VAL A C    1 
ATOM   5580 O  O    . VAL A 1 346 ? -23.241 -40.460 -19.636 1.00  27.02 ? 1799 VAL A O    1 
ATOM   5581 C  CB   . VAL A 1 346 ? -22.798 -37.411 -18.803 1.00  24.92 ? 1799 VAL A CB   1 
ATOM   5582 C  CG1  . VAL A 1 346 ? -21.862 -37.741 -17.669 1.00  26.24 ? 1799 VAL A CG1  1 
ATOM   5583 C  CG2  . VAL A 1 346 ? -22.715 -35.929 -19.104 1.00  26.48 ? 1799 VAL A CG2  1 
ATOM   5584 H  H    . VAL A 1 346 ? -24.268 -37.972 -20.773 1.00  29.03 ? 1799 VAL A H    1 
ATOM   5585 H  HA   . VAL A 1 346 ? -21.599 -37.870 -20.424 1.00  27.62 ? 1799 VAL A HA   1 
ATOM   5586 H  HB   . VAL A 1 346 ? -23.713 -37.622 -18.524 1.00  29.90 ? 1799 VAL A HB   1 
ATOM   5587 H  HG11 . VAL A 1 346 ? -20.964 -37.527 -17.932 1.00  31.49 ? 1799 VAL A HG11 1 
ATOM   5588 H  HG12 . VAL A 1 346 ? -22.110 -37.223 -16.899 1.00  31.49 ? 1799 VAL A HG12 1 
ATOM   5589 H  HG13 . VAL A 1 346 ? -21.931 -38.678 -17.469 1.00  31.49 ? 1799 VAL A HG13 1 
ATOM   5590 H  HG21 . VAL A 1 346 ? -23.336 -35.717 -19.804 1.00  31.78 ? 1799 VAL A HG21 1 
ATOM   5591 H  HG22 . VAL A 1 346 ? -22.936 -35.437 -18.310 1.00  31.78 ? 1799 VAL A HG22 1 
ATOM   5592 H  HG23 . VAL A 1 346 ? -21.821 -35.716 -19.383 1.00  31.78 ? 1799 VAL A HG23 1 
ATOM   5593 N  N    . LEU A 1 347 ? -21.001 -40.142 -19.768 1.00  24.82 ? 1800 LEU A N    1 
ATOM   5594 C  CA   . LEU A 1 347 ? -20.678 -41.567 -19.772 1.00  26.64 ? 1800 LEU A CA   1 
ATOM   5595 C  C    . LEU A 1 347 ? -19.807 -41.995 -18.591 1.00  27.88 ? 1800 LEU A C    1 
ATOM   5596 O  O    . LEU A 1 347 ? -19.286 -43.118 -18.580 1.00  31.28 ? 1800 LEU A O    1 
ATOM   5597 C  CB   . LEU A 1 347 ? -19.998 -41.931 -21.094 1.00  27.38 ? 1800 LEU A CB   1 
ATOM   5598 C  CG   . LEU A 1 347 ? -20.860 -41.752 -22.347 1.00  27.65 ? 1800 LEU A CG   1 
ATOM   5599 C  CD1  . LEU A 1 347 ? -19.999 -41.804 -23.607 1.00  29.44 ? 1800 LEU A CD1  1 
ATOM   5600 C  CD2  . LEU A 1 347 ? -21.924 -42.833 -22.415 1.00  27.74 ? 1800 LEU A CD2  1 
ATOM   5601 H  H    . LEU A 1 347 ? -20.312 -39.628 -19.747 1.00  29.78 ? 1800 LEU A H    1 
ATOM   5602 H  HA   . LEU A 1 347 ? -21.515 -42.075 -19.720 1.00  31.97 ? 1800 LEU A HA   1 
ATOM   5603 H  HB2  . LEU A 1 347 ? -19.212 -41.373 -21.199 1.00  32.86 ? 1800 LEU A HB2  1 
ATOM   5604 H  HB3  . LEU A 1 347 ? -19.731 -42.863 -21.055 1.00  32.86 ? 1800 LEU A HB3  1 
ATOM   5605 H  HG   . LEU A 1 347 ? -21.302 -40.889 -22.313 1.00  33.18 ? 1800 LEU A HG   1 
ATOM   5606 H  HD11 . LEU A 1 347 ? -19.557 -42.656 -23.648 1.00  35.33 ? 1800 LEU A HD11 1 
ATOM   5607 H  HD12 . LEU A 1 347 ? -20.562 -41.690 -24.375 1.00  35.33 ? 1800 LEU A HD12 1 
ATOM   5608 H  HD13 . LEU A 1 347 ? -19.348 -41.100 -23.569 1.00  35.33 ? 1800 LEU A HD13 1 
ATOM   5609 H  HD21 . LEU A 1 347 ? -22.481 -42.773 -21.636 1.00  33.28 ? 1800 LEU A HD21 1 
ATOM   5610 H  HD22 . LEU A 1 347 ? -22.452 -42.702 -23.206 1.00  33.28 ? 1800 LEU A HD22 1 
ATOM   5611 H  HD23 . LEU A 1 347 ? -21.495 -43.692 -22.445 1.00  33.28 ? 1800 LEU A HD23 1 
ATOM   5612 N  N    . VAL A 1 348 ? -19.627 -41.097 -17.616 1.00  24.95 ? 1801 VAL A N    1 
ATOM   5613 C  CA   . VAL A 1 348 ? -19.083 -41.476 -16.317 1.00  23.22 ? 1801 VAL A CA   1 
ATOM   5614 C  C    . VAL A 1 348 ? -20.151 -41.286 -15.246 1.00  23.37 ? 1801 VAL A C    1 
ATOM   5615 O  O    . VAL A 1 348 ? -20.925 -40.337 -15.291 1.00  23.17 ? 1801 VAL A O    1 
ATOM   5616 C  CB   . VAL A 1 348 ? -17.806 -40.687 -15.939 1.00  23.51 ? 1801 VAL A CB   1 
ATOM   5617 C  CG1  . VAL A 1 348 ? -16.601 -41.210 -16.714 1.00  24.58 ? 1801 VAL A CG1  1 
ATOM   5618 C  CG2  . VAL A 1 348 ? -18.012 -39.190 -16.154 1.00  23.26 ? 1801 VAL A CG2  1 
ATOM   5619 H  H    . VAL A 1 348 ? -19.814 -40.261 -17.687 1.00  29.94 ? 1801 VAL A H    1 
ATOM   5620 H  HA   . VAL A 1 348 ? -18.849 -42.428 -16.340 1.00  27.87 ? 1801 VAL A HA   1 
ATOM   5621 H  HB   . VAL A 1 348 ? -17.626 -40.826 -14.986 1.00  28.21 ? 1801 VAL A HB   1 
ATOM   5622 H  HG11 . VAL A 1 348 ? -16.766 -41.108 -17.654 1.00  29.50 ? 1801 VAL A HG11 1 
ATOM   5623 H  HG12 . VAL A 1 348 ? -15.824 -40.705 -16.461 1.00  29.50 ? 1801 VAL A HG12 1 
ATOM   5624 H  HG13 . VAL A 1 348 ? -16.472 -42.137 -16.502 1.00  29.50 ? 1801 VAL A HG13 1 
ATOM   5625 H  HG21 . VAL A 1 348 ? -18.740 -38.892 -15.603 1.00  27.92 ? 1801 VAL A HG21 1 
ATOM   5626 H  HG22 . VAL A 1 348 ? -17.207 -38.726 -15.913 1.00  27.92 ? 1801 VAL A HG22 1 
ATOM   5627 H  HG23 . VAL A 1 348 ? -18.216 -39.032 -17.079 1.00  27.92 ? 1801 VAL A HG23 1 
ATOM   5628 N  N    . PRO A 1 349 ? -20.203 -42.206 -14.279 1.00  23.28 ? 1802 PRO A N    1 
ATOM   5629 C  CA   . PRO A 1 349 ? -21.252 -42.202 -13.257 1.00  22.83 ? 1802 PRO A CA   1 
ATOM   5630 C  C    . PRO A 1 349 ? -20.986 -41.208 -12.133 1.00  20.72 ? 1802 PRO A C    1 
ATOM   5631 O  O    . PRO A 1 349 ? -19.856 -40.742 -11.969 1.00  20.03 ? 1802 PRO A O    1 
ATOM   5632 C  CB   . PRO A 1 349 ? -21.175 -43.620 -12.704 1.00  24.21 ? 1802 PRO A CB   1 
ATOM   5633 C  CG   . PRO A 1 349 ? -19.730 -43.953 -12.830 1.00  24.93 ? 1802 PRO A CG   1 
ATOM   5634 C  CD   . PRO A 1 349 ? -19.298 -43.358 -14.131 1.00  24.30 ? 1802 PRO A CD   1 
ATOM   5635 H  HA   . PRO A 1 349 ? -22.134 -42.041 -13.653 1.00  27.40 ? 1802 PRO A HA   1 
ATOM   5636 H  HB2  . PRO A 1 349 ? -21.456 -43.630 -11.776 1.00  29.06 ? 1802 PRO A HB2  1 
ATOM   5637 H  HB3  . PRO A 1 349 ? -21.719 -44.216 -13.242 1.00  29.06 ? 1802 PRO A HB3  1 
ATOM   5638 H  HG2  . PRO A 1 349 ? -19.239 -43.558 -12.093 1.00  29.91 ? 1802 PRO A HG2  1 
ATOM   5639 H  HG3  . PRO A 1 349 ? -19.617 -44.916 -12.840 1.00  29.91 ? 1802 PRO A HG3  1 
ATOM   5640 H  HD2  . PRO A 1 349 ? -18.376 -43.062 -14.080 1.00  29.15 ? 1802 PRO A HD2  1 
ATOM   5641 H  HD3  . PRO A 1 349 ? -19.432 -43.990 -14.855 1.00  29.15 ? 1802 PRO A HD3  1 
ATOM   5642 N  N    . PRO A 1 350 ? -22.027 -40.884 -11.360 1.00  21.00 ? 1803 PRO A N    1 
ATOM   5643 C  CA   . PRO A 1 350 ? -21.809 -40.111 -10.139 1.00  20.38 ? 1803 PRO A CA   1 
ATOM   5644 C  C    . PRO A 1 350 ? -20.802 -40.834 -9.254  1.00  20.15 ? 1803 PRO A C    1 
ATOM   5645 O  O    . PRO A 1 350 ? -20.911 -42.048 -9.051  1.00  22.30 ? 1803 PRO A O    1 
ATOM   5646 C  CB   . PRO A 1 350 ? -23.201 -40.067 -9.496  1.00  20.72 ? 1803 PRO A CB   1 
ATOM   5647 C  CG   . PRO A 1 350 ? -24.159 -40.320 -10.626 1.00  21.86 ? 1803 PRO A CG   1 
ATOM   5648 C  CD   . PRO A 1 350 ? -23.436 -41.286 -11.527 1.00  21.12 ? 1803 PRO A CD   1 
ATOM   5649 H  HA   . PRO A 1 350 ? -21.498 -39.204 -10.343 1.00  24.45 ? 1803 PRO A HA   1 
ATOM   5650 H  HB2  . PRO A 1 350 ? -23.273 -40.761 -8.822  1.00  24.86 ? 1803 PRO A HB2  1 
ATOM   5651 H  HB3  . PRO A 1 350 ? -23.354 -39.192 -9.105  1.00  24.86 ? 1803 PRO A HB3  1 
ATOM   5652 H  HG2  . PRO A 1 350 ? -24.976 -40.714 -10.283 1.00  26.24 ? 1803 PRO A HG2  1 
ATOM   5653 H  HG3  . PRO A 1 350 ? -24.345 -39.489 -11.091 1.00  26.24 ? 1803 PRO A HG3  1 
ATOM   5654 H  HD2  . PRO A 1 350 ? -23.569 -42.198 -11.224 1.00  25.34 ? 1803 PRO A HD2  1 
ATOM   5655 H  HD3  . PRO A 1 350 ? -23.718 -41.169 -12.447 1.00  25.34 ? 1803 PRO A HD3  1 
ATOM   5656 N  N    . GLY A 1 351 ? -19.809 -40.101 -8.763  1.00  20.04 ? 1804 GLY A N    1 
ATOM   5657 C  CA   . GLY A 1 351 ? -18.785 -40.685 -7.927  1.00  19.87 ? 1804 GLY A CA   1 
ATOM   5658 C  C    . GLY A 1 351 ? -17.471 -40.903 -8.650  1.00  19.72 ? 1804 GLY A C    1 
ATOM   5659 O  O    . GLY A 1 351 ? -16.473 -41.230 -8.019  1.00  20.98 ? 1804 GLY A O    1 
ATOM   5660 H  H    . GLY A 1 351 ? -19.710 -39.259 -8.904  1.00  24.05 ? 1804 GLY A H    1 
ATOM   5661 H  HA2  . GLY A 1 351 ? -18.622 -40.103 -7.168  1.00  23.85 ? 1804 GLY A HA2  1 
ATOM   5662 H  HA3  . GLY A 1 351 ? -19.094 -41.541 -7.593  1.00  23.85 ? 1804 GLY A HA3  1 
ATOM   5663 N  N    . TYR A 1 352 ? -17.449 -40.729 -9.968  1.00  19.38 ? 1805 TYR A N    1 
ATOM   5664 C  CA   . TYR A 1 352 ? -16.196 -40.864 -10.712 1.00  19.19 ? 1805 TYR A CA   1 
ATOM   5665 C  C    . TYR A 1 352 ? -15.214 -39.753 -10.328 1.00  17.57 ? 1805 TYR A C    1 
ATOM   5666 O  O    . TYR A 1 352 ? -14.001 -39.944 -10.305 1.00  18.42 ? 1805 TYR A O    1 
ATOM   5667 C  CB   . TYR A 1 352 ? -16.450 -40.825 -12.215 1.00  18.88 ? 1805 TYR A CB   1 
ATOM   5668 C  CG   . TYR A 1 352 ? -15.190 -41.045 -13.023 1.00  18.36 ? 1805 TYR A CG   1 
ATOM   5669 C  CD1  . TYR A 1 352 ? -14.589 -42.296 -13.097 1.00  19.32 ? 1805 TYR A CD1  1 
ATOM   5670 C  CD2  . TYR A 1 352 ? -14.586 -39.998 -13.692 1.00  19.01 ? 1805 TYR A CD2  1 
ATOM   5671 C  CE1  . TYR A 1 352 ? -13.425 -42.482 -13.819 1.00  20.30 ? 1805 TYR A CE1  1 
ATOM   5672 C  CE2  . TYR A 1 352 ? -13.434 -40.179 -14.418 1.00  19.11 ? 1805 TYR A CE2  1 
ATOM   5673 C  CZ   . TYR A 1 352 ? -12.854 -41.420 -14.482 1.00  19.06 ? 1805 TYR A CZ   1 
ATOM   5674 O  OH   . TYR A 1 352 ? -11.692 -41.611 -15.202 1.00  20.54 ? 1805 TYR A OH   1 
ATOM   5675 H  H    . TYR A 1 352 ? -18.133 -40.534 -10.452 1.00  23.26 ? 1805 TYR A H    1 
ATOM   5676 H  HA   . TYR A 1 352 ? -15.783 -41.726 -10.493 1.00  23.03 ? 1805 TYR A HA   1 
ATOM   5677 H  HB2  . TYR A 1 352 ? -17.082 -41.524 -12.447 1.00  22.66 ? 1805 TYR A HB2  1 
ATOM   5678 H  HB3  . TYR A 1 352 ? -16.812 -39.957 -12.452 1.00  22.66 ? 1805 TYR A HB3  1 
ATOM   5679 H  HD1  . TYR A 1 352 ? -14.971 -39.152 -13.654 1.00  22.81 ? 1805 TYR A HD1  1 
ATOM   5680 H  HD2  . TYR A 1 352 ? -14.970 -43.016 -12.649 1.00  23.19 ? 1805 TYR A HD2  1 
ATOM   5681 H  HE1  . TYR A 1 352 ? -13.045 -39.460 -14.863 1.00  22.93 ? 1805 TYR A HE1  1 
ATOM   5682 H  HE2  . TYR A 1 352 ? -13.033 -43.324 -13.865 1.00  24.36 ? 1805 TYR A HE2  1 
ATOM   5683 H  HH   . TYR A 1 352 ? -11.095 -41.136 -14.902 1.00  24.65 ? 1805 TYR A HH   1 
ATOM   5684 N  N    . GLY A 1 353 ? -15.758 -38.582 -10.034 1.00  16.75 ? 1806 GLY A N    1 
ATOM   5685 C  CA   . GLY A 1 353 ? -14.946 -37.436 -9.691  1.00  17.14 ? 1806 GLY A CA   1 
ATOM   5686 C  C    . GLY A 1 353 ? -14.268 -37.539 -8.342  1.00  16.37 ? 1806 GLY A C    1 
ATOM   5687 O  O    . GLY A 1 353 ? -14.769 -38.218 -7.428  1.00  17.54 ? 1806 GLY A O    1 
ATOM   5688 H  H    . GLY A 1 353 ? -16.604 -38.428 -10.026 1.00  20.10 ? 1806 GLY A H    1 
ATOM   5689 H  HA2  . GLY A 1 353 ? -14.258 -37.322 -10.366 1.00  20.57 ? 1806 GLY A HA2  1 
ATOM   5690 H  HA3  . GLY A 1 353 ? -15.503 -36.642 -9.690  1.00  20.57 ? 1806 GLY A HA3  1 
ATOM   5691 N  N    . GLN A 1 354 ? -13.134 -36.847 -8.217  1.00  16.27 ? 1807 GLN A N    1 
ATOM   5692 C  CA   . GLN A 1 354 ? -12.318 -36.889 -7.008  1.00  15.94 ? 1807 GLN A CA   1 
ATOM   5693 C  C    . GLN A 1 354 ? -11.967 -35.495 -6.520  1.00  15.28 ? 1807 GLN A C    1 
ATOM   5694 O  O    . GLN A 1 354 ? -11.943 -34.540 -7.290  1.00  15.55 ? 1807 GLN A O    1 
ATOM   5695 C  CB   . GLN A 1 354 ? -11.007 -37.640 -7.261  1.00  16.37 ? 1807 GLN A CB   1 
ATOM   5696 C  CG   . GLN A 1 354 ? -11.218 -39.099 -7.682  1.00  17.24 ? 1807 GLN A CG   1 
ATOM   5697 C  CD   . GLN A 1 354 ? -9.912  -39.818 -7.995  1.00  19.45 ? 1807 GLN A CD   1 
ATOM   5698 O  OE1  . GLN A 1 354 ? -8.841  -39.364 -7.618  1.00  21.63 ? 1807 GLN A OE1  1 
ATOM   5699 N  NE2  . GLN A 1 354 ? -10.006 -40.955 -8.686  1.00  21.73 ? 1807 GLN A NE2  1 
ATOM   5700 H  H    . GLN A 1 354 ? -12.813 -36.337 -8.831  1.00  19.53 ? 1807 GLN A H    1 
ATOM   5701 H  HA   . GLN A 1 354 ? -12.810 -37.353 -6.298  1.00  19.13 ? 1807 GLN A HA   1 
ATOM   5702 H  HB2  . GLN A 1 354 ? -10.520 -37.192 -7.971  1.00  19.64 ? 1807 GLN A HB2  1 
ATOM   5703 H  HB3  . GLN A 1 354 ? -10.480 -37.637 -6.447  1.00  19.64 ? 1807 GLN A HB3  1 
ATOM   5704 H  HG2  . GLN A 1 354 ? -11.657 -39.575 -6.960  1.00  20.68 ? 1807 GLN A HG2  1 
ATOM   5705 H  HG3  . GLN A 1 354 ? -11.771 -39.121 -8.479  1.00  20.68 ? 1807 GLN A HG3  1 
ATOM   5706 H  HE21 . GLN A 1 354 ? -10.777 -41.247 -8.931  1.00  26.08 ? 1807 GLN A HE21 1 
ATOM   5707 H  HE22 . GLN A 1 354 ? -9.295  -41.396 -8.886  1.00  26.08 ? 1807 GLN A HE22 1 
ATOM   5708 N  N    . ASP A 1 355 ? -11.714 -35.413 -5.220  1.00  15.65 ? 1808 ASP A N    1 
ATOM   5709 C  CA   . ASP A 1 355 ? -11.249 -34.198 -4.545  1.00  14.81 ? 1808 ASP A CA   1 
ATOM   5710 C  C    . ASP A 1 355 ? -9.775  -33.978 -4.852  1.00  14.38 ? 1808 ASP A C    1 
ATOM   5711 O  O    . ASP A 1 355 ? -8.897  -34.705 -4.344  1.00  15.88 ? 1808 ASP A O    1 
ATOM   5712 C  CB   . ASP A 1 355 ? -11.437 -34.378 -3.032  1.00  16.07 ? 1808 ASP A CB   1 
ATOM   5713 C  CG   . ASP A 1 355 ? -11.151 -33.119 -2.235  1.00  17.55 ? 1808 ASP A CG   1 
ATOM   5714 O  OD1  . ASP A 1 355 ? -10.595 -32.148 -2.779  1.00  16.77 ? 1808 ASP A OD1  1 
ATOM   5715 O  OD2  . ASP A 1 355 ? -11.483 -33.126 -1.021  1.00  19.93 ? 1808 ASP A OD2  1 
ATOM   5716 H  H    . ASP A 1 355 ? -11.808 -36.077 -4.681  1.00  18.78 ? 1808 ASP A H    1 
ATOM   5717 H  HA   . ASP A 1 355 ? -11.764 -33.421 -4.847  1.00  17.77 ? 1808 ASP A HA   1 
ATOM   5718 H  HB2  . ASP A 1 355 ? -12.356 -34.638 -2.859  1.00  19.29 ? 1808 ASP A HB2  1 
ATOM   5719 H  HB3  . ASP A 1 355 ? -10.834 -35.071 -2.721  1.00  19.29 ? 1808 ASP A HB3  1 
ATOM   5720 N  N    . VAL A 1 356 ? -9.482  -32.981 -5.683  1.00  13.73 ? 1809 VAL A N    1 
ATOM   5721 C  CA   . VAL A 1 356 ? -8.106  -32.802 -6.133  1.00  14.53 ? 1809 VAL A CA   1 
ATOM   5722 C  C    . VAL A 1 356 ? -7.178  -32.391 -4.987  1.00  14.36 ? 1809 VAL A C    1 
ATOM   5723 O  O    . VAL A 1 356 ? -5.955  -32.562 -5.083  1.00  15.52 ? 1809 VAL A O    1 
ATOM   5724 C  CB   . VAL A 1 356 ? -7.991  -31.805 -7.303  1.00  13.89 ? 1809 VAL A CB   1 
ATOM   5725 C  CG1  . VAL A 1 356 ? -8.882  -32.250 -8.462  1.00  14.84 ? 1809 VAL A CG1  1 
ATOM   5726 C  CG2  . VAL A 1 356 ? -8.339  -30.377 -6.853  1.00  13.86 ? 1809 VAL A CG2  1 
ATOM   5727 H  H    . VAL A 1 356 ? -10.045 -32.410 -5.993  1.00  16.48 ? 1809 VAL A H    1 
ATOM   5728 H  HA   . VAL A 1 356 ? -7.784  -33.667 -6.463  1.00  17.44 ? 1809 VAL A HA   1 
ATOM   5729 H  HB   . VAL A 1 356 ? -7.065  -31.800 -7.623  1.00  16.67 ? 1809 VAL A HB   1 
ATOM   5730 H  HG11 . VAL A 1 356 ? -9.793  -32.285 -8.160  1.00  17.81 ? 1809 VAL A HG11 1 
ATOM   5731 H  HG12 . VAL A 1 356 ? -8.798  -31.619 -9.180  1.00  17.81 ? 1809 VAL A HG12 1 
ATOM   5732 H  HG13 . VAL A 1 356 ? -8.601  -33.120 -8.755  1.00  17.81 ? 1809 VAL A HG13 1 
ATOM   5733 H  HG21 . VAL A 1 356 ? -7.731  -30.111 -6.159  1.00  16.64 ? 1809 VAL A HG21 1 
ATOM   5734 H  HG22 . VAL A 1 356 ? -8.257  -29.784 -7.604  1.00  16.64 ? 1809 VAL A HG22 1 
ATOM   5735 H  HG23 . VAL A 1 356 ? -9.240  -30.364 -6.522  1.00  16.64 ? 1809 VAL A HG23 1 
ATOM   5736 N  N    . ARG A 1 357 ? -7.739  -31.845 -3.902  1.00  14.22 ? 1810 ARG A N    1 
ATOM   5737 C  CA   . ARG A 1 357 ? -6.904  -31.474 -2.761  1.00  15.06 ? 1810 ARG A CA   1 
ATOM   5738 C  C    . ARG A 1 357 ? -6.337  -32.657 -1.998  1.00  16.31 ? 1810 ARG A C    1 
ATOM   5739 O  O    . ARG A 1 357 ? -5.422  -32.481 -1.191  1.00  18.51 ? 1810 ARG A O    1 
ATOM   5740 C  CB   . ARG A 1 357 ? -7.640  -30.523 -1.810  1.00  14.95 ? 1810 ARG A CB   1 
ATOM   5741 C  CG   . ARG A 1 357 ? -7.698  -29.094 -2.308  1.00  14.56 ? 1810 ARG A CG   1 
ATOM   5742 C  CD   . ARG A 1 357 ? -6.383  -28.332 -2.048  1.00  14.11 ? 1810 ARG A CD   1 
ATOM   5743 N  NE   . ARG A 1 357 ? -6.566  -26.916 -2.382  1.00  14.35 ? 1810 ARG A NE   1 
ATOM   5744 C  CZ   . ARG A 1 357 ? -6.016  -26.279 -3.414  1.00  13.21 ? 1810 ARG A CZ   1 
ATOM   5745 N  NH1  . ARG A 1 357 ? -5.157  -26.888 -4.232  1.00  14.35 ? 1810 ARG A NH1  1 
ATOM   5746 N  NH2  . ARG A 1 357 ? -6.327  -25.009 -3.631  1.00  13.45 ? 1810 ARG A NH2  1 
ATOM   5747 H  H    . ARG A 1 357 ? -8.578  -31.684 -3.805  1.00  17.06 ? 1810 ARG A H    1 
ATOM   5748 H  HA   . ARG A 1 357 ? -6.136  -30.977 -3.111  1.00  18.07 ? 1810 ARG A HA   1 
ATOM   5749 H  HB2  . ARG A 1 357 ? -8.551  -30.835 -1.696  1.00  17.94 ? 1810 ARG A HB2  1 
ATOM   5750 H  HB3  . ARG A 1 357 ? -7.183  -30.521 -0.954  1.00  17.94 ? 1810 ARG A HB3  1 
ATOM   5751 H  HG2  . ARG A 1 357 ? -7.861  -29.097 -3.264  1.00  17.47 ? 1810 ARG A HG2  1 
ATOM   5752 H  HG3  . ARG A 1 357 ? -8.414  -28.626 -1.849  1.00  17.47 ? 1810 ARG A HG3  1 
ATOM   5753 H  HD2  . ARG A 1 357 ? -6.145  -28.402 -1.110  1.00  16.93 ? 1810 ARG A HD2  1 
ATOM   5754 H  HD3  . ARG A 1 357 ? -5.679  -28.695 -2.607  1.00  16.93 ? 1810 ARG A HD3  1 
ATOM   5755 H  HE   . ARG A 1 357 ? -7.074  -26.455 -1.864  1.00  17.22 ? 1810 ARG A HE   1 
ATOM   5756 H  HH11 . ARG A 1 357 ? -4.961  -27.717 -4.111  1.00  16.14 ? 1810 ARG A HH11 1 
ATOM   5757 H  HH12 . ARG A 1 357 ? -4.806  -26.455 -4.887  1.00  16.14 ? 1810 ARG A HH12 1 
ATOM   5758 H  HH21 . ARG A 1 357 ? -6.867  -24.602 -3.101  1.00  17.22 ? 1810 ARG A HH21 1 
ATOM   5759 H  HH22 . ARG A 1 357 ? -5.955  -24.580 -4.277  1.00  17.22 ? 1810 ARG A HH22 1 
ATOM   5760 N  N    . LYS A 1 358 ? -6.846  -33.854 -2.277  1.00  17.58 ? 1811 LYS A N    1 
ATOM   5761 C  CA   . LYS A 1 358 ? -6.339  -35.072 -1.661  1.00  18.99 ? 1811 LYS A CA   1 
ATOM   5762 C  C    . LYS A 1 358 ? -5.233  -35.720 -2.485  1.00  19.07 ? 1811 LYS A C    1 
ATOM   5763 O  O    . LYS A 1 358 ? -4.561  -36.640 -2.018  1.00  21.61 ? 1811 LYS A O    1 
ATOM   5764 C  CB   . LYS A 1 358 ? -7.464  -36.081 -1.486  1.00  20.81 ? 1811 LYS A CB   1 
ATOM   5765 C  CG   . LYS A 1 358 ? -8.477  -35.694 -0.452  1.00  24.69 ? 1811 LYS A CG   1 
ATOM   5766 C  CD   . LYS A 1 358 ? -9.535  -36.765 -0.356  1.00  29.53 ? 1811 LYS A CD   1 
ATOM   5767 C  CE   . LYS A 1 358 ? -9.710  -37.201 1.067   1.00  33.90 ? 1811 LYS A CE   1 
ATOM   5768 N  NZ   . LYS A 1 358 ? -10.215 -36.077 1.869   1.00  35.63 ? 1811 LYS A NZ   1 
ATOM   5769 H  H    . LYS A 1 358 ? -7.493  -33.987 -2.826  1.00  21.09 ? 1811 LYS A H    1 
ATOM   5770 H  HA   . LYS A 1 358 ? -5.976  -34.859 -0.775  1.00  22.78 ? 1811 LYS A HA   1 
ATOM   5771 H  HB2  . LYS A 1 358 ? -7.928  -36.180 -2.332  1.00  24.97 ? 1811 LYS A HB2  1 
ATOM   5772 H  HB3  . LYS A 1 358 ? -7.081  -36.932 -1.220  1.00  24.97 ? 1811 LYS A HB3  1 
ATOM   5773 H  HG2  . LYS A 1 358 ? -8.045  -35.607 0.412   1.00  29.63 ? 1811 LYS A HG2  1 
ATOM   5774 H  HG3  . LYS A 1 358 ? -8.902  -34.861 -0.707  1.00  29.63 ? 1811 LYS A HG3  1 
ATOM   5775 H  HD2  . LYS A 1 358 ? -10.381 -36.414 -0.676  1.00  35.44 ? 1811 LYS A HD2  1 
ATOM   5776 H  HD3  . LYS A 1 358 ? -9.266  -37.534 -0.882  1.00  35.44 ? 1811 LYS A HD3  1 
ATOM   5777 H  HE2  . LYS A 1 358 ? -10.353 -37.926 1.109   1.00  40.68 ? 1811 LYS A HE2  1 
ATOM   5778 H  HE3  . LYS A 1 358 ? -8.855  -37.481 1.429   1.00  40.68 ? 1811 LYS A HE3  1 
ATOM   5779 H  HZ1  . LYS A 1 358 ? -10.999 -35.804 1.549   1.00  42.75 ? 1811 LYS A HZ1  1 
ATOM   5780 H  HZ2  . LYS A 1 358 ? -10.321 -36.331 2.715   1.00  42.75 ? 1811 LYS A HZ2  1 
ATOM   5781 H  HZ3  . LYS A 1 358 ? -9.639  -35.400 1.840   1.00  42.75 ? 1811 LYS A HZ3  1 
ATOM   5782 N  N    . TRP A 1 359 ? -5.062  -35.275 -3.724  1.00  18.31 ? 1812 TRP A N    1 
ATOM   5783 C  CA   . TRP A 1 359 ? -3.970  -35.777 -4.559  1.00  18.46 ? 1812 TRP A CA   1 
ATOM   5784 C  C    . TRP A 1 359 ? -2.658  -35.196 -4.047  1.00  20.39 ? 1812 TRP A C    1 
ATOM   5785 O  O    . TRP A 1 359 ? -2.628  -34.059 -3.607  1.00  21.61 ? 1812 TRP A O    1 
ATOM   5786 C  CB   . TRP A 1 359 ? -4.157  -35.334 -6.006  1.00  17.77 ? 1812 TRP A CB   1 
ATOM   5787 C  CG   . TRP A 1 359 ? -5.409  -35.842 -6.681  1.00  17.19 ? 1812 TRP A CG   1 
ATOM   5788 C  CD1  . TRP A 1 359 ? -6.304  -36.752 -6.199  1.00  17.11 ? 1812 TRP A CD1  1 
ATOM   5789 C  CD2  . TRP A 1 359 ? -5.859  -35.498 -7.992  1.00  16.08 ? 1812 TRP A CD2  1 
ATOM   5790 N  NE1  . TRP A 1 359 ? -7.298  -36.968 -7.121  1.00  17.75 ? 1812 TRP A NE1  1 
ATOM   5791 C  CE2  . TRP A 1 359 ? -7.042  -36.215 -8.233  1.00  16.86 ? 1812 TRP A CE2  1 
ATOM   5792 C  CE3  . TRP A 1 359 ? -5.376  -34.643 -8.987  1.00  16.02 ? 1812 TRP A CE3  1 
ATOM   5793 C  CZ2  . TRP A 1 359 ? -7.751  -36.098 -9.419  1.00  17.48 ? 1812 TRP A CZ2  1 
ATOM   5794 C  CZ3  . TRP A 1 359 ? -6.089  -34.524 -10.161 1.00  17.32 ? 1812 TRP A CZ3  1 
ATOM   5795 C  CH2  . TRP A 1 359 ? -7.260  -35.250 -10.373 1.00  17.66 ? 1812 TRP A CH2  1 
ATOM   5796 H  H    . TRP A 1 359 ? -5.559  -34.686 -4.106  1.00  21.97 ? 1812 TRP A H    1 
ATOM   5797 H  HA   . TRP A 1 359 ? -3.930  -36.755 -4.520  1.00  22.16 ? 1812 TRP A HA   1 
ATOM   5798 H  HB2  . TRP A 1 359 ? -4.186  -34.364 -6.029  1.00  21.32 ? 1812 TRP A HB2  1 
ATOM   5799 H  HB3  . TRP A 1 359 ? -3.399  -35.647 -6.523  1.00  21.32 ? 1812 TRP A HB3  1 
ATOM   5800 H  HD1  . TRP A 1 359 ? -6.256  -37.154 -5.362  1.00  20.54 ? 1812 TRP A HD1  1 
ATOM   5801 H  HE1  . TRP A 1 359 ? -7.966  -37.500 -7.020  1.00  21.30 ? 1812 TRP A HE1  1 
ATOM   5802 H  HE3  . TRP A 1 359 ? -4.597  -34.153 -8.853  1.00  19.22 ? 1812 TRP A HE3  1 
ATOM   5803 H  HZ2  . TRP A 1 359 ? -8.535  -36.578 -9.560  1.00  20.98 ? 1812 TRP A HZ2  1 
ATOM   5804 H  HZ3  . TRP A 1 359 ? -5.776  -33.958 -10.830 1.00  20.78 ? 1812 TRP A HZ3  1 
ATOM   5805 H  HH2  . TRP A 1 359 ? -7.718  -35.154 -11.177 1.00  21.20 ? 1812 TRP A HH2  1 
ATOM   5806 N  N    . PRO A 1 360 ? -1.565  -35.968 -4.121  1.00  23.28 ? 1813 PRO A N    1 
ATOM   5807 C  CA   . PRO A 1 360 ? -0.281  -35.427 -3.657  1.00  24.03 ? 1813 PRO A CA   1 
ATOM   5808 C  C    . PRO A 1 360 ? 0.102   -34.128 -4.376  1.00  24.14 ? 1813 PRO A C    1 
ATOM   5809 O  O    . PRO A 1 360 ? 0.651   -33.203 -3.766  1.00  26.69 ? 1813 PRO A O    1 
ATOM   5810 C  CB   . PRO A 1 360 ? 0.704   -36.546 -3.995  1.00  26.02 ? 1813 PRO A CB   1 
ATOM   5811 C  CG   . PRO A 1 360 ? -0.110  -37.781 -3.926  1.00  25.93 ? 1813 PRO A CG   1 
ATOM   5812 C  CD   . PRO A 1 360 ? -1.507  -37.415 -4.372  1.00  24.75 ? 1813 PRO A CD   1 
ATOM   5813 H  HA   . PRO A 1 360 ? -0.296  -35.279 -2.688  1.00  28.83 ? 1813 PRO A HA   1 
ATOM   5814 H  HB2  . PRO A 1 360 ? 1.058   -36.415 -4.888  1.00  31.22 ? 1813 PRO A HB2  1 
ATOM   5815 H  HB3  . PRO A 1 360 ? 1.418   -36.566 -3.339  1.00  31.22 ? 1813 PRO A HB3  1 
ATOM   5816 H  HG2  . PRO A 1 360 ? 0.269   -38.449 -4.519  1.00  31.12 ? 1813 PRO A HG2  1 
ATOM   5817 H  HG3  . PRO A 1 360 ? -0.121  -38.107 -3.013  1.00  31.12 ? 1813 PRO A HG3  1 
ATOM   5818 H  HD2  . PRO A 1 360 ? -1.621  -37.600 -5.317  1.00  29.70 ? 1813 PRO A HD2  1 
ATOM   5819 H  HD3  . PRO A 1 360 ? -2.167  -37.879 -3.834  1.00  29.70 ? 1813 PRO A HD3  1 
ATOM   5820 N  N    . GLN A 1 361 ? -0.227  -34.048 -5.656  1.00  23.14 ? 1814 GLN A N    1 
ATOM   5821 C  CA   . GLN A 1 361 ? 0.084   -32.882 -6.477  1.00  24.08 ? 1814 GLN A CA   1 
ATOM   5822 C  C    . GLN A 1 361 ? -0.859  -31.707 -6.183  1.00  21.58 ? 1814 GLN A C    1 
ATOM   5823 O  O    . GLN A 1 361 ? -0.629  -30.584 -6.619  1.00  21.87 ? 1814 GLN A O    1 
ATOM   5824 C  CB   . GLN A 1 361 ? -0.035  -33.221 -7.974  1.00  28.15 ? 1814 GLN A CB   1 
ATOM   5825 C  CG   . GLN A 1 361 ? 0.374   -34.616 -8.396  1.00  31.20 ? 1814 GLN A CG   1 
ATOM   5826 C  CD   . GLN A 1 361 ? -0.689  -35.671 -8.059  1.00  30.50 ? 1814 GLN A CD   1 
ATOM   5827 O  OE1  . GLN A 1 361 ? -0.756  -36.136 -6.942  1.00  31.36 ? 1814 GLN A OE1  1 
ATOM   5828 N  NE2  . GLN A 1 361 ? -1.526  -36.023 -9.022  1.00  31.00 ? 1814 GLN A NE2  1 
ATOM   5829 H  H    . GLN A 1 361 ? -0.639  -34.670 -6.084  1.00  27.77 ? 1814 GLN A H    1 
ATOM   5830 H  HA   . GLN A 1 361 ? 1.003   -32.593 -6.298  1.00  28.90 ? 1814 GLN A HA   1 
ATOM   5831 H  HB2  . GLN A 1 361 ? -0.961  -33.104 -8.237  1.00  33.78 ? 1814 GLN A HB2  1 
ATOM   5832 H  HB3  . GLN A 1 361 ? 0.519   -32.598 -8.470  1.00  33.78 ? 1814 GLN A HB3  1 
ATOM   5833 H  HG2  . GLN A 1 361 ? 0.515   -34.627 -9.356  1.00  37.44 ? 1814 GLN A HG2  1 
ATOM   5834 H  HG3  . GLN A 1 361 ? 1.194   -34.858 -7.937  1.00  37.44 ? 1814 GLN A HG3  1 
ATOM   5835 H  HE21 . GLN A 1 361 ? -1.462  -35.663 -9.800  1.00  37.21 ? 1814 GLN A HE21 1 
ATOM   5836 H  HE22 . GLN A 1 361 ? -2.135  -36.611 -8.869  1.00  37.21 ? 1814 GLN A HE22 1 
ATOM   5837 N  N    . GLY A 1 362 ? -1.941  -31.974 -5.459  1.00  19.83 ? 1815 GLY A N    1 
ATOM   5838 C  CA   . GLY A 1 362 ? -2.978  -30.984 -5.230  1.00  18.43 ? 1815 GLY A CA   1 
ATOM   5839 C  C    . GLY A 1 362 ? -2.890  -30.229 -3.925  1.00  17.96 ? 1815 GLY A C    1 
ATOM   5840 O  O    . GLY A 1 362 ? -3.707  -29.347 -3.673  1.00  19.03 ? 1815 GLY A O    1 
ATOM   5841 H  H    . GLY A 1 362 ? -2.096  -32.733 -5.086  1.00  23.79 ? 1815 GLY A H    1 
ATOM   5842 H  HA2  . GLY A 1 362 ? -2.953  -30.334 -5.950  1.00  22.12 ? 1815 GLY A HA2  1 
ATOM   5843 H  HA3  . GLY A 1 362 ? -3.842  -31.425 -5.259  1.00  22.12 ? 1815 GLY A HA3  1 
ATOM   5844 N  N    . ALA A 1 363 ? -1.911  -30.551 -3.092  1.00  18.92 ? 1816 ALA A N    1 
ATOM   5845 C  CA   . ALA A 1 363 ? -1.653  -29.773 -1.887  1.00  19.96 ? 1816 ALA A CA   1 
ATOM   5846 C  C    . ALA A 1 363 ? -0.983  -28.450 -2.263  1.00  19.88 ? 1816 ALA A C    1 
ATOM   5847 O  O    . ALA A 1 363 ? -0.157  -28.386 -3.174  1.00  20.74 ? 1816 ALA A O    1 
ATOM   5848 C  CB   . ALA A 1 363 ? -0.766  -30.550 -0.937  1.00  21.37 ? 1816 ALA A CB   1 
ATOM   5849 H  H    . ALA A 1 363 ? -1.379  -31.218 -3.202  1.00  22.71 ? 1816 ALA A H    1 
ATOM   5850 H  HA   . ALA A 1 363 ? -2.500  -29.577 -1.434  1.00  23.95 ? 1816 ALA A HA   1 
ATOM   5851 H  HB1  . ALA A 1 363 ? 0.067   -30.742 -1.374  1.00  25.65 ? 1816 ALA A HB1  1 
ATOM   5852 H  HB2  . ALA A 1 363 ? -0.609  -30.020 -0.152  1.00  25.65 ? 1816 ALA A HB2  1 
ATOM   5853 H  HB3  . ALA A 1 363 ? -1.206  -31.368 -0.697  1.00  25.65 ? 1816 ALA A HB3  1 
ATOM   5854 N  N    . VAL A 1 364 ? -1.355  -27.377 -1.579  1.00  19.21 ? 1817 VAL A N    1 
ATOM   5855 C  CA   . VAL A 1 364 ? -0.718  -26.092 -1.846  1.00  18.77 ? 1817 VAL A CA   1 
ATOM   5856 C  C    . VAL A 1 364 ? 0.635   -26.070 -1.131  1.00  19.23 ? 1817 VAL A C    1 
ATOM   5857 O  O    . VAL A 1 364 ? 0.707   -26.305 0.073   1.00  19.06 ? 1817 VAL A O    1 
ATOM   5858 C  CB   . VAL A 1 364 ? -1.573  -24.917 -1.351  1.00  17.98 ? 1817 VAL A CB   1 
ATOM   5859 C  CG1  . VAL A 1 364 ? -0.891  -23.596 -1.680  1.00  18.34 ? 1817 VAL A CG1  1 
ATOM   5860 C  CG2  . VAL A 1 364 ? -2.983  -24.975 -1.958  1.00  18.59 ? 1817 VAL A CG2  1 
ATOM   5861 H  H    . VAL A 1 364 ? -1.960  -27.363 -0.968  1.00  23.05 ? 1817 VAL A H    1 
ATOM   5862 H  HA   . VAL A 1 364 ? -0.567  -25.989 -2.809  1.00  22.52 ? 1817 VAL A HA   1 
ATOM   5863 H  HB   . VAL A 1 364 ? -1.662  -24.976 -0.377  1.00  21.58 ? 1817 VAL A HB   1 
ATOM   5864 H  HG11 . VAL A 1 364 ? -0.780  -23.531 -2.631  1.00  22.01 ? 1817 VAL A HG11 1 
ATOM   5865 H  HG12 . VAL A 1 364 ? -1.440  -22.874 -1.364  1.00  22.01 ? 1817 VAL A HG12 1 
ATOM   5866 H  HG13 . VAL A 1 364 ? -0.035  -23.571 -1.247  1.00  22.01 ? 1817 VAL A HG13 1 
ATOM   5867 H  HG21 . VAL A 1 364 ? -3.402  -25.798 -1.698  1.00  22.31 ? 1817 VAL A HG21 1 
ATOM   5868 H  HG22 . VAL A 1 364 ? -3.494  -24.230 -1.632  1.00  22.31 ? 1817 VAL A HG22 1 
ATOM   5869 H  HG23 . VAL A 1 364 ? -2.914  -24.930 -2.915  1.00  22.31 ? 1817 VAL A HG23 1 
ATOM   5870 N  N    . PRO A 1 365 ? 1.719   -25.791 -1.869  1.00  21.53 ? 1818 PRO A N    1 
ATOM   5871 C  CA   . PRO A 1 365 ? 3.023   -25.783 -1.204  1.00  21.84 ? 1818 PRO A CA   1 
ATOM   5872 C  C    . PRO A 1 365 ? 3.112   -24.752 -0.081  1.00  21.26 ? 1818 PRO A C    1 
ATOM   5873 O  O    . PRO A 1 365 ? 2.564   -23.665 -0.209  1.00  21.00 ? 1818 PRO A O    1 
ATOM   5874 C  CB   . PRO A 1 365 ? 3.987   -25.423 -2.340  1.00  23.01 ? 1818 PRO A CB   1 
ATOM   5875 C  CG   . PRO A 1 365 ? 3.282   -25.910 -3.591  1.00  24.39 ? 1818 PRO A CG   1 
ATOM   5876 C  CD   . PRO A 1 365 ? 1.834   -25.645 -3.331  1.00  23.20 ? 1818 PRO A CD   1 
ATOM   5877 H  HA   . PRO A 1 365 ? 3.240   -26.673 -0.856  1.00  26.21 ? 1818 PRO A HA   1 
ATOM   5878 H  HB2  . PRO A 1 365 ? 4.118   -24.462 -2.368  1.00  27.61 ? 1818 PRO A HB2  1 
ATOM   5879 H  HB3  . PRO A 1 365 ? 4.830   -25.885 -2.215  1.00  27.61 ? 1818 PRO A HB3  1 
ATOM   5880 H  HG2  . PRO A 1 365 ? 3.592   -25.407 -4.360  1.00  29.27 ? 1818 PRO A HG2  1 
ATOM   5881 H  HG3  . PRO A 1 365 ? 3.443   -26.859 -3.711  1.00  29.27 ? 1818 PRO A HG3  1 
ATOM   5882 H  HD2  . PRO A 1 365 ? 1.601   -24.742 -3.600  1.00  27.84 ? 1818 PRO A HD2  1 
ATOM   5883 H  HD3  . PRO A 1 365 ? 1.283   -26.304 -3.781  1.00  27.84 ? 1818 PRO A HD3  1 
ATOM   5884 N  N    . GLN A 1 366 ? 3.782   -25.091 1.013   1.00  22.09 ? 1819 GLN A N    1 
ATOM   5885 C  CA   . GLN A 1 366 ? 3.989   -24.127 2.087   1.00  23.86 ? 1819 GLN A CA   1 
ATOM   5886 C  C    . GLN A 1 366 ? 5.321   -24.385 2.752   1.00  24.96 ? 1819 GLN A C    1 
ATOM   5887 O  O    . GLN A 1 366 ? 5.867   -25.487 2.687   1.00  26.06 ? 1819 GLN A O    1 
ATOM   5888 C  CB   . GLN A 1 366 ? 2.854   -24.151 3.123   1.00  26.73 ? 1819 GLN A CB   1 
ATOM   5889 C  CG   . GLN A 1 366 ? 2.957   -25.262 4.121   1.00  27.97 ? 1819 GLN A CG   1 
ATOM   5890 C  CD   . GLN A 1 366 ? 1.808   -25.312 5.107   1.00  30.06 ? 1819 GLN A CD   1 
ATOM   5891 O  OE1  . GLN A 1 366 ? 0.955   -26.179 5.009   1.00  32.10 ? 1819 GLN A OE1  1 
ATOM   5892 N  NE2  . GLN A 1 366 ? 1.789   -24.392 6.065   1.00  30.63 ? 1819 GLN A NE2  1 
ATOM   5893 H  H    . GLN A 1 366 ? 4.125   -25.866 1.158   1.00  26.50 ? 1819 GLN A H    1 
ATOM   5894 H  HA   . GLN A 1 366 ? 4.019   -23.227 1.700   1.00  28.63 ? 1819 GLN A HA   1 
ATOM   5895 H  HB2  . GLN A 1 366 ? 2.861   -23.313 3.612   1.00  32.08 ? 1819 GLN A HB2  1 
ATOM   5896 H  HB3  . GLN A 1 366 ? 2.010   -24.251 2.656   1.00  32.08 ? 1819 GLN A HB3  1 
ATOM   5897 H  HG2  . GLN A 1 366 ? 2.976   -26.108 3.646   1.00  33.57 ? 1819 GLN A HG2  1 
ATOM   5898 H  HG3  . GLN A 1 366 ? 3.777   -25.151 4.628   1.00  33.57 ? 1819 GLN A HG3  1 
ATOM   5899 H  HE21 . GLN A 1 366 ? 2.412   -23.801 6.106   1.00  36.75 ? 1819 GLN A HE21 1 
ATOM   5900 H  HE22 . GLN A 1 366 ? 1.152   -24.387 6.643   1.00  36.75 ? 1819 GLN A HE22 1 
ATOM   5901 N  N    . LEU A 1 367 ? 5.853   -23.348 3.372   1.00  25.99 ? 1820 LEU A N    1 
ATOM   5902 C  CA   . LEU A 1 367 ? 7.069   -23.481 4.165   1.00  27.38 ? 1820 LEU A CA   1 
ATOM   5903 C  C    . LEU A 1 367 ? 6.787   -24.333 5.406   1.00  29.93 ? 1820 LEU A C    1 
ATOM   5904 O  O    . LEU A 1 367 ? 5.687   -24.292 5.943   1.00  30.57 ? 1820 LEU A O    1 
ATOM   5905 C  CB   . LEU A 1 367 ? 7.577   -22.100 4.580   1.00  28.90 ? 1820 LEU A CB   1 
ATOM   5906 C  CG   . LEU A 1 367 ? 7.980   -21.165 3.438   1.00  30.22 ? 1820 LEU A CG   1 
ATOM   5907 C  CD1  . LEU A 1 367 ? 8.469   -19.847 3.992   1.00  31.88 ? 1820 LEU A CD1  1 
ATOM   5908 C  CD2  . LEU A 1 367 ? 9.055   -21.798 2.561   1.00  29.67 ? 1820 LEU A CD2  1 
ATOM   5909 H  H    . LEU A 1 367 ? 5.530   -22.551 3.353   1.00  31.19 ? 1820 LEU A H    1 
ATOM   5910 H  HA   . LEU A 1 367 ? 7.763   -23.923 3.632   1.00  32.86 ? 1820 LEU A HA   1 
ATOM   5911 H  HB2  . LEU A 1 367 ? 6.877   -21.656 5.084   1.00  34.68 ? 1820 LEU A HB2  1 
ATOM   5912 H  HB3  . LEU A 1 367 ? 8.356   -22.218 5.145   1.00  34.68 ? 1820 LEU A HB3  1 
ATOM   5913 H  HG   . LEU A 1 367 ? 7.204   -20.989 2.883   1.00  36.26 ? 1820 LEU A HG   1 
ATOM   5914 H  HD11 . LEU A 1 367 ? 9.230   -20.008 4.555   1.00  38.26 ? 1820 LEU A HD11 1 
ATOM   5915 H  HD12 . LEU A 1 367 ? 8.717   -19.274 3.262   1.00  38.26 ? 1820 LEU A HD12 1 
ATOM   5916 H  HD13 . LEU A 1 367 ? 7.764   -19.441 4.502   1.00  38.26 ? 1820 LEU A HD13 1 
ATOM   5917 H  HD21 . LEU A 1 367 ? 8.713   -22.614 2.188   1.00  35.61 ? 1820 LEU A HD21 1 
ATOM   5918 H  HD22 . LEU A 1 367 ? 9.284   -21.187 1.857   1.00  35.61 ? 1820 LEU A HD22 1 
ATOM   5919 H  HD23 . LEU A 1 367 ? 9.829   -21.982 3.099   1.00  35.61 ? 1820 LEU A HD23 1 
ATOM   5920 N  N    . PRO A 1 368 ? 7.786   -25.100 5.867   1.00  32.63 ? 1821 PRO A N    1 
ATOM   5921 C  CA   . PRO A 1 368 ? 7.639   -25.968 7.043   1.00  34.94 ? 1821 PRO A CA   1 
ATOM   5922 C  C    . PRO A 1 368 ? 7.126   -25.209 8.264   1.00  36.37 ? 1821 PRO A C    1 
ATOM   5923 O  O    . PRO A 1 368 ? 7.573   -24.076 8.453   1.00  37.07 ? 1821 PRO A O    1 
ATOM   5924 C  CB   . PRO A 1 368 ? 9.072   -26.450 7.311   1.00  35.38 ? 1821 PRO A CB   1 
ATOM   5925 C  CG   . PRO A 1 368 ? 9.803   -26.241 6.061   1.00  35.10 ? 1821 PRO A CG   1 
ATOM   5926 C  CD   . PRO A 1 368 ? 9.174   -25.057 5.390   1.00  34.16 ? 1821 PRO A CD   1 
ATOM   5927 H  HA   . PRO A 1 368 ? 7.057   -26.732 6.849   1.00  41.93 ? 1821 PRO A HA   1 
ATOM   5928 H  HB2  . PRO A 1 368 ? 9.463   -25.925 8.027   1.00  42.45 ? 1821 PRO A HB2  1 
ATOM   5929 H  HB3  . PRO A 1 368 ? 9.059   -27.391 7.545   1.00  42.45 ? 1821 PRO A HB3  1 
ATOM   5930 H  HG2  . PRO A 1 368 ? 10.736  -26.062 6.260   1.00  42.12 ? 1821 PRO A HG2  1 
ATOM   5931 H  HG3  . PRO A 1 368 ? 9.721   -27.030 5.503   1.00  42.12 ? 1821 PRO A HG3  1 
ATOM   5932 H  HD2  . PRO A 1 368 ? 9.606   -24.236 5.677   1.00  40.99 ? 1821 PRO A HD2  1 
ATOM   5933 H  HD3  . PRO A 1 368 ? 9.205   -25.158 4.426   1.00  40.99 ? 1821 PRO A HD3  1 
HETATM 5934 ZN ZN   . ZN  B 2 .   ? -21.055 -17.233 -6.790  0.89  11.01 2 2822 ZN  A ZN   1 
HETATM 5935 ZN ZN   . ZN  C 2 .   ? -20.545 -14.054 -6.070  0.86  10.87 2 2823 ZN  A ZN   1 
HETATM 5936 ZN ZN   . ZN  D 2 .   ? -15.244 -16.537 -7.922  0.61  14.05 2 2824 ZN  A ZN   1 
HETATM 5937 ZN ZN   . ZN  E 2 .   ? -0.979  -24.644 -22.520 0.68  18.11 2 2825 ZN  A ZN   1 
HETATM 5938 C  C    . FMT F 3 .   ? -5.796  -15.097 -3.787  1.00  16.11 ? 2826 FMT A C    1 
HETATM 5939 O  O1   . FMT F 3 .   ? -4.965  -14.335 -4.300  1.00  17.92 ? 2826 FMT A O1   1 
HETATM 5940 O  O2   . FMT F 3 .   ? -5.575  -15.643 -2.707  1.00  15.37 ? 2826 FMT A O2   1 
HETATM 5941 H  H    . FMT F 3 .   ? -6.746  -15.305 -4.279  1.00  19.33 ? 2826 FMT A H    1 
HETATM 5942 C  C    . FMT G 3 .   ? 0.000   -23.907 -15.191 0.45  12.02 ? 2827 FMT A C    1 
HETATM 5943 O  O1   . FMT G 3 .   ? 0.346   -24.508 -14.169 0.45  12.73 ? 2827 FMT A O1   1 
HETATM 5944 O  O2   . FMT G 3 .   ? -0.345  -24.499 -16.219 0.45  12.71 ? 2827 FMT A O2   1 
HETATM 5945 H  H    . FMT G 3 .   ? -0.010  -22.818 -15.213 0.45  14.42 ? 2827 FMT A H    1 
HETATM 5946 C  C    . FMT H 3 .   ? 3.859   -31.942 -7.356  1.00  39.94 ? 2828 FMT A C    1 
HETATM 5947 O  O1   . FMT H 3 .   ? 4.144   -31.700 -6.179  1.00  39.22 ? 2828 FMT A O1   1 
HETATM 5948 O  O2   . FMT H 3 .   ? 3.869   -33.093 -7.811  1.00  40.11 ? 2828 FMT A O2   1 
HETATM 5949 H  H    . FMT H 3 .   ? 3.587   -31.134 -8.036  1.00  47.93 ? 2828 FMT A H    1 
HETATM 5950 C  C    . FMT I 3 .   ? -25.985 -17.915 -5.801  1.00  38.85 ? 2829 FMT A C    1 
HETATM 5951 O  O1   . FMT I 3 .   ? -25.542 -18.639 -4.914  1.00  37.48 ? 2829 FMT A O1   1 
HETATM 5952 O  O2   . FMT I 3 .   ? -27.181 -17.940 -6.102  1.00  38.79 ? 2829 FMT A O2   1 
HETATM 5953 H  H    . FMT I 3 .   ? -25.334 -17.231 -6.346  1.00  46.62 ? 2829 FMT A H    1 
HETATM 5954 O  O    . HOH J 4 .   ? -2.612  -28.333 -24.323 1.00  31.43 ? 2001 HOH A O    1 
HETATM 5955 O  O    . HOH J 4 .   ? -30.066 -23.879 -1.541  1.00  34.49 ? 2002 HOH A O    1 
HETATM 5956 O  O    . HOH J 4 .   ? -20.004 -27.600 -0.967  1.00  30.07 ? 2003 HOH A O    1 
HETATM 5957 O  O    . HOH J 4 .   ? -25.393 -38.416 -5.466  1.00  41.66 ? 2004 HOH A O    1 
HETATM 5958 O  O    . HOH J 4 .   ? -24.604 -23.581 9.876   1.00  39.79 ? 2005 HOH A O    1 
HETATM 5959 O  O    . HOH J 4 .   ? -22.945 -29.981 9.373   1.00  40.07 ? 2006 HOH A O    1 
HETATM 5960 O  O    . HOH J 4 .   ? -24.997 -11.752 13.260  1.00  54.25 ? 2007 HOH A O    1 
HETATM 5961 O  O    . HOH J 4 .   ? -18.650 -3.461  14.912  1.00  26.74 ? 2008 HOH A O    1 
HETATM 5962 O  O    . HOH J 4 .   ? -10.022 -5.759  16.547  1.00  33.31 ? 2009 HOH A O    1 
HETATM 5963 O  O    . HOH J 4 .   ? -3.931  -13.699 14.041  1.00  48.71 ? 2010 HOH A O    1 
HETATM 5964 O  O    . HOH J 4 .   ? -3.543  -3.810  13.157  1.00  25.76 ? 2011 HOH A O    1 
HETATM 5965 O  O    . HOH J 4 .   ? -0.227  -21.101 8.439   1.00  44.63 ? 2012 HOH A O    1 
HETATM 5966 O  O    . HOH J 4 .   ? 2.146   -16.887 -0.336  1.00  28.47 ? 2013 HOH A O    1 
HETATM 5967 O  O    . HOH J 4 .   ? 3.484   -12.762 -0.179  1.00  29.63 ? 2014 HOH A O    1 
HETATM 5968 O  O    . HOH J 4 .   ? 0.242   -17.073 -1.959  1.00  32.00 ? 2015 HOH A O    1 
HETATM 5969 O  O    . HOH J 4 .   ? 1.881   -8.115  -0.444  1.00  38.45 ? 2016 HOH A O    1 
HETATM 5970 O  O    . HOH J 4 .   ? 1.332   -11.765 -1.857  1.00  35.52 ? 2017 HOH A O    1 
HETATM 5971 O  O    . HOH J 4 .   ? -24.710 1.056   -10.497 1.00  47.75 ? 2018 HOH A O    1 
HETATM 5972 O  O    . HOH J 4 .   ? -4.532  2.009   -14.911 1.00  23.57 ? 2019 HOH A O    1 
HETATM 5973 O  O    . HOH J 4 .   ? -4.737  3.420   -17.457 1.00  38.92 ? 2020 HOH A O    1 
HETATM 5974 O  O    . HOH J 4 .   ? -0.800  -9.779  -14.336 1.00  32.68 ? 2021 HOH A O    1 
HETATM 5975 O  O    . HOH J 4 .   ? -1.137  -11.547 -15.580 1.00  34.75 ? 2022 HOH A O    1 
HETATM 5976 O  O    . HOH J 4 .   ? -2.264  -6.859  -16.369 1.00  42.39 ? 2023 HOH A O    1 
HETATM 5977 O  O    . HOH J 4 .   ? 0.123   -8.304  -12.752 1.00  41.58 ? 2024 HOH A O    1 
HETATM 5978 O  O    . HOH J 4 .   ? 0.000   -5.715  -15.193 0.52  41.47 ? 2025 HOH A O    1 
HETATM 5979 O  O    . HOH J 4 .   ? 1.142   2.940   -14.547 1.00  33.92 ? 2026 HOH A O    1 
HETATM 5980 O  O    . HOH J 4 .   ? 1.706   -9.940  -8.486  1.00  26.43 ? 2027 HOH A O    1 
HETATM 5981 O  O    . HOH J 4 .   ? -2.065  -15.699 -7.476  1.00  35.55 ? 2028 HOH A O    1 
HETATM 5982 O  O    . HOH J 4 .   ? -0.536  -11.415 -8.867  1.00  31.32 ? 2029 HOH A O    1 
HETATM 5983 O  O    . HOH J 4 .   ? 0.561   -13.135 -5.580  1.00  33.70 ? 2030 HOH A O    1 
HETATM 5984 O  O    . HOH J 4 .   ? -26.036 -11.429 -28.495 1.00  41.32 ? 2031 HOH A O    1 
HETATM 5985 O  O    . HOH J 4 .   ? -35.236 -5.623  -14.877 1.00  40.82 ? 2032 HOH A O    1 
HETATM 5986 O  O    . HOH J 4 .   ? -37.345 -20.815 -19.599 1.00  28.20 ? 2033 HOH A O    1 
HETATM 5987 O  O    . HOH J 4 .   ? -22.833 -5.790  -25.652 1.00  49.15 ? 2034 HOH A O    1 
HETATM 5988 O  O    . HOH J 4 .   ? -19.232 -5.102  -26.547 1.00  41.29 ? 2035 HOH A O    1 
HETATM 5989 O  O    . HOH J 4 .   ? -27.158 -23.709 -18.683 1.00  18.69 ? 2036 HOH A O    1 
HETATM 5990 O  O    . HOH J 4 .   ? -21.440 -13.721 -29.402 1.00  36.60 ? 2037 HOH A O    1 
HETATM 5991 O  O    . HOH J 4 .   ? -7.507  -13.681 -32.286 1.00  40.55 ? 2038 HOH A O    1 
HETATM 5992 O  O    . HOH J 4 .   ? -22.147 -17.318 -34.743 1.00  44.64 ? 2039 HOH A O    1 
HETATM 5993 O  O    . HOH J 4 .   ? -7.735  -12.207 -34.622 1.00  45.75 ? 2040 HOH A O    1 
HETATM 5994 O  O    . HOH J 4 .   ? -5.965  -8.972  -28.232 1.00  40.90 ? 2041 HOH A O    1 
HETATM 5995 O  O    . HOH J 4 .   ? 0.289   -34.900 -12.874 1.00  29.66 ? 2042 HOH A O    1 
HETATM 5996 O  O    . HOH J 4 .   ? -21.798 -28.559 -38.358 1.00  43.68 ? 2043 HOH A O    1 
HETATM 5997 O  O    . HOH J 4 .   ? -30.240 -29.392 -26.386 1.00  44.80 ? 2044 HOH A O    1 
HETATM 5998 O  O    . HOH J 4 .   ? -31.045 -34.481 -12.979 1.00  43.93 ? 2045 HOH A O    1 
HETATM 5999 O  O    . HOH J 4 .   ? -38.113 -21.145 -29.427 1.00  46.11 ? 2046 HOH A O    1 
HETATM 6000 O  O    . HOH J 4 .   ? -12.588 -44.628 -10.616 1.00  45.47 ? 2047 HOH A O    1 
HETATM 6001 O  O    . HOH J 4 .   ? -14.385 -47.062 -22.873 1.00  49.65 ? 2048 HOH A O    1 
HETATM 6002 O  O    . HOH J 4 .   ? -16.763 -45.127 -16.595 1.00  44.85 ? 2049 HOH A O    1 
HETATM 6003 O  O    . HOH J 4 .   ? -16.405 -45.728 -14.017 1.00  45.55 ? 2050 HOH A O    1 
HETATM 6004 O  O    . HOH J 4 .   ? -7.233  -39.420 -3.855  1.00  34.48 ? 2051 HOH A O    1 
HETATM 6005 O  O    . HOH J 4 .   ? -1.190  -34.635 0.966   1.00  49.40 ? 2052 HOH A O    1 
HETATM 6006 O  O    . HOH J 4 .   ? 2.905   -31.716 -0.184  1.00  50.63 ? 2053 HOH A O    1 
HETATM 6007 O  O    . HOH J 4 .   ? 4.752   -13.659 1.789   1.00  45.12 ? 2054 HOH A O    1 
HETATM 6008 O  O    . HOH J 4 .   ? 0.001   -35.099 -15.193 0.51  38.59 ? 2055 HOH A O    1 
HETATM 6009 O  O    . HOH J 4 .   ? -33.551 -28.091 -28.611 1.00  51.23 ? 2056 HOH A O    1 
HETATM 6010 O  O    . HOH J 4 .   ? -13.012 -27.812 -35.292 1.00  37.01 ? 2057 HOH A O    1 
HETATM 6011 O  O    . HOH J 4 .   ? -5.923  -30.048 -31.813 1.00  37.35 ? 2058 HOH A O    1 
HETATM 6012 O  O    . HOH J 4 .   ? -4.937  -28.407 -30.162 1.00  45.66 ? 2059 HOH A O    1 
HETATM 6013 O  O    . HOH J 4 .   ? -4.458  -29.343 -25.686 1.00  41.66 ? 2060 HOH A O    1 
HETATM 6014 O  O    . HOH J 4 .   ? -3.534  -38.066 -23.371 1.00  45.02 ? 2061 HOH A O    1 
HETATM 6015 O  O    . HOH J 4 .   ? -5.477  -31.629 -19.354 1.00  19.00 ? 2062 HOH A O    1 
HETATM 6016 O  O    . HOH J 4 .   ? -7.260  -29.716 -15.946 1.00  15.17 ? 2063 HOH A O    1 
HETATM 6017 O  O    . HOH J 4 .   ? -12.085 -20.835 -13.867 1.00  12.78 ? 2064 HOH A O    1 
HETATM 6018 O  O    . HOH J 4 .   ? -13.788 -17.965 -7.759  1.00  13.29 ? 2065 HOH A O    1 
HETATM 6019 O  O    . HOH J 4 .   ? -21.811 -15.348 -6.862  1.00  12.77 ? 2066 HOH A O    1 
HETATM 6020 O  O    . HOH J 4 .   ? -24.077 -24.071 -4.161  1.00  16.24 ? 2067 HOH A O    1 
HETATM 6021 O  O    . HOH J 4 .   ? -21.654 -25.476 -4.141  1.00  15.65 ? 2068 HOH A O    1 
HETATM 6022 O  O    . HOH J 4 .   ? -27.684 -25.170 -1.516  1.00  21.17 ? 2069 HOH A O    1 
HETATM 6023 O  O    . HOH J 4 .   ? -26.179 -23.068 -2.626  1.00  18.30 ? 2070 HOH A O    1 
HETATM 6024 O  O    . HOH J 4 .   ? -29.602 -20.938 -2.326  1.00  47.03 ? 2071 HOH A O    1 
HETATM 6025 O  O    . HOH J 4 .   ? -21.837 -28.001 -3.309  1.00  27.35 ? 2072 HOH A O    1 
HETATM 6026 O  O    . HOH J 4 .   ? -25.095 -35.686 -6.391  1.00  20.65 ? 2073 HOH A O    1 
HETATM 6027 O  O    . HOH J 4 .   ? -23.925 -37.075 -3.300  1.00  25.39 ? 2074 HOH A O    1 
HETATM 6028 O  O    . HOH J 4 .   ? -27.598 -34.675 -0.599  1.00  36.91 ? 2075 HOH A O    1 
HETATM 6029 O  O    . HOH J 4 .   ? -28.828 -32.423 0.472   1.00  32.68 ? 2076 HOH A O    1 
HETATM 6030 O  O    . HOH J 4 .   ? -32.029 -30.610 -0.980  1.00  34.14 ? 2077 HOH A O    1 
HETATM 6031 O  O    . HOH J 4 .   ? -32.510 -24.487 -0.979  1.00  40.12 ? 2078 HOH A O    1 
HETATM 6032 O  O    . HOH J 4 .   ? -34.354 -29.328 -2.038  1.00  37.09 ? 2079 HOH A O    1 
HETATM 6033 O  O    . HOH J 4 .   ? -35.841 -29.776 -9.906  1.00  31.38 ? 2080 HOH A O    1 
HETATM 6034 O  O    . HOH J 4 .   ? -34.300 -20.337 -3.231  1.00  38.57 ? 2081 HOH A O    1 
HETATM 6035 O  O    . HOH J 4 .   ? -28.584 -35.619 -10.490 1.00  28.63 ? 2082 HOH A O    1 
HETATM 6036 O  O    . HOH J 4 .   ? -29.773 -35.138 -4.996  1.00  39.94 ? 2083 HOH A O    1 
HETATM 6037 O  O    . HOH J 4 .   ? -28.282 -37.250 -7.393  1.00  45.73 ? 2084 HOH A O    1 
HETATM 6038 O  O    . HOH J 4 .   ? -27.220 -36.172 -13.079 1.00  29.84 ? 2085 HOH A O    1 
HETATM 6039 O  O    . HOH J 4 .   ? -22.914 -27.674 -23.470 1.00  29.19 ? 2086 HOH A O    1 
HETATM 6040 O  O    . HOH J 4 .   ? -18.436 -24.269 -20.497 1.00  17.95 ? 2087 HOH A O    1 
HETATM 6041 O  O    . HOH J 4 .   ? -17.993 -25.647 -0.775  1.00  17.80 ? 2088 HOH A O    1 
HETATM 6042 O  O    . HOH J 4 .   ? -25.838 -20.765 2.791   1.00  25.71 ? 2089 HOH A O    1 
HETATM 6043 O  O    . HOH J 4 .   ? -28.466 -23.984 7.003   1.00  48.09 ? 2090 HOH A O    1 
HETATM 6044 O  O    . HOH J 4 .   ? -29.109 -30.261 4.353   1.00  33.28 ? 2091 HOH A O    1 
HETATM 6045 O  O    . HOH J 4 .   ? -27.936 -28.965 9.098   1.00  48.06 ? 2092 HOH A O    1 
HETATM 6046 O  O    . HOH J 4 .   ? -22.795 -25.206 8.769   1.00  23.48 ? 2093 HOH A O    1 
HETATM 6047 O  O    . HOH J 4 .   ? -21.830 -27.719 10.468  1.00  39.38 ? 2094 HOH A O    1 
HETATM 6048 O  O    . HOH J 4 .   ? -18.347 -26.904 14.481  1.00  48.59 ? 2095 HOH A O    1 
HETATM 6049 O  O    . HOH J 4 .   ? -21.128 -28.619 13.386  1.00  54.29 ? 2096 HOH A O    1 
HETATM 6050 O  O    . HOH J 4 .   ? -14.530 -26.008 12.306  1.00  34.68 ? 2097 HOH A O    1 
HETATM 6051 O  O    . HOH J 4 .   ? -13.582 -31.242 7.788   1.00  31.66 ? 2098 HOH A O    1 
HETATM 6052 O  O    . HOH J 4 .   ? -21.485 -33.028 9.378   1.00  42.78 ? 2099 HOH A O    1 
HETATM 6053 O  O    . HOH J 4 .   ? -15.130 -36.114 4.481   1.00  28.62 ? 2100 HOH A O    1 
HETATM 6054 O  O    . HOH J 4 .   ? -9.532  -32.137 0.646   1.00  23.05 ? 2101 HOH A O    1 
HETATM 6055 O  O    . HOH J 4 .   ? -12.718 -38.036 2.754   1.00  48.60 ? 2102 HOH A O    1 
HETATM 6056 O  O    . HOH J 4 .   ? -18.491 -40.556 -0.867  1.00  23.16 ? 2103 HOH A O    1 
HETATM 6057 O  O    . HOH J 4 .   ? -16.014 -41.484 -0.792  1.00  30.42 ? 2104 HOH A O    1 
HETATM 6058 O  O    . HOH J 4 .   ? -17.598 -42.527 -3.302  1.00  46.58 ? 2105 HOH A O    1 
HETATM 6059 O  O    . HOH J 4 .   ? -15.858 -42.073 -5.158  1.00  29.64 ? 2106 HOH A O    1 
HETATM 6060 O  O    . HOH J 4 .   ? -15.346 -40.084 -6.243  1.00  16.20 ? 2107 HOH A O    1 
HETATM 6061 O  O    . HOH J 4 .   ? -11.723 -37.922 -3.721  1.00  19.61 ? 2108 HOH A O    1 
HETATM 6062 O  O    . HOH J 4 .   ? -24.276 -40.731 -5.899  1.00  38.00 ? 2109 HOH A O    1 
HETATM 6063 O  O    . HOH J 4 .   ? -21.202 -43.005 -5.725  1.00  31.08 ? 2110 HOH A O    1 
HETATM 6064 O  O    . HOH J 4 .   ? -11.471 -29.680 -1.692  1.00  20.01 ? 2111 HOH A O    1 
HETATM 6065 O  O    . HOH J 4 .   ? -18.392 -14.367 3.847   1.00  16.89 ? 2112 HOH A O    1 
HETATM 6066 O  O    . HOH J 4 .   ? -15.125 -14.733 12.151  1.00  17.70 ? 2113 HOH A O    1 
HETATM 6067 O  O    . HOH J 4 .   ? -19.537 -20.013 11.717  1.00  32.92 ? 2114 HOH A O    1 
HETATM 6068 O  O    . HOH J 4 .   ? -21.789 -14.752 9.469   1.00  19.95 ? 2115 HOH A O    1 
HETATM 6069 O  O    . HOH J 4 .   ? -17.188 -14.240 16.811  1.00  44.32 ? 2116 HOH A O    1 
HETATM 6070 O  O    . HOH J 4 .   ? -17.414 -11.269 14.561  1.00  41.03 ? 2117 HOH A O    1 
HETATM 6071 O  O    . HOH J 4 .   ? -15.107 -14.367 14.922  1.00  38.66 ? 2118 HOH A O    1 
HETATM 6072 O  O    . HOH J 4 .   ? -23.046 -14.609 11.462  1.00  27.09 ? 2119 HOH A O    1 
HETATM 6073 O  O    . HOH J 4 .   ? -13.634 -16.395 15.750  1.00  41.53 ? 2120 HOH A O    1 
HETATM 6074 O  O    . HOH J 4 .   ? -9.442  -19.650 10.389  1.00  20.09 ? 2121 HOH A O    1 
HETATM 6075 O  O    . HOH J 4 .   ? -7.449  -22.489 13.415  1.00  38.31 ? 2122 HOH A O    1 
HETATM 6076 O  O    . HOH J 4 .   ? -5.625  -18.660 13.664  1.00  44.68 ? 2123 HOH A O    1 
HETATM 6077 O  O    . HOH J 4 .   ? -9.933  -26.232 11.390  1.00  39.56 ? 2124 HOH A O    1 
HETATM 6078 O  O    . HOH J 4 .   ? -15.329 -23.488 12.734  1.00  34.27 ? 2125 HOH A O    1 
HETATM 6079 O  O    . HOH J 4 .   ? -6.738  -20.370 10.187  1.00  25.18 ? 2126 HOH A O    1 
HETATM 6080 O  O    . HOH J 4 .   ? -4.707  -26.829 6.839   1.00  29.85 ? 2127 HOH A O    1 
HETATM 6081 O  O    . HOH J 4 .   ? -6.191  -29.587 5.799   1.00  31.62 ? 2128 HOH A O    1 
HETATM 6082 O  O    . HOH J 4 .   ? -10.985 -28.539 12.617  1.00  44.67 ? 2129 HOH A O    1 
HETATM 6083 O  O    . HOH J 4 .   ? -7.296  -23.503 0.772   1.00  14.73 ? 2130 HOH A O    1 
HETATM 6084 O  O    . HOH J 4 .   ? -3.132  -27.779 0.691   1.00  24.45 ? 2131 HOH A O    1 
HETATM 6085 O  O    . HOH J 4 .   ? -3.011  -30.350 1.939   1.00  41.96 ? 2132 HOH A O    1 
HETATM 6086 O  O    . HOH J 4 .   ? -7.223  -32.868 1.865   1.00  38.55 ? 2133 HOH A O    1 
HETATM 6087 O  O    . HOH J 4 .   ? -21.224 -9.820  4.050   1.00  23.22 ? 2134 HOH A O    1 
HETATM 6088 O  O    . HOH J 4 .   ? -24.209 -14.749 -5.773  1.00  27.59 ? 2135 HOH A O    1 
HETATM 6089 O  O    . HOH J 4 .   ? -19.436 -7.216  4.444   1.00  30.70 ? 2136 HOH A O    1 
HETATM 6090 O  O    . HOH J 4 .   ? -20.813 -2.239  -3.217  1.00  25.40 ? 2137 HOH A O    1 
HETATM 6091 O  O    . HOH J 4 .   ? -22.450 -17.501 11.352  1.00  45.92 ? 2138 HOH A O    1 
HETATM 6092 O  O    . HOH J 4 .   ? -23.222 -11.670 10.514  1.00  41.17 ? 2139 HOH A O    1 
HETATM 6093 O  O    . HOH J 4 .   ? -23.643 -7.180  5.677   1.00  47.29 ? 2140 HOH A O    1 
HETATM 6094 O  O    . HOH J 4 .   ? -19.287 -2.872  6.667   1.00  30.38 ? 2141 HOH A O    1 
HETATM 6095 O  O    . HOH J 4 .   ? -21.030 -4.033  12.462  1.00  42.01 ? 2142 HOH A O    1 
HETATM 6096 O  O    . HOH J 4 .   ? -16.108 -3.843  13.979  1.00  24.23 ? 2143 HOH A O    1 
HETATM 6097 O  O    . HOH J 4 .   ? -13.992 -12.376 11.460  1.00  18.58 ? 2144 HOH A O    1 
HETATM 6098 O  O    . HOH J 4 .   ? -14.921 -11.514 15.316  1.00  38.60 ? 2145 HOH A O    1 
HETATM 6099 O  O    . HOH J 4 .   ? -9.755  -8.146  15.670  1.00  34.67 ? 2146 HOH A O    1 
HETATM 6100 O  O    . HOH J 4 .   ? -9.915  -17.534 8.682   1.00  18.78 ? 2147 HOH A O    1 
HETATM 6101 O  O    . HOH J 4 .   ? -4.438  -15.068 4.960   1.00  16.74 ? 2148 HOH A O    1 
HETATM 6102 O  O    . HOH J 4 .   ? -2.106  -13.281 7.157   1.00  29.76 ? 2149 HOH A O    1 
HETATM 6103 O  O    . HOH J 4 .   ? -2.189  -16.047 8.321   1.00  29.00 ? 2150 HOH A O    1 
HETATM 6104 O  O    . HOH J 4 .   ? -6.605  -11.680 14.059  1.00  40.61 ? 2151 HOH A O    1 
HETATM 6105 O  O    . HOH J 4 .   ? -8.087  -7.476  13.572  1.00  36.97 ? 2152 HOH A O    1 
HETATM 6106 O  O    . HOH J 4 .   ? -5.623  -6.137  13.102  1.00  37.83 ? 2153 HOH A O    1 
HETATM 6107 O  O    . HOH J 4 .   ? -2.796  -7.094  10.449  1.00  37.26 ? 2154 HOH A O    1 
HETATM 6108 O  O    . HOH J 4 .   ? -0.096  -18.430 7.604   1.00  32.10 ? 2155 HOH A O    1 
HETATM 6109 O  O    . HOH J 4 .   ? 0.863   -14.272 1.614   1.00  39.13 ? 2156 HOH A O    1 
HETATM 6110 O  O    . HOH J 4 .   ? -1.463  -16.272 -0.960  1.00  35.25 ? 2157 HOH A O    1 
HETATM 6111 O  O    . HOH J 4 .   ? 1.441   -20.260 5.668   1.00  38.38 ? 2158 HOH A O    1 
HETATM 6112 O  O    . HOH J 4 .   ? 2.731   -16.858 2.426   1.00  45.51 ? 2159 HOH A O    1 
HETATM 6113 O  O    . HOH J 4 .   ? 0.548   -19.904 -2.257  1.00  25.71 ? 2160 HOH A O    1 
HETATM 6114 O  O    . HOH J 4 .   ? -2.706  -19.509 -2.513  1.00  31.07 ? 2161 HOH A O    1 
HETATM 6115 O  O    . HOH J 4 .   ? -1.306  -26.345 2.261   1.00  31.11 ? 2162 HOH A O    1 
HETATM 6116 O  O    . HOH J 4 .   ? -2.354  -25.318 5.812   1.00  38.99 ? 2163 HOH A O    1 
HETATM 6117 O  O    . HOH J 4 .   ? -17.164 -9.502  -7.113  1.00  13.69 ? 2164 HOH A O    1 
HETATM 6118 O  O    . HOH J 4 .   ? -18.154 -7.614  -9.153  1.00  18.16 ? 2165 HOH A O    1 
HETATM 6119 O  O    . HOH J 4 .   ? -25.092 -5.897  -8.556  1.00  17.86 ? 2166 HOH A O    1 
HETATM 6120 O  O    . HOH J 4 .   ? -24.866 -7.517  -4.566  1.00  29.90 ? 2167 HOH A O    1 
HETATM 6121 O  O    . HOH J 4 .   ? -20.790 2.399   -8.558  1.00  29.78 ? 2168 HOH A O    1 
HETATM 6122 O  O    . HOH J 4 .   ? -0.608  -7.161  -0.418  1.00  19.52 ? 2169 HOH A O    1 
HETATM 6123 O  O    . HOH J 4 .   ? -3.704  -7.845  -2.608  1.00  17.87 ? 2170 HOH A O    1 
HETATM 6124 O  O    . HOH J 4 .   ? 0.622   -3.067  -0.733  1.00  33.11 ? 2171 HOH A O    1 
HETATM 6125 O  O    . HOH J 4 .   ? -2.778  -4.668  9.431   1.00  28.18 ? 2172 HOH A O    1 
HETATM 6126 O  O    . HOH J 4 .   ? -0.240  -12.231 5.323   1.00  37.16 ? 2173 HOH A O    1 
HETATM 6127 O  O    . HOH J 4 .   ? 1.393   -12.892 3.800   1.00  34.66 ? 2174 HOH A O    1 
HETATM 6128 O  O    . HOH J 4 .   ? -3.064  -16.928 -2.844  1.00  22.24 ? 2175 HOH A O    1 
HETATM 6129 O  O    . HOH J 4 .   ? -0.419  -13.816 -0.593  1.00  17.43 ? 2176 HOH A O    1 
HETATM 6130 O  O    . HOH J 4 .   ? -17.342 -15.620 -11.888 1.00  18.95 ? 2177 HOH A O    1 
HETATM 6131 O  O    . HOH J 4 .   ? -18.169 -11.353 -14.123 1.00  11.16 ? 2178 HOH A O    1 
HETATM 6132 O  O    . HOH J 4 .   ? -20.791 -6.230  -17.933 1.00  13.98 ? 2179 HOH A O    1 
HETATM 6133 O  O    . HOH J 4 .   ? -22.912 -0.123  -11.923 1.00  27.02 ? 2180 HOH A O    1 
HETATM 6134 O  O    . HOH J 4 .   ? -18.992 0.820   -14.143 1.00  16.19 ? 2181 HOH A O    1 
HETATM 6135 O  O    . HOH J 4 .   ? -17.094 6.020   -17.613 1.00  43.92 ? 2182 HOH A O    1 
HETATM 6136 O  O    . HOH J 4 .   ? -12.687 5.992   -17.329 1.00  34.74 ? 2183 HOH A O    1 
HETATM 6137 O  O    . HOH J 4 .   ? -20.335 1.328   -11.897 1.00  26.82 ? 2184 HOH A O    1 
HETATM 6138 O  O    . HOH J 4 .   ? -7.219  1.965   -14.575 1.00  19.71 ? 2185 HOH A O    1 
HETATM 6139 O  O    . HOH J 4 .   ? -2.413  -2.340  -15.317 1.00  19.34 ? 2186 HOH A O    1 
HETATM 6140 O  O    . HOH J 4 .   ? -6.115  -3.355  -20.484 1.00  23.71 ? 2187 HOH A O    1 
HETATM 6141 O  O    . HOH J 4 .   ? -7.392  2.814   -18.468 1.00  37.64 ? 2188 HOH A O    1 
HETATM 6142 O  O    . HOH J 4 .   ? -2.058  2.766   -11.018 1.00  19.86 ? 2189 HOH A O    1 
HETATM 6143 O  O    . HOH J 4 .   ? -3.287  -9.439  -15.779 1.00  25.21 ? 2190 HOH A O    1 
HETATM 6144 O  O    . HOH J 4 .   ? -2.234  -10.931 -12.911 1.00  21.46 ? 2191 HOH A O    1 
HETATM 6145 O  O    . HOH J 4 .   ? 1.096   -6.488  -11.541 1.00  31.78 ? 2192 HOH A O    1 
HETATM 6146 O  O    . HOH J 4 .   ? -0.137  -3.513  -15.122 0.30  13.03 ? 2193 HOH A O    1 
HETATM 6147 O  O    . HOH J 4 .   ? 4.317   0.699   -9.024  1.00  41.34 ? 2194 HOH A O    1 
HETATM 6148 O  O    . HOH J 4 .   ? 2.596   0.465   -14.142 1.00  21.14 ? 2195 HOH A O    1 
HETATM 6149 O  O    . HOH J 4 .   ? 2.447   -0.468  -4.756  1.00  37.11 ? 2196 HOH A O    1 
HETATM 6150 O  O    . HOH J 4 .   ? 0.559   3.433   -11.797 1.00  33.05 ? 2197 HOH A O    1 
HETATM 6151 O  O    . HOH J 4 .   ? 2.327   -8.391  -6.602  1.00  30.76 ? 2198 HOH A O    1 
HETATM 6152 O  O    . HOH J 4 .   ? 4.797   -5.199  -6.007  1.00  32.48 ? 2199 HOH A O    1 
HETATM 6153 O  O    . HOH J 4 .   ? 0.062   -7.658  -9.898  1.00  39.92 ? 2200 HOH A O    1 
HETATM 6154 O  O    . HOH J 4 .   ? -1.844  -12.137 -6.721  1.00  20.22 ? 2201 HOH A O    1 
HETATM 6155 O  O    . HOH J 4 .   ? -1.752  -9.957  -10.489 1.00  21.34 ? 2202 HOH A O    1 
HETATM 6156 O  O    . HOH J 4 .   ? -4.204  -13.778 -6.702  1.00  21.86 ? 2203 HOH A O    1 
HETATM 6157 O  O    . HOH J 4 .   ? -23.279 -17.612 -17.350 1.00  15.55 ? 2204 HOH A O    1 
HETATM 6158 O  O    . HOH J 4 .   ? -22.806 -13.634 -11.342 1.00  22.48 ? 2205 HOH A O    1 
HETATM 6159 O  O    . HOH J 4 .   ? -20.608 -9.120  -26.152 1.00  28.83 ? 2206 HOH A O    1 
HETATM 6160 O  O    . HOH J 4 .   ? -23.801 -11.535 -27.006 1.00  36.02 ? 2207 HOH A O    1 
HETATM 6161 O  O    . HOH J 4 .   ? -23.298 -7.395  -18.089 1.00  14.51 ? 2208 HOH A O    1 
HETATM 6162 O  O    . HOH J 4 .   ? -26.419 -6.918  -24.924 1.00  39.88 ? 2209 HOH A O    1 
HETATM 6163 O  O    . HOH J 4 .   ? -33.641 -4.027  -21.971 1.00  32.04 ? 2210 HOH A O    1 
HETATM 6164 O  O    . HOH J 4 .   ? -27.698 1.133   -19.792 1.00  33.20 ? 2211 HOH A O    1 
HETATM 6165 O  O    . HOH J 4 .   ? -25.868 -1.715  -13.936 1.00  30.43 ? 2212 HOH A O    1 
HETATM 6166 O  O    . HOH J 4 .   ? -33.999 -7.517  -24.558 1.00  36.25 ? 2213 HOH A O    1 
HETATM 6167 O  O    . HOH J 4 .   ? -32.210 -5.102  -27.300 1.00  51.03 ? 2214 HOH A O    1 
HETATM 6168 O  O    . HOH J 4 .   ? -32.165 -9.777  -25.680 1.00  29.64 ? 2215 HOH A O    1 
HETATM 6169 O  O    . HOH J 4 .   ? -29.191 -11.878 -25.799 1.00  34.56 ? 2216 HOH A O    1 
HETATM 6170 O  O    . HOH J 4 .   ? -29.041 -7.647  -27.055 1.00  43.00 ? 2217 HOH A O    1 
HETATM 6171 O  O    . HOH J 4 .   ? -36.639 -6.715  -16.848 1.00  36.80 ? 2218 HOH A O    1 
HETATM 6172 O  O    . HOH J 4 .   ? -40.025 -10.999 -21.691 1.00  44.14 ? 2219 HOH A O    1 
HETATM 6173 O  O    . HOH J 4 .   ? -39.944 -8.040  -19.485 1.00  40.18 ? 2220 HOH A O    1 
HETATM 6174 O  O    . HOH J 4 .   ? -35.935 -6.792  -26.245 1.00  41.29 ? 2221 HOH A O    1 
HETATM 6175 O  O    . HOH J 4 .   ? -37.125 -14.658 -21.434 1.00  33.24 ? 2222 HOH A O    1 
HETATM 6176 O  O    . HOH J 4 .   ? -35.313 -15.688 -23.354 1.00  39.46 ? 2223 HOH A O    1 
HETATM 6177 O  O    . HOH J 4 .   ? -38.402 -12.733 -15.555 1.00  30.62 ? 2224 HOH A O    1 
HETATM 6178 O  O    . HOH J 4 .   ? -33.888 -8.074  -12.535 1.00  42.11 ? 2225 HOH A O    1 
HETATM 6179 O  O    . HOH J 4 .   ? -40.782 -12.132 -13.396 1.00  49.41 ? 2226 HOH A O    1 
HETATM 6180 O  O    . HOH J 4 .   ? -39.079 -18.911 -19.913 1.00  28.67 ? 2227 HOH A O    1 
HETATM 6181 O  O    . HOH J 4 .   ? -34.738 -17.438 -21.300 1.00  34.55 ? 2228 HOH A O    1 
HETATM 6182 O  O    . HOH J 4 .   ? -29.376 -7.885  -13.740 1.00  20.34 ? 2229 HOH A O    1 
HETATM 6183 O  O    . HOH J 4 .   ? -30.156 -8.030  -11.127 1.00  30.55 ? 2230 HOH A O    1 
HETATM 6184 O  O    . HOH J 4 .   ? -25.687 -14.202 -8.803  1.00  29.60 ? 2231 HOH A O    1 
HETATM 6185 O  O    . HOH J 4 .   ? -28.976 -4.941  -14.577 1.00  30.44 ? 2232 HOH A O    1 
HETATM 6186 O  O    . HOH J 4 .   ? -22.165 2.510   -17.798 1.00  30.53 ? 2233 HOH A O    1 
HETATM 6187 O  O    . HOH J 4 .   ? -26.400 0.089   -22.022 1.00  32.76 ? 2234 HOH A O    1 
HETATM 6188 O  O    . HOH J 4 .   ? -21.356 -3.620  -25.292 1.00  39.81 ? 2235 HOH A O    1 
HETATM 6189 O  O    . HOH J 4 .   ? -16.588 1.279   -22.143 1.00  25.22 ? 2236 HOH A O    1 
HETATM 6190 O  O    . HOH J 4 .   ? -22.815 0.818   -15.050 1.00  41.06 ? 2237 HOH A O    1 
HETATM 6191 O  O    . HOH J 4 .   ? -14.702 -3.358  -26.405 1.00  33.33 ? 2238 HOH A O    1 
HETATM 6192 O  O    . HOH J 4 .   ? -9.771  -7.102  -26.163 1.00  33.94 ? 2239 HOH A O    1 
HETATM 6193 O  O    . HOH J 4 .   ? -7.896  -3.461  -25.903 1.00  36.73 ? 2240 HOH A O    1 
HETATM 6194 O  O    . HOH J 4 .   ? -6.690  -5.666  -22.818 1.00  30.51 ? 2241 HOH A O    1 
HETATM 6195 O  O    . HOH J 4 .   ? -13.693 0.783   -22.438 1.00  37.20 ? 2242 HOH A O    1 
HETATM 6196 O  O    . HOH J 4 .   ? -12.408 -4.291  -27.407 1.00  41.33 ? 2243 HOH A O    1 
HETATM 6197 O  O    . HOH J 4 .   ? -2.476  -10.387 -19.356 1.00  33.52 ? 2244 HOH A O    1 
HETATM 6198 O  O    . HOH J 4 .   ? -5.518  -9.447  -24.039 1.00  33.96 ? 2245 HOH A O    1 
HETATM 6199 O  O    . HOH J 4 .   ? -2.463  -13.751 -15.227 1.00  19.43 ? 2246 HOH A O    1 
HETATM 6200 O  O    . HOH J 4 .   ? -23.525 -18.830 -14.876 1.00  14.56 ? 2247 HOH A O    1 
HETATM 6201 O  O    . HOH J 4 .   ? -24.850 -16.358 -11.853 1.00  13.96 ? 2248 HOH A O    1 
HETATM 6202 O  O    . HOH J 4 .   ? -30.515 -19.663 -11.950 1.00  14.76 ? 2249 HOH A O    1 
HETATM 6203 O  O    . HOH J 4 .   ? -38.839 -24.951 -7.675  1.00  33.23 ? 2250 HOH A O    1 
HETATM 6204 O  O    . HOH J 4 .   ? -37.154 -25.116 -14.026 1.00  32.21 ? 2251 HOH A O    1 
HETATM 6205 O  O    . HOH J 4 .   ? -39.609 -24.825 -12.071 1.00  27.84 ? 2252 HOH A O    1 
HETATM 6206 O  O    . HOH J 4 .   ? -40.974 -19.087 -5.491  1.00  45.36 ? 2253 HOH A O    1 
HETATM 6207 O  O    . HOH J 4 .   ? -39.439 -16.891 -6.275  1.00  27.99 ? 2254 HOH A O    1 
HETATM 6208 O  O    . HOH J 4 .   ? -38.107 -23.074 -3.789  1.00  45.27 ? 2255 HOH A O    1 
HETATM 6209 O  O    . HOH J 4 .   ? -39.739 -13.003 -10.817 1.00  35.67 ? 2256 HOH A O    1 
HETATM 6210 O  O    . HOH J 4 .   ? -43.422 -17.042 -5.746  1.00  43.58 ? 2257 HOH A O    1 
HETATM 6211 O  O    . HOH J 4 .   ? -26.693 -20.912 -19.259 1.00  15.48 ? 2258 HOH A O    1 
HETATM 6212 O  O    . HOH J 4 .   ? -22.422 -19.367 -19.441 1.00  14.27 ? 2259 HOH A O    1 
HETATM 6213 O  O    . HOH J 4 .   ? -25.404 -25.412 -17.280 1.00  16.18 ? 2260 HOH A O    1 
HETATM 6214 O  O    . HOH J 4 .   ? -25.087 -29.427 -22.602 1.00  23.21 ? 2261 HOH A O    1 
HETATM 6215 O  O    . HOH J 4 .   ? -20.630 -15.428 -28.202 1.00  33.02 ? 2262 HOH A O    1 
HETATM 6216 O  O    . HOH J 4 .   ? -15.977 -21.871 -32.920 1.00  27.66 ? 2263 HOH A O    1 
HETATM 6217 O  O    . HOH J 4 .   ? -13.640 -20.847 -32.320 1.00  36.83 ? 2264 HOH A O    1 
HETATM 6218 O  O    . HOH J 4 .   ? -9.148  -15.789 -32.748 1.00  36.47 ? 2265 HOH A O    1 
HETATM 6219 O  O    . HOH J 4 .   ? -17.511 -16.622 -36.549 1.00  39.75 ? 2266 HOH A O    1 
HETATM 6220 O  O    . HOH J 4 .   ? -21.865 -13.379 -32.019 1.00  35.12 ? 2267 HOH A O    1 
HETATM 6221 O  O    . HOH J 4 .   ? -19.567 -10.482 -32.248 1.00  47.71 ? 2268 HOH A O    1 
HETATM 6222 O  O    . HOH J 4 .   ? -18.854 -13.230 -29.670 1.00  27.70 ? 2269 HOH A O    1 
HETATM 6223 O  O    . HOH J 4 .   ? -20.233 -16.109 -35.174 1.00  45.97 ? 2270 HOH A O    1 
HETATM 6224 O  O    . HOH J 4 .   ? -9.036  -9.914  -34.234 1.00  41.41 ? 2271 HOH A O    1 
HETATM 6225 O  O    . HOH J 4 .   ? -7.665  -11.777 -30.510 1.00  37.58 ? 2272 HOH A O    1 
HETATM 6226 O  O    . HOH J 4 .   ? -12.224 -7.799  -28.288 1.00  38.01 ? 2273 HOH A O    1 
HETATM 6227 O  O    . HOH J 4 .   ? -9.689  -9.736  -26.235 1.00  31.37 ? 2274 HOH A O    1 
HETATM 6228 O  O    . HOH J 4 .   ? -14.793 -7.512  -28.681 1.00  32.48 ? 2275 HOH A O    1 
HETATM 6229 O  O    . HOH J 4 .   ? -21.900 -10.363 -27.774 1.00  47.20 ? 2276 HOH A O    1 
HETATM 6230 O  O    . HOH J 4 .   ? -2.945  -14.699 -28.437 1.00  25.69 ? 2277 HOH A O    1 
HETATM 6231 O  O    . HOH J 4 .   ? -6.669  -17.914 -31.980 1.00  25.02 ? 2278 HOH A O    1 
HETATM 6232 O  O    . HOH J 4 .   ? -3.926  -18.977 -29.893 1.00  21.39 ? 2279 HOH A O    1 
HETATM 6233 O  O    . HOH J 4 .   ? -2.965  -21.895 -25.591 1.00  26.12 ? 2280 HOH A O    1 
HETATM 6234 O  O    . HOH J 4 .   ? -3.007  -14.897 -24.724 1.00  35.11 ? 2281 HOH A O    1 
HETATM 6235 O  O    . HOH J 4 .   ? -0.766  -15.474 -23.082 1.00  34.45 ? 2282 HOH A O    1 
HETATM 6236 O  O    . HOH J 4 .   ? -3.627  -13.956 -22.390 1.00  24.52 ? 2283 HOH A O    1 
HETATM 6237 O  O    . HOH J 4 .   ? -5.499  -11.933 -28.759 1.00  27.57 ? 2284 HOH A O    1 
HETATM 6238 O  O    . HOH J 4 .   ? -7.121  -10.453 -26.114 1.00  27.32 ? 2285 HOH A O    1 
HETATM 6239 O  O    . HOH J 4 .   ? -3.178  -11.780 -26.031 1.00  34.22 ? 2286 HOH A O    1 
HETATM 6240 O  O    . HOH J 4 .   ? -3.864  -11.267 -22.315 1.00  37.18 ? 2287 HOH A O    1 
HETATM 6241 O  O    . HOH J 4 .   ? -1.678  -28.322 -19.659 1.00  31.79 ? 2288 HOH A O    1 
HETATM 6242 O  O    . HOH J 4 .   ? -2.732  -25.495 -23.112 1.00  22.95 ? 2289 HOH A O    1 
HETATM 6243 O  O    . HOH J 4 .   ? 0.353   -26.105 -22.049 1.00  21.32 ? 2290 HOH A O    1 
HETATM 6244 O  O    . HOH J 4 .   ? -5.178  -28.936 -14.200 1.00  15.99 ? 2291 HOH A O    1 
HETATM 6245 O  O    . HOH J 4 .   ? 0.709   -27.432 -18.912 1.00  26.82 ? 2292 HOH A O    1 
HETATM 6246 O  O    . HOH J 4 .   ? -4.901  -30.980 -16.680 1.00  16.41 ? 2293 HOH A O    1 
HETATM 6247 O  O    . HOH J 4 .   ? -2.496  -31.011 -19.435 1.00  30.20 ? 2294 HOH A O    1 
HETATM 6248 O  O    . HOH J 4 .   ? 2.978   -13.997 -11.849 1.00  30.14 ? 2295 HOH A O    1 
HETATM 6249 O  O    . HOH J 4 .   ? 0.004   -12.641 -11.937 1.00  38.25 ? 2296 HOH A O    1 
HETATM 6250 O  O    . HOH J 4 .   ? -2.768  -17.539 -5.308  1.00  36.85 ? 2297 HOH A O    1 
HETATM 6251 O  O    . HOH J 4 .   ? -0.156  -27.221 -6.529  1.00  31.39 ? 2298 HOH A O    1 
HETATM 6252 O  O    . HOH J 4 .   ? -1.873  -34.703 -11.224 1.00  33.39 ? 2299 HOH A O    1 
HETATM 6253 O  O    . HOH J 4 .   ? -2.479  -33.493 -18.120 1.00  28.48 ? 2300 HOH A O    1 
HETATM 6254 O  O    . HOH J 4 .   ? -4.607  -37.182 -12.449 1.00  31.38 ? 2301 HOH A O    1 
HETATM 6255 O  O    . HOH J 4 .   ? 1.253   -37.214 -11.462 1.00  31.64 ? 2302 HOH A O    1 
HETATM 6256 O  O    . HOH J 4 .   ? -3.677  -35.028 -20.481 1.00  28.98 ? 2303 HOH A O    1 
HETATM 6257 O  O    . HOH J 4 .   ? -6.349  -40.914 -23.203 1.00  42.32 ? 2304 HOH A O    1 
HETATM 6258 O  O    . HOH J 4 .   ? -5.398  -41.369 -15.824 1.00  40.62 ? 2305 HOH A O    1 
HETATM 6259 O  O    . HOH J 4 .   ? -19.469 -29.053 -38.051 1.00  47.10 ? 2306 HOH A O    1 
HETATM 6260 O  O    . HOH J 4 .   ? -22.790 -25.770 -38.637 1.00  42.86 ? 2307 HOH A O    1 
HETATM 6261 O  O    . HOH J 4 .   ? -25.129 -28.457 -30.028 1.00  47.07 ? 2308 HOH A O    1 
HETATM 6262 O  O    . HOH J 4 .   ? -27.810 -25.945 -35.765 1.00  42.43 ? 2309 HOH A O    1 
HETATM 6263 O  O    . HOH J 4 .   ? -25.137 -19.969 -34.991 1.00  38.81 ? 2310 HOH A O    1 
HETATM 6264 O  O    . HOH J 4 .   ? -28.006 -21.260 -35.302 1.00  41.65 ? 2311 HOH A O    1 
HETATM 6265 O  O    . HOH J 4 .   ? -29.728 -24.787 -33.184 1.00  35.12 ? 2312 HOH A O    1 
HETATM 6266 O  O    . HOH J 4 .   ? -31.516 -18.820 -34.544 1.00  42.52 ? 2313 HOH A O    1 
HETATM 6267 O  O    . HOH J 4 .   ? -33.682 -20.842 -29.023 1.00  33.03 ? 2314 HOH A O    1 
HETATM 6268 O  O    . HOH J 4 .   ? -35.111 -26.503 -24.861 1.00  40.96 ? 2315 HOH A O    1 
HETATM 6269 O  O    . HOH J 4 .   ? -35.788 -24.066 -27.208 1.00  31.81 ? 2316 HOH A O    1 
HETATM 6270 O  O    . HOH J 4 .   ? -34.785 -20.265 -20.620 1.00  22.36 ? 2317 HOH A O    1 
HETATM 6271 O  O    . HOH J 4 .   ? -37.861 -24.618 -25.999 1.00  43.77 ? 2318 HOH A O    1 
HETATM 6272 O  O    . HOH J 4 .   ? -37.409 -25.101 -21.494 1.00  30.40 ? 2319 HOH A O    1 
HETATM 6273 O  O    . HOH J 4 .   ? -31.755 -29.006 -24.296 1.00  40.62 ? 2320 HOH A O    1 
HETATM 6274 O  O    . HOH J 4 .   ? -32.734 -31.346 -23.654 1.00  38.99 ? 2321 HOH A O    1 
HETATM 6275 O  O    . HOH J 4 .   ? -30.925 -26.914 -17.967 1.00  20.20 ? 2322 HOH A O    1 
HETATM 6276 O  O    . HOH J 4 .   ? -29.863 -24.549 -18.798 1.00  19.83 ? 2323 HOH A O    1 
HETATM 6277 O  O    . HOH J 4 .   ? -28.682 -34.006 -15.224 1.00  40.78 ? 2324 HOH A O    1 
HETATM 6278 O  O    . HOH J 4 .   ? -32.848 -30.149 -16.490 1.00  35.30 ? 2325 HOH A O    1 
HETATM 6279 O  O    . HOH J 4 .   ? -35.330 -29.233 -12.814 1.00  37.87 ? 2326 HOH A O    1 
HETATM 6280 O  O    . HOH J 4 .   ? -37.436 -23.474 -19.227 1.00  25.35 ? 2327 HOH A O    1 
HETATM 6281 O  O    . HOH J 4 .   ? -38.697 -29.966 -21.186 1.00  47.42 ? 2328 HOH A O    1 
HETATM 6282 O  O    . HOH J 4 .   ? -38.195 -18.956 -22.832 1.00  36.97 ? 2329 HOH A O    1 
HETATM 6283 O  O    . HOH J 4 .   ? -36.011 -21.306 -27.829 1.00  33.06 ? 2330 HOH A O    1 
HETATM 6284 O  O    . HOH J 4 .   ? -38.782 -20.635 -25.808 1.00  41.53 ? 2331 HOH A O    1 
HETATM 6285 O  O    . HOH J 4 .   ? -32.333 -16.465 -32.208 1.00  42.07 ? 2332 HOH A O    1 
HETATM 6286 O  O    . HOH J 4 .   ? -23.337 -14.409 -27.701 1.00  37.09 ? 2333 HOH A O    1 
HETATM 6287 O  O    . HOH J 4 .   ? -27.099 -14.243 -31.417 1.00  38.06 ? 2334 HOH A O    1 
HETATM 6288 O  O    . HOH J 4 .   ? -23.391 -15.423 -33.027 1.00  40.45 ? 2335 HOH A O    1 
HETATM 6289 O  O    . HOH J 4 .   ? -24.096 -14.650 -30.145 1.00  39.42 ? 2336 HOH A O    1 
HETATM 6290 O  O    . HOH J 4 .   ? -21.382 -27.878 -26.406 1.00  38.03 ? 2337 HOH A O    1 
HETATM 6291 O  O    . HOH J 4 .   ? -21.977 -30.832 -27.029 1.00  30.53 ? 2338 HOH A O    1 
HETATM 6292 O  O    . HOH J 4 .   ? -18.128 -37.001 -31.022 1.00  34.00 ? 2339 HOH A O    1 
HETATM 6293 O  O    . HOH J 4 .   ? -13.418 -42.219 -29.862 1.00  49.48 ? 2340 HOH A O    1 
HETATM 6294 O  O    . HOH J 4 .   ? -9.840  -43.512 -14.078 1.00  30.02 ? 2341 HOH A O    1 
HETATM 6295 O  O    . HOH J 4 .   ? -8.368  -44.817 -16.764 1.00  44.69 ? 2342 HOH A O    1 
HETATM 6296 O  O    . HOH J 4 .   ? -12.277 -41.943 -10.219 1.00  31.61 ? 2343 HOH A O    1 
HETATM 6297 O  O    . HOH J 4 .   ? -7.457  -41.725 -12.253 1.00  36.16 ? 2344 HOH A O    1 
HETATM 6298 O  O    . HOH J 4 .   ? -7.479  -45.521 -19.920 1.00  43.33 ? 2345 HOH A O    1 
HETATM 6299 O  O    . HOH J 4 .   ? -13.953 -44.999 -21.101 1.00  31.82 ? 2346 HOH A O    1 
HETATM 6300 O  O    . HOH J 4 .   ? -11.007 -46.020 -14.558 1.00  42.23 ? 2347 HOH A O    1 
HETATM 6301 O  O    . HOH J 4 .   ? -12.233 -48.376 -19.595 1.00  49.53 ? 2348 HOH A O    1 
HETATM 6302 O  O    . HOH J 4 .   ? -16.621 -44.195 -19.797 1.00  30.66 ? 2349 HOH A O    1 
HETATM 6303 O  O    . HOH J 4 .   ? -25.178 -31.734 -24.056 1.00  27.35 ? 2350 HOH A O    1 
HETATM 6304 O  O    . HOH J 4 .   ? -25.829 -33.014 -28.693 1.00  51.84 ? 2351 HOH A O    1 
HETATM 6305 O  O    . HOH J 4 .   ? -22.770 -43.983 -8.671  1.00  41.43 ? 2352 HOH A O    1 
HETATM 6306 O  O    . HOH J 4 .   ? -18.994 -44.144 -9.187  1.00  32.54 ? 2353 HOH A O    1 
HETATM 6307 O  O    . HOH J 4 .   ? -17.755 -44.329 -7.111  1.00  40.20 ? 2354 HOH A O    1 
HETATM 6308 O  O    . HOH J 4 .   ? -13.591 -41.742 -7.484  1.00  31.38 ? 2355 HOH A O    1 
HETATM 6309 O  O    . HOH J 4 .   ? -15.460 -43.236 -7.321  1.00  27.60 ? 2356 HOH A O    1 
HETATM 6310 O  O    . HOH J 4 .   ? -16.664 -44.192 -10.756 1.00  36.94 ? 2357 HOH A O    1 
HETATM 6311 O  O    . HOH J 4 .   ? -13.565 -39.906 -4.616  1.00  25.96 ? 2358 HOH A O    1 
HETATM 6312 O  O    . HOH J 4 .   ? -6.358  -40.036 -9.350  1.00  46.26 ? 2359 HOH A O    1 
HETATM 6313 O  O    . HOH J 4 .   ? -11.288 -42.446 -5.706  1.00  41.21 ? 2360 HOH A O    1 
HETATM 6314 O  O    . HOH J 4 .   ? -7.189  -42.377 -9.597  1.00  50.47 ? 2361 HOH A O    1 
HETATM 6315 O  O    . HOH J 4 .   ? -9.059  -37.527 -4.231  1.00  24.33 ? 2362 HOH A O    1 
HETATM 6316 O  O    . HOH J 4 .   ? -2.847  -33.547 -0.855  1.00  29.30 ? 2363 HOH A O    1 
HETATM 6317 O  O    . HOH J 4 .   ? -4.535  -39.442 -4.118  1.00  41.50 ? 2364 HOH A O    1 
HETATM 6318 O  O    . HOH J 4 .   ? 1.687   -33.766 -1.246  1.00  38.03 ? 2365 HOH A O    1 
HETATM 6319 O  O    . HOH J 4 .   ? 1.853   -30.618 -4.114  1.00  35.71 ? 2366 HOH A O    1 
HETATM 6320 O  O    . HOH J 4 .   ? 1.398   -30.036 -8.755  1.00  40.65 ? 2367 HOH A O    1 
HETATM 6321 O  O    . HOH J 4 .   ? 0.611   -28.919 -5.199  1.00  19.88 ? 2368 HOH A O    1 
HETATM 6322 O  O    . HOH J 4 .   ? -3.041  -38.430 -9.115  1.00  48.06 ? 2369 HOH A O    1 
HETATM 6323 O  O    . HOH J 4 .   ? 1.615   -28.329 1.671   1.00  39.91 ? 2370 HOH A O    1 
HETATM 6324 O  O    . HOH J 4 .   ? 2.797   -21.432 -1.800  1.00  27.71 ? 2371 HOH A O    1 
HETATM 6325 O  O    . HOH J 4 .   ? 3.587   -22.518 6.937   1.00  49.55 ? 2372 HOH A O    1 
HETATM 6326 O  O    . HOH J 4 .   ? 4.481   -27.994 1.877   1.00  41.65 ? 2373 HOH A O    1 
HETATM 6327 O  O    . HOH J 4 .   ? 5.975   -27.848 4.006   1.00  44.56 ? 2374 HOH A O    1 
HETATM 6328 O  O    . HOH J 4 .   ? 4.322   -20.901 3.160   1.00  31.45 ? 2375 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . LYS A 7   ? 0.5536 0.4890 0.5360 -0.0479 -0.0001 -0.0918 1460 LYS A N   
2    C  CA  . LYS A 7   ? 0.5416 0.4839 0.5221 -0.0503 -0.0049 -0.0951 1460 LYS A CA  
3    C  C   . LYS A 7   ? 0.5108 0.4719 0.5048 -0.0467 0.0030  -0.0977 1460 LYS A C   
4    O  O   . LYS A 7   ? 0.5189 0.4741 0.5136 -0.0488 -0.0236 -0.1069 1460 LYS A O   
5    C  CB  . LYS A 7   ? 0.5554 0.4907 0.5402 -0.0461 -0.0101 -0.0859 1460 LYS A CB  
10   N  N   . LEU A 8   ? 0.4536 0.4556 0.4649 -0.0482 0.0260  -0.1021 1461 LEU A N   
11   C  CA  . LEU A 8   ? 0.3856 0.4341 0.4275 -0.0540 0.0413  -0.1138 1461 LEU A CA  
12   C  C   . LEU A 8   ? 0.3488 0.4085 0.3874 -0.0554 0.0545  -0.1175 1461 LEU A C   
13   O  O   . LEU A 8   ? 0.3504 0.4296 0.4207 -0.0723 0.0729  -0.1278 1461 LEU A O   
14   C  CB  . LEU A 8   ? 0.3883 0.4357 0.4608 -0.0374 0.0425  -0.1119 1461 LEU A CB  
15   C  CG  . LEU A 8   ? 0.3982 0.4404 0.4930 -0.0323 0.0390  -0.1015 1461 LEU A CG  
16   C  CD1 . LEU A 8   ? 0.4113 0.4462 0.5200 -0.0375 0.0254  -0.1004 1461 LEU A CD1 
17   C  CD2 . LEU A 8   ? 0.3814 0.4420 0.4765 -0.0305 0.0528  -0.1019 1461 LEU A CD2 
29   N  N   . VAL A 9   ? 0.3060 0.3555 0.3185 -0.0490 0.0409  -0.1033 1462 VAL A N   
30   C  CA  A VAL A 9   ? 0.2924 0.3310 0.2976 -0.0474 0.0297  -0.0815 1462 VAL A CA  
31   C  CA  B VAL A 9   ? 0.2904 0.3299 0.2939 -0.0398 0.0441  -0.0877 1462 VAL A CA  
32   C  C   . VAL A 9   ? 0.2677 0.3013 0.2780 -0.0366 0.0599  -0.0792 1462 VAL A C   
33   O  O   . VAL A 9   ? 0.2486 0.2735 0.3030 -0.0338 0.0497  -0.0631 1462 VAL A O   
34   C  CB  A VAL A 9   ? 0.3246 0.3383 0.2926 -0.0603 -0.0213 -0.0614 1462 VAL A CB  
35   C  CB  B VAL A 9   ? 0.3046 0.3343 0.2933 -0.0359 0.0275  -0.0782 1462 VAL A CB  
36   C  CG1 A VAL A 9   ? 0.3222 0.3355 0.3028 -0.0805 -0.0333 -0.0532 1462 VAL A CG1 
37   C  CG1 B VAL A 9   ? 0.3163 0.3366 0.2999 -0.0301 0.0397  -0.0748 1462 VAL A CG1 
38   C  CG2 A VAL A 9   ? 0.3664 0.3482 0.3552 -0.0533 -0.0135 -0.0417 1462 VAL A CG2 
39   C  CG2 B VAL A 9   ? 0.3048 0.3355 0.3052 -0.0379 0.0311  -0.0732 1462 VAL A CG2 
58   N  N   . ARG A 10  ? 0.2572 0.2842 0.2820 -0.0355 0.0537  -0.0778 1463 ARG A N   
59   C  CA  . ARG A 10  ? 0.2617 0.2735 0.2775 -0.0110 0.0499  -0.0858 1463 ARG A CA  
60   C  C   . ARG A 10  ? 0.2358 0.2505 0.2754 -0.0420 0.0400  -0.0683 1463 ARG A C   
61   O  O   . ARG A 10  ? 0.2680 0.2661 0.3290 -0.0499 0.0430  -0.0632 1463 ARG A O   
62   C  CB  . ARG A 10  ? 0.3058 0.2930 0.3293 0.0290  0.0352  -0.0950 1463 ARG A CB  
63   C  CG  . ARG A 10  ? 0.3394 0.3152 0.3984 0.0423  0.0398  -0.0720 1463 ARG A CG  
64   C  CD  . ARG A 10  ? 0.3573 0.3365 0.4448 0.0429  0.0532  -0.0563 1463 ARG A CD  
65   N  NE  . ARG A 10  ? 0.3549 0.3487 0.4733 0.0328  0.0733  -0.0359 1463 ARG A NE  
66   C  CZ  . ARG A 10  ? 0.3569 0.3598 0.4852 0.0220  0.0979  -0.0369 1463 ARG A CZ  
67   N  NH1 . ARG A 10  ? 0.3777 0.3649 0.5013 0.0158  0.1041  -0.0340 1463 ARG A NH1 
68   N  NH2 . ARG A 10  ? 0.3450 0.3669 0.4982 0.0105  0.1169  -0.0331 1463 ARG A NH2 
82   N  N   . LEU A 11  ? 0.2194 0.2159 0.2352 -0.0442 0.0680  -0.0609 1464 LEU A N   
83   C  CA  . LEU A 11  ? 0.2013 0.1952 0.2252 -0.0443 0.0630  -0.0672 1464 LEU A CA  
84   C  C   . LEU A 11  ? 0.1886 0.1752 0.2617 -0.0378 0.0394  -0.0558 1464 LEU A C   
85   O  O   . LEU A 11  ? 0.1758 0.1627 0.2821 -0.0343 0.0361  -0.0454 1464 LEU A O   
86   C  CB  . LEU A 11  ? 0.1986 0.1984 0.2366 -0.0360 0.0322  -0.0625 1464 LEU A CB  
87   C  CG  . LEU A 11  ? 0.2413 0.2087 0.2563 -0.0350 0.0150  -0.0601 1464 LEU A CG  
88   C  CD1 . LEU A 11  ? 0.2418 0.2075 0.2717 -0.0100 -0.0203 -0.0725 1464 LEU A CD1 
89   C  CD2 . LEU A 11  ? 0.2751 0.2218 0.2633 -0.0401 0.0224  -0.0345 1464 LEU A CD2 
101  N  N   . PRO A 12  ? 0.1822 0.1644 0.2641 -0.0324 0.0268  -0.0451 1465 PRO A N   
102  C  CA  . PRO A 12  ? 0.1847 0.1653 0.2691 -0.0199 0.0388  -0.0499 1465 PRO A CA  
103  C  C   . PRO A 12  ? 0.1988 0.1561 0.2519 -0.0030 0.0558  -0.0387 1465 PRO A C   
104  O  O   . PRO A 12  ? 0.2125 0.1594 0.2681 -0.0166 0.0346  -0.0417 1465 PRO A O   
105  C  CB  . PRO A 12  ? 0.2080 0.1721 0.2854 -0.0381 0.0170  -0.0464 1465 PRO A CB  
106  C  CG  . PRO A 12  ? 0.2501 0.1761 0.3016 -0.0473 0.0040  -0.0485 1465 PRO A CG  
107  C  CD  . PRO A 12  ? 0.2246 0.1696 0.2932 -0.0566 -0.0020 -0.0353 1465 PRO A CD  
115  N  N   . GLY A 13  ? 0.1955 0.1487 0.2585 0.0038  0.0569  -0.0229 1466 GLY A N   
116  C  CA  . GLY A 13  ? 0.2011 0.1411 0.2587 -0.0097 0.0587  -0.0342 1466 GLY A CA  
117  C  C   . GLY A 13  ? 0.1666 0.1221 0.2749 -0.0134 0.0573  -0.0411 1466 GLY A C   
118  O  O   . GLY A 13  ? 0.1536 0.1214 0.3212 -0.0146 0.0200  -0.0329 1466 GLY A O   
122  N  N   . LEU A 14  ? 0.1486 0.1141 0.2454 -0.0186 0.0404  -0.0505 1467 LEU A N   
123  C  CA  . LEU A 14  ? 0.1404 0.1206 0.2302 -0.0171 0.0204  -0.0493 1467 LEU A CA  
124  C  C   . LEU A 14  ? 0.1462 0.1059 0.2262 -0.0165 0.0185  -0.0235 1467 LEU A C   
125  O  O   . LEU A 14  ? 0.1615 0.1062 0.2279 -0.0150 0.0376  -0.0269 1467 LEU A O   
126  C  CB  . LEU A 14  ? 0.1347 0.1460 0.2341 -0.0289 0.0109  -0.0486 1467 LEU A CB  
127  C  CG  . LEU A 14  ? 0.1381 0.1586 0.2313 -0.0237 0.0193  -0.0395 1467 LEU A CG  
128  C  CD1 . LEU A 14  ? 0.1643 0.1700 0.2495 -0.0270 -0.0043 -0.0312 1467 LEU A CD1 
129  C  CD2 . LEU A 14  ? 0.1432 0.1530 0.2405 -0.0383 0.0224  -0.0355 1467 LEU A CD2 
141  N  N   . ILE A 15  ? 0.1374 0.1000 0.2237 -0.0005 0.0124  -0.0214 1468 ILE A N   
142  C  CA  . ILE A 15  ? 0.1240 0.1004 0.2249 -0.0073 0.0222  -0.0066 1468 ILE A CA  
143  C  C   . ILE A 15  ? 0.1481 0.0947 0.2113 -0.0084 0.0200  -0.0138 1468 ILE A C   
144  O  O   . ILE A 15  ? 0.1671 0.0970 0.2434 -0.0035 0.0160  -0.0124 1468 ILE A O   
145  C  CB  . ILE A 15  ? 0.1403 0.1070 0.2316 -0.0090 0.0141  -0.0055 1468 ILE A CB  
146  C  CG1 . ILE A 15  ? 0.1322 0.1085 0.2694 -0.0088 0.0053  0.0034  1468 ILE A CG1 
147  C  CG2 . ILE A 15  ? 0.1672 0.1174 0.2404 -0.0179 0.0029  -0.0266 1468 ILE A CG2 
148  C  CD1 . ILE A 15  ? 0.1361 0.1162 0.2979 0.0079  0.0147  0.0004  1468 ILE A CD1 
160  N  N   . ASP A 16  ? 0.1396 0.0931 0.2229 -0.0159 0.0076  -0.0185 1469 ASP A N   
161  C  CA  . ASP A 16  ? 0.1224 0.1124 0.2234 -0.0022 -0.0054 -0.0159 1469 ASP A CA  
162  C  C   . ASP A 16  ? 0.1337 0.1075 0.2077 -0.0047 0.0034  -0.0014 1469 ASP A C   
163  O  O   . ASP A 16  ? 0.1410 0.1116 0.2114 -0.0127 0.0116  -0.0106 1469 ASP A O   
164  C  CB  . ASP A 16  ? 0.1230 0.1238 0.2143 -0.0031 0.0005  -0.0149 1469 ASP A CB  
165  C  CG  . ASP A 16  ? 0.1496 0.1379 0.2381 -0.0033 -0.0019 -0.0118 1469 ASP A CG  
166  O  OD1 . ASP A 16  ? 0.1622 0.1313 0.2762 -0.0051 -0.0008 -0.0054 1469 ASP A OD1 
167  O  OD2 . ASP A 16  ? 0.1931 0.1628 0.2552 0.0162  -0.0074 -0.0324 1469 ASP A OD2 
172  N  N   . VAL A 17  ? 0.1216 0.1041 0.2071 0.0126  0.0130  -0.0087 1470 VAL A N   
173  C  CA  . VAL A 17  ? 0.1132 0.1044 0.2081 -0.0003 -0.0091 -0.0143 1470 VAL A CA  
174  C  C   . VAL A 17  ? 0.1007 0.1105 0.1989 -0.0026 -0.0240 -0.0082 1470 VAL A C   
175  O  O   . VAL A 17  ? 0.1244 0.1262 0.2053 0.0006  -0.0003 -0.0109 1470 VAL A O   
176  C  CB  . VAL A 17  ? 0.1248 0.1042 0.2110 -0.0069 -0.0112 -0.0158 1470 VAL A CB  
177  C  CG1 . VAL A 17  ? 0.1415 0.1167 0.2235 0.0008  -0.0179 -0.0291 1470 VAL A CG1 
178  C  CG2 . VAL A 17  ? 0.1441 0.1094 0.2200 -0.0190 0.0113  -0.0124 1470 VAL A CG2 
188  N  N   . HIS A 18  ? 0.1000 0.1089 0.1910 -0.0140 0.0082  -0.0037 1471 HIS A N   
189  C  CA  . HIS A 18  ? 0.1083 0.0983 0.1804 -0.0073 0.0083  -0.0017 1471 HIS A CA  
190  C  C   . HIS A 18  ? 0.1107 0.1046 0.1805 0.0017  -0.0180 0.0028  1471 HIS A C   
191  O  O   . HIS A 18  ? 0.1254 0.1108 0.1911 0.0012  0.0012  -0.0044 1471 HIS A O   
192  C  CB  . HIS A 18  ? 0.1374 0.1012 0.1885 -0.0008 -0.0059 -0.0082 1471 HIS A CB  
193  C  CG  . HIS A 18  ? 0.1258 0.0961 0.2039 -0.0042 0.0061  -0.0256 1471 HIS A CG  
194  N  ND1 . HIS A 18  ? 0.1394 0.1083 0.2456 -0.0104 0.0013  -0.0450 1471 HIS A ND1 
195  C  CD2 . HIS A 18  ? 0.1146 0.1025 0.1787 0.0000  0.0167  -0.0219 1471 HIS A CD2 
196  C  CE1 . HIS A 18  ? 0.1393 0.1031 0.2544 -0.0012 0.0277  -0.0397 1471 HIS A CE1 
197  N  NE2 . HIS A 18  ? 0.1347 0.1039 0.1978 0.0006  0.0131  -0.0052 1471 HIS A NE2 
204  N  N   . VAL A 19  ? 0.1077 0.1170 0.2061 -0.0079 0.0065  0.0001  1472 VAL A N   
205  C  CA  . VAL A 19  ? 0.1219 0.1230 0.2081 -0.0015 0.0111  -0.0112 1472 VAL A CA  
206  C  C   . VAL A 19  ? 0.1104 0.1344 0.2036 0.0013  0.0083  -0.0002 1472 VAL A C   
207  O  O   . VAL A 19  ? 0.1258 0.1514 0.2121 -0.0049 0.0059  0.0218  1472 VAL A O   
208  C  CB  . VAL A 19  ? 0.1363 0.1301 0.2217 -0.0022 0.0163  -0.0145 1472 VAL A CB  
209  C  CG1 . VAL A 19  ? 0.1384 0.1310 0.2326 -0.0267 0.0288  -0.0194 1472 VAL A CG1 
210  C  CG2 . VAL A 19  ? 0.1311 0.1327 0.2502 0.0044  0.0084  -0.0281 1472 VAL A CG2 
220  N  N   . HIS A 20  ? 0.1017 0.1333 0.2191 -0.0104 0.0244  -0.0142 1473 HIS A N   
221  C  CA  . HIS A 20  ? 0.1136 0.1265 0.1962 -0.0155 0.0166  0.0023  1473 HIS A CA  
222  C  C   . HIS A 20  ? 0.1396 0.1286 0.2376 -0.0271 0.0134  0.0060  1473 HIS A C   
223  O  O   . HIS A 20  ? 0.1439 0.1229 0.2683 -0.0274 -0.0101 0.0045  1473 HIS A O   
224  C  CB  . HIS A 20  ? 0.1032 0.1209 0.2238 -0.0192 0.0305  -0.0161 1473 HIS A CB  
225  C  CG  . HIS A 20  ? 0.1195 0.1166 0.2210 -0.0203 0.0300  -0.0059 1473 HIS A CG  
226  N  ND1 . HIS A 20  ? 0.1313 0.1271 0.2024 -0.0099 0.0076  0.0042  1473 HIS A ND1 
227  C  CD2 . HIS A 20  ? 0.1057 0.1066 0.2320 -0.0190 0.0045  -0.0207 1473 HIS A CD2 
228  C  CE1 . HIS A 20  ? 0.1443 0.1254 0.2273 -0.0042 0.0091  -0.0017 1473 HIS A CE1 
229  N  NE2 . HIS A 20  ? 0.1161 0.1168 0.2246 0.0070  0.0125  -0.0091 1473 HIS A NE2 
237  N  N   . LEU A 21  ? 0.1170 0.1320 0.2483 -0.0307 -0.0035 0.0036  1474 LEU A N   
238  C  CA  . LEU A 21  ? 0.1485 0.1452 0.2607 -0.0327 0.0261  -0.0021 1474 LEU A CA  
239  C  C   . LEU A 21  ? 0.1541 0.1551 0.2665 -0.0278 0.0167  0.0109  1474 LEU A C   
240  O  O   . LEU A 21  ? 0.1735 0.1532 0.2994 -0.0381 0.0243  -0.0015 1474 LEU A O   
241  C  CB  . LEU A 21  ? 0.1817 0.1450 0.2632 -0.0266 0.0632  -0.0234 1474 LEU A CB  
242  C  CG  . LEU A 21  ? 0.1908 0.1559 0.2648 -0.0201 0.0545  0.0043  1474 LEU A CG  
243  C  CD1 . LEU A 21  ? 0.1999 0.1596 0.3170 -0.0107 0.0998  0.0084  1474 LEU A CD1 
244  C  CD2 . LEU A 21  ? 0.2321 0.1826 0.2949 -0.0312 0.0454  -0.0209 1474 LEU A CD2 
256  N  N   . ARG A 22  ? 0.1338 0.1697 0.2399 -0.0181 -0.0048 0.0119  1475 ARG A N   
257  C  CA  . ARG A 22  ? 0.1342 0.1807 0.2537 -0.0171 0.0119  0.0197  1475 ARG A CA  
258  C  C   . ARG A 22  ? 0.1608 0.1986 0.3137 -0.0301 0.0397  0.0399  1475 ARG A C   
259  O  O   . ARG A 22  ? 0.2127 0.2375 0.3699 0.0078  0.0718  0.0699  1475 ARG A O   
260  C  CB  . ARG A 22  ? 0.1228 0.1768 0.2663 -0.0159 -0.0028 0.0123  1475 ARG A CB  
261  C  CG  . ARG A 22  ? 0.1555 0.1775 0.2882 -0.0130 -0.0077 0.0173  1475 ARG A CG  
262  C  CD  . ARG A 22  ? 0.1716 0.1733 0.2793 -0.0149 -0.0117 0.0124  1475 ARG A CD  
263  N  NE  . ARG A 22  ? 0.1543 0.1667 0.2690 -0.0059 -0.0234 0.0170  1475 ARG A NE  
264  C  CZ  . ARG A 22  ? 0.1523 0.1778 0.2520 0.0046  -0.0062 0.0127  1475 ARG A CZ  
265  N  NH1 . ARG A 22  ? 0.1851 0.1866 0.2455 0.0136  0.0055  -0.0017 1475 ARG A NH1 
266  N  NH2 . ARG A 22  ? 0.1605 0.1791 0.2777 0.0017  0.0011  0.0227  1475 ARG A NH2 
280  N  N   . GLU A 23  ? 0.1695 0.1743 0.3136 -0.0271 0.0526  0.0549  1476 GLU A N   
281  C  CA  . GLU A 23  ? 0.1921 0.1728 0.3065 -0.0318 0.0475  0.0593  1476 GLU A CA  
282  C  C   . GLU A 23  ? 0.1980 0.1802 0.3281 -0.0384 0.0308  0.0497  1476 GLU A C   
283  O  O   . GLU A 23  ? 0.1913 0.1877 0.3735 -0.0399 0.0334  0.0274  1476 GLU A O   
284  C  CB  . GLU A 23  ? 0.1913 0.1728 0.2867 -0.0324 0.0276  0.0403  1476 GLU A CB  
285  C  CG  . GLU A 23  ? 0.1932 0.1773 0.2982 -0.0304 0.0004  0.0413  1476 GLU A CG  
286  C  CD  . GLU A 23  ? 0.2094 0.1783 0.3040 -0.0369 0.0042  0.0445  1476 GLU A CD  
287  O  OE1 . GLU A 23  ? 0.2167 0.1795 0.3161 -0.0372 0.0104  0.0249  1476 GLU A OE1 
288  O  OE2 . GLU A 23  ? 0.2682 0.1794 0.3479 -0.0391 0.0110  0.0522  1476 GLU A OE2 
295  N  N   . PRO A 24  ? 0.2047 0.2009 0.3155 -0.0326 -0.0018 0.0478  1477 PRO A N   
296  C  CA  . PRO A 24  ? 0.2200 0.2116 0.3243 -0.0417 0.0024  0.0383  1477 PRO A CA  
297  C  C   . PRO A 24  ? 0.2116 0.2246 0.3167 -0.0460 0.0121  0.0367  1477 PRO A C   
298  O  O   . PRO A 24  ? 0.2236 0.2207 0.3019 -0.0529 0.0017  0.0281  1477 PRO A O   
299  C  CB  . PRO A 24  ? 0.2433 0.2095 0.3331 -0.0347 0.0181  0.0402  1477 PRO A CB  
300  C  CG  . PRO A 24  ? 0.2481 0.2148 0.3433 -0.0203 -0.0096 0.0356  1477 PRO A CG  
301  C  CD  . PRO A 24  ? 0.2346 0.2037 0.3346 -0.0261 -0.0161 0.0440  1477 PRO A CD  
309  N  N   . GLY A 25  ? 0.2014 0.2447 0.3225 -0.0423 0.0181  0.0228  1478 GLY A N   
310  C  CA  . GLY A 25  ? 0.1770 0.2672 0.3436 -0.0323 0.0186  0.0355  1478 GLY A CA  
311  C  C   . GLY A 25  ? 0.2127 0.2871 0.3646 -0.0312 0.0231  0.0198  1478 GLY A C   
312  O  O   . GLY A 25  ? 0.2443 0.3162 0.3901 -0.0136 0.0388  0.0178  1478 GLY A O   
316  N  N   . GLY A 26  ? 0.2146 0.2682 0.3295 -0.0486 -0.0076 0.0152  1479 GLY A N   
317  C  CA  . GLY A 26  ? 0.2078 0.2551 0.3212 -0.0446 0.0005  0.0201  1479 GLY A CA  
318  C  C   . GLY A 26  ? 0.1968 0.2472 0.3011 -0.0434 0.0212  0.0169  1479 GLY A C   
319  O  O   . GLY A 26  ? 0.1883 0.2428 0.2850 -0.0389 -0.0130 0.0012  1479 GLY A O   
323  N  N   . THR A 27  ? 0.1955 0.2406 0.2949 -0.0499 0.0258  0.0176  1480 THR A N   
324  C  CA  . THR A 27  ? 0.2003 0.2374 0.3270 -0.0439 0.0090  0.0207  1480 THR A CA  
325  C  C   . THR A 27  ? 0.1971 0.2323 0.3512 -0.0559 0.0190  0.0146  1480 THR A C   
326  O  O   . THR A 27  ? 0.2171 0.2257 0.3859 -0.0583 -0.0003 -0.0043 1480 THR A O   
327  C  CB  . THR A 27  ? 0.1885 0.2406 0.3570 -0.0492 0.0049  0.0301  1480 THR A CB  
328  O  OG1 . THR A 27  ? 0.2107 0.2474 0.3867 -0.0584 0.0651  0.0407  1480 THR A OG1 
329  C  CG2 . THR A 27  ? 0.1939 0.2464 0.3691 -0.0372 0.0115  0.0342  1480 THR A CG2 
337  N  N   . HIS A 28  ? 0.1778 0.2343 0.3377 -0.0545 0.0402  0.0203  1481 HIS A N   
338  C  CA  . HIS A 28  ? 0.1756 0.2443 0.3355 -0.0558 0.0255  0.0100  1481 HIS A CA  
339  C  C   . HIS A 28  ? 0.1845 0.2476 0.3118 -0.0417 0.0061  0.0056  1481 HIS A C   
340  O  O   . HIS A 28  ? 0.2124 0.2643 0.3154 -0.0425 -0.0054 0.0010  1481 HIS A O   
341  C  CB  . HIS A 28  ? 0.1719 0.2595 0.3494 -0.0449 0.0249  0.0115  1481 HIS A CB  
342  C  CG  . HIS A 28  ? 0.1893 0.2696 0.3470 -0.0291 0.0425  0.0213  1481 HIS A CG  
343  N  ND1 . HIS A 28  ? 0.2219 0.2770 0.3393 -0.0078 0.0622  0.0323  1481 HIS A ND1 
344  C  CD2 . HIS A 28  ? 0.1778 0.2760 0.3408 -0.0118 0.0580  0.0147  1481 HIS A CD2 
345  C  CE1 . HIS A 28  ? 0.2160 0.2792 0.3515 -0.0005 0.0556  0.0328  1481 HIS A CE1 
346  N  NE2 . HIS A 28  ? 0.1944 0.2804 0.3544 0.0060  0.0532  0.0290  1481 HIS A NE2 
355  N  N   . LYS A 29  ? 0.1578 0.2300 0.2949 -0.0433 0.0043  -0.0036 1482 LYS A N   
356  C  CA  . LYS A 29  ? 0.1604 0.2151 0.2738 -0.0345 0.0046  -0.0049 1482 LYS A CA  
357  C  C   . LYS A 29  ? 0.1514 0.2061 0.2829 -0.0269 0.0157  0.0003  1482 LYS A C   
358  O  O   . LYS A 29  ? 0.1585 0.2112 0.2854 -0.0167 0.0271  -0.0017 1482 LYS A O   
359  C  CB  . LYS A 29  ? 0.1734 0.2147 0.2610 -0.0305 0.0058  -0.0066 1482 LYS A CB  
360  C  CG  . LYS A 29  ? 0.1711 0.2279 0.2558 -0.0197 0.0039  -0.0159 1482 LYS A CG  
361  C  CD  . LYS A 29  ? 0.1873 0.2315 0.2618 0.0004  -0.0039 -0.0370 1482 LYS A CD  
362  C  CE  . LYS A 29  ? 0.1786 0.2428 0.2876 0.0263  -0.0165 -0.0467 1482 LYS A CE  
363  N  NZ  . LYS A 29  ? 0.1750 0.2557 0.3127 0.0410  -0.0313 -0.0588 1482 LYS A NZ  
377  N  N   . GLU A 30  ? 0.1532 0.1850 0.3016 -0.0163 0.0299  0.0074  1483 GLU A N   
378  C  CA  . GLU A 30  ? 0.1441 0.1731 0.2939 -0.0261 0.0427  0.0052  1483 GLU A CA  
379  C  C   . GLU A 30  ? 0.1501 0.1690 0.3031 -0.0237 0.0304  0.0030  1483 GLU A C   
380  O  O   . GLU A 30  ? 0.1575 0.1809 0.2956 -0.0222 0.0314  0.0105  1483 GLU A O   
381  C  CB  . GLU A 30  ? 0.1440 0.1614 0.3034 -0.0245 0.0291  0.0026  1483 GLU A CB  
382  C  CG  . GLU A 30  ? 0.1386 0.1574 0.3003 -0.0444 0.0042  -0.0062 1483 GLU A CG  
383  C  CD  . GLU A 30  ? 0.1536 0.1522 0.2839 -0.0348 0.0137  -0.0092 1483 GLU A CD  
384  O  OE1 . GLU A 30  ? 0.1558 0.1479 0.2985 -0.0350 0.0055  -0.0034 1483 GLU A OE1 
385  O  OE2 . GLU A 30  ? 0.1569 0.1501 0.2898 -0.0230 0.0201  -0.0222 1483 GLU A OE2 
392  N  N   . ASP A 31  ? 0.1618 0.1532 0.3221 -0.0355 0.0163  0.0030  1484 ASP A N   
393  C  CA  . ASP A 31  ? 0.1573 0.1591 0.3057 -0.0367 0.0217  0.0069  1484 ASP A CA  
394  C  C   . ASP A 31  ? 0.1740 0.1547 0.2946 -0.0240 0.0276  0.0082  1484 ASP A C   
395  O  O   . ASP A 31  ? 0.1599 0.1605 0.2886 -0.0263 0.0315  -0.0025 1484 ASP A O   
396  C  CB  . ASP A 31  ? 0.1657 0.1713 0.3103 -0.0429 0.0268  0.0029  1484 ASP A CB  
397  C  CG  . ASP A 31  ? 0.2030 0.1765 0.3621 -0.0683 0.0398  0.0192  1484 ASP A CG  
398  O  OD1 . ASP A 31  ? 0.1973 0.1664 0.3334 -0.0467 0.0246  0.0076  1484 ASP A OD1 
399  O  OD2 . ASP A 31  ? 0.2637 0.2008 0.4226 -0.0926 0.0561  -0.0041 1484 ASP A OD2 
404  N  N   . PHE A 32  ? 0.1829 0.1476 0.3006 -0.0260 0.0132  0.0128  1485 PHE A N   
405  C  CA  . PHE A 32  ? 0.1805 0.1466 0.2748 -0.0338 0.0294  0.0130  1485 PHE A CA  
406  C  C   . PHE A 32  ? 0.1888 0.1464 0.2890 -0.0311 0.0301  -0.0038 1485 PHE A C   
407  O  O   . PHE A 32  ? 0.1938 0.1483 0.2833 -0.0308 0.0271  -0.0106 1485 PHE A O   
408  C  CB  . PHE A 32  ? 0.1965 0.1534 0.2691 -0.0261 0.0035  0.0260  1485 PHE A CB  
409  C  CG  . PHE A 32  ? 0.2303 0.1663 0.2702 0.0047  -0.0114 0.0108  1485 PHE A CG  
410  C  CD1 . PHE A 32  ? 0.2841 0.1715 0.2846 -0.0059 -0.0187 0.0183  1485 PHE A CD1 
411  C  CD2 . PHE A 32  ? 0.2296 0.1754 0.3017 0.0259  -0.0175 -0.0079 1485 PHE A CD2 
412  C  CE1 . PHE A 32  ? 0.2997 0.1745 0.2936 0.0112  -0.0255 0.0114  1485 PHE A CE1 
413  C  CE2 . PHE A 32  ? 0.2607 0.1864 0.3121 0.0332  -0.0144 -0.0065 1485 PHE A CE2 
414  C  CZ  . PHE A 32  ? 0.3019 0.1820 0.3200 0.0324  -0.0270 0.0037  1485 PHE A CZ  
424  N  N   . ALA A 33  ? 0.1699 0.1450 0.3054 -0.0292 0.0398  -0.0183 1486 ALA A N   
425  C  CA  . ALA A 33  ? 0.1790 0.1418 0.3235 -0.0398 0.0354  -0.0262 1486 ALA A CA  
426  C  C   . ALA A 33  ? 0.1788 0.1491 0.3385 -0.0331 0.0339  -0.0342 1486 ALA A C   
427  O  O   . ALA A 33  ? 0.1994 0.1534 0.3314 -0.0243 0.0250  -0.0333 1486 ALA A O   
428  C  CB  . ALA A 33  ? 0.1950 0.1420 0.3501 -0.0517 0.0405  -0.0127 1486 ALA A CB  
434  N  N   . SER A 34  ? 0.1711 0.1461 0.3150 -0.0437 0.0341  -0.0374 1487 SER A N   
435  C  CA  . SER A 34  ? 0.1642 0.1556 0.3179 -0.0541 -0.0024 -0.0430 1487 SER A CA  
436  C  C   . SER A 34  ? 0.1596 0.1564 0.2949 -0.0452 0.0180  -0.0341 1487 SER A C   
437  O  O   . SER A 34  ? 0.1753 0.1620 0.3067 -0.0440 0.0188  -0.0405 1487 SER A O   
438  C  CB  . SER A 34  ? 0.1552 0.1641 0.3138 -0.0595 0.0014  -0.0335 1487 SER A CB  
439  O  OG  . SER A 34  ? 0.1659 0.1717 0.2967 -0.0517 -0.0002 -0.0308 1487 SER A OG  
445  N  N   . GLY A 35  ? 0.1374 0.1524 0.2798 -0.0547 0.0037  -0.0315 1488 GLY A N   
446  C  CA  . GLY A 35  ? 0.1395 0.1391 0.2821 -0.0342 0.0243  -0.0332 1488 GLY A CA  
447  C  C   . GLY A 35  ? 0.1556 0.1339 0.2806 -0.0273 0.0165  -0.0349 1488 GLY A C   
448  O  O   . GLY A 35  ? 0.1585 0.1343 0.2728 -0.0269 0.0303  -0.0318 1488 GLY A O   
452  N  N   . THR A 36  ? 0.1530 0.1258 0.2941 -0.0237 0.0011  -0.0431 1489 THR A N   
453  C  CA  . THR A 36  ? 0.1645 0.1294 0.2735 -0.0323 0.0221  -0.0397 1489 THR A CA  
454  C  C   . THR A 36  ? 0.1717 0.1341 0.2757 -0.0376 0.0201  -0.0395 1489 THR A C   
455  O  O   . THR A 36  ? 0.1675 0.1450 0.2884 -0.0250 0.0073  -0.0375 1489 THR A O   
456  C  CB  . THR A 36  ? 0.1738 0.1217 0.3014 -0.0446 0.0093  -0.0365 1489 THR A CB  
457  O  OG1 . THR A 36  ? 0.1534 0.1226 0.3147 -0.0309 0.0279  -0.0257 1489 THR A OG1 
458  C  CG2 . THR A 36  ? 0.1911 0.1248 0.3218 -0.0406 0.0087  -0.0215 1489 THR A CG2 
466  N  N   . ALA A 37  ? 0.1871 0.1343 0.2561 -0.0530 0.0189  -0.0355 1490 ALA A N   
467  C  CA  . ALA A 37  ? 0.1792 0.1344 0.2936 -0.0585 0.0170  -0.0504 1490 ALA A CA  
468  C  C   . ALA A 37  ? 0.1703 0.1441 0.2624 -0.0549 0.0238  -0.0489 1490 ALA A C   
469  O  O   . ALA A 37  ? 0.1772 0.1576 0.2768 -0.0463 0.0305  -0.0458 1490 ALA A O   
470  C  CB  . ALA A 37  ? 0.1766 0.1521 0.3233 -0.0685 0.0133  -0.0529 1490 ALA A CB  
476  N  N   . ALA A 38  ? 0.1675 0.1495 0.2792 -0.0400 0.0145  -0.0378 1491 ALA A N   
477  C  CA  . ALA A 38  ? 0.1683 0.1423 0.2832 -0.0304 0.0015  -0.0385 1491 ALA A CA  
478  C  C   . ALA A 38  ? 0.1623 0.1398 0.2730 -0.0390 0.0145  -0.0390 1491 ALA A C   
479  O  O   . ALA A 38  ? 0.1452 0.1427 0.2679 -0.0365 0.0131  -0.0447 1491 ALA A O   
480  C  CB  . ALA A 38  ? 0.1811 0.1421 0.2674 -0.0238 0.0124  -0.0348 1491 ALA A CB  
486  N  N   . ALA A 39  ? 0.1640 0.1405 0.2714 -0.0466 0.0017  -0.0398 1492 ALA A N   
487  C  CA  . ALA A 39  ? 0.1396 0.1431 0.2599 -0.0356 -0.0048 -0.0454 1492 ALA A CA  
488  C  C   . ALA A 39  ? 0.1447 0.1330 0.2582 -0.0286 0.0049  -0.0465 1492 ALA A C   
489  O  O   . ALA A 39  ? 0.1550 0.1377 0.2624 -0.0184 0.0058  -0.0404 1492 ALA A O   
490  C  CB  . ALA A 39  ? 0.1326 0.1475 0.2640 -0.0439 0.0104  -0.0484 1492 ALA A CB  
496  N  N   . LEU A 40  ? 0.1622 0.1340 0.2796 -0.0318 0.0275  -0.0468 1493 LEU A N   
497  C  CA  . LEU A 40  ? 0.1826 0.1390 0.2840 -0.0340 0.0392  -0.0467 1493 LEU A CA  
498  C  C   . LEU A 40  ? 0.1829 0.1485 0.2766 -0.0393 0.0141  -0.0555 1493 LEU A C   
499  O  O   . LEU A 40  ? 0.1968 0.1440 0.2760 -0.0346 0.0185  -0.0508 1493 LEU A O   
500  C  CB  . LEU A 40  ? 0.2043 0.1362 0.2805 -0.0295 0.0112  -0.0500 1493 LEU A CB  
501  C  CG  . LEU A 40  ? 0.1950 0.1391 0.3125 -0.0172 0.0228  -0.0514 1493 LEU A CG  
502  C  CD1 . LEU A 40  ? 0.1901 0.1433 0.3327 -0.0186 0.0058  -0.0344 1493 LEU A CD1 
503  C  CD2 . LEU A 40  ? 0.1994 0.1374 0.3169 -0.0328 0.0262  -0.0682 1493 LEU A CD2 
515  N  N   . ALA A 41  ? 0.1707 0.1586 0.2664 -0.0337 0.0018  -0.0646 1494 ALA A N   
516  C  CA  . ALA A 41  ? 0.1934 0.1709 0.2834 -0.0307 -0.0099 -0.0568 1494 ALA A CA  
517  C  C   . ALA A 41  ? 0.2064 0.1716 0.2660 -0.0311 -0.0218 -0.0431 1494 ALA A C   
518  O  O   . ALA A 41  ? 0.2411 0.1861 0.2951 -0.0354 -0.0313 -0.0514 1494 ALA A O   
519  C  CB  . ALA A 41  ? 0.1953 0.1815 0.2714 -0.0287 -0.0034 -0.0627 1494 ALA A CB  
525  N  N   . GLY A 42  ? 0.1927 0.1546 0.2484 -0.0173 -0.0017 -0.0510 1495 GLY A N   
526  C  CA  . GLY A 42  ? 0.1981 0.1499 0.2558 -0.0167 -0.0048 -0.0579 1495 GLY A CA  
527  C  C   . GLY A 42  ? 0.2038 0.1425 0.2501 -0.0112 0.0095  -0.0597 1495 GLY A C   
528  O  O   . GLY A 42  ? 0.2070 0.1348 0.2620 -0.0177 0.0227  -0.0413 1495 GLY A O   
532  N  N   . GLY A 43  ? 0.2008 0.1499 0.2475 -0.0073 0.0015  -0.0755 1496 GLY A N   
533  C  CA  . GLY A 43  ? 0.1785 0.1542 0.2408 -0.0172 0.0269  -0.0603 1496 GLY A CA  
534  C  C   . GLY A 43  ? 0.1464 0.1498 0.2444 -0.0227 0.0272  -0.0537 1496 GLY A C   
535  O  O   . GLY A 43  ? 0.1640 0.1543 0.2830 -0.0315 0.0244  -0.0637 1496 GLY A O   
539  N  N   . ILE A 44  ? 0.1552 0.1412 0.2411 -0.0302 0.0142  -0.0371 1497 ILE A N   
540  C  CA  . ILE A 44  ? 0.1615 0.1261 0.2201 -0.0384 0.0298  -0.0268 1497 ILE A CA  
541  C  C   . ILE A 44  ? 0.1626 0.1253 0.2542 -0.0396 0.0384  -0.0230 1497 ILE A C   
542  O  O   . ILE A 44  ? 0.1640 0.1298 0.2865 -0.0430 0.0205  -0.0051 1497 ILE A O   
543  C  CB  . ILE A 44  ? 0.1847 0.1350 0.2413 -0.0407 0.0243  -0.0342 1497 ILE A CB  
544  C  CG1 . ILE A 44  ? 0.2297 0.1619 0.2785 -0.0505 0.0174  -0.0375 1497 ILE A CG1 
545  C  CG2 . ILE A 44  ? 0.1874 0.1318 0.2665 -0.0311 0.0376  -0.0436 1497 ILE A CG2 
546  C  CD1 . ILE A 44  ? 0.2451 0.1780 0.3175 -0.0176 0.0529  -0.0235 1497 ILE A CD1 
558  N  N   . THR A 45  ? 0.1383 0.1162 0.2560 -0.0265 0.0364  -0.0183 1498 THR A N   
559  C  CA  . THR A 45  ? 0.1424 0.1170 0.2558 -0.0211 0.0409  -0.0130 1498 THR A CA  
560  C  C   . THR A 45  ? 0.1445 0.1056 0.2418 -0.0186 0.0297  -0.0206 1498 THR A C   
561  O  O   . THR A 45  ? 0.1487 0.1025 0.2805 -0.0184 0.0099  -0.0225 1498 THR A O   
562  C  CB  . THR A 45  ? 0.1490 0.1330 0.2663 -0.0242 0.0329  -0.0196 1498 THR A CB  
563  O  OG1 . THR A 45  ? 0.1474 0.1353 0.2567 -0.0338 0.0428  -0.0114 1498 THR A OG1 
564  C  CG2 . THR A 45  ? 0.1970 0.1403 0.2815 -0.0248 0.0601  -0.0420 1498 THR A CG2 
572  N  N   . MET A 46  ? 0.1542 0.1100 0.2508 -0.0126 0.0145  -0.0222 1499 MET A N   
573  C  CA  . MET A 46  ? 0.1354 0.0971 0.2399 -0.0139 0.0268  -0.0194 1499 MET A CA  
574  C  C   . MET A 46  ? 0.1250 0.0929 0.2367 -0.0137 0.0415  -0.0125 1499 MET A C   
575  O  O   . MET A 46  ? 0.1403 0.0917 0.2584 -0.0142 0.0297  -0.0033 1499 MET A O   
576  C  CB  . MET A 46  ? 0.1446 0.1012 0.2443 -0.0139 0.0114  -0.0130 1499 MET A CB  
577  C  CG  . MET A 46  ? 0.1394 0.1098 0.2650 -0.0106 -0.0079 -0.0115 1499 MET A CG  
578  S  SD  . MET A 46  ? 0.1571 0.1176 0.2945 -0.0163 0.0107  -0.0060 1499 MET A SD  
579  C  CE  . MET A 46  ? 0.1658 0.1280 0.2999 -0.0043 0.0154  -0.0113 1499 MET A CE  
589  N  N   . VAL A 47  ? 0.1451 0.0962 0.2398 -0.0100 0.0342  -0.0225 1500 VAL A N   
590  C  CA  . VAL A 47  ? 0.1428 0.1107 0.2350 0.0051  0.0238  0.0025  1500 VAL A CA  
591  C  C   . VAL A 47  ? 0.1454 0.1030 0.2123 0.0012  0.0099  -0.0017 1500 VAL A C   
592  O  O   . VAL A 47  ? 0.1664 0.1135 0.2426 -0.0001 0.0072  0.0012  1500 VAL A O   
593  C  CB  . VAL A 47  ? 0.1391 0.1317 0.2344 -0.0130 0.0151  -0.0036 1500 VAL A CB  
594  C  CG1 . VAL A 47  ? 0.1464 0.1431 0.2282 -0.0231 -0.0155 -0.0314 1500 VAL A CG1 
595  C  CG2 . VAL A 47  ? 0.1534 0.1348 0.2697 -0.0164 0.0013  -0.0030 1500 VAL A CG2 
605  N  N   . CYS A 48  ? 0.1385 0.1018 0.2287 -0.0083 0.0137  -0.0126 1501 CYS A N   
606  C  CA  . CYS A 48  ? 0.1241 0.1052 0.2137 -0.0088 0.0084  0.0084  1501 CYS A CA  
607  C  C   . CYS A 48  ? 0.1178 0.1079 0.2142 -0.0099 0.0045  0.0019  1501 CYS A C   
608  O  O   . CYS A 48  ? 0.1234 0.1108 0.2263 -0.0028 0.0057  0.0043  1501 CYS A O   
609  C  CB  . CYS A 48  ? 0.1211 0.1098 0.2306 -0.0008 0.0186  0.0118  1501 CYS A CB  
610  S  SG  . CYS A 48  ? 0.1376 0.1363 0.2960 -0.0111 0.0263  -0.0010 1501 CYS A SG  
616  N  N   . ALA A 49  ? 0.1189 0.1190 0.2109 -0.0146 0.0132  0.0181  1502 ALA A N   
617  C  CA  . ALA A 49  ? 0.1064 0.1192 0.2159 -0.0208 0.0179  0.0039  1502 ALA A CA  
618  C  C   . ALA A 49  ? 0.1171 0.1240 0.2058 -0.0044 -0.0008 0.0093  1502 ALA A C   
619  O  O   . ALA A 49  ? 0.1480 0.1220 0.1964 -0.0102 -0.0100 0.0172  1502 ALA A O   
620  C  CB  . ALA A 49  ? 0.1437 0.1231 0.2504 -0.0376 0.0278  0.0025  1502 ALA A CB  
626  N  N   . MET A 50  ? 0.1177 0.1183 0.2025 0.0057  0.0084  -0.0083 1503 MET A N   
627  C  CA  . MET A 50  ? 0.1394 0.1192 0.1970 0.0033  0.0071  0.0049  1503 MET A CA  
628  C  C   . MET A 50  ? 0.1568 0.1214 0.2084 -0.0047 0.0036  0.0126  1503 MET A C   
629  O  O   . MET A 50  ? 0.1776 0.1304 0.2201 -0.0203 0.0046  0.0003  1503 MET A O   
630  C  CB  . MET A 50  ? 0.1370 0.1147 0.1961 0.0028  -0.0146 0.0260  1503 MET A CB  
631  C  CG  . MET A 50  ? 0.1648 0.1300 0.2285 -0.0082 0.0005  0.0265  1503 MET A CG  
632  S  SD  . MET A 50  ? 0.1606 0.1371 0.2357 -0.0165 -0.0061 0.0115  1503 MET A SD  
633  C  CE  . MET A 50  ? 0.1473 0.1517 0.2510 -0.0274 0.0083  0.0153  1503 MET A CE  
643  N  N   . PRO A 51  ? 0.1518 0.1220 0.1800 -0.0207 0.0202  0.0206  1504 PRO A N   
644  C  CA  . PRO A 51  ? 0.1623 0.1297 0.2018 -0.0186 0.0021  0.0160  1504 PRO A CA  
645  C  C   . PRO A 51  ? 0.1726 0.1482 0.2082 -0.0234 0.0046  0.0161  1504 PRO A C   
646  O  O   . PRO A 51  ? 0.1626 0.1561 0.2047 -0.0283 0.0013  0.0229  1504 PRO A O   
647  C  CB  . PRO A 51  ? 0.1721 0.1195 0.2031 -0.0227 0.0046  0.0081  1504 PRO A CB  
648  C  CG  . PRO A 51  ? 0.1542 0.1199 0.1939 -0.0166 0.0226  0.0305  1504 PRO A CG  
649  C  CD  . PRO A 51  ? 0.1488 0.1201 0.1878 -0.0229 0.0037  0.0187  1504 PRO A CD  
657  N  N   . ASN A 52  ? 0.1663 0.1546 0.2129 -0.0147 0.0128  0.0171  1505 ASN A N   
658  C  CA  . ASN A 52  ? 0.1610 0.1780 0.2369 -0.0045 0.0073  0.0122  1505 ASN A CA  
659  C  C   . ASN A 52  ? 0.1542 0.1986 0.2464 -0.0158 0.0064  0.0117  1505 ASN A C   
660  O  O   . ASN A 52  ? 0.1700 0.2111 0.2435 -0.0191 0.0117  0.0133  1505 ASN A O   
661  C  CB  . ASN A 52  ? 0.1516 0.1799 0.2489 0.0057  0.0062  0.0097  1505 ASN A CB  
662  C  CG  . ASN A 52  ? 0.1672 0.1993 0.2604 0.0251  0.0203  0.0155  1505 ASN A CG  
663  O  OD1 . ASN A 52  ? 0.1791 0.2052 0.2317 0.0136  0.0392  -0.0024 1505 ASN A OD1 
664  N  ND2 . ASN A 52  ? 0.2069 0.2147 0.2961 0.0341  0.0092  0.0334  1505 ASN A ND2 
671  N  N   . THR A 53  ? 0.1443 0.1939 0.2565 -0.0318 -0.0071 0.0168  1506 THR A N   
672  C  CA  . THR A 53  ? 0.1732 0.2160 0.2488 -0.0329 0.0155  0.0217  1506 THR A CA  
673  C  C   . THR A 53  ? 0.1731 0.2437 0.2628 -0.0404 0.0098  0.0274  1506 THR A C   
674  O  O   . THR A 53  ? 0.1680 0.2395 0.2648 -0.0285 0.0207  0.0268  1506 THR A O   
675  C  CB  . THR A 53  ? 0.1848 0.2059 0.2551 -0.0334 0.0195  0.0269  1506 THR A CB  
676  O  OG1 . THR A 53  ? 0.2002 0.1971 0.2692 -0.0300 0.0184  0.0401  1506 THR A OG1 
677  C  CG2 . THR A 53  ? 0.1898 0.2012 0.2709 -0.0438 0.0476  0.0180  1506 THR A CG2 
685  N  N   . ARG A 54  ? 0.2030 0.2791 0.2796 -0.0490 0.0189  0.0334  1507 ARG A N   
686  C  CA  . ARG A 54  ? 0.2214 0.3093 0.3249 -0.0453 0.0197  0.0244  1507 ARG A CA  
687  C  C   . ARG A 54  ? 0.2508 0.3050 0.2955 -0.0728 0.0276  0.0319  1507 ARG A C   
688  O  O   . ARG A 54  ? 0.2654 0.3086 0.2999 -0.0761 0.0227  0.0213  1507 ARG A O   
689  C  CB  . ARG A 54  ? 0.2595 0.3518 0.4019 -0.0266 0.0204  0.0131  1507 ARG A CB  
690  C  CG  . ARG A 54  ? 0.3450 0.3944 0.5052 -0.0089 -0.0079 0.0127  1507 ARG A CG  
691  C  CD  . ARG A 54  ? 0.4177 0.4309 0.5584 0.0047  -0.0065 0.0027  1507 ARG A CD  
692  N  NE  . ARG A 54  ? 0.4666 0.4582 0.6111 0.0167  -0.0219 -0.0105 1507 ARG A NE  
693  C  CZ  . ARG A 54  ? 0.5020 0.4765 0.6410 0.0217  -0.0472 -0.0257 1507 ARG A CZ  
694  N  NH1 . ARG A 54  ? 0.5135 0.4834 0.6583 0.0295  -0.0470 -0.0243 1507 ARG A NH1 
695  N  NH2 . ARG A 54  ? 0.5111 0.4859 0.6457 0.0164  -0.0676 -0.0267 1507 ARG A NH2 
709  N  N   . PRO A 55  ? 0.2700 0.2935 0.2814 -0.0883 0.0148  0.0210  1508 PRO A N   
710  C  CA  . PRO A 55  ? 0.2634 0.2824 0.2522 -0.0939 -0.0082 0.0278  1508 PRO A CA  
711  C  C   . PRO A 55  ? 0.2445 0.2519 0.2489 -0.0775 0.0248  0.0117  1508 PRO A C   
712  O  O   . PRO A 55  ? 0.2535 0.2389 0.2536 -0.0832 0.0158  0.0120  1508 PRO A O   
713  C  CB  . PRO A 55  ? 0.3141 0.2993 0.2655 -0.0839 -0.0198 0.0297  1508 PRO A CB  
714  C  CG  . PRO A 55  ? 0.3131 0.3067 0.2825 -0.0726 -0.0302 0.0451  1508 PRO A CG  
715  C  CD  . PRO A 55  ? 0.2990 0.2998 0.2835 -0.0890 -0.0090 0.0317  1508 PRO A CD  
723  N  N   . PRO A 56  ? 0.2116 0.2313 0.2494 -0.0447 0.0244  -0.0041 1509 PRO A N   
724  C  CA  . PRO A 56  ? 0.1834 0.2094 0.2492 -0.0429 0.0140  0.0054  1509 PRO A CA  
725  C  C   . PRO A 56  ? 0.2015 0.1876 0.2282 -0.0521 0.0185  0.0169  1509 PRO A C   
726  O  O   . PRO A 56  ? 0.2123 0.1862 0.2347 -0.0597 0.0392  0.0169  1509 PRO A O   
727  C  CB  . PRO A 56  ? 0.1885 0.2203 0.2725 -0.0184 0.0082  0.0115  1509 PRO A CB  
728  C  CG  . PRO A 56  ? 0.2244 0.2333 0.2905 -0.0095 0.0095  -0.0094 1509 PRO A CG  
729  C  CD  . PRO A 56  ? 0.2212 0.2387 0.2783 -0.0179 0.0267  -0.0185 1509 PRO A CD  
737  N  N   . ILE A 57  ? 0.1812 0.1734 0.2264 -0.0406 0.0140  0.0381  1510 ILE A N   
738  C  CA  . ILE A 57  ? 0.1801 0.1650 0.2382 -0.0383 0.0111  0.0418  1510 ILE A CA  
739  C  C   . ILE A 57  ? 0.1877 0.1624 0.2530 -0.0441 0.0350  0.0439  1510 ILE A C   
740  O  O   . ILE A 57  ? 0.2083 0.1591 0.2561 -0.0461 0.0256  0.0397  1510 ILE A O   
741  C  CB  . ILE A 57  ? 0.1796 0.1666 0.2524 -0.0340 0.0148  0.0555  1510 ILE A CB  
742  C  CG1 . ILE A 57  ? 0.1875 0.1759 0.2785 -0.0237 0.0167  0.0574  1510 ILE A CG1 
743  C  CG2 . ILE A 57  ? 0.1850 0.1636 0.2689 -0.0244 0.0072  0.0500  1510 ILE A CG2 
744  C  CD1 . ILE A 57  ? 0.2061 0.1870 0.2982 -0.0406 -0.0053 0.0420  1510 ILE A CD1 
756  N  N   . ILE A 58  ? 0.2115 0.1745 0.2382 -0.0594 0.0193  0.0295  1511 ILE A N   
757  C  CA  . ILE A 58  ? 0.2378 0.1824 0.2249 -0.0672 0.0122  0.0292  1511 ILE A CA  
758  C  C   . ILE A 58  ? 0.2631 0.1816 0.2429 -0.0661 -0.0016 0.0416  1511 ILE A C   
759  O  O   . ILE A 58  ? 0.2916 0.1720 0.2317 -0.0682 0.0045  0.0388  1511 ILE A O   
760  C  CB  . ILE A 58  ? 0.2439 0.2108 0.2652 -0.0632 0.0165  0.0247  1511 ILE A CB  
761  C  CG1 . ILE A 58  ? 0.2445 0.2302 0.2684 -0.0468 0.0227  0.0135  1511 ILE A CG1 
762  C  CG2 . ILE A 58  ? 0.2743 0.2103 0.2728 -0.0639 -0.0022 0.0301  1511 ILE A CG2 
763  C  CD1 . ILE A 58  ? 0.2613 0.2585 0.3227 -0.0414 0.0259  -0.0002 1511 ILE A CD1 
775  N  N   . ASP A 59  ? 0.2821 0.1828 0.2486 -0.0600 -0.0222 0.0473  1512 ASP A N   
776  C  CA  . ASP A 59  ? 0.3193 0.1816 0.2504 -0.0474 -0.0191 0.0573  1512 ASP A CA  
777  C  C   . ASP A 59  ? 0.2951 0.1694 0.2450 -0.0404 -0.0322 0.0680  1512 ASP A C   
778  O  O   . ASP A 59  ? 0.2709 0.1694 0.2770 -0.0684 -0.0272 0.0617  1512 ASP A O   
779  C  CB  . ASP A 59  ? 0.3701 0.2063 0.2906 -0.0426 0.0003  0.0443  1512 ASP A CB  
780  C  CG  . ASP A 59  ? 0.4004 0.2434 0.3334 -0.0372 0.0378  0.0151  1512 ASP A CG  
781  O  OD1 . ASP A 59  ? 0.3762 0.2234 0.3064 -0.0350 0.0112  0.0171  1512 ASP A OD1 
782  O  OD2 . ASP A 59  ? 0.4672 0.2832 0.4316 -0.0461 0.0201  0.0074  1512 ASP A OD2 
787  N  N   . ALA A 60  ? 0.3217 0.1738 0.2535 -0.0310 -0.0361 0.0786  1513 ALA A N   
788  C  CA  . ALA A 60  ? 0.3049 0.1736 0.2665 -0.0299 -0.0456 0.0724  1513 ALA A CA  
789  C  C   . ALA A 60  ? 0.3027 0.1723 0.2765 -0.0315 -0.0383 0.0750  1513 ALA A C   
790  O  O   . ALA A 60  ? 0.2925 0.1679 0.3135 -0.0330 -0.0104 0.0599  1513 ALA A O   
791  C  CB  . ALA A 60  ? 0.3196 0.1865 0.2906 -0.0256 -0.0625 0.0737  1513 ALA A CB  
797  N  N   . PRO A 61  ? 0.3171 0.1787 0.2701 -0.0414 -0.0161 0.0543  1514 PRO A N   
798  C  CA  . PRO A 61  ? 0.3083 0.1731 0.2564 -0.0512 0.0100  0.0555  1514 PRO A CA  
799  C  C   . PRO A 61  ? 0.2875 0.1621 0.2359 -0.0396 0.0143  0.0646  1514 PRO A C   
800  O  O   . PRO A 61  ? 0.2817 0.1780 0.2737 -0.0388 0.0109  0.0421  1514 PRO A O   
801  C  CB  . PRO A 61  ? 0.3419 0.1811 0.2460 -0.0550 0.0170  0.0599  1514 PRO A CB  
802  C  CG  . PRO A 61  ? 0.3509 0.1935 0.2818 -0.0427 0.0260  0.0478  1514 PRO A CG  
803  C  CD  . PRO A 61  ? 0.3445 0.1861 0.2626 -0.0370 0.0158  0.0625  1514 PRO A CD  
811  N  N   . ALA A 62  ? 0.2677 0.1468 0.2381 -0.0298 0.0196  0.0648  1515 ALA A N   
812  C  CA  . ALA A 62  ? 0.2503 0.1460 0.2636 -0.0324 0.0362  0.0662  1515 ALA A CA  
813  C  C   . ALA A 62  ? 0.2288 0.1517 0.2703 -0.0331 0.0167  0.0631  1515 ALA A C   
814  O  O   . ALA A 62  ? 0.2307 0.1578 0.2930 -0.0314 0.0213  0.0760  1515 ALA A O   
815  C  CB  . ALA A 62  ? 0.2605 0.1444 0.2812 -0.0206 0.0212  0.0692  1515 ALA A CB  
821  N  N   . LEU A 63  ? 0.2394 0.1576 0.2717 -0.0565 0.0095  0.0588  1516 LEU A N   
822  C  CA  . LEU A 63  ? 0.2120 0.1684 0.2691 -0.0562 0.0224  0.0706  1516 LEU A CA  
823  C  C   . LEU A 63  ? 0.2219 0.1666 0.2748 -0.0539 0.0200  0.0678  1516 LEU A C   
824  O  O   . LEU A 63  ? 0.2273 0.1600 0.2936 -0.0548 0.0205  0.0569  1516 LEU A O   
825  C  CB  . LEU A 63  ? 0.2210 0.1870 0.2964 -0.0574 0.0165  0.0649  1516 LEU A CB  
826  C  CG  . LEU A 63  ? 0.2211 0.2056 0.2973 -0.0705 0.0154  0.0487  1516 LEU A CG  
827  C  CD1 . LEU A 63  ? 0.2400 0.2118 0.3055 -0.0635 0.0038  0.0415  1516 LEU A CD1 
828  C  CD2 . LEU A 63  ? 0.2359 0.2235 0.3294 -0.0687 -0.0042 0.0328  1516 LEU A CD2 
840  N  N   . ALA A 64  ? 0.2270 0.1635 0.2585 -0.0388 0.0199  0.0669  1517 ALA A N   
841  C  CA  . ALA A 64  ? 0.2201 0.1545 0.2593 -0.0308 0.0031  0.0579  1517 ALA A CA  
842  C  C   . ALA A 64  ? 0.1936 0.1458 0.2652 -0.0341 0.0302  0.0544  1517 ALA A C   
843  O  O   . ALA A 64  ? 0.2056 0.1600 0.2898 -0.0399 0.0373  0.0183  1517 ALA A O   
844  C  CB  . ALA A 64  ? 0.2367 0.1554 0.2734 -0.0298 0.0203  0.0417  1517 ALA A CB  
850  N  N   . LEU A 65  ? 0.2157 0.1411 0.2590 -0.0308 0.0195  0.0651  1518 LEU A N   
851  C  CA  . LEU A 65  ? 0.1915 0.1486 0.2592 -0.0308 0.0127  0.0502  1518 LEU A CA  
852  C  C   . LEU A 65  ? 0.1855 0.1345 0.2548 -0.0379 0.0155  0.0428  1518 LEU A C   
853  O  O   . LEU A 65  ? 0.2005 0.1383 0.2758 -0.0231 0.0387  0.0342  1518 LEU A O   
854  C  CB  . LEU A 65  ? 0.1800 0.1774 0.2749 -0.0141 0.0327  0.0449  1518 LEU A CB  
855  C  CG  . LEU A 65  ? 0.2047 0.2003 0.3084 -0.0106 0.0309  0.0295  1518 LEU A CG  
856  C  CD1 . LEU A 65  ? 0.2267 0.2073 0.3059 -0.0327 0.0435  0.0494  1518 LEU A CD1 
857  C  CD2 . LEU A 65  ? 0.2210 0.2225 0.3595 -0.0048 0.0124  0.0044  1518 LEU A CD2 
869  N  N   . ALA A 66  ? 0.2148 0.1322 0.2585 -0.0353 0.0443  0.0493  1519 ALA A N   
870  C  CA  . ALA A 66  ? 0.2453 0.1359 0.2503 -0.0353 0.0332  0.0470  1519 ALA A CA  
871  C  C   . ALA A 66  ? 0.2347 0.1508 0.2569 -0.0464 0.0295  0.0604  1519 ALA A C   
872  O  O   . ALA A 66  ? 0.2505 0.1437 0.2799 -0.0390 0.0231  0.0600  1519 ALA A O   
873  C  CB  . ALA A 66  ? 0.2844 0.1347 0.2598 -0.0263 0.0427  0.0428  1519 ALA A CB  
879  N  N   . GLN A 67  ? 0.2350 0.1731 0.2750 -0.0463 0.0213  0.0553  1520 GLN A N   
880  C  CA  A GLN A 67  ? 0.2288 0.1955 0.2945 -0.0468 0.0388  0.0572  1520 GLN A CA  
881  C  CA  B GLN A 67  ? 0.2249 0.1858 0.2924 -0.0467 0.0401  0.0636  1520 GLN A CA  
882  C  C   . GLN A 67  ? 0.2097 0.1812 0.2892 -0.0434 0.0439  0.0641  1520 GLN A C   
883  O  O   . GLN A 67  ? 0.1966 0.1805 0.2951 -0.0434 0.0395  0.0624  1520 GLN A O   
884  C  CB  A GLN A 67  ? 0.2469 0.2282 0.3187 -0.0480 0.0363  0.0440  1520 GLN A CB  
885  C  CB  B GLN A 67  ? 0.2357 0.2018 0.3098 -0.0493 0.0428  0.0655  1520 GLN A CB  
886  C  CG  A GLN A 67  ? 0.2570 0.2538 0.3385 -0.0436 0.0236  0.0303  1520 GLN A CG  
887  C  CG  B GLN A 67  ? 0.2438 0.2155 0.3337 -0.0442 0.0408  0.0578  1520 GLN A CG  
888  C  CD  A GLN A 67  ? 0.2530 0.2756 0.3541 -0.0369 0.0219  0.0290  1520 GLN A CD  
889  C  CD  B GLN A 67  ? 0.2473 0.2185 0.3482 -0.0459 0.0610  0.0665  1520 GLN A CD  
890  O  OE1 A GLN A 67  ? 0.2588 0.2955 0.3791 -0.0228 0.0014  0.0048  1520 GLN A OE1 
891  O  OE1 B GLN A 67  ? 0.2508 0.2096 0.3047 -0.0475 0.1020  0.0839  1520 GLN A OE1 
892  N  NE2 A GLN A 67  ? 0.2777 0.2855 0.3862 -0.0356 0.0209  0.0276  1520 GLN A NE2 
893  N  NE2 B GLN A 67  ? 0.2464 0.2262 0.3724 -0.0394 0.0494  0.0667  1520 GLN A NE2 
910  N  N   . LYS A 68  ? 0.1779 0.1658 0.2768 -0.0353 0.0458  0.0750  1521 LYS A N   
911  C  CA  . LYS A 68  ? 0.2048 0.1692 0.2888 -0.0367 0.0499  0.0785  1521 LYS A CA  
912  C  C   . LYS A 68  ? 0.2009 0.1518 0.2847 -0.0348 0.0401  0.0600  1521 LYS A C   
913  O  O   . LYS A 68  ? 0.2045 0.1433 0.3206 -0.0474 0.0538  0.0503  1521 LYS A O   
914  C  CB  . LYS A 68  ? 0.2338 0.1939 0.2959 -0.0274 0.0550  0.0879  1521 LYS A CB  
915  C  CG  . LYS A 68  ? 0.2801 0.2159 0.3163 -0.0214 0.0801  0.0931  1521 LYS A CG  
916  C  CD  . LYS A 68  ? 0.3146 0.2333 0.3393 -0.0180 0.0985  0.0778  1521 LYS A CD  
917  C  CE  . LYS A 68  ? 0.3207 0.2333 0.3478 -0.0198 0.1521  0.0483  1521 LYS A CE  
918  N  NZ  . LYS A 68  ? 0.3331 0.2408 0.4123 -0.0106 0.1367  0.0294  1521 LYS A NZ  
932  N  N   . LEU A 69  ? 0.1912 0.1509 0.2857 -0.0295 0.0331  0.0491  1522 LEU A N   
933  C  CA  . LEU A 69  ? 0.1820 0.1491 0.2903 -0.0212 0.0484  0.0332  1522 LEU A CA  
934  C  C   . LEU A 69  ? 0.1788 0.1282 0.2792 -0.0327 0.0427  0.0159  1522 LEU A C   
935  O  O   . LEU A 69  ? 0.1918 0.1276 0.3164 -0.0341 0.0400  0.0040  1522 LEU A O   
936  C  CB  . LEU A 69  ? 0.1908 0.1692 0.2917 -0.0136 0.0545  0.0319  1522 LEU A CB  
937  C  CG  . LEU A 69  ? 0.2003 0.1921 0.3128 -0.0119 0.0442  0.0477  1522 LEU A CG  
938  C  CD1 . LEU A 69  ? 0.2151 0.2033 0.3229 0.0047  0.0359  0.0483  1522 LEU A CD1 
939  C  CD2 . LEU A 69  ? 0.1844 0.2075 0.3120 -0.0153 0.0715  0.0528  1522 LEU A CD2 
951  N  N   . ALA A 70  ? 0.1869 0.1281 0.2825 -0.0333 0.0314  0.0156  1523 ALA A N   
952  C  CA  . ALA A 70  ? 0.1819 0.1182 0.2909 -0.0401 0.0348  0.0192  1523 ALA A CA  
953  C  C   . ALA A 70  ? 0.1891 0.1247 0.3061 -0.0427 0.0451  0.0119  1523 ALA A C   
954  O  O   . ALA A 70  ? 0.2156 0.1372 0.3097 -0.0402 0.0317  0.0103  1523 ALA A O   
955  C  CB  . ALA A 70  ? 0.1642 0.1176 0.3066 -0.0404 0.0371  0.0192  1523 ALA A CB  
961  N  N   . GLU A 71  ? 0.1801 0.1206 0.3294 -0.0240 0.0585  0.0262  1524 GLU A N   
962  C  CA  . GLU A 71  ? 0.1835 0.1364 0.3633 -0.0247 0.0377  0.0125  1524 GLU A CA  
963  C  C   . GLU A 71  ? 0.2133 0.1337 0.3745 -0.0357 0.0468  0.0104  1524 GLU A C   
964  O  O   . GLU A 71  ? 0.2230 0.1459 0.3935 -0.0417 0.0518  -0.0157 1524 GLU A O   
965  C  CB  . GLU A 71  ? 0.1940 0.1596 0.3590 -0.0438 0.0480  0.0427  1524 GLU A CB  
966  C  CG  . GLU A 71  ? 0.1963 0.1877 0.3879 -0.0551 0.0385  0.0524  1524 GLU A CG  
967  C  CD  . GLU A 71  ? 0.2335 0.2258 0.4124 -0.0510 0.0391  0.0870  1524 GLU A CD  
968  O  OE1 . GLU A 71  ? 0.2640 0.2796 0.4465 -0.0468 0.0379  0.1163  1524 GLU A OE1 
969  O  OE2 . GLU A 71  ? 0.2308 0.2258 0.3985 -0.0351 0.0328  0.0664  1524 GLU A OE2 
976  N  N   . ALA A 72  ? 0.1915 0.1265 0.3639 -0.0350 0.0439  0.0142  1525 ALA A N   
977  C  CA  . ALA A 72  ? 0.2234 0.1404 0.3803 -0.0435 0.0413  0.0089  1525 ALA A CA  
978  C  C   . ALA A 72  ? 0.2174 0.1370 0.3593 -0.0483 0.0582  -0.0184 1525 ALA A C   
979  O  O   . ALA A 72  ? 0.2296 0.1418 0.3768 -0.0452 0.0486  -0.0311 1525 ALA A O   
980  C  CB  . ALA A 72  ? 0.2279 0.1474 0.4143 -0.0519 0.0325  0.0257  1525 ALA A CB  
986  N  N   . GLY A 73  ? 0.1956 0.1288 0.3417 -0.0510 0.0540  -0.0076 1526 GLY A N   
987  C  CA  . GLY A 73  ? 0.1803 0.1271 0.3465 -0.0414 0.0472  -0.0062 1526 GLY A CA  
988  C  C   . GLY A 73  ? 0.1663 0.1293 0.3238 -0.0439 0.0248  -0.0153 1526 GLY A C   
989  O  O   . GLY A 73  ? 0.1813 0.1409 0.3523 -0.0458 0.0038  -0.0100 1526 GLY A O   
993  N  N   . ALA A 74  ? 0.1627 0.1322 0.3302 -0.0560 0.0477  -0.0012 1527 ALA A N   
994  C  CA  . ALA A 74  ? 0.1750 0.1292 0.3034 -0.0472 0.0495  -0.0065 1527 ALA A CA  
995  C  C   . ALA A 74  ? 0.1834 0.1174 0.3101 -0.0326 0.0340  -0.0117 1527 ALA A C   
996  O  O   . ALA A 74  ? 0.2025 0.1105 0.3513 -0.0372 0.0393  0.0094  1527 ALA A O   
997  C  CB  . ALA A 74  ? 0.1831 0.1350 0.3322 -0.0505 0.0233  -0.0055 1527 ALA A CB  
1003 N  N   . ARG A 75  ? 0.1826 0.1192 0.3157 -0.0443 0.0471  -0.0172 1528 ARG A N   
1004 C  CA  . ARG A 75  ? 0.1664 0.1210 0.3175 -0.0404 0.0397  -0.0308 1528 ARG A CA  
1005 C  C   . ARG A 75  ? 0.1901 0.1199 0.3250 -0.0400 0.0556  -0.0322 1528 ARG A C   
1006 O  O   . ARG A 75  ? 0.2193 0.1332 0.3458 -0.0472 0.0550  -0.0400 1528 ARG A O   
1007 C  CB  . ARG A 75  ? 0.1754 0.1296 0.3309 -0.0416 0.0064  -0.0354 1528 ARG A CB  
1008 C  CG  . ARG A 75  ? 0.1765 0.1343 0.3803 -0.0460 0.0247  -0.0440 1528 ARG A CG  
1009 C  CD  . ARG A 75  ? 0.1920 0.1597 0.4017 -0.0673 0.0304  -0.0488 1528 ARG A CD  
1010 N  NE  . ARG A 75  ? 0.2046 0.1774 0.4150 -0.0772 0.0197  -0.0536 1528 ARG A NE  
1011 C  CZ  . ARG A 75  ? 0.2018 0.2052 0.4291 -0.0656 0.0272  -0.0542 1528 ARG A CZ  
1012 N  NH1 . ARG A 75  ? 0.2132 0.2209 0.4372 -0.0487 0.0385  -0.0601 1528 ARG A NH1 
1013 N  NH2 . ARG A 75  ? 0.2014 0.2262 0.4501 -0.0402 0.0298  -0.0556 1528 ARG A NH2 
1027 N  N   . CYS A 76  ? 0.1647 0.1172 0.3096 -0.0527 0.0407  -0.0357 1529 CYS A N   
1028 C  CA  . CYS A 76  ? 0.1703 0.1111 0.2994 -0.0519 0.0421  -0.0216 1529 CYS A CA  
1029 C  C   . CYS A 76  ? 0.1661 0.1063 0.2854 -0.0310 0.0447  -0.0221 1529 CYS A C   
1030 O  O   . CYS A 76  ? 0.1720 0.1050 0.3153 -0.0412 0.0578  -0.0219 1529 CYS A O   
1031 C  CB  . CYS A 76  ? 0.1833 0.1102 0.3232 -0.0420 0.0389  -0.0134 1529 CYS A CB  
1032 S  SG  . CYS A 76  ? 0.1845 0.1177 0.3248 -0.0299 0.0213  -0.0139 1529 CYS A SG  
1038 N  N   . ASP A 77  ? 0.1640 0.1063 0.2904 -0.0137 0.0408  -0.0268 1530 ASP A N   
1039 C  CA  . ASP A 77  ? 0.1637 0.1013 0.2863 -0.0137 0.0397  -0.0267 1530 ASP A CA  
1040 C  C   . ASP A 77  ? 0.1560 0.1039 0.2681 -0.0217 0.0395  -0.0098 1530 ASP A C   
1041 O  O   . ASP A 77  ? 0.1611 0.1025 0.2474 -0.0122 0.0183  -0.0103 1530 ASP A O   
1042 C  CB  . ASP A 77  ? 0.1626 0.0919 0.2965 -0.0101 0.0393  -0.0234 1530 ASP A CB  
1043 C  CG  . ASP A 77  ? 0.1703 0.0912 0.3027 -0.0166 0.0597  0.0033  1530 ASP A CG  
1044 O  OD1 . ASP A 77  ? 0.1929 0.0935 0.3220 -0.0209 0.0596  0.0134  1530 ASP A OD1 
1045 O  OD2 . ASP A 77  ? 0.1857 0.0873 0.3011 -0.0100 0.0546  -0.0076 1530 ASP A OD2 
1050 N  N   . PHE A 78  ? 0.1557 0.1028 0.2752 -0.0277 0.0378  -0.0116 1531 PHE A N   
1051 C  CA  . PHE A 78  ? 0.1481 0.1013 0.2386 -0.0193 0.0447  0.0006  1531 PHE A CA  
1052 C  C   . PHE A 78  ? 0.1658 0.0977 0.2561 -0.0048 0.0303  0.0055  1531 PHE A C   
1053 O  O   . PHE A 78  ? 0.1555 0.0969 0.2771 -0.0084 0.0323  0.0060  1531 PHE A O   
1054 C  CB  . PHE A 78  ? 0.1578 0.1125 0.2471 -0.0233 0.0453  -0.0036 1531 PHE A CB  
1055 C  CG  . PHE A 78  ? 0.1589 0.1059 0.2676 -0.0291 0.0360  0.0106  1531 PHE A CG  
1056 C  CD1 . PHE A 78  ? 0.1829 0.1184 0.2951 -0.0375 0.0330  0.0298  1531 PHE A CD1 
1057 C  CD2 . PHE A 78  ? 0.1729 0.1075 0.2838 -0.0402 0.0483  0.0144  1531 PHE A CD2 
1058 C  CE1 . PHE A 78  ? 0.1939 0.1235 0.3072 -0.0340 0.0427  0.0239  1531 PHE A CE1 
1059 C  CE2 . PHE A 78  ? 0.1738 0.1240 0.2914 -0.0374 0.0718  0.0355  1531 PHE A CE2 
1060 C  CZ  . PHE A 78  ? 0.1776 0.1229 0.2793 -0.0388 0.0700  0.0379  1531 PHE A CZ  
1070 N  N   . ALA A 79  ? 0.1700 0.0920 0.2475 -0.0057 0.0242  0.0074  1532 ALA A N   
1071 C  CA  . ALA A 79  ? 0.1676 0.0999 0.2375 -0.0055 0.0236  0.0107  1532 ALA A CA  
1072 C  C   . ALA A 79  ? 0.1559 0.1009 0.2282 0.0018  0.0348  0.0173  1532 ALA A C   
1073 O  O   . ALA A 79  ? 0.1668 0.1143 0.2307 0.0157  0.0107  0.0150  1532 ALA A O   
1074 C  CB  . ALA A 79  ? 0.1608 0.1188 0.2628 -0.0021 0.0098  0.0128  1532 ALA A CB  
1080 N  N   . LEU A 80  ? 0.1626 0.1058 0.2257 -0.0122 0.0334  0.0191  1533 LEU A N   
1081 C  CA  . LEU A 80  ? 0.1698 0.1122 0.2199 -0.0298 0.0266  0.0241  1533 LEU A CA  
1082 C  C   . LEU A 80  ? 0.1497 0.1059 0.1970 -0.0113 -0.0031 0.0105  1533 LEU A C   
1083 O  O   . LEU A 80  ? 0.1762 0.1076 0.2201 0.0010  -0.0218 0.0188  1533 LEU A O   
1084 C  CB  . LEU A 80  ? 0.2141 0.1279 0.2233 -0.0494 0.0125  0.0389  1533 LEU A CB  
1085 C  CG  . LEU A 80  ? 0.2627 0.1427 0.2368 -0.0613 0.0195  0.0477  1533 LEU A CG  
1086 C  CD1 . LEU A 80  ? 0.3162 0.1623 0.2920 -0.0760 0.0283  0.0646  1533 LEU A CD1 
1087 C  CD2 . LEU A 80  ? 0.2397 0.1509 0.2690 -0.0567 0.0177  0.0297  1533 LEU A CD2 
1099 N  N   . PHE A 81  ? 0.1608 0.1092 0.1919 -0.0063 0.0161  0.0027  1534 PHE A N   
1100 C  CA  . PHE A 81  ? 0.1549 0.1092 0.1898 0.0058  0.0104  0.0113  1534 PHE A CA  
1101 C  C   . PHE A 81  ? 0.1551 0.1288 0.2097 -0.0183 0.0000  0.0188  1534 PHE A C   
1102 O  O   . PHE A 81  ? 0.1680 0.1475 0.2126 -0.0360 -0.0062 0.0127  1534 PHE A O   
1103 C  CB  . PHE A 81  ? 0.1659 0.1049 0.1809 0.0152  -0.0070 0.0125  1534 PHE A CB  
1104 C  CG  . PHE A 81  ? 0.1572 0.1060 0.1731 0.0027  0.0038  0.0176  1534 PHE A CG  
1105 C  CD1 . PHE A 81  ? 0.1838 0.1214 0.2151 -0.0013 0.0198  0.0311  1534 PHE A CD1 
1106 C  CD2 . PHE A 81  ? 0.1693 0.1075 0.2084 0.0001  0.0242  0.0189  1534 PHE A CD2 
1107 C  CE1 . PHE A 81  ? 0.1839 0.1293 0.2202 -0.0030 0.0148  0.0326  1534 PHE A CE1 
1108 C  CE2 . PHE A 81  ? 0.2149 0.1155 0.2037 -0.0023 0.0232  0.0192  1534 PHE A CE2 
1109 C  CZ  . PHE A 81  ? 0.2065 0.1289 0.2184 0.0005  0.0480  0.0330  1534 PHE A CZ  
1119 N  N   . LEU A 82  ? 0.1385 0.1300 0.2096 -0.0035 -0.0081 0.0192  1535 LEU A N   
1120 C  CA  . LEU A 82  ? 0.1633 0.1193 0.1971 -0.0165 0.0011  0.0364  1535 LEU A CA  
1121 C  C   . LEU A 82  ? 0.1564 0.1201 0.1899 -0.0124 0.0107  0.0390  1535 LEU A C   
1122 O  O   . LEU A 82  ? 0.1769 0.1237 0.2105 -0.0178 0.0135  0.0372  1535 LEU A O   
1123 C  CB  . LEU A 82  ? 0.1659 0.1120 0.2005 -0.0285 0.0103  0.0543  1535 LEU A CB  
1124 C  CG  . LEU A 82  ? 0.1897 0.1237 0.2195 -0.0234 -0.0123 0.0641  1535 LEU A CG  
1125 C  CD1 . LEU A 82  ? 0.2127 0.1320 0.2316 -0.0155 -0.0408 0.0465  1535 LEU A CD1 
1126 C  CD2 . LEU A 82  ? 0.2173 0.1407 0.2291 -0.0407 -0.0224 0.0556  1535 LEU A CD2 
1138 N  N   . GLY A 83  ? 0.1638 0.1212 0.1821 -0.0033 0.0223  0.0269  1536 GLY A N   
1139 C  CA  . GLY A 83  ? 0.1833 0.1227 0.2068 -0.0021 -0.0013 0.0109  1536 GLY A CA  
1140 C  C   . GLY A 83  ? 0.1908 0.1297 0.1832 -0.0109 0.0099  0.0361  1536 GLY A C   
1141 O  O   . GLY A 83  ? 0.2254 0.1331 0.1973 -0.0213 -0.0016 0.0218  1536 GLY A O   
1145 N  N   . ALA A 84  ? 0.1690 0.1292 0.1800 -0.0061 0.0047  0.0272  1537 ALA A N   
1146 C  CA  . ALA A 84  ? 0.1782 0.1325 0.1858 -0.0094 0.0150  0.0321  1537 ALA A CA  
1147 C  C   . ALA A 84  ? 0.2002 0.1513 0.1878 -0.0118 0.0192  0.0270  1537 ALA A C   
1148 O  O   . ALA A 84  ? 0.2081 0.1757 0.1864 0.0082  0.0187  0.0120  1537 ALA A O   
1149 C  CB  . ALA A 84  ? 0.1840 0.1337 0.1889 -0.0108 0.0243  0.0467  1537 ALA A CB  
1155 N  N   . SER A 85  ? 0.1960 0.1536 0.1845 -0.0238 0.0404  0.0187  1538 SER A N   
1156 C  CA  . SER A 85  ? 0.1931 0.1714 0.1825 -0.0219 0.0336  0.0177  1538 SER A CA  
1157 C  C   . SER A 85  ? 0.1906 0.1751 0.1959 -0.0238 0.0339  0.0121  1538 SER A C   
1158 O  O   . SER A 85  ? 0.2109 0.1793 0.2009 -0.0299 0.0222  0.0113  1538 SER A O   
1159 C  CB  . SER A 85  ? 0.2287 0.1813 0.2075 -0.0220 0.0273  0.0293  1538 SER A CB  
1160 O  OG  . SER A 85  ? 0.2509 0.1906 0.2145 -0.0310 0.0486  0.0269  1538 SER A OG  
1166 N  N   . SER A 86  ? 0.2304 0.1955 0.2050 -0.0085 0.0274  -0.0059 1539 SER A N   
1167 C  CA  . SER A 86  ? 0.2649 0.2311 0.2194 0.0066  0.0339  -0.0162 1539 SER A CA  
1168 C  C   . SER A 86  ? 0.3022 0.2549 0.2381 -0.0001 0.0313  -0.0199 1539 SER A C   
1169 O  O   . SER A 86  ? 0.3266 0.2656 0.2628 0.0071  0.0220  -0.0387 1539 SER A O   
1170 C  CB  . SER A 86  ? 0.2809 0.2480 0.2824 0.0098  0.0690  -0.0331 1539 SER A CB  
1171 O  OG  . SER A 86  ? 0.2906 0.2685 0.3295 0.0025  0.0886  -0.0238 1539 SER A OG  
1177 N  N   . GLU A 87  ? 0.3027 0.2637 0.2381 -0.0091 0.0305  -0.0029 1540 GLU A N   
1178 C  CA  A GLU A 87  ? 0.3303 0.2735 0.2562 -0.0098 0.0420  0.0109  1540 GLU A CA  
1179 C  CA  B GLU A 87  ? 0.3315 0.2754 0.2495 -0.0103 0.0404  0.0096  1540 GLU A CA  
1180 C  C   . GLU A 87  ? 0.3205 0.2643 0.2280 -0.0062 0.0317  0.0175  1540 GLU A C   
1181 O  O   . GLU A 87  ? 0.3452 0.2861 0.2424 0.0193  0.0160  0.0043  1540 GLU A O   
1182 C  CB  A GLU A 87  ? 0.3665 0.2945 0.3156 -0.0116 0.0493  0.0243  1540 GLU A CB  
1183 C  CB  B GLU A 87  ? 0.3702 0.3002 0.2948 -0.0131 0.0443  0.0203  1540 GLU A CB  
1184 C  CG  A GLU A 87  ? 0.3960 0.3097 0.3804 -0.0117 0.0491  0.0236  1540 GLU A CG  
1185 C  CG  B GLU A 87  ? 0.4022 0.3197 0.3416 -0.0136 0.0393  0.0173  1540 GLU A CG  
1186 C  CD  A GLU A 87  ? 0.4196 0.3197 0.4407 -0.0080 0.0533  0.0205  1540 GLU A CD  
1187 C  CD  B GLU A 87  ? 0.4313 0.3328 0.3789 -0.0121 0.0326  0.0073  1540 GLU A CD  
1188 O  OE1 A GLU A 87  ? 0.4265 0.3238 0.4576 -0.0087 0.0484  0.0262  1540 GLU A OE1 
1189 O  OE1 B GLU A 87  ? 0.4401 0.3390 0.3964 -0.0141 0.0291  0.0022  1540 GLU A OE1 
1190 O  OE2 A GLU A 87  ? 0.4401 0.3271 0.4764 -0.0050 0.0401  0.0147  1540 GLU A OE2 
1191 O  OE2 B GLU A 87  ? 0.4503 0.3406 0.3965 -0.0157 0.0311  0.0026  1540 GLU A OE2 
1204 N  N   . ASN A 88  ? 0.2733 0.2224 0.1858 -0.0394 0.0419  0.0254  1541 ASN A N   
1205 C  CA  . ASN A 88  ? 0.2517 0.1993 0.1724 -0.0323 0.0113  0.0210  1541 ASN A CA  
1206 C  C   . ASN A 88  ? 0.2478 0.1805 0.1772 -0.0331 -0.0027 0.0236  1541 ASN A C   
1207 O  O   . ASN A 88  ? 0.2762 0.1725 0.2090 -0.0308 -0.0160 0.0333  1541 ASN A O   
1208 C  CB  . ASN A 88  ? 0.2291 0.1925 0.1512 -0.0410 0.0000  0.0229  1541 ASN A CB  
1209 C  CG  . ASN A 88  ? 0.2235 0.1751 0.1608 -0.0378 0.0015  0.0272  1541 ASN A CG  
1210 O  OD1 . ASN A 88  ? 0.2278 0.1580 0.1818 -0.0304 -0.0046 0.0361  1541 ASN A OD1 
1211 N  ND2 . ASN A 88  ? 0.2263 0.1735 0.1957 -0.0340 0.0030  0.0272  1541 ASN A ND2 
1218 N  N   . ALA A 89  ? 0.2424 0.1737 0.1833 -0.0265 -0.0184 0.0256  1542 ALA A N   
1219 C  CA  . ALA A 89  ? 0.2516 0.1783 0.2005 -0.0283 -0.0244 0.0313  1542 ALA A CA  
1220 C  C   . ALA A 89  ? 0.2856 0.1987 0.2075 -0.0268 -0.0138 0.0415  1542 ALA A C   
1221 O  O   . ALA A 89  ? 0.3190 0.2203 0.1981 -0.0210 -0.0411 0.0408  1542 ALA A O   
1222 C  CB  . ALA A 89  ? 0.2431 0.1771 0.2237 -0.0395 -0.0230 0.0214  1542 ALA A CB  
1228 N  N   . GLY A 90  ? 0.2821 0.1960 0.2233 -0.0164 -0.0217 0.0414  1543 GLY A N   
1229 C  CA  . GLY A 90  ? 0.3183 0.2085 0.2302 -0.0203 -0.0285 0.0568  1543 GLY A CA  
1230 C  C   . GLY A 90  ? 0.3267 0.2185 0.2402 -0.0122 -0.0361 0.0791  1543 GLY A C   
1231 O  O   . GLY A 90  ? 0.3463 0.2362 0.3257 -0.0233 -0.0569 0.1039  1543 GLY A O   
1235 N  N   . THR A 91  ? 0.3073 0.2054 0.1937 -0.0169 -0.0061 0.0617  1544 THR A N   
1236 C  CA  . THR A 91  ? 0.3027 0.2066 0.1840 -0.0175 -0.0126 0.0628  1544 THR A CA  
1237 C  C   . THR A 91  ? 0.3088 0.1987 0.2089 -0.0080 -0.0084 0.0576  1544 THR A C   
1238 O  O   . THR A 91  ? 0.3578 0.1889 0.2543 -0.0085 0.0012  0.0572  1544 THR A O   
1239 C  CB  . THR A 91  ? 0.3282 0.2181 0.2272 -0.0230 0.0097  0.0643  1544 THR A CB  
1240 O  OG1 . THR A 91  ? 0.3291 0.2094 0.2302 -0.0269 0.0013  0.0728  1544 THR A OG1 
1241 C  CG2 . THR A 91  ? 0.3429 0.2313 0.2516 -0.0156 0.0129  0.0615  1544 THR A CG2 
1249 N  N   . LEU A 92  ? 0.2816 0.2037 0.2090 -0.0089 0.0122  0.0446  1545 LEU A N   
1250 C  CA  . LEU A 92  ? 0.2679 0.2117 0.2158 -0.0074 0.0121  0.0403  1545 LEU A CA  
1251 C  C   . LEU A 92  ? 0.2686 0.2230 0.2449 0.0010  -0.0127 0.0413  1545 LEU A C   
1252 O  O   . LEU A 92  ? 0.2699 0.2203 0.2486 0.0139  0.0037  0.0435  1545 LEU A O   
1253 C  CB  . LEU A 92  ? 0.2616 0.2168 0.2253 -0.0184 0.0095  0.0346  1545 LEU A CB  
1254 C  CG  . LEU A 92  ? 0.2561 0.2104 0.2425 0.0008  0.0048  0.0376  1545 LEU A CG  
1255 C  CD1 . LEU A 92  ? 0.2702 0.2186 0.2562 0.0098  0.0267  0.0348  1545 LEU A CD1 
1256 C  CD2 . LEU A 92  ? 0.2681 0.2264 0.2749 -0.0097 0.0105  0.0516  1545 LEU A CD2 
1268 N  N   . GLY A 93  ? 0.2783 0.2419 0.2888 0.0157  -0.0190 0.0349  1546 GLY A N   
1269 C  CA  . GLY A 93  ? 0.2901 0.2575 0.3250 0.0206  -0.0315 0.0194  1546 GLY A CA  
1270 C  C   . GLY A 93  ? 0.3054 0.2687 0.3241 0.0439  -0.0428 0.0287  1546 GLY A C   
1271 O  O   . GLY A 93  ? 0.3149 0.2815 0.3366 0.0462  -0.0322 0.0418  1546 GLY A O   
1275 N  N   . THR A 94  ? 0.3321 0.2581 0.3224 0.0594  -0.0448 0.0288  1547 THR A N   
1276 C  CA  . THR A 94  ? 0.3618 0.2602 0.3491 0.0564  -0.0456 0.0353  1547 THR A CA  
1277 C  C   . THR A 94  ? 0.3352 0.2325 0.3375 0.0592  -0.0316 0.0314  1547 THR A C   
1278 O  O   . THR A 94  ? 0.3755 0.2468 0.3772 0.0778  -0.0545 0.0152  1547 THR A O   
1279 C  CB  . THR A 94  ? 0.4343 0.3015 0.4079 0.0501  -0.0477 0.0383  1547 THR A CB  
1280 O  OG1 . THR A 94  ? 0.4875 0.3295 0.4597 0.0461  -0.0277 0.0596  1547 THR A OG1 
1281 C  CG2 . THR A 94  ? 0.4531 0.3059 0.4073 0.0420  -0.0569 0.0302  1547 THR A CG2 
1289 N  N   . VAL A 95  ? 0.2762 0.2044 0.2898 0.0231  -0.0002 0.0604  1548 VAL A N   
1290 C  CA  . VAL A 95  ? 0.2434 0.1912 0.2915 0.0072  0.0133  0.0685  1548 VAL A CA  
1291 C  C   . VAL A 95  ? 0.1972 0.1676 0.2900 -0.0049 -0.0078 0.0582  1548 VAL A C   
1292 O  O   . VAL A 95  ? 0.2016 0.1669 0.3141 -0.0077 -0.0036 0.0551  1548 VAL A O   
1293 C  CB  . VAL A 95  ? 0.2704 0.1964 0.3134 -0.0119 0.0258  0.0834  1548 VAL A CB  
1294 C  CG1 . VAL A 95  ? 0.2851 0.2099 0.3570 -0.0224 0.0204  0.0805  1548 VAL A CG1 
1295 C  CG2 . VAL A 95  ? 0.2587 0.2078 0.3234 -0.0010 0.0328  0.0843  1548 VAL A CG2 
1305 N  N   . ALA A 96  ? 0.1893 0.1572 0.2656 -0.0123 -0.0110 0.0512  1549 ALA A N   
1306 C  CA  . ALA A 96  ? 0.1830 0.1598 0.2455 -0.0088 0.0086  0.0444  1549 ALA A CA  
1307 C  C   . ALA A 96  ? 0.1914 0.1482 0.2223 -0.0044 -0.0097 0.0458  1549 ALA A C   
1308 O  O   . ALA A 96  ? 0.2084 0.1372 0.2453 -0.0036 -0.0149 0.0381  1549 ALA A O   
1309 C  CB  . ALA A 96  ? 0.1917 0.1615 0.2187 -0.0140 0.0105  0.0355  1549 ALA A CB  
1315 N  N   . GLY A 97  ? 0.1849 0.1580 0.2514 -0.0028 -0.0096 0.0464  1550 GLY A N   
1316 C  CA  . GLY A 97  ? 0.1736 0.1625 0.2573 0.0001  -0.0085 0.0466  1550 GLY A CA  
1317 C  C   . GLY A 97  ? 0.1954 0.1640 0.2528 0.0064  0.0033  0.0434  1550 GLY A C   
1318 O  O   . GLY A 97  ? 0.2206 0.1807 0.2823 -0.0065 0.0213  0.0227  1550 GLY A O   
1322 N  N   . SER A 98  ? 0.1686 0.1464 0.2501 0.0162  -0.0001 0.0455  1551 SER A N   
1323 C  CA  A SER A 98  ? 0.2011 0.1452 0.2717 0.0222  0.0062  0.0374  1551 SER A CA  
1324 C  CA  B SER A 98  ? 0.1895 0.1455 0.2499 0.0204  0.0018  0.0405  1551 SER A CA  
1325 C  C   . SER A 98  ? 0.1839 0.1371 0.2474 0.0157  -0.0121 0.0284  1551 SER A C   
1326 O  O   . SER A 98  ? 0.1924 0.1374 0.2708 0.0120  -0.0176 0.0168  1551 SER A O   
1327 C  CB  A SER A 98  ? 0.2294 0.1468 0.3066 0.0149  0.0088  0.0432  1551 SER A CB  
1328 C  CB  B SER A 98  ? 0.2034 0.1499 0.2482 0.0173  0.0024  0.0506  1551 SER A CB  
1329 O  OG  A SER A 98  ? 0.2685 0.1535 0.3273 0.0103  0.0135  0.0654  1551 SER A OG  
1330 O  OG  B SER A 98  ? 0.2190 0.1610 0.2426 0.0121  0.0014  0.0750  1551 SER A OG  
1341 N  N   . ALA A 99  ? 0.1864 0.1349 0.2492 0.0062  -0.0113 0.0270  1552 ALA A N   
1342 C  CA  . ALA A 99  ? 0.1650 0.1325 0.2416 0.0083  0.0029  0.0082  1552 ALA A CA  
1343 C  C   . ALA A 99  ? 0.1579 0.1306 0.2357 0.0185  -0.0135 0.0044  1552 ALA A C   
1344 O  O   . ALA A 99  ? 0.1646 0.1410 0.2642 0.0341  -0.0200 -0.0002 1552 ALA A O   
1345 C  CB  . ALA A 99  ? 0.1807 0.1385 0.2632 0.0166  -0.0039 0.0097  1552 ALA A CB  
1351 N  N   . ALA A 100 ? 0.1631 0.1148 0.2384 -0.0012 -0.0078 0.0014  1553 ALA A N   
1352 C  CA  . ALA A 100 ? 0.1603 0.1104 0.1984 -0.0119 0.0160  0.0109  1553 ALA A CA  
1353 C  C   . ALA A 100 ? 0.1515 0.1131 0.2059 -0.0067 -0.0013 -0.0076 1553 ALA A C   
1354 O  O   . ALA A 100 ? 0.1813 0.1178 0.2489 -0.0069 0.0157  -0.0044 1553 ALA A O   
1355 C  CB  . ALA A 100 ? 0.1675 0.1159 0.2240 -0.0178 0.0239  0.0137  1553 ALA A CB  
1361 N  N   . GLY A 101 ? 0.1698 0.1043 0.2093 0.0011  -0.0056 0.0010  1554 GLY A N   
1362 C  CA  . GLY A 101 ? 0.1573 0.1050 0.1925 -0.0029 0.0164  0.0037  1554 GLY A CA  
1363 C  C   . GLY A 101 ? 0.1550 0.1104 0.1965 -0.0032 0.0165  0.0185  1554 GLY A C   
1364 O  O   . GLY A 101 ? 0.1592 0.1171 0.2171 -0.0053 0.0061  0.0011  1554 GLY A O   
1368 N  N   . LEU A 102 ? 0.1323 0.1099 0.1998 0.0012  0.0070  0.0181  1555 LEU A N   
1369 C  CA  . LEU A 102 ? 0.1521 0.1195 0.1659 0.0073  -0.0176 0.0093  1555 LEU A CA  
1370 C  C   . LEU A 102 ? 0.1534 0.1135 0.1642 0.0157  -0.0196 0.0245  1555 LEU A C   
1371 O  O   . LEU A 102 ? 0.1575 0.1188 0.1970 -0.0078 -0.0008 0.0409  1555 LEU A O   
1372 C  CB  . LEU A 102 ? 0.1661 0.1299 0.1700 0.0185  -0.0171 0.0057  1555 LEU A CB  
1373 C  CG  . LEU A 102 ? 0.1837 0.1245 0.1625 0.0031  -0.0159 -0.0084 1555 LEU A CG  
1374 C  CD1 . LEU A 102 ? 0.2108 0.1311 0.1763 0.0009  0.0137  0.0203  1555 LEU A CD1 
1375 C  CD2 . LEU A 102 ? 0.2083 0.1440 0.1836 -0.0012 -0.0324 -0.0155 1555 LEU A CD2 
1387 N  N   . KCX A 103 ? 0.1232 0.1112 0.1818 0.0017  -0.0190 0.0260  1556 KCX A N   
1388 C  CA  . KCX A 103 ? 0.1178 0.1164 0.1746 -0.0065 -0.0134 0.0127  1556 KCX A CA  
1389 C  CB  . KCX A 103 ? 0.1264 0.1199 0.2075 -0.0142 -0.0051 0.0195  1556 KCX A CB  
1390 C  CG  . KCX A 103 ? 0.1280 0.1269 0.1976 -0.0183 -0.0299 0.0252  1556 KCX A CG  
1391 C  CD  . KCX A 103 ? 0.1666 0.1220 0.2019 -0.0263 -0.0175 0.0309  1556 KCX A CD  
1392 C  CE  . KCX A 103 ? 0.1521 0.1231 0.2101 -0.0301 -0.0174 0.0151  1556 KCX A CE  
1393 N  NZ  . KCX A 103 ? 0.1782 0.1177 0.2057 -0.0354 -0.0448 0.0256  1556 KCX A NZ  
1394 C  C   . KCX A 103 ? 0.1184 0.1128 0.1689 -0.0123 0.0113  0.0257  1556 KCX A C   
1395 O  O   . KCX A 103 ? 0.1460 0.1320 0.1791 -0.0013 0.0071  0.0117  1556 KCX A O   
1396 C  CX  . KCX A 103 ? 0.1605 0.1171 0.2047 -0.0302 -0.0040 0.0107  1556 KCX A CX  
1397 O  OQ1 . KCX A 103 ? 0.1504 0.1176 0.1975 -0.0032 -0.0079 0.0089  1556 KCX A OQ1 
1398 O  OQ2 . KCX A 103 ? 0.1691 0.1310 0.2317 -0.0262 -0.0048 -0.0036 1556 KCX A OQ2 
1410 N  N   . LEU A 104 ? 0.1197 0.1159 0.1909 -0.0021 0.0210  0.0121  1557 LEU A N   
1411 C  CA  . LEU A 104 ? 0.1411 0.1306 0.2017 -0.0079 -0.0013 0.0142  1557 LEU A CA  
1412 C  C   . LEU A 104 ? 0.1454 0.1290 0.2003 -0.0068 0.0095  0.0153  1557 LEU A C   
1413 O  O   . LEU A 104 ? 0.1500 0.1468 0.1920 0.0107  0.0200  0.0180  1557 LEU A O   
1414 C  CB  . LEU A 104 ? 0.1679 0.1421 0.2685 -0.0075 -0.0420 0.0028  1557 LEU A CB  
1415 C  CG  . LEU A 104 ? 0.2280 0.1615 0.3836 -0.0367 -0.0916 -0.0067 1557 LEU A CG  
1416 C  CD1 . LEU A 104 ? 0.2786 0.1770 0.3885 -0.0416 -0.0600 -0.0094 1557 LEU A CD1 
1417 C  CD2 . LEU A 104 ? 0.2837 0.1782 0.4524 -0.0610 -0.1479 0.0064  1557 LEU A CD2 
1429 N  N   . TYR A 105 ? 0.1623 0.1268 0.1873 -0.0031 -0.0021 0.0163  1558 TYR A N   
1430 C  CA  A TYR A 105 ? 0.1586 0.1343 0.2075 -0.0016 0.0124  0.0115  1558 TYR A CA  
1431 C  CA  B TYR A 105 ? 0.1559 0.1481 0.1974 -0.0087 0.0110  0.0176  1558 TYR A CA  
1432 C  C   . TYR A 105 ? 0.1642 0.1461 0.1980 -0.0003 0.0287  0.0094  1558 TYR A C   
1433 O  O   . TYR A 105 ? 0.1856 0.1583 0.2159 -0.0083 0.0278  0.0083  1558 TYR A O   
1434 C  CB  A TYR A 105 ? 0.1489 0.1268 0.2500 0.0081  -0.0098 0.0020  1558 TYR A CB  
1435 C  CB  B TYR A 105 ? 0.1375 0.1705 0.2088 -0.0180 0.0046  0.0204  1558 TYR A CB  
1436 C  CG  A TYR A 105 ? 0.1630 0.1359 0.2576 0.0103  -0.0007 -0.0056 1558 TYR A CG  
1437 C  CG  B TYR A 105 ? 0.1210 0.2002 0.1999 -0.0322 0.0074  0.0247  1558 TYR A CG  
1438 C  CD1 A TYR A 105 ? 0.1573 0.1330 0.2842 0.0156  -0.0223 0.0014  1558 TYR A CD1 
1439 C  CD1 B TYR A 105 ? 0.1477 0.2213 0.2142 -0.0211 0.0097  0.0061  1558 TYR A CD1 
1440 C  CD2 A TYR A 105 ? 0.1816 0.1347 0.2451 -0.0096 -0.0081 0.0085  1558 TYR A CD2 
1441 C  CD2 B TYR A 105 ? 0.1179 0.2162 0.2062 -0.0224 0.0174  0.0282  1558 TYR A CD2 
1442 C  CE1 A TYR A 105 ? 0.1348 0.1255 0.2808 0.0020  -0.0083 -0.0041 1558 TYR A CE1 
1443 C  CE1 B TYR A 105 ? 0.1638 0.2336 0.2284 -0.0070 0.0102  0.0247  1558 TYR A CE1 
1444 C  CE2 A TYR A 105 ? 0.1638 0.1310 0.2574 -0.0047 -0.0049 0.0150  1558 TYR A CE2 
1445 C  CE2 B TYR A 105 ? 0.1107 0.2280 0.2075 -0.0316 0.0144  0.0388  1558 TYR A CE2 
1446 C  CZ  A TYR A 105 ? 0.1477 0.1287 0.2652 -0.0077 -0.0048 0.0070  1558 TYR A CZ  
1447 C  CZ  B TYR A 105 ? 0.1332 0.2393 0.2176 -0.0260 -0.0101 0.0326  1558 TYR A CZ  
1448 O  OH  A TYR A 105 ? 0.1381 0.1213 0.2025 -0.0221 0.0070  -0.0174 1558 TYR A OH  
1449 O  OH  B TYR A 105 ? 0.1496 0.2578 0.2440 -0.0295 -0.0264 0.0450  1558 TYR A OH  
1468 N  N   . LEU A 106 ? 0.1563 0.1410 0.1942 -0.0078 0.0101  0.0084  1559 LEU A N   
1469 C  CA  . LEU A 106 ? 0.1570 0.1437 0.2154 0.0021  0.0351  -0.0107 1559 LEU A CA  
1470 C  C   . LEU A 106 ? 0.1702 0.1739 0.2911 0.0063  0.0266  -0.0105 1559 LEU A C   
1471 O  O   . LEU A 106 ? 0.2071 0.1831 0.3565 0.0024  0.0348  -0.0541 1559 LEU A O   
1472 C  CB  . LEU A 106 ? 0.1693 0.1319 0.2016 -0.0059 0.0080  -0.0244 1559 LEU A CB  
1473 C  CG  . LEU A 106 ? 0.1977 0.1353 0.1735 -0.0247 0.0230  -0.0088 1559 LEU A CG  
1474 C  CD1 . LEU A 106 ? 0.1892 0.1345 0.2102 -0.0422 0.0138  -0.0178 1559 LEU A CD1 
1475 C  CD2 . LEU A 106 ? 0.2185 0.1405 0.1807 -0.0383 -0.0001 -0.0115 1559 LEU A CD2 
1487 N  N   . ASN A 107 ? 0.1696 0.2042 0.2606 0.0408  -0.0037 0.0167  1560 ASN A N   
1488 C  CA  . ASN A 107 ? 0.1676 0.2473 0.2691 0.0269  0.0248  0.0347  1560 ASN A CA  
1489 C  C   . ASN A 107 ? 0.2379 0.3431 0.3409 -0.0048 0.0369  0.0644  1560 ASN A C   
1490 O  O   . ASN A 107 ? 0.2822 0.3617 0.3443 0.0131  0.0437  0.0753  1560 ASN A O   
1491 C  CB  . ASN A 107 ? 0.1530 0.2062 0.2831 0.0301  0.0029  0.0176  1560 ASN A CB  
1492 C  CG  . ASN A 107 ? 0.1687 0.1840 0.2886 0.0228  -0.0075 0.0001  1560 ASN A CG  
1493 O  OD1 . ASN A 107 ? 0.1721 0.1809 0.2491 0.0041  0.0057  -0.0098 1560 ASN A OD1 
1494 N  ND2 . ASN A 107 ? 0.2007 0.1674 0.3195 -0.0093 0.0038  -0.0169 1560 ASN A ND2 
1501 N  N   . GLU A 108 ? 0.2913 0.4106 0.3964 -0.0255 0.0837  0.0691  1561 GLU A N   
1502 C  CA  . GLU A 108 ? 0.3351 0.4481 0.4475 -0.0132 0.0792  0.0502  1561 GLU A CA  
1503 C  C   . GLU A 108 ? 0.3912 0.4611 0.4978 0.0072  0.0486  0.0155  1561 GLU A C   
1504 O  O   . GLU A 108 ? 0.4049 0.4693 0.4962 0.0199  0.1131  0.0204  1561 GLU A O   
1505 C  CB  . GLU A 108 ? 0.3882 0.4716 0.4926 -0.0229 0.0844  0.0308  1561 GLU A CB  
1506 C  CG  . GLU A 108 ? 0.4284 0.4941 0.5374 -0.0082 0.0603  0.0129  1561 GLU A CG  
1507 C  CD  . GLU A 108 ? 0.4716 0.5169 0.5763 -0.0027 0.0207  -0.0023 1561 GLU A CD  
1508 O  OE1 . GLU A 108 ? 0.4729 0.5252 0.5868 0.0081  0.0107  0.0006  1561 GLU A OE1 
1509 O  OE2 . GLU A 108 ? 0.4936 0.5271 0.6129 0.0044  0.0089  -0.0039 1561 GLU A OE2 
1516 N  N   . THR A 109 ? 0.3951 0.4560 0.4936 0.0151  -0.0105 0.0053  1562 THR A N   
1517 C  CA  . THR A 109 ? 0.3548 0.4470 0.4427 0.0234  0.0210  0.0349  1562 THR A CA  
1518 C  C   . THR A 109 ? 0.3798 0.4388 0.4801 0.0164  0.0087  0.0491  1562 THR A C   
1519 O  O   . THR A 109 ? 0.3483 0.4389 0.4677 0.0376  0.0559  0.0605  1562 THR A O   
1520 C  CB  . THR A 109 ? 0.3327 0.4455 0.4321 0.0154  0.0227  0.0303  1562 THR A CB  
1526 N  N   . PHE A 110 ? 0.4071 0.4378 0.4994 -0.0006 0.0254  0.0307  1563 PHE A N   
1527 C  CA  . PHE A 110 ? 0.4020 0.4233 0.4716 -0.0413 0.0753  0.0223  1563 PHE A CA  
1528 C  C   . PHE A 110 ? 0.3865 0.4193 0.4820 -0.0505 0.1130  -0.0029 1563 PHE A C   
1529 O  O   . PHE A 110 ? 0.3311 0.4046 0.5026 -0.0689 0.1129  -0.0336 1563 PHE A O   
1530 C  CB  . PHE A 110 ? 0.4544 0.4300 0.4882 -0.0327 0.0671  0.0175  1563 PHE A CB  
1536 N  N   . SER A 111 ? 0.4474 0.4259 0.4782 -0.0169 0.0920  -0.0214 1564 SER A N   
1537 C  CA  . SER A 111 ? 0.4598 0.4273 0.4952 0.0022  0.0473  -0.0108 1564 SER A CA  
1538 C  C   . SER A 111 ? 0.4780 0.4126 0.5436 0.0042  -0.0059 -0.0173 1564 SER A C   
1539 O  O   . SER A 111 ? 0.4977 0.4210 0.5828 0.0005  -0.0157 -0.0260 1564 SER A O   
1540 C  CB  . SER A 111 ? 0.4574 0.4322 0.4769 0.0043  0.0614  -0.0028 1564 SER A CB  
1546 N  N   . GLU A 112 ? 0.4699 0.3828 0.5416 -0.0009 -0.0322 -0.0009 1565 GLU A N   
1547 C  CA  . GLU A 112 ? 0.4457 0.3466 0.4926 0.0106  -0.0498 -0.0016 1565 GLU A CA  
1548 C  C   . GLU A 112 ? 0.3882 0.2899 0.4404 0.0007  -0.0826 -0.0154 1565 GLU A C   
1549 O  O   . GLU A 112 ? 0.3852 0.2734 0.4341 0.0065  -0.1067 -0.0246 1565 GLU A O   
1550 C  CB  . GLU A 112 ? 0.4855 0.3739 0.4771 0.0178  -0.0316 -0.0075 1565 GLU A CB  
1551 C  CG  . GLU A 112 ? 0.5206 0.4035 0.4875 0.0194  -0.0255 -0.0099 1565 GLU A CG  
1552 C  CD  . GLU A 112 ? 0.5458 0.4357 0.5381 0.0225  -0.0308 -0.0005 1565 GLU A CD  
1553 O  OE1 . GLU A 112 ? 0.5481 0.4496 0.5676 0.0096  -0.0281 0.0005  1565 GLU A OE1 
1554 O  OE2 . GLU A 112 ? 0.5710 0.4470 0.5676 0.0298  -0.0384 0.0109  1565 GLU A OE2 
1561 N  N   . LEU A 113 ? 0.3523 0.2620 0.4173 -0.0122 -0.0956 -0.0261 1566 LEU A N   
1562 C  CA  . LEU A 113 ? 0.3367 0.2349 0.3675 0.0243  -0.0652 -0.0154 1566 LEU A CA  
1563 C  C   . LEU A 113 ? 0.2595 0.2114 0.3094 0.0047  0.0051  -0.0280 1566 LEU A C   
1564 O  O   . LEU A 113 ? 0.2253 0.1984 0.2653 0.0018  0.0275  -0.0234 1566 LEU A O   
1565 C  CB  . LEU A 113 ? 0.4000 0.2472 0.3898 0.0461  -0.0988 -0.0139 1566 LEU A CB  
1566 C  CG  . LEU A 113 ? 0.4300 0.2655 0.4097 0.0159  -0.0907 -0.0228 1566 LEU A CG  
1567 C  CD1 . LEU A 113 ? 0.4531 0.2815 0.4406 0.0051  -0.0865 -0.0299 1566 LEU A CD1 
1568 C  CD2 . LEU A 113 ? 0.4290 0.2646 0.4031 0.0237  -0.0936 -0.0219 1566 LEU A CD2 
1580 N  N   . ARG A 114 ? 0.2254 0.2100 0.3286 -0.0010 0.0531  -0.0241 1567 ARG A N   
1581 C  CA  . ARG A 114 ? 0.2366 0.2196 0.3165 -0.0090 0.0838  -0.0201 1567 ARG A CA  
1582 C  C   . ARG A 114 ? 0.2529 0.2073 0.2926 -0.0276 0.0593  -0.0166 1567 ARG A C   
1583 O  O   . ARG A 114 ? 0.2613 0.2071 0.3388 -0.0469 0.0309  -0.0075 1567 ARG A O   
1584 C  CB  . ARG A 114 ? 0.2952 0.2562 0.3767 0.0055  0.0972  -0.0364 1567 ARG A CB  
1585 C  CG  . ARG A 114 ? 0.3614 0.3051 0.4540 0.0200  0.1179  -0.0359 1567 ARG A CG  
1586 C  CD  . ARG A 114 ? 0.4311 0.3443 0.4865 0.0372  0.1247  -0.0448 1567 ARG A CD  
1587 N  NE  . ARG A 114 ? 0.5117 0.3786 0.5332 0.0338  0.0922  -0.0367 1567 ARG A NE  
1588 C  CZ  . ARG A 114 ? 0.5711 0.4023 0.5616 0.0183  0.0769  -0.0236 1567 ARG A CZ  
1589 N  NH1 . ARG A 114 ? 0.5880 0.4097 0.5854 0.0255  0.0730  -0.0013 1567 ARG A NH1 
1590 N  NH2 . ARG A 114 ? 0.5966 0.4150 0.5533 0.0086  0.0640  -0.0239 1567 ARG A NH2 
1604 N  N   . LEU A 115 ? 0.2539 0.2029 0.2919 -0.0162 0.0510  -0.0174 1568 LEU A N   
1605 C  CA  . LEU A 115 ? 0.2435 0.1980 0.3137 -0.0193 0.0363  -0.0244 1568 LEU A CA  
1606 C  C   . LEU A 115 ? 0.2706 0.2174 0.3941 -0.0199 0.0688  -0.0235 1568 LEU A C   
1607 O  O   . LEU A 115 ? 0.3305 0.2230 0.4621 0.0054  0.0836  -0.0292 1568 LEU A O   
1608 C  CB  . LEU A 115 ? 0.2261 0.1881 0.2626 -0.0238 -0.0007 -0.0098 1568 LEU A CB  
1609 C  CG  . LEU A 115 ? 0.2291 0.1847 0.2467 -0.0153 0.0147  0.0055  1568 LEU A CG  
1610 C  CD1 . LEU A 115 ? 0.2593 0.1802 0.2563 -0.0040 0.0402  0.0232  1568 LEU A CD1 
1611 C  CD2 . LEU A 115 ? 0.2151 0.1979 0.2840 -0.0186 0.0127  0.0199  1568 LEU A CD2 
1623 N  N   . ASP A 116 ? 0.2548 0.2309 0.4341 -0.0458 0.0713  -0.0450 1569 ASP A N   
1624 C  CA  . ASP A 116 ? 0.3001 0.2468 0.4552 -0.0436 0.0544  -0.0672 1569 ASP A CA  
1625 C  C   . ASP A 116 ? 0.2488 0.2264 0.4286 -0.0217 0.0382  -0.0694 1569 ASP A C   
1626 O  O   . ASP A 116 ? 0.2598 0.2331 0.4731 0.0001  0.0313  -0.0866 1569 ASP A O   
1627 C  CB  . ASP A 116 ? 0.3666 0.2861 0.4902 -0.0639 0.0667  -0.0646 1569 ASP A CB  
1628 C  CG  . ASP A 116 ? 0.4425 0.3286 0.5409 -0.0615 0.0487  -0.0734 1569 ASP A CG  
1629 O  OD1 . ASP A 116 ? 0.4791 0.3501 0.5944 -0.0497 0.0520  -0.0535 1569 ASP A OD1 
1630 O  OD2 . ASP A 116 ? 0.4933 0.3577 0.5461 -0.0402 0.0742  -0.0820 1569 ASP A OD2 
1635 N  N   . SER A 117 ? 0.2070 0.2025 0.3267 -0.0098 0.0589  -0.0449 1570 SER A N   
1636 C  CA  . SER A 117 ? 0.2178 0.1751 0.2680 -0.0159 0.0470  -0.0259 1570 SER A CA  
1637 C  C   . SER A 117 ? 0.1885 0.1457 0.2254 -0.0165 0.0136  -0.0053 1570 SER A C   
1638 O  O   . SER A 117 ? 0.1932 0.1347 0.2377 -0.0059 0.0087  -0.0075 1570 SER A O   
1639 C  CB  . SER A 117 ? 0.2386 0.1901 0.2434 -0.0278 0.0608  -0.0293 1570 SER A CB  
1640 O  OG  . SER A 117 ? 0.2615 0.2065 0.2507 -0.0194 0.0319  -0.0172 1570 SER A OG  
1646 N  N   . VAL A 118 ? 0.1948 0.1370 0.2205 -0.0154 -0.0073 -0.0124 1571 VAL A N   
1647 C  CA  A VAL A 118 ? 0.1959 0.1347 0.2066 -0.0325 -0.0244 0.0003  1571 VAL A CA  
1648 C  CA  B VAL A 118 ? 0.1984 0.1329 0.2026 -0.0165 -0.0246 -0.0014 1571 VAL A CA  
1649 C  C   . VAL A 118 ? 0.1854 0.1252 0.1926 -0.0161 -0.0057 0.0063  1571 VAL A C   
1650 O  O   . VAL A 118 ? 0.1865 0.1249 0.2212 -0.0016 -0.0103 0.0137  1571 VAL A O   
1651 C  CB  A VAL A 118 ? 0.2212 0.1432 0.2386 -0.0321 -0.0442 0.0138  1571 VAL A CB  
1652 C  CB  B VAL A 118 ? 0.2184 0.1362 0.2143 -0.0017 -0.0534 0.0057  1571 VAL A CB  
1653 C  CG1 A VAL A 118 ? 0.2290 0.1511 0.2480 -0.0404 -0.0207 0.0289  1571 VAL A CG1 
1654 C  CG1 B VAL A 118 ? 0.2264 0.1351 0.2286 0.0034  -0.0537 0.0165  1571 VAL A CG1 
1655 C  CG2 A VAL A 118 ? 0.2301 0.1389 0.2553 -0.0246 -0.0427 0.0376  1571 VAL A CG2 
1656 C  CG2 B VAL A 118 ? 0.2191 0.1356 0.2024 0.0113  -0.0627 0.0127  1571 VAL A CG2 
1675 N  N   . VAL A 119 ? 0.1953 0.1208 0.2138 0.0004  -0.0055 -0.0004 1572 VAL A N   
1676 C  CA  . VAL A 119 ? 0.2185 0.1320 0.1870 -0.0038 -0.0130 0.0029  1572 VAL A CA  
1677 C  C   . VAL A 119 ? 0.2142 0.1290 0.1982 0.0031  -0.0045 -0.0024 1572 VAL A C   
1678 O  O   . VAL A 119 ? 0.2234 0.1229 0.2037 0.0057  -0.0125 0.0036  1572 VAL A O   
1679 C  CB  . VAL A 119 ? 0.2600 0.1482 0.2105 0.0214  -0.0255 -0.0124 1572 VAL A CB  
1680 C  CG1 . VAL A 119 ? 0.3265 0.1699 0.2118 0.0171  -0.0471 -0.0186 1572 VAL A CG1 
1681 C  CG2 . VAL A 119 ? 0.2678 0.1523 0.2376 0.0121  -0.0296 -0.0232 1572 VAL A CG2 
1691 N  N   . GLN A 120 ? 0.1946 0.1323 0.1874 -0.0098 0.0234  -0.0006 1573 GLN A N   
1692 C  CA  . GLN A 120 ? 0.1777 0.1343 0.1813 -0.0186 0.0234  0.0049  1573 GLN A CA  
1693 C  C   . GLN A 120 ? 0.1850 0.1302 0.1768 -0.0078 0.0321  0.0123  1573 GLN A C   
1694 O  O   . GLN A 120 ? 0.2077 0.1259 0.1741 0.0003  0.0172  0.0079  1573 GLN A O   
1695 C  CB  . GLN A 120 ? 0.1937 0.1538 0.2268 -0.0270 0.0407  0.0098  1573 GLN A CB  
1696 C  CG  . GLN A 120 ? 0.2152 0.1901 0.2610 -0.0313 0.0646  0.0023  1573 GLN A CG  
1697 C  CD  . GLN A 120 ? 0.2636 0.2399 0.3188 -0.0179 0.0840  0.0410  1573 GLN A CD  
1698 O  OE1 . GLN A 120 ? 0.2894 0.2622 0.3619 -0.0169 0.0590  0.0123  1573 GLN A OE1 
1699 N  NE2 . GLN A 120 ? 0.3220 0.2640 0.3865 -0.0066 0.1003  0.0594  1573 GLN A NE2 
1708 N  N   . TRP A 121 ? 0.1702 0.1304 0.1655 -0.0047 0.0149  0.0263  1574 TRP A N   
1709 C  CA  . TRP A 121 ? 0.1570 0.1363 0.1646 -0.0062 -0.0038 0.0279  1574 TRP A CA  
1710 C  C   . TRP A 121 ? 0.1553 0.1338 0.1902 -0.0034 -0.0104 0.0205  1574 TRP A C   
1711 O  O   . TRP A 121 ? 0.1699 0.1326 0.2020 0.0071  -0.0019 0.0151  1574 TRP A O   
1712 C  CB  . TRP A 121 ? 0.1694 0.1378 0.1958 -0.0035 -0.0058 0.0232  1574 TRP A CB  
1713 C  CG  . TRP A 121 ? 0.1666 0.1215 0.1840 -0.0155 -0.0054 0.0042  1574 TRP A CG  
1714 C  CD1 . TRP A 121 ? 0.1946 0.1207 0.1685 -0.0113 -0.0073 0.0164  1574 TRP A CD1 
1715 C  CD2 . TRP A 121 ? 0.1634 0.1120 0.1432 -0.0039 -0.0020 0.0050  1574 TRP A CD2 
1716 N  NE1 . TRP A 121 ? 0.1972 0.1342 0.1793 -0.0062 0.0064  0.0236  1574 TRP A NE1 
1717 C  CE2 . TRP A 121 ? 0.1731 0.1179 0.1554 -0.0085 -0.0031 0.0060  1574 TRP A CE2 
1718 C  CE3 . TRP A 121 ? 0.1618 0.1144 0.1589 0.0010  -0.0176 0.0068  1574 TRP A CE3 
1719 C  CZ2 . TRP A 121 ? 0.1572 0.1322 0.1676 0.0029  -0.0040 -0.0017 1574 TRP A CZ2 
1720 C  CZ3 . TRP A 121 ? 0.1489 0.1111 0.1550 0.0077  -0.0021 0.0030  1574 TRP A CZ3 
1721 C  CH2 . TRP A 121 ? 0.1537 0.1206 0.1605 0.0220  -0.0090 0.0009  1574 TRP A CH2 
1732 N  N   . MET A 122 ? 0.1697 0.1332 0.1910 -0.0134 -0.0141 0.0215  1575 MET A N   
1733 C  CA  A MET A 122 ? 0.2104 0.1487 0.1908 -0.0144 -0.0157 0.0286  1575 MET A CA  
1734 C  CA  B MET A 122 ? 0.1840 0.1418 0.1788 -0.0134 -0.0061 0.0247  1575 MET A CA  
1735 C  C   . MET A 122 ? 0.1942 0.1435 0.1935 -0.0107 -0.0160 0.0223  1575 MET A C   
1736 O  O   . MET A 122 ? 0.1815 0.1575 0.2088 -0.0072 -0.0022 0.0244  1575 MET A O   
1737 C  CB  A MET A 122 ? 0.2552 0.1697 0.2421 -0.0205 -0.0282 0.0300  1575 MET A CB  
1738 C  CB  B MET A 122 ? 0.1812 0.1473 0.1885 -0.0169 0.0059  0.0216  1575 MET A CB  
1739 C  CG  A MET A 122 ? 0.3323 0.1922 0.3052 -0.0325 -0.0253 0.0286  1575 MET A CG  
1740 C  CG  B MET A 122 ? 0.1955 0.1468 0.1937 -0.0204 0.0252  0.0154  1575 MET A CG  
1741 S  SD  A MET A 122 ? 0.4146 0.2139 0.3880 -0.0353 -0.0255 0.0321  1575 MET A SD  
1742 S  SD  B MET A 122 ? 0.2042 0.1434 0.2071 -0.0242 0.0260  0.0134  1575 MET A SD  
1743 C  CE  A MET A 122 ? 0.3675 0.1995 0.3614 -0.0457 -0.0014 0.0620  1575 MET A CE  
1744 C  CE  B MET A 122 ? 0.2043 0.1326 0.1817 -0.0327 -0.0033 0.0033  1575 MET A CE  
1763 N  N   . GLU A 123 ? 0.1925 0.1383 0.1881 -0.0076 -0.0155 0.0392  1576 GLU A N   
1764 C  CA  . GLU A 123 ? 0.2198 0.1361 0.1702 -0.0132 -0.0307 0.0304  1576 GLU A CA  
1765 C  C   . GLU A 123 ? 0.2018 0.1280 0.1704 -0.0079 -0.0099 0.0246  1576 GLU A C   
1766 O  O   . GLU A 123 ? 0.2103 0.1357 0.1891 0.0044  -0.0317 0.0189  1576 GLU A O   
1767 C  CB  . GLU A 123 ? 0.2561 0.1550 0.1554 -0.0167 -0.0254 0.0290  1576 GLU A CB  
1768 C  CG  . GLU A 123 ? 0.3097 0.1941 0.2026 -0.0095 -0.0009 0.0115  1576 GLU A CG  
1769 C  CD  . GLU A 123 ? 0.3768 0.2328 0.2369 -0.0155 0.0188  -0.0108 1576 GLU A CD  
1770 O  OE1 . GLU A 123 ? 0.3644 0.2506 0.2499 -0.0262 -0.0083 -0.0241 1576 GLU A OE1 
1771 O  OE2 . GLU A 123 ? 0.4266 0.2582 0.2498 -0.0210 0.0249  -0.0180 1576 GLU A OE2 
1778 N  N   . HIS A 124 ? 0.1894 0.1181 0.1761 -0.0221 -0.0039 0.0126  1577 HIS A N   
1779 C  CA  . HIS A 124 ? 0.1728 0.1228 0.1648 -0.0173 -0.0319 0.0254  1577 HIS A CA  
1780 C  C   . HIS A 124 ? 0.1707 0.1227 0.1699 -0.0134 -0.0072 0.0355  1577 HIS A C   
1781 O  O   . HIS A 124 ? 0.1925 0.1328 0.2004 0.0018  -0.0184 0.0322  1577 HIS A O   
1782 C  CB  . HIS A 124 ? 0.1902 0.1270 0.1528 -0.0268 -0.0169 0.0301  1577 HIS A CB  
1783 C  CG  . HIS A 124 ? 0.1980 0.1334 0.1790 -0.0183 0.0132  0.0162  1577 HIS A CG  
1784 N  ND1 . HIS A 124 ? 0.1910 0.1357 0.2002 -0.0093 0.0140  0.0213  1577 HIS A ND1 
1785 C  CD2 . HIS A 124 ? 0.2107 0.1494 0.1810 -0.0263 0.0071  0.0080  1577 HIS A CD2 
1786 C  CE1 . HIS A 124 ? 0.2100 0.1521 0.1935 -0.0138 -0.0045 0.0126  1577 HIS A CE1 
1787 N  NE2 . HIS A 124 ? 0.2191 0.1490 0.1791 -0.0226 0.0199  0.0041  1577 HIS A NE2 
1796 N  N   . PHE A 125 ? 0.1745 0.1243 0.1895 -0.0094 -0.0159 0.0325  1578 PHE A N   
1797 C  CA  . PHE A 125 ? 0.1846 0.1347 0.1693 -0.0081 -0.0116 0.0304  1578 PHE A CA  
1798 C  C   . PHE A 125 ? 0.1726 0.1382 0.1838 0.0054  -0.0217 0.0306  1578 PHE A C   
1799 O  O   . PHE A 125 ? 0.1708 0.1509 0.2173 0.0081  0.0010  0.0145  1578 PHE A O   
1800 C  CB  . PHE A 125 ? 0.1894 0.1321 0.1742 -0.0154 0.0030  0.0304  1578 PHE A CB  
1801 C  CG  . PHE A 125 ? 0.1690 0.1347 0.1647 -0.0008 -0.0001 0.0199  1578 PHE A CG  
1802 C  CD1 . PHE A 125 ? 0.1747 0.1519 0.1693 -0.0111 -0.0109 0.0079  1578 PHE A CD1 
1803 C  CD2 . PHE A 125 ? 0.1644 0.1215 0.1749 0.0131  0.0073  0.0226  1578 PHE A CD2 
1804 C  CE1 . PHE A 125 ? 0.1684 0.1545 0.2115 -0.0010 -0.0265 0.0091  1578 PHE A CE1 
1805 C  CE2 . PHE A 125 ? 0.1854 0.1316 0.1898 0.0117  0.0113  0.0117  1578 PHE A CE2 
1806 C  CZ  . PHE A 125 ? 0.1830 0.1498 0.1833 0.0147  -0.0266 0.0068  1578 PHE A CZ  
1816 N  N   . GLU A 126 ? 0.1636 0.1328 0.1850 -0.0083 -0.0339 0.0376  1579 GLU A N   
1817 C  CA  . GLU A 126 ? 0.1912 0.1483 0.2264 -0.0050 -0.0465 0.0306  1579 GLU A CA  
1818 C  C   . GLU A 126 ? 0.1919 0.1575 0.2494 0.0118  -0.0471 0.0321  1579 GLU A C   
1819 O  O   . GLU A 126 ? 0.2027 0.1709 0.3274 0.0189  -0.0682 0.0395  1579 GLU A O   
1820 C  CB  . GLU A 126 ? 0.2211 0.1529 0.2287 -0.0138 -0.0319 0.0207  1579 GLU A CB  
1821 C  CG  . GLU A 126 ? 0.2683 0.1641 0.2584 -0.0337 -0.0110 0.0226  1579 GLU A CG  
1822 C  CD  . GLU A 126 ? 0.3734 0.1896 0.3448 -0.0427 0.0206  0.0134  1579 GLU A CD  
1823 O  OE1 . GLU A 126 ? 0.4119 0.1977 0.3450 -0.0237 0.0145  0.0003  1579 GLU A OE1 
1824 O  OE2 . GLU A 126 ? 0.4297 0.2152 0.4153 -0.0554 0.0125  0.0021  1579 GLU A OE2 
1831 N  N   . THR A 127 ? 0.2050 0.1493 0.2091 0.0075  -0.0367 0.0359  1580 THR A N   
1832 C  CA  . THR A 127 ? 0.2110 0.1475 0.1789 0.0141  -0.0358 0.0380  1580 THR A CA  
1833 C  C   . THR A 127 ? 0.2304 0.1474 0.2014 0.0109  -0.0220 0.0325  1580 THR A C   
1834 O  O   . THR A 127 ? 0.2565 0.1419 0.2175 0.0118  -0.0264 0.0286  1580 THR A O   
1835 C  CB  . THR A 127 ? 0.2414 0.1569 0.1930 0.0099  -0.0302 0.0364  1580 THR A CB  
1836 O  OG1 . THR A 127 ? 0.2287 0.1528 0.2074 0.0032  -0.0107 0.0352  1580 THR A OG1 
1837 C  CG2 . THR A 127 ? 0.2764 0.1742 0.1947 0.0133  -0.0385 0.0281  1580 THR A CG2 
1845 N  N   . TRP A 128 ? 0.1990 0.1447 0.2034 0.0028  -0.0228 0.0208  1581 TRP A N   
1846 C  CA  . TRP A 128 ? 0.1777 0.1519 0.1831 -0.0156 -0.0174 0.0249  1581 TRP A CA  
1847 C  C   . TRP A 128 ? 0.1778 0.1652 0.2056 -0.0088 -0.0154 0.0397  1581 TRP A C   
1848 O  O   . TRP A 128 ? 0.1907 0.1712 0.2068 -0.0167 -0.0155 0.0473  1581 TRP A O   
1849 C  CB  . TRP A 128 ? 0.1771 0.1431 0.1709 -0.0196 -0.0346 0.0274  1581 TRP A CB  
1850 C  CG  . TRP A 128 ? 0.1554 0.1319 0.1821 -0.0089 -0.0267 0.0297  1581 TRP A CG  
1851 C  CD1 . TRP A 128 ? 0.1664 0.1299 0.2052 -0.0051 -0.0182 0.0389  1581 TRP A CD1 
1852 C  CD2 . TRP A 128 ? 0.1680 0.1393 0.1902 -0.0044 -0.0158 0.0437  1581 TRP A CD2 
1853 N  NE1 . TRP A 128 ? 0.1577 0.1397 0.1983 -0.0032 -0.0123 0.0250  1581 TRP A NE1 
1854 C  CE2 . TRP A 128 ? 0.1573 0.1396 0.1941 0.0086  -0.0204 0.0277  1581 TRP A CE2 
1855 C  CE3 . TRP A 128 ? 0.1813 0.1463 0.2090 0.0040  -0.0113 0.0429  1581 TRP A CE3 
1856 C  CZ2 . TRP A 128 ? 0.1860 0.1444 0.1835 0.0115  -0.0213 0.0175  1581 TRP A CZ2 
1857 C  CZ3 . TRP A 128 ? 0.1983 0.1550 0.2224 0.0040  0.0010  0.0335  1581 TRP A CZ3 
1858 C  CH2 . TRP A 128 ? 0.1766 0.1488 0.2079 0.0049  -0.0131 0.0295  1581 TRP A CH2 
1869 N  N   . PRO A 129 ? 0.1546 0.1618 0.2242 -0.0118 -0.0132 0.0376  1582 PRO A N   
1870 C  CA  . PRO A 129 ? 0.1666 0.1727 0.2450 -0.0026 -0.0192 0.0306  1582 PRO A CA  
1871 C  C   . PRO A 129 ? 0.1821 0.1957 0.2524 -0.0211 -0.0222 0.0088  1582 PRO A C   
1872 O  O   . PRO A 129 ? 0.1834 0.1813 0.2483 -0.0114 -0.0249 0.0054  1582 PRO A O   
1873 C  CB  . PRO A 129 ? 0.1698 0.1678 0.2635 0.0070  -0.0420 0.0407  1582 PRO A CB  
1874 C  CG  . PRO A 129 ? 0.1712 0.1659 0.2651 0.0181  -0.0201 0.0368  1582 PRO A CG  
1875 C  CD  . PRO A 129 ? 0.1405 0.1596 0.2440 0.0037  -0.0285 0.0399  1582 PRO A CD  
1883 N  N   . SER A 130 ? 0.2186 0.2279 0.2878 -0.0417 -0.0027 -0.0007 1583 SER A N   
1884 C  CA  . SER A 130 ? 0.2440 0.2504 0.3174 -0.0756 -0.0007 -0.0047 1583 SER A CA  
1885 C  C   . SER A 130 ? 0.2285 0.2368 0.2996 -0.0581 0.0302  0.0050  1583 SER A C   
1886 O  O   . SER A 130 ? 0.2814 0.2357 0.3104 -0.0569 0.0556  0.0094  1583 SER A O   
1887 C  CB  . SER A 130 ? 0.2918 0.2882 0.3853 -0.0833 0.0049  -0.0172 1583 SER A CB  
1888 O  OG  . SER A 130 ? 0.3186 0.3194 0.4504 -0.0896 -0.0270 -0.0215 1583 SER A OG  
1894 N  N   . HIS A 131 ? 0.1715 0.2293 0.2783 -0.0517 0.0212  0.0042  1584 HIS A N   
1895 C  CA  . HIS A 131 ? 0.1646 0.2197 0.2701 -0.0327 0.0099  0.0076  1584 HIS A CA  
1896 C  C   . HIS A 131 ? 0.1601 0.1903 0.2390 -0.0228 0.0067  0.0178  1584 HIS A C   
1897 O  O   . HIS A 131 ? 0.1667 0.2097 0.2383 -0.0344 0.0274  0.0249  1584 HIS A O   
1898 C  CB  . HIS A 131 ? 0.1768 0.2434 0.2891 -0.0167 -0.0112 0.0202  1584 HIS A CB  
1899 C  CG  . HIS A 131 ? 0.1891 0.2568 0.2672 0.0159  -0.0212 0.0296  1584 HIS A CG  
1900 N  ND1 . HIS A 131 ? 0.2146 0.2663 0.2550 0.0190  -0.0034 0.0229  1584 HIS A ND1 
1901 C  CD2 . HIS A 131 ? 0.1987 0.2569 0.2692 0.0234  -0.0047 0.0369  1584 HIS A CD2 
1902 C  CE1 . HIS A 131 ? 0.2123 0.2609 0.2462 0.0378  -0.0275 0.0303  1584 HIS A CE1 
1903 N  NE2 . HIS A 131 ? 0.2099 0.2638 0.2611 0.0336  -0.0324 0.0400  1584 HIS A NE2 
1912 N  N   . LEU A 132 ? 0.1454 0.1529 0.2280 0.0025  -0.0092 0.0308  1585 LEU A N   
1913 C  CA  . LEU A 132 ? 0.1608 0.1315 0.1909 0.0052  0.0042  0.0315  1585 LEU A CA  
1914 C  C   . LEU A 132 ? 0.1635 0.1114 0.1926 0.0045  -0.0013 0.0215  1585 LEU A C   
1915 O  O   . LEU A 132 ? 0.1746 0.1087 0.1953 -0.0052 -0.0193 0.0151  1585 LEU A O   
1916 C  CB  . LEU A 132 ? 0.1830 0.1278 0.2040 -0.0015 -0.0079 0.0469  1585 LEU A CB  
1917 C  CG  . LEU A 132 ? 0.1895 0.1408 0.2232 0.0055  -0.0185 0.0384  1585 LEU A CG  
1918 C  CD1 . LEU A 132 ? 0.1996 0.1552 0.2159 0.0025  -0.0220 0.0404  1585 LEU A CD1 
1919 C  CD2 . LEU A 132 ? 0.1874 0.1449 0.2587 0.0119  0.0040  0.0366  1585 LEU A CD2 
1931 N  N   . PRO A 133 ? 0.1443 0.0994 0.1973 0.0069  0.0037  0.0140  1586 PRO A N   
1932 C  CA  . PRO A 133 ? 0.1574 0.1105 0.2101 0.0054  -0.0035 0.0135  1586 PRO A CA  
1933 C  C   . PRO A 133 ? 0.1486 0.1040 0.1806 -0.0042 0.0058  0.0207  1586 PRO A C   
1934 O  O   . PRO A 133 ? 0.1516 0.0990 0.1886 -0.0037 0.0197  0.0226  1586 PRO A O   
1935 C  CB  . PRO A 133 ? 0.1696 0.1009 0.1776 -0.0019 -0.0049 0.0109  1586 PRO A CB  
1936 C  CG  . PRO A 133 ? 0.1735 0.1021 0.1912 -0.0079 0.0048  -0.0083 1586 PRO A CG  
1937 C  CD  . PRO A 133 ? 0.1510 0.0993 0.2071 0.0070  -0.0171 -0.0002 1586 PRO A CD  
1945 N  N   . ILE A 134 ? 0.1281 0.1079 0.1917 -0.0145 -0.0020 0.0233  1587 ILE A N   
1946 C  CA  A ILE A 134 ? 0.1371 0.1109 0.1836 -0.0118 0.0009  0.0173  1587 ILE A CA  
1947 C  CA  B ILE A 134 ? 0.1296 0.1088 0.1810 -0.0158 -0.0057 0.0162  1587 ILE A CA  
1948 C  C   . ILE A 134 ? 0.1301 0.1095 0.1785 -0.0084 0.0049  0.0163  1587 ILE A C   
1949 O  O   . ILE A 134 ? 0.1298 0.1236 0.1861 -0.0131 0.0021  0.0328  1587 ILE A O   
1950 C  CB  A ILE A 134 ? 0.1582 0.1159 0.1904 -0.0116 0.0018  0.0126  1587 ILE A CB  
1951 C  CB  B ILE A 134 ? 0.1557 0.1164 0.1962 -0.0141 0.0117  0.0151  1587 ILE A CB  
1952 C  CG1 A ILE A 134 ? 0.1747 0.1194 0.1927 -0.0105 0.0059  0.0127  1587 ILE A CG1 
1953 C  CG1 B ILE A 134 ? 0.1542 0.1319 0.2265 -0.0173 0.0201  0.0148  1587 ILE A CG1 
1954 C  CG2 A ILE A 134 ? 0.1621 0.1166 0.1960 -0.0121 -0.0032 0.0097  1587 ILE A CG2 
1955 C  CG2 B ILE A 134 ? 0.1737 0.1152 0.2067 -0.0260 -0.0045 0.0154  1587 ILE A CG2 
1956 C  CD1 A ILE A 134 ? 0.1876 0.1215 0.1916 -0.0097 0.0066  0.0136  1587 ILE A CD1 
1957 C  CD1 B ILE A 134 ? 0.2058 0.1296 0.2106 -0.0059 0.0154  0.0300  1587 ILE A CD1 
1980 N  N   . VAL A 135 ? 0.1325 0.1133 0.1555 -0.0060 0.0022  0.0278  1588 VAL A N   
1981 C  CA  . VAL A 135 ? 0.1266 0.1201 0.1568 0.0056  -0.0131 0.0142  1588 VAL A CA  
1982 C  C   . VAL A 135 ? 0.1259 0.1134 0.1644 -0.0006 0.0036  0.0109  1588 VAL A C   
1983 O  O   . VAL A 135 ? 0.1394 0.1161 0.1823 0.0100  0.0228  0.0173  1588 VAL A O   
1984 C  CB  . VAL A 135 ? 0.1585 0.1229 0.2034 0.0144  0.0048  0.0033  1588 VAL A CB  
1985 C  CG1 . VAL A 135 ? 0.1622 0.1147 0.1950 0.0121  0.0203  0.0139  1588 VAL A CG1 
1986 C  CG2 . VAL A 135 ? 0.1544 0.1353 0.2274 0.0086  0.0064  -0.0207 1588 VAL A CG2 
1996 N  N   . ALA A 136 ? 0.1242 0.1068 0.1754 -0.0008 0.0018  0.0061  1589 ALA A N   
1997 C  CA  . ALA A 136 ? 0.1201 0.1019 0.1929 0.0058  0.0048  -0.0099 1589 ALA A CA  
1998 C  C   . ALA A 136 ? 0.1276 0.1094 0.1811 0.0025  0.0078  -0.0129 1589 ALA A C   
1999 O  O   . ALA A 136 ? 0.1515 0.1124 0.1867 0.0052  -0.0023 0.0042  1589 ALA A O   
2000 C  CB  . ALA A 136 ? 0.1413 0.1135 0.2037 0.0009  -0.0083 -0.0078 1589 ALA A CB  
2006 N  N   . HIS A 137 ? 0.0922 0.1120 0.1832 0.0093  0.0025  -0.0022 1590 HIS A N   
2007 C  CA  . HIS A 137 ? 0.1157 0.1156 0.1803 0.0045  -0.0097 -0.0152 1590 HIS A CA  
2008 C  C   . HIS A 137 ? 0.1310 0.1064 0.1597 0.0118  0.0136  -0.0073 1590 HIS A C   
2009 O  O   . HIS A 137 ? 0.1609 0.1033 0.1796 0.0100  0.0262  -0.0096 1590 HIS A O   
2010 C  CB  . HIS A 137 ? 0.1137 0.1169 0.1880 -0.0107 -0.0136 -0.0070 1590 HIS A CB  
2011 C  CG  . HIS A 137 ? 0.1249 0.1199 0.1943 -0.0151 -0.0178 -0.0122 1590 HIS A CG  
2012 N  ND1 . HIS A 137 ? 0.1336 0.1259 0.1982 -0.0087 -0.0007 -0.0160 1590 HIS A ND1 
2013 C  CD2 . HIS A 137 ? 0.1510 0.1258 0.2131 -0.0045 -0.0274 -0.0237 1590 HIS A CD2 
2014 C  CE1 . HIS A 137 ? 0.1283 0.1160 0.2179 0.0042  -0.0001 -0.0252 1590 HIS A CE1 
2015 N  NE2 . HIS A 137 ? 0.1604 0.1266 0.2223 0.0043  -0.0110 -0.0229 1590 HIS A NE2 
2023 N  N   . ALA A 138 ? 0.1329 0.1022 0.1714 -0.0001 -0.0067 -0.0047 1591 ALA A N   
2024 C  CA  . ALA A 138 ? 0.1458 0.1231 0.1762 0.0089  0.0194  0.0056  1591 ALA A CA  
2025 C  C   . ALA A 138 ? 0.1818 0.1581 0.1688 0.0352  0.0309  0.0109  1591 ALA A C   
2026 O  O   . ALA A 138 ? 0.2361 0.2029 0.2405 0.0881  0.0571  0.0486  1591 ALA A O   
2027 C  CB  . ALA A 138 ? 0.1499 0.1275 0.1964 0.0069  -0.0038 0.0040  1591 ALA A CB  
2033 N  N   . GLU A 139 ? 0.1366 0.1340 0.1632 0.0220  0.0043  -0.0038 1592 GLU A N   
2034 C  CA  . GLU A 139 ? 0.1474 0.1244 0.1969 0.0153  -0.0189 -0.0159 1592 GLU A CA  
2035 C  C   . GLU A 139 ? 0.1603 0.1185 0.1846 0.0186  -0.0184 -0.0010 1592 GLU A C   
2036 O  O   . GLU A 139 ? 0.1543 0.1160 0.1955 0.0158  -0.0170 0.0003  1592 GLU A O   
2037 C  CB  . GLU A 139 ? 0.1542 0.1353 0.2164 0.0109  -0.0482 -0.0258 1592 GLU A CB  
2038 C  CG  . GLU A 139 ? 0.1674 0.1491 0.2393 -0.0006 -0.0329 -0.0378 1592 GLU A CG  
2039 C  CD  . GLU A 139 ? 0.1622 0.1620 0.2881 0.0085  -0.0250 -0.0214 1592 GLU A CD  
2040 O  OE1 . GLU A 139 ? 0.1629 0.1832 0.2832 -0.0041 -0.0526 -0.0072 1592 GLU A OE1 
2041 O  OE2 . GLU A 139 ? 0.1682 0.1733 0.3287 0.0025  -0.0412 -0.0214 1592 GLU A OE2 
2048 N  N   . GLN A 140 ? 0.1885 0.1208 0.1832 0.0287  -0.0048 -0.0013 1593 GLN A N   
2049 C  CA  . GLN A 140 ? 0.1670 0.1227 0.1883 0.0268  -0.0234 0.0115  1593 GLN A CA  
2050 C  C   . GLN A 140 ? 0.1534 0.1200 0.1745 0.0254  -0.0156 0.0157  1593 GLN A C   
2051 O  O   . GLN A 140 ? 0.1616 0.1341 0.2105 0.0327  0.0005  0.0128  1593 GLN A O   
2052 C  CB  . GLN A 140 ? 0.1875 0.1381 0.2382 0.0108  -0.0426 -0.0071 1593 GLN A CB  
2053 C  CG  . GLN A 140 ? 0.2282 0.1558 0.2812 0.0177  -0.0494 0.0021  1593 GLN A CG  
2054 C  CD  . GLN A 140 ? 0.2440 0.1935 0.3565 0.0202  -0.0829 0.0112  1593 GLN A CD  
2055 O  OE1 . GLN A 140 ? 0.2988 0.2047 0.4219 0.0406  -0.0813 -0.0046 1593 GLN A OE1 
2056 N  NE2 . GLN A 140 ? 0.2299 0.2177 0.4000 0.0377  -0.0643 -0.0064 1593 GLN A NE2 
2065 N  N   . GLN A 141 ? 0.1382 0.1323 0.1820 0.0148  -0.0194 -0.0096 1594 GLN A N   
2066 C  CA  . GLN A 141 ? 0.1434 0.1450 0.1818 0.0223  -0.0249 -0.0179 1594 GLN A CA  
2067 C  C   . GLN A 141 ? 0.1354 0.1259 0.1721 0.0011  -0.0128 0.0077  1594 GLN A C   
2068 O  O   . GLN A 141 ? 0.1554 0.1262 0.2083 -0.0031 -0.0145 -0.0148 1594 GLN A O   
2069 C  CB  . GLN A 141 ? 0.2020 0.1938 0.2794 0.0358  -0.0363 -0.0570 1594 GLN A CB  
2070 C  CG  . GLN A 141 ? 0.2536 0.2434 0.2996 0.0484  -0.0131 -0.0902 1594 GLN A CG  
2071 C  CD  . GLN A 141 ? 0.2666 0.2818 0.3736 0.0685  0.0272  -0.0909 1594 GLN A CD  
2072 O  OE1 . GLN A 141 ? 0.2328 0.2793 0.3228 0.0415  0.0252  -0.0883 1594 GLN A OE1 
2073 N  NE2 . GLN A 141 ? 0.3452 0.3265 0.4247 0.0423  0.0471  -0.0761 1594 GLN A NE2 
2082 N  N   . THR A 142 ? 0.1495 0.1146 0.1580 -0.0153 -0.0023 0.0149  1595 THR A N   
2083 C  CA  . THR A 142 ? 0.1519 0.1155 0.1581 -0.0113 0.0028  -0.0041 1595 THR A CA  
2084 C  C   . THR A 142 ? 0.1579 0.1098 0.1688 -0.0026 -0.0052 0.0090  1595 THR A C   
2085 O  O   . THR A 142 ? 0.1595 0.1176 0.1717 -0.0016 -0.0159 0.0020  1595 THR A O   
2086 C  CB  . THR A 142 ? 0.1532 0.1145 0.1734 -0.0096 0.0107  -0.0165 1595 THR A CB  
2087 O  OG1 . THR A 142 ? 0.1495 0.1117 0.2169 -0.0061 0.0143  -0.0068 1595 THR A OG1 
2088 C  CG2 . THR A 142 ? 0.1665 0.1304 0.1694 -0.0051 0.0042  -0.0063 1595 THR A CG2 
2096 N  N   . VAL A 143 ? 0.1432 0.1054 0.1742 0.0059  -0.0208 0.0091  1596 VAL A N   
2097 C  CA  A VAL A 143 ? 0.1420 0.0971 0.1676 0.0111  -0.0190 0.0018  1596 VAL A CA  
2098 C  CA  B VAL A 143 ? 0.1418 0.0964 0.1820 0.0105  -0.0073 0.0051  1596 VAL A CA  
2099 C  C   . VAL A 143 ? 0.1332 0.0903 0.1758 0.0104  -0.0082 0.0087  1596 VAL A C   
2100 O  O   . VAL A 143 ? 0.1474 0.0973 0.1838 0.0165  0.0050  -0.0036 1596 VAL A O   
2101 C  CB  A VAL A 143 ? 0.1466 0.1005 0.1579 0.0107  -0.0221 -0.0203 1596 VAL A CB  
2102 C  CB  B VAL A 143 ? 0.1491 0.1054 0.2085 0.0019  0.0114  -0.0210 1596 VAL A CB  
2103 C  CG1 A VAL A 143 ? 0.1615 0.1142 0.1709 0.0162  -0.0148 0.0011  1596 VAL A CG1 
2104 C  CG1 B VAL A 143 ? 0.1965 0.1203 0.2370 0.0019  -0.0024 -0.0008 1596 VAL A CG1 
2105 C  CG2 A VAL A 143 ? 0.1654 0.0906 0.1386 0.0128  -0.0230 -0.0432 1596 VAL A CG2 
2106 C  CG2 B VAL A 143 ? 0.1709 0.1160 0.2174 -0.0036 0.0149  -0.0233 1596 VAL A CG2 
2125 N  N   . ALA A 144 ? 0.1610 0.0889 0.1646 -0.0014 -0.0095 0.0083  1597 ALA A N   
2126 C  CA  . ALA A 144 ? 0.1404 0.0912 0.1582 -0.0029 -0.0003 0.0060  1597 ALA A CA  
2127 C  C   . ALA A 144 ? 0.1366 0.1031 0.1481 -0.0068 -0.0021 -0.0033 1597 ALA A C   
2128 O  O   . ALA A 144 ? 0.1406 0.1030 0.1683 -0.0024 0.0109  -0.0063 1597 ALA A O   
2129 C  CB  . ALA A 144 ? 0.1517 0.0956 0.1687 -0.0024 -0.0194 -0.0081 1597 ALA A CB  
2135 N  N   . ALA A 145 ? 0.1322 0.0996 0.1337 -0.0083 -0.0083 -0.0002 1598 ALA A N   
2136 C  CA  . ALA A 145 ? 0.1191 0.1002 0.1564 0.0011  -0.0037 -0.0116 1598 ALA A CA  
2137 C  C   . ALA A 145 ? 0.1269 0.0949 0.1702 -0.0096 -0.0117 -0.0139 1598 ALA A C   
2138 O  O   . ALA A 145 ? 0.1391 0.1070 0.1716 -0.0073 -0.0141 -0.0068 1598 ALA A O   
2139 C  CB  . ALA A 145 ? 0.1325 0.1041 0.1817 -0.0017 0.0038  -0.0279 1598 ALA A CB  
2145 N  N   . VAL A 146 ? 0.1292 0.0811 0.1611 -0.0004 -0.0020 -0.0128 1599 VAL A N   
2146 C  CA  . VAL A 146 ? 0.1324 0.0866 0.1569 0.0030  -0.0146 -0.0165 1599 VAL A CA  
2147 C  C   . VAL A 146 ? 0.1427 0.0915 0.1538 -0.0093 0.0003  0.0027  1599 VAL A C   
2148 O  O   . VAL A 146 ? 0.1476 0.0861 0.1849 -0.0005 -0.0029 0.0040  1599 VAL A O   
2149 C  CB  . VAL A 146 ? 0.1403 0.0905 0.1760 -0.0009 0.0034  -0.0124 1599 VAL A CB  
2150 C  CG1 . VAL A 146 ? 0.1574 0.0889 0.1926 0.0046  -0.0039 -0.0085 1599 VAL A CG1 
2151 C  CG2 . VAL A 146 ? 0.1475 0.0867 0.2063 -0.0014 0.0009  -0.0079 1599 VAL A CG2 
2161 N  N   . LEU A 147 ? 0.1148 0.1067 0.1645 -0.0111 0.0075  0.0096  1600 LEU A N   
2162 C  CA  . LEU A 147 ? 0.1187 0.1131 0.1639 -0.0108 -0.0118 -0.0007 1600 LEU A CA  
2163 C  C   . LEU A 147 ? 0.1223 0.1098 0.1559 -0.0055 0.0048  -0.0024 1600 LEU A C   
2164 O  O   . LEU A 147 ? 0.1198 0.1137 0.1922 0.0121  -0.0151 0.0002  1600 LEU A O   
2165 C  CB  . LEU A 147 ? 0.1672 0.1450 0.1554 -0.0026 -0.0205 -0.0034 1600 LEU A CB  
2166 C  CG  . LEU A 147 ? 0.2347 0.1717 0.2168 -0.0026 -0.0069 0.0022  1600 LEU A CG  
2167 C  CD1 . LEU A 147 ? 0.2616 0.1859 0.2067 0.0037  -0.0039 0.0129  1600 LEU A CD1 
2168 C  CD2 . LEU A 147 ? 0.3146 0.1745 0.2606 0.0246  0.0322  -0.0244 1600 LEU A CD2 
2180 N  N   . MET A 148 ? 0.1390 0.1070 0.1466 -0.0102 0.0154  0.0030  1601 MET A N   
2181 C  CA  . MET A 148 ? 0.1533 0.1084 0.1538 -0.0030 0.0021  -0.0101 1601 MET A CA  
2182 C  C   . MET A 148 ? 0.1378 0.1141 0.1338 -0.0063 0.0041  0.0013  1601 MET A C   
2183 O  O   . MET A 148 ? 0.1481 0.1155 0.1713 0.0071  -0.0092 0.0049  1601 MET A O   
2184 C  CB  . MET A 148 ? 0.1468 0.1037 0.1796 0.0040  0.0040  -0.0060 1601 MET A CB  
2185 C  CG  . MET A 148 ? 0.1307 0.1221 0.2325 -0.0074 -0.0250 -0.0201 1601 MET A CG  
2186 S  SD  . MET A 148 ? 0.2029 0.1516 0.2958 -0.0123 -0.0066 -0.0069 1601 MET A SD  
2187 C  CE  . MET A 148 ? 0.2172 0.1620 0.3260 -0.0199 -0.0340 0.0052  1601 MET A CE  
2197 N  N   . VAL A 149 ? 0.1450 0.1136 0.1387 -0.0132 0.0058  0.0077  1602 VAL A N   
2198 C  CA  . VAL A 149 ? 0.1340 0.1188 0.1723 -0.0125 0.0112  0.0095  1602 VAL A CA  
2199 C  C   . VAL A 149 ? 0.1490 0.1254 0.1983 -0.0087 -0.0006 0.0114  1602 VAL A C   
2200 O  O   . VAL A 149 ? 0.1512 0.1289 0.2034 0.0010  -0.0183 0.0114  1602 VAL A O   
2201 C  CB  . VAL A 149 ? 0.1529 0.1312 0.1720 -0.0211 -0.0048 0.0072  1602 VAL A CB  
2202 C  CG1 . VAL A 149 ? 0.1813 0.1412 0.1709 -0.0296 0.0123  0.0269  1602 VAL A CG1 
2203 C  CG2 . VAL A 149 ? 0.1692 0.1494 0.1791 -0.0199 -0.0051 0.0019  1602 VAL A CG2 
2213 N  N   . ALA A 150 ? 0.1437 0.1177 0.1745 0.0004  -0.0055 -0.0015 1603 ALA A N   
2214 C  CA  . ALA A 150 ? 0.1393 0.1155 0.1989 -0.0078 -0.0215 -0.0085 1603 ALA A CA  
2215 C  C   . ALA A 150 ? 0.1338 0.1186 0.2137 0.0077  0.0155  0.0018  1603 ALA A C   
2216 O  O   . ALA A 150 ? 0.1455 0.1143 0.2221 0.0031  -0.0022 -0.0082 1603 ALA A O   
2217 C  CB  . ALA A 150 ? 0.1304 0.1133 0.2086 -0.0016 -0.0241 -0.0111 1603 ALA A CB  
2223 N  N   . GLN A 151 ? 0.1154 0.1186 0.2167 0.0147  -0.0119 -0.0010 1604 GLN A N   
2224 C  CA  . GLN A 151 ? 0.1384 0.1276 0.2047 0.0064  -0.0197 -0.0042 1604 GLN A CA  
2225 C  C   . GLN A 151 ? 0.1396 0.1276 0.2058 -0.0015 0.0072  -0.0187 1604 GLN A C   
2226 O  O   . GLN A 151 ? 0.1463 0.1356 0.2121 0.0171  -0.0091 -0.0189 1604 GLN A O   
2227 C  CB  . GLN A 151 ? 0.1525 0.1375 0.2318 0.0066  -0.0429 0.0065  1604 GLN A CB  
2228 C  CG  . GLN A 151 ? 0.1840 0.1523 0.2688 0.0166  -0.0322 0.0339  1604 GLN A CG  
2229 C  CD  . GLN A 151 ? 0.2007 0.1833 0.3085 0.0202  -0.0158 0.0188  1604 GLN A CD  
2230 O  OE1 . GLN A 151 ? 0.2051 0.1994 0.2937 0.0237  -0.0123 0.0169  1604 GLN A OE1 
2231 N  NE2 . GLN A 151 ? 0.1913 0.1818 0.3006 0.0044  0.0168  -0.0040 1604 GLN A NE2 
2240 N  N   . LEU A 152 ? 0.1543 0.1475 0.1870 -0.0190 -0.0016 -0.0217 1605 LEU A N   
2241 C  CA  . LEU A 152 ? 0.1668 0.1635 0.1747 -0.0160 -0.0060 -0.0123 1605 LEU A CA  
2242 C  C   . LEU A 152 ? 0.2011 0.1615 0.1961 -0.0245 0.0020  -0.0245 1605 LEU A C   
2243 O  O   . LEU A 152 ? 0.2281 0.1719 0.2393 -0.0278 -0.0164 -0.0043 1605 LEU A O   
2244 C  CB  . LEU A 152 ? 0.1811 0.1656 0.1978 0.0012  -0.0033 -0.0266 1605 LEU A CB  
2245 C  CG  . LEU A 152 ? 0.1910 0.1779 0.2666 0.0145  -0.0147 -0.0247 1605 LEU A CG  
2246 C  CD1 . LEU A 152 ? 0.2115 0.1842 0.3011 0.0482  0.0029  -0.0192 1605 LEU A CD1 
2247 C  CD2 . LEU A 152 ? 0.2042 0.1774 0.3019 -0.0016 -0.0126 -0.0359 1605 LEU A CD2 
2259 N  N   . THR A 153 ? 0.2282 0.1486 0.2037 -0.0250 -0.0306 -0.0080 1606 THR A N   
2260 C  CA  . THR A 153 ? 0.2271 0.1541 0.2410 0.0090  -0.0431 0.0018  1606 THR A CA  
2261 C  C   . THR A 153 ? 0.2357 0.1656 0.2637 0.0154  -0.0396 -0.0074 1606 THR A C   
2262 O  O   . THR A 153 ? 0.2670 0.1868 0.3110 0.0224  -0.0710 0.0207  1606 THR A O   
2263 C  CB  . THR A 153 ? 0.2275 0.1529 0.2462 -0.0039 -0.0624 0.0067  1606 THR A CB  
2264 O  OG1 . THR A 153 ? 0.2247 0.1541 0.2547 -0.0091 -0.0540 0.0305  1606 THR A OG1 
2265 C  CG2 . THR A 153 ? 0.2330 0.1690 0.2785 -0.0171 -0.0363 0.0189  1606 THR A CG2 
2273 N  N   . GLN A 154 ? 0.2312 0.1654 0.2466 0.0112  -0.0688 -0.0280 1607 GLN A N   
2274 C  CA  A GLN A 154 ? 0.1997 0.1777 0.2478 0.0062  -0.0833 -0.0300 1607 GLN A CA  
2275 C  CA  B GLN A 154 ? 0.1886 0.1753 0.2585 0.0075  -0.0687 -0.0274 1607 GLN A CA  
2276 C  C   . GLN A 154 ? 0.1697 0.1709 0.2481 0.0199  -0.0726 -0.0293 1607 GLN A C   
2277 O  O   . GLN A 154 ? 0.1712 0.1923 0.3070 0.0403  -0.0717 -0.0315 1607 GLN A O   
2278 C  CB  A GLN A 154 ? 0.2254 0.2150 0.2829 0.0086  -0.0617 -0.0338 1607 GLN A CB  
2279 C  CB  B GLN A 154 ? 0.1962 0.2113 0.3171 0.0139  -0.0142 -0.0293 1607 GLN A CB  
2280 C  CG  A GLN A 154 ? 0.2498 0.2438 0.2946 0.0032  -0.0813 -0.0323 1607 GLN A CG  
2281 C  CG  B GLN A 154 ? 0.2235 0.2475 0.3518 0.0059  0.0085  -0.0387 1607 GLN A CG  
2282 C  CD  A GLN A 154 ? 0.2902 0.2801 0.3264 -0.0018 -0.0982 -0.0376 1607 GLN A CD  
2283 C  CD  B GLN A 154 ? 0.2206 0.2755 0.3642 -0.0072 0.0680  -0.0347 1607 GLN A CD  
2284 O  OE1 A GLN A 154 ? 0.3065 0.2969 0.3535 0.0039  -0.1084 -0.0303 1607 GLN A OE1 
2285 O  OE1 B GLN A 154 ? 0.2654 0.2916 0.4217 -0.0163 0.0672  -0.0294 1607 GLN A OE1 
2286 N  NE2 A GLN A 154 ? 0.3074 0.2917 0.3570 0.0000  -0.0895 -0.0447 1607 GLN A NE2 
2287 N  NE2 B GLN A 154 ? 0.1857 0.2859 0.3370 -0.0176 0.1061  -0.0298 1607 GLN A NE2 
2304 N  N   . ARG A 155 ? 0.1407 0.1501 0.1913 0.0090  -0.0408 -0.0078 1608 ARG A N   
2305 C  CA  . ARG A 155 ? 0.1389 0.1314 0.1869 -0.0081 -0.0266 -0.0107 1608 ARG A CA  
2306 C  C   . ARG A 155 ? 0.1300 0.1192 0.1795 -0.0005 -0.0082 -0.0038 1608 ARG A C   
2307 O  O   . ARG A 155 ? 0.1495 0.1239 0.1975 0.0075  -0.0181 0.0054  1608 ARG A O   
2308 C  CB  . ARG A 155 ? 0.1462 0.1318 0.1524 -0.0033 -0.0232 0.0014  1608 ARG A CB  
2309 C  CG  . ARG A 155 ? 0.1499 0.1250 0.1945 -0.0084 0.0029  0.0037  1608 ARG A CG  
2310 C  CD  . ARG A 155 ? 0.1744 0.1253 0.1907 -0.0114 -0.0229 0.0114  1608 ARG A CD  
2311 N  NE  . ARG A 155 ? 0.1699 0.1266 0.1912 -0.0089 -0.0287 0.0041  1608 ARG A NE  
2312 C  CZ  . ARG A 155 ? 0.1765 0.1283 0.1704 -0.0064 -0.0451 0.0187  1608 ARG A CZ  
2313 N  NH1 . ARG A 155 ? 0.1955 0.1298 0.1741 -0.0070 -0.0209 0.0087  1608 ARG A NH1 
2314 N  NH2 . ARG A 155 ? 0.2139 0.1296 0.1825 0.0070  -0.0343 0.0219  1608 ARG A NH2 
2328 N  N   . SER A 156 ? 0.1261 0.1282 0.1883 -0.0103 -0.0165 -0.0037 1609 SER A N   
2329 C  CA  . SER A 156 ? 0.1291 0.1192 0.1844 0.0003  -0.0165 0.0098  1609 SER A CA  
2330 C  C   . SER A 156 ? 0.1270 0.1148 0.1579 0.0024  -0.0234 0.0166  1609 SER A C   
2331 O  O   . SER A 156 ? 0.1506 0.1136 0.1903 0.0015  -0.0177 0.0138  1609 SER A O   
2332 C  CB  . SER A 156 ? 0.1489 0.1240 0.1975 0.0212  -0.0137 -0.0027 1609 SER A CB  
2333 O  OG  . SER A 156 ? 0.1699 0.1238 0.2312 0.0397  -0.0253 -0.0104 1609 SER A OG  
2339 N  N   . VAL A 157 ? 0.1419 0.1310 0.1417 -0.0152 -0.0459 0.0130  1610 VAL A N   
2340 C  CA  . VAL A 157 ? 0.1351 0.1227 0.1699 -0.0062 -0.0142 0.0051  1610 VAL A CA  
2341 C  C   . VAL A 157 ? 0.1299 0.1250 0.1787 -0.0002 0.0054  0.0064  1610 VAL A C   
2342 O  O   . VAL A 157 ? 0.1256 0.1311 0.1574 -0.0134 -0.0160 0.0022  1610 VAL A O   
2343 C  CB  . VAL A 157 ? 0.1330 0.1267 0.1884 0.0024  -0.0014 0.0010  1610 VAL A CB  
2344 C  CG1 . VAL A 157 ? 0.1472 0.1335 0.1898 0.0073  -0.0054 0.0156  1610 VAL A CG1 
2345 C  CG2 . VAL A 157 ? 0.1377 0.1328 0.1817 0.0033  0.0004  -0.0009 1610 VAL A CG2 
2355 N  N   . HIS A 158 ? 0.1288 0.1163 0.1468 -0.0054 -0.0179 0.0068  1611 HIS A N   
2356 C  CA  . HIS A 158 ? 0.1056 0.1166 0.1419 -0.0101 -0.0142 -0.0062 1611 HIS A CA  
2357 C  C   . HIS A 158 ? 0.1174 0.1185 0.1559 0.0036  0.0045  0.0040  1611 HIS A C   
2358 O  O   . HIS A 158 ? 0.1198 0.1323 0.1824 0.0045  -0.0002 0.0141  1611 HIS A O   
2359 C  CB  . HIS A 158 ? 0.1239 0.1136 0.1439 -0.0059 -0.0241 0.0106  1611 HIS A CB  
2360 C  CG  . HIS A 158 ? 0.1359 0.1042 0.1772 0.0041  -0.0226 0.0162  1611 HIS A CG  
2361 N  ND1 . HIS A 158 ? 0.1293 0.1044 0.1977 0.0000  -0.0076 0.0084  1611 HIS A ND1 
2362 C  CD2 . HIS A 158 ? 0.1379 0.1189 0.1934 -0.0014 0.0039  0.0155  1611 HIS A CD2 
2363 C  CE1 . HIS A 158 ? 0.1385 0.1164 0.2030 -0.0159 -0.0333 -0.0006 1611 HIS A CE1 
2364 N  NE2 . HIS A 158 ? 0.1428 0.1234 0.2174 -0.0038 -0.0029 0.0078  1611 HIS A NE2 
2373 N  N   . ILE A 159 ? 0.1056 0.1044 0.1600 0.0000  -0.0229 0.0120  1612 ILE A N   
2374 C  CA  . ILE A 159 ? 0.1064 0.1002 0.1537 0.0008  -0.0166 -0.0003 1612 ILE A CA  
2375 C  C   . ILE A 159 ? 0.1207 0.1074 0.1491 -0.0059 0.0074  0.0092  1612 ILE A C   
2376 O  O   . ILE A 159 ? 0.1306 0.1199 0.1736 -0.0068 -0.0240 0.0092  1612 ILE A O   
2377 C  CB  . ILE A 159 ? 0.1209 0.1051 0.1708 0.0155  -0.0283 -0.0056 1612 ILE A CB  
2378 C  CG1 . ILE A 159 ? 0.1399 0.1256 0.1896 0.0002  -0.0182 0.0020  1612 ILE A CG1 
2379 C  CG2 . ILE A 159 ? 0.1085 0.1016 0.2093 0.0012  -0.0299 -0.0101 1612 ILE A CG2 
2380 C  CD1 . ILE A 159 ? 0.1733 0.1284 0.1824 -0.0164 -0.0454 0.0046  1612 ILE A CD1 
2392 N  N   . CYS A 160 ? 0.0997 0.1083 0.1676 -0.0184 -0.0062 -0.0021 1613 CYS A N   
2393 C  CA  . CYS A 160 ? 0.1257 0.1067 0.1748 -0.0301 -0.0109 -0.0058 1613 CYS A CA  
2394 C  C   . CYS A 160 ? 0.1300 0.1018 0.1692 -0.0153 -0.0288 -0.0070 1613 CYS A C   
2395 O  O   . CYS A 160 ? 0.1454 0.1169 0.2061 -0.0102 -0.0136 -0.0093 1613 CYS A O   
2396 C  CB  . CYS A 160 ? 0.1436 0.1076 0.1946 -0.0171 -0.0155 0.0100  1613 CYS A CB  
2397 S  SG  . CYS A 160 ? 0.1557 0.1219 0.2197 -0.0148 -0.0180 0.0103  1613 CYS A SG  
2402 N  N   . HIS A 161 ? 0.1304 0.1012 0.1763 -0.0073 -0.0298 -0.0117 1614 HIS A N   
2403 C  CA  . HIS A 161 ? 0.1037 0.1030 0.1787 0.0030  -0.0262 -0.0091 1614 HIS A CA  
2404 C  C   . HIS A 161 ? 0.1137 0.1155 0.1819 0.0079  -0.0191 -0.0038 1614 HIS A C   
2405 O  O   . HIS A 161 ? 0.1312 0.1290 0.2189 0.0108  -0.0059 -0.0138 1614 HIS A O   
2406 C  CB  . HIS A 161 ? 0.1277 0.1098 0.2049 -0.0033 -0.0171 -0.0151 1614 HIS A CB  
2407 C  CG  . HIS A 161 ? 0.1238 0.1117 0.1830 -0.0084 -0.0179 -0.0107 1614 HIS A CG  
2408 N  ND1 . HIS A 161 ? 0.1135 0.1193 0.2018 -0.0100 0.0044  -0.0267 1614 HIS A ND1 
2409 C  CD2 . HIS A 161 ? 0.1126 0.1066 0.1916 -0.0099 -0.0033 -0.0183 1614 HIS A CD2 
2410 C  CE1 . HIS A 161 ? 0.1180 0.1179 0.1896 -0.0082 0.0104  -0.0247 1614 HIS A CE1 
2411 N  NE2 . HIS A 161 ? 0.1214 0.1108 0.1891 -0.0160 0.0038  -0.0204 1614 HIS A NE2 
2419 N  N   . VAL A 162 ? 0.1102 0.1089 0.1876 -0.0023 -0.0085 0.0086  1615 VAL A N   
2420 C  CA  . VAL A 162 ? 0.1202 0.1104 0.1736 -0.0054 -0.0140 -0.0036 1615 VAL A CA  
2421 C  C   . VAL A 162 ? 0.1286 0.1135 0.1775 0.0061  -0.0022 -0.0096 1615 VAL A C   
2422 O  O   . VAL A 162 ? 0.1553 0.1248 0.1797 0.0204  -0.0122 -0.0056 1615 VAL A O   
2423 C  CB  . VAL A 162 ? 0.1333 0.1179 0.1840 0.0020  0.0195  0.0040  1615 VAL A CB  
2424 C  CG1 . VAL A 162 ? 0.1470 0.1122 0.2154 -0.0073 0.0179  0.0009  1615 VAL A CG1 
2425 C  CG2 . VAL A 162 ? 0.1490 0.1215 0.1869 0.0096  0.0158  0.0007  1615 VAL A CG2 
2435 N  N   . ALA A 163 ? 0.1065 0.1213 0.1964 0.0115  -0.0058 -0.0079 1616 ALA A N   
2436 C  CA  . ALA A 163 ? 0.1065 0.1266 0.1839 0.0163  -0.0054 -0.0094 1616 ALA A CA  
2437 C  C   . ALA A 163 ? 0.1310 0.1319 0.2063 0.0163  -0.0318 0.0010  1616 ALA A C   
2438 O  O   . ALA A 163 ? 0.1738 0.1310 0.2126 -0.0019 -0.0809 -0.0070 1616 ALA A O   
2439 C  CB  . ALA A 163 ? 0.1171 0.1296 0.2247 0.0006  0.0022  -0.0148 1616 ALA A CB  
2445 N  N   . ARG A 164 ? 0.1207 0.1245 0.2122 0.0126  -0.0385 -0.0015 1617 ARG A N   
2446 C  CA  A ARG A 164 ? 0.1172 0.1257 0.2071 0.0244  -0.0203 -0.0025 1617 ARG A CA  
2447 C  CA  B ARG A 164 ? 0.1300 0.1278 0.2116 0.0171  -0.0251 -0.0027 1617 ARG A CA  
2448 C  C   . ARG A 164 ? 0.1238 0.1220 0.1998 0.0222  -0.0023 0.0005  1617 ARG A C   
2449 O  O   . ARG A 164 ? 0.1397 0.1186 0.1951 0.0127  0.0050  0.0001  1617 ARG A O   
2450 C  CB  A ARG A 164 ? 0.1246 0.1394 0.2228 0.0278  -0.0096 -0.0009 1617 ARG A CB  
2451 C  CB  B ARG A 164 ? 0.1533 0.1412 0.2364 0.0113  -0.0265 -0.0045 1617 ARG A CB  
2452 C  CG  A ARG A 164 ? 0.1494 0.1449 0.2256 0.0400  0.0046  -0.0074 1617 ARG A CG  
2453 C  CG  B ARG A 164 ? 0.1822 0.1495 0.2554 0.0075  -0.0233 -0.0099 1617 ARG A CG  
2454 C  CD  A ARG A 164 ? 0.1550 0.1470 0.2300 0.0257  0.0134  -0.0067 1617 ARG A CD  
2455 C  CD  B ARG A 164 ? 0.1900 0.1558 0.2712 -0.0096 -0.0274 -0.0095 1617 ARG A CD  
2456 N  NE  A ARG A 164 ? 0.1436 0.1455 0.2225 0.0019  -0.0209 -0.0102 1617 ARG A NE  
2457 N  NE  B ARG A 164 ? 0.1989 0.1637 0.2830 -0.0212 -0.0126 -0.0110 1617 ARG A NE  
2458 C  CZ  A ARG A 164 ? 0.1453 0.1440 0.1828 -0.0117 -0.0194 -0.0053 1617 ARG A CZ  
2459 C  CZ  B ARG A 164 ? 0.1512 0.1462 0.2551 -0.0475 -0.0057 -0.0029 1617 ARG A CZ  
2460 N  NH1 A ARG A 164 ? 0.1654 0.1489 0.2283 -0.0145 0.0010  -0.0245 1617 ARG A NH1 
2461 N  NH1 B ARG A 164 ? 0.2299 0.1690 0.3021 -0.0371 0.0146  0.0063  1617 ARG A NH1 
2462 N  NH2 A ARG A 164 ? 0.1478 0.1328 0.1329 -0.0360 -0.0077 0.0131  1617 ARG A NH2 
2463 N  NH2 B ARG A 164 ? 0.0595 0.1058 0.0917 -0.0411 -0.0005 -0.0182 1617 ARG A NH2 
2490 N  N   . LYS A 165 ? 0.1329 0.1281 0.1888 0.0166  -0.0101 0.0118  1618 LYS A N   
2491 C  CA  . LYS A 165 ? 0.1628 0.1258 0.1797 0.0141  0.0079  0.0068  1618 LYS A CA  
2492 C  C   . LYS A 165 ? 0.1722 0.1165 0.2172 0.0196  0.0096  0.0089  1618 LYS A C   
2493 O  O   . LYS A 165 ? 0.1404 0.1195 0.2159 0.0150  0.0180  0.0204  1618 LYS A O   
2494 C  CB  . LYS A 165 ? 0.1746 0.1440 0.2009 0.0112  0.0052  0.0413  1618 LYS A CB  
2495 C  CG  . LYS A 165 ? 0.2093 0.1659 0.2564 -0.0030 -0.0018 0.0922  1618 LYS A CG  
2496 C  CD  . LYS A 165 ? 0.2392 0.1935 0.3339 -0.0060 -0.0057 0.1212  1618 LYS A CD  
2497 C  CE  . LYS A 165 ? 0.3242 0.2233 0.4422 -0.0085 0.0075  0.1459  1618 LYS A CE  
2498 N  NZ  . LYS A 165 ? 0.3894 0.2455 0.4918 -0.0161 0.0175  0.1668  1618 LYS A NZ  
2512 N  N   . GLU A 166 ? 0.1709 0.1044 0.2082 0.0086  -0.0002 0.0093  1619 GLU A N   
2513 C  CA  . GLU A 166 ? 0.1701 0.1230 0.2007 0.0221  -0.0071 0.0050  1619 GLU A CA  
2514 C  C   . GLU A 166 ? 0.1521 0.1179 0.1960 0.0056  -0.0146 0.0009  1619 GLU A C   
2515 O  O   . GLU A 166 ? 0.1700 0.1153 0.2401 0.0147  -0.0124 -0.0014 1619 GLU A O   
2516 C  CB  . GLU A 166 ? 0.2410 0.1606 0.2425 0.0599  0.0067  -0.0338 1619 GLU A CB  
2517 C  CG  . GLU A 166 ? 0.2481 0.1739 0.2584 0.0460  0.0301  -0.0226 1619 GLU A CG  
2518 C  CD  . GLU A 166 ? 0.2319 0.1739 0.2669 0.0078  0.0253  -0.0110 1619 GLU A CD  
2519 O  OE1 . GLU A 166 ? 0.2687 0.1915 0.2974 -0.0083 0.0250  -0.0218 1619 GLU A OE1 
2520 O  OE2 . GLU A 166 ? 0.2351 0.1749 0.2904 -0.0114 0.0127  -0.0071 1619 GLU A OE2 
2527 N  N   . GLU A 167 ? 0.1284 0.1110 0.1900 0.0119  -0.0171 0.0011  1620 GLU A N   
2528 C  CA  . GLU A 167 ? 0.1284 0.1153 0.1556 0.0095  0.0078  0.0078  1620 GLU A CA  
2529 C  C   . GLU A 167 ? 0.1361 0.1114 0.1441 0.0016  -0.0151 -0.0014 1620 GLU A C   
2530 O  O   . GLU A 167 ? 0.1454 0.1159 0.1851 -0.0018 -0.0156 -0.0018 1620 GLU A O   
2531 C  CB  . GLU A 167 ? 0.1286 0.1308 0.1968 0.0025  0.0176  0.0079  1620 GLU A CB  
2532 C  CG  . GLU A 167 ? 0.1336 0.1399 0.1827 -0.0013 0.0076  -0.0098 1620 GLU A CG  
2533 C  CD  . GLU A 167 ? 0.1600 0.1487 0.1880 0.0004  0.0077  -0.0277 1620 GLU A CD  
2534 O  OE1 . GLU A 167 ? 0.1782 0.1433 0.2100 -0.0060 0.0119  -0.0229 1620 GLU A OE1 
2535 O  OE2 . GLU A 167 ? 0.1679 0.1659 0.1972 -0.0020 -0.0020 -0.0239 1620 GLU A OE2 
2542 N  N   . ILE A 168 ? 0.1360 0.1095 0.1591 -0.0044 0.0126  -0.0058 1621 ILE A N   
2543 C  CA  . ILE A 168 ? 0.1284 0.1113 0.1691 -0.0068 0.0106  -0.0212 1621 ILE A CA  
2544 C  C   . ILE A 168 ? 0.1291 0.0984 0.1772 -0.0013 0.0180  -0.0074 1621 ILE A C   
2545 O  O   . ILE A 168 ? 0.1312 0.1019 0.2226 0.0067  0.0129  -0.0039 1621 ILE A O   
2546 C  CB  . ILE A 168 ? 0.1303 0.1178 0.1784 0.0088  0.0143  -0.0160 1621 ILE A CB  
2547 C  CG1 . ILE A 168 ? 0.1456 0.1135 0.2004 0.0106  0.0239  -0.0071 1621 ILE A CG1 
2548 C  CG2 . ILE A 168 ? 0.1610 0.1268 0.1762 0.0137  0.0009  -0.0035 1621 ILE A CG2 
2549 C  CD1 . ILE A 168 ? 0.1705 0.1270 0.2346 0.0039  0.0351  -0.0067 1621 ILE A CD1 
2561 N  N   . LEU A 169 ? 0.1315 0.0981 0.1822 -0.0103 0.0093  0.0031  1622 LEU A N   
2562 C  CA  . LEU A 169 ? 0.1372 0.1080 0.1799 -0.0043 0.0118  0.0125  1622 LEU A CA  
2563 C  C   . LEU A 169 ? 0.1308 0.1127 0.1885 0.0028  0.0068  0.0025  1622 LEU A C   
2564 O  O   . LEU A 169 ? 0.1303 0.1262 0.2019 0.0099  0.0233  0.0006  1622 LEU A O   
2565 C  CB  . LEU A 169 ? 0.1589 0.1165 0.2119 0.0110  0.0100  0.0037  1622 LEU A CB  
2566 C  CG  . LEU A 169 ? 0.1724 0.1304 0.2239 0.0149  -0.0005 0.0123  1622 LEU A CG  
2567 C  CD1 . LEU A 169 ? 0.1915 0.1225 0.2400 0.0116  -0.0156 0.0211  1622 LEU A CD1 
2568 C  CD2 . LEU A 169 ? 0.1944 0.1484 0.2253 -0.0036 -0.0074 0.0047  1622 LEU A CD2 
2580 N  N   . LEU A 170 ? 0.1421 0.1223 0.1933 0.0019  -0.0043 -0.0150 1623 LEU A N   
2581 C  CA  . LEU A 170 ? 0.1302 0.1375 0.1828 0.0049  0.0124  -0.0032 1623 LEU A CA  
2582 C  C   . LEU A 170 ? 0.1234 0.1199 0.1759 0.0032  0.0115  -0.0238 1623 LEU A C   
2583 O  O   . LEU A 170 ? 0.1354 0.1283 0.2026 -0.0090 0.0149  -0.0257 1623 LEU A O   
2584 C  CB  . LEU A 170 ? 0.1628 0.1678 0.2171 -0.0047 0.0248  -0.0073 1623 LEU A CB  
2585 C  CG  . LEU A 170 ? 0.2423 0.2025 0.2698 -0.0014 0.0369  -0.0099 1623 LEU A CG  
2586 C  CD1 . LEU A 170 ? 0.2763 0.2189 0.3315 0.0002  0.0299  -0.0066 1623 LEU A CD1 
2587 C  CD2 . LEU A 170 ? 0.2385 0.2093 0.2297 -0.0258 0.0180  -0.0276 1623 LEU A CD2 
2599 N  N   . ILE A 171 ? 0.1153 0.1008 0.1887 0.0110  0.0056  -0.0228 1624 ILE A N   
2600 C  CA  . ILE A 171 ? 0.1235 0.1041 0.1723 -0.0015 0.0262  -0.0174 1624 ILE A CA  
2601 C  C   . ILE A 171 ? 0.1205 0.1103 0.1542 0.0047  0.0083  -0.0085 1624 ILE A C   
2602 O  O   . ILE A 171 ? 0.1257 0.1178 0.2028 -0.0006 0.0109  -0.0010 1624 ILE A O   
2603 C  CB  . ILE A 171 ? 0.1230 0.1053 0.1770 -0.0062 0.0182  -0.0081 1624 ILE A CB  
2604 C  CG1 . ILE A 171 ? 0.1414 0.1113 0.1844 -0.0065 0.0159  -0.0191 1624 ILE A CG1 
2605 C  CG2 . ILE A 171 ? 0.1199 0.1143 0.2050 -0.0105 -0.0027 0.0055  1624 ILE A CG2 
2606 C  CD1 . ILE A 171 ? 0.1623 0.1198 0.2135 -0.0217 0.0114  -0.0216 1624 ILE A CD1 
2618 N  N   . LYS A 172 ? 0.1192 0.1156 0.1908 0.0005  -0.0056 -0.0015 1625 LYS A N   
2619 C  CA  A LYS A 172 ? 0.1245 0.1150 0.1781 0.0051  0.0108  -0.0213 1625 LYS A CA  
2620 C  CA  B LYS A 172 ? 0.1262 0.1167 0.1754 0.0043  -0.0024 -0.0155 1625 LYS A CA  
2621 C  C   . LYS A 172 ? 0.1239 0.1138 0.1714 0.0061  0.0064  -0.0139 1625 LYS A C   
2622 O  O   . LYS A 172 ? 0.1422 0.1142 0.1912 -0.0010 0.0135  -0.0031 1625 LYS A O   
2623 C  CB  A LYS A 172 ? 0.1319 0.1153 0.1893 -0.0064 0.0106  -0.0252 1625 LYS A CB  
2624 C  CB  B LYS A 172 ? 0.1370 0.1200 0.1811 -0.0073 -0.0282 -0.0097 1625 LYS A CB  
2625 C  CG  A LYS A 172 ? 0.1527 0.1308 0.2191 -0.0221 0.0238  -0.0295 1625 LYS A CG  
2626 C  CG  B LYS A 172 ? 0.1599 0.1356 0.2029 -0.0174 -0.0408 -0.0057 1625 LYS A CG  
2627 C  CD  A LYS A 172 ? 0.1844 0.1561 0.2310 -0.0309 0.0308  -0.0172 1625 LYS A CD  
2628 C  CD  B LYS A 172 ? 0.2073 0.1578 0.2073 -0.0297 -0.0567 0.0092  1625 LYS A CD  
2629 C  CE  A LYS A 172 ? 0.2303 0.1678 0.2665 -0.0093 0.0216  -0.0090 1625 LYS A CE  
2630 C  CE  B LYS A 172 ? 0.2131 0.1672 0.2251 -0.0223 -0.0901 0.0300  1625 LYS A CE  
2631 N  NZ  A LYS A 172 ? 0.2367 0.1688 0.3012 -0.0057 0.0294  -0.0120 1625 LYS A NZ  
2632 N  NZ  B LYS A 172 ? 0.2108 0.1698 0.2458 -0.0182 -0.0962 0.0282  1625 LYS A NZ  
2659 N  N   . ALA A 173 ? 0.1222 0.1145 0.1815 -0.0025 0.0035  -0.0240 1626 ALA A N   
2660 C  CA  . ALA A 173 ? 0.1446 0.1111 0.1853 -0.0127 -0.0015 -0.0319 1626 ALA A CA  
2661 C  C   . ALA A 173 ? 0.1479 0.1097 0.1869 -0.0223 -0.0035 -0.0233 1626 ALA A C   
2662 O  O   . ALA A 173 ? 0.1397 0.1083 0.2177 -0.0123 0.0004  -0.0130 1626 ALA A O   
2663 C  CB  . ALA A 173 ? 0.1494 0.1123 0.1951 -0.0111 0.0036  -0.0219 1626 ALA A CB  
2669 N  N   . ALA A 174 ? 0.1397 0.1156 0.1954 -0.0064 0.0046  -0.0110 1627 ALA A N   
2670 C  CA  . ALA A 174 ? 0.1277 0.1188 0.1788 -0.0044 0.0118  -0.0022 1627 ALA A CA  
2671 C  C   . ALA A 174 ? 0.1170 0.1194 0.1819 -0.0055 0.0007  -0.0050 1627 ALA A C   
2672 O  O   . ALA A 174 ? 0.1372 0.1203 0.2025 0.0032  -0.0021 -0.0091 1627 ALA A O   
2673 C  CB  . ALA A 174 ? 0.1345 0.1187 0.1942 0.0027  0.0103  -0.0087 1627 ALA A CB  
2679 N  N   . LYS A 175 ? 0.0991 0.1213 0.2059 -0.0112 0.0058  -0.0199 1628 LYS A N   
2680 C  CA  . LYS A 175 ? 0.1182 0.1268 0.1968 -0.0069 -0.0089 -0.0129 1628 LYS A CA  
2681 C  C   . LYS A 175 ? 0.1222 0.1398 0.1906 -0.0005 -0.0047 -0.0105 1628 LYS A C   
2682 O  O   . LYS A 175 ? 0.1397 0.1498 0.2290 -0.0093 -0.0164 -0.0449 1628 LYS A O   
2683 C  CB  . LYS A 175 ? 0.1160 0.1247 0.1796 -0.0086 -0.0205 -0.0037 1628 LYS A CB  
2684 C  CG  . LYS A 175 ? 0.1171 0.1285 0.1802 -0.0086 -0.0208 -0.0096 1628 LYS A CG  
2685 C  CD  . LYS A 175 ? 0.1305 0.1352 0.1885 0.0055  0.0043  -0.0184 1628 LYS A CD  
2686 C  CE  . LYS A 175 ? 0.1372 0.1399 0.1847 -0.0065 0.0297  -0.0154 1628 LYS A CE  
2687 N  NZ  . LYS A 175 ? 0.1695 0.1504 0.1968 -0.0149 0.0193  -0.0131 1628 LYS A NZ  
2701 N  N   . ALA A 176 ? 0.1136 0.1503 0.2066 -0.0089 0.0121  -0.0170 1629 ALA A N   
2702 C  CA  . ALA A 176 ? 0.1189 0.1599 0.1999 -0.0272 0.0209  -0.0102 1629 ALA A CA  
2703 C  C   . ALA A 176 ? 0.1211 0.1767 0.2226 -0.0429 0.0179  0.0010  1629 ALA A C   
2704 O  O   . ALA A 176 ? 0.1546 0.2348 0.2538 -0.0727 0.0212  -0.0057 1629 ALA A O   
2705 C  CB  . ALA A 176 ? 0.1379 0.1652 0.2189 -0.0303 0.0161  0.0024  1629 ALA A CB  
2711 N  N   . ARG A 177 ? 0.1482 0.1595 0.2235 -0.0430 0.0119  0.0029  1630 ARG A N   
2712 C  CA  A ARG A 177 ? 0.1652 0.1677 0.2332 -0.0348 -0.0022 0.0017  1630 ARG A CA  
2713 C  CA  B ARG A 177 ? 0.1543 0.1597 0.2321 -0.0401 0.0037  0.0030  1630 ARG A CA  
2714 C  C   . ARG A 177 ? 0.1626 0.1620 0.2374 -0.0361 -0.0219 0.0015  1630 ARG A C   
2715 O  O   . ARG A 177 ? 0.2148 0.1712 0.2905 -0.0314 -0.0393 0.0063  1630 ARG A O   
2716 C  CB  A ARG A 177 ? 0.2212 0.1841 0.2666 -0.0251 -0.0209 -0.0028 1630 ARG A CB  
2717 C  CB  B ARG A 177 ? 0.2012 0.1610 0.2669 -0.0413 -0.0126 0.0002  1630 ARG A CB  
2718 C  CG  A ARG A 177 ? 0.2660 0.2017 0.3166 -0.0135 -0.0370 -0.0042 1630 ARG A CG  
2719 C  CG  B ARG A 177 ? 0.2319 0.1650 0.3206 -0.0407 -0.0317 -0.0028 1630 ARG A CG  
2720 C  CD  A ARG A 177 ? 0.2990 0.2169 0.3808 -0.0020 -0.0419 0.0013  1630 ARG A CD  
2721 C  CD  B ARG A 177 ? 0.2617 0.1674 0.3892 -0.0318 -0.0126 0.0041  1630 ARG A CD  
2722 N  NE  A ARG A 177 ? 0.3262 0.2352 0.4309 0.0020  -0.0610 -0.0027 1630 ARG A NE  
2723 N  NE  B ARG A 177 ? 0.2903 0.1747 0.4379 -0.0286 0.0109  -0.0074 1630 ARG A NE  
2724 C  CZ  A ARG A 177 ? 0.3327 0.2488 0.4619 0.0221  -0.0560 -0.0111 1630 ARG A CZ  
2725 C  CZ  B ARG A 177 ? 0.2983 0.1774 0.4663 -0.0322 0.0346  -0.0048 1630 ARG A CZ  
2726 N  NH1 A ARG A 177 ? 0.3185 0.2469 0.4717 0.0298  -0.0758 -0.0190 1630 ARG A NH1 
2727 N  NH1 B ARG A 177 ? 0.2971 0.1677 0.4526 -0.0438 0.0496  0.0003  1630 ARG A NH1 
2728 N  NH2 A ARG A 177 ? 0.3431 0.2647 0.4818 0.0172  -0.0611 -0.0151 1630 ARG A NH2 
2729 N  NH2 B ARG A 177 ? 0.3254 0.1900 0.4999 -0.0261 0.0357  -0.0128 1630 ARG A NH2 
2756 N  N   . GLY A 178 ? 0.1335 0.1504 0.2144 -0.0092 -0.0210 0.0043  1631 GLY A N   
2757 C  CA  . GLY A 178 ? 0.1530 0.1518 0.2546 0.0032  -0.0138 0.0074  1631 GLY A CA  
2758 C  C   . GLY A 178 ? 0.1543 0.1450 0.2452 0.0072  -0.0141 0.0149  1631 GLY A C   
2759 O  O   . GLY A 178 ? 0.1674 0.1613 0.2804 0.0083  0.0041  0.0289  1631 GLY A O   
2763 N  N   . LEU A 179 ? 0.1393 0.1248 0.2077 0.0021  -0.0155 0.0066  1632 LEU A N   
2764 C  CA  . LEU A 179 ? 0.1580 0.1278 0.1924 -0.0016 -0.0260 -0.0026 1632 LEU A CA  
2765 C  C   . LEU A 179 ? 0.1317 0.1269 0.1709 -0.0037 -0.0235 -0.0037 1632 LEU A C   
2766 O  O   . LEU A 179 ? 0.1368 0.1300 0.1751 -0.0099 -0.0154 -0.0006 1632 LEU A O   
2767 C  CB  . LEU A 179 ? 0.1951 0.1352 0.2040 0.0096  0.0073  -0.0041 1632 LEU A CB  
2768 C  CG  . LEU A 179 ? 0.2460 0.1500 0.2584 0.0302  -0.0334 -0.0115 1632 LEU A CG  
2769 C  CD1 . LEU A 179 ? 0.2667 0.1423 0.2744 0.0669  -0.0297 -0.0261 1632 LEU A CD1 
2770 C  CD2 . LEU A 179 ? 0.2968 0.1592 0.2996 0.0197  -0.0262 -0.0197 1632 LEU A CD2 
2782 N  N   . PRO A 180 ? 0.1257 0.1270 0.1937 -0.0052 -0.0264 -0.0080 1633 PRO A N   
2783 C  CA  . PRO A 180 ? 0.1215 0.1254 0.1752 -0.0112 -0.0112 0.0051  1633 PRO A CA  
2784 C  C   . PRO A 180 ? 0.1518 0.1344 0.1731 -0.0028 -0.0086 0.0101  1633 PRO A C   
2785 O  O   . PRO A 180 ? 0.1603 0.1561 0.1823 -0.0054 -0.0231 0.0228  1633 PRO A O   
2786 C  CB  . PRO A 180 ? 0.1394 0.1257 0.2220 -0.0212 -0.0236 0.0100  1633 PRO A CB  
2787 C  CG  . PRO A 180 ? 0.1410 0.1288 0.2165 -0.0174 -0.0360 0.0090  1633 PRO A CG  
2788 C  CD  . PRO A 180 ? 0.1458 0.1330 0.2142 -0.0072 -0.0367 0.0069  1633 PRO A CD  
2796 N  N   . VAL A 181 ? 0.1303 0.1287 0.1675 -0.0103 0.0079  0.0159  1634 VAL A N   
2797 C  CA  A VAL A 181 ? 0.1248 0.1218 0.1534 -0.0184 0.0125  0.0111  1634 VAL A CA  
2798 C  CA  B VAL A 181 ? 0.1192 0.1261 0.1693 -0.0093 -0.0017 0.0123  1634 VAL A CA  
2799 C  C   . VAL A 181 ? 0.1054 0.1252 0.1502 -0.0207 -0.0013 0.0119  1634 VAL A C   
2800 O  O   . VAL A 181 ? 0.1538 0.1393 0.1676 -0.0491 0.0128  0.0007  1634 VAL A O   
2801 C  CB  A VAL A 181 ? 0.1429 0.1251 0.1690 -0.0081 0.0060  0.0120  1634 VAL A CB  
2802 C  CB  B VAL A 181 ? 0.1241 0.1287 0.1955 0.0076  -0.0059 0.0132  1634 VAL A CB  
2803 C  CG1 A VAL A 181 ? 0.1317 0.1191 0.1991 -0.0198 -0.0146 -0.0004 1634 VAL A CG1 
2804 C  CG1 B VAL A 181 ? 0.1367 0.1284 0.2074 0.0137  -0.0103 0.0086  1634 VAL A CG1 
2805 C  CG2 A VAL A 181 ? 0.1800 0.1262 0.1892 0.0117  -0.0055 -0.0010 1634 VAL A CG2 
2806 C  CG2 B VAL A 181 ? 0.1123 0.1288 0.1990 0.0207  -0.0003 0.0160  1634 VAL A CG2 
2825 N  N   . THR A 182 ? 0.1099 0.1085 0.1567 -0.0215 -0.0194 -0.0037 1635 THR A N   
2826 C  CA  . THR A 182 ? 0.1131 0.0986 0.1772 -0.0075 -0.0266 -0.0162 1635 THR A CA  
2827 C  C   . THR A 182 ? 0.1203 0.0917 0.1690 -0.0115 0.0073  -0.0068 1635 THR A C   
2828 O  O   . THR A 182 ? 0.1253 0.0964 0.1527 -0.0114 0.0016  -0.0106 1635 THR A O   
2829 C  CB  . THR A 182 ? 0.1231 0.1066 0.1909 -0.0120 0.0029  -0.0087 1635 THR A CB  
2830 O  OG1 . THR A 182 ? 0.1348 0.1161 0.2036 -0.0079 0.0121  -0.0073 1635 THR A OG1 
2831 C  CG2 . THR A 182 ? 0.1332 0.1210 0.1980 -0.0007 0.0093  -0.0162 1635 THR A CG2 
2839 N  N   . CYS A 183 ? 0.1198 0.0995 0.1972 0.0094  -0.0014 -0.0141 1636 CYS A N   
2840 C  CA  . CYS A 183 ? 0.1168 0.1008 0.1433 -0.0015 0.0026  -0.0102 1636 CYS A CA  
2841 C  C   . CYS A 183 ? 0.1224 0.1061 0.1604 -0.0083 -0.0061 -0.0114 1636 CYS A C   
2842 O  O   . CYS A 183 ? 0.1191 0.1236 0.1616 -0.0061 0.0033  -0.0181 1636 CYS A O   
2843 C  CB  . CYS A 183 ? 0.1288 0.1038 0.1612 -0.0051 0.0135  0.0023  1636 CYS A CB  
2844 S  SG  . CYS A 183 ? 0.1803 0.1119 0.1871 -0.0017 0.0065  -0.0001 1636 CYS A SG  
2850 N  N   . GLU A 184 ? 0.0945 0.1083 0.1737 -0.0017 -0.0245 -0.0070 1637 GLU A N   
2851 C  CA  . GLU A 184 ? 0.0988 0.1085 0.1795 -0.0003 -0.0124 -0.0001 1637 GLU A CA  
2852 C  C   . GLU A 184 ? 0.1147 0.1019 0.1795 0.0044  -0.0087 -0.0140 1637 GLU A C   
2853 O  O   . GLU A 184 ? 0.1238 0.1055 0.1919 0.0020  -0.0168 -0.0201 1637 GLU A O   
2854 C  CB  . GLU A 184 ? 0.1354 0.1144 0.1968 -0.0033 -0.0003 0.0012  1637 GLU A CB  
2855 C  CG  . GLU A 184 ? 0.1560 0.1238 0.1995 -0.0015 0.0085  -0.0124 1637 GLU A CG  
2856 C  CD  . GLU A 184 ? 0.1680 0.1212 0.2117 -0.0170 0.0120  -0.0313 1637 GLU A CD  
2857 O  OE1 . GLU A 184 ? 0.1812 0.1327 0.2121 -0.0202 -0.0003 0.0027  1637 GLU A OE1 
2858 O  OE2 . GLU A 184 ? 0.1780 0.1299 0.2336 -0.0202 0.0302  -0.0177 1637 GLU A OE2 
2865 N  N   . VAL A 185 ? 0.0976 0.1129 0.1626 0.0059  -0.0100 -0.0140 1638 VAL A N   
2866 C  CA  . VAL A 185 ? 0.1038 0.1113 0.1608 0.0063  -0.0102 -0.0218 1638 VAL A CA  
2867 C  C   . VAL A 185 ? 0.1175 0.1114 0.1718 0.0079  0.0023  -0.0201 1638 VAL A C   
2868 O  O   . VAL A 185 ? 0.1129 0.1255 0.1938 0.0121  0.0067  -0.0312 1638 VAL A O   
2869 C  CB  . VAL A 185 ? 0.1291 0.1281 0.1637 0.0055  -0.0162 -0.0177 1638 VAL A CB  
2870 C  CG1 . VAL A 185 ? 0.1668 0.1371 0.1815 0.0053  0.0022  0.0012  1638 VAL A CG1 
2871 C  CG2 . VAL A 185 ? 0.1303 0.1351 0.1834 -0.0031 -0.0026 -0.0259 1638 VAL A CG2 
2881 N  N   . ALA A 186 ? 0.1114 0.1051 0.1910 -0.0029 0.0213  -0.0124 1639 ALA A N   
2882 C  CA  . ALA A 186 ? 0.1100 0.1189 0.1803 -0.0150 0.0137  -0.0035 1639 ALA A CA  
2883 C  C   . ALA A 186 ? 0.1313 0.1180 0.1991 -0.0022 0.0105  -0.0244 1639 ALA A C   
2884 O  O   . ALA A 186 ? 0.1215 0.1217 0.2193 -0.0001 -0.0052 -0.0159 1639 ALA A O   
2885 C  CB  . ALA A 186 ? 0.1299 0.1342 0.2023 -0.0089 0.0191  0.0062  1639 ALA A CB  
2891 N  N   . PRO A 187 ? 0.1512 0.1165 0.2013 0.0001  -0.0155 -0.0367 1640 PRO A N   
2892 C  CA  . PRO A 187 ? 0.1399 0.1291 0.2075 0.0144  -0.0157 -0.0413 1640 PRO A CA  
2893 C  C   . PRO A 187 ? 0.1443 0.1468 0.1858 0.0073  -0.0055 -0.0260 1640 PRO A C   
2894 O  O   . PRO A 187 ? 0.1497 0.1602 0.1719 -0.0014 -0.0177 -0.0114 1640 PRO A O   
2895 C  CB  . PRO A 187 ? 0.1765 0.1256 0.2497 0.0228  -0.0130 -0.0441 1640 PRO A CB  
2896 C  CG  . PRO A 187 ? 0.2056 0.1319 0.2762 0.0081  -0.0482 -0.0327 1640 PRO A CG  
2897 C  CD  . PRO A 187 ? 0.1857 0.1171 0.2147 0.0015  -0.0065 -0.0322 1640 PRO A CD  
2905 N  N   . HIS A 188 ? 0.1336 0.1502 0.1839 0.0107  0.0051  -0.0085 1641 HIS A N   
2906 C  CA  . HIS A 188 ? 0.1383 0.1557 0.1854 0.0021  0.0051  -0.0180 1641 HIS A CA  
2907 C  C   . HIS A 188 ? 0.1377 0.1555 0.1872 0.0017  -0.0179 -0.0095 1641 HIS A C   
2908 O  O   . HIS A 188 ? 0.1444 0.1595 0.2437 0.0117  -0.0648 -0.0130 1641 HIS A O   
2909 C  CB  . HIS A 188 ? 0.1349 0.1590 0.1942 0.0031  -0.0028 -0.0050 1641 HIS A CB  
2910 C  CG  . HIS A 188 ? 0.1297 0.1530 0.1944 -0.0061 -0.0079 0.0050  1641 HIS A CG  
2911 N  ND1 . HIS A 188 ? 0.1416 0.1601 0.2102 -0.0019 -0.0293 -0.0134 1641 HIS A ND1 
2912 C  CD2 . HIS A 188 ? 0.1330 0.1521 0.2153 0.0075  -0.0156 0.0141  1641 HIS A CD2 
2913 C  CE1 . HIS A 188 ? 0.1478 0.1553 0.2210 -0.0071 0.0010  -0.0030 1641 HIS A CE1 
2914 N  NE2 . HIS A 188 ? 0.1366 0.1469 0.2131 0.0121  0.0000  0.0023  1641 HIS A NE2 
2923 N  N   . HIS A 189 ? 0.1143 0.1450 0.1893 -0.0104 -0.0237 -0.0070 1642 HIS A N   
2924 C  CA  . HIS A 189 ? 0.1148 0.1489 0.1682 -0.0073 -0.0175 0.0065  1642 HIS A CA  
2925 C  C   . HIS A 189 ? 0.1225 0.1523 0.1694 -0.0033 -0.0162 0.0014  1642 HIS A C   
2926 O  O   . HIS A 189 ? 0.1386 0.1568 0.1858 -0.0010 -0.0036 0.0095  1642 HIS A O   
2927 C  CB  . HIS A 189 ? 0.1189 0.1447 0.1757 -0.0038 -0.0123 -0.0080 1642 HIS A CB  
2928 C  CG  . HIS A 189 ? 0.1177 0.1505 0.1799 0.0049  0.0002  -0.0012 1642 HIS A CG  
2929 N  ND1 . HIS A 189 ? 0.1180 0.1502 0.1957 0.0104  -0.0129 -0.0109 1642 HIS A ND1 
2930 C  CD2 . HIS A 189 ? 0.1134 0.1612 0.1927 0.0059  -0.0028 -0.0126 1642 HIS A CD2 
2931 C  CE1 . HIS A 189 ? 0.1224 0.1534 0.1846 -0.0021 -0.0088 -0.0113 1642 HIS A CE1 
2932 N  NE2 . HIS A 189 ? 0.1230 0.1631 0.1761 0.0044  0.0019  -0.0084 1642 HIS A NE2 
2941 N  N   . LEU A 190 ? 0.1418 0.1527 0.1612 0.0030  -0.0152 0.0021  1643 LEU A N   
2942 C  CA  . LEU A 190 ? 0.1244 0.1710 0.1605 0.0056  -0.0092 0.0018  1643 LEU A CA  
2943 C  C   . LEU A 190 ? 0.1313 0.1858 0.1707 0.0065  0.0078  -0.0003 1643 LEU A C   
2944 O  O   . LEU A 190 ? 0.1418 0.1981 0.1866 0.0084  0.0082  0.0005  1643 LEU A O   
2945 C  CB  . LEU A 190 ? 0.1213 0.1765 0.1799 0.0034  -0.0358 -0.0148 1643 LEU A CB  
2946 C  CG  . LEU A 190 ? 0.1253 0.1912 0.2133 0.0091  -0.0392 -0.0108 1643 LEU A CG  
2947 C  CD1 . LEU A 190 ? 0.1579 0.1969 0.2387 0.0309  -0.0474 0.0019  1643 LEU A CD1 
2948 C  CD2 . LEU A 190 ? 0.1272 0.2009 0.2194 -0.0105 -0.0083 -0.0033 1643 LEU A CD2 
2960 N  N   . PHE A 191 ? 0.1249 0.2018 0.1856 0.0126  -0.0085 -0.0072 1644 PHE A N   
2961 C  CA  . PHE A 191 ? 0.1272 0.2050 0.2054 0.0058  -0.0397 -0.0170 1644 PHE A CA  
2962 C  C   . PHE A 191 ? 0.1376 0.2293 0.2200 0.0099  -0.0363 -0.0295 1644 PHE A C   
2963 O  O   . PHE A 191 ? 0.1553 0.2675 0.2516 0.0151  -0.0598 -0.0484 1644 PHE A O   
2964 C  CB  . PHE A 191 ? 0.1752 0.1999 0.2029 0.0068  -0.0125 -0.0273 1644 PHE A CB  
2965 C  CG  . PHE A 191 ? 0.1637 0.1965 0.1918 -0.0026 -0.0032 -0.0374 1644 PHE A CG  
2966 C  CD1 . PHE A 191 ? 0.2035 0.2091 0.2113 0.0265  -0.0002 -0.0375 1644 PHE A CD1 
2967 C  CD2 . PHE A 191 ? 0.1458 0.1917 0.2001 0.0026  -0.0079 -0.0413 1644 PHE A CD2 
2968 C  CE1 . PHE A 191 ? 0.2033 0.2149 0.2348 0.0205  0.0235  -0.0278 1644 PHE A CE1 
2969 C  CE2 . PHE A 191 ? 0.1603 0.1956 0.2032 -0.0042 -0.0151 -0.0387 1644 PHE A CE2 
2970 C  CZ  . PHE A 191 ? 0.1693 0.2013 0.2076 0.0057  0.0065  -0.0245 1644 PHE A CZ  
2980 N  N   . LEU A 192 ? 0.1254 0.2218 0.2209 0.0154  -0.0135 -0.0187 1645 LEU A N   
2981 C  CA  . LEU A 192 ? 0.1248 0.2140 0.2209 0.0120  -0.0140 -0.0112 1645 LEU A CA  
2982 C  C   . LEU A 192 ? 0.1154 0.2075 0.2288 0.0175  -0.0297 -0.0093 1645 LEU A C   
2983 O  O   . LEU A 192 ? 0.1338 0.1936 0.2581 0.0014  -0.0389 0.0129  1645 LEU A O   
2984 C  CB  . LEU A 192 ? 0.1223 0.2117 0.2182 0.0029  -0.0104 -0.0215 1645 LEU A CB  
2985 C  CG  . LEU A 192 ? 0.1499 0.2102 0.2201 -0.0099 -0.0281 -0.0258 1645 LEU A CG  
2986 C  CD1 . LEU A 192 ? 0.1314 0.2098 0.2252 -0.0056 -0.0122 -0.0068 1645 LEU A CD1 
2987 C  CD2 . LEU A 192 ? 0.1796 0.2124 0.2391 0.0010  -0.0429 -0.0307 1645 LEU A CD2 
2999 N  N   . SER A 193 ? 0.1334 0.2103 0.2558 0.0307  -0.0322 -0.0232 1646 SER A N   
3000 C  CA  . SER A 193 ? 0.1446 0.2198 0.2547 0.0292  -0.0098 -0.0009 1646 SER A CA  
3001 C  C   . SER A 193 ? 0.1366 0.2291 0.2862 0.0177  -0.0284 0.0004  1646 SER A C   
3002 O  O   . SER A 193 ? 0.1539 0.2269 0.2988 0.0034  -0.0526 0.0022  1646 SER A O   
3003 C  CB  . SER A 193 ? 0.1732 0.2388 0.2669 0.0265  -0.0388 0.0230  1646 SER A CB  
3004 O  OG  . SER A 193 ? 0.2018 0.2581 0.2961 0.0211  -0.0440 0.0422  1646 SER A OG  
3010 N  N   . HIS A 194 ? 0.1471 0.2421 0.3385 0.0348  -0.0377 -0.0127 1647 HIS A N   
3011 C  CA  . HIS A 194 ? 0.1652 0.2555 0.3645 0.0497  -0.0542 -0.0157 1647 HIS A CA  
3012 C  C   . HIS A 194 ? 0.1765 0.2626 0.4068 0.0394  -0.0547 -0.0124 1647 HIS A C   
3013 O  O   . HIS A 194 ? 0.1546 0.2647 0.4590 0.0365  -0.0717 -0.0317 1647 HIS A O   
3014 C  CB  . HIS A 194 ? 0.1897 0.2658 0.3671 0.0599  -0.0464 -0.0248 1647 HIS A CB  
3015 C  CG  . HIS A 194 ? 0.2121 0.2807 0.3660 0.0658  -0.0173 -0.0263 1647 HIS A CG  
3016 N  ND1 . HIS A 194 ? 0.2453 0.2926 0.3772 0.0555  -0.0213 -0.0355 1647 HIS A ND1 
3017 C  CD2 . HIS A 194 ? 0.2326 0.2905 0.3836 0.0652  -0.0067 -0.0291 1647 HIS A CD2 
3018 C  CE1 . HIS A 194 ? 0.2477 0.2944 0.3915 0.0523  -0.0198 -0.0347 1647 HIS A CE1 
3019 N  NE2 . HIS A 194 ? 0.2503 0.2887 0.3923 0.0639  0.0042  -0.0388 1647 HIS A NE2 
3028 N  N   . ASP A 195 ? 0.2080 0.2822 0.3766 0.0391  -0.0865 0.0065  1648 ASP A N   
3029 C  CA  . ASP A 195 ? 0.2418 0.3186 0.4050 0.0351  -0.1138 0.0137  1648 ASP A CA  
3030 C  C   . ASP A 195 ? 0.2163 0.3218 0.3944 0.0296  -0.1205 0.0074  1648 ASP A C   
3031 O  O   . ASP A 195 ? 0.2505 0.3342 0.4413 0.0169  -0.1403 0.0077  1648 ASP A O   
3032 C  CB  . ASP A 195 ? 0.3162 0.3512 0.4385 0.0238  -0.1018 0.0382  1648 ASP A CB  
3033 C  CG  . ASP A 195 ? 0.4026 0.3796 0.5005 0.0242  -0.0499 0.0429  1648 ASP A CG  
3034 O  OD1 . ASP A 195 ? 0.4428 0.3878 0.5407 0.0239  -0.0312 0.0367  1648 ASP A OD1 
3035 O  OD2 . ASP A 195 ? 0.4453 0.3950 0.5180 0.0222  -0.0350 0.0633  1648 ASP A OD2 
3040 N  N   . ASP A 196 ? 0.1814 0.3106 0.3416 0.0314  -0.0936 -0.0061 1649 ASP A N   
3041 C  CA  . ASP A 196 ? 0.1788 0.3092 0.3330 0.0358  -0.0909 -0.0357 1649 ASP A CA  
3042 C  C   . ASP A 196 ? 0.1830 0.3045 0.3638 0.0297  -0.0645 -0.0441 1649 ASP A C   
3043 O  O   . ASP A 196 ? 0.1891 0.2898 0.3865 0.0159  -0.0797 -0.0488 1649 ASP A O   
3044 C  CB  . ASP A 196 ? 0.1916 0.3206 0.3030 0.0482  -0.1018 -0.0687 1649 ASP A CB  
3045 C  CG  . ASP A 196 ? 0.2223 0.3475 0.2979 0.0465  -0.1082 -0.0828 1649 ASP A CG  
3046 O  OD1 . ASP A 196 ? 0.2687 0.3803 0.3601 0.0385  -0.0995 -0.0912 1649 ASP A OD1 
3047 O  OD2 . ASP A 196 ? 0.2302 0.3454 0.2837 0.0651  -0.1126 -0.0632 1649 ASP A OD2 
3052 N  N   . LEU A 197 ? 0.1791 0.3098 0.3449 0.0370  -0.0422 -0.0484 1650 LEU A N   
3053 C  CA  . LEU A 197 ? 0.1860 0.3274 0.3576 0.0420  -0.0449 -0.0647 1650 LEU A CA  
3054 C  C   . LEU A 197 ? 0.2019 0.3479 0.3857 0.0352  -0.0362 -0.0519 1650 LEU A C   
3055 O  O   . LEU A 197 ? 0.2105 0.3477 0.4063 0.0286  0.0096  -0.0500 1650 LEU A O   
3056 C  CB  . LEU A 197 ? 0.1861 0.3364 0.3557 0.0363  -0.0651 -0.0732 1650 LEU A CB  
3057 C  CG  . LEU A 197 ? 0.2348 0.3414 0.3733 0.0369  -0.0623 -0.0673 1650 LEU A CG  
3058 C  CD1 . LEU A 197 ? 0.2562 0.3427 0.3937 0.0248  -0.0650 -0.0708 1650 LEU A CD1 
3059 C  CD2 . LEU A 197 ? 0.2541 0.3485 0.3905 0.0374  -0.0485 -0.0521 1650 LEU A CD2 
3071 N  N   . GLU A 198 ? 0.1946 0.3612 0.4118 0.0344  -0.0800 -0.0308 1651 GLU A N   
3072 C  CA  . GLU A 198 ? 0.2334 0.3841 0.4422 0.0217  -0.1276 -0.0167 1651 GLU A CA  
3073 C  C   . GLU A 198 ? 0.2036 0.3754 0.4634 0.0139  -0.1172 -0.0264 1651 GLU A C   
3074 O  O   . GLU A 198 ? 0.2267 0.3803 0.5352 0.0059  -0.0954 -0.0458 1651 GLU A O   
3075 C  CB  . GLU A 198 ? 0.2858 0.4110 0.4732 0.0192  -0.1691 0.0109  1651 GLU A CB  
3076 C  CG  . GLU A 198 ? 0.3501 0.4390 0.5148 0.0095  -0.1751 0.0250  1651 GLU A CG  
3077 C  CD  . GLU A 198 ? 0.4255 0.4634 0.5737 -0.0047 -0.1378 0.0368  1651 GLU A CD  
3078 O  OE1 . GLU A 198 ? 0.4717 0.4753 0.6073 -0.0058 -0.1144 0.0398  1651 GLU A OE1 
3079 O  OE2 . GLU A 198 ? 0.4603 0.4704 0.5979 -0.0055 -0.1294 0.0340  1651 GLU A OE2 
3086 N  N   . ARG A 199 ? 0.1932 0.3629 0.4254 0.0165  -0.1121 -0.0222 1652 ARG A N   
3087 C  CA  . ARG A 199 ? 0.2058 0.3554 0.3814 0.0260  -0.1049 -0.0411 1652 ARG A CA  
3088 C  C   . ARG A 199 ? 0.2037 0.3466 0.3913 0.0162  -0.0755 -0.0425 1652 ARG A C   
3089 O  O   . ARG A 199 ? 0.2025 0.3568 0.4077 0.0024  -0.0682 -0.0422 1652 ARG A O   
3090 C  CB  . ARG A 199 ? 0.2477 0.3572 0.3650 0.0169  -0.0756 -0.0590 1652 ARG A CB  
3091 C  CG  . ARG A 199 ? 0.2600 0.3609 0.3769 0.0009  -0.0635 -0.0651 1652 ARG A CG  
3092 C  CD  . ARG A 199 ? 0.2762 0.3628 0.3797 -0.0054 -0.0521 -0.0526 1652 ARG A CD  
3093 N  NE  . ARG A 199 ? 0.2850 0.3596 0.3750 -0.0090 -0.0522 -0.0375 1652 ARG A NE  
3094 C  CZ  . ARG A 199 ? 0.3002 0.3629 0.3892 -0.0236 -0.0608 -0.0281 1652 ARG A CZ  
3095 N  NH1 . ARG A 199 ? 0.2998 0.3656 0.3980 -0.0281 -0.0890 -0.0177 1652 ARG A NH1 
3096 N  NH2 . ARG A 199 ? 0.3078 0.3558 0.3894 -0.0196 -0.0642 -0.0202 1652 ARG A NH2 
3110 N  N   . LEU A 200 ? 0.2024 0.3306 0.3686 0.0318  -0.0823 -0.0356 1653 LEU A N   
3111 C  CA  . LEU A 200 ? 0.1886 0.3170 0.3521 0.0283  -0.0613 -0.0210 1653 LEU A CA  
3112 C  C   . LEU A 200 ? 0.2000 0.3157 0.3735 0.0161  -0.0416 -0.0099 1653 LEU A C   
3113 O  O   . LEU A 200 ? 0.2015 0.3122 0.4022 0.0105  -0.0257 0.0062  1653 LEU A O   
3114 C  CB  . LEU A 200 ? 0.1628 0.3073 0.3349 0.0282  -0.0514 -0.0148 1653 LEU A CB  
3115 C  CG  . LEU A 200 ? 0.1784 0.3036 0.3441 0.0163  -0.0386 -0.0278 1653 LEU A CG  
3116 C  CD1 . LEU A 200 ? 0.1831 0.3139 0.3416 0.0224  -0.0382 -0.0199 1653 LEU A CD1 
3117 C  CD2 . LEU A 200 ? 0.2114 0.3018 0.3625 0.0211  -0.0341 -0.0169 1653 LEU A CD2 
3129 N  N   . GLY A 201 ? 0.1897 0.3088 0.3634 0.0196  -0.0458 -0.0162 1654 GLY A N   
3130 C  CA  . GLY A 201 ? 0.2044 0.3102 0.3851 0.0362  -0.0390 -0.0160 1654 GLY A CA  
3131 C  C   . GLY A 201 ? 0.2040 0.3113 0.3815 0.0600  -0.0476 -0.0123 1654 GLY A C   
3132 O  O   . GLY A 201 ? 0.1876 0.3080 0.3701 0.0657  -0.0584 -0.0150 1654 GLY A O   
3136 N  N   . PRO A 202 ? 0.2147 0.3107 0.3790 0.0765  -0.0506 -0.0172 1655 PRO A N   
3137 C  CA  . PRO A 202 ? 0.2477 0.3105 0.3942 0.0693  -0.0587 -0.0142 1655 PRO A CA  
3138 C  C   . PRO A 202 ? 0.2456 0.3111 0.4106 0.0485  -0.0691 -0.0060 1655 PRO A C   
3139 O  O   . PRO A 202 ? 0.3140 0.3197 0.4475 0.0259  -0.1023 -0.0084 1655 PRO A O   
3140 C  CB  . PRO A 202 ? 0.2533 0.3163 0.3998 0.0724  -0.0329 -0.0331 1655 PRO A CB  
3141 C  CG  . PRO A 202 ? 0.2489 0.3226 0.3958 0.0865  -0.0509 -0.0314 1655 PRO A CG  
3142 C  CD  . PRO A 202 ? 0.2225 0.3218 0.3748 0.0826  -0.0323 -0.0384 1655 PRO A CD  
3150 N  N   . GLY A 203 ? 0.1940 0.3026 0.3898 0.0493  -0.0322 0.0059  1656 GLY A N   
3151 C  CA  . GLY A 203 ? 0.1684 0.2884 0.3804 0.0221  -0.0149 0.0093  1656 GLY A CA  
3152 C  C   . GLY A 203 ? 0.1619 0.2821 0.3663 0.0024  -0.0154 0.0096  1656 GLY A C   
3153 O  O   . GLY A 203 ? 0.1586 0.2731 0.3638 0.0002  -0.0287 0.0146  1656 GLY A O   
3157 N  N   . LYS A 204 ? 0.1475 0.2794 0.3579 -0.0087 -0.0302 -0.0061 1657 LYS A N   
3158 C  CA  . LYS A 204 ? 0.1570 0.2889 0.3939 -0.0024 -0.0220 -0.0192 1657 LYS A CA  
3159 C  C   . LYS A 204 ? 0.1316 0.2812 0.4202 0.0118  -0.0348 -0.0266 1657 LYS A C   
3160 O  O   . LYS A 204 ? 0.1448 0.2912 0.4662 0.0198  -0.0088 -0.0411 1657 LYS A O   
3161 C  CB  . LYS A 204 ? 0.1737 0.3078 0.3785 -0.0069 -0.0169 -0.0189 1657 LYS A CB  
3162 C  CG  . LYS A 204 ? 0.2194 0.3358 0.3845 -0.0078 -0.0572 -0.0320 1657 LYS A CG  
3163 C  CD  . LYS A 204 ? 0.2584 0.3555 0.4116 -0.0177 -0.0579 -0.0428 1657 LYS A CD  
3164 C  CE  . LYS A 204 ? 0.2517 0.3685 0.4168 -0.0118 -0.0439 -0.0331 1657 LYS A CE  
3165 N  NZ  . LYS A 204 ? 0.2148 0.3737 0.3826 -0.0124 -0.0696 -0.0351 1657 LYS A NZ  
3179 N  N   . GLY A 205 ? 0.1353 0.2665 0.3916 0.0093  -0.0475 -0.0310 1658 GLY A N   
3180 C  CA  . GLY A 205 ? 0.1414 0.2637 0.3674 0.0105  -0.0623 -0.0115 1658 GLY A CA  
3181 C  C   . GLY A 205 ? 0.1482 0.2551 0.3729 0.0108  -0.0428 0.0033  1658 GLY A C   
3182 O  O   . GLY A 205 ? 0.1624 0.2521 0.3872 -0.0031 -0.0346 0.0179  1658 GLY A O   
3186 N  N   . GLU A 206 ? 0.1623 0.2464 0.3510 0.0195  -0.0454 0.0103  1659 GLU A N   
3187 C  CA  . GLU A 206 ? 0.1756 0.2315 0.3325 0.0146  -0.0439 -0.0077 1659 GLU A CA  
3188 C  C   . GLU A 206 ? 0.1514 0.2067 0.2910 0.0127  -0.0375 -0.0063 1659 GLU A C   
3189 O  O   . GLU A 206 ? 0.1497 0.1966 0.3096 0.0010  -0.0228 -0.0097 1659 GLU A O   
3190 C  CB  . GLU A 206 ? 0.2171 0.2473 0.3896 0.0376  0.0113  -0.0213 1659 GLU A CB  
3191 C  CG  . GLU A 206 ? 0.3448 0.2785 0.4596 0.0167  -0.0070 -0.0420 1659 GLU A CG  
3192 C  CD  . GLU A 206 ? 0.4614 0.2968 0.5045 0.0142  -0.0226 -0.0628 1659 GLU A CD  
3193 O  OE1 . GLU A 206 ? 0.5076 0.3031 0.5218 0.0145  -0.0049 -0.0683 1659 GLU A OE1 
3194 O  OE2 . GLU A 206 ? 0.5328 0.3235 0.5497 0.0015  -0.0337 -0.0602 1659 GLU A OE2 
3201 N  N   . VAL A 207 ? 0.1364 0.2049 0.2823 0.0164  -0.0441 -0.0112 1660 VAL A N   
3202 C  CA  . VAL A 207 ? 0.1226 0.2072 0.2608 -0.0044 -0.0282 -0.0174 1660 VAL A CA  
3203 C  C   . VAL A 207 ? 0.1230 0.2106 0.2702 -0.0160 -0.0141 -0.0218 1660 VAL A C   
3204 O  O   . VAL A 207 ? 0.1271 0.2135 0.2699 -0.0176 -0.0037 -0.0183 1660 VAL A O   
3205 C  CB  . VAL A 207 ? 0.1483 0.2039 0.2781 0.0047  -0.0330 -0.0093 1660 VAL A CB  
3206 C  CG1 . VAL A 207 ? 0.1719 0.2005 0.2669 -0.0056 -0.0162 -0.0027 1660 VAL A CG1 
3207 C  CG2 . VAL A 207 ? 0.1505 0.2106 0.2825 0.0202  -0.0292 0.0052  1660 VAL A CG2 
3217 N  N   . ARG A 208 ? 0.1254 0.2053 0.2749 -0.0215 -0.0182 -0.0199 1661 ARG A N   
3218 C  CA  . ARG A 208 ? 0.1562 0.2038 0.2378 -0.0031 0.0112  -0.0281 1661 ARG A CA  
3219 C  C   . ARG A 208 ? 0.1446 0.1880 0.2389 -0.0019 -0.0058 -0.0205 1661 ARG A C   
3220 O  O   . ARG A 208 ? 0.1715 0.1941 0.2711 0.0025  0.0100  -0.0062 1661 ARG A O   
3221 C  CB  . ARG A 208 ? 0.1931 0.2428 0.2811 0.0116  0.0279  -0.0388 1661 ARG A CB  
3222 C  CG  . ARG A 208 ? 0.2085 0.2891 0.3296 0.0220  0.0294  -0.0440 1661 ARG A CG  
3223 C  CD  . ARG A 208 ? 0.2527 0.3349 0.3974 0.0209  0.0131  -0.0539 1661 ARG A CD  
3224 N  NE  . ARG A 208 ? 0.2933 0.3688 0.4375 0.0310  0.0070  -0.0687 1661 ARG A NE  
3225 C  CZ  . ARG A 208 ? 0.3342 0.3903 0.4625 0.0571  0.0035  -0.0683 1661 ARG A CZ  
3226 N  NH1 . ARG A 208 ? 0.3584 0.3975 0.4730 0.0809  -0.0012 -0.0695 1661 ARG A NH1 
3227 N  NH2 . ARG A 208 ? 0.3322 0.4036 0.4888 0.0454  0.0310  -0.0590 1661 ARG A NH2 
3241 N  N   . PRO A 209 ? 0.1191 0.1711 0.2270 0.0082  0.0031  0.0002  1662 PRO A N   
3242 C  CA  . PRO A 209 ? 0.1245 0.1715 0.2334 -0.0047 -0.0196 -0.0024 1662 PRO A CA  
3243 C  C   . PRO A 209 ? 0.1416 0.1805 0.2430 0.0019  -0.0053 -0.0156 1662 PRO A C   
3244 O  O   . PRO A 209 ? 0.1525 0.1841 0.2269 -0.0015 -0.0180 -0.0179 1662 PRO A O   
3245 C  CB  . PRO A 209 ? 0.1229 0.1802 0.2449 0.0011  0.0021  -0.0061 1662 PRO A CB  
3246 C  CG  . PRO A 209 ? 0.1567 0.1814 0.2182 0.0093  0.0198  -0.0040 1662 PRO A CG  
3247 C  CD  . PRO A 209 ? 0.1293 0.1810 0.2121 0.0122  -0.0007 0.0008  1662 PRO A CD  
3255 N  N   . GLU A 210 ? 0.1399 0.1732 0.2394 0.0111  -0.0135 -0.0271 1663 GLU A N   
3256 C  CA  A GLU A 210 ? 0.1428 0.1873 0.2714 0.0251  -0.0309 -0.0213 1663 GLU A CA  
3257 C  CA  B GLU A 210 ? 0.1462 0.1841 0.2651 0.0141  -0.0191 -0.0178 1663 GLU A CA  
3258 C  C   . GLU A 210 ? 0.1251 0.1912 0.2663 0.0163  -0.0320 -0.0115 1663 GLU A C   
3259 O  O   . GLU A 210 ? 0.1282 0.2031 0.2753 0.0259  -0.0290 -0.0055 1663 GLU A O   
3260 C  CB  A GLU A 210 ? 0.1873 0.2065 0.2893 0.0296  -0.0320 -0.0107 1663 GLU A CB  
3261 C  CB  B GLU A 210 ? 0.1744 0.1887 0.2938 0.0156  -0.0117 -0.0156 1663 GLU A CB  
3262 C  CG  A GLU A 210 ? 0.2840 0.2378 0.3510 0.0388  -0.0120 -0.0162 1663 GLU A CG  
3263 C  CG  B GLU A 210 ? 0.2005 0.1933 0.3224 0.0168  -0.0054 -0.0148 1663 GLU A CG  
3264 C  CD  A GLU A 210 ? 0.3695 0.2723 0.4307 0.0380  0.0204  -0.0137 1663 GLU A CD  
3265 C  CD  B GLU A 210 ? 0.2227 0.1976 0.3477 0.0177  0.0000  -0.0148 1663 GLU A CD  
3266 O  OE1 A GLU A 210 ? 0.3903 0.2926 0.4687 0.0572  0.0413  -0.0183 1663 GLU A OE1 
3267 O  OE1 B GLU A 210 ? 0.2305 0.1992 0.3571 0.0186  0.0021  -0.0149 1663 GLU A OE1 
3268 O  OE2 A GLU A 210 ? 0.4336 0.2879 0.4697 0.0280  0.0337  -0.0152 1663 GLU A OE2 
3269 O  OE2 B GLU A 210 ? 0.2321 0.1991 0.3570 0.0177  0.0021  -0.0147 1663 GLU A OE2 
3282 N  N   . LEU A 211 ? 0.1313 0.1906 0.2609 0.0066  -0.0301 -0.0276 1664 LEU A N   
3283 C  CA  . LEU A 211 ? 0.1402 0.1830 0.2316 0.0138  -0.0179 -0.0172 1664 LEU A CA  
3284 C  C   . LEU A 211 ? 0.1531 0.1779 0.2325 0.0165  -0.0121 -0.0114 1664 LEU A C   
3285 O  O   . LEU A 211 ? 0.1803 0.1743 0.2627 0.0197  -0.0026 -0.0153 1664 LEU A O   
3286 C  CB  . LEU A 211 ? 0.1553 0.1870 0.2316 0.0095  -0.0108 -0.0224 1664 LEU A CB  
3287 C  CG  . LEU A 211 ? 0.1557 0.1867 0.2264 0.0051  -0.0166 -0.0218 1664 LEU A CG  
3288 C  CD1 . LEU A 211 ? 0.1634 0.1948 0.2521 0.0027  -0.0143 -0.0227 1664 LEU A CD1 
3289 C  CD2 . LEU A 211 ? 0.1778 0.1883 0.2202 0.0132  -0.0090 -0.0205 1664 LEU A CD2 
3301 N  N   . GLY A 212 ? 0.1480 0.1750 0.2575 -0.0072 0.0034  -0.0038 1665 GLY A N   
3302 C  CA  . GLY A 212 ? 0.1668 0.1865 0.2651 -0.0077 -0.0123 0.0133  1665 GLY A CA  
3303 C  C   . GLY A 212 ? 0.1444 0.1890 0.2561 0.0198  -0.0314 0.0074  1665 GLY A C   
3304 O  O   . GLY A 212 ? 0.1545 0.1947 0.2843 0.0167  -0.0627 -0.0033 1665 GLY A O   
3308 N  N   . SER A 213 ? 0.1571 0.1910 0.2494 0.0323  -0.0163 0.0141  1666 SER A N   
3309 C  CA  . SER A 213 ? 0.1726 0.1949 0.2419 0.0456  -0.0116 0.0237  1666 SER A CA  
3310 C  C   . SER A 213 ? 0.1809 0.1965 0.2316 0.0487  -0.0296 0.0342  1666 SER A C   
3311 O  O   . SER A 213 ? 0.1698 0.1830 0.2337 0.0472  -0.0288 0.0113  1666 SER A O   
3312 C  CB  . SER A 213 ? 0.1853 0.1984 0.2915 0.0523  -0.0068 0.0109  1666 SER A CB  
3313 O  OG  . SER A 213 ? 0.1770 0.1935 0.2995 0.0443  -0.0041 0.0228  1666 SER A OG  
3319 N  N   . ARG A 214 ? 0.2066 0.2312 0.2527 0.0612  -0.0516 0.0485  1667 ARG A N   
3320 C  CA  . ARG A 214 ? 0.2265 0.2414 0.2710 0.0673  -0.0421 0.0558  1667 ARG A CA  
3321 C  C   . ARG A 214 ? 0.2210 0.2264 0.2552 0.0593  -0.0323 0.0532  1667 ARG A C   
3322 O  O   . ARG A 214 ? 0.2194 0.2263 0.2584 0.0700  -0.0269 0.0377  1667 ARG A O   
3323 C  CB  . ARG A 214 ? 0.2688 0.2696 0.3175 0.0571  -0.0450 0.0591  1667 ARG A CB  
3329 N  N   . GLN A 215 ? 0.2172 0.2183 0.2697 0.0568  -0.0156 0.0564  1668 GLN A N   
3330 C  CA  A GLN A 215 ? 0.2402 0.2146 0.2674 0.0465  -0.0260 0.0629  1668 GLN A CA  
3331 C  CA  B GLN A 215 ? 0.2340 0.2122 0.2687 0.0478  -0.0164 0.0506  1668 GLN A CA  
3332 C  C   . GLN A 215 ? 0.1994 0.1943 0.2328 0.0400  -0.0207 0.0389  1668 GLN A C   
3333 O  O   . GLN A 215 ? 0.1923 0.1818 0.2512 0.0285  -0.0043 0.0336  1668 GLN A O   
3334 C  CB  A GLN A 215 ? 0.2934 0.2337 0.3046 0.0501  -0.0187 0.0719  1668 GLN A CB  
3335 C  CB  B GLN A 215 ? 0.2783 0.2251 0.3066 0.0501  -0.0006 0.0449  1668 GLN A CB  
3336 C  CG  A GLN A 215 ? 0.3319 0.2548 0.3388 0.0667  -0.0359 0.0889  1668 GLN A CG  
3337 C  CG  B GLN A 215 ? 0.3152 0.2394 0.3433 0.0586  0.0033  0.0400  1668 GLN A CG  
3338 C  CD  A GLN A 215 ? 0.3879 0.2699 0.3544 0.0579  -0.0045 0.1104  1668 GLN A CD  
3339 C  CD  B GLN A 215 ? 0.3448 0.2517 0.3734 0.0616  0.0009  0.0280  1668 GLN A CD  
3340 O  OE1 A GLN A 215 ? 0.3762 0.2609 0.3363 0.0841  0.0457  0.1155  1668 GLN A OE1 
3341 O  OE1 B GLN A 215 ? 0.3573 0.2605 0.3960 0.0601  -0.0091 0.0048  1668 GLN A OE1 
3342 N  NE2 A GLN A 215 ? 0.4220 0.2892 0.3872 0.0374  0.0021  0.1128  1668 GLN A NE2 
3343 N  NE2 B GLN A 215 ? 0.3514 0.2491 0.3779 0.0710  0.0061  0.0385  1668 GLN A NE2 
3360 N  N   . ASP A 216 ? 0.1717 0.1770 0.2227 0.0356  -0.0243 0.0169  1669 ASP A N   
3361 C  CA  . ASP A 216 ? 0.1576 0.1584 0.1825 0.0341  -0.0141 0.0051  1669 ASP A CA  
3362 C  C   . ASP A 216 ? 0.1447 0.1462 0.1732 0.0287  -0.0441 0.0094  1669 ASP A C   
3363 O  O   . ASP A 216 ? 0.1364 0.1389 0.2020 0.0248  -0.0197 0.0201  1669 ASP A O   
3364 C  CB  . ASP A 216 ? 0.1606 0.1575 0.1790 0.0218  -0.0136 -0.0102 1669 ASP A CB  
3365 C  CG  . ASP A 216 ? 0.1596 0.1635 0.2378 0.0324  -0.0255 -0.0086 1669 ASP A CG  
3366 O  OD1 . ASP A 216 ? 0.1657 0.1602 0.2508 0.0198  -0.0349 -0.0056 1669 ASP A OD1 
3367 O  OD2 . ASP A 216 ? 0.1715 0.1776 0.2575 0.0290  -0.0377 -0.0212 1669 ASP A OD2 
3372 N  N   . VAL A 217 ? 0.1394 0.1608 0.1821 0.0247  -0.0128 0.0010  1670 VAL A N   
3373 C  CA  . VAL A 217 ? 0.1518 0.1692 0.1856 0.0196  -0.0167 0.0063  1670 VAL A CA  
3374 C  C   . VAL A 217 ? 0.1562 0.1844 0.1936 0.0287  -0.0225 0.0013  1670 VAL A C   
3375 O  O   . VAL A 217 ? 0.1419 0.1876 0.2029 0.0210  -0.0086 0.0043  1670 VAL A O   
3376 C  CB  . VAL A 217 ? 0.1610 0.1839 0.2019 0.0236  -0.0234 0.0026  1670 VAL A CB  
3377 C  CG1 . VAL A 217 ? 0.1906 0.1830 0.2291 0.0306  -0.0075 -0.0108 1670 VAL A CG1 
3378 C  CG2 . VAL A 217 ? 0.1589 0.1900 0.2083 0.0056  -0.0283 0.0174  1670 VAL A CG2 
3388 N  N   . GLU A 218 ? 0.1693 0.1970 0.1967 0.0336  -0.0271 0.0104  1671 GLU A N   
3389 C  CA  A GLU A 218 ? 0.1985 0.2010 0.2147 0.0248  -0.0162 0.0281  1671 GLU A CA  
3390 C  CA  B GLU A 218 ? 0.2018 0.2024 0.2105 0.0252  -0.0084 0.0288  1671 GLU A CA  
3391 C  C   . GLU A 218 ? 0.1811 0.1893 0.2068 0.0248  0.0023  0.0272  1671 GLU A C   
3392 O  O   . GLU A 218 ? 0.1932 0.1858 0.1977 0.0291  0.0196  0.0278  1671 GLU A O   
3393 C  CB  A GLU A 218 ? 0.2238 0.2218 0.2499 0.0395  -0.0224 0.0412  1671 GLU A CB  
3394 C  CB  B GLU A 218 ? 0.2329 0.2259 0.2366 0.0397  0.0014  0.0419  1671 GLU A CB  
3395 C  CG  A GLU A 218 ? 0.2817 0.2443 0.2851 0.0347  -0.0442 0.0524  1671 GLU A CG  
3396 C  CG  B GLU A 218 ? 0.2993 0.2524 0.2797 0.0329  0.0015  0.0544  1671 GLU A CG  
3397 C  CD  A GLU A 218 ? 0.3247 0.2710 0.3395 0.0301  -0.0632 0.0647  1671 GLU A CD  
3398 C  CD  B GLU A 218 ? 0.3547 0.2741 0.3006 0.0350  0.0129  0.0690  1671 GLU A CD  
3399 O  OE1 A GLU A 218 ? 0.3320 0.2766 0.3808 0.0298  -0.0776 0.0739  1671 GLU A OE1 
3400 O  OE1 B GLU A 218 ? 0.3983 0.2792 0.3046 0.0269  0.0039  0.0710  1671 GLU A OE1 
3401 O  OE2 A GLU A 218 ? 0.3526 0.2869 0.3465 0.0286  -0.0659 0.0689  1671 GLU A OE2 
3402 O  OE2 B GLU A 218 ? 0.3733 0.2890 0.3136 0.0353  0.0241  0.0716  1671 GLU A OE2 
3415 N  N   . ALA A 219 ? 0.1733 0.1730 0.2134 0.0161  0.0083  0.0321  1672 ALA A N   
3416 C  CA  . ALA A 219 ? 0.1717 0.1644 0.2040 0.0071  0.0094  0.0371  1672 ALA A CA  
3417 C  C   . ALA A 219 ? 0.1565 0.1580 0.1977 0.0032  0.0049  0.0234  1672 ALA A C   
3418 O  O   . ALA A 219 ? 0.1610 0.1624 0.2322 0.0104  0.0122  0.0122  1672 ALA A O   
3419 C  CB  . ALA A 219 ? 0.1756 0.1645 0.2028 -0.0053 0.0052  0.0180  1672 ALA A CB  
3425 N  N   . LEU A 220 ? 0.1369 0.1469 0.1853 -0.0043 -0.0088 0.0163  1673 LEU A N   
3426 C  CA  . LEU A 220 ? 0.1418 0.1501 0.1668 -0.0011 0.0087  0.0101  1673 LEU A CA  
3427 C  C   . LEU A 220 ? 0.1311 0.1599 0.1519 0.0017  -0.0227 0.0088  1673 LEU A C   
3428 O  O   . LEU A 220 ? 0.1479 0.1625 0.1895 0.0095  0.0084  -0.0052 1673 LEU A O   
3429 C  CB  . LEU A 220 ? 0.1433 0.1548 0.1689 -0.0035 0.0123  0.0044  1673 LEU A CB  
3430 C  CG  . LEU A 220 ? 0.1401 0.1538 0.1743 -0.0045 0.0017  -0.0021 1673 LEU A CG  
3431 C  CD1 . LEU A 220 ? 0.1330 0.1714 0.1690 -0.0092 -0.0243 -0.0017 1673 LEU A CD1 
3432 C  CD2 . LEU A 220 ? 0.1521 0.1600 0.1855 -0.0189 0.0046  -0.0090 1673 LEU A CD2 
3444 N  N   . TRP A 221 ? 0.1450 0.1666 0.1497 -0.0025 -0.0142 0.0039  1674 TRP A N   
3445 C  CA  . TRP A 221 ? 0.1591 0.1722 0.1559 0.0038  -0.0021 0.0134  1674 TRP A CA  
3446 C  C   . TRP A 221 ? 0.1450 0.1771 0.1795 0.0063  -0.0104 0.0174  1674 TRP A C   
3447 O  O   . TRP A 221 ? 0.1660 0.1780 0.1986 0.0066  0.0007  0.0098  1674 TRP A O   
3448 C  CB  . TRP A 221 ? 0.1719 0.1777 0.1666 0.0045  -0.0055 0.0182  1674 TRP A CB  
3449 C  CG  . TRP A 221 ? 0.1712 0.1751 0.1666 0.0033  -0.0090 -0.0014 1674 TRP A CG  
3450 C  CD1 . TRP A 221 ? 0.1651 0.1741 0.1911 -0.0001 -0.0080 -0.0049 1674 TRP A CD1 
3451 C  CD2 . TRP A 221 ? 0.1729 0.1768 0.1601 0.0020  -0.0074 -0.0204 1674 TRP A CD2 
3452 N  NE1 . TRP A 221 ? 0.1546 0.1720 0.1797 -0.0049 -0.0231 -0.0221 1674 TRP A NE1 
3453 C  CE2 . TRP A 221 ? 0.1858 0.1793 0.1612 0.0048  -0.0216 -0.0232 1674 TRP A CE2 
3454 C  CE3 . TRP A 221 ? 0.1970 0.1806 0.1662 0.0018  0.0045  -0.0264 1674 TRP A CE3 
3455 C  CZ2 . TRP A 221 ? 0.1876 0.1818 0.1776 -0.0081 -0.0181 -0.0171 1674 TRP A CZ2 
3456 C  CZ3 . TRP A 221 ? 0.2003 0.1875 0.1879 -0.0011 -0.0134 -0.0426 1674 TRP A CZ3 
3457 C  CH2 . TRP A 221 ? 0.1943 0.1883 0.1974 -0.0118 -0.0202 -0.0213 1674 TRP A CH2 
3468 N  N   . GLU A 222 ? 0.1421 0.1861 0.1925 0.0058  -0.0006 0.0274  1675 GLU A N   
3469 C  CA  A GLU A 222 ? 0.1746 0.1956 0.1954 -0.0020 -0.0074 0.0221  1675 GLU A CA  
3470 C  CA  B GLU A 222 ? 0.1661 0.1926 0.1979 -0.0156 0.0043  0.0215  1675 GLU A CA  
3471 C  C   . GLU A 222 ? 0.1632 0.1885 0.1888 -0.0174 0.0063  0.0241  1675 GLU A C   
3472 O  O   . GLU A 222 ? 0.1758 0.2150 0.2224 -0.0162 -0.0032 0.0500  1675 GLU A O   
3473 C  CB  A GLU A 222 ? 0.2178 0.2192 0.2542 0.0105  -0.0508 0.0322  1675 GLU A CB  
3474 C  CB  B GLU A 222 ? 0.1943 0.2086 0.2524 -0.0307 -0.0131 0.0264  1675 GLU A CB  
3475 C  CG  A GLU A 222 ? 0.2853 0.2418 0.3069 0.0180  -0.0672 0.0288  1675 GLU A CG  
3476 C  CG  B GLU A 222 ? 0.2397 0.2227 0.3005 -0.0470 -0.0125 0.0204  1675 GLU A CG  
3477 C  CD  A GLU A 222 ? 0.3413 0.2627 0.3671 0.0197  -0.0737 0.0231  1675 GLU A CD  
3478 C  CD  B GLU A 222 ? 0.2972 0.2414 0.3558 -0.0654 0.0039  0.0250  1675 GLU A CD  
3479 O  OE1 A GLU A 222 ? 0.3774 0.2648 0.3968 0.0190  -0.0494 0.0079  1675 GLU A OE1 
3480 O  OE1 B GLU A 222 ? 0.3282 0.2538 0.3625 -0.0633 0.0168  0.0290  1675 GLU A OE1 
3481 O  OE2 A GLU A 222 ? 0.3602 0.2790 0.4117 0.0238  -0.0877 0.0271  1675 GLU A OE2 
3482 O  OE2 B GLU A 222 ? 0.3202 0.2550 0.4026 -0.0703 0.0224  0.0302  1675 GLU A OE2 
3495 N  N   . ASN A 223 ? 0.1519 0.1665 0.1513 -0.0129 0.0120  0.0201  1676 ASN A N   
3496 C  CA  . ASN A 223 ? 0.1624 0.1550 0.1526 -0.0057 0.0139  0.0040  1676 ASN A CA  
3497 C  C   . ASN A 223 ? 0.1617 0.1499 0.1563 -0.0099 0.0128  0.0078  1676 ASN A C   
3498 O  O   . ASN A 223 ? 0.1588 0.1484 0.1647 0.0083  0.0099  0.0003  1676 ASN A O   
3499 C  CB  . ASN A 223 ? 0.1761 0.1476 0.1815 -0.0126 0.0119  0.0251  1676 ASN A CB  
3500 C  CG  . ASN A 223 ? 0.1877 0.1612 0.2058 -0.0201 0.0182  0.0020  1676 ASN A CG  
3501 O  OD1 . ASN A 223 ? 0.2031 0.1668 0.2521 -0.0161 -0.0019 -0.0055 1676 ASN A OD1 
3502 N  ND2 . ASN A 223 ? 0.2025 0.1742 0.2462 -0.0228 0.0185  -0.0090 1676 ASN A ND2 
3509 N  N   . MET A 224 ? 0.1695 0.1468 0.1540 0.0018  0.0130  0.0144  1677 MET A N   
3510 C  CA  . MET A 224 ? 0.1810 0.1336 0.1587 -0.0042 -0.0082 0.0033  1677 MET A CA  
3511 C  C   . MET A 224 ? 0.1765 0.1349 0.1702 -0.0130 0.0024  -0.0180 1677 MET A C   
3512 O  O   . MET A 224 ? 0.1678 0.1274 0.1675 -0.0020 0.0065  -0.0076 1677 MET A O   
3513 C  CB  . MET A 224 ? 0.2120 0.1341 0.2057 -0.0169 -0.0097 -0.0109 1677 MET A CB  
3514 C  CG  . MET A 224 ? 0.2201 0.1416 0.2262 -0.0228 -0.0243 -0.0110 1677 MET A CG  
3515 S  SD  . MET A 224 ? 0.2155 0.1553 0.2650 -0.0157 -0.0465 0.0012  1677 MET A SD  
3516 C  CE  . MET A 224 ? 0.2290 0.1627 0.2894 -0.0216 -0.0610 0.0235  1677 MET A CE  
3526 N  N   . ALA A 225 ? 0.1533 0.1419 0.1874 -0.0042 0.0226  -0.0068 1678 ALA A N   
3527 C  CA  . ALA A 225 ? 0.1492 0.1468 0.1977 -0.0020 0.0296  -0.0034 1678 ALA A CA  
3528 C  C   . ALA A 225 ? 0.1385 0.1467 0.1926 0.0039  0.0139  0.0077  1678 ALA A C   
3529 O  O   . ALA A 225 ? 0.1500 0.1749 0.2333 0.0265  0.0256  0.0104  1678 ALA A O   
3530 C  CB  . ALA A 225 ? 0.1743 0.1664 0.2171 -0.0084 0.0559  0.0116  1678 ALA A CB  
3536 N  N   . VAL A 226 ? 0.1336 0.1244 0.1693 -0.0023 0.0046  0.0041  1679 VAL A N   
3537 C  CA  . VAL A 226 ? 0.1128 0.1190 0.1536 0.0121  0.0051  0.0164  1679 VAL A CA  
3538 C  C   . VAL A 226 ? 0.1262 0.1087 0.1398 0.0099  -0.0131 -0.0026 1679 VAL A C   
3539 O  O   . VAL A 226 ? 0.1624 0.1265 0.1665 -0.0089 -0.0146 -0.0004 1679 VAL A O   
3540 C  CB  . VAL A 226 ? 0.1502 0.1299 0.1666 -0.0011 0.0064  0.0145  1679 VAL A CB  
3541 C  CG1 . VAL A 226 ? 0.1609 0.1457 0.1935 -0.0012 -0.0015 -0.0092 1679 VAL A CG1 
3542 C  CG2 . VAL A 226 ? 0.1943 0.1236 0.2044 -0.0172 0.0276  0.0092  1679 VAL A CG2 
3552 N  N   . ILE A 227 ? 0.1310 0.1003 0.1388 -0.0010 0.0115  -0.0041 1680 ILE A N   
3553 C  CA  . ILE A 227 ? 0.1337 0.0951 0.1504 0.0083  0.0088  -0.0078 1680 ILE A CA  
3554 C  C   . ILE A 227 ? 0.1251 0.0980 0.1532 0.0127  0.0111  -0.0001 1680 ILE A C   
3555 O  O   . ILE A 227 ? 0.1663 0.1116 0.1963 0.0240  0.0300  -0.0037 1680 ILE A O   
3556 C  CB  . ILE A 227 ? 0.1336 0.0952 0.1827 -0.0019 -0.0007 0.0125  1680 ILE A CB  
3557 C  CG1 . ILE A 227 ? 0.1358 0.1086 0.1897 0.0022  -0.0102 0.0213  1680 ILE A CG1 
3558 C  CG2 . ILE A 227 ? 0.1498 0.1078 0.1901 -0.0192 -0.0057 -0.0012 1680 ILE A CG2 
3559 C  CD1 . ILE A 227 ? 0.1505 0.1254 0.2048 0.0050  -0.0066 0.0498  1680 ILE A CD1 
3571 N  N   . ASP A 228 ? 0.1166 0.0951 0.1512 0.0075  0.0096  0.0002  1681 ASP A N   
3572 C  CA  . ASP A 228 ? 0.1199 0.0949 0.1606 0.0023  -0.0009 -0.0132 1681 ASP A CA  
3573 C  C   . ASP A 228 ? 0.0949 0.0983 0.1766 -0.0012 -0.0177 -0.0109 1681 ASP A C   
3574 O  O   . ASP A 228 ? 0.1198 0.1118 0.1992 0.0129  -0.0091 -0.0197 1681 ASP A O   
3575 C  CB  . ASP A 228 ? 0.1230 0.1033 0.1803 0.0085  -0.0100 -0.0223 1681 ASP A CB  
3576 C  CG  . ASP A 228 ? 0.1303 0.1191 0.1671 0.0006  0.0101  -0.0282 1681 ASP A CG  
3577 O  OD1 . ASP A 228 ? 0.1495 0.1357 0.2660 -0.0070 0.0238  -0.0287 1681 ASP A OD1 
3578 O  OD2 . ASP A 228 ? 0.1449 0.1325 0.1710 -0.0079 0.0143  -0.0259 1681 ASP A OD2 
3583 N  N   . CYS A 229 ? 0.0919 0.1014 0.1902 -0.0105 -0.0103 -0.0142 1682 CYS A N   
3584 C  CA  . CYS A 229 ? 0.1009 0.1043 0.1857 -0.0164 0.0088  -0.0080 1682 CYS A CA  
3585 C  C   . CYS A 229 ? 0.0919 0.1017 0.1838 -0.0036 0.0087  -0.0086 1682 CYS A C   
3586 O  O   . CYS A 229 ? 0.1009 0.1128 0.2127 0.0142  0.0003  -0.0136 1682 CYS A O   
3587 C  CB  . CYS A 229 ? 0.1117 0.1228 0.2269 -0.0008 -0.0322 -0.0010 1682 CYS A CB  
3588 S  SG  . CYS A 229 ? 0.1699 0.1403 0.2423 0.0057  -0.0088 -0.0003 1682 CYS A SG  
3594 N  N   . PHE A 230 ? 0.0935 0.1015 0.1955 0.0037  0.0084  -0.0212 1683 PHE A N   
3595 C  CA  . PHE A 230 ? 0.1081 0.1088 0.1800 -0.0091 0.0177  -0.0120 1683 PHE A CA  
3596 C  C   . PHE A 230 ? 0.1210 0.1184 0.2054 -0.0083 0.0180  -0.0064 1683 PHE A C   
3597 O  O   . PHE A 230 ? 0.1420 0.1281 0.2518 0.0023  0.0299  0.0205  1683 PHE A O   
3598 C  CB  . PHE A 230 ? 0.1167 0.1199 0.1751 0.0074  0.0056  -0.0113 1683 PHE A CB  
3599 C  CG  . PHE A 230 ? 0.1244 0.1235 0.1895 0.0016  -0.0106 -0.0051 1683 PHE A CG  
3600 C  CD1 . PHE A 230 ? 0.1259 0.1207 0.1979 -0.0141 -0.0051 -0.0019 1683 PHE A CD1 
3601 C  CD2 . PHE A 230 ? 0.1156 0.1316 0.1870 -0.0075 -0.0018 -0.0042 1683 PHE A CD2 
3602 C  CE1 . PHE A 230 ? 0.1338 0.1398 0.1989 -0.0014 -0.0060 0.0097  1683 PHE A CE1 
3603 C  CE2 . PHE A 230 ? 0.1236 0.1420 0.1734 -0.0158 0.0022  -0.0022 1683 PHE A CE2 
3604 C  CZ  . PHE A 230 ? 0.1300 0.1400 0.1820 -0.0095 0.0069  0.0113  1683 PHE A CZ  
3614 N  N   . ALA A 231 ? 0.1254 0.1152 0.1856 -0.0124 0.0252  -0.0080 1684 ALA A N   
3615 C  CA  . ALA A 231 ? 0.1156 0.1173 0.1879 -0.0095 -0.0070 0.0007  1684 ALA A CA  
3616 C  C   . ALA A 231 ? 0.1098 0.1157 0.2311 -0.0140 -0.0007 -0.0057 1684 ALA A C   
3617 O  O   . ALA A 231 ? 0.1127 0.1139 0.2816 -0.0109 0.0039  0.0105  1684 ALA A O   
3618 C  CB  . ALA A 231 ? 0.1747 0.1334 0.2184 0.0132  -0.0087 -0.0055 1684 ALA A CB  
3624 N  N   . SER A 232 ? 0.1089 0.1227 0.2296 -0.0159 -0.0075 0.0029  1685 SER A N   
3625 C  CA  . SER A 232 ? 0.1125 0.1345 0.2274 -0.0210 -0.0228 0.0048  1685 SER A CA  
3626 C  C   . SER A 232 ? 0.1159 0.1243 0.2164 -0.0093 -0.0035 -0.0089 1685 SER A C   
3627 O  O   . SER A 232 ? 0.1169 0.1340 0.2249 -0.0092 -0.0064 -0.0062 1685 SER A O   
3628 C  CB  . SER A 232 ? 0.1269 0.1425 0.2674 -0.0291 -0.0169 0.0006  1685 SER A CB  
3629 O  OG  . SER A 232 ? 0.1653 0.1424 0.2952 -0.0340 -0.0014 -0.0068 1685 SER A OG  
3635 N  N   . ASP A 233 ? 0.1080 0.1271 0.2377 -0.0142 -0.0082 -0.0122 1686 ASP A N   
3636 C  CA  . ASP A 233 ? 0.1051 0.1141 0.2126 -0.0119 0.0151  -0.0272 1686 ASP A CA  
3637 C  C   . ASP A 233 ? 0.1030 0.1177 0.1932 -0.0043 0.0181  -0.0153 1686 ASP A C   
3638 O  O   . ASP A 233 ? 0.1043 0.1194 0.2183 -0.0011 0.0071  -0.0304 1686 ASP A O   
3639 C  CB  . ASP A 233 ? 0.1192 0.1153 0.2404 -0.0165 -0.0094 -0.0319 1686 ASP A CB  
3640 C  CG  . ASP A 233 ? 0.1255 0.1282 0.2394 -0.0082 -0.0029 -0.0236 1686 ASP A CG  
3641 O  OD1 . ASP A 233 ? 0.1331 0.1294 0.2056 -0.0033 0.0127  -0.0185 1686 ASP A OD1 
3642 O  OD2 . ASP A 233 ? 0.1591 0.1467 0.2241 0.0100  0.0237  -0.0271 1686 ASP A OD2 
3647 N  N   . HIS A 234 ? 0.1028 0.1177 0.2277 -0.0177 0.0101  -0.0074 1687 HIS A N   
3648 C  CA  . HIS A 234 ? 0.1021 0.1254 0.2064 -0.0150 0.0167  -0.0140 1687 HIS A CA  
3649 C  C   . HIS A 234 ? 0.1109 0.1354 0.1932 -0.0101 0.0090  -0.0089 1687 HIS A C   
3650 O  O   . HIS A 234 ? 0.1262 0.1408 0.2110 -0.0100 0.0025  -0.0148 1687 HIS A O   
3651 C  CB  . HIS A 234 ? 0.1195 0.1242 0.1968 -0.0184 -0.0073 -0.0232 1687 HIS A CB  
3652 C  CG  . HIS A 234 ? 0.1221 0.1391 0.2039 -0.0214 -0.0138 -0.0323 1687 HIS A CG  
3653 N  ND1 . HIS A 234 ? 0.1310 0.1488 0.2297 -0.0226 0.0017  -0.0066 1687 HIS A ND1 
3654 C  CD2 . HIS A 234 ? 0.1293 0.1341 0.2117 -0.0223 0.0060  -0.0246 1687 HIS A CD2 
3655 C  CE1 . HIS A 234 ? 0.1409 0.1485 0.2334 -0.0338 0.0006  -0.0153 1687 HIS A CE1 
3656 N  NE2 . HIS A 234 ? 0.1255 0.1532 0.2317 -0.0172 0.0010  -0.0125 1687 HIS A NE2 
3665 N  N   . ALA A 235 ? 0.1071 0.1449 0.1924 -0.0121 0.0026  0.0029  1688 ALA A N   
3666 C  CA  . ALA A 235 ? 0.1189 0.1471 0.2108 -0.0127 0.0150  -0.0057 1688 ALA A CA  
3667 C  C   . ALA A 235 ? 0.1392 0.1464 0.2273 -0.0031 0.0087  -0.0110 1688 ALA A C   
3668 O  O   . ALA A 235 ? 0.1649 0.1490 0.2690 -0.0077 0.0237  0.0106  1688 ALA A O   
3669 C  CB  . ALA A 235 ? 0.1532 0.1577 0.2219 -0.0158 0.0178  -0.0063 1688 ALA A CB  
3675 N  N   . PRO A 236 ? 0.1221 0.1566 0.2498 0.0001  0.0121  -0.0149 1689 PRO A N   
3676 C  CA  . PRO A 236 ? 0.1084 0.1709 0.2517 0.0025  0.0005  -0.0059 1689 PRO A CA  
3677 C  C   . PRO A 236 ? 0.1372 0.1810 0.2291 -0.0041 -0.0007 -0.0144 1689 PRO A C   
3678 O  O   . PRO A 236 ? 0.1429 0.1839 0.2234 -0.0012 0.0004  -0.0196 1689 PRO A O   
3679 C  CB  . PRO A 236 ? 0.1193 0.1620 0.2820 -0.0106 0.0127  -0.0200 1689 PRO A CB  
3680 C  CG  . PRO A 236 ? 0.1272 0.1469 0.2965 -0.0163 0.0021  -0.0250 1689 PRO A CG  
3681 C  CD  . PRO A 236 ? 0.1473 0.1420 0.2789 -0.0017 -0.0113 -0.0228 1689 PRO A CD  
3689 N  N   . HIS A 237 ? 0.1129 0.1876 0.2367 -0.0156 -0.0025 -0.0060 1690 HIS A N   
3690 C  CA  . HIS A 237 ? 0.1060 0.1990 0.2446 -0.0082 -0.0049 -0.0257 1690 HIS A CA  
3691 C  C   . HIS A 237 ? 0.1143 0.2173 0.2406 -0.0058 -0.0020 -0.0194 1690 HIS A C   
3692 O  O   . HIS A 237 ? 0.1321 0.2250 0.2476 -0.0072 -0.0065 -0.0232 1690 HIS A O   
3693 C  CB  . HIS A 237 ? 0.1248 0.1982 0.2496 -0.0038 -0.0277 -0.0254 1690 HIS A CB  
3694 C  CG  . HIS A 237 ? 0.1449 0.2020 0.2364 -0.0023 -0.0319 -0.0223 1690 HIS A CG  
3695 N  ND1 . HIS A 237 ? 0.1509 0.2053 0.2611 -0.0143 -0.0091 -0.0307 1690 HIS A ND1 
3696 C  CD2 . HIS A 237 ? 0.1414 0.1925 0.2488 -0.0070 0.0017  -0.0182 1690 HIS A CD2 
3697 C  CE1 . HIS A 237 ? 0.1702 0.2027 0.2514 -0.0105 -0.0029 -0.0264 1690 HIS A CE1 
3698 N  NE2 . HIS A 237 ? 0.1668 0.1953 0.2562 -0.0070 0.0175  -0.0109 1690 HIS A NE2 
3707 N  N   . THR A 238 ? 0.1126 0.2323 0.2427 -0.0155 -0.0014 -0.0049 1691 THR A N   
3708 C  CA  . THR A 238 ? 0.1168 0.2486 0.2809 -0.0208 -0.0129 -0.0032 1691 THR A CA  
3709 C  C   . THR A 238 ? 0.1246 0.2520 0.2705 -0.0202 -0.0312 -0.0118 1691 THR A C   
3710 O  O   . THR A 238 ? 0.1172 0.2531 0.2780 -0.0213 -0.0319 -0.0144 1691 THR A O   
3711 C  CB  . THR A 238 ? 0.1352 0.2613 0.3272 -0.0280 -0.0183 0.0093  1691 THR A CB  
3712 O  OG1 . THR A 238 ? 0.1312 0.2763 0.3315 -0.0148 -0.0089 0.0112  1691 THR A OG1 
3713 C  CG2 . THR A 238 ? 0.1621 0.2691 0.3402 -0.0329 -0.0270 0.0191  1691 THR A CG2 
3721 N  N   . LEU A 239 ? 0.1487 0.2572 0.2565 -0.0164 -0.0345 -0.0054 1692 LEU A N   
3722 C  CA  . LEU A 239 ? 0.1604 0.2661 0.2505 -0.0188 -0.0501 0.0033  1692 LEU A CA  
3723 C  C   . LEU A 239 ? 0.1393 0.2648 0.2716 -0.0257 -0.0301 0.0039  1692 LEU A C   
3724 O  O   . LEU A 239 ? 0.1466 0.2507 0.3033 -0.0305 -0.0325 -0.0097 1692 LEU A O   
3725 C  CB  . LEU A 239 ? 0.1869 0.2822 0.2446 -0.0271 -0.0355 -0.0053 1692 LEU A CB  
3726 C  CG  . LEU A 239 ? 0.2213 0.2956 0.2681 -0.0368 -0.0462 0.0018  1692 LEU A CG  
3727 C  CD1 . LEU A 239 ? 0.2329 0.2993 0.2851 -0.0408 -0.0423 0.0133  1692 LEU A CD1 
3728 C  CD2 . LEU A 239 ? 0.2469 0.3045 0.2793 -0.0267 -0.0419 -0.0144 1692 LEU A CD2 
3740 N  N   . GLU A 240 ? 0.1301 0.2755 0.2768 -0.0227 -0.0150 0.0020  1693 GLU A N   
3741 C  CA  . GLU A 240 ? 0.1489 0.2983 0.3021 -0.0191 0.0010  -0.0053 1693 GLU A CA  
3742 C  C   . GLU A 240 ? 0.1391 0.2884 0.2803 -0.0068 0.0017  -0.0137 1693 GLU A C   
3743 O  O   . GLU A 240 ? 0.1571 0.2938 0.3018 0.0020  -0.0054 -0.0113 1693 GLU A O   
3744 C  CB  . GLU A 240 ? 0.1850 0.3279 0.3553 -0.0269 0.0527  -0.0112 1693 GLU A CB  
3745 C  CG  . GLU A 240 ? 0.2505 0.3613 0.4379 -0.0212 0.0370  -0.0210 1693 GLU A CG  
3746 C  CD  . GLU A 240 ? 0.3275 0.3935 0.5339 -0.0058 0.0335  -0.0187 1693 GLU A CD  
3747 O  OE1 . GLU A 240 ? 0.3317 0.4061 0.5675 -0.0174 0.0139  -0.0175 1693 GLU A OE1 
3748 O  OE2 . GLU A 240 ? 0.3757 0.4104 0.5767 -0.0068 0.0434  -0.0132 1693 GLU A OE2 
3755 N  N   . GLU A 241 ? 0.1219 0.2768 0.2736 -0.0241 -0.0164 -0.0213 1694 GLU A N   
3756 C  CA  . GLU A 241 ? 0.1208 0.2784 0.2581 -0.0011 0.0120  -0.0092 1694 GLU A CA  
3757 C  C   . GLU A 241 ? 0.1298 0.2705 0.2388 0.0205  -0.0051 -0.0093 1694 GLU A C   
3758 O  O   . GLU A 241 ? 0.1487 0.2759 0.2619 0.0238  -0.0022 -0.0106 1694 GLU A O   
3759 C  CB  . GLU A 241 ? 0.1354 0.2812 0.2466 0.0037  0.0154  0.0031  1694 GLU A CB  
3760 C  CG  . GLU A 241 ? 0.1518 0.2908 0.2780 0.0164  0.0107  0.0116  1694 GLU A CG  
3761 C  CD  . GLU A 241 ? 0.1753 0.2996 0.2813 0.0175  0.0011  0.0127  1694 GLU A CD  
3762 O  OE1 . GLU A 241 ? 0.1750 0.3041 0.2761 0.0188  0.0012  0.0064  1694 GLU A OE1 
3763 O  OE2 . GLU A 241 ? 0.1934 0.3078 0.3026 0.0163  0.0016  0.0111  1694 GLU A OE2 
3770 N  N   . LYS A 242 ? 0.1224 0.2605 0.2411 0.0059  -0.0043 -0.0088 1695 LYS A N   
3771 C  CA  . LYS A 242 ? 0.1182 0.2487 0.2415 -0.0013 -0.0039 -0.0112 1695 LYS A CA  
3772 C  C   . LYS A 242 ? 0.1378 0.2615 0.2651 0.0033  -0.0152 -0.0168 1695 LYS A C   
3773 O  O   . LYS A 242 ? 0.1456 0.2580 0.2989 -0.0039 -0.0081 -0.0147 1695 LYS A O   
3774 C  CB  . LYS A 242 ? 0.1303 0.2364 0.2438 0.0005  0.0175  -0.0123 1695 LYS A CB  
3775 C  CG  . LYS A 242 ? 0.1217 0.2226 0.2399 -0.0057 -0.0069 -0.0094 1695 LYS A CG  
3776 C  CD  . LYS A 242 ? 0.1339 0.2150 0.2512 -0.0033 -0.0323 -0.0011 1695 LYS A CD  
3777 C  CE  . LYS A 242 ? 0.1385 0.2089 0.2215 0.0142  -0.0101 -0.0118 1695 LYS A CE  
3778 N  NZ  . LYS A 242 ? 0.1386 0.2000 0.2219 0.0146  -0.0051 -0.0165 1695 LYS A NZ  
3792 N  N   . CYS A 243 ? 0.1205 0.2803 0.3020 0.0073  -0.0372 -0.0135 1696 CYS A N   
3793 C  CA  A CYS A 243 ? 0.1450 0.2971 0.3096 0.0232  -0.0106 -0.0094 1696 CYS A CA  
3794 C  CA  B CYS A 243 ? 0.1274 0.2808 0.2859 0.0098  -0.0392 -0.0148 1696 CYS A CA  
3795 C  C   . CYS A 243 ? 0.1514 0.3112 0.3080 0.0297  -0.0337 -0.0158 1696 CYS A C   
3796 O  O   . CYS A 243 ? 0.1841 0.3223 0.3756 0.0667  -0.0158 -0.0253 1696 CYS A O   
3797 C  CB  A CYS A 243 ? 0.2115 0.3166 0.3400 0.0224  0.0359  -0.0027 1696 CYS A CB  
3798 C  CB  B CYS A 243 ? 0.1315 0.2546 0.2621 -0.0121 -0.0414 -0.0165 1696 CYS A CB  
3799 S  SG  A CYS A 243 ? 0.3374 0.3421 0.3933 0.0135  0.0484  -0.0101 1696 CYS A SG  
3800 S  SG  B CYS A 243 ? 0.1309 0.2211 0.2205 -0.0446 -0.0613 -0.0261 1696 CYS A SG  
3811 N  N   . GLY A 244 ? 0.1542 0.3416 0.2889 0.0238  0.0061  -0.0160 1697 GLY A N   
3812 C  CA  . GLY A 244 ? 0.2036 0.3712 0.2988 0.0370  -0.0077 -0.0221 1697 GLY A CA  
3813 C  C   . GLY A 244 ? 0.2457 0.3999 0.3369 0.0449  -0.0029 -0.0236 1697 GLY A C   
3814 O  O   . GLY A 244 ? 0.3326 0.3966 0.3417 0.0512  0.0161  -0.0206 1697 GLY A O   
3818 N  N   . SER A 245 ? 0.2381 0.4295 0.3787 0.0565  -0.0217 -0.0263 1698 SER A N   
3819 C  CA  . SER A 245 ? 0.3055 0.4554 0.4204 0.0519  0.0117  -0.0327 1698 SER A CA  
3820 C  C   . SER A 245 ? 0.3408 0.4615 0.4429 0.0534  0.0158  -0.0412 1698 SER A C   
3821 O  O   . SER A 245 ? 0.3984 0.4707 0.4902 0.0402  0.0002  -0.0474 1698 SER A O   
3822 C  CB  . SER A 245 ? 0.3175 0.4729 0.4384 0.0547  0.0467  -0.0300 1698 SER A CB  
3823 O  OG  . SER A 245 ? 0.3555 0.4896 0.4639 0.0345  0.0711  -0.0363 1698 SER A OG  
3829 N  N   . ARG A 246 ? 0.2777 0.4618 0.3930 0.0595  0.0428  -0.0400 1699 ARG A N   
3830 C  CA  . ARG A 246 ? 0.3268 0.4537 0.4084 0.0581  0.0646  -0.0310 1699 ARG A CA  
3831 C  C   . ARG A 246 ? 0.2748 0.4157 0.3665 0.0649  0.0576  -0.0148 1699 ARG A C   
3832 O  O   . ARG A 246 ? 0.2591 0.4260 0.3846 0.0583  0.0225  0.0091  1699 ARG A O   
3833 C  CB  . ARG A 246 ? 0.3973 0.4706 0.4775 0.0572  0.0659  -0.0279 1699 ARG A CB  
3834 C  CG  . ARG A 246 ? 0.4751 0.4839 0.5662 0.0526  0.0623  -0.0196 1699 ARG A CG  
3835 C  CD  . ARG A 246 ? 0.5417 0.4934 0.6327 0.0540  0.0691  -0.0155 1699 ARG A CD  
3836 N  NE  . ARG A 246 ? 0.5971 0.5057 0.6886 0.0559  0.0691  -0.0113 1699 ARG A NE  
3837 C  CZ  . ARG A 246 ? 0.6314 0.5124 0.7216 0.0523  0.0675  -0.0057 1699 ARG A CZ  
3838 N  NH1 . ARG A 246 ? 0.6500 0.5162 0.7346 0.0478  0.0640  0.0000  1699 ARG A NH1 
3839 N  NH2 . ARG A 246 ? 0.6404 0.5166 0.7262 0.0472  0.0723  -0.0040 1699 ARG A NH2 
3853 N  N   . PRO A 247 ? 0.2701 0.3670 0.3160 0.0536  0.0286  -0.0273 1700 PRO A N   
3854 C  CA  . PRO A 247 ? 0.1961 0.3248 0.3008 0.0361  0.0274  -0.0468 1700 PRO A CA  
3855 C  C   . PRO A 247 ? 0.1813 0.2844 0.3143 0.0148  -0.0188 -0.0505 1700 PRO A C   
3856 O  O   . PRO A 247 ? 0.2181 0.2839 0.3383 -0.0010 -0.0171 -0.0566 1700 PRO A O   
3857 C  CB  . PRO A 247 ? 0.2200 0.3383 0.3069 0.0458  0.0381  -0.0445 1700 PRO A CB  
3858 C  CG  . PRO A 247 ? 0.3219 0.3525 0.3409 0.0546  0.0566  -0.0362 1700 PRO A CG  
3859 C  CD  . PRO A 247 ? 0.3148 0.3587 0.3086 0.0616  0.0567  -0.0415 1700 PRO A CD  
3867 N  N   . PRO A 248 ? 0.1507 0.2520 0.2779 0.0123  -0.0145 -0.0397 1701 PRO A N   
3868 C  CA  . PRO A 248 ? 0.1585 0.2396 0.2728 0.0043  -0.0064 -0.0343 1701 PRO A CA  
3869 C  C   . PRO A 248 ? 0.1529 0.2319 0.2648 -0.0108 -0.0008 -0.0413 1701 PRO A C   
3870 O  O   . PRO A 248 ? 0.1437 0.2364 0.2671 -0.0086 0.0003  -0.0277 1701 PRO A O   
3871 C  CB  . PRO A 248 ? 0.1847 0.2449 0.3077 0.0094  -0.0263 -0.0179 1701 PRO A CB  
3872 C  CG  . PRO A 248 ? 0.1880 0.2462 0.3060 0.0093  -0.0374 -0.0211 1701 PRO A CG  
3873 C  CD  . PRO A 248 ? 0.1644 0.2450 0.2886 0.0103  -0.0113 -0.0293 1701 PRO A CD  
3881 N  N   . PRO A 249 ? 0.1695 0.2249 0.2740 -0.0155 0.0120  -0.0514 1702 PRO A N   
3882 C  CA  . PRO A 249 ? 0.1441 0.2112 0.2382 -0.0120 0.0404  -0.0440 1702 PRO A CA  
3883 C  C   . PRO A 249 ? 0.1285 0.2050 0.2382 -0.0006 0.0122  -0.0257 1702 PRO A C   
3884 O  O   . PRO A 249 ? 0.1680 0.2224 0.2756 -0.0189 -0.0012 -0.0112 1702 PRO A O   
3885 C  CB  . PRO A 249 ? 0.1496 0.2248 0.2530 -0.0250 0.0019  -0.0431 1702 PRO A CB  
3886 C  CG  . PRO A 249 ? 0.1734 0.2319 0.2958 -0.0313 -0.0173 -0.0417 1702 PRO A CG  
3887 C  CD  . PRO A 249 ? 0.1777 0.2318 0.2869 -0.0348 -0.0210 -0.0449 1702 PRO A CD  
3895 N  N   . GLY A 250 ? 0.1350 0.1908 0.2264 0.0134  -0.0032 -0.0209 1703 GLY A N   
3896 C  CA  . GLY A 250 ? 0.1081 0.1821 0.2179 0.0059  -0.0055 -0.0148 1703 GLY A CA  
3897 C  C   . GLY A 250 ? 0.1107 0.1710 0.2083 0.0041  -0.0176 -0.0072 1703 GLY A C   
3898 O  O   . GLY A 250 ? 0.1091 0.1739 0.2284 0.0056  0.0029  -0.0158 1703 GLY A O   
3902 N  N   . PHE A 251 ? 0.1073 0.1705 0.2163 -0.0062 -0.0050 -0.0148 1704 PHE A N   
3903 C  CA  . PHE A 251 ? 0.1250 0.1764 0.2173 -0.0052 -0.0048 -0.0075 1704 PHE A CA  
3904 C  C   . PHE A 251 ? 0.0951 0.1764 0.2176 -0.0121 -0.0065 -0.0113 1704 PHE A C   
3905 O  O   . PHE A 251 ? 0.0956 0.1708 0.2428 0.0017  0.0050  -0.0009 1704 PHE A O   
3906 C  CB  . PHE A 251 ? 0.1285 0.1745 0.2256 0.0000  0.0070  0.0098  1704 PHE A CB  
3907 C  CG  . PHE A 251 ? 0.1183 0.1720 0.2247 -0.0013 0.0071  -0.0010 1704 PHE A CG  
3908 C  CD1 . PHE A 251 ? 0.1263 0.1766 0.2339 -0.0101 -0.0201 0.0054  1704 PHE A CD1 
3909 C  CD2 . PHE A 251 ? 0.1433 0.1757 0.2706 -0.0060 0.0147  -0.0138 1704 PHE A CD2 
3910 C  CE1 . PHE A 251 ? 0.1353 0.1813 0.2601 -0.0160 -0.0111 -0.0070 1704 PHE A CE1 
3911 C  CE2 . PHE A 251 ? 0.1360 0.1682 0.2782 -0.0088 0.0099  -0.0101 1704 PHE A CE2 
3912 C  CZ  . PHE A 251 ? 0.1408 0.1702 0.2783 -0.0017 -0.0133 -0.0015 1704 PHE A CZ  
3922 N  N   . PRO A 252 ? 0.1073 0.1804 0.2236 -0.0102 0.0043  -0.0221 1705 PRO A N   
3923 C  CA  . PRO A 252 ? 0.1217 0.1782 0.2165 -0.0149 -0.0105 -0.0323 1705 PRO A CA  
3924 C  C   . PRO A 252 ? 0.1180 0.1719 0.2187 -0.0038 0.0171  -0.0353 1705 PRO A C   
3925 O  O   . PRO A 252 ? 0.1430 0.1812 0.2481 -0.0001 -0.0009 -0.0104 1705 PRO A O   
3926 C  CB  . PRO A 252 ? 0.1409 0.1877 0.2646 -0.0034 -0.0107 -0.0195 1705 PRO A CB  
3927 C  CG  . PRO A 252 ? 0.1475 0.1953 0.2498 -0.0035 -0.0263 -0.0132 1705 PRO A CG  
3928 C  CD  . PRO A 252 ? 0.1189 0.1910 0.2376 -0.0063 -0.0088 -0.0213 1705 PRO A CD  
3936 N  N   . GLY A 253 ? 0.1193 0.1596 0.2285 -0.0213 0.0211  -0.0295 1706 GLY A N   
3937 C  CA  . GLY A 253 ? 0.1331 0.1591 0.2211 -0.0212 0.0294  -0.0351 1706 GLY A CA  
3938 C  C   . GLY A 253 ? 0.1332 0.1513 0.2154 -0.0313 0.0162  -0.0462 1706 GLY A C   
3939 O  O   . GLY A 253 ? 0.1380 0.1649 0.2371 -0.0309 0.0228  -0.0453 1706 GLY A O   
3943 N  N   . LEU A 254 ? 0.1152 0.1457 0.2219 -0.0219 0.0008  -0.0256 1707 LEU A N   
3944 C  CA  . LEU A 254 ? 0.1332 0.1454 0.2419 -0.0207 0.0082  -0.0298 1707 LEU A CA  
3945 C  C   . LEU A 254 ? 0.1177 0.1489 0.2425 -0.0171 -0.0094 -0.0334 1707 LEU A C   
3946 O  O   . LEU A 254 ? 0.1356 0.1578 0.2516 -0.0284 0.0107  -0.0319 1707 LEU A O   
3947 C  CB  . LEU A 254 ? 0.1371 0.1386 0.2317 -0.0237 0.0212  -0.0336 1707 LEU A CB  
3948 C  CG  . LEU A 254 ? 0.1482 0.1431 0.2467 -0.0130 0.0240  -0.0368 1707 LEU A CG  
3949 C  CD1 . LEU A 254 ? 0.1596 0.1483 0.2780 0.0070  -0.0062 -0.0294 1707 LEU A CD1 
3950 C  CD2 . LEU A 254 ? 0.1633 0.1545 0.2498 -0.0270 -0.0049 -0.0333 1707 LEU A CD2 
3962 N  N   . GLU A 255 ? 0.1352 0.1613 0.2468 -0.0265 -0.0085 -0.0555 1708 GLU A N   
3963 C  CA  . GLU A 255 ? 0.1485 0.1673 0.2512 -0.0341 -0.0112 -0.0613 1708 GLU A CA  
3964 C  C   . GLU A 255 ? 0.1647 0.1829 0.2248 -0.0289 -0.0005 -0.0612 1708 GLU A C   
3965 O  O   . GLU A 255 ? 0.2037 0.1974 0.2370 -0.0246 0.0127  -0.0556 1708 GLU A O   
3966 C  CB  . GLU A 255 ? 0.1550 0.1749 0.2658 -0.0401 0.0021  -0.0771 1708 GLU A CB  
3967 C  CG  . GLU A 255 ? 0.1467 0.1762 0.2811 -0.0389 0.0086  -0.0718 1708 GLU A CG  
3968 C  CD  . GLU A 255 ? 0.1756 0.1869 0.2878 -0.0533 0.0003  -0.0724 1708 GLU A CD  
3969 O  OE1 . GLU A 255 ? 0.1798 0.2028 0.2975 -0.0679 0.0217  -0.0733 1708 GLU A OE1 
3970 O  OE2 . GLU A 255 ? 0.1929 0.1939 0.3256 -0.0569 -0.0118 -0.0777 1708 GLU A OE2 
3977 N  N   . THR A 256 ? 0.1503 0.1743 0.2343 -0.0274 -0.0043 -0.0484 1709 THR A N   
3978 C  CA  . THR A 256 ? 0.1469 0.1725 0.2429 -0.0140 0.0103  -0.0491 1709 THR A CA  
3979 C  C   . THR A 256 ? 0.1214 0.1724 0.2263 -0.0169 -0.0032 -0.0386 1709 THR A C   
3980 O  O   . THR A 256 ? 0.1419 0.1872 0.2304 -0.0262 -0.0051 -0.0368 1709 THR A O   
3981 C  CB  . THR A 256 ? 0.1341 0.1703 0.2233 -0.0090 -0.0080 -0.0476 1709 THR A CB  
3982 O  OG1 . THR A 256 ? 0.1415 0.1757 0.2362 -0.0103 -0.0221 -0.0359 1709 THR A OG1 
3983 C  CG2 . THR A 256 ? 0.1413 0.1682 0.2447 -0.0233 -0.0037 -0.0295 1709 THR A CG2 
3991 N  N   . MET A 257 ? 0.1227 0.1590 0.2279 -0.0266 -0.0129 -0.0362 1710 MET A N   
3992 C  CA  . MET A 257 ? 0.1203 0.1565 0.2010 -0.0213 -0.0015 -0.0298 1710 MET A CA  
3993 C  C   . MET A 257 ? 0.1203 0.1557 0.2004 -0.0210 -0.0082 -0.0321 1710 MET A C   
3994 O  O   . MET A 257 ? 0.1389 0.1674 0.2206 -0.0260 0.0020  -0.0162 1710 MET A O   
3995 C  CB  . MET A 257 ? 0.1280 0.1617 0.2131 -0.0145 -0.0157 -0.0327 1710 MET A CB  
3996 C  CG  . MET A 257 ? 0.1402 0.1637 0.2246 -0.0162 -0.0068 -0.0306 1710 MET A CG  
3997 S  SD  . MET A 257 ? 0.1475 0.1626 0.2258 -0.0064 -0.0051 -0.0179 1710 MET A SD  
3998 C  CE  . MET A 257 ? 0.1477 0.1638 0.2444 -0.0052 -0.0175 0.0046  1710 MET A CE  
4008 N  N   . LEU A 258 ? 0.1231 0.1574 0.2350 -0.0117 0.0020  -0.0415 1711 LEU A N   
4009 C  CA  . LEU A 258 ? 0.1528 0.1667 0.2269 -0.0193 0.0178  -0.0333 1711 LEU A CA  
4010 C  C   . LEU A 258 ? 0.1492 0.1822 0.2216 -0.0173 0.0073  -0.0381 1711 LEU A C   
4011 O  O   . LEU A 258 ? 0.1613 0.1918 0.2306 -0.0089 0.0128  -0.0222 1711 LEU A O   
4012 C  CB  . LEU A 258 ? 0.1608 0.1623 0.2376 -0.0174 0.0121  -0.0492 1711 LEU A CB  
4013 C  CG  . LEU A 258 ? 0.1567 0.1564 0.2575 -0.0320 0.0298  -0.0531 1711 LEU A CG  
4014 C  CD1 . LEU A 258 ? 0.1502 0.1705 0.2881 -0.0371 0.0213  -0.0483 1711 LEU A CD1 
4015 C  CD2 . LEU A 258 ? 0.1854 0.1565 0.2900 -0.0192 0.0322  -0.0520 1711 LEU A CD2 
4027 N  N   . PRO A 259 ? 0.1558 0.1854 0.2159 -0.0275 0.0230  -0.0388 1712 PRO A N   
4028 C  CA  . PRO A 259 ? 0.1772 0.1965 0.2229 -0.0244 -0.0012 -0.0499 1712 PRO A CA  
4029 C  C   . PRO A 259 ? 0.1751 0.2077 0.1887 -0.0223 -0.0087 -0.0399 1712 PRO A C   
4030 O  O   . PRO A 259 ? 0.1808 0.2249 0.2050 -0.0356 -0.0150 -0.0403 1712 PRO A O   
4031 C  CB  . PRO A 259 ? 0.1896 0.1968 0.2630 -0.0317 -0.0316 -0.0466 1712 PRO A CB  
4032 C  CG  . PRO A 259 ? 0.1944 0.2079 0.2746 -0.0226 -0.0143 -0.0444 1712 PRO A CG  
4033 C  CD  . PRO A 259 ? 0.1616 0.1864 0.2393 -0.0490 0.0141  -0.0523 1712 PRO A CD  
4041 N  N   . LEU A 260 ? 0.1589 0.2009 0.1785 -0.0226 -0.0190 -0.0393 1713 LEU A N   
4042 C  CA  . LEU A 260 ? 0.1408 0.1901 0.1990 -0.0173 -0.0106 -0.0267 1713 LEU A CA  
4043 C  C   . LEU A 260 ? 0.1313 0.1817 0.1637 -0.0238 -0.0205 -0.0155 1713 LEU A C   
4044 O  O   . LEU A 260 ? 0.1680 0.1881 0.2069 -0.0264 -0.0152 -0.0112 1713 LEU A O   
4045 C  CB  . LEU A 260 ? 0.1384 0.1852 0.1966 -0.0195 0.0241  -0.0332 1713 LEU A CB  
4046 C  CG  . LEU A 260 ? 0.1301 0.1873 0.1956 -0.0171 -0.0131 -0.0391 1713 LEU A CG  
4047 C  CD1 . LEU A 260 ? 0.1396 0.1850 0.2417 -0.0254 0.0276  -0.0325 1713 LEU A CD1 
4048 C  CD2 . LEU A 260 ? 0.1472 0.2102 0.2251 0.0026  -0.0351 -0.0399 1713 LEU A CD2 
4060 N  N   . LEU A 261 ? 0.1138 0.1767 0.1939 -0.0195 -0.0263 -0.0221 1714 LEU A N   
4061 C  CA  . LEU A 261 ? 0.1241 0.1923 0.1847 -0.0160 0.0103  -0.0354 1714 LEU A CA  
4062 C  C   . LEU A 261 ? 0.1356 0.1981 0.1841 -0.0186 0.0013  -0.0339 1714 LEU A C   
4063 O  O   . LEU A 261 ? 0.1493 0.2008 0.1982 -0.0220 0.0078  -0.0229 1714 LEU A O   
4064 C  CB  . LEU A 261 ? 0.1629 0.1981 0.1825 -0.0144 -0.0035 -0.0391 1714 LEU A CB  
4065 C  CG  . LEU A 261 ? 0.1474 0.2060 0.1857 -0.0309 -0.0132 -0.0334 1714 LEU A CG  
4066 C  CD1 . LEU A 261 ? 0.1469 0.2236 0.1968 -0.0368 -0.0399 -0.0339 1714 LEU A CD1 
4067 C  CD2 . LEU A 261 ? 0.1661 0.2033 0.2303 -0.0332 -0.0429 -0.0371 1714 LEU A CD2 
4079 N  N   . LEU A 262 ? 0.1616 0.2101 0.1965 -0.0237 0.0090  -0.0483 1715 LEU A N   
4080 C  CA  . LEU A 262 ? 0.1698 0.2148 0.2074 -0.0316 0.0191  -0.0606 1715 LEU A CA  
4081 C  C   . LEU A 262 ? 0.1689 0.2287 0.2053 -0.0274 0.0191  -0.0595 1715 LEU A C   
4082 O  O   . LEU A 262 ? 0.1793 0.2356 0.1956 -0.0284 0.0053  -0.0558 1715 LEU A O   
4083 C  CB  . LEU A 262 ? 0.1865 0.2098 0.2162 -0.0413 0.0077  -0.0577 1715 LEU A CB  
4084 C  CG  . LEU A 262 ? 0.2090 0.2195 0.2603 -0.0310 0.0065  -0.0572 1715 LEU A CG  
4085 C  CD1 . LEU A 262 ? 0.2440 0.2127 0.2817 -0.0207 0.0237  -0.0549 1715 LEU A CD1 
4086 C  CD2 . LEU A 262 ? 0.2180 0.2316 0.2418 -0.0308 0.0099  -0.0492 1715 LEU A CD2 
4098 N  N   . THR A 263 ? 0.1647 0.2372 0.2139 -0.0217 -0.0047 -0.0536 1716 THR A N   
4099 C  CA  . THR A 263 ? 0.1729 0.2487 0.2176 -0.0228 -0.0244 -0.0427 1716 THR A CA  
4100 C  C   . THR A 263 ? 0.1831 0.2404 0.2005 -0.0202 -0.0119 -0.0259 1716 THR A C   
4101 O  O   . THR A 263 ? 0.1926 0.2451 0.2417 -0.0305 0.0078  -0.0270 1716 THR A O   
4102 C  CB  . THR A 263 ? 0.1766 0.2661 0.2115 -0.0201 -0.0181 -0.0245 1716 THR A CB  
4103 O  OG1 . THR A 263 ? 0.1839 0.2837 0.2229 -0.0411 -0.0231 -0.0235 1716 THR A OG1 
4104 C  CG2 . THR A 263 ? 0.2095 0.2752 0.1995 -0.0240 -0.0418 -0.0002 1716 THR A CG2 
4112 N  N   . ALA A 264 ? 0.1698 0.2302 0.1771 -0.0023 -0.0081 -0.0206 1717 ALA A N   
4113 C  CA  . ALA A 264 ? 0.1695 0.2272 0.1908 -0.0138 0.0052  -0.0162 1717 ALA A CA  
4114 C  C   . ALA A 264 ? 0.1744 0.2247 0.1784 -0.0231 0.0119  -0.0212 1717 ALA A C   
4115 O  O   . ALA A 264 ? 0.2066 0.2234 0.2142 -0.0360 0.0344  -0.0190 1717 ALA A O   
4116 C  CB  . ALA A 264 ? 0.1702 0.2254 0.2133 -0.0022 -0.0025 -0.0154 1717 ALA A CB  
4122 N  N   . VAL A 265 ? 0.1606 0.2359 0.1895 -0.0217 0.0085  -0.0308 1718 VAL A N   
4123 C  CA  . VAL A 265 ? 0.1846 0.2545 0.2165 -0.0309 0.0273  -0.0383 1718 VAL A CA  
4124 C  C   . VAL A 265 ? 0.2170 0.2878 0.2253 -0.0503 0.0523  -0.0418 1718 VAL A C   
4125 O  O   . VAL A 265 ? 0.2287 0.3017 0.2557 -0.0712 0.0322  -0.0335 1718 VAL A O   
4126 C  CB  . VAL A 265 ? 0.1842 0.2446 0.2234 -0.0168 0.0390  -0.0484 1718 VAL A CB  
4127 C  CG1 . VAL A 265 ? 0.2046 0.2543 0.2575 -0.0159 0.0243  -0.0382 1718 VAL A CG1 
4128 C  CG2 . VAL A 265 ? 0.1605 0.2364 0.2336 -0.0060 0.0212  -0.0351 1718 VAL A CG2 
4138 N  N   . SER A 266 ? 0.2753 0.3088 0.2133 -0.0616 0.0145  -0.0501 1719 SER A N   
4139 C  CA  A SER A 266 ? 0.3080 0.3222 0.2306 -0.0625 0.0037  -0.0365 1719 SER A CA  
4140 C  CA  B SER A 266 ? 0.3036 0.3233 0.2244 -0.0614 0.0137  -0.0370 1719 SER A CA  
4141 C  C   . SER A 266 ? 0.3231 0.3361 0.2280 -0.0666 0.0026  -0.0260 1719 SER A C   
4142 O  O   . SER A 266 ? 0.3810 0.3543 0.2424 -0.0685 -0.0055 -0.0245 1719 SER A O   
4143 C  CB  A SER A 266 ? 0.3313 0.3233 0.2643 -0.0569 0.0010  -0.0326 1719 SER A CB  
4144 C  CB  B SER A 266 ? 0.3273 0.3288 0.2748 -0.0476 0.0358  -0.0341 1719 SER A CB  
4145 O  OG  A SER A 266 ? 0.3514 0.3259 0.2838 -0.0561 -0.0133 -0.0314 1719 SER A OG  
4146 O  OG  B SER A 266 ? 0.3460 0.3378 0.2997 -0.0478 0.0356  -0.0337 1719 SER A OG  
4157 N  N   . GLU A 267 ? 0.3118 0.3391 0.2149 -0.0581 0.0023  -0.0118 1720 GLU A N   
4158 C  CA  . GLU A 267 ? 0.3095 0.3469 0.2660 -0.0495 -0.0239 0.0047  1720 GLU A CA  
4159 C  C   . GLU A 267 ? 0.3123 0.3354 0.2764 -0.0538 -0.0269 0.0146  1720 GLU A C   
4160 O  O   . GLU A 267 ? 0.3239 0.3464 0.3144 -0.0562 -0.0332 0.0302  1720 GLU A O   
4161 C  CB  . GLU A 267 ? 0.3127 0.3642 0.2996 -0.0421 -0.0239 0.0057  1720 GLU A CB  
4162 C  CG  . GLU A 267 ? 0.3312 0.3826 0.3497 -0.0406 -0.0484 0.0022  1720 GLU A CG  
4163 C  CD  . GLU A 267 ? 0.3672 0.4057 0.4248 -0.0412 -0.0411 -0.0146 1720 GLU A CD  
4164 O  OE1 . GLU A 267 ? 0.3985 0.4193 0.4636 -0.0352 -0.0182 -0.0266 1720 GLU A OE1 
4165 O  OE2 . GLU A 267 ? 0.3504 0.4173 0.4598 -0.0359 -0.0418 -0.0061 1720 GLU A OE2 
4172 N  N   . GLY A 268 ? 0.2832 0.3168 0.2590 -0.0555 0.0164  0.0145  1721 GLY A N   
4173 C  CA  . GLY A 268 ? 0.2876 0.2983 0.2560 -0.0588 0.0094  0.0321  1721 GLY A CA  
4174 C  C   . GLY A 268 ? 0.2532 0.2768 0.2336 -0.0539 -0.0127 0.0335  1721 GLY A C   
4175 O  O   . GLY A 268 ? 0.2588 0.2852 0.2867 -0.0716 -0.0034 0.0291  1721 GLY A O   
4179 N  N   . ARG A 269 ? 0.1994 0.2507 0.2030 -0.0274 -0.0055 0.0216  1722 ARG A N   
4180 C  CA  . ARG A 269 ? 0.2133 0.2384 0.2152 -0.0195 -0.0265 0.0111  1722 ARG A CA  
4181 C  C   . ARG A 269 ? 0.2010 0.2291 0.2441 -0.0122 -0.0172 0.0059  1722 ARG A C   
4182 O  O   . ARG A 269 ? 0.2299 0.2332 0.2666 -0.0116 -0.0305 0.0062  1722 ARG A O   
4183 C  CB  . ARG A 269 ? 0.2256 0.2466 0.2464 0.0074  -0.0275 -0.0131 1722 ARG A CB  
4184 C  CG  . ARG A 269 ? 0.2470 0.2657 0.2335 0.0168  -0.0246 -0.0261 1722 ARG A CG  
4185 C  CD  . ARG A 269 ? 0.2625 0.2796 0.2392 0.0283  -0.0146 -0.0182 1722 ARG A CD  
4186 N  NE  . ARG A 269 ? 0.2615 0.2860 0.2515 0.0354  -0.0113 0.0041  1722 ARG A NE  
4187 C  CZ  . ARG A 269 ? 0.3135 0.2958 0.2415 0.0445  -0.0157 0.0095  1722 ARG A CZ  
4188 N  NH1 . ARG A 269 ? 0.3419 0.3024 0.2324 0.0506  -0.0193 0.0056  1722 ARG A NH1 
4189 N  NH2 . ARG A 269 ? 0.3107 0.3003 0.2582 0.0532  -0.0302 0.0266  1722 ARG A NH2 
4203 N  N   . LEU A 270 ? 0.1734 0.2198 0.2402 0.0078  -0.0046 -0.0023 1723 LEU A N   
4204 C  CA  . LEU A 270 ? 0.1838 0.2148 0.2586 0.0065  0.0114  0.0058  1723 LEU A CA  
4205 C  C   . LEU A 270 ? 0.1818 0.2119 0.2487 -0.0030 0.0052  0.0051  1723 LEU A C   
4206 O  O   . LEU A 270 ? 0.1596 0.2207 0.2557 -0.0169 0.0085  0.0111  1723 LEU A O   
4207 C  CB  . LEU A 270 ? 0.1832 0.2124 0.2746 -0.0218 0.0206  -0.0010 1723 LEU A CB  
4208 C  CG  . LEU A 270 ? 0.2103 0.2216 0.2622 -0.0238 0.0395  0.0070  1723 LEU A CG  
4209 C  CD1 . LEU A 270 ? 0.2322 0.2314 0.2863 -0.0042 0.0568  0.0012  1723 LEU A CD1 
4210 C  CD2 . LEU A 270 ? 0.2239 0.2272 0.2794 -0.0085 0.0389  0.0006  1723 LEU A CD2 
4222 N  N   . SER A 271 ? 0.1667 0.2049 0.2213 0.0076  -0.0115 0.0121  1724 SER A N   
4223 C  CA  . SER A 271 ? 0.1577 0.1969 0.2125 -0.0052 -0.0006 0.0032  1724 SER A CA  
4224 C  C   . SER A 271 ? 0.1595 0.1896 0.2126 -0.0134 0.0068  -0.0140 1724 SER A C   
4225 O  O   . SER A 271 ? 0.1634 0.1845 0.2173 -0.0079 0.0179  -0.0131 1724 SER A O   
4226 C  CB  . SER A 271 ? 0.1569 0.1969 0.1983 0.0007  -0.0009 0.0006  1724 SER A CB  
4227 O  OG  . SER A 271 ? 0.1504 0.1985 0.2061 -0.0029 -0.0064 0.0043  1724 SER A OG  
4233 N  N   . LEU A 272 ? 0.1656 0.1786 0.1934 -0.0148 0.0157  -0.0314 1725 LEU A N   
4234 C  CA  . LEU A 272 ? 0.1725 0.1695 0.1949 -0.0121 0.0275  -0.0481 1725 LEU A CA  
4235 C  C   . LEU A 272 ? 0.1573 0.1619 0.1940 -0.0308 0.0295  -0.0344 1725 LEU A C   
4236 O  O   . LEU A 272 ? 0.1627 0.1598 0.2209 -0.0442 0.0389  -0.0478 1725 LEU A O   
4237 C  CB  . LEU A 272 ? 0.1952 0.1742 0.2245 -0.0014 0.0106  -0.0509 1725 LEU A CB  
4238 C  CG  . LEU A 272 ? 0.2364 0.1833 0.2685 0.0041  0.0277  -0.0534 1725 LEU A CG  
4239 C  CD1 . LEU A 272 ? 0.2668 0.1823 0.3209 -0.0067 0.0486  -0.0371 1725 LEU A CD1 
4240 C  CD2 . LEU A 272 ? 0.2686 0.1943 0.2854 -0.0058 0.0257  -0.0691 1725 LEU A CD2 
4252 N  N   . ASP A 273 ? 0.1451 0.1570 0.1875 -0.0161 0.0196  -0.0320 1726 ASP A N   
4253 C  CA  . ASP A 273 ? 0.1424 0.1512 0.1791 -0.0241 0.0109  -0.0175 1726 ASP A CA  
4254 C  C   . ASP A 273 ? 0.1337 0.1499 0.1634 -0.0217 0.0147  -0.0161 1726 ASP A C   
4255 O  O   . ASP A 273 ? 0.1559 0.1505 0.1880 -0.0169 0.0112  -0.0081 1726 ASP A O   
4256 C  CB  . ASP A 273 ? 0.1373 0.1651 0.2303 -0.0212 0.0066  -0.0256 1726 ASP A CB  
4257 C  CG  . ASP A 273 ? 0.1842 0.1917 0.2617 -0.0229 -0.0029 -0.0262 1726 ASP A CG  
4258 O  OD1 . ASP A 273 ? 0.1931 0.2055 0.2657 0.0132  -0.0049 -0.0466 1726 ASP A OD1 
4259 O  OD2 . ASP A 273 ? 0.2269 0.2117 0.3075 -0.0421 -0.0507 -0.0274 1726 ASP A OD2 
4264 N  N   . ASP A 274 ? 0.1430 0.1496 0.1973 -0.0087 0.0063  -0.0243 1727 ASP A N   
4265 C  CA  . ASP A 274 ? 0.1541 0.1526 0.1846 0.0095  0.0270  -0.0308 1727 ASP A CA  
4266 C  C   . ASP A 274 ? 0.1465 0.1552 0.1901 0.0013  -0.0129 -0.0440 1727 ASP A C   
4267 O  O   . ASP A 274 ? 0.1564 0.1574 0.2001 -0.0020 -0.0043 -0.0370 1727 ASP A O   
4268 C  CB  . ASP A 274 ? 0.1857 0.1562 0.2152 0.0160  0.0297  -0.0213 1727 ASP A CB  
4269 C  CG  . ASP A 274 ? 0.2367 0.1721 0.2567 0.0010  -0.0195 -0.0108 1727 ASP A CG  
4270 O  OD1 . ASP A 274 ? 0.2737 0.1818 0.2844 -0.0202 -0.0421 -0.0016 1727 ASP A OD1 
4271 O  OD2 . ASP A 274 ? 0.2539 0.1771 0.2505 0.0051  0.0018  -0.0163 1727 ASP A OD2 
4276 N  N   . LEU A 275 ? 0.1474 0.1614 0.1810 -0.0122 0.0117  -0.0362 1728 LEU A N   
4277 C  CA  A LEU A 275 ? 0.1574 0.1672 0.1968 -0.0227 -0.0059 -0.0311 1728 LEU A CA  
4278 C  CA  B LEU A 275 ? 0.1532 0.1612 0.1985 -0.0169 0.0030  -0.0316 1728 LEU A CA  
4279 C  C   . LEU A 275 ? 0.1517 0.1613 0.2155 -0.0266 0.0028  -0.0267 1728 LEU A C   
4280 O  O   . LEU A 275 ? 0.1529 0.1650 0.2217 -0.0321 0.0051  -0.0359 1728 LEU A O   
4281 C  CB  A LEU A 275 ? 0.1703 0.1879 0.2083 -0.0234 -0.0214 -0.0305 1728 LEU A CB  
4282 C  CB  B LEU A 275 ? 0.1607 0.1646 0.2075 -0.0089 -0.0013 -0.0308 1728 LEU A CB  
4283 C  CG  A LEU A 275 ? 0.1962 0.1941 0.1917 -0.0509 -0.0005 -0.0359 1728 LEU A CG  
4284 C  CG  B LEU A 275 ? 0.1718 0.1618 0.2024 -0.0109 0.0113  -0.0327 1728 LEU A CG  
4285 C  CD1 A LEU A 275 ? 0.1843 0.2032 0.2249 -0.0489 0.0261  -0.0386 1728 LEU A CD1 
4286 C  CD1 B LEU A 275 ? 0.1726 0.1637 0.2127 -0.0045 0.0147  -0.0239 1728 LEU A CD1 
4287 C  CD2 A LEU A 275 ? 0.2133 0.2054 0.2088 -0.0651 0.0086  -0.0288 1728 LEU A CD2 
4288 C  CD2 B LEU A 275 ? 0.1667 0.1632 0.2058 -0.0100 0.0324  -0.0383 1728 LEU A CD2 
4311 N  N   . LEU A 276 ? 0.1568 0.1487 0.2026 -0.0289 0.0002  -0.0069 1729 LEU A N   
4312 C  CA  . LEU A 276 ? 0.1649 0.1326 0.2006 -0.0326 0.0186  -0.0171 1729 LEU A CA  
4313 C  C   . LEU A 276 ? 0.1281 0.1232 0.2131 -0.0143 0.0043  0.0037  1729 LEU A C   
4314 O  O   . LEU A 276 ? 0.1654 0.1135 0.2231 -0.0042 0.0114  -0.0087 1729 LEU A O   
4315 C  CB  . LEU A 276 ? 0.2100 0.1438 0.2314 -0.0280 0.0380  -0.0396 1729 LEU A CB  
4316 C  CG  . LEU A 276 ? 0.2259 0.1493 0.2526 -0.0491 0.0651  -0.0556 1729 LEU A CG  
4317 C  CD1 . LEU A 276 ? 0.2689 0.1650 0.2951 -0.0277 0.0731  -0.0617 1729 LEU A CD1 
4318 C  CD2 . LEU A 276 ? 0.2600 0.1603 0.2723 -0.0869 0.0451  -0.0627 1729 LEU A CD2 
4330 N  N   . GLN A 277 ? 0.1019 0.1210 0.2077 -0.0184 0.0098  0.0022  1730 GLN A N   
4331 C  CA  . GLN A 277 ? 0.1160 0.1088 0.2145 -0.0176 -0.0170 0.0004  1730 GLN A CA  
4332 C  C   . GLN A 277 ? 0.1192 0.1111 0.1757 -0.0094 -0.0264 -0.0019 1730 GLN A C   
4333 O  O   . GLN A 277 ? 0.1276 0.1141 0.2003 0.0090  0.0041  -0.0117 1730 GLN A O   
4334 C  CB  . GLN A 277 ? 0.1411 0.1039 0.2060 -0.0085 0.0110  -0.0158 1730 GLN A CB  
4335 C  CG  . GLN A 277 ? 0.1414 0.1170 0.2000 -0.0057 0.0073  -0.0011 1730 GLN A CG  
4336 C  CD  . GLN A 277 ? 0.1347 0.1320 0.2011 -0.0025 0.0122  -0.0165 1730 GLN A CD  
4337 O  OE1 . GLN A 277 ? 0.1359 0.1474 0.2155 -0.0113 0.0031  -0.0088 1730 GLN A OE1 
4338 N  NE2 . GLN A 277 ? 0.1413 0.1385 0.2147 0.0125  0.0133  -0.0191 1730 GLN A NE2 
4347 N  N   . ARG A 278 ? 0.1098 0.1120 0.1627 -0.0108 -0.0112 -0.0187 1731 ARG A N   
4348 C  CA  . ARG A 278 ? 0.1115 0.1007 0.1836 0.0093  0.0108  -0.0048 1731 ARG A CA  
4349 C  C   . ARG A 278 ? 0.1221 0.1067 0.1949 0.0093  0.0121  -0.0138 1731 ARG A C   
4350 O  O   . ARG A 278 ? 0.1200 0.1095 0.1979 0.0018  0.0179  -0.0165 1731 ARG A O   
4351 C  CB  . ARG A 278 ? 0.1192 0.0963 0.1892 -0.0088 0.0054  -0.0037 1731 ARG A CB  
4352 C  CG  . ARG A 278 ? 0.1262 0.0933 0.1818 -0.0210 0.0105  -0.0128 1731 ARG A CG  
4353 C  CD  . ARG A 278 ? 0.1292 0.0933 0.1839 -0.0063 0.0111  0.0018  1731 ARG A CD  
4354 N  NE  . ARG A 278 ? 0.1339 0.1003 0.1799 -0.0090 0.0053  -0.0037 1731 ARG A NE  
4355 C  CZ  . ARG A 278 ? 0.1686 0.1091 0.1581 -0.0226 0.0393  -0.0247 1731 ARG A CZ  
4356 N  NH1 . ARG A 278 ? 0.1926 0.1197 0.2434 -0.0208 0.0470  -0.0476 1731 ARG A NH1 
4357 N  NH2 . ARG A 278 ? 0.1830 0.1202 0.2319 -0.0343 0.0497  -0.0319 1731 ARG A NH2 
4371 N  N   . LEU A 279 ? 0.1136 0.1050 0.1924 0.0061  0.0127  -0.0179 1732 LEU A N   
4372 C  CA  . LEU A 279 ? 0.1126 0.1110 0.1902 -0.0019 0.0003  -0.0097 1732 LEU A CA  
4373 C  C   . LEU A 279 ? 0.1087 0.1059 0.2002 -0.0165 0.0120  -0.0144 1732 LEU A C   
4374 O  O   . LEU A 279 ? 0.1196 0.1130 0.2440 -0.0265 0.0209  -0.0176 1732 LEU A O   
4375 C  CB  . LEU A 279 ? 0.1296 0.1356 0.2196 -0.0067 0.0073  -0.0109 1732 LEU A CB  
4376 C  CG  . LEU A 279 ? 0.1428 0.1552 0.2265 -0.0107 -0.0163 -0.0021 1732 LEU A CG  
4377 C  CD1 . LEU A 279 ? 0.1824 0.1798 0.2626 -0.0159 -0.0362 0.0148  1732 LEU A CD1 
4378 C  CD2 . LEU A 279 ? 0.1250 0.1682 0.2197 -0.0035 -0.0020 -0.0342 1732 LEU A CD2 
4390 N  N   . HIS A 280 ? 0.1119 0.0975 0.2316 0.0012  0.0076  -0.0162 1733 HIS A N   
4391 C  CA  . HIS A 280 ? 0.0975 0.1029 0.2086 -0.0059 -0.0100 -0.0205 1733 HIS A CA  
4392 C  C   . HIS A 280 ? 0.1048 0.0995 0.2020 -0.0154 -0.0063 -0.0003 1733 HIS A C   
4393 O  O   . HIS A 280 ? 0.1262 0.1129 0.1992 -0.0110 0.0109  -0.0048 1733 HIS A O   
4394 C  CB  . HIS A 280 ? 0.1141 0.1007 0.2396 -0.0157 0.0134  -0.0185 1733 HIS A CB  
4395 C  CG  . HIS A 280 ? 0.1438 0.0958 0.2445 -0.0102 0.0027  -0.0217 1733 HIS A CG  
4396 N  ND1 . HIS A 280 ? 0.1424 0.0896 0.2654 -0.0021 0.0159  -0.0197 1733 HIS A ND1 
4397 C  CD2 . HIS A 280 ? 0.1465 0.1020 0.2842 0.0001  0.0058  -0.0242 1733 HIS A CD2 
4398 C  CE1 . HIS A 280 ? 0.1620 0.1078 0.2674 -0.0102 0.0004  -0.0205 1733 HIS A CE1 
4399 N  NE2 . HIS A 280 ? 0.1395 0.1099 0.2964 0.0118  0.0095  -0.0232 1733 HIS A NE2 
4408 N  N   . HIS A 281 ? 0.0966 0.0935 0.2297 -0.0057 0.0053  0.0077  1734 HIS A N   
4409 C  CA  . HIS A 281 ? 0.1117 0.0952 0.2181 -0.0010 0.0039  0.0040  1734 HIS A CA  
4410 C  C   . HIS A 281 ? 0.1270 0.0896 0.2169 0.0017  -0.0034 0.0114  1734 HIS A C   
4411 O  O   . HIS A 281 ? 0.1353 0.0814 0.2070 0.0053  -0.0055 -0.0019 1734 HIS A O   
4412 C  CB  . HIS A 281 ? 0.1092 0.1104 0.1991 -0.0096 -0.0001 0.0008  1734 HIS A CB  
4413 C  CG  . HIS A 281 ? 0.1351 0.1209 0.2224 -0.0129 0.0066  -0.0246 1734 HIS A CG  
4414 N  ND1 . HIS A 281 ? 0.1537 0.1161 0.2479 -0.0052 0.0357  -0.0277 1734 HIS A ND1 
4415 C  CD2 . HIS A 281 ? 0.1628 0.1371 0.2404 -0.0262 0.0279  -0.0356 1734 HIS A CD2 
4416 C  CE1 . HIS A 281 ? 0.1762 0.1330 0.2869 -0.0297 0.0348  -0.0464 1734 HIS A CE1 
4417 N  NE2 . HIS A 281 ? 0.1973 0.1537 0.2594 -0.0395 0.0336  -0.0495 1734 HIS A NE2 
4425 N  N   . ASN A 282 ? 0.1220 0.0873 0.2118 0.0056  -0.0107 0.0004  1735 ASN A N   
4426 C  CA  . ASN A 282 ? 0.1068 0.0928 0.1934 0.0073  0.0058  0.0044  1735 ASN A CA  
4427 C  C   . ASN A 282 ? 0.1094 0.1023 0.1767 0.0015  -0.0026 -0.0021 1735 ASN A C   
4428 O  O   . ASN A 282 ? 0.1421 0.0982 0.1922 -0.0005 -0.0099 -0.0017 1735 ASN A O   
4429 C  CB  . ASN A 282 ? 0.1158 0.0965 0.2001 -0.0008 0.0111  0.0135  1735 ASN A CB  
4430 C  CG  . ASN A 282 ? 0.1079 0.1122 0.2263 0.0075  0.0079  0.0079  1735 ASN A CG  
4431 O  OD1 . ASN A 282 ? 0.1046 0.1218 0.2753 0.0039  -0.0155 0.0202  1735 ASN A OD1 
4432 N  ND2 . ASN A 282 ? 0.1209 0.1141 0.2363 -0.0059 0.0016  0.0170  1735 ASN A ND2 
4439 N  N   . PRO A 283 ? 0.1100 0.1078 0.1998 -0.0223 -0.0012 -0.0039 1736 PRO A N   
4440 C  CA  . PRO A 283 ? 0.1133 0.1187 0.2116 -0.0263 0.0073  -0.0033 1736 PRO A CA  
4441 C  C   . PRO A 283 ? 0.1224 0.1145 0.2090 -0.0173 0.0110  -0.0129 1736 PRO A C   
4442 O  O   . PRO A 283 ? 0.1253 0.1234 0.2296 -0.0058 0.0036  -0.0079 1736 PRO A O   
4443 C  CB  . PRO A 283 ? 0.1391 0.1276 0.2352 -0.0298 0.0217  0.0085  1736 PRO A CB  
4444 C  CG  . PRO A 283 ? 0.1274 0.1081 0.2361 -0.0269 0.0050  0.0073  1736 PRO A CG  
4445 C  CD  . PRO A 283 ? 0.1012 0.1057 0.2251 -0.0151 -0.0078 -0.0004 1736 PRO A CD  
4453 N  N   . ARG A 284 ? 0.1370 0.1086 0.2020 -0.0101 0.0311  -0.0187 1737 ARG A N   
4454 C  CA  . ARG A 284 ? 0.1464 0.1197 0.1983 0.0080  0.0280  -0.0117 1737 ARG A CA  
4455 C  C   . ARG A 284 ? 0.1424 0.1170 0.1933 0.0093  0.0283  0.0037  1737 ARG A C   
4456 O  O   . ARG A 284 ? 0.1519 0.1267 0.2106 -0.0078 0.0237  0.0064  1737 ARG A O   
4457 C  CB  . ARG A 284 ? 0.2005 0.1303 0.2161 0.0106  0.0202  -0.0241 1737 ARG A CB  
4458 C  CG  . ARG A 284 ? 0.2153 0.1371 0.2665 -0.0011 0.0306  -0.0107 1737 ARG A CG  
4459 C  CD  . ARG A 284 ? 0.2059 0.1281 0.2668 -0.0165 0.0092  -0.0292 1737 ARG A CD  
4460 N  NE  . ARG A 284 ? 0.1847 0.1377 0.3006 -0.0067 0.0081  -0.0105 1737 ARG A NE  
4461 C  CZ  . ARG A 284 ? 0.1605 0.1349 0.3235 0.0091  0.0225  -0.0209 1737 ARG A CZ  
4462 N  NH1 . ARG A 284 ? 0.1169 0.1286 0.3221 0.0055  0.0214  0.0098  1737 ARG A NH1 
4463 N  NH2 . ARG A 284 ? 0.1760 0.1343 0.3499 0.0048  0.0358  -0.0070 1737 ARG A NH2 
4477 N  N   . ARG A 285 ? 0.1352 0.1042 0.1928 0.0142  0.0125  0.0053  1738 ARG A N   
4478 C  CA  . ARG A 285 ? 0.1061 0.1155 0.1937 0.0112  -0.0086 0.0177  1738 ARG A CA  
4479 C  C   . ARG A 285 ? 0.1109 0.1275 0.1994 -0.0010 -0.0017 0.0234  1738 ARG A C   
4480 O  O   . ARG A 285 ? 0.1241 0.1562 0.2095 0.0136  -0.0052 0.0153  1738 ARG A O   
4481 C  CB  . ARG A 285 ? 0.1207 0.1192 0.1841 -0.0026 -0.0037 0.0128  1738 ARG A CB  
4482 C  CG  . ARG A 285 ? 0.1201 0.1271 0.2046 -0.0186 0.0000  0.0303  1738 ARG A CG  
4483 C  CD  . ARG A 285 ? 0.1268 0.1439 0.2177 -0.0147 0.0189  0.0337  1738 ARG A CD  
4484 N  NE  . ARG A 285 ? 0.1403 0.1595 0.2554 -0.0031 -0.0159 0.0713  1738 ARG A NE  
4485 C  CZ  . ARG A 285 ? 0.1938 0.1525 0.3451 0.0106  0.0033  0.0774  1738 ARG A CZ  
4486 N  NH1 . ARG A 285 ? 0.2007 0.1405 0.3131 0.0160  0.0053  0.0443  1738 ARG A NH1 
4487 N  NH2 . ARG A 285 ? 0.2134 0.1665 0.4084 0.0049  -0.0166 0.1214  1738 ARG A NH2 
4501 N  N   . ILE A 286 ? 0.1180 0.1110 0.1986 0.0000  0.0120  0.0079  1739 ILE A N   
4502 C  CA  . ILE A 286 ? 0.1239 0.1174 0.1882 0.0041  -0.0116 0.0030  1739 ILE A CA  
4503 C  C   . ILE A 286 ? 0.1412 0.1221 0.1915 -0.0058 -0.0126 -0.0024 1739 ILE A C   
4504 O  O   . ILE A 286 ? 0.1682 0.1345 0.2042 -0.0185 -0.0136 0.0051  1739 ILE A O   
4505 C  CB  . ILE A 286 ? 0.1487 0.1166 0.1817 0.0165  -0.0142 -0.0005 1739 ILE A CB  
4506 C  CG1 . ILE A 286 ? 0.1874 0.1256 0.1969 0.0278  -0.0369 -0.0008 1739 ILE A CG1 
4507 C  CG2 . ILE A 286 ? 0.1927 0.1172 0.1993 -0.0027 -0.0163 -0.0184 1739 ILE A CG2 
4508 C  CD1 . ILE A 286 ? 0.1864 0.1404 0.2007 0.0284  -0.0341 -0.0087 1739 ILE A CD1 
4520 N  N   . PHE A 287 ? 0.1431 0.1117 0.2057 -0.0025 -0.0028 0.0075  1740 PHE A N   
4521 C  CA  . PHE A 287 ? 0.1437 0.1218 0.2193 -0.0065 0.0270  0.0148  1740 PHE A CA  
4522 C  C   . PHE A 287 ? 0.1610 0.1233 0.1909 0.0026  0.0319  0.0328  1740 PHE A C   
4523 O  O   . PHE A 287 ? 0.1935 0.1416 0.2294 0.0036  0.0191  0.0392  1740 PHE A O   
4524 C  CB  . PHE A 287 ? 0.1527 0.1196 0.2322 0.0006  0.0297  -0.0098 1740 PHE A CB  
4525 C  CG  . PHE A 287 ? 0.1522 0.1198 0.2046 0.0160  0.0151  -0.0202 1740 PHE A CG  
4526 C  CD1 . PHE A 287 ? 0.1849 0.1351 0.2147 0.0168  0.0239  -0.0105 1740 PHE A CD1 
4527 C  CD2 . PHE A 287 ? 0.1630 0.1272 0.2079 0.0173  0.0022  -0.0400 1740 PHE A CD2 
4528 C  CE1 . PHE A 287 ? 0.2001 0.1460 0.2365 0.0446  0.0202  -0.0188 1740 PHE A CE1 
4529 C  CE2 . PHE A 287 ? 0.1562 0.1385 0.2184 0.0175  0.0096  -0.0343 1740 PHE A CE2 
4530 C  CZ  . PHE A 287 ? 0.1766 0.1502 0.2316 0.0299  0.0164  -0.0123 1740 PHE A CZ  
4540 N  N   . HIS A 288 ? 0.1477 0.1214 0.2139 0.0043  0.0331  0.0367  1741 HIS A N   
4541 C  CA  . HIS A 288 ? 0.1533 0.1326 0.2190 -0.0021 0.0011  0.0369  1741 HIS A CA  
4542 C  C   . HIS A 288 ? 0.1417 0.1195 0.2156 0.0023  -0.0030 0.0429  1741 HIS A C   
4543 O  O   . HIS A 288 ? 0.1880 0.1207 0.2497 0.0031  0.0221  0.0521  1741 HIS A O   
4544 C  CB  . HIS A 288 ? 0.2211 0.1626 0.2070 -0.0158 -0.0148 0.0561  1741 HIS A CB  
4545 C  CG  . HIS A 288 ? 0.3723 0.2159 0.2780 -0.0358 -0.0672 0.0812  1741 HIS A CG  
4546 N  ND1 . HIS A 288 ? 0.4578 0.2302 0.3106 -0.0558 -0.0767 0.0764  1741 HIS A ND1 
4547 C  CD2 . HIS A 288 ? 0.4249 0.2442 0.2971 -0.0323 -0.0718 0.0894  1741 HIS A CD2 
4548 C  CE1 . HIS A 288 ? 0.4776 0.2429 0.3578 -0.0467 -0.0552 0.0686  1741 HIS A CE1 
4549 N  NE2 . HIS A 288 ? 0.4808 0.2503 0.3402 -0.0382 -0.0617 0.0674  1741 HIS A NE2 
4558 N  N   . LEU A 289 ? 0.1389 0.1234 0.2250 -0.0027 0.0002  0.0395  1742 LEU A N   
4559 C  CA  . LEU A 289 ? 0.1459 0.1236 0.2461 -0.0123 0.0209  0.0195  1742 LEU A CA  
4560 C  C   . LEU A 289 ? 0.1685 0.1263 0.2723 -0.0134 0.0381  0.0068  1742 LEU A C   
4561 O  O   . LEU A 289 ? 0.1948 0.1342 0.2866 -0.0236 0.0413  -0.0061 1742 LEU A O   
4562 C  CB  . LEU A 289 ? 0.1418 0.1282 0.2571 -0.0118 0.0159  0.0195  1742 LEU A CB  
4563 C  CG  . LEU A 289 ? 0.1420 0.1236 0.2718 -0.0062 0.0049  0.0234  1742 LEU A CG  
4564 C  CD1 . LEU A 289 ? 0.1489 0.1246 0.3082 -0.0197 -0.0210 0.0264  1742 LEU A CD1 
4565 C  CD2 . LEU A 289 ? 0.1679 0.1306 0.2626 0.0038  0.0319  0.0180  1742 LEU A CD2 
4577 N  N   . PRO A 290 ? 0.1519 0.1228 0.2722 0.0044  0.0419  0.0105  1743 PRO A N   
4578 C  CA  . PRO A 290 ? 0.1341 0.1234 0.2958 -0.0001 0.0487  0.0043  1743 PRO A CA  
4579 C  C   . PRO A 290 ? 0.1299 0.1256 0.2999 -0.0065 0.0553  0.0024  1743 PRO A C   
4580 O  O   . PRO A 290 ? 0.1383 0.1276 0.3164 -0.0057 0.0438  -0.0034 1743 PRO A O   
4581 C  CB  . PRO A 290 ? 0.1673 0.1250 0.3012 -0.0017 0.0405  0.0070  1743 PRO A CB  
4582 C  CG  . PRO A 290 ? 0.1859 0.1258 0.2987 0.0001  0.0456  0.0174  1743 PRO A CG  
4583 C  CD  . PRO A 290 ? 0.1832 0.1248 0.2737 -0.0017 0.0506  0.0196  1743 PRO A CD  
4591 N  N   . PRO A 291 ? 0.1131 0.1338 0.3034 -0.0002 0.0473  -0.0089 1744 PRO A N   
4592 C  CA  . PRO A 291 ? 0.1368 0.1411 0.3130 -0.0023 0.0338  -0.0060 1744 PRO A CA  
4593 C  C   . PRO A 291 ? 0.1537 0.1333 0.3221 -0.0025 0.0503  -0.0044 1744 PRO A C   
4594 O  O   . PRO A 291 ? 0.1626 0.1445 0.3352 -0.0147 0.0345  -0.0098 1744 PRO A O   
4595 C  CB  . PRO A 291 ? 0.1504 0.1518 0.3296 -0.0025 0.0358  -0.0148 1744 PRO A CB  
4596 C  CG  . PRO A 291 ? 0.1375 0.1710 0.3434 -0.0005 0.0353  -0.0208 1744 PRO A CG  
4597 C  CD  . PRO A 291 ? 0.1233 0.1634 0.3297 0.0092  0.0490  -0.0193 1744 PRO A CD  
4605 N  N   . GLN A 292 ? 0.1476 0.1174 0.3252 -0.0054 0.0204  -0.0064 1745 GLN A N   
4606 C  CA  . GLN A 292 ? 0.1589 0.1197 0.3349 -0.0119 0.0386  -0.0162 1745 GLN A CA  
4607 C  C   . GLN A 292 ? 0.1725 0.1271 0.3704 -0.0033 0.0337  -0.0287 1745 GLN A C   
4608 O  O   . GLN A 292 ? 0.1780 0.1223 0.3904 0.0033  0.0446  -0.0223 1745 GLN A O   
4609 C  CB  . GLN A 292 ? 0.1557 0.1175 0.3065 -0.0158 0.0322  -0.0196 1745 GLN A CB  
4610 C  CG  . GLN A 292 ? 0.1625 0.1138 0.3109 -0.0167 0.0075  -0.0262 1745 GLN A CG  
4611 C  CD  . GLN A 292 ? 0.1620 0.1070 0.2854 -0.0257 0.0170  -0.0308 1745 GLN A CD  
4612 O  OE1 . GLN A 292 ? 0.1711 0.1198 0.3174 -0.0350 0.0343  -0.0053 1745 GLN A OE1 
4613 N  NE2 . GLN A 292 ? 0.1535 0.0996 0.2871 -0.0188 0.0386  -0.0039 1745 GLN A NE2 
4622 N  N   . GLU A 293 ? 0.1871 0.1407 0.3834 0.0077  0.0567  -0.0354 1746 GLU A N   
4623 C  CA  . GLU A 293 ? 0.2238 0.1558 0.3811 0.0205  0.0356  -0.0452 1746 GLU A CA  
4624 C  C   . GLU A 293 ? 0.1978 0.1393 0.3628 0.0190  0.0509  -0.0444 1746 GLU A C   
4625 O  O   . GLU A 293 ? 0.1995 0.1254 0.3748 0.0015  0.0505  -0.0266 1746 GLU A O   
4626 C  CB  . GLU A 293 ? 0.2828 0.1984 0.4181 0.0441  -0.0009 -0.0582 1746 GLU A CB  
4627 C  CG  . GLU A 293 ? 0.3652 0.2329 0.4893 0.0238  -0.0211 -0.0523 1746 GLU A CG  
4628 C  CD  . GLU A 293 ? 0.4538 0.2619 0.5532 0.0025  -0.0475 -0.0399 1746 GLU A CD  
4629 O  OE1 . GLU A 293 ? 0.5357 0.2908 0.6165 0.0200  -0.0538 -0.0459 1746 GLU A OE1 
4630 O  OE2 . GLU A 293 ? 0.4471 0.2718 0.5699 -0.0159 -0.0436 -0.0182 1746 GLU A OE2 
4637 N  N   . ASP A 294 ? 0.1932 0.1546 0.3809 0.0068  0.0736  -0.0235 1747 ASP A N   
4638 C  CA  A ASP A 294 ? 0.2260 0.1492 0.3783 -0.0029 0.0596  -0.0366 1747 ASP A CA  
4639 C  CA  B ASP A 294 ? 0.2120 0.1505 0.3753 -0.0007 0.0643  -0.0342 1747 ASP A CA  
4640 C  C   . ASP A 294 ? 0.2070 0.1369 0.3721 -0.0069 0.0694  -0.0363 1747 ASP A C   
4641 O  O   . ASP A 294 ? 0.2211 0.1270 0.3992 -0.0130 0.0544  -0.0471 1747 ASP A O   
4642 C  CB  A ASP A 294 ? 0.2757 0.1605 0.3978 0.0030  0.0305  -0.0456 1747 ASP A CB  
4643 C  CB  B ASP A 294 ? 0.2333 0.1678 0.3936 0.0164  0.0368  -0.0389 1747 ASP A CB  
4644 C  CG  A ASP A 294 ? 0.3227 0.1704 0.4233 0.0014  0.0285  -0.0405 1747 ASP A CG  
4645 C  CG  B ASP A 294 ? 0.2567 0.1858 0.4132 0.0250  0.0470  -0.0226 1747 ASP A CG  
4646 O  OD1 A ASP A 294 ? 0.3450 0.1737 0.4401 0.0001  0.0169  -0.0412 1747 ASP A OD1 
4647 O  OD1 B ASP A 294 ? 0.2640 0.1960 0.4154 0.0178  0.0683  -0.0259 1747 ASP A OD1 
4648 O  OD2 A ASP A 294 ? 0.3419 0.1724 0.4321 -0.0085 0.0227  -0.0461 1747 ASP A OD2 
4649 O  OD2 B ASP A 294 ? 0.2614 0.1933 0.4380 0.0386  0.0279  -0.0031 1747 ASP A OD2 
4658 N  N   . THR A 295 ? 0.2010 0.1323 0.3684 0.0122  0.0724  -0.0277 1748 THR A N   
4659 C  CA  . THR A 295 ? 0.1861 0.1363 0.3460 -0.0029 0.0490  -0.0232 1748 THR A CA  
4660 C  C   . THR A 295 ? 0.1729 0.1476 0.3406 -0.0145 0.0357  -0.0165 1748 THR A C   
4661 O  O   . THR A 295 ? 0.1724 0.1673 0.3737 -0.0204 0.0238  0.0020  1748 THR A O   
4662 C  CB  . THR A 295 ? 0.1710 0.1223 0.3334 0.0079  0.0466  -0.0227 1748 THR A CB  
4663 O  OG1 . THR A 295 ? 0.1808 0.1078 0.3391 0.0099  0.0265  -0.0210 1748 THR A OG1 
4664 C  CG2 . THR A 295 ? 0.1655 0.1224 0.3357 0.0086  0.0507  -0.0132 1748 THR A CG2 
4672 N  N   . TYR A 296 ? 0.1685 0.1513 0.3343 -0.0168 0.0513  -0.0312 1749 TYR A N   
4673 C  CA  . TYR A 296 ? 0.1910 0.1592 0.3308 -0.0159 0.0698  -0.0524 1749 TYR A CA  
4674 C  C   . TYR A 296 ? 0.1689 0.1511 0.3216 -0.0447 0.0573  -0.0542 1749 TYR A C   
4675 O  O   . TYR A 296 ? 0.1967 0.1446 0.3523 -0.0622 0.0581  -0.0534 1749 TYR A O   
4676 C  CB  . TYR A 296 ? 0.2631 0.1843 0.3660 -0.0237 0.0981  -0.0592 1749 TYR A CB  
4677 C  CG  . TYR A 296 ? 0.3352 0.1989 0.3914 -0.0223 0.1287  -0.0764 1749 TYR A CG  
4678 C  CD1 . TYR A 296 ? 0.3560 0.2053 0.4275 -0.0228 0.1571  -0.0716 1749 TYR A CD1 
4679 C  CD2 . TYR A 296 ? 0.3946 0.2039 0.3996 -0.0338 0.1062  -0.0967 1749 TYR A CD2 
4680 C  CE1 . TYR A 296 ? 0.4020 0.2121 0.4385 -0.0235 0.1534  -0.0899 1749 TYR A CE1 
4681 C  CE2 . TYR A 296 ? 0.4335 0.2101 0.4248 -0.0330 0.1189  -0.1052 1749 TYR A CE2 
4682 C  CZ  . TYR A 296 ? 0.4468 0.2066 0.4396 -0.0332 0.1399  -0.1157 1749 TYR A CZ  
4683 O  OH  . TYR A 296 ? 0.5068 0.2143 0.4986 -0.0366 0.1535  -0.1139 1749 TYR A OH  
4693 N  N   . VAL A 297 ? 0.1814 0.1548 0.3106 -0.0276 0.0408  -0.0568 1750 VAL A N   
4694 C  CA  . VAL A 297 ? 0.1918 0.1657 0.2964 -0.0438 0.0267  -0.0555 1750 VAL A CA  
4695 C  C   . VAL A 297 ? 0.2082 0.1914 0.3019 -0.0619 0.0247  -0.0421 1750 VAL A C   
4696 O  O   . VAL A 297 ? 0.2257 0.2190 0.3162 -0.0771 0.0251  -0.0154 1750 VAL A O   
4697 C  CB  . VAL A 297 ? 0.2008 0.1694 0.2961 -0.0349 0.0362  -0.0576 1750 VAL A CB  
4698 C  CG1 . VAL A 297 ? 0.2188 0.1855 0.3114 -0.0166 0.0639  -0.0397 1750 VAL A CG1 
4699 C  CG2 . VAL A 297 ? 0.2130 0.1625 0.3004 -0.0369 0.0269  -0.0736 1750 VAL A CG2 
4709 N  N   . GLU A 298 ? 0.2112 0.2033 0.2814 -0.0492 0.0256  -0.0578 1751 GLU A N   
4710 C  CA  . GLU A 298 ? 0.2245 0.2243 0.3045 -0.0366 0.0279  -0.0900 1751 GLU A CA  
4711 C  C   . GLU A 298 ? 0.2262 0.2203 0.3081 -0.0568 0.0109  -0.0903 1751 GLU A C   
4712 O  O   . GLU A 298 ? 0.2380 0.2143 0.3186 -0.0596 0.0071  -0.0855 1751 GLU A O   
4713 C  CB  . GLU A 298 ? 0.2615 0.2506 0.3568 -0.0196 0.0202  -0.1171 1751 GLU A CB  
4714 C  CG  . GLU A 298 ? 0.3036 0.2854 0.4403 -0.0077 0.0157  -0.1424 1751 GLU A CG  
4715 C  CD  . GLU A 298 ? 0.3464 0.3172 0.5516 0.0101  0.0134  -0.1473 1751 GLU A CD  
4716 O  OE1 . GLU A 298 ? 0.3675 0.3238 0.5932 -0.0030 -0.0009 -0.1455 1751 GLU A OE1 
4717 O  OE2 . GLU A 298 ? 0.3459 0.3344 0.5990 0.0292  0.0268  -0.1498 1751 GLU A OE2 
4724 N  N   . VAL A 299 ? 0.2304 0.2248 0.3002 -0.0557 0.0365  -0.0783 1752 VAL A N   
4725 C  CA  . VAL A 299 ? 0.2493 0.2369 0.2866 -0.0504 0.0211  -0.0955 1752 VAL A CA  
4726 C  C   . VAL A 299 ? 0.2438 0.2631 0.2978 -0.0472 0.0410  -0.0780 1752 VAL A C   
4727 O  O   . VAL A 299 ? 0.2577 0.2649 0.2871 -0.0433 0.0269  -0.0800 1752 VAL A O   
4728 C  CB  . VAL A 299 ? 0.2639 0.2324 0.3089 -0.0652 0.0176  -0.0864 1752 VAL A CB  
4729 C  CG1 . VAL A 299 ? 0.2506 0.2255 0.3060 -0.0617 0.0142  -0.0909 1752 VAL A CG1 
4730 C  CG2 . VAL A 299 ? 0.2894 0.2389 0.3050 -0.0570 0.0199  -0.0680 1752 VAL A CG2 
4740 N  N   . ASP A 300 ? 0.2486 0.2882 0.3032 -0.0378 0.0625  -0.0654 1753 ASP A N   
4741 C  CA  . ASP A 300 ? 0.2634 0.3122 0.3314 -0.0385 0.0365  -0.0805 1753 ASP A CA  
4742 C  C   . ASP A 300 ? 0.2475 0.3169 0.3233 -0.0264 0.0537  -0.0598 1753 ASP A C   
4743 O  O   . ASP A 300 ? 0.2376 0.3108 0.3573 -0.0242 0.0746  -0.0427 1753 ASP A O   
4744 C  CB  . ASP A 300 ? 0.2913 0.3402 0.3749 -0.0464 0.0107  -0.1088 1753 ASP A CB  
4745 C  CG  . ASP A 300 ? 0.3383 0.3738 0.4249 -0.0480 -0.0384 -0.1283 1753 ASP A CG  
4746 O  OD1 . ASP A 300 ? 0.3578 0.3859 0.4286 -0.0278 -0.0822 -0.1197 1753 ASP A OD1 
4747 O  OD2 . ASP A 300 ? 0.3659 0.4038 0.4586 -0.0475 -0.0439 -0.1337 1753 ASP A OD2 
4752 N  N   . LEU A 301 ? 0.2589 0.3351 0.3120 -0.0181 0.0298  -0.0601 1754 LEU A N   
4753 C  CA  . LEU A 301 ? 0.2857 0.3529 0.2964 -0.0148 0.0331  -0.0466 1754 LEU A CA  
4754 C  C   . LEU A 301 ? 0.2908 0.3723 0.3256 -0.0089 0.0260  -0.0412 1754 LEU A C   
4755 O  O   . LEU A 301 ? 0.3152 0.3810 0.3860 -0.0027 -0.0208 -0.0274 1754 LEU A O   
4756 C  CB  . LEU A 301 ? 0.3070 0.3611 0.2999 -0.0229 0.0290  -0.0341 1754 LEU A CB  
4757 C  CG  . LEU A 301 ? 0.3350 0.3704 0.3326 -0.0392 0.0277  -0.0272 1754 LEU A CG  
4758 C  CD1 . LEU A 301 ? 0.3707 0.3740 0.3869 -0.0381 0.0295  -0.0198 1754 LEU A CD1 
4759 C  CD2 . LEU A 301 ? 0.3550 0.3697 0.3283 -0.0416 0.0145  -0.0387 1754 LEU A CD2 
4771 N  N   . GLU A 302 ? 0.3051 0.3916 0.3018 0.0040  0.0411  -0.0414 1755 GLU A N   
4772 C  CA  . GLU A 302 ? 0.3156 0.4084 0.3426 0.0062  0.0273  -0.0512 1755 GLU A CA  
4773 C  C   . GLU A 302 ? 0.3176 0.4159 0.3695 -0.0059 0.0134  -0.0561 1755 GLU A C   
4774 O  O   . GLU A 302 ? 0.3320 0.4219 0.4159 -0.0129 -0.0153 -0.0446 1755 GLU A O   
4775 C  CB  . GLU A 302 ? 0.3320 0.4118 0.3478 0.0135  0.0245  -0.0574 1755 GLU A CB  
4781 N  N   . HIS A 303 ? 0.2990 0.4179 0.3712 -0.0171 0.0390  -0.0755 1756 HIS A N   
4782 C  CA  . HIS A 303 ? 0.3080 0.4195 0.3706 -0.0296 0.0383  -0.0886 1756 HIS A CA  
4783 C  C   . HIS A 303 ? 0.2908 0.4091 0.3133 -0.0356 0.0140  -0.0972 1756 HIS A C   
4784 O  O   . HIS A 303 ? 0.2756 0.4015 0.3139 -0.0601 -0.0123 -0.0862 1756 HIS A O   
4785 C  CB  . HIS A 303 ? 0.3239 0.4251 0.3945 -0.0441 0.0252  -0.0989 1756 HIS A CB  
4786 C  CG  . HIS A 303 ? 0.3429 0.4360 0.4222 -0.0618 0.0046  -0.1125 1756 HIS A CG  
4787 N  ND1 . HIS A 303 ? 0.3521 0.4394 0.4338 -0.0716 0.0050  -0.1155 1756 HIS A ND1 
4788 C  CD2 . HIS A 303 ? 0.3468 0.4436 0.4218 -0.0825 -0.0279 -0.1236 1756 HIS A CD2 
4789 C  CE1 . HIS A 303 ? 0.3474 0.4396 0.4303 -0.0767 0.0078  -0.1200 1756 HIS A CE1 
4790 N  NE2 . HIS A 303 ? 0.3566 0.4451 0.4425 -0.0825 -0.0055 -0.1117 1756 HIS A NE2 
4799 N  N   . GLU A 304 ? 0.2874 0.4115 0.2906 -0.0333 0.0062  -0.1000 1757 GLU A N   
4800 C  CA  . GLU A 304 ? 0.2805 0.4155 0.2929 -0.0415 -0.0097 -0.0760 1757 GLU A CA  
4801 C  C   . GLU A 304 ? 0.2615 0.4090 0.2659 -0.0488 -0.0324 -0.0915 1757 GLU A C   
4802 O  O   . GLU A 304 ? 0.2778 0.4191 0.2947 -0.0647 -0.0382 -0.0980 1757 GLU A O   
4803 C  CB  . GLU A 304 ? 0.3336 0.4277 0.3296 -0.0384 -0.0108 -0.0535 1757 GLU A CB  
4804 C  CG  . GLU A 304 ? 0.4136 0.4393 0.3817 -0.0317 -0.0098 -0.0379 1757 GLU A CG  
4805 C  CD  . GLU A 304 ? 0.4938 0.4547 0.4501 -0.0321 -0.0260 -0.0238 1757 GLU A CD  
4806 O  OE1 . GLU A 304 ? 0.5127 0.4638 0.4907 -0.0279 -0.0282 -0.0130 1757 GLU A OE1 
4807 O  OE2 . GLU A 304 ? 0.5320 0.4654 0.4967 -0.0332 -0.0242 -0.0084 1757 GLU A OE2 
4814 N  N   . TRP A 305 ? 0.2307 0.3922 0.2620 -0.0378 -0.0249 -0.0880 1758 TRP A N   
4815 C  CA  . TRP A 305 ? 0.2155 0.3707 0.2515 -0.0522 -0.0268 -0.0777 1758 TRP A CA  
4816 C  C   . TRP A 305 ? 0.2000 0.3694 0.2493 -0.0519 -0.0394 -0.0784 1758 TRP A C   
4817 O  O   . TRP A 305 ? 0.2037 0.3687 0.2853 -0.0413 -0.0427 -0.0870 1758 TRP A O   
4818 C  CB  . TRP A 305 ? 0.2208 0.3504 0.2374 -0.0551 -0.0063 -0.0769 1758 TRP A CB  
4819 C  CG  . TRP A 305 ? 0.2136 0.3355 0.2484 -0.0490 -0.0072 -0.0569 1758 TRP A CG  
4820 C  CD1 . TRP A 305 ? 0.2233 0.3363 0.2463 -0.0411 -0.0390 -0.0615 1758 TRP A CD1 
4821 C  CD2 . TRP A 305 ? 0.1985 0.3275 0.2360 -0.0526 -0.0185 -0.0472 1758 TRP A CD2 
4822 N  NE1 . TRP A 305 ? 0.2256 0.3329 0.2548 -0.0320 -0.0216 -0.0411 1758 TRP A NE1 
4823 C  CE2 . TRP A 305 ? 0.2056 0.3265 0.2428 -0.0426 -0.0106 -0.0463 1758 TRP A CE2 
4824 C  CE3 . TRP A 305 ? 0.2093 0.3334 0.2482 -0.0514 -0.0159 -0.0406 1758 TRP A CE3 
4825 C  CZ2 . TRP A 305 ? 0.1985 0.3262 0.2402 -0.0618 -0.0170 -0.0334 1758 TRP A CZ2 
4826 C  CZ3 . TRP A 305 ? 0.2062 0.3343 0.2622 -0.0543 -0.0198 -0.0403 1758 TRP A CZ3 
4827 C  CH2 . TRP A 305 ? 0.2152 0.3308 0.2657 -0.0615 -0.0217 -0.0406 1758 TRP A CH2 
4838 N  N   . THR A 306 ? 0.2097 0.3719 0.2441 -0.0500 -0.0177 -0.0689 1759 THR A N   
4839 C  CA  . THR A 306 ? 0.1991 0.3764 0.2312 -0.0453 -0.0262 -0.0473 1759 THR A CA  
4840 C  C   . THR A 306 ? 0.1988 0.3617 0.2407 -0.0531 -0.0115 -0.0522 1759 THR A C   
4841 O  O   . THR A 306 ? 0.2278 0.3626 0.2629 -0.0693 0.0024  -0.0581 1759 THR A O   
4842 C  CB  . THR A 306 ? 0.2324 0.3921 0.2462 -0.0291 -0.0221 -0.0287 1759 THR A CB  
4843 O  OG1 . THR A 306 ? 0.2744 0.4039 0.2677 -0.0243 -0.0455 -0.0097 1759 THR A OG1 
4844 C  CG2 . THR A 306 ? 0.2344 0.3966 0.2609 -0.0247 -0.0014 -0.0261 1759 THR A CG2 
4852 N  N   . ILE A 307 ? 0.1887 0.3429 0.2238 -0.0387 -0.0270 -0.0597 1760 ILE A N   
4853 C  CA  A ILE A 307 ? 0.1682 0.3339 0.2198 -0.0333 -0.0428 -0.0706 1760 ILE A CA  
4854 C  CA  B ILE A 307 ? 0.1803 0.3407 0.2249 -0.0347 -0.0320 -0.0670 1760 ILE A CA  
4855 C  C   . ILE A 307 ? 0.1685 0.3456 0.2479 -0.0358 -0.0383 -0.0700 1760 ILE A C   
4856 O  O   . ILE A 307 ? 0.1648 0.3568 0.2766 -0.0233 -0.0188 -0.0557 1760 ILE A O   
4857 C  CB  A ILE A 307 ? 0.1560 0.3204 0.2242 -0.0218 -0.0331 -0.0658 1760 ILE A CB  
4858 C  CB  B ILE A 307 ? 0.1870 0.3358 0.2199 -0.0284 -0.0217 -0.0678 1760 ILE A CB  
4859 C  CG1 A ILE A 307 ? 0.1530 0.3224 0.2542 -0.0368 -0.0179 -0.0462 1760 ILE A CG1 
4860 C  CG1 B ILE A 307 ? 0.1951 0.3353 0.2305 -0.0325 -0.0125 -0.0638 1760 ILE A CG1 
4861 C  CG2 A ILE A 307 ? 0.1622 0.3115 0.2485 -0.0137 -0.0456 -0.0697 1760 ILE A CG2 
4862 C  CG2 B ILE A 307 ? 0.1877 0.3336 0.2275 -0.0249 -0.0260 -0.0674 1760 ILE A CG2 
4863 C  CD1 A ILE A 307 ? 0.1252 0.3201 0.2619 -0.0385 -0.0096 -0.0458 1760 ILE A CD1 
4864 C  CD1 B ILE A 307 ? 0.1899 0.3324 0.2267 -0.0358 -0.0067 -0.0678 1760 ILE A CD1 
4887 N  N   . PRO A 308 ? 0.1657 0.3531 0.2709 -0.0430 -0.0320 -0.0710 1761 PRO A N   
4888 C  CA  . PRO A 308 ? 0.1776 0.3590 0.2904 -0.0569 -0.0139 -0.0602 1761 PRO A CA  
4889 C  C   . PRO A 308 ? 0.1464 0.3636 0.2807 -0.0626 -0.0209 -0.0544 1761 PRO A C   
4890 O  O   . PRO A 308 ? 0.1692 0.3583 0.2954 -0.0636 -0.0288 -0.0492 1761 PRO A O   
4891 C  CB  . PRO A 308 ? 0.1894 0.3579 0.2908 -0.0695 -0.0218 -0.0692 1761 PRO A CB  
4892 C  CG  . PRO A 308 ? 0.1878 0.3583 0.2912 -0.0670 0.0090  -0.0680 1761 PRO A CG  
4893 C  CD  . PRO A 308 ? 0.1919 0.3534 0.2801 -0.0592 -0.0251 -0.0727 1761 PRO A CD  
4901 N  N   . SER A 309 ? 0.1397 0.3755 0.2834 -0.0494 -0.0038 -0.0464 1762 SER A N   
4902 C  CA  . SER A 309 ? 0.1302 0.3758 0.2962 -0.0406 0.0022  -0.0491 1762 SER A CA  
4903 C  C   . SER A 309 ? 0.1542 0.3596 0.2811 -0.0331 -0.0007 -0.0523 1762 SER A C   
4904 O  O   . SER A 309 ? 0.1823 0.3570 0.2711 -0.0408 -0.0188 -0.0362 1762 SER A O   
4905 C  CB  . SER A 309 ? 0.1445 0.3889 0.3516 -0.0579 -0.0194 -0.0342 1762 SER A CB  
4906 O  OG  . SER A 309 ? 0.1699 0.3999 0.4025 -0.0770 -0.0345 -0.0388 1762 SER A OG  
4912 N  N   . HIS A 310 ? 0.1448 0.3539 0.2879 -0.0384 -0.0182 -0.0798 1763 HIS A N   
4913 C  CA  . HIS A 310 ? 0.1561 0.3443 0.2993 -0.0388 0.0042  -0.0806 1763 HIS A CA  
4914 C  C   . HIS A 310 ? 0.1546 0.3378 0.3040 -0.0324 -0.0088 -0.0658 1763 HIS A C   
4915 O  O   . HIS A 310 ? 0.1856 0.3442 0.3244 -0.0348 0.0111  -0.0444 1763 HIS A O   
4916 C  CB  . HIS A 310 ? 0.1853 0.3429 0.3286 -0.0559 0.0056  -0.0901 1763 HIS A CB  
4917 C  CG  . HIS A 310 ? 0.2143 0.3527 0.3976 -0.0713 0.0038  -0.0734 1763 HIS A CG  
4918 N  ND1 . HIS A 310 ? 0.2234 0.3576 0.4036 -0.0737 -0.0153 -0.0736 1763 HIS A ND1 
4919 C  CD2 . HIS A 310 ? 0.2260 0.3535 0.4325 -0.0780 0.0016  -0.0739 1763 HIS A CD2 
4920 C  CE1 . HIS A 310 ? 0.2222 0.3584 0.4245 -0.0775 -0.0057 -0.0702 1763 HIS A CE1 
4921 N  NE2 . HIS A 310 ? 0.2348 0.3563 0.4561 -0.0740 -0.0047 -0.0737 1763 HIS A NE2 
4930 N  N   . MET A 311 ? 0.1306 0.3237 0.3031 -0.0388 -0.0087 -0.0488 1764 MET A N   
4931 C  CA  . MET A 311 ? 0.1505 0.3159 0.2917 -0.0583 -0.0038 -0.0505 1764 MET A CA  
4932 C  C   . MET A 311 ? 0.1776 0.2945 0.3102 -0.0530 -0.0080 -0.0679 1764 MET A C   
4933 O  O   . MET A 311 ? 0.1835 0.2823 0.3461 -0.0477 0.0168  -0.0620 1764 MET A O   
4934 C  CB  . MET A 311 ? 0.1531 0.3298 0.2868 -0.0638 -0.0142 -0.0243 1764 MET A CB  
4935 C  CG  . MET A 311 ? 0.1854 0.3484 0.3150 -0.0686 -0.0417 -0.0109 1764 MET A CG  
4936 S  SD  . MET A 311 ? 0.2344 0.3659 0.3652 -0.0823 -0.0617 0.0170  1764 MET A SD  
4937 C  CE  . MET A 311 ? 0.2351 0.3707 0.3577 -0.0669 -0.0556 0.0168  1764 MET A CE  
4947 N  N   . PRO A 312 ? 0.1937 0.2826 0.3315 -0.0717 -0.0068 -0.0893 1765 PRO A N   
4948 C  CA  . PRO A 312 ? 0.2119 0.2770 0.3475 -0.0794 -0.0098 -0.0730 1765 PRO A CA  
4949 C  C   . PRO A 312 ? 0.1874 0.2622 0.3383 -0.0912 -0.0192 -0.0675 1765 PRO A C   
4950 O  O   . PRO A 312 ? 0.2195 0.2819 0.3851 -0.1007 -0.0201 -0.0255 1765 PRO A O   
4951 C  CB  . PRO A 312 ? 0.2663 0.2850 0.3393 -0.0736 0.0063  -0.0896 1765 PRO A CB  
4952 C  CG  . PRO A 312 ? 0.2717 0.2896 0.3469 -0.0641 0.0041  -0.0931 1765 PRO A CG  
4953 C  CD  . PRO A 312 ? 0.2334 0.2897 0.3356 -0.0690 -0.0195 -0.0896 1765 PRO A CD  
4961 N  N   . PHE A 313 ? 0.1883 0.2429 0.3312 -0.0719 -0.0196 -0.0858 1766 PHE A N   
4962 C  CA  . PHE A 313 ? 0.1612 0.2120 0.3414 -0.0470 -0.0062 -0.0785 1766 PHE A CA  
4963 C  C   . PHE A 313 ? 0.1701 0.2049 0.3283 -0.0613 -0.0028 -0.0568 1766 PHE A C   
4964 O  O   . PHE A 313 ? 0.2112 0.2240 0.3771 -0.0444 -0.0111 -0.0482 1766 PHE A O   
4965 C  CB  . PHE A 313 ? 0.1641 0.2022 0.3566 -0.0418 -0.0035 -0.0959 1766 PHE A CB  
4966 C  CG  . PHE A 313 ? 0.2056 0.1912 0.3822 -0.0379 0.0242  -0.1125 1766 PHE A CG  
4967 C  CD1 . PHE A 313 ? 0.2337 0.1876 0.3971 -0.0414 0.0445  -0.1094 1766 PHE A CD1 
4968 C  CD2 . PHE A 313 ? 0.2317 0.1891 0.4031 -0.0364 0.0486  -0.1157 1766 PHE A CD2 
4969 C  CE1 . PHE A 313 ? 0.2532 0.1887 0.4195 -0.0516 0.0574  -0.1127 1766 PHE A CE1 
4970 C  CE2 . PHE A 313 ? 0.2564 0.1924 0.4234 -0.0320 0.0727  -0.1180 1766 PHE A CE2 
4971 C  CZ  . PHE A 313 ? 0.2561 0.1918 0.4242 -0.0322 0.0817  -0.1228 1766 PHE A CZ  
4981 N  N   . SER A 314 ? 0.1578 0.1858 0.3103 -0.0548 0.0068  -0.0204 1767 SER A N   
4982 C  CA  A SER A 314 ? 0.1529 0.1877 0.2934 -0.0476 -0.0046 -0.0308 1767 SER A CA  
4983 C  CA  B SER A 314 ? 0.1566 0.1849 0.3018 -0.0392 0.0139  -0.0253 1767 SER A CA  
4984 C  C   . SER A 314 ? 0.1428 0.1930 0.2938 -0.0435 -0.0204 -0.0356 1767 SER A C   
4985 O  O   . SER A 314 ? 0.1466 0.2075 0.3096 -0.0377 -0.0278 -0.0333 1767 SER A O   
4986 C  CB  A SER A 314 ? 0.1593 0.1853 0.2820 -0.0457 -0.0045 -0.0362 1767 SER A CB  
4987 C  CB  B SER A 314 ? 0.1417 0.1830 0.2835 -0.0310 0.0291  -0.0196 1767 SER A CB  
4988 O  OG  A SER A 314 ? 0.1655 0.1839 0.2757 -0.0445 -0.0079 -0.0400 1767 SER A OG  
4989 O  OG  B SER A 314 ? 0.1729 0.1823 0.2927 -0.0195 0.0282  -0.0124 1767 SER A OG  
5000 N  N   . LYS A 315 ? 0.1379 0.1980 0.3092 -0.0421 -0.0005 -0.0150 1768 LYS A N   
5001 C  CA  . LYS A 315 ? 0.1487 0.2174 0.3204 -0.0554 0.0004  -0.0094 1768 LYS A CA  
5002 C  C   . LYS A 315 ? 0.1358 0.2195 0.3218 -0.0410 0.0045  -0.0229 1768 LYS A C   
5003 O  O   . LYS A 315 ? 0.1471 0.2445 0.3548 -0.0287 0.0053  -0.0113 1768 LYS A O   
5004 C  CB  . LYS A 315 ? 0.1930 0.2388 0.3170 -0.0593 -0.0063 -0.0038 1768 LYS A CB  
5005 C  CG  . LYS A 315 ? 0.2100 0.2536 0.3582 -0.0701 0.0097  0.0226  1768 LYS A CG  
5006 C  CD  . LYS A 315 ? 0.2615 0.2692 0.4079 -0.0681 0.0136  0.0407  1768 LYS A CD  
5007 C  CE  . LYS A 315 ? 0.2956 0.2881 0.4377 -0.0693 0.0195  0.0392  1768 LYS A CE  
5008 N  NZ  . LYS A 315 ? 0.3431 0.2936 0.4529 -0.0586 0.0081  0.0453  1768 LYS A NZ  
5022 N  N   . ALA A 316 ? 0.1492 0.2073 0.2999 -0.0213 -0.0184 -0.0239 1769 ALA A N   
5023 C  CA  . ALA A 316 ? 0.1503 0.1993 0.2919 -0.0148 -0.0410 -0.0270 1769 ALA A CA  
5024 C  C   . ALA A 316 ? 0.1617 0.2119 0.3112 -0.0300 -0.0130 -0.0259 1769 ALA A C   
5025 O  O   . ALA A 316 ? 0.1553 0.2156 0.3155 -0.0187 -0.0044 -0.0216 1769 ALA A O   
5026 C  CB  . ALA A 316 ? 0.1432 0.1812 0.2942 -0.0195 -0.0344 -0.0324 1769 ALA A CB  
5032 N  N   . HIS A 317 ? 0.1691 0.2235 0.3152 -0.0368 0.0066  -0.0206 1770 HIS A N   
5033 C  CA  . HIS A 317 ? 0.1672 0.2356 0.3145 -0.0521 -0.0044 -0.0282 1770 HIS A CA  
5034 C  C   . HIS A 317 ? 0.1541 0.2390 0.2994 -0.0513 -0.0104 -0.0262 1770 HIS A C   
5035 O  O   . HIS A 317 ? 0.1912 0.2518 0.3126 -0.0486 0.0018  -0.0145 1770 HIS A O   
5036 C  CB  . HIS A 317 ? 0.1904 0.2503 0.3494 -0.0693 -0.0370 -0.0428 1770 HIS A CB  
5037 C  CG  . HIS A 317 ? 0.2484 0.2756 0.4109 -0.0789 -0.0236 -0.0435 1770 HIS A CG  
5038 N  ND1 . HIS A 317 ? 0.2856 0.2939 0.4484 -0.0816 -0.0443 -0.0414 1770 HIS A ND1 
5039 C  CD2 . HIS A 317 ? 0.2585 0.2865 0.4217 -0.0935 -0.0599 -0.0379 1770 HIS A CD2 
5040 C  CE1 . HIS A 317 ? 0.2983 0.2982 0.4618 -0.0930 -0.0547 -0.0407 1770 HIS A CE1 
5041 N  NE2 . HIS A 317 ? 0.2994 0.3008 0.4628 -0.0957 -0.0471 -0.0371 1770 HIS A NE2 
5050 N  N   . TRP A 318 ? 0.1432 0.2366 0.2946 -0.0522 -0.0088 -0.0291 1771 TRP A N   
5051 C  CA  . TRP A 318 ? 0.1245 0.2307 0.2323 -0.0407 -0.0107 -0.0399 1771 TRP A CA  
5052 C  C   . TRP A 318 ? 0.1271 0.2368 0.2296 -0.0351 -0.0287 -0.0355 1771 TRP A C   
5053 O  O   . TRP A 318 ? 0.1372 0.2410 0.2441 -0.0304 -0.0392 -0.0354 1771 TRP A O   
5054 C  CB  . TRP A 318 ? 0.1285 0.2257 0.2561 -0.0180 -0.0217 -0.0321 1771 TRP A CB  
5055 C  CG  . TRP A 318 ? 0.1204 0.2097 0.2482 -0.0114 -0.0420 -0.0212 1771 TRP A CG  
5056 C  CD1 . TRP A 318 ? 0.1470 0.2052 0.2634 -0.0152 -0.0306 -0.0272 1771 TRP A CD1 
5057 C  CD2 . TRP A 318 ? 0.1241 0.2065 0.2488 0.0062  -0.0081 -0.0345 1771 TRP A CD2 
5058 N  NE1 . TRP A 318 ? 0.1506 0.2041 0.2674 -0.0013 -0.0030 -0.0273 1771 TRP A NE1 
5059 C  CE2 . TRP A 318 ? 0.1314 0.2049 0.2617 0.0121  -0.0048 -0.0278 1771 TRP A CE2 
5060 C  CE3 . TRP A 318 ? 0.1373 0.2201 0.2668 0.0099  -0.0072 -0.0234 1771 TRP A CE3 
5061 C  CZ2 . TRP A 318 ? 0.1290 0.2077 0.2551 0.0019  -0.0218 -0.0251 1771 TRP A CZ2 
5062 C  CZ3 . TRP A 318 ? 0.1371 0.2199 0.2503 0.0082  0.0050  -0.0202 1771 TRP A CZ3 
5063 C  CH2 . TRP A 318 ? 0.1339 0.2184 0.2444 0.0040  -0.0049 -0.0170 1771 TRP A CH2 
5074 N  N   . THR A 319 ? 0.1293 0.2345 0.2174 -0.0321 -0.0122 -0.0348 1772 THR A N   
5075 C  CA  . THR A 319 ? 0.1200 0.2330 0.2173 -0.0247 -0.0152 -0.0193 1772 THR A CA  
5076 C  C   . THR A 319 ? 0.1170 0.2322 0.2209 -0.0239 -0.0314 -0.0205 1772 THR A C   
5077 O  O   . THR A 319 ? 0.1231 0.2475 0.2580 -0.0257 -0.0311 -0.0135 1772 THR A O   
5078 C  CB  . THR A 319 ? 0.1334 0.2376 0.2211 -0.0282 -0.0428 -0.0289 1772 THR A CB  
5079 O  OG1 . THR A 319 ? 0.1429 0.2336 0.2355 -0.0343 -0.0278 -0.0248 1772 THR A OG1 
5080 C  CG2 . THR A 319 ? 0.1650 0.2460 0.2276 -0.0256 -0.0303 -0.0200 1772 THR A CG2 
5088 N  N   . PRO A 320 ? 0.1433 0.2123 0.2416 -0.0183 -0.0394 -0.0238 1773 PRO A N   
5089 C  CA  . PRO A 320 ? 0.1533 0.2138 0.2477 -0.0097 -0.0366 -0.0261 1773 PRO A CA  
5090 C  C   . PRO A 320 ? 0.1419 0.2218 0.2356 -0.0026 -0.0148 -0.0288 1773 PRO A C   
5091 O  O   . PRO A 320 ? 0.1706 0.2248 0.2338 0.0061  -0.0138 -0.0062 1773 PRO A O   
5092 C  CB  . PRO A 320 ? 0.1602 0.2058 0.2321 -0.0007 -0.0153 -0.0263 1773 PRO A CB  
5093 C  CG  . PRO A 320 ? 0.1514 0.2056 0.2458 -0.0068 -0.0313 -0.0100 1773 PRO A CG  
5094 C  CD  . PRO A 320 ? 0.1552 0.2026 0.2298 -0.0152 -0.0262 -0.0178 1773 PRO A CD  
5102 N  N   . PHE A 321 ? 0.1239 0.2317 0.2179 0.0046  0.0013  -0.0379 1774 PHE A N   
5103 C  CA  . PHE A 321 ? 0.1364 0.2519 0.2218 -0.0036 -0.0172 -0.0314 1774 PHE A CA  
5104 C  C   . PHE A 321 ? 0.1436 0.2864 0.2431 0.0025  -0.0204 -0.0309 1774 PHE A C   
5105 O  O   . PHE A 321 ? 0.1620 0.2920 0.2326 0.0107  -0.0071 -0.0341 1774 PHE A O   
5106 C  CB  . PHE A 321 ? 0.1600 0.2367 0.2271 -0.0154 -0.0111 -0.0194 1774 PHE A CB  
5107 C  CG  . PHE A 321 ? 0.1329 0.2196 0.2227 -0.0243 -0.0234 -0.0326 1774 PHE A CG  
5108 C  CD1 . PHE A 321 ? 0.1458 0.2180 0.2140 -0.0095 -0.0342 -0.0324 1774 PHE A CD1 
5109 C  CD2 . PHE A 321 ? 0.1323 0.2082 0.2374 -0.0149 -0.0256 -0.0488 1774 PHE A CD2 
5110 C  CE1 . PHE A 321 ? 0.1548 0.2082 0.2341 -0.0096 -0.0183 -0.0428 1774 PHE A CE1 
5111 C  CE2 . PHE A 321 ? 0.1351 0.2027 0.2230 -0.0099 -0.0157 -0.0481 1774 PHE A CE2 
5112 C  CZ  . PHE A 321 ? 0.1419 0.2048 0.2252 -0.0159 -0.0115 -0.0542 1774 PHE A CZ  
5122 N  N   . GLU A 322 ? 0.1335 0.3119 0.2277 -0.0109 -0.0508 -0.0338 1775 GLU A N   
5123 C  CA  . GLU A 322 ? 0.1400 0.3356 0.2209 -0.0140 -0.0598 -0.0432 1775 GLU A CA  
5124 C  C   . GLU A 322 ? 0.1693 0.3443 0.2430 -0.0115 -0.0464 -0.0452 1775 GLU A C   
5125 O  O   . GLU A 322 ? 0.1832 0.3480 0.2444 0.0043  -0.0361 -0.0518 1775 GLU A O   
5126 C  CB  . GLU A 322 ? 0.1453 0.3534 0.2504 -0.0159 -0.0500 -0.0369 1775 GLU A CB  
5127 C  CG  . GLU A 322 ? 0.1541 0.3721 0.2831 -0.0136 -0.0277 -0.0421 1775 GLU A CG  
5128 C  CD  . GLU A 322 ? 0.2087 0.3948 0.3278 -0.0179 -0.0326 -0.0584 1775 GLU A CD  
5129 O  OE1 . GLU A 322 ? 0.2245 0.4012 0.3381 -0.0339 -0.0132 -0.0595 1775 GLU A OE1 
5130 O  OE2 . GLU A 322 ? 0.2286 0.4068 0.3292 -0.0110 -0.0660 -0.0691 1775 GLU A OE2 
5137 N  N   . GLY A 323 ? 0.1809 0.3505 0.2309 -0.0052 -0.0576 -0.0433 1776 GLY A N   
5138 C  CA  . GLY A 323 ? 0.2126 0.3577 0.2296 -0.0029 -0.0483 -0.0371 1776 GLY A CA  
5139 C  C   . GLY A 323 ? 0.2402 0.3666 0.2414 0.0076  -0.0474 -0.0321 1776 GLY A C   
5140 O  O   . GLY A 323 ? 0.2749 0.3702 0.2741 0.0095  -0.0393 -0.0218 1776 GLY A O   
5144 N  N   . GLN A 324 ? 0.2244 0.3706 0.2256 0.0044  -0.0496 -0.0331 1777 GLN A N   
5145 C  CA  . GLN A 324 ? 0.2170 0.3674 0.2341 0.0013  -0.0279 -0.0326 1777 GLN A CA  
5146 C  C   . GLN A 324 ? 0.2053 0.3629 0.2197 0.0006  -0.0536 -0.0221 1777 GLN A C   
5147 O  O   . GLN A 324 ? 0.2186 0.3605 0.2152 -0.0066 -0.0170 -0.0195 1777 GLN A O   
5148 C  CB  . GLN A 324 ? 0.2352 0.3715 0.2520 0.0070  -0.0239 -0.0480 1777 GLN A CB  
5149 C  CG  . GLN A 324 ? 0.2510 0.3733 0.2968 0.0264  -0.0198 -0.0687 1777 GLN A CG  
5150 C  CD  . GLN A 324 ? 0.2726 0.3761 0.3489 0.0327  -0.0246 -0.0792 1777 GLN A CD  
5151 O  OE1 . GLN A 324 ? 0.3115 0.3834 0.4041 0.0241  -0.0565 -0.0953 1777 GLN A OE1 
5152 N  NE2 . GLN A 324 ? 0.2649 0.3770 0.3551 0.0300  -0.0292 -0.0631 1777 GLN A NE2 
5161 N  N   . LYS A 325 ? 0.2200 0.3650 0.2482 -0.0032 -0.0302 -0.0231 1778 LYS A N   
5162 C  CA  A LYS A 325 ? 0.2387 0.3741 0.2807 -0.0110 -0.0289 -0.0229 1778 LYS A CA  
5163 C  CA  B LYS A 325 ? 0.2389 0.3732 0.2801 -0.0086 -0.0278 -0.0232 1778 LYS A CA  
5164 C  C   . LYS A 325 ? 0.2228 0.3653 0.2650 -0.0190 -0.0288 -0.0342 1778 LYS A C   
5165 O  O   . LYS A 325 ? 0.2188 0.3625 0.3247 -0.0288 -0.0391 -0.0388 1778 LYS A O   
5166 C  CB  A LYS A 325 ? 0.2603 0.3901 0.3228 -0.0130 -0.0332 -0.0149 1778 LYS A CB  
5167 C  CB  B LYS A 325 ? 0.2592 0.3874 0.3208 -0.0056 -0.0296 -0.0157 1778 LYS A CB  
5168 C  CG  A LYS A 325 ? 0.2962 0.4043 0.3623 -0.0122 -0.0275 -0.0056 1778 LYS A CG  
5169 C  CG  B LYS A 325 ? 0.2927 0.4002 0.3587 -0.0003 -0.0197 -0.0062 1778 LYS A CG  
5170 C  CD  A LYS A 325 ? 0.3303 0.4139 0.4035 -0.0133 -0.0340 -0.0011 1778 LYS A CD  
5171 C  CD  B LYS A 325 ? 0.3263 0.4092 0.3995 0.0055  -0.0162 -0.0011 1778 LYS A CD  
5172 C  CE  A LYS A 325 ? 0.3607 0.4197 0.4282 -0.0119 -0.0408 0.0032  1778 LYS A CE  
5173 C  CE  B LYS A 325 ? 0.3578 0.4151 0.4248 0.0146  -0.0079 0.0034  1778 LYS A CE  
5174 N  NZ  A LYS A 325 ? 0.3853 0.4247 0.4545 -0.0156 -0.0309 0.0073  1778 LYS A NZ  
5175 N  NZ  B LYS A 325 ? 0.3821 0.4204 0.4432 0.0167  -0.0034 0.0086  1778 LYS A NZ  
5202 N  N   . VAL A 326 ? 0.2007 0.3516 0.2106 -0.0264 -0.0227 -0.0424 1779 VAL A N   
5203 C  CA  . VAL A 326 ? 0.2011 0.3425 0.2236 -0.0315 -0.0067 -0.0634 1779 VAL A CA  
5204 C  C   . VAL A 326 ? 0.1932 0.3348 0.2282 -0.0393 -0.0015 -0.0787 1779 VAL A C   
5205 O  O   . VAL A 326 ? 0.1938 0.3474 0.2574 -0.0376 -0.0376 -0.0696 1779 VAL A O   
5206 C  CB  . VAL A 326 ? 0.1937 0.3395 0.2322 -0.0390 -0.0173 -0.0639 1779 VAL A CB  
5207 C  CG1 . VAL A 326 ? 0.2010 0.3447 0.2312 -0.0391 -0.0169 -0.0602 1779 VAL A CG1 
5208 C  CG2 . VAL A 326 ? 0.1946 0.3379 0.2687 -0.0412 -0.0267 -0.0468 1779 VAL A CG2 
5218 N  N   . LYS A 327 ? 0.1950 0.3231 0.2519 -0.0338 0.0039  -0.0752 1780 LYS A N   
5219 C  CA  . LYS A 327 ? 0.2312 0.3124 0.2659 -0.0435 0.0070  -0.0647 1780 LYS A CA  
5220 C  C   . LYS A 327 ? 0.2406 0.2910 0.3282 -0.0430 -0.0130 -0.0483 1780 LYS A C   
5221 O  O   . LYS A 327 ? 0.2595 0.2786 0.3490 -0.0448 -0.0047 -0.0506 1780 LYS A O   
5222 C  CB  . LYS A 327 ? 0.2820 0.3266 0.2913 -0.0477 0.0310  -0.0584 1780 LYS A CB  
5223 C  CG  . LYS A 327 ? 0.3399 0.3464 0.3362 -0.0522 0.0273  -0.0385 1780 LYS A CG  
5224 C  CD  . LYS A 327 ? 0.3978 0.3675 0.3915 -0.0426 0.0422  -0.0261 1780 LYS A CD  
5225 C  CE  . LYS A 327 ? 0.4513 0.3842 0.4468 -0.0401 0.0575  -0.0039 1780 LYS A CE  
5226 N  NZ  . LYS A 327 ? 0.4755 0.3937 0.4965 -0.0503 0.0681  0.0117  1780 LYS A NZ  
5240 N  N   . GLY A 328 ? 0.2198 0.2730 0.3573 -0.0476 -0.0295 -0.0318 1781 GLY A N   
5241 C  CA  . GLY A 328 ? 0.2232 0.2611 0.3820 -0.0412 -0.0247 -0.0222 1781 GLY A CA  
5242 C  C   . GLY A 328 ? 0.2161 0.2435 0.3540 -0.0292 -0.0186 -0.0439 1781 GLY A C   
5243 O  O   . GLY A 328 ? 0.2121 0.2375 0.3350 -0.0276 -0.0264 -0.0719 1781 GLY A O   
5247 N  N   . THR A 329 ? 0.2160 0.2263 0.3149 -0.0196 0.0011  -0.0543 1782 THR A N   
5248 C  CA  A THR A 329 ? 0.2293 0.2317 0.3245 -0.0374 0.0092  -0.0566 1782 THR A CA  
5249 C  CA  B THR A 329 ? 0.2283 0.2268 0.3143 -0.0358 0.0063  -0.0451 1782 THR A CA  
5250 C  C   . THR A 329 ? 0.2287 0.2177 0.3137 -0.0487 0.0132  -0.0570 1782 THR A C   
5251 O  O   . THR A 329 ? 0.2339 0.2290 0.3039 -0.0502 0.0269  -0.0602 1782 THR A O   
5252 C  CB  A THR A 329 ? 0.2904 0.2517 0.3929 -0.0535 0.0013  -0.0278 1782 THR A CB  
5253 C  CB  B THR A 329 ? 0.2545 0.2379 0.3354 -0.0400 0.0071  -0.0142 1782 THR A CB  
5254 O  OG1 A THR A 329 ? 0.3216 0.2782 0.4544 -0.0562 0.0068  -0.0074 1782 THR A OG1 
5255 O  OG1 B THR A 329 ? 0.2615 0.2385 0.3205 -0.0408 -0.0022 -0.0059 1782 THR A OG1 
5256 C  CG2 A THR A 329 ? 0.3004 0.2408 0.3550 -0.0529 -0.0421 -0.0542 1782 THR A CG2 
5257 C  CG2 B THR A 329 ? 0.2659 0.2448 0.3552 -0.0449 0.0072  -0.0022 1782 THR A CG2 
5272 N  N   . VAL A 330 ? 0.2328 0.1981 0.3012 -0.0590 0.0053  -0.0720 1783 VAL A N   
5273 C  CA  . VAL A 330 ? 0.2557 0.1982 0.3108 -0.0690 0.0021  -0.0732 1783 VAL A CA  
5274 C  C   . VAL A 330 ? 0.2409 0.2071 0.3373 -0.0826 0.0043  -0.0720 1783 VAL A C   
5275 O  O   . VAL A 330 ? 0.2253 0.2256 0.3678 -0.0768 -0.0180 -0.0738 1783 VAL A O   
5276 C  CB  . VAL A 330 ? 0.2963 0.1939 0.3099 -0.0858 -0.0004 -0.0661 1783 VAL A CB  
5277 C  CG1 . VAL A 330 ? 0.3001 0.1979 0.3262 -0.0815 -0.0119 -0.0441 1783 VAL A CG1 
5278 C  CG2 . VAL A 330 ? 0.3216 0.1887 0.2830 -0.0928 -0.0130 -0.0883 1783 VAL A CG2 
5288 N  N   . ARG A 331 ? 0.2491 0.1970 0.3453 -0.0775 0.0071  -0.0826 1784 ARG A N   
5289 C  CA  A ARG A 331 ? 0.2720 0.2017 0.3479 -0.0872 -0.0060 -0.0776 1784 ARG A CA  
5290 C  CA  B ARG A 331 ? 0.2812 0.2017 0.3494 -0.0850 0.0001  -0.0766 1784 ARG A CA  
5291 C  C   . ARG A 331 ? 0.2850 0.2026 0.3510 -0.0959 0.0015  -0.0763 1784 ARG A C   
5292 O  O   . ARG A 331 ? 0.2939 0.2012 0.4158 -0.1131 -0.0160 -0.0619 1784 ARG A O   
5293 C  CB  A ARG A 331 ? 0.3031 0.2116 0.3562 -0.0899 0.0065  -0.0691 1784 ARG A CB  
5294 C  CB  B ARG A 331 ? 0.3175 0.2086 0.3577 -0.0824 0.0083  -0.0680 1784 ARG A CB  
5295 C  CG  A ARG A 331 ? 0.3400 0.2292 0.3569 -0.0780 0.0230  -0.0535 1784 ARG A CG  
5296 C  CG  B ARG A 331 ? 0.3550 0.2195 0.3668 -0.0723 0.0178  -0.0560 1784 ARG A CG  
5297 C  CD  A ARG A 331 ? 0.3399 0.2335 0.3444 -0.0924 0.0345  -0.0415 1784 ARG A CD  
5298 C  CD  B ARG A 331 ? 0.3787 0.2258 0.3747 -0.0708 0.0247  -0.0463 1784 ARG A CD  
5299 N  NE  A ARG A 331 ? 0.3435 0.2379 0.3417 -0.1048 0.0375  -0.0312 1784 ARG A NE  
5300 N  NE  B ARG A 331 ? 0.3996 0.2342 0.3901 -0.0676 0.0248  -0.0391 1784 ARG A NE  
5301 C  CZ  A ARG A 331 ? 0.3722 0.2475 0.3570 -0.0944 0.0498  -0.0099 1784 ARG A CZ  
5302 C  CZ  B ARG A 331 ? 0.4131 0.2368 0.4009 -0.0656 0.0364  -0.0329 1784 ARG A CZ  
5303 N  NH1 A ARG A 331 ? 0.3776 0.2423 0.3531 -0.0961 0.0141  -0.0188 1784 ARG A NH1 
5304 N  NH1 B ARG A 331 ? 0.4177 0.2357 0.4026 -0.0661 0.0318  -0.0321 1784 ARG A NH1 
5305 N  NH2 A ARG A 331 ? 0.4031 0.2645 0.3680 -0.0717 0.0483  -0.0039 1784 ARG A NH2 
5306 N  NH2 B ARG A 331 ? 0.4218 0.2397 0.4184 -0.0679 0.0451  -0.0269 1784 ARG A NH2 
5333 N  N   . ARG A 332 ? 0.2808 0.1970 0.3378 -0.0899 0.0282  -0.0806 1785 ARG A N   
5334 C  CA  A ARG A 332 ? 0.2886 0.1978 0.3381 -0.0838 0.0526  -0.0847 1785 ARG A CA  
5335 C  CA  B ARG A 332 ? 0.2855 0.1962 0.3394 -0.0862 0.0443  -0.0803 1785 ARG A CA  
5336 C  C   . ARG A 332 ? 0.2656 0.1834 0.3314 -0.0771 0.0516  -0.0811 1785 ARG A C   
5337 O  O   . ARG A 332 ? 0.2780 0.1797 0.3492 -0.0826 0.0508  -0.0610 1785 ARG A O   
5338 C  CB  A ARG A 332 ? 0.3288 0.2137 0.3613 -0.0721 0.0392  -0.0978 1785 ARG A CB  
5339 C  CB  B ARG A 332 ? 0.3173 0.2090 0.3638 -0.0808 0.0219  -0.0837 1785 ARG A CB  
5340 C  CG  A ARG A 332 ? 0.3680 0.2256 0.3749 -0.0589 0.0458  -0.1117 1785 ARG A CG  
5341 C  CG  B ARG A 332 ? 0.3492 0.2194 0.3846 -0.0730 0.0117  -0.0881 1785 ARG A CG  
5342 C  CD  A ARG A 332 ? 0.3982 0.2407 0.4049 -0.0498 0.0483  -0.1059 1785 ARG A CD  
5343 C  CD  B ARG A 332 ? 0.3725 0.2290 0.4118 -0.0756 0.0026  -0.0946 1785 ARG A CD  
5344 N  NE  A ARG A 332 ? 0.4152 0.2552 0.4288 -0.0474 0.0612  -0.0998 1785 ARG A NE  
5345 N  NE  B ARG A 332 ? 0.3879 0.2362 0.4327 -0.0753 -0.0043 -0.0908 1785 ARG A NE  
5346 C  CZ  A ARG A 332 ? 0.4325 0.2696 0.4450 -0.0365 0.0559  -0.0901 1785 ARG A CZ  
5347 C  CZ  B ARG A 332 ? 0.3936 0.2308 0.4475 -0.0896 -0.0039 -0.0777 1785 ARG A CZ  
5348 N  NH1 A ARG A 332 ? 0.4525 0.2805 0.4700 -0.0322 0.0555  -0.0771 1785 ARG A NH1 
5349 N  NH1 B ARG A 332 ? 0.3762 0.2241 0.4460 -0.1172 -0.0208 -0.0773 1785 ARG A NH1 
5350 N  NH2 A ARG A 332 ? 0.4459 0.2700 0.4562 -0.0312 0.0502  -0.1024 1785 ARG A NH2 
5351 N  NH2 B ARG A 332 ? 0.4007 0.2335 0.4467 -0.0779 -0.0020 -0.0734 1785 ARG A NH2 
5378 N  N   . VAL A 333 ? 0.2340 0.1605 0.3149 -0.0711 0.0370  -0.0873 1786 VAL A N   
5379 C  CA  . VAL A 333 ? 0.2198 0.1419 0.3026 -0.0502 0.0508  -0.0709 1786 VAL A CA  
5380 C  C   . VAL A 333 ? 0.2273 0.1309 0.3251 -0.0579 0.0503  -0.0607 1786 VAL A C   
5381 O  O   . VAL A 333 ? 0.2384 0.1399 0.3721 -0.0570 0.0433  -0.0385 1786 VAL A O   
5382 C  CB  . VAL A 333 ? 0.2225 0.1479 0.2918 -0.0542 0.0474  -0.0528 1786 VAL A CB  
5383 C  CG1 . VAL A 333 ? 0.2136 0.1579 0.3016 -0.0375 0.0296  -0.0394 1786 VAL A CG1 
5384 C  CG2 . VAL A 333 ? 0.2115 0.1428 0.3063 -0.0522 0.0374  -0.0464 1786 VAL A CG2 
5394 N  N   . VAL A 334 ? 0.2375 0.1300 0.3222 -0.0455 0.0613  -0.0546 1787 VAL A N   
5395 C  CA  . VAL A 334 ? 0.2349 0.1376 0.3296 -0.0420 0.0502  -0.0517 1787 VAL A CA  
5396 C  C   . VAL A 334 ? 0.2215 0.1202 0.3233 -0.0457 0.0633  -0.0468 1787 VAL A C   
5397 O  O   . VAL A 334 ? 0.2011 0.1113 0.3563 -0.0345 0.0617  -0.0448 1787 VAL A O   
5398 C  CB  . VAL A 334 ? 0.2561 0.1519 0.3393 -0.0315 0.0603  -0.0553 1787 VAL A CB  
5399 C  CG1 . VAL A 334 ? 0.2518 0.1620 0.3621 -0.0216 0.0900  -0.0544 1787 VAL A CG1 
5400 C  CG2 . VAL A 334 ? 0.2570 0.1615 0.3339 -0.0232 0.0524  -0.0631 1787 VAL A CG2 
5410 N  N   . LEU A 335 ? 0.2299 0.1210 0.3238 -0.0333 0.0578  -0.0381 1788 LEU A N   
5411 C  CA  . LEU A 335 ? 0.2140 0.1201 0.3222 -0.0185 0.0484  -0.0259 1788 LEU A CA  
5412 C  C   . LEU A 335 ? 0.2170 0.1147 0.3422 -0.0130 0.0626  -0.0219 1788 LEU A C   
5413 O  O   . LEU A 335 ? 0.2168 0.1069 0.3673 -0.0094 0.0661  -0.0160 1788 LEU A O   
5414 C  CB  . LEU A 335 ? 0.2160 0.1315 0.3208 -0.0212 0.0478  -0.0345 1788 LEU A CB  
5415 C  CG  . LEU A 335 ? 0.1823 0.1298 0.3194 -0.0275 0.0451  -0.0390 1788 LEU A CG  
5416 C  CD1 . LEU A 335 ? 0.1776 0.1242 0.3554 -0.0358 0.0670  -0.0398 1788 LEU A CD1 
5417 C  CD2 . LEU A 335 ? 0.1907 0.1482 0.3221 -0.0096 0.0203  -0.0367 1788 LEU A CD2 
5429 N  N   . ARG A 336 ? 0.2201 0.1162 0.3624 0.0020  0.0705  -0.0322 1789 ARG A N   
5430 C  CA  . ARG A 336 ? 0.2109 0.1219 0.3535 -0.0028 0.0757  -0.0421 1789 ARG A CA  
5431 C  C   . ARG A 336 ? 0.2461 0.1247 0.3634 -0.0023 0.0887  -0.0380 1789 ARG A C   
5432 O  O   . ARG A 336 ? 0.2885 0.1257 0.3787 -0.0084 0.0809  -0.0330 1789 ARG A O   
5433 C  CB  . ARG A 336 ? 0.2127 0.1173 0.3393 -0.0145 0.0654  -0.0398 1789 ARG A CB  
5434 C  CG  . ARG A 336 ? 0.2017 0.1256 0.3412 -0.0134 0.0606  -0.0272 1789 ARG A CG  
5435 C  CD  . ARG A 336 ? 0.2073 0.1209 0.3590 0.0070  0.0357  -0.0166 1789 ARG A CD  
5436 N  NE  . ARG A 336 ? 0.2006 0.1089 0.3704 -0.0036 0.0394  -0.0173 1789 ARG A NE  
5437 C  CZ  . ARG A 336 ? 0.1962 0.1079 0.3531 -0.0128 0.0598  -0.0242 1789 ARG A CZ  
5438 N  NH1 . ARG A 336 ? 0.2391 0.1099 0.3538 -0.0056 0.0528  -0.0267 1789 ARG A NH1 
5439 N  NH2 . ARG A 336 ? 0.1725 0.1149 0.3892 -0.0260 0.0437  -0.0219 1789 ARG A NH2 
5453 N  N   . GLY A 337 ? 0.2567 0.1328 0.3659 -0.0060 0.0948  -0.0647 1790 GLY A N   
5454 C  CA  . GLY A 337 ? 0.2733 0.1465 0.3816 -0.0073 0.0920  -0.0876 1790 GLY A CA  
5455 C  C   . GLY A 337 ? 0.3079 0.1526 0.3824 -0.0198 0.0808  -0.0984 1790 GLY A C   
5456 O  O   . GLY A 337 ? 0.3561 0.1685 0.4183 -0.0109 0.0610  -0.1154 1790 GLY A O   
5460 N  N   . GLU A 338 ? 0.3079 0.1497 0.3856 -0.0267 0.0733  -0.0822 1791 GLU A N   
5461 C  CA  . GLU A 338 ? 0.2987 0.1578 0.3541 -0.0357 0.0860  -0.0732 1791 GLU A CA  
5462 C  C   . GLU A 338 ? 0.2839 0.1517 0.3563 -0.0532 0.0784  -0.0693 1791 GLU A C   
5463 O  O   . GLU A 338 ? 0.2448 0.1355 0.3762 -0.0581 0.0661  -0.0615 1791 GLU A O   
5464 C  CB  . GLU A 338 ? 0.3403 0.1690 0.3711 -0.0293 0.0705  -0.0572 1791 GLU A CB  
5465 C  CG  . GLU A 338 ? 0.3951 0.1712 0.4071 -0.0308 0.0410  -0.0551 1791 GLU A CG  
5466 C  CD  . GLU A 338 ? 0.4853 0.1985 0.4918 -0.0151 0.0038  -0.0368 1791 GLU A CD  
5467 O  OE1 . GLU A 338 ? 0.5209 0.2116 0.5090 -0.0362 -0.0133 -0.0258 1791 GLU A OE1 
5468 O  OE2 . GLU A 338 ? 0.5354 0.2099 0.5409 0.0053  -0.0031 -0.0452 1791 GLU A OE2 
5475 N  N   . VAL A 339 ? 0.3113 0.1665 0.3483 -0.0454 0.0851  -0.0615 1792 VAL A N   
5476 C  CA  . VAL A 339 ? 0.2924 0.1711 0.3556 -0.0458 0.0791  -0.0703 1792 VAL A CA  
5477 C  C   . VAL A 339 ? 0.2768 0.1629 0.3686 -0.0659 0.0837  -0.0740 1792 VAL A C   
5478 O  O   . VAL A 339 ? 0.3300 0.1596 0.3993 -0.0671 0.1001  -0.0758 1792 VAL A O   
5479 C  CB  . VAL A 339 ? 0.3165 0.1987 0.3820 -0.0247 0.0740  -0.0681 1792 VAL A CB  
5480 C  CG1 . VAL A 339 ? 0.3426 0.1950 0.3830 -0.0341 0.0495  -0.0552 1792 VAL A CG1 
5481 C  CG2 . VAL A 339 ? 0.3133 0.2090 0.3827 -0.0134 0.0712  -0.0664 1792 VAL A CG2 
5491 N  N   . ALA A 340 ? 0.2393 0.1601 0.3330 -0.0702 0.0621  -0.0860 1793 ALA A N   
5492 C  CA  . ALA A 340 ? 0.2249 0.1772 0.3136 -0.0617 0.0404  -0.0818 1793 ALA A CA  
5493 C  C   . ALA A 340 ? 0.2300 0.1845 0.3001 -0.0719 0.0286  -0.0935 1793 ALA A C   
5494 O  O   . ALA A 340 ? 0.2485 0.1923 0.3023 -0.0610 0.0551  -0.1139 1793 ALA A O   
5495 C  CB  . ALA A 340 ? 0.2235 0.1853 0.3358 -0.0619 0.0158  -0.0959 1793 ALA A CB  
5501 N  N   . TYR A 341 ? 0.2330 0.1853 0.3097 -0.0709 0.0099  -0.0751 1794 TYR A N   
5502 C  CA  . TYR A 341 ? 0.2186 0.1842 0.3082 -0.0676 0.0018  -0.0821 1794 TYR A CA  
5503 C  C   . TYR A 341 ? 0.2299 0.1872 0.3202 -0.0676 0.0031  -0.0827 1794 TYR A C   
5504 O  O   . TYR A 341 ? 0.2352 0.1953 0.3486 -0.0749 0.0284  -0.0700 1794 TYR A O   
5505 C  CB  . TYR A 341 ? 0.2378 0.1836 0.3264 -0.0609 0.0098  -0.0861 1794 TYR A CB  
5506 C  CG  . TYR A 341 ? 0.2275 0.1821 0.3495 -0.0530 0.0017  -0.0963 1794 TYR A CG  
5507 C  CD1 . TYR A 341 ? 0.2336 0.1850 0.3587 -0.0406 0.0139  -0.1021 1794 TYR A CD1 
5508 C  CD2 . TYR A 341 ? 0.2219 0.1790 0.3672 -0.0525 -0.0236 -0.1028 1794 TYR A CD2 
5509 C  CE1 . TYR A 341 ? 0.2362 0.1790 0.3687 -0.0468 0.0023  -0.1070 1794 TYR A CE1 
5510 C  CE2 . TYR A 341 ? 0.2486 0.1871 0.3990 -0.0506 -0.0146 -0.0982 1794 TYR A CE2 
5511 C  CZ  . TYR A 341 ? 0.2623 0.1875 0.3839 -0.0389 -0.0247 -0.1053 1794 TYR A CZ  
5512 O  OH  . TYR A 341 ? 0.2835 0.1886 0.4098 -0.0350 -0.0198 -0.0924 1794 TYR A OH  
5522 N  N   . ILE A 342 ? 0.2435 0.1910 0.3192 -0.0925 -0.0191 -0.0790 1795 ILE A N   
5523 C  CA  . ILE A 342 ? 0.2782 0.2157 0.3225 -0.0991 -0.0010 -0.0840 1795 ILE A CA  
5524 C  C   . ILE A 342 ? 0.2804 0.2391 0.3305 -0.1104 -0.0128 -0.0905 1795 ILE A C   
5525 O  O   . ILE A 342 ? 0.2613 0.2573 0.3367 -0.1166 -0.0063 -0.0859 1795 ILE A O   
5526 C  CB  . ILE A 342 ? 0.3353 0.2250 0.3312 -0.0835 0.0187  -0.0893 1795 ILE A CB  
5527 C  CG1 . ILE A 342 ? 0.3459 0.2268 0.3739 -0.0844 0.0308  -0.0800 1795 ILE A CG1 
5528 C  CG2 . ILE A 342 ? 0.3684 0.2306 0.3486 -0.0739 0.0288  -0.0847 1795 ILE A CG2 
5529 C  CD1 . ILE A 342 ? 0.3434 0.2330 0.4035 -0.0816 0.0296  -0.0820 1795 ILE A CD1 
5541 N  N   . ASP A 343 ? 0.2987 0.2493 0.3416 -0.1035 -0.0085 -0.0973 1796 ASP A N   
5542 C  CA  . ASP A 343 ? 0.3256 0.2686 0.3595 -0.0919 -0.0131 -0.0967 1796 ASP A CA  
5543 C  C   . ASP A 343 ? 0.3204 0.2647 0.3803 -0.0996 0.0011  -0.1102 1796 ASP A C   
5544 O  O   . ASP A 343 ? 0.3097 0.2569 0.4088 -0.0608 -0.0195 -0.1068 1796 ASP A O   
5545 C  CB  . ASP A 343 ? 0.3428 0.2768 0.3733 -0.1009 -0.0129 -0.0963 1796 ASP A CB  
5546 C  CG  . ASP A 343 ? 0.3669 0.2891 0.3957 -0.1045 -0.0277 -0.0876 1796 ASP A CG  
5547 O  OD1 . ASP A 343 ? 0.4001 0.2950 0.4089 -0.1159 -0.0237 -0.0749 1796 ASP A OD1 
5548 O  OD2 . ASP A 343 ? 0.3593 0.2921 0.3875 -0.0841 -0.0177 -0.0913 1796 ASP A OD2 
5553 N  N   . GLY A 344 ? 0.3415 0.2803 0.4043 -0.1246 0.0352  -0.1285 1797 GLY A N   
5554 C  CA  . GLY A 344 ? 0.3723 0.3014 0.4233 -0.1157 0.0470  -0.1351 1797 GLY A CA  
5555 C  C   . GLY A 344 ? 0.3832 0.3224 0.4396 -0.1187 0.0468  -0.1384 1797 GLY A C   
5556 O  O   . GLY A 344 ? 0.4536 0.3357 0.4944 -0.0857 0.1053  -0.1321 1797 GLY A O   
5560 N  N   . GLN A 345 ? 0.3410 0.3291 0.3693 -0.1350 -0.0048 -0.1523 1798 GLN A N   
5561 C  CA  . GLN A 345 ? 0.3443 0.3482 0.3580 -0.1303 -0.0183 -0.1520 1798 GLN A CA  
5562 C  C   . GLN A 345 ? 0.3010 0.3438 0.3224 -0.1243 0.0068  -0.1528 1798 GLN A C   
5563 O  O   . GLN A 345 ? 0.2851 0.3497 0.3267 -0.1326 0.0343  -0.1592 1798 GLN A O   
5564 C  CB  . GLN A 345 ? 0.3985 0.3673 0.3933 -0.1360 -0.0478 -0.1215 1798 GLN A CB  
5565 C  CG  . GLN A 345 ? 0.4500 0.3895 0.4402 -0.1212 -0.0546 -0.0925 1798 GLN A CG  
5566 C  CD  . GLN A 345 ? 0.4710 0.4059 0.4747 -0.0981 -0.0454 -0.0661 1798 GLN A CD  
5567 O  OE1 . GLN A 345 ? 0.4839 0.4130 0.5243 -0.0912 -0.0444 -0.0512 1798 GLN A OE1 
5568 N  NE2 . GLN A 345 ? 0.4939 0.4162 0.4872 -0.0773 -0.0520 -0.0520 1798 GLN A NE2 
5577 N  N   . VAL A 346 ? 0.2876 0.3305 0.3011 -0.1050 -0.0005 -0.1550 1799 VAL A N   
5578 C  CA  . VAL A 346 ? 0.2534 0.3246 0.2965 -0.1035 0.0129  -0.1526 1799 VAL A CA  
5579 C  C   . VAL A 346 ? 0.2660 0.3028 0.3488 -0.1306 0.0302  -0.1314 1799 VAL A C   
5580 O  O   . VAL A 346 ? 0.2989 0.3126 0.4150 -0.1402 0.0309  -0.0959 1799 VAL A O   
5581 C  CB  . VAL A 346 ? 0.2827 0.3457 0.3184 -0.0799 -0.0046 -0.1622 1799 VAL A CB  
5582 C  CG1 . VAL A 346 ? 0.3106 0.3538 0.3326 -0.0624 0.0046  -0.1653 1799 VAL A CG1 
5583 C  CG2 . VAL A 346 ? 0.3194 0.3600 0.3267 -0.0533 -0.0084 -0.1486 1799 VAL A CG2 
5593 N  N   . LEU A 347 ? 0.2991 0.2725 0.3714 -0.1133 0.0296  -0.1465 1800 LEU A N   
5594 C  CA  . LEU A 347 ? 0.3417 0.2573 0.4132 -0.1099 0.0405  -0.1448 1800 LEU A CA  
5595 C  C   . LEU A 347 ? 0.3590 0.2355 0.4648 -0.0966 0.0404  -0.1268 1800 LEU A C   
5596 O  O   . LEU A 347 ? 0.4099 0.2489 0.5299 -0.0797 0.0331  -0.1278 1800 LEU A O   
5597 C  CB  . LEU A 347 ? 0.3561 0.2740 0.4103 -0.1058 0.0445  -0.1606 1800 LEU A CB  
5598 C  CG  . LEU A 347 ? 0.3591 0.2925 0.3989 -0.1068 0.0562  -0.1528 1800 LEU A CG  
5599 C  CD1 . LEU A 347 ? 0.3861 0.3182 0.4144 -0.0823 0.0728  -0.1408 1800 LEU A CD1 
5600 C  CD2 . LEU A 347 ? 0.3586 0.2867 0.4085 -0.1326 0.0272  -0.1481 1800 LEU A CD2 
5612 N  N   . VAL A 348 ? 0.3145 0.2142 0.4192 -0.1028 0.0460  -0.1067 1801 VAL A N   
5613 C  CA  . VAL A 348 ? 0.2848 0.1948 0.4028 -0.0895 0.0532  -0.0771 1801 VAL A CA  
5614 C  C   . VAL A 348 ? 0.2908 0.1840 0.4130 -0.0808 0.0510  -0.0678 1801 VAL A C   
5615 O  O   . VAL A 348 ? 0.2582 0.1894 0.4325 -0.0791 0.0717  -0.0687 1801 VAL A O   
5616 C  CB  . VAL A 348 ? 0.2827 0.1925 0.4181 -0.0765 0.0486  -0.0478 1801 VAL A CB  
5617 C  CG1 . VAL A 348 ? 0.3080 0.1976 0.4283 -0.0611 0.0419  -0.0343 1801 VAL A CG1 
5618 C  CG2 . VAL A 348 ? 0.2769 0.1846 0.4225 -0.0703 0.0189  -0.0514 1801 VAL A CG2 
5628 N  N   . PRO A 349 ? 0.2996 0.1719 0.4129 -0.0703 0.0689  -0.0481 1802 PRO A N   
5629 C  CA  . PRO A 349 ? 0.2951 0.1608 0.4117 -0.0818 0.0727  -0.0337 1802 PRO A CA  
5630 C  C   . PRO A 349 ? 0.2414 0.1582 0.3878 -0.0742 0.0842  -0.0286 1802 PRO A C   
5631 O  O   . PRO A 349 ? 0.2230 0.1523 0.3856 -0.0691 0.0654  -0.0179 1802 PRO A O   
5632 C  CB  . PRO A 349 ? 0.3258 0.1584 0.4358 -0.0668 0.0712  -0.0391 1802 PRO A CB  
5633 C  CG  . PRO A 349 ? 0.3341 0.1662 0.4469 -0.0630 0.0754  -0.0396 1802 PRO A CG  
5634 C  CD  . PRO A 349 ? 0.3283 0.1694 0.4254 -0.0628 0.0719  -0.0520 1802 PRO A CD  
5642 N  N   . PRO A 350 ? 0.2322 0.1618 0.4039 -0.0766 0.0577  -0.0346 1803 PRO A N   
5643 C  CA  . PRO A 350 ? 0.2204 0.1569 0.3970 -0.0699 0.0476  -0.0215 1803 PRO A CA  
5644 C  C   . PRO A 350 ? 0.2226 0.1498 0.3934 -0.0670 0.0677  0.0038  1803 PRO A C   
5645 O  O   . PRO A 350 ? 0.2626 0.1519 0.4329 -0.0676 0.0475  -0.0002 1803 PRO A O   
5646 C  CB  . PRO A 350 ? 0.2176 0.1628 0.4067 -0.0587 0.0303  -0.0453 1803 PRO A CB  
5647 C  CG  . PRO A 350 ? 0.2336 0.1699 0.4272 -0.0607 0.0417  -0.0531 1803 PRO A CG  
5648 C  CD  . PRO A 350 ? 0.2218 0.1673 0.4133 -0.0746 0.0560  -0.0534 1803 PRO A CD  
5656 N  N   . GLY A 351 ? 0.2029 0.1482 0.4103 -0.0500 0.0839  0.0029  1804 GLY A N   
5657 C  CA  . GLY A 351 ? 0.2259 0.1388 0.3904 -0.0515 0.0875  0.0068  1804 GLY A CA  
5658 C  C   . GLY A 351 ? 0.2331 0.1295 0.3866 -0.0373 0.0815  -0.0016 1804 GLY A C   
5659 O  O   . GLY A 351 ? 0.2514 0.1279 0.4179 -0.0335 0.0677  0.0054  1804 GLY A O   
5663 N  N   . TYR A 352 ? 0.2213 0.1269 0.3882 -0.0450 0.0660  -0.0221 1805 TYR A N   
5664 C  CA  . TYR A 352 ? 0.2206 0.1296 0.3790 -0.0376 0.0660  -0.0369 1805 TYR A CA  
5665 C  C   . TYR A 352 ? 0.1853 0.1208 0.3615 -0.0394 0.0595  -0.0202 1805 TYR A C   
5666 O  O   . TYR A 352 ? 0.1961 0.1167 0.3869 -0.0385 0.0545  -0.0114 1805 TYR A O   
5667 C  CB  . TYR A 352 ? 0.2225 0.1277 0.3672 -0.0434 0.0687  -0.0401 1805 TYR A CB  
5668 C  CG  . TYR A 352 ? 0.2091 0.1183 0.3703 -0.0352 0.0901  -0.0352 1805 TYR A CG  
5669 C  CD1 . TYR A 352 ? 0.2401 0.1161 0.3779 -0.0317 0.0983  -0.0136 1805 TYR A CD1 
5670 C  CD2 . TYR A 352 ? 0.2157 0.1222 0.3844 -0.0405 0.0861  -0.0142 1805 TYR A CD2 
5671 C  CE1 . TYR A 352 ? 0.2561 0.1193 0.3959 -0.0269 0.1032  -0.0287 1805 TYR A CE1 
5672 C  CE2 . TYR A 352 ? 0.2259 0.1217 0.3784 -0.0397 0.0880  -0.0403 1805 TYR A CE2 
5673 C  CZ  . TYR A 352 ? 0.2253 0.1216 0.3772 -0.0347 0.0987  -0.0463 1805 TYR A CZ  
5674 O  OH  . TYR A 352 ? 0.2619 0.1324 0.3861 -0.0310 0.0970  -0.0509 1805 TYR A OH  
5684 N  N   . GLY A 353 ? 0.1756 0.1159 0.3448 -0.0327 0.0578  -0.0332 1806 GLY A N   
5685 C  CA  . GLY A 353 ? 0.1976 0.1067 0.3469 -0.0313 0.0612  -0.0270 1806 GLY A CA  
5686 C  C   . GLY A 353 ? 0.1862 0.0999 0.3359 -0.0277 0.0446  -0.0068 1806 GLY A C   
5687 O  O   . GLY A 353 ? 0.1900 0.1112 0.3652 -0.0313 0.0394  0.0105  1806 GLY A O   
5691 N  N   . GLN A 354 ? 0.1990 0.0965 0.3228 -0.0342 0.0233  -0.0110 1807 GLN A N   
5692 C  CA  . GLN A 354 ? 0.1999 0.0943 0.3115 -0.0162 0.0392  0.0015  1807 GLN A CA  
5693 C  C   . GLN A 354 ? 0.1822 0.0920 0.3065 -0.0196 0.0432  0.0105  1807 GLN A C   
5694 O  O   . GLN A 354 ? 0.1939 0.1069 0.2901 -0.0237 0.0534  0.0205  1807 GLN A O   
5695 C  CB  . GLN A 354 ? 0.2102 0.0889 0.3228 0.0027  0.0679  0.0071  1807 GLN A CB  
5696 C  CG  . GLN A 354 ? 0.2112 0.0926 0.3512 -0.0059 0.0394  0.0002  1807 GLN A CG  
5697 C  CD  . GLN A 354 ? 0.2290 0.1053 0.4048 -0.0149 0.0374  -0.0092 1807 GLN A CD  
5698 O  OE1 . GLN A 354 ? 0.2567 0.1164 0.4488 -0.0016 0.0507  -0.0172 1807 GLN A OE1 
5699 N  NE2 . GLN A 354 ? 0.2714 0.1162 0.4381 -0.0204 0.0299  -0.0155 1807 GLN A NE2 
5708 N  N   . ASP A 355 ? 0.1888 0.0922 0.3136 -0.0256 0.0292  -0.0013 1808 ASP A N   
5709 C  CA  . ASP A 355 ? 0.1584 0.1022 0.3020 -0.0333 0.0269  -0.0008 1808 ASP A CA  
5710 C  C   . ASP A 355 ? 0.1497 0.0982 0.2984 -0.0104 0.0418  0.0232  1808 ASP A C   
5711 O  O   . ASP A 355 ? 0.1774 0.0976 0.3282 -0.0041 0.0077  0.0201  1808 ASP A O   
5712 C  CB  . ASP A 355 ? 0.1889 0.1184 0.3034 -0.0223 0.0509  -0.0038 1808 ASP A CB  
5713 C  CG  . ASP A 355 ? 0.2042 0.1457 0.3171 -0.0310 0.0590  0.0104  1808 ASP A CG  
5714 O  OD1 . ASP A 355 ? 0.1767 0.1419 0.3185 -0.0065 0.0453  0.0263  1808 ASP A OD1 
5715 O  OD2 . ASP A 355 ? 0.2451 0.1751 0.3370 -0.0428 0.0806  0.0122  1808 ASP A OD2 
5720 N  N   . VAL A 356 ? 0.1409 0.0933 0.2876 -0.0148 0.0432  0.0308  1809 VAL A N   
5721 C  CA  . VAL A 356 ? 0.1590 0.1005 0.2927 -0.0158 0.0471  0.0192  1809 VAL A CA  
5722 C  C   . VAL A 356 ? 0.1528 0.1101 0.2827 -0.0158 0.0362  0.0140  1809 VAL A C   
5723 O  O   . VAL A 356 ? 0.1623 0.1199 0.3074 -0.0137 0.0241  0.0150  1809 VAL A O   
5724 C  CB  . VAL A 356 ? 0.1676 0.1061 0.2542 -0.0081 0.0422  0.0057  1809 VAL A CB  
5725 C  CG1 . VAL A 356 ? 0.1901 0.1175 0.2564 -0.0147 0.0271  -0.0072 1809 VAL A CG1 
5726 C  CG2 . VAL A 356 ? 0.1769 0.0954 0.2544 -0.0100 0.0283  0.0202  1809 VAL A CG2 
5736 N  N   . ARG A 357 ? 0.1655 0.1044 0.2703 -0.0188 0.0299  0.0236  1810 ARG A N   
5737 C  CA  . ARG A 357 ? 0.1800 0.1156 0.2766 0.0050  0.0131  0.0315  1810 ARG A CA  
5738 C  C   . ARG A 357 ? 0.2036 0.1254 0.2906 0.0097  -0.0151 0.0217  1810 ARG A C   
5739 O  O   . ARG A 357 ? 0.2510 0.1337 0.3186 0.0059  -0.0396 0.0189  1810 ARG A O   
5740 C  CB  . ARG A 357 ? 0.1692 0.1212 0.2775 0.0086  0.0250  0.0321  1810 ARG A CB  
5741 C  CG  . ARG A 357 ? 0.1625 0.1163 0.2744 0.0144  0.0316  0.0253  1810 ARG A CG  
5742 C  CD  . ARG A 357 ? 0.1624 0.1045 0.2693 0.0015  0.0374  0.0385  1810 ARG A CD  
5743 N  NE  . ARG A 357 ? 0.1790 0.1006 0.2657 -0.0155 0.0438  0.0302  1810 ARG A NE  
5744 C  CZ  . ARG A 357 ? 0.1474 0.1089 0.2456 -0.0121 0.0413  0.0237  1810 ARG A CZ  
5745 N  NH1 . ARG A 357 ? 0.1804 0.1103 0.2548 -0.0002 0.0379  0.0095  1810 ARG A NH1 
5746 N  NH2 . ARG A 357 ? 0.1374 0.1270 0.2467 -0.0163 0.0300  0.0246  1810 ARG A NH2 
5760 N  N   . LYS A 358 ? 0.2210 0.1368 0.3101 0.0173  -0.0166 0.0368  1811 LYS A N   
5761 C  CA  . LYS A 358 ? 0.2573 0.1485 0.3156 0.0198  0.0037  0.0548  1811 LYS A CA  
5762 C  C   . LYS A 358 ? 0.2395 0.1509 0.3342 0.0155  0.0073  0.0649  1811 LYS A C   
5763 O  O   . LYS A 358 ? 0.2798 0.1639 0.3774 0.0397  0.0067  0.0836  1811 LYS A O   
5764 C  CB  . LYS A 358 ? 0.2885 0.1643 0.3377 0.0272  0.0206  0.0586  1811 LYS A CB  
5765 C  CG  . LYS A 358 ? 0.3539 0.1888 0.3954 0.0134  0.0383  0.0580  1811 LYS A CG  
5766 C  CD  . LYS A 358 ? 0.4373 0.2208 0.4639 0.0156  0.0456  0.0636  1811 LYS A CD  
5767 C  CE  . LYS A 358 ? 0.5068 0.2512 0.5301 0.0185  0.0137  0.0497  1811 LYS A CE  
5768 N  NZ  . LYS A 358 ? 0.5357 0.2594 0.5585 0.0359  0.0026  0.0494  1811 LYS A NZ  
5782 N  N   . TRP A 359 ? 0.2078 0.1538 0.3338 0.0145  0.0004  0.0533  1812 TRP A N   
5783 C  CA  . TRP A 359 ? 0.1942 0.1572 0.3502 0.0097  0.0246  0.0335  1812 TRP A CA  
5784 C  C   . TRP A 359 ? 0.2087 0.1777 0.3882 0.0153  0.0111  0.0611  1812 TRP A C   
5785 O  O   . TRP A 359 ? 0.2461 0.1847 0.3903 -0.0195 -0.0047 0.0553  1812 TRP A O   
5786 C  CB  . TRP A 359 ? 0.1906 0.1444 0.3401 0.0038  0.0540  0.0217  1812 TRP A CB  
5787 C  CG  . TRP A 359 ? 0.1897 0.1286 0.3348 -0.0067 0.0651  0.0091  1812 TRP A CG  
5788 C  CD1 . TRP A 359 ? 0.2078 0.1311 0.3113 -0.0119 0.0532  0.0064  1812 TRP A CD1 
5789 C  CD2 . TRP A 359 ? 0.1911 0.1190 0.3008 -0.0131 0.0547  -0.0019 1812 TRP A CD2 
5790 N  NE1 . TRP A 359 ? 0.2086 0.1270 0.3388 -0.0126 0.0519  0.0102  1812 TRP A NE1 
5791 C  CE2 . TRP A 359 ? 0.2057 0.1198 0.3151 -0.0105 0.0645  0.0037  1812 TRP A CE2 
5792 C  CE3 . TRP A 359 ? 0.2071 0.1175 0.2839 -0.0254 0.0645  -0.0048 1812 TRP A CE3 
5793 C  CZ2 . TRP A 359 ? 0.2124 0.1185 0.3333 -0.0216 0.0668  0.0118  1812 TRP A CZ2 
5794 C  CZ3 . TRP A 359 ? 0.2288 0.1213 0.3080 -0.0394 0.0475  -0.0059 1812 TRP A CZ3 
5795 C  CH2 . TRP A 359 ? 0.2170 0.1232 0.3310 -0.0331 0.0795  0.0080  1812 TRP A CH2 
5806 N  N   . PRO A 360 ? 0.2315 0.1979 0.4550 0.0260  0.0091  0.0702  1813 PRO A N   
5807 C  CA  . PRO A 360 ? 0.2294 0.2123 0.4713 0.0249  0.0098  0.0694  1813 PRO A CA  
5808 C  C   . PRO A 360 ? 0.2456 0.2277 0.4438 0.0015  0.0087  0.0527  1813 PRO A C   
5809 O  O   . PRO A 360 ? 0.3008 0.2505 0.4630 -0.0220 -0.0202 0.0544  1813 PRO A O   
5810 C  CB  . PRO A 360 ? 0.2494 0.2177 0.5213 0.0345  0.0172  0.0633  1813 PRO A CB  
5811 C  CG  . PRO A 360 ? 0.2458 0.2116 0.5278 0.0403  0.0122  0.0642  1813 PRO A CG  
5812 C  CD  . PRO A 360 ? 0.2402 0.2028 0.4976 0.0416  0.0223  0.0643  1813 PRO A CD  
5820 N  N   . GLN A 361 ? 0.2344 0.2293 0.4156 -0.0006 0.0410  0.0302  1814 GLN A N   
5821 C  CA  . GLN A 361 ? 0.2618 0.2389 0.4144 0.0035  0.0557  0.0402  1814 GLN A CA  
5822 C  C   . GLN A 361 ? 0.2194 0.1967 0.4040 -0.0036 0.0451  0.0480  1814 GLN A C   
5823 O  O   . GLN A 361 ? 0.2096 0.1877 0.4339 -0.0164 0.0469  0.0501  1814 GLN A O   
5824 C  CB  . GLN A 361 ? 0.3416 0.2762 0.4518 0.0119  0.0607  0.0391  1814 GLN A CB  
5825 C  CG  . GLN A 361 ? 0.3841 0.3019 0.4995 0.0222  0.0612  0.0434  1814 GLN A CG  
5826 C  CD  . GLN A 361 ? 0.3784 0.2946 0.4858 0.0209  0.0796  0.0568  1814 GLN A CD  
5827 O  OE1 . GLN A 361 ? 0.3770 0.3031 0.5113 0.0188  0.0871  0.0432  1814 GLN A OE1 
5828 N  NE2 . GLN A 361 ? 0.3687 0.2939 0.5154 0.0357  0.1082  0.0701  1814 GLN A NE2 
5837 N  N   . GLY A 362 ? 0.1996 0.1753 0.3785 -0.0010 0.0517  0.0238  1815 GLY A N   
5838 C  CA  . GLY A 362 ? 0.1949 0.1604 0.3451 -0.0004 0.0239  0.0331  1815 GLY A CA  
5839 C  C   . GLY A 362 ? 0.2037 0.1533 0.3254 -0.0035 0.0377  0.0445  1815 GLY A C   
5840 O  O   . GLY A 362 ? 0.2290 0.1496 0.3445 0.0258  0.0267  0.0348  1815 GLY A O   
5844 N  N   . ALA A 363 ? 0.2271 0.1659 0.3259 -0.0276 0.0156  0.0421  1816 ALA A N   
5845 C  CA  . ALA A 363 ? 0.2529 0.1925 0.3131 -0.0300 -0.0083 0.0310  1816 ALA A CA  
5846 C  C   . ALA A 363 ? 0.2425 0.2165 0.2964 -0.0508 0.0064  0.0220  1816 ALA A C   
5847 O  O   . ALA A 363 ? 0.2491 0.2305 0.3083 -0.0557 -0.0028 0.0002  1816 ALA A O   
5848 C  CB  . ALA A 363 ? 0.2973 0.2028 0.3119 -0.0428 -0.0135 0.0370  1816 ALA A CB  
5854 N  N   . VAL A 364 ? 0.2428 0.2142 0.2729 -0.0641 0.0275  0.0254  1817 VAL A N   
5855 C  CA  . VAL A 364 ? 0.2365 0.2288 0.2478 -0.0609 0.0259  0.0291  1817 VAL A CA  
5856 C  C   . VAL A 364 ? 0.2271 0.2499 0.2538 -0.0586 0.0338  0.0126  1817 VAL A C   
5857 O  O   . VAL A 364 ? 0.2166 0.2368 0.2708 -0.0230 0.0289  0.0316  1817 VAL A O   
5858 C  CB  . VAL A 364 ? 0.2375 0.2210 0.2247 -0.0513 -0.0093 0.0526  1817 VAL A CB  
5859 C  CG1 . VAL A 364 ? 0.2588 0.2102 0.2280 -0.0570 -0.0245 0.0647  1817 VAL A CG1 
5860 C  CG2 . VAL A 364 ? 0.2393 0.2258 0.2411 -0.0461 -0.0007 0.0484  1817 VAL A CG2 
5870 N  N   . PRO A 365 ? 0.2543 0.2889 0.2747 -0.0748 0.0342  -0.0073 1818 PRO A N   
5871 C  CA  . PRO A 365 ? 0.2348 0.3105 0.2844 -0.0740 0.0468  -0.0055 1818 PRO A CA  
5872 C  C   . PRO A 365 ? 0.2167 0.3206 0.2706 -0.0595 0.0230  0.0233  1818 PRO A C   
5873 O  O   . PRO A 365 ? 0.2363 0.3037 0.2581 -0.0679 -0.0179 0.0352  1818 PRO A O   
5874 C  CB  . PRO A 365 ? 0.2546 0.3266 0.2929 -0.0853 0.0650  -0.0303 1818 PRO A CB  
5875 C  CG  . PRO A 365 ? 0.2745 0.3272 0.3250 -0.0777 0.0549  -0.0307 1818 PRO A CG  
5876 C  CD  . PRO A 365 ? 0.2605 0.3093 0.3116 -0.0919 0.0434  -0.0215 1818 PRO A CD  
5884 N  N   . GLN A 366 ? 0.1866 0.3499 0.3027 -0.0385 0.0084  0.0398  1819 GLN A N   
5885 C  CA  . GLN A 366 ? 0.2044 0.3928 0.3094 -0.0124 -0.0135 0.0701  1819 GLN A CA  
5886 C  C   . GLN A 366 ? 0.2308 0.4120 0.3055 0.0105  -0.0291 0.0850  1819 GLN A C   
5887 O  O   . GLN A 366 ? 0.2432 0.4193 0.3278 0.0183  -0.0008 0.0856  1819 GLN A O   
5888 C  CB  . GLN A 366 ? 0.2186 0.4138 0.3832 -0.0007 -0.0063 0.0810  1819 GLN A CB  
5889 C  CG  . GLN A 366 ? 0.2360 0.4306 0.3961 -0.0065 0.0321  0.1091  1819 GLN A CG  
5890 C  CD  . GLN A 366 ? 0.2736 0.4425 0.4260 -0.0002 -0.0018 0.1181  1819 GLN A CD  
5891 O  OE1 . GLN A 366 ? 0.3048 0.4521 0.4629 -0.0199 0.0305  0.1255  1819 GLN A OE1 
5892 N  NE2 . GLN A 366 ? 0.2874 0.4490 0.4273 0.0237  -0.0324 0.1291  1819 GLN A NE2 
5901 N  N   . LEU A 367 ? 0.2559 0.4284 0.3033 0.0172  -0.0488 0.0972  1820 LEU A N   
5902 C  CA  . LEU A 367 ? 0.2866 0.4436 0.3102 0.0225  -0.0695 0.1053  1820 LEU A CA  
5903 C  C   . LEU A 367 ? 0.3465 0.4510 0.3399 0.0305  -0.0422 0.0939  1820 LEU A C   
5904 O  O   . LEU A 367 ? 0.3577 0.4539 0.3499 0.0303  -0.0410 0.0947  1820 LEU A O   
5905 C  CB  . LEU A 367 ? 0.3116 0.4537 0.3326 0.0129  -0.0580 0.1077  1820 LEU A CB  
5906 C  CG  . LEU A 367 ? 0.3397 0.4599 0.3485 0.0125  -0.0711 0.1129  1820 LEU A CG  
5907 C  CD1 . LEU A 367 ? 0.3549 0.4658 0.3907 0.0100  -0.0524 0.1020  1820 LEU A CD1 
5908 C  CD2 . LEU A 367 ? 0.3432 0.4624 0.3219 0.0027  -0.0729 0.1240  1820 LEU A CD2 
5920 N  N   . PRO A 368 ? 0.4167 0.4539 0.3690 0.0362  -0.0421 0.0755  1821 PRO A N   
5921 C  CA  . PRO A 368 ? 0.4613 0.4593 0.4070 0.0382  -0.0271 0.0582  1821 PRO A CA  
5922 C  C   . PRO A 368 ? 0.4910 0.4615 0.4294 0.0296  -0.0281 0.0298  1821 PRO A C   
5923 O  O   . PRO A 368 ? 0.5053 0.4681 0.4349 0.0216  -0.0390 0.0158  1821 PRO A O   
5924 C  CB  . PRO A 368 ? 0.4663 0.4635 0.4144 0.0439  -0.0199 0.0632  1821 PRO A CB  
5925 C  CG  . PRO A 368 ? 0.4590 0.4599 0.4146 0.0481  -0.0206 0.0676  1821 PRO A CG  
5926 C  CD  . PRO A 368 ? 0.4451 0.4569 0.3959 0.0453  -0.0295 0.0699  1821 PRO A CD  
5934 ZN ZN  . ZN  B .   ? 0.1102 0.1093 0.1988 -0.0126 0.0057  -0.0064 2822 ZN  A ZN  
5935 ZN ZN  . ZN  C .   ? 0.1146 0.1062 0.1921 -0.0097 -0.0042 -0.0040 2823 ZN  A ZN  
5936 ZN ZN  . ZN  D .   ? 0.1569 0.1361 0.2409 -0.0118 -0.0037 -0.0012 2824 ZN  A ZN  
5937 ZN ZN  . ZN  E .   ? 0.2090 0.1926 0.2864 -0.0105 0.0162  -0.0416 2825 ZN  A ZN  
5938 C  C   . FMT F .   ? 0.1790 0.2047 0.2284 -0.0459 -0.0024 0.0235  2826 FMT A C   
5939 O  O1  . FMT F .   ? 0.2036 0.2202 0.2570 -0.0510 -0.0004 0.0089  2826 FMT A O1  
5940 O  O2  . FMT F .   ? 0.1857 0.1989 0.1992 -0.0486 0.0009  0.0136  2826 FMT A O2  
5942 C  C   . FMT G .   ? 0.0989 0.0985 0.2592 0.0010  -0.0087 0.0012  2827 FMT A C   
5943 O  O1  . FMT G .   ? 0.1205 0.0999 0.2631 0.0094  0.0066  0.0110  2827 FMT A O1  
5944 O  O2  . FMT G .   ? 0.1206 0.0999 0.2625 -0.0075 0.0069  -0.0086 2827 FMT A O2  
5946 C  C   . FMT H .   ? 0.5056 0.5290 0.4830 -0.0813 0.0153  -0.0594 2828 FMT A C   
5947 O  O1  . FMT H .   ? 0.4895 0.5269 0.4738 -0.0801 0.0228  -0.0586 2828 FMT A O1  
5948 O  O2  . FMT H .   ? 0.5087 0.5323 0.4832 -0.0858 0.0087  -0.0539 2828 FMT A O2  
5950 C  C   . FMT I .   ? 0.4932 0.4646 0.5184 0.0612  -0.0202 -0.0396 2829 FMT A C   
5951 O  O1  . FMT I .   ? 0.4732 0.4696 0.4814 0.0599  -0.0232 -0.0388 2829 FMT A O1  
5952 O  O2  . FMT I .   ? 0.4735 0.4543 0.5460 0.0649  -0.0442 -0.0455 2829 FMT A O2  
5954 O  O   . HOH J .   ? 0.3549 0.3657 0.4738 -0.0584 0.0354  0.0812  2001 HOH A O   
5955 O  O   . HOH J .   ? 0.3059 0.4135 0.5911 0.1003  -0.0458 -0.0672 2002 HOH A O   
5956 O  O   . HOH J .   ? 0.3809 0.3746 0.3871 -0.1734 -0.1068 0.1385  2003 HOH A O   
5957 O  O   . HOH J .   ? 0.4632 0.5358 0.5838 -0.2191 0.1743  -0.0070 2004 HOH A O   
5958 O  O   . HOH J .   ? 0.5422 0.6267 0.3428 0.1495  0.1327  0.0210  2005 HOH A O   
5959 O  O   . HOH J .   ? 0.5001 0.5233 0.4990 -0.1107 0.0234  0.0366  2006 HOH A O   
5960 O  O   . HOH J .   ? 0.7332 0.6928 0.6352 -0.0242 -0.0260 -0.0106 2007 HOH A O   
5961 O  O   . HOH J .   ? 0.4082 0.1673 0.4407 0.0073  0.0661  0.0252  2008 HOH A O   
5962 O  O   . HOH J .   ? 0.4727 0.3657 0.4275 -0.0324 -0.0317 0.0514  2009 HOH A O   
5963 O  O   . HOH J .   ? 0.5541 0.7480 0.5487 -0.0591 -0.0722 -0.0061 2010 HOH A O   
5964 O  O   . HOH J .   ? 0.3587 0.3069 0.3130 -0.0582 -0.0385 0.0478  2011 HOH A O   
5965 O  O   . HOH J .   ? 0.5869 0.6244 0.4845 -0.0698 -0.1334 0.0491  2012 HOH A O   
5966 O  O   . HOH J .   ? 0.3263 0.3167 0.4387 0.0103  0.1381  -0.0422 2013 HOH A O   
5967 O  O   . HOH J .   ? 0.3513 0.3551 0.4194 0.0178  0.0629  0.0269  2014 HOH A O   
5968 O  O   . HOH J .   ? 0.3334 0.2505 0.6318 0.0781  -0.0259 0.0237  2015 HOH A O   
5969 O  O   . HOH J .   ? 0.3187 0.6386 0.5036 0.1554  -0.0421 0.0138  2016 HOH A O   
5970 O  O   . HOH J .   ? 0.3745 0.5185 0.4568 0.2155  0.1668  0.2386  2017 HOH A O   
5971 O  O   . HOH J .   ? 0.5410 0.6369 0.6364 0.0701  0.1037  -0.0377 2018 HOH A O   
5972 O  O   . HOH J .   ? 0.2582 0.2189 0.4186 -0.0105 0.0771  0.0036  2019 HOH A O   
5973 O  O   . HOH J .   ? 0.5030 0.5243 0.4514 0.0361  0.1344  0.0331  2020 HOH A O   
5974 O  O   . HOH J .   ? 0.2661 0.4575 0.5179 0.0260  0.0972  -0.1344 2021 HOH A O   
5975 O  O   . HOH J .   ? 0.4602 0.3540 0.5061 0.1667  -0.0231 0.0160  2022 HOH A O   
5976 O  O   . HOH J .   ? 0.5599 0.4094 0.6414 -0.2059 -0.0133 -0.0385 2023 HOH A O   
5977 O  O   . HOH J .   ? 0.5823 0.4396 0.5581 -0.0742 0.0459  -0.0266 2024 HOH A O   
5978 O  O   . HOH J .   ? 0.6506 0.5303 0.3948 -0.0001 0.0152  0.0002  2025 HOH A O   
5979 O  O   . HOH J .   ? 0.4186 0.3781 0.4920 0.0815  0.0263  -0.0735 2026 HOH A O   
5980 O  O   . HOH J .   ? 0.2649 0.2766 0.4629 -0.0085 0.0366  -0.0379 2027 HOH A O   
5981 O  O   . HOH J .   ? 0.5329 0.2972 0.5205 0.0090  -0.1844 0.0814  2028 HOH A O   
5982 O  O   . HOH J .   ? 0.3021 0.4654 0.4227 -0.0516 0.0887  -0.0234 2029 HOH A O   
5983 O  O   . HOH J .   ? 0.4878 0.3139 0.4787 0.1384  0.0303  -0.0804 2030 HOH A O   
5984 O  O   . HOH J .   ? 0.5533 0.5618 0.4549 -0.0270 -0.0943 -0.0060 2031 HOH A O   
5985 O  O   . HOH J .   ? 0.4719 0.5471 0.5321 -0.0375 0.0928  -0.0376 2032 HOH A O   
5986 O  O   . HOH J .   ? 0.1680 0.4066 0.4967 -0.0153 0.0268  0.0195  2033 HOH A O   
5987 O  O   . HOH J .   ? 0.5915 0.6807 0.5954 0.0204  -0.1049 0.0309  2034 HOH A O   
5988 O  O   . HOH J .   ? 0.4630 0.6680 0.4378 0.1314  0.0637  0.0194  2035 HOH A O   
5989 O  O   . HOH J .   ? 0.1705 0.2013 0.3384 -0.0143 -0.0252 -0.0387 2036 HOH A O   
5990 O  O   . HOH J .   ? 0.4174 0.5344 0.4390 -0.0022 -0.0941 -0.0504 2037 HOH A O   
5991 O  O   . HOH J .   ? 0.4909 0.5971 0.4528 -0.1911 -0.0271 0.1294  2038 HOH A O   
5992 O  O   . HOH J .   ? 0.5773 0.5673 0.5516 -0.0701 -0.1505 -0.0706 2039 HOH A O   
5993 O  O   . HOH J .   ? 0.5749 0.6024 0.5609 0.0192  0.0637  0.0752  2040 HOH A O   
5994 O  O   . HOH J .   ? 0.5005 0.5608 0.4927 -0.1141 0.0482  -0.0537 2041 HOH A O   
5995 O  O   . HOH J .   ? 0.2400 0.2739 0.6130 0.0313  0.0789  0.0455  2042 HOH A O   
5996 O  O   . HOH J .   ? 0.6233 0.5431 0.4933 -0.0366 -0.0292 -0.1145 2043 HOH A O   
5997 O  O   . HOH J .   ? 0.6782 0.4692 0.5549 0.1104  -0.0644 -0.1751 2044 HOH A O   
5998 O  O   . HOH J .   ? 0.5919 0.6114 0.4656 -0.0821 0.1368  -0.0861 2045 HOH A O   
5999 O  O   . HOH J .   ? 0.4727 0.6819 0.5974 0.0444  -0.0872 -0.0411 2046 HOH A O   
6000 O  O   . HOH J .   ? 0.6185 0.4996 0.6094 0.0901  -0.0637 -0.0213 2047 HOH A O   
6001 O  O   . HOH J .   ? 0.6349 0.7023 0.5491 -0.0895 -0.1414 -0.0950 2048 HOH A O   
6002 O  O   . HOH J .   ? 0.5700 0.5000 0.6340 0.0921  0.0406  -0.0743 2049 HOH A O   
6003 O  O   . HOH J .   ? 0.5728 0.4787 0.6793 0.0362  -0.0620 -0.0301 2050 HOH A O   
6004 O  O   . HOH J .   ? 0.4299 0.3225 0.5576 0.0736  0.0550  0.1042  2051 HOH A O   
6005 O  O   . HOH J .   ? 0.6785 0.5551 0.6434 0.0703  -0.0411 -0.0602 2052 HOH A O   
6006 O  O   . HOH J .   ? 0.5876 0.6800 0.6559 0.0414  -0.0820 -0.0160 2053 HOH A O   
6007 O  O   . HOH J .   ? 0.6580 0.5821 0.4743 -0.0055 0.1142  0.1579  2054 HOH A O   
6008 O  O   . HOH J .   ? 0.5783 0.3904 0.4976 0.0000  0.0160  0.0007  2055 HOH A O   
6009 O  O   . HOH J .   ? 0.7177 0.5082 0.7206 -0.0939 0.0711  -0.0719 2056 HOH A O   
6010 O  O   . HOH J .   ? 0.3426 0.6058 0.4580 0.0388  0.1103  0.0068  2057 HOH A O   
6011 O  O   . HOH J .   ? 0.2435 0.7412 0.4345 0.0108  0.1009  -0.0424 2058 HOH A O   
6012 O  O   . HOH J .   ? 0.4846 0.7493 0.5010 -0.1354 0.0719  -0.1125 2059 HOH A O   
6013 O  O   . HOH J .   ? 0.5665 0.4741 0.5422 -0.1065 0.0595  -0.1441 2060 HOH A O   
6014 O  O   . HOH J .   ? 0.5950 0.5429 0.5728 0.0115  0.0462  0.0434  2061 HOH A O   
6015 O  O   . HOH J .   ? 0.2295 0.1445 0.3478 0.0074  0.0685  -0.0233 2062 HOH A O   
6016 O  O   . HOH J .   ? 0.1443 0.1136 0.3183 -0.0077 0.0330  -0.0075 2063 HOH A O   
6017 O  O   . HOH J .   ? 0.1475 0.1206 0.2173 -0.0220 0.0043  -0.0047 2064 HOH A O   
6018 O  O   . HOH J .   ? 0.1526 0.1334 0.2189 -0.0069 0.0080  -0.0132 2065 HOH A O   
6019 O  O   . HOH J .   ? 0.1486 0.1237 0.2131 -0.0136 -0.0369 -0.0029 2066 HOH A O   
6020 O  O   . HOH J .   ? 0.1711 0.1709 0.2752 -0.0233 0.0122  0.0256  2067 HOH A O   
6021 O  O   . HOH J .   ? 0.1778 0.1659 0.2510 -0.0332 0.0085  -0.0038 2068 HOH A O   
6022 O  O   . HOH J .   ? 0.2176 0.2684 0.3184 -0.0310 -0.0056 -0.0504 2069 HOH A O   
6023 O  O   . HOH J .   ? 0.1909 0.2173 0.2871 -0.0005 0.0267  0.0009  2070 HOH A O   
6024 O  O   . HOH J .   ? 0.5817 0.5638 0.6412 -0.0288 0.0705  -0.0940 2071 HOH A O   
6025 O  O   . HOH J .   ? 0.5039 0.2008 0.3346 0.0893  0.1434  0.0799  2072 HOH A O   
6026 O  O   . HOH J .   ? 0.2695 0.1911 0.3240 -0.0226 0.0269  -0.0024 2073 HOH A O   
6027 O  O   . HOH J .   ? 0.1938 0.2719 0.4991 -0.0809 -0.0079 0.0445  2074 HOH A O   
6028 O  O   . HOH J .   ? 0.3374 0.5491 0.5160 -0.0728 0.1150  0.1140  2075 HOH A O   
6029 O  O   . HOH J .   ? 0.4786 0.2606 0.5026 -0.1803 0.0417  0.0275  2076 HOH A O   
6030 O  O   . HOH J .   ? 0.4316 0.4449 0.4206 -0.2098 0.0521  0.0764  2077 HOH A O   
6031 O  O   . HOH J .   ? 0.6256 0.4807 0.4179 0.0378  -0.0142 -0.0299 2078 HOH A O   
6032 O  O   . HOH J .   ? 0.4286 0.5194 0.4612 -0.0249 0.1215  0.1069  2079 HOH A O   
6033 O  O   . HOH J .   ? 0.3181 0.4720 0.4023 -0.1632 -0.0216 -0.0100 2080 HOH A O   
6034 O  O   . HOH J .   ? 0.4883 0.5382 0.4391 0.0347  0.1494  -0.1545 2081 HOH A O   
6035 O  O   . HOH J .   ? 0.3105 0.2681 0.5093 -0.1073 0.0801  -0.0727 2082 HOH A O   
6036 O  O   . HOH J .   ? 0.5742 0.4370 0.5064 -0.0924 0.1811  0.0930  2083 HOH A O   
6037 O  O   . HOH J .   ? 0.6944 0.4290 0.6140 -0.0063 0.1382  0.0509  2084 HOH A O   
6038 O  O   . HOH J .   ? 0.2608 0.3025 0.5707 -0.0877 0.0598  -0.1855 2085 HOH A O   
6039 O  O   . HOH J .   ? 0.3646 0.2682 0.4763 0.0004  -0.0106 -0.1322 2086 HOH A O   
6040 O  O   . HOH J .   ? 0.1956 0.1643 0.3223 -0.0044 0.0600  -0.0137 2087 HOH A O   
6041 O  O   . HOH J .   ? 0.2205 0.1846 0.2714 -0.0443 0.0256  0.0197  2088 HOH A O   
6042 O  O   . HOH J .   ? 0.3105 0.3456 0.3207 -0.0323 0.0307  0.0134  2089 HOH A O   
6043 O  O   . HOH J .   ? 0.4366 0.7423 0.6482 -0.0265 0.1788  -0.0074 2090 HOH A O   
6044 O  O   . HOH J .   ? 0.3511 0.4301 0.4834 -0.1467 -0.0055 0.1315  2091 HOH A O   
6045 O  O   . HOH J .   ? 0.5578 0.6962 0.5722 -0.1261 0.1377  0.0541  2092 HOH A O   
6046 O  O   . HOH J .   ? 0.3225 0.3128 0.2567 -0.0843 0.0161  0.0504  2093 HOH A O   
6047 O  O   . HOH J .   ? 0.3075 0.6473 0.5414 0.0606  -0.0637 -0.1089 2094 HOH A O   
6048 O  O   . HOH J .   ? 0.8188 0.5369 0.4906 -0.0391 -0.0280 0.0475  2095 HOH A O   
6049 O  O   . HOH J .   ? 0.6919 0.7715 0.5994 0.1252  -0.0038 0.0167  2096 HOH A O   
6050 O  O   . HOH J .   ? 0.6367 0.3661 0.3149 -0.0486 -0.1194 -0.0325 2097 HOH A O   
6051 O  O   . HOH J .   ? 0.3230 0.4105 0.4695 -0.0179 -0.0315 0.0624  2098 HOH A O   
6052 O  O   . HOH J .   ? 0.6302 0.5699 0.4254 -0.2255 0.0297  -0.0670 2099 HOH A O   
6053 O  O   . HOH J .   ? 0.3198 0.3565 0.4112 -0.0253 0.0442  0.0184  2100 HOH A O   
6054 O  O   . HOH J .   ? 0.3565 0.1741 0.3452 0.0048  0.0260  0.0449  2101 HOH A O   
6055 O  O   . HOH J .   ? 0.5021 0.6524 0.6922 -0.0946 -0.1642 -0.1271 2102 HOH A O   
6056 O  O   . HOH J .   ? 0.3062 0.1715 0.4023 -0.0310 0.0148  0.0209  2103 HOH A O   
6057 O  O   . HOH J .   ? 0.3607 0.2701 0.5251 0.0302  0.0898  0.0794  2104 HOH A O   
6058 O  O   . HOH J .   ? 0.6179 0.4471 0.7050 0.0488  0.1003  0.1940  2105 HOH A O   
6059 O  O   . HOH J .   ? 0.3511 0.2979 0.4773 -0.1234 0.0269  0.0207  2106 HOH A O   
6060 O  O   . HOH J .   ? 0.2089 0.0903 0.3163 -0.0333 0.0297  0.0040  2107 HOH A O   
6061 O  O   . HOH J .   ? 0.2294 0.1212 0.3945 -0.0235 0.0365  0.0562  2108 HOH A O   
6062 O  O   . HOH J .   ? 0.4067 0.5145 0.5226 -0.1656 0.0607  -0.0054 2109 HOH A O   
6063 O  O   . HOH J .   ? 0.5851 0.1787 0.4173 -0.0820 0.0702  0.0049  2110 HOH A O   
6064 O  O   . HOH J .   ? 0.2968 0.1657 0.2979 0.0578  -0.0638 -0.0091 2111 HOH A O   
6065 O  O   . HOH J .   ? 0.2325 0.2213 0.1881 0.0458  0.0043  0.0264  2112 HOH A O   
6066 O  O   . HOH J .   ? 0.2524 0.1804 0.2398 -0.0149 0.0349  0.0406  2113 HOH A O   
6067 O  O   . HOH J .   ? 0.4746 0.3901 0.3861 -0.1984 -0.0039 0.1461  2114 HOH A O   
6068 O  O   . HOH J .   ? 0.2158 0.2237 0.3185 -0.0041 0.0264  0.0061  2115 HOH A O   
6069 O  O   . HOH J .   ? 0.6160 0.6757 0.3922 0.0471  0.0341  -0.0722 2116 HOH A O   
6070 O  O   . HOH J .   ? 0.6098 0.4254 0.5238 -0.0901 0.0288  0.0873  2117 HOH A O   
6071 O  O   . HOH J .   ? 0.5416 0.6217 0.3056 -0.0562 0.1005  0.0038  2118 HOH A O   
6072 O  O   . HOH J .   ? 0.3054 0.3789 0.3450 -0.0787 0.1410  -0.0383 2119 HOH A O   
6073 O  O   . HOH J .   ? 0.4502 0.7458 0.3819 0.0448  -0.0690 -0.1320 2120 HOH A O   
6074 O  O   . HOH J .   ? 0.2875 0.2219 0.2540 -0.0608 -0.0040 0.0537  2121 HOH A O   
6075 O  O   . HOH J .   ? 0.4159 0.6061 0.4336 0.2223  -0.0696 -0.1235 2122 HOH A O   
6076 O  O   . HOH J .   ? 0.5144 0.6016 0.5818 0.1704  -0.0723 0.1390  2123 HOH A O   
6077 O  O   . HOH J .   ? 0.7037 0.2854 0.5140 0.0656  -0.0755 0.0262  2124 HOH A O   
6078 O  O   . HOH J .   ? 0.4813 0.2988 0.5221 -0.1227 -0.1210 0.0810  2125 HOH A O   
6079 O  O   . HOH J .   ? 0.3726 0.2212 0.3630 -0.0349 -0.0045 0.0788  2126 HOH A O   
6080 O  O   . HOH J .   ? 0.3168 0.4961 0.3214 0.1379  -0.0570 0.0795  2127 HOH A O   
6081 O  O   . HOH J .   ? 0.4277 0.3456 0.4280 0.0793  -0.0467 0.0465  2128 HOH A O   
6082 O  O   . HOH J .   ? 0.6739 0.4523 0.5711 -0.0353 -0.0401 -0.0086 2129 HOH A O   
6083 O  O   . HOH J .   ? 0.1816 0.1333 0.2448 -0.0056 -0.0256 0.0134  2130 HOH A O   
6084 O  O   . HOH J .   ? 0.2607 0.3323 0.3361 -0.0631 0.0207  0.0189  2131 HOH A O   
6085 O  O   . HOH J .   ? 0.6214 0.3781 0.5949 0.0791  -0.0229 0.0600  2132 HOH A O   
6086 O  O   . HOH J .   ? 0.5496 0.3426 0.5725 0.1085  0.0239  -0.0041 2133 HOH A O   
6087 O  O   . HOH J .   ? 0.3188 0.2390 0.3242 0.0546  0.0879  0.0027  2134 HOH A O   
6088 O  O   . HOH J .   ? 0.1953 0.4347 0.4183 0.0066  0.0552  -0.0785 2135 HOH A O   
6089 O  O   . HOH J .   ? 0.5238 0.2717 0.3707 -0.0136 0.1307  -0.0186 2136 HOH A O   
6090 O  O   . HOH J .   ? 0.2617 0.3078 0.3956 0.0454  0.0748  0.0038  2137 HOH A O   
6091 O  O   . HOH J .   ? 0.5411 0.6763 0.5273 -0.0147 0.0897  0.0460  2138 HOH A O   
6092 O  O   . HOH J .   ? 0.4358 0.6330 0.4955 0.1870  0.0236  -0.0383 2139 HOH A O   
6093 O  O   . HOH J .   ? 0.5463 0.6329 0.6176 0.0324  -0.0997 0.0664  2140 HOH A O   
6094 O  O   . HOH J .   ? 0.3357 0.4169 0.4015 0.1241  -0.0746 -0.1882 2141 HOH A O   
6095 O  O   . HOH J .   ? 0.5907 0.4350 0.5706 0.2212  -0.1526 -0.1717 2142 HOH A O   
6096 O  O   . HOH J .   ? 0.3988 0.2302 0.2917 -0.0267 0.0332  -0.0108 2143 HOH A O   
6097 O  O   . HOH J .   ? 0.2568 0.1642 0.2852 -0.0247 -0.0257 0.0422  2144 HOH A O   
6098 O  O   . HOH J .   ? 0.5026 0.6461 0.3177 -0.0565 0.1294  0.0201  2145 HOH A O   
6099 O  O   . HOH J .   ? 0.5741 0.3526 0.3906 0.0041  -0.0106 -0.0507 2146 HOH A O   
6100 O  O   . HOH J .   ? 0.2337 0.1789 0.3012 -0.0237 0.0111  0.0435  2147 HOH A O   
6101 O  O   . HOH J .   ? 0.3005 0.1526 0.1831 -0.0129 0.0027  0.0259  2148 HOH A O   
6102 O  O   . HOH J .   ? 0.3186 0.3773 0.4350 -0.0102 -0.0212 -0.0274 2149 HOH A O   
6103 O  O   . HOH J .   ? 0.3274 0.3178 0.4568 0.0372  -0.1385 -0.1378 2150 HOH A O   
6104 O  O   . HOH J .   ? 0.7789 0.3877 0.3763 0.0074  0.0537  0.0726  2151 HOH A O   
6105 O  O   . HOH J .   ? 0.4185 0.5829 0.4033 -0.0730 0.0509  -0.0948 2152 HOH A O   
6106 O  O   . HOH J .   ? 0.5382 0.4681 0.4311 -0.0413 -0.0408 -0.1192 2153 HOH A O   
6107 O  O   . HOH J .   ? 0.6381 0.3160 0.4616 -0.1430 -0.0219 -0.0219 2154 HOH A O   
6108 O  O   . HOH J .   ? 0.3042 0.6140 0.3016 -0.1262 -0.0400 -0.0361 2155 HOH A O   
6109 O  O   . HOH J .   ? 0.4275 0.6406 0.4185 0.2706  -0.0856 -0.0477 2156 HOH A O   
6110 O  O   . HOH J .   ? 0.3628 0.5183 0.4583 -0.0503 -0.0600 -0.2616 2157 HOH A O   
6111 O  O   . HOH J .   ? 0.4582 0.5199 0.4802 -0.0473 -0.2199 -0.0966 2158 HOH A O   
6112 O  O   . HOH J .   ? 0.3339 0.7603 0.6352 -0.1054 0.0077  -0.1896 2159 HOH A O   
6113 O  O   . HOH J .   ? 0.3149 0.3141 0.3477 -0.0155 0.1202  0.0916  2160 HOH A O   
6114 O  O   . HOH J .   ? 0.2563 0.4240 0.5004 0.0228  -0.0014 0.0995  2161 HOH A O   
6115 O  O   . HOH J .   ? 0.3633 0.2774 0.5414 0.0183  -0.1598 0.1042  2162 HOH A O   
6116 O  O   . HOH J .   ? 0.4687 0.4772 0.5356 0.0258  0.0126  0.2549  2163 HOH A O   
6117 O  O   . HOH J .   ? 0.1762 0.1517 0.1922 -0.0250 0.0029  -0.0208 2164 HOH A O   
6118 O  O   . HOH J .   ? 0.2562 0.1615 0.2723 -0.0337 0.0234  -0.0307 2165 HOH A O   
6119 O  O   . HOH J .   ? 0.2051 0.1989 0.2746 0.0225  -0.0240 -0.0490 2166 HOH A O   
6120 O  O   . HOH J .   ? 0.2957 0.3457 0.4947 -0.0069 0.0804  -0.0740 2167 HOH A O   
6121 O  O   . HOH J .   ? 0.3184 0.3863 0.4267 0.0726  -0.0006 -0.0028 2168 HOH A O   
6122 O  O   . HOH J .   ? 0.2611 0.2080 0.2728 -0.0541 0.0167  0.0106  2169 HOH A O   
6123 O  O   . HOH J .   ? 0.2135 0.1850 0.2805 0.0243  -0.0242 0.0239  2170 HOH A O   
6124 O  O   . HOH J .   ? 0.3693 0.4904 0.3984 0.1443  -0.0102 -0.0186 2171 HOH A O   
6125 O  O   . HOH J .   ? 0.4898 0.3027 0.2783 -0.0857 -0.0079 0.0021  2172 HOH A O   
6126 O  O   . HOH J .   ? 0.6746 0.3364 0.4009 0.1386  -0.0725 0.0253  2173 HOH A O   
6127 O  O   . HOH J .   ? 0.4288 0.4293 0.4587 -0.0822 -0.0610 0.0193  2174 HOH A O   
6128 O  O   . HOH J .   ? 0.2111 0.2021 0.4318 0.0143  -0.0247 -0.0482 2175 HOH A O   
6129 O  O   . HOH J .   ? 0.2016 0.1483 0.3123 0.0498  -0.0313 -0.0433 2176 HOH A O   
6130 O  O   . HOH J .   ? 0.2347 0.1813 0.3042 0.0479  -0.0239 -0.0263 2177 HOH A O   
6131 O  O   . HOH J .   ? 0.1353 0.1239 0.1647 0.0146  -0.0305 -0.0144 2178 HOH A O   
6132 O  O   . HOH J .   ? 0.1537 0.1607 0.2169 0.0046  -0.0324 -0.0021 2179 HOH A O   
6133 O  O   . HOH J .   ? 0.3514 0.3131 0.3623 0.0385  -0.0763 0.0141  2180 HOH A O   
6134 O  O   . HOH J .   ? 0.1798 0.1500 0.2852 0.0315  -0.0185 -0.0034 2181 HOH A O   
6135 O  O   . HOH J .   ? 0.6147 0.5407 0.5132 0.0343  0.0313  0.0108  2182 HOH A O   
6136 O  O   . HOH J .   ? 0.5606 0.2903 0.4688 0.0424  -0.0062 0.0280  2183 HOH A O   
6137 O  O   . HOH J .   ? 0.3249 0.3968 0.2975 0.0451  -0.0203 -0.0859 2184 HOH A O   
6138 O  O   . HOH J .   ? 0.2387 0.2325 0.2778 -0.0283 0.0672  0.0439  2185 HOH A O   
6139 O  O   . HOH J .   ? 0.1728 0.3265 0.2355 0.0208  0.0244  -0.0273 2186 HOH A O   
6140 O  O   . HOH J .   ? 0.2651 0.2479 0.3879 -0.0281 0.0571  -0.0184 2187 HOH A O   
6141 O  O   . HOH J .   ? 0.4751 0.3371 0.6179 -0.0631 0.0615  0.0236  2188 HOH A O   
6142 O  O   . HOH J .   ? 0.2596 0.2082 0.2869 -0.0452 0.0005  0.0142  2189 HOH A O   
6143 O  O   . HOH J .   ? 0.2283 0.4535 0.2761 0.0666  0.0494  0.0057  2190 HOH A O   
6144 O  O   . HOH J .   ? 0.1999 0.3017 0.3138 -0.0611 0.0222  -0.0764 2191 HOH A O   
6145 O  O   . HOH J .   ? 0.3027 0.3642 0.5408 -0.0995 -0.0546 -0.0608 2192 HOH A O   
6146 O  O   . HOH J .   ? 0.1335 0.1830 0.1786 -0.0775 0.0183  0.0436  2193 HOH A O   
6147 O  O   . HOH J .   ? 0.3027 0.6783 0.5897 -0.1059 0.1612  -0.0007 2194 HOH A O   
6148 O  O   . HOH J .   ? 0.2176 0.3555 0.2301 -0.0122 0.0292  0.0061  2195 HOH A O   
6149 O  O   . HOH J .   ? 0.5337 0.4295 0.4467 0.0819  -0.0713 -0.1633 2196 HOH A O   
6150 O  O   . HOH J .   ? 0.3539 0.3605 0.5414 -0.0737 0.0327  -0.0580 2197 HOH A O   
6151 O  O   . HOH J .   ? 0.3428 0.2753 0.5505 0.0476  0.2001  0.0729  2198 HOH A O   
6152 O  O   . HOH J .   ? 0.3882 0.4742 0.3717 0.0759  -0.0820 -0.0926 2199 HOH A O   
6153 O  O   . HOH J .   ? 0.5317 0.5542 0.4308 0.0867  0.2437  -0.0865 2200 HOH A O   
6154 O  O   . HOH J .   ? 0.2249 0.2630 0.2803 -0.0033 -0.0071 -0.0341 2201 HOH A O   
6155 O  O   . HOH J .   ? 0.1806 0.2945 0.3356 -0.0164 0.0166  -0.0414 2202 HOH A O   
6156 O  O   . HOH J .   ? 0.2350 0.3052 0.2906 -0.0419 -0.0353 0.0468  2203 HOH A O   
6157 O  O   . HOH J .   ? 0.2149 0.1592 0.2166 0.0112  0.0049  -0.0260 2204 HOH A O   
6158 O  O   . HOH J .   ? 0.4035 0.2351 0.2156 0.1248  -0.0715 -0.0371 2205 HOH A O   
6159 O  O   . HOH J .   ? 0.3023 0.5676 0.2254 -0.0212 -0.0758 0.0598  2206 HOH A O   
6160 O  O   . HOH J .   ? 0.4796 0.5408 0.3481 0.0050  -0.0202 0.0454  2207 HOH A O   
6161 O  O   . HOH J .   ? 0.1313 0.1815 0.2384 0.0284  -0.0167 0.0169  2208 HOH A O   
6162 O  O   . HOH J .   ? 0.4918 0.6481 0.3753 0.0818  -0.0179 0.0123  2209 HOH A O   
6163 O  O   . HOH J .   ? 0.2748 0.3961 0.5465 0.0982  -0.1121 0.0424  2210 HOH A O   
6164 O  O   . HOH J .   ? 0.2684 0.3900 0.6031 0.0633  -0.0104 0.0372  2211 HOH A O   
6165 O  O   . HOH J .   ? 0.3435 0.3710 0.4418 0.1150  -0.0400 0.0077  2212 HOH A O   
6166 O  O   . HOH J .   ? 0.4005 0.4259 0.5512 -0.1115 -0.2269 0.1804  2213 HOH A O   
6167 O  O   . HOH J .   ? 0.5964 0.7136 0.6291 0.0964  -0.1427 0.0322  2214 HOH A O   
6168 O  O   . HOH J .   ? 0.3419 0.3814 0.4030 -0.0330 -0.0935 -0.0018 2215 HOH A O   
6169 O  O   . HOH J .   ? 0.3626 0.5442 0.4063 0.1124  -0.1162 -0.1286 2216 HOH A O   
6170 O  O   . HOH J .   ? 0.5721 0.5602 0.5015 -0.1152 -0.0578 -0.0323 2217 HOH A O   
6171 O  O   . HOH J .   ? 0.5001 0.4452 0.4529 -0.0041 0.0156  -0.0052 2218 HOH A O   
6172 O  O   . HOH J .   ? 0.2546 0.7300 0.6927 0.0409  0.0076  0.0293  2219 HOH A O   
6173 O  O   . HOH J .   ? 0.4741 0.5926 0.4600 0.1378  0.0164  0.0087  2220 HOH A O   
6174 O  O   . HOH J .   ? 0.5062 0.5663 0.4962 -0.0953 -0.0616 -0.0064 2221 HOH A O   
6175 O  O   . HOH J .   ? 0.2541 0.3762 0.6326 -0.0725 -0.0916 -0.0514 2222 HOH A O   
6176 O  O   . HOH J .   ? 0.3679 0.5114 0.6198 0.0475  -0.0810 -0.1015 2223 HOH A O   
6177 O  O   . HOH J .   ? 0.2117 0.3734 0.5785 0.0146  -0.1371 -0.0986 2224 HOH A O   
6178 O  O   . HOH J .   ? 0.4500 0.4354 0.7146 0.0995  -0.0727 -0.0296 2225 HOH A O   
6179 O  O   . HOH J .   ? 0.5687 0.6899 0.6188 0.0662  -0.1918 -0.0314 2226 HOH A O   
6180 O  O   . HOH J .   ? 0.1836 0.3437 0.5621 -0.0686 -0.0784 -0.0062 2227 HOH A O   
6181 O  O   . HOH J .   ? 0.2927 0.5190 0.5011 0.1695  0.1276  0.1479  2228 HOH A O   
6182 O  O   . HOH J .   ? 0.1665 0.3017 0.3047 0.0259  -0.0056 -0.0484 2229 HOH A O   
6183 O  O   . HOH J .   ? 0.3928 0.2731 0.4947 -0.0451 0.0958  -0.0315 2230 HOH A O   
6184 O  O   . HOH J .   ? 0.3242 0.3080 0.4924 -0.0815 -0.1328 0.1097  2231 HOH A O   
6185 O  O   . HOH J .   ? 0.1883 0.6079 0.3605 0.1115  0.0108  0.0408  2232 HOH A O   
6186 O  O   . HOH J .   ? 0.4127 0.3283 0.4189 -0.0124 -0.0462 -0.0356 2233 HOH A O   
6187 O  O   . HOH J .   ? 0.2835 0.5638 0.3975 0.1844  -0.0621 0.0554  2234 HOH A O   
6188 O  O   . HOH J .   ? 0.5697 0.5023 0.4408 0.1788  -0.1416 0.0443  2235 HOH A O   
6189 O  O   . HOH J .   ? 0.2705 0.2556 0.4320 -0.0161 0.0035  0.1215  2236 HOH A O   
6190 O  O   . HOH J .   ? 0.4410 0.5475 0.5716 0.1975  0.0263  -0.2223 2237 HOH A O   
6191 O  O   . HOH J .   ? 0.5032 0.3991 0.3640 0.0443  -0.0149 0.0570  2238 HOH A O   
6192 O  O   . HOH J .   ? 0.6416 0.3121 0.3357 0.1162  0.2395  0.0437  2239 HOH A O   
6193 O  O   . HOH J .   ? 0.4262 0.5354 0.4340 -0.1134 0.0611  0.0998  2240 HOH A O   
6194 O  O   . HOH J .   ? 0.2398 0.4226 0.4970 0.0832  0.1106  0.2606  2241 HOH A O   
6195 O  O   . HOH J .   ? 0.4973 0.3880 0.5282 -0.1258 0.0158  0.0625  2242 HOH A O   
6196 O  O   . HOH J .   ? 0.4152 0.6829 0.4724 -0.0237 0.1093  -0.1104 2243 HOH A O   
6197 O  O   . HOH J .   ? 0.3257 0.4579 0.4900 0.1679  0.0980  -0.0292 2244 HOH A O   
6198 O  O   . HOH J .   ? 0.3894 0.5371 0.3638 0.0546  0.0570  0.2062  2245 HOH A O   
6199 O  O   . HOH J .   ? 0.2161 0.2039 0.3182 0.0502  0.0208  -0.0268 2246 HOH A O   
6200 O  O   . HOH J .   ? 0.1443 0.1561 0.2526 -0.0191 -0.0093 -0.0139 2247 HOH A O   
6201 O  O   . HOH J .   ? 0.1233 0.1621 0.2452 -0.0184 -0.0176 0.0098  2248 HOH A O   
6202 O  O   . HOH J .   ? 0.1289 0.2028 0.2291 -0.0133 0.0164  -0.0249 2249 HOH A O   
6203 O  O   . HOH J .   ? 0.3005 0.5165 0.4457 -0.1140 -0.0064 0.1203  2250 HOH A O   
6204 O  O   . HOH J .   ? 0.3742 0.2942 0.5552 0.0575  -0.1077 -0.1559 2251 HOH A O   
6205 O  O   . HOH J .   ? 0.2460 0.2746 0.5372 -0.0806 -0.0154 -0.0435 2252 HOH A O   
6206 O  O   . HOH J .   ? 0.4923 0.6384 0.5928 -0.1462 0.1016  0.0650  2253 HOH A O   
6207 O  O   . HOH J .   ? 0.3083 0.4436 0.3116 0.0085  0.0511  -0.0578 2254 HOH A O   
6208 O  O   . HOH J .   ? 0.4398 0.6922 0.5881 0.1527  0.0951  0.1351  2255 HOH A O   
6209 O  O   . HOH J .   ? 0.3941 0.5448 0.4163 -0.0125 0.0489  0.0192  2256 HOH A O   
6210 O  O   . HOH J .   ? 0.5351 0.6887 0.4321 -0.1737 0.0981  0.0624  2257 HOH A O   
6211 O  O   . HOH J .   ? 0.1295 0.1954 0.2633 -0.0166 -0.0181 -0.0309 2258 HOH A O   
6212 O  O   . HOH J .   ? 0.1506 0.1811 0.2105 -0.0144 0.0130  -0.0327 2259 HOH A O   
6213 O  O   . HOH J .   ? 0.1491 0.1862 0.2794 -0.0401 0.0294  -0.0484 2260 HOH A O   
6214 O  O   . HOH J .   ? 0.2125 0.2877 0.3815 -0.0132 -0.0143 -0.0920 2261 HOH A O   
6215 O  O   . HOH J .   ? 0.5199 0.3335 0.4014 0.0100  -0.1246 -0.0642 2262 HOH A O   
6216 O  O   . HOH J .   ? 0.2703 0.4404 0.3402 -0.0337 0.0415  -0.0869 2263 HOH A O   
6217 O  O   . HOH J .   ? 0.4660 0.4410 0.4923 -0.0835 0.0526  -0.0552 2264 HOH A O   
6218 O  O   . HOH J .   ? 0.3988 0.5915 0.3953 -0.1494 -0.0419 0.1343  2265 HOH A O   
6219 O  O   . HOH J .   ? 0.6230 0.4884 0.3988 -0.0910 -0.1144 0.0080  2266 HOH A O   
6220 O  O   . HOH J .   ? 0.4022 0.4871 0.4450 0.0257  -0.1191 0.0313  2267 HOH A O   
6221 O  O   . HOH J .   ? 0.6380 0.6513 0.5234 0.0272  -0.1914 -0.0018 2268 HOH A O   
6222 O  O   . HOH J .   ? 0.3454 0.3527 0.3544 0.0006  -0.0917 0.0072  2269 HOH A O   
6223 O  O   . HOH J .   ? 0.6290 0.5977 0.5200 -0.1320 -0.1005 -0.0027 2270 HOH A O   
6224 O  O   . HOH J .   ? 0.5540 0.5321 0.4872 -0.0795 0.0585  0.1116  2271 HOH A O   
6225 O  O   . HOH J .   ? 0.4657 0.4079 0.5540 0.0084  0.0028  0.1826  2272 HOH A O   
6226 O  O   . HOH J .   ? 0.3897 0.4550 0.5996 -0.0292 -0.0611 0.1266  2273 HOH A O   
6227 O  O   . HOH J .   ? 0.5257 0.3234 0.3428 0.1099  -0.1004 -0.0849 2274 HOH A O   
6228 O  O   . HOH J .   ? 0.4460 0.3988 0.3895 -0.1080 -0.1220 0.1170  2275 HOH A O   
6229 O  O   . HOH J .   ? 0.5671 0.6967 0.5295 -0.0368 0.0135  0.2005  2276 HOH A O   
6230 O  O   . HOH J .   ? 0.2163 0.2730 0.4868 0.0730  -0.0024 0.0151  2277 HOH A O   
6231 O  O   . HOH J .   ? 0.4293 0.2751 0.2463 -0.0681 -0.0484 -0.0301 2278 HOH A O   
6232 O  O   . HOH J .   ? 0.2103 0.3376 0.2648 0.0039  0.0631  -0.0303 2279 HOH A O   
6233 O  O   . HOH J .   ? 0.2981 0.2425 0.4518 -0.0753 0.0546  -0.0876 2280 HOH A O   
6234 O  O   . HOH J .   ? 0.4888 0.2809 0.5643 -0.0419 -0.0641 -0.0379 2281 HOH A O   
6235 O  O   . HOH J .   ? 0.5475 0.3614 0.4001 -0.0543 0.0618  -0.0136 2282 HOH A O   
6236 O  O   . HOH J .   ? 0.1998 0.2637 0.4682 -0.0165 0.0937  -0.0212 2283 HOH A O   
6237 O  O   . HOH J .   ? 0.3841 0.3142 0.3492 -0.0986 0.0190  0.0415  2284 HOH A O   
6238 O  O   . HOH J .   ? 0.4260 0.2516 0.3605 0.0403  -0.0272 -0.0212 2285 HOH A O   
6239 O  O   . HOH J .   ? 0.5197 0.3259 0.4548 0.2056  0.0169  -0.0132 2286 HOH A O   
6240 O  O   . HOH J .   ? 0.5109 0.3773 0.5246 0.0295  0.2760  -0.0729 2287 HOH A O   
6241 O  O   . HOH J .   ? 0.2383 0.4506 0.5189 0.0694  0.0773  -0.1714 2288 HOH A O   
6242 O  O   . HOH J .   ? 0.2759 0.2538 0.3421 -0.0501 -0.0153 -0.0368 2289 HOH A O   
6243 O  O   . HOH J .   ? 0.2182 0.2197 0.3722 0.0077  -0.0048 -0.0166 2290 HOH A O   
6244 O  O   . HOH J .   ? 0.1648 0.1149 0.3278 0.0023  0.0287  -0.0016 2291 HOH A O   
6245 O  O   . HOH J .   ? 0.2848 0.2456 0.4884 0.0575  0.1293  -0.0735 2292 HOH A O   
6246 O  O   . HOH J .   ? 0.1563 0.1144 0.3528 -0.0141 0.0191  -0.0230 2293 HOH A O   
6247 O  O   . HOH J .   ? 0.3913 0.2222 0.5340 0.0972  0.0931  -0.0070 2294 HOH A O   
6248 O  O   . HOH J .   ? 0.2152 0.3021 0.6277 0.0807  0.0235  -0.0678 2295 HOH A O   
6249 O  O   . HOH J .   ? 0.4955 0.3989 0.5587 0.1489  -0.0218 -0.0491 2296 HOH A O   
6250 O  O   . HOH J .   ? 0.4637 0.5021 0.4341 -0.1437 -0.0137 -0.1896 2297 HOH A O   
6251 O  O   . HOH J .   ? 0.3671 0.2475 0.5781 0.1401  0.0405  -0.0444 2298 HOH A O   
6252 O  O   . HOH J .   ? 0.3394 0.4243 0.5049 0.1819  0.0584  0.1750  2299 HOH A O   
6253 O  O   . HOH J .   ? 0.3318 0.2427 0.5075 -0.0066 0.1047  0.0312  2300 HOH A O   
6254 O  O   . HOH J .   ? 0.2730 0.3251 0.5941 0.0244  0.0522  0.0460  2301 HOH A O   
6255 O  O   . HOH J .   ? 0.2440 0.2870 0.6712 0.0649  0.1281  0.0972  2302 HOH A O   
6256 O  O   . HOH J .   ? 0.2867 0.2946 0.5199 -0.0162 0.0731  0.0180  2303 HOH A O   
6257 O  O   . HOH J .   ? 0.5528 0.4717 0.5835 0.0522  -0.0050 -0.1115 2304 HOH A O   
6258 O  O   . HOH J .   ? 0.3761 0.5896 0.5776 -0.0937 0.0468  0.0345  2305 HOH A O   
6259 O  O   . HOH J .   ? 0.5935 0.6960 0.5002 -0.0929 -0.0067 -0.1042 2306 HOH A O   
6260 O  O   . HOH J .   ? 0.5859 0.5952 0.4475 -0.0112 -0.0892 -0.2545 2307 HOH A O   
6261 O  O   . HOH J .   ? 0.7759 0.4062 0.6063 -0.0142 0.0277  -0.0544 2308 HOH A O   
6262 O  O   . HOH J .   ? 0.5435 0.5656 0.5030 -0.1052 -0.1216 -0.1488 2309 HOH A O   
6263 O  O   . HOH J .   ? 0.4803 0.5287 0.4658 0.0497  -0.1511 -0.0322 2310 HOH A O   
6264 O  O   . HOH J .   ? 0.4508 0.6711 0.4606 0.0366  0.0080  -0.1104 2311 HOH A O   
6265 O  O   . HOH J .   ? 0.2995 0.4868 0.5481 -0.1105 -0.0385 -0.2103 2312 HOH A O   
6266 O  O   . HOH J .   ? 0.5480 0.5875 0.4802 -0.0020 -0.0368 0.0272  2313 HOH A O   
6267 O  O   . HOH J .   ? 0.2595 0.5629 0.4328 -0.0028 -0.1192 -0.0516 2314 HOH A O   
6268 O  O   . HOH J .   ? 0.4851 0.5469 0.5244 -0.1044 0.0273  0.0427  2315 HOH A O   
6269 O  O   . HOH J .   ? 0.3006 0.5718 0.3360 -0.1255 -0.0977 -0.0423 2316 HOH A O   
6270 O  O   . HOH J .   ? 0.1460 0.3598 0.3439 -0.0193 -0.0239 -0.0214 2317 HOH A O   
6271 O  O   . HOH J .   ? 0.4928 0.7436 0.4265 -0.1978 -0.0700 -0.1212 2318 HOH A O   
6272 O  O   . HOH J .   ? 0.2856 0.5271 0.3424 -0.0175 -0.0421 -0.0710 2319 HOH A O   
6273 O  O   . HOH J .   ? 0.5015 0.5382 0.5037 -0.0340 -0.0881 -0.1552 2320 HOH A O   
6274 O  O   . HOH J .   ? 0.5031 0.4060 0.5722 -0.0921 0.0356  -0.1299 2321 HOH A O   
6275 O  O   . HOH J .   ? 0.1909 0.2531 0.3235 -0.0296 -0.0099 -0.0307 2322 HOH A O   
6276 O  O   . HOH J .   ? 0.1522 0.2954 0.3058 -0.0276 -0.0197 -0.0548 2323 HOH A O   
6277 O  O   . HOH J .   ? 0.6515 0.4006 0.4974 -0.2225 0.0290  -0.0223 2324 HOH A O   
6278 O  O   . HOH J .   ? 0.3884 0.4207 0.5321 -0.1392 -0.1362 -0.0337 2325 HOH A O   
6279 O  O   . HOH J .   ? 0.3453 0.5020 0.5917 -0.1969 -0.0240 0.1011  2326 HOH A O   
6280 O  O   . HOH J .   ? 0.1668 0.3508 0.4456 -0.0146 -0.0606 -0.0226 2327 HOH A O   
6281 O  O   . HOH J .   ? 0.5125 0.6275 0.6618 -0.1739 0.0226  0.0426  2328 HOH A O   
6282 O  O   . HOH J .   ? 0.2808 0.6428 0.4811 0.0380  0.0656  -0.0143 2329 HOH A O   
6283 O  O   . HOH J .   ? 0.3040 0.5586 0.3935 -0.0229 -0.0486 -0.1416 2330 HOH A O   
6284 O  O   . HOH J .   ? 0.3467 0.7077 0.5234 -0.0474 -0.1540 0.0020  2331 HOH A O   
6285 O  O   . HOH J .   ? 0.5615 0.5530 0.4842 0.1049  -0.1919 0.0267  2332 HOH A O   
6286 O  O   . HOH J .   ? 0.3922 0.5200 0.4970 0.0326  -0.0274 0.1198  2333 HOH A O   
6287 O  O   . HOH J .   ? 0.6499 0.3869 0.4093 0.0302  0.1594  0.0322  2334 HOH A O   
6288 O  O   . HOH J .   ? 0.4556 0.5902 0.4911 -0.1309 -0.1026 0.0482  2335 HOH A O   
6289 O  O   . HOH J .   ? 0.5350 0.4385 0.5242 -0.0618 -0.0823 0.0038  2336 HOH A O   
6290 O  O   . HOH J .   ? 0.3704 0.4725 0.6023 0.0142  0.0943  -0.1253 2337 HOH A O   
6291 O  O   . HOH J .   ? 0.3491 0.3315 0.4793 -0.0348 -0.0644 -0.0026 2338 HOH A O   
6292 O  O   . HOH J .   ? 0.3808 0.4107 0.5006 -0.1642 -0.0632 0.0275  2339 HOH A O   
6293 O  O   . HOH J .   ? 0.6761 0.6172 0.5869 -0.0650 -0.0199 0.0932  2340 HOH A O   
6294 O  O   . HOH J .   ? 0.4862 0.2169 0.4377 0.0322  0.0392  -0.0044 2341 HOH A O   
6295 O  O   . HOH J .   ? 0.5691 0.4983 0.6307 0.0034  0.0803  -0.0016 2342 HOH A O   
6296 O  O   . HOH J .   ? 0.3548 0.1840 0.6623 0.0048  -0.0949 -0.0670 2343 HOH A O   
6297 O  O   . HOH J .   ? 0.5139 0.2846 0.5755 0.1928  0.0899  0.0124  2344 HOH A O   
6298 O  O   . HOH J .   ? 0.6668 0.3109 0.6685 0.0928  0.0748  -0.1393 2345 HOH A O   
6299 O  O   . HOH J .   ? 0.5571 0.1864 0.4656 -0.0948 0.0138  -0.0774 2346 HOH A O   
6300 O  O   . HOH J .   ? 0.6339 0.3920 0.5788 -0.0773 -0.0684 0.0062  2347 HOH A O   
6301 O  O   . HOH J .   ? 0.7387 0.4623 0.6810 -0.0891 0.0644  0.0619  2348 HOH A O   
6302 O  O   . HOH J .   ? 0.4721 0.2279 0.4650 -0.1069 0.0336  -0.0197 2349 HOH A O   
6303 O  O   . HOH J .   ? 0.3704 0.3274 0.3415 -0.0682 0.0060  -0.0829 2350 HOH A O   
6304 O  O   . HOH J .   ? 0.6819 0.6538 0.6339 0.0241  0.0447  0.0000  2351 HOH A O   
6305 O  O   . HOH J .   ? 0.5162 0.4014 0.6566 -0.2237 0.0223  0.0384  2352 HOH A O   
6306 O  O   . HOH J .   ? 0.3789 0.2117 0.6457 -0.0037 0.0971  0.0779  2353 HOH A O   
6307 O  O   . HOH J .   ? 0.6792 0.3287 0.5196 -0.0448 0.0640  0.0304  2354 HOH A O   
6308 O  O   . HOH J .   ? 0.3772 0.2273 0.5877 -0.0638 -0.0354 0.0028  2355 HOH A O   
6309 O  O   . HOH J .   ? 0.3765 0.1877 0.4846 -0.0403 0.0273  0.0170  2356 HOH A O   
6310 O  O   . HOH J .   ? 0.5259 0.2427 0.6351 -0.0168 0.2034  0.0282  2357 HOH A O   
6311 O  O   . HOH J .   ? 0.3219 0.2025 0.4618 -0.0621 0.0520  -0.0273 2358 HOH A O   
6312 O  O   . HOH J .   ? 0.5631 0.5249 0.6698 0.1091  -0.0337 -0.0718 2359 HOH A O   
6313 O  O   . HOH J .   ? 0.5016 0.4431 0.6212 0.1051  0.0375  0.1160  2360 HOH A O   
6314 O  O   . HOH J .   ? 0.7185 0.5705 0.6285 0.1910  0.0569  -0.1706 2361 HOH A O   
6315 O  O   . HOH J .   ? 0.2860 0.1389 0.4995 -0.0202 0.0661  0.0255  2362 HOH A O   
6316 O  O   . HOH J .   ? 0.2783 0.3126 0.5223 -0.0027 0.0011  0.0616  2363 HOH A O   
6317 O  O   . HOH J .   ? 0.4555 0.4696 0.6519 0.0451  0.0098  0.1191  2364 HOH A O   
6318 O  O   . HOH J .   ? 0.4292 0.4818 0.5341 0.0222  -0.1231 0.1428  2365 HOH A O   
6319 O  O   . HOH J .   ? 0.4586 0.3828 0.5155 0.0992  0.0489  0.1046  2366 HOH A O   
6320 O  O   . HOH J .   ? 0.5262 0.4346 0.5836 0.1200  0.0428  0.0581  2367 HOH A O   
6321 O  O   . HOH J .   ? 0.2164 0.1950 0.3437 0.0455  0.0169  0.0464  2368 HOH A O   
6322 O  O   . HOH J .   ? 0.5943 0.6696 0.5622 -0.0235 0.0972  -0.0216 2369 HOH A O   
6323 O  O   . HOH J .   ? 0.5600 0.3700 0.5865 0.1055  -0.0832 -0.1608 2370 HOH A O   
6324 O  O   . HOH J .   ? 0.3120 0.3605 0.3802 -0.0106 0.1084  0.1616  2371 HOH A O   
6325 O  O   . HOH J .   ? 0.6094 0.7088 0.5646 0.0207  0.1064  -0.0106 2372 HOH A O   
6326 O  O   . HOH J .   ? 0.6149 0.4378 0.5296 -0.0248 0.2010  -0.0559 2373 HOH A O   
6327 O  O   . HOH J .   ? 0.6603 0.4552 0.5775 0.0049  -0.0537 -0.0455 2374 HOH A O   
6328 O  O   . HOH J .   ? 0.1597 0.4120 0.6232 0.0072  -0.0131 -0.0546 2375 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1454 ?    ?   ?   A . n 
A 1 2   PRO 2   1455 ?    ?   ?   A . n 
A 1 3   MET 3   1456 ?    ?   ?   A . n 
A 1 4   THR 4   1457 ?    ?   ?   A . n 
A 1 5   SER 5   1458 ?    ?   ?   A . n 
A 1 6   GLN 6   1459 ?    ?   ?   A . n 
A 1 7   LYS 7   1460 1460 LYS LYS A . n 
A 1 8   LEU 8   1461 1461 LEU LEU A . n 
A 1 9   VAL 9   1462 1462 VAL VAL A . n 
A 1 10  ARG 10  1463 1463 ARG ARG A . n 
A 1 11  LEU 11  1464 1464 LEU LEU A . n 
A 1 12  PRO 12  1465 1465 PRO PRO A . n 
A 1 13  GLY 13  1466 1466 GLY GLY A . n 
A 1 14  LEU 14  1467 1467 LEU LEU A . n 
A 1 15  ILE 15  1468 1468 ILE ILE A . n 
A 1 16  ASP 16  1469 1469 ASP ASP A . n 
A 1 17  VAL 17  1470 1470 VAL VAL A . n 
A 1 18  HIS 18  1471 1471 HIS HIS A . n 
A 1 19  VAL 19  1472 1472 VAL VAL A . n 
A 1 20  HIS 20  1473 1473 HIS HIS A . n 
A 1 21  LEU 21  1474 1474 LEU LEU A . n 
A 1 22  ARG 22  1475 1475 ARG ARG A . n 
A 1 23  GLU 23  1476 1476 GLU GLU A . n 
A 1 24  PRO 24  1477 1477 PRO PRO A . n 
A 1 25  GLY 25  1478 1478 GLY GLY A . n 
A 1 26  GLY 26  1479 1479 GLY GLY A . n 
A 1 27  THR 27  1480 1480 THR THR A . n 
A 1 28  HIS 28  1481 1481 HIS HIS A . n 
A 1 29  LYS 29  1482 1482 LYS LYS A . n 
A 1 30  GLU 30  1483 1483 GLU GLU A . n 
A 1 31  ASP 31  1484 1484 ASP ASP A . n 
A 1 32  PHE 32  1485 1485 PHE PHE A . n 
A 1 33  ALA 33  1486 1486 ALA ALA A . n 
A 1 34  SER 34  1487 1487 SER SER A . n 
A 1 35  GLY 35  1488 1488 GLY GLY A . n 
A 1 36  THR 36  1489 1489 THR THR A . n 
A 1 37  ALA 37  1490 1490 ALA ALA A . n 
A 1 38  ALA 38  1491 1491 ALA ALA A . n 
A 1 39  ALA 39  1492 1492 ALA ALA A . n 
A 1 40  LEU 40  1493 1493 LEU LEU A . n 
A 1 41  ALA 41  1494 1494 ALA ALA A . n 
A 1 42  GLY 42  1495 1495 GLY GLY A . n 
A 1 43  GLY 43  1496 1496 GLY GLY A . n 
A 1 44  ILE 44  1497 1497 ILE ILE A . n 
A 1 45  THR 45  1498 1498 THR THR A . n 
A 1 46  MET 46  1499 1499 MET MET A . n 
A 1 47  VAL 47  1500 1500 VAL VAL A . n 
A 1 48  CYS 48  1501 1501 CYS CYS A . n 
A 1 49  ALA 49  1502 1502 ALA ALA A . n 
A 1 50  MET 50  1503 1503 MET MET A . n 
A 1 51  PRO 51  1504 1504 PRO PRO A . n 
A 1 52  ASN 52  1505 1505 ASN ASN A . n 
A 1 53  THR 53  1506 1506 THR THR A . n 
A 1 54  ARG 54  1507 1507 ARG ARG A . n 
A 1 55  PRO 55  1508 1508 PRO PRO A . n 
A 1 56  PRO 56  1509 1509 PRO PRO A . n 
A 1 57  ILE 57  1510 1510 ILE ILE A . n 
A 1 58  ILE 58  1511 1511 ILE ILE A . n 
A 1 59  ASP 59  1512 1512 ASP ASP A . n 
A 1 60  ALA 60  1513 1513 ALA ALA A . n 
A 1 61  PRO 61  1514 1514 PRO PRO A . n 
A 1 62  ALA 62  1515 1515 ALA ALA A . n 
A 1 63  LEU 63  1516 1516 LEU LEU A . n 
A 1 64  ALA 64  1517 1517 ALA ALA A . n 
A 1 65  LEU 65  1518 1518 LEU LEU A . n 
A 1 66  ALA 66  1519 1519 ALA ALA A . n 
A 1 67  GLN 67  1520 1520 GLN GLN A . n 
A 1 68  LYS 68  1521 1521 LYS LYS A . n 
A 1 69  LEU 69  1522 1522 LEU LEU A . n 
A 1 70  ALA 70  1523 1523 ALA ALA A . n 
A 1 71  GLU 71  1524 1524 GLU GLU A . n 
A 1 72  ALA 72  1525 1525 ALA ALA A . n 
A 1 73  GLY 73  1526 1526 GLY GLY A . n 
A 1 74  ALA 74  1527 1527 ALA ALA A . n 
A 1 75  ARG 75  1528 1528 ARG ARG A . n 
A 1 76  CYS 76  1529 1529 CYS CYS A . n 
A 1 77  ASP 77  1530 1530 ASP ASP A . n 
A 1 78  PHE 78  1531 1531 PHE PHE A . n 
A 1 79  ALA 79  1532 1532 ALA ALA A . n 
A 1 80  LEU 80  1533 1533 LEU LEU A . n 
A 1 81  PHE 81  1534 1534 PHE PHE A . n 
A 1 82  LEU 82  1535 1535 LEU LEU A . n 
A 1 83  GLY 83  1536 1536 GLY GLY A . n 
A 1 84  ALA 84  1537 1537 ALA ALA A . n 
A 1 85  SER 85  1538 1538 SER SER A . n 
A 1 86  SER 86  1539 1539 SER SER A . n 
A 1 87  GLU 87  1540 1540 GLU GLU A . n 
A 1 88  ASN 88  1541 1541 ASN ASN A . n 
A 1 89  ALA 89  1542 1542 ALA ALA A . n 
A 1 90  GLY 90  1543 1543 GLY GLY A . n 
A 1 91  THR 91  1544 1544 THR THR A . n 
A 1 92  LEU 92  1545 1545 LEU LEU A . n 
A 1 93  GLY 93  1546 1546 GLY GLY A . n 
A 1 94  THR 94  1547 1547 THR THR A . n 
A 1 95  VAL 95  1548 1548 VAL VAL A . n 
A 1 96  ALA 96  1549 1549 ALA ALA A . n 
A 1 97  GLY 97  1550 1550 GLY GLY A . n 
A 1 98  SER 98  1551 1551 SER SER A . n 
A 1 99  ALA 99  1552 1552 ALA ALA A . n 
A 1 100 ALA 100 1553 1553 ALA ALA A . n 
A 1 101 GLY 101 1554 1554 GLY GLY A . n 
A 1 102 LEU 102 1555 1555 LEU LEU A . n 
A 1 103 KCX 103 1556 1556 KCX KCX A . n 
A 1 104 LEU 104 1557 1557 LEU LEU A . n 
A 1 105 TYR 105 1558 1558 TYR TYR A . n 
A 1 106 LEU 106 1559 1559 LEU LEU A . n 
A 1 107 ASN 107 1560 1560 ASN ASN A . n 
A 1 108 GLU 108 1561 1561 GLU GLU A . n 
A 1 109 THR 109 1562 1562 THR THR A . n 
A 1 110 PHE 110 1563 1563 PHE PHE A . n 
A 1 111 SER 111 1564 1564 SER SER A . n 
A 1 112 GLU 112 1565 1565 GLU GLU A . n 
A 1 113 LEU 113 1566 1566 LEU LEU A . n 
A 1 114 ARG 114 1567 1567 ARG ARG A . n 
A 1 115 LEU 115 1568 1568 LEU LEU A . n 
A 1 116 ASP 116 1569 1569 ASP ASP A . n 
A 1 117 SER 117 1570 1570 SER SER A . n 
A 1 118 VAL 118 1571 1571 VAL VAL A . n 
A 1 119 VAL 119 1572 1572 VAL VAL A . n 
A 1 120 GLN 120 1573 1573 GLN GLN A . n 
A 1 121 TRP 121 1574 1574 TRP TRP A . n 
A 1 122 MET 122 1575 1575 MET MET A . n 
A 1 123 GLU 123 1576 1576 GLU GLU A . n 
A 1 124 HIS 124 1577 1577 HIS HIS A . n 
A 1 125 PHE 125 1578 1578 PHE PHE A . n 
A 1 126 GLU 126 1579 1579 GLU GLU A . n 
A 1 127 THR 127 1580 1580 THR THR A . n 
A 1 128 TRP 128 1581 1581 TRP TRP A . n 
A 1 129 PRO 129 1582 1582 PRO PRO A . n 
A 1 130 SER 130 1583 1583 SER SER A . n 
A 1 131 HIS 131 1584 1584 HIS HIS A . n 
A 1 132 LEU 132 1585 1585 LEU LEU A . n 
A 1 133 PRO 133 1586 1586 PRO PRO A . n 
A 1 134 ILE 134 1587 1587 ILE ILE A . n 
A 1 135 VAL 135 1588 1588 VAL VAL A . n 
A 1 136 ALA 136 1589 1589 ALA ALA A . n 
A 1 137 HIS 137 1590 1590 HIS HIS A . n 
A 1 138 ALA 138 1591 1591 ALA ALA A . n 
A 1 139 GLU 139 1592 1592 GLU GLU A . n 
A 1 140 GLN 140 1593 1593 GLN GLN A . n 
A 1 141 GLN 141 1594 1594 GLN GLN A . n 
A 1 142 THR 142 1595 1595 THR THR A . n 
A 1 143 VAL 143 1596 1596 VAL VAL A . n 
A 1 144 ALA 144 1597 1597 ALA ALA A . n 
A 1 145 ALA 145 1598 1598 ALA ALA A . n 
A 1 146 VAL 146 1599 1599 VAL VAL A . n 
A 1 147 LEU 147 1600 1600 LEU LEU A . n 
A 1 148 MET 148 1601 1601 MET MET A . n 
A 1 149 VAL 149 1602 1602 VAL VAL A . n 
A 1 150 ALA 150 1603 1603 ALA ALA A . n 
A 1 151 GLN 151 1604 1604 GLN GLN A . n 
A 1 152 LEU 152 1605 1605 LEU LEU A . n 
A 1 153 THR 153 1606 1606 THR THR A . n 
A 1 154 GLN 154 1607 1607 GLN GLN A . n 
A 1 155 ARG 155 1608 1608 ARG ARG A . n 
A 1 156 SER 156 1609 1609 SER SER A . n 
A 1 157 VAL 157 1610 1610 VAL VAL A . n 
A 1 158 HIS 158 1611 1611 HIS HIS A . n 
A 1 159 ILE 159 1612 1612 ILE ILE A . n 
A 1 160 CYS 160 1613 1613 CYS CYS A . n 
A 1 161 HIS 161 1614 1614 HIS HIS A . n 
A 1 162 VAL 162 1615 1615 VAL VAL A . n 
A 1 163 ALA 163 1616 1616 ALA ALA A . n 
A 1 164 ARG 164 1617 1617 ARG ARG A . n 
A 1 165 LYS 165 1618 1618 LYS LYS A . n 
A 1 166 GLU 166 1619 1619 GLU GLU A . n 
A 1 167 GLU 167 1620 1620 GLU GLU A . n 
A 1 168 ILE 168 1621 1621 ILE ILE A . n 
A 1 169 LEU 169 1622 1622 LEU LEU A . n 
A 1 170 LEU 170 1623 1623 LEU LEU A . n 
A 1 171 ILE 171 1624 1624 ILE ILE A . n 
A 1 172 LYS 172 1625 1625 LYS LYS A . n 
A 1 173 ALA 173 1626 1626 ALA ALA A . n 
A 1 174 ALA 174 1627 1627 ALA ALA A . n 
A 1 175 LYS 175 1628 1628 LYS LYS A . n 
A 1 176 ALA 176 1629 1629 ALA ALA A . n 
A 1 177 ARG 177 1630 1630 ARG ARG A . n 
A 1 178 GLY 178 1631 1631 GLY GLY A . n 
A 1 179 LEU 179 1632 1632 LEU LEU A . n 
A 1 180 PRO 180 1633 1633 PRO PRO A . n 
A 1 181 VAL 181 1634 1634 VAL VAL A . n 
A 1 182 THR 182 1635 1635 THR THR A . n 
A 1 183 CYS 183 1636 1636 CYS CYS A . n 
A 1 184 GLU 184 1637 1637 GLU GLU A . n 
A 1 185 VAL 185 1638 1638 VAL VAL A . n 
A 1 186 ALA 186 1639 1639 ALA ALA A . n 
A 1 187 PRO 187 1640 1640 PRO PRO A . n 
A 1 188 HIS 188 1641 1641 HIS HIS A . n 
A 1 189 HIS 189 1642 1642 HIS HIS A . n 
A 1 190 LEU 190 1643 1643 LEU LEU A . n 
A 1 191 PHE 191 1644 1644 PHE PHE A . n 
A 1 192 LEU 192 1645 1645 LEU LEU A . n 
A 1 193 SER 193 1646 1646 SER SER A . n 
A 1 194 HIS 194 1647 1647 HIS HIS A . n 
A 1 195 ASP 195 1648 1648 ASP ASP A . n 
A 1 196 ASP 196 1649 1649 ASP ASP A . n 
A 1 197 LEU 197 1650 1650 LEU LEU A . n 
A 1 198 GLU 198 1651 1651 GLU GLU A . n 
A 1 199 ARG 199 1652 1652 ARG ARG A . n 
A 1 200 LEU 200 1653 1653 LEU LEU A . n 
A 1 201 GLY 201 1654 1654 GLY GLY A . n 
A 1 202 PRO 202 1655 1655 PRO PRO A . n 
A 1 203 GLY 203 1656 1656 GLY GLY A . n 
A 1 204 LYS 204 1657 1657 LYS LYS A . n 
A 1 205 GLY 205 1658 1658 GLY GLY A . n 
A 1 206 GLU 206 1659 1659 GLU GLU A . n 
A 1 207 VAL 207 1660 1660 VAL VAL A . n 
A 1 208 ARG 208 1661 1661 ARG ARG A . n 
A 1 209 PRO 209 1662 1662 PRO PRO A . n 
A 1 210 GLU 210 1663 1663 GLU GLU A . n 
A 1 211 LEU 211 1664 1664 LEU LEU A . n 
A 1 212 GLY 212 1665 1665 GLY GLY A . n 
A 1 213 SER 213 1666 1666 SER SER A . n 
A 1 214 ARG 214 1667 1667 ARG ARG A . n 
A 1 215 GLN 215 1668 1668 GLN GLN A . n 
A 1 216 ASP 216 1669 1669 ASP ASP A . n 
A 1 217 VAL 217 1670 1670 VAL VAL A . n 
A 1 218 GLU 218 1671 1671 GLU GLU A . n 
A 1 219 ALA 219 1672 1672 ALA ALA A . n 
A 1 220 LEU 220 1673 1673 LEU LEU A . n 
A 1 221 TRP 221 1674 1674 TRP TRP A . n 
A 1 222 GLU 222 1675 1675 GLU GLU A . n 
A 1 223 ASN 223 1676 1676 ASN ASN A . n 
A 1 224 MET 224 1677 1677 MET MET A . n 
A 1 225 ALA 225 1678 1678 ALA ALA A . n 
A 1 226 VAL 226 1679 1679 VAL VAL A . n 
A 1 227 ILE 227 1680 1680 ILE ILE A . n 
A 1 228 ASP 228 1681 1681 ASP ASP A . n 
A 1 229 CYS 229 1682 1682 CYS CYS A . n 
A 1 230 PHE 230 1683 1683 PHE PHE A . n 
A 1 231 ALA 231 1684 1684 ALA ALA A . n 
A 1 232 SER 232 1685 1685 SER SER A . n 
A 1 233 ASP 233 1686 1686 ASP ASP A . n 
A 1 234 HIS 234 1687 1687 HIS HIS A . n 
A 1 235 ALA 235 1688 1688 ALA ALA A . n 
A 1 236 PRO 236 1689 1689 PRO PRO A . n 
A 1 237 HIS 237 1690 1690 HIS HIS A . n 
A 1 238 THR 238 1691 1691 THR THR A . n 
A 1 239 LEU 239 1692 1692 LEU LEU A . n 
A 1 240 GLU 240 1693 1693 GLU GLU A . n 
A 1 241 GLU 241 1694 1694 GLU GLU A . n 
A 1 242 LYS 242 1695 1695 LYS LYS A . n 
A 1 243 CYS 243 1696 1696 CYS CYS A . n 
A 1 244 GLY 244 1697 1697 GLY GLY A . n 
A 1 245 SER 245 1698 1698 SER SER A . n 
A 1 246 ARG 246 1699 1699 ARG ARG A . n 
A 1 247 PRO 247 1700 1700 PRO PRO A . n 
A 1 248 PRO 248 1701 1701 PRO PRO A . n 
A 1 249 PRO 249 1702 1702 PRO PRO A . n 
A 1 250 GLY 250 1703 1703 GLY GLY A . n 
A 1 251 PHE 251 1704 1704 PHE PHE A . n 
A 1 252 PRO 252 1705 1705 PRO PRO A . n 
A 1 253 GLY 253 1706 1706 GLY GLY A . n 
A 1 254 LEU 254 1707 1707 LEU LEU A . n 
A 1 255 GLU 255 1708 1708 GLU GLU A . n 
A 1 256 THR 256 1709 1709 THR THR A . n 
A 1 257 MET 257 1710 1710 MET MET A . n 
A 1 258 LEU 258 1711 1711 LEU LEU A . n 
A 1 259 PRO 259 1712 1712 PRO PRO A . n 
A 1 260 LEU 260 1713 1713 LEU LEU A . n 
A 1 261 LEU 261 1714 1714 LEU LEU A . n 
A 1 262 LEU 262 1715 1715 LEU LEU A . n 
A 1 263 THR 263 1716 1716 THR THR A . n 
A 1 264 ALA 264 1717 1717 ALA ALA A . n 
A 1 265 VAL 265 1718 1718 VAL VAL A . n 
A 1 266 SER 266 1719 1719 SER SER A . n 
A 1 267 GLU 267 1720 1720 GLU GLU A . n 
A 1 268 GLY 268 1721 1721 GLY GLY A . n 
A 1 269 ARG 269 1722 1722 ARG ARG A . n 
A 1 270 LEU 270 1723 1723 LEU LEU A . n 
A 1 271 SER 271 1724 1724 SER SER A . n 
A 1 272 LEU 272 1725 1725 LEU LEU A . n 
A 1 273 ASP 273 1726 1726 ASP ASP A . n 
A 1 274 ASP 274 1727 1727 ASP ASP A . n 
A 1 275 LEU 275 1728 1728 LEU LEU A . n 
A 1 276 LEU 276 1729 1729 LEU LEU A . n 
A 1 277 GLN 277 1730 1730 GLN GLN A . n 
A 1 278 ARG 278 1731 1731 ARG ARG A . n 
A 1 279 LEU 279 1732 1732 LEU LEU A . n 
A 1 280 HIS 280 1733 1733 HIS HIS A . n 
A 1 281 HIS 281 1734 1734 HIS HIS A . n 
A 1 282 ASN 282 1735 1735 ASN ASN A . n 
A 1 283 PRO 283 1736 1736 PRO PRO A . n 
A 1 284 ARG 284 1737 1737 ARG ARG A . n 
A 1 285 ARG 285 1738 1738 ARG ARG A . n 
A 1 286 ILE 286 1739 1739 ILE ILE A . n 
A 1 287 PHE 287 1740 1740 PHE PHE A . n 
A 1 288 HIS 288 1741 1741 HIS HIS A . n 
A 1 289 LEU 289 1742 1742 LEU LEU A . n 
A 1 290 PRO 290 1743 1743 PRO PRO A . n 
A 1 291 PRO 291 1744 1744 PRO PRO A . n 
A 1 292 GLN 292 1745 1745 GLN GLN A . n 
A 1 293 GLU 293 1746 1746 GLU GLU A . n 
A 1 294 ASP 294 1747 1747 ASP ASP A . n 
A 1 295 THR 295 1748 1748 THR THR A . n 
A 1 296 TYR 296 1749 1749 TYR TYR A . n 
A 1 297 VAL 297 1750 1750 VAL VAL A . n 
A 1 298 GLU 298 1751 1751 GLU GLU A . n 
A 1 299 VAL 299 1752 1752 VAL VAL A . n 
A 1 300 ASP 300 1753 1753 ASP ASP A . n 
A 1 301 LEU 301 1754 1754 LEU LEU A . n 
A 1 302 GLU 302 1755 1755 GLU GLU A . n 
A 1 303 HIS 303 1756 1756 HIS HIS A . n 
A 1 304 GLU 304 1757 1757 GLU GLU A . n 
A 1 305 TRP 305 1758 1758 TRP TRP A . n 
A 1 306 THR 306 1759 1759 THR THR A . n 
A 1 307 ILE 307 1760 1760 ILE ILE A . n 
A 1 308 PRO 308 1761 1761 PRO PRO A . n 
A 1 309 SER 309 1762 1762 SER SER A . n 
A 1 310 HIS 310 1763 1763 HIS HIS A . n 
A 1 311 MET 311 1764 1764 MET MET A . n 
A 1 312 PRO 312 1765 1765 PRO PRO A . n 
A 1 313 PHE 313 1766 1766 PHE PHE A . n 
A 1 314 SER 314 1767 1767 SER SER A . n 
A 1 315 LYS 315 1768 1768 LYS LYS A . n 
A 1 316 ALA 316 1769 1769 ALA ALA A . n 
A 1 317 HIS 317 1770 1770 HIS HIS A . n 
A 1 318 TRP 318 1771 1771 TRP TRP A . n 
A 1 319 THR 319 1772 1772 THR THR A . n 
A 1 320 PRO 320 1773 1773 PRO PRO A . n 
A 1 321 PHE 321 1774 1774 PHE PHE A . n 
A 1 322 GLU 322 1775 1775 GLU GLU A . n 
A 1 323 GLY 323 1776 1776 GLY GLY A . n 
A 1 324 GLN 324 1777 1777 GLN GLN A . n 
A 1 325 LYS 325 1778 1778 LYS LYS A . n 
A 1 326 VAL 326 1779 1779 VAL VAL A . n 
A 1 327 LYS 327 1780 1780 LYS LYS A . n 
A 1 328 GLY 328 1781 1781 GLY GLY A . n 
A 1 329 THR 329 1782 1782 THR THR A . n 
A 1 330 VAL 330 1783 1783 VAL VAL A . n 
A 1 331 ARG 331 1784 1784 ARG ARG A . n 
A 1 332 ARG 332 1785 1785 ARG ARG A . n 
A 1 333 VAL 333 1786 1786 VAL VAL A . n 
A 1 334 VAL 334 1787 1787 VAL VAL A . n 
A 1 335 LEU 335 1788 1788 LEU LEU A . n 
A 1 336 ARG 336 1789 1789 ARG ARG A . n 
A 1 337 GLY 337 1790 1790 GLY GLY A . n 
A 1 338 GLU 338 1791 1791 GLU GLU A . n 
A 1 339 VAL 339 1792 1792 VAL VAL A . n 
A 1 340 ALA 340 1793 1793 ALA ALA A . n 
A 1 341 TYR 341 1794 1794 TYR TYR A . n 
A 1 342 ILE 342 1795 1795 ILE ILE A . n 
A 1 343 ASP 343 1796 1796 ASP ASP A . n 
A 1 344 GLY 344 1797 1797 GLY GLY A . n 
A 1 345 GLN 345 1798 1798 GLN GLN A . n 
A 1 346 VAL 346 1799 1799 VAL VAL A . n 
A 1 347 LEU 347 1800 1800 LEU LEU A . n 
A 1 348 VAL 348 1801 1801 VAL VAL A . n 
A 1 349 PRO 349 1802 1802 PRO PRO A . n 
A 1 350 PRO 350 1803 1803 PRO PRO A . n 
A 1 351 GLY 351 1804 1804 GLY GLY A . n 
A 1 352 TYR 352 1805 1805 TYR TYR A . n 
A 1 353 GLY 353 1806 1806 GLY GLY A . n 
A 1 354 GLN 354 1807 1807 GLN GLN A . n 
A 1 355 ASP 355 1808 1808 ASP ASP A . n 
A 1 356 VAL 356 1809 1809 VAL VAL A . n 
A 1 357 ARG 357 1810 1810 ARG ARG A . n 
A 1 358 LYS 358 1811 1811 LYS LYS A . n 
A 1 359 TRP 359 1812 1812 TRP TRP A . n 
A 1 360 PRO 360 1813 1813 PRO PRO A . n 
A 1 361 GLN 361 1814 1814 GLN GLN A . n 
A 1 362 GLY 362 1815 1815 GLY GLY A . n 
A 1 363 ALA 363 1816 1816 ALA ALA A . n 
A 1 364 VAL 364 1817 1817 VAL VAL A . n 
A 1 365 PRO 365 1818 1818 PRO PRO A . n 
A 1 366 GLN 366 1819 1819 GLN GLN A . n 
A 1 367 LEU 367 1820 1820 LEU LEU A . n 
A 1 368 PRO 368 1821 1821 PRO PRO A . n 
A 1 369 PRO 369 1822 ?    ?   ?   A . n 
A 1 370 SER 370 1823 ?    ?   ?   A . n 
A 1 371 ALA 371 1824 ?    ?   ?   A . n 
A 1 372 PRO 372 1825 ?    ?   ?   A . n 
A 1 373 ALA 373 1826 ?    ?   ?   A . n 
A 1 374 THR 374 1827 ?    ?   ?   A . n 
A 1 375 SER 375 1828 ?    ?   ?   A . n 
A 1 376 GLU 376 1829 ?    ?   ?   A . n 
A 1 377 MET 377 1830 ?    ?   ?   A . n 
A 1 378 THR 378 1831 ?    ?   ?   A . n 
A 1 379 THR 379 1832 ?    ?   ?   A . n 
A 1 380 THR 380 1833 ?    ?   ?   A . n 
A 1 381 PRO 381 1834 ?    ?   ?   A . n 
A 1 382 GLU 382 1835 ?    ?   ?   A . n 
A 1 383 ARG 383 1836 ?    ?   ?   A . n 
A 1 384 PRO 384 1837 ?    ?   ?   A . n 
A 1 385 ARG 385 1838 ?    ?   ?   A . n 
A 1 386 ARG 386 1839 ?    ?   ?   A . n 
A 1 387 GLY 387 1840 ?    ?   ?   A . n 
A 1 388 ILE 388 1841 ?    ?   ?   A . n 
A 1 389 PRO 389 1842 ?    ?   ?   A . n 
A 1 390 GLY 390 1843 ?    ?   ?   A . n 
A 1 391 LEU 391 1844 ?    ?   ?   A . n 
A 1 392 PRO 392 1845 ?    ?   ?   A . n 
A 1 393 ASP 393 1846 ?    ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   2822 2822 ZN  ZN  A . 
C 2 ZN  1   2823 2823 ZN  ZN  A . 
D 2 ZN  1   2824 2824 ZN  ZN  A . 
E 2 ZN  1   2825 2825 ZN  ZN  A . 
F 3 FMT 1   2826 2826 FMT FMT A . 
G 3 FMT 1   2827 2827 FMT FMT A . 
H 3 FMT 1   2828 2828 FMT FMT A . 
I 3 FMT 1   2829 2829 FMT FMT A . 
J 4 HOH 1   2001 2001 HOH HOH A . 
J 4 HOH 2   2002 2002 HOH HOH A . 
J 4 HOH 3   2003 2003 HOH HOH A . 
J 4 HOH 4   2004 2004 HOH HOH A . 
J 4 HOH 5   2005 2005 HOH HOH A . 
J 4 HOH 6   2006 2006 HOH HOH A . 
J 4 HOH 7   2007 2007 HOH HOH A . 
J 4 HOH 8   2008 2008 HOH HOH A . 
J 4 HOH 9   2009 2009 HOH HOH A . 
J 4 HOH 10  2010 2010 HOH HOH A . 
J 4 HOH 11  2011 2011 HOH HOH A . 
J 4 HOH 12  2012 2012 HOH HOH A . 
J 4 HOH 13  2013 2013 HOH HOH A . 
J 4 HOH 14  2014 2014 HOH HOH A . 
J 4 HOH 15  2015 2015 HOH HOH A . 
J 4 HOH 16  2016 2016 HOH HOH A . 
J 4 HOH 17  2017 2017 HOH HOH A . 
J 4 HOH 18  2018 2018 HOH HOH A . 
J 4 HOH 19  2019 2019 HOH HOH A . 
J 4 HOH 20  2020 2020 HOH HOH A . 
J 4 HOH 21  2021 2021 HOH HOH A . 
J 4 HOH 22  2022 2022 HOH HOH A . 
J 4 HOH 23  2023 2023 HOH HOH A . 
J 4 HOH 24  2024 2024 HOH HOH A . 
J 4 HOH 25  2025 2025 HOH HOH A . 
J 4 HOH 26  2026 2026 HOH HOH A . 
J 4 HOH 27  2027 2027 HOH HOH A . 
J 4 HOH 28  2028 2028 HOH HOH A . 
J 4 HOH 29  2029 2029 HOH HOH A . 
J 4 HOH 30  2030 2030 HOH HOH A . 
J 4 HOH 31  2031 2031 HOH HOH A . 
J 4 HOH 32  2032 2032 HOH HOH A . 
J 4 HOH 33  2033 2033 HOH HOH A . 
J 4 HOH 34  2034 2034 HOH HOH A . 
J 4 HOH 35  2035 2035 HOH HOH A . 
J 4 HOH 36  2036 2036 HOH HOH A . 
J 4 HOH 37  2037 2037 HOH HOH A . 
J 4 HOH 38  2038 2038 HOH HOH A . 
J 4 HOH 39  2039 2039 HOH HOH A . 
J 4 HOH 40  2040 2040 HOH HOH A . 
J 4 HOH 41  2041 2041 HOH HOH A . 
J 4 HOH 42  2042 2042 HOH HOH A . 
J 4 HOH 43  2043 2043 HOH HOH A . 
J 4 HOH 44  2044 2044 HOH HOH A . 
J 4 HOH 45  2045 2045 HOH HOH A . 
J 4 HOH 46  2046 2046 HOH HOH A . 
J 4 HOH 47  2047 2047 HOH HOH A . 
J 4 HOH 48  2048 2048 HOH HOH A . 
J 4 HOH 49  2049 2049 HOH HOH A . 
J 4 HOH 50  2050 2050 HOH HOH A . 
J 4 HOH 51  2051 2051 HOH HOH A . 
J 4 HOH 52  2052 2052 HOH HOH A . 
J 4 HOH 53  2053 2053 HOH HOH A . 
J 4 HOH 54  2054 2054 HOH HOH A . 
J 4 HOH 55  2055 2055 HOH HOH A . 
J 4 HOH 56  2056 2056 HOH HOH A . 
J 4 HOH 57  2057 2057 HOH HOH A . 
J 4 HOH 58  2058 2058 HOH HOH A . 
J 4 HOH 59  2059 2059 HOH HOH A . 
J 4 HOH 60  2060 2060 HOH HOH A . 
J 4 HOH 61  2061 2061 HOH HOH A . 
J 4 HOH 62  2062 2062 HOH HOH A . 
J 4 HOH 63  2063 2063 HOH HOH A . 
J 4 HOH 64  2064 2064 HOH HOH A . 
J 4 HOH 65  2065 2065 HOH HOH A . 
J 4 HOH 66  2066 2066 HOH HOH A . 
J 4 HOH 67  2067 2067 HOH HOH A . 
J 4 HOH 68  2068 2068 HOH HOH A . 
J 4 HOH 69  2069 2069 HOH HOH A . 
J 4 HOH 70  2070 2070 HOH HOH A . 
J 4 HOH 71  2071 2071 HOH HOH A . 
J 4 HOH 72  2072 2072 HOH HOH A . 
J 4 HOH 73  2073 2073 HOH HOH A . 
J 4 HOH 74  2074 2074 HOH HOH A . 
J 4 HOH 75  2075 2075 HOH HOH A . 
J 4 HOH 76  2076 2076 HOH HOH A . 
J 4 HOH 77  2077 2077 HOH HOH A . 
J 4 HOH 78  2078 2078 HOH HOH A . 
J 4 HOH 79  2079 2079 HOH HOH A . 
J 4 HOH 80  2080 2080 HOH HOH A . 
J 4 HOH 81  2081 2081 HOH HOH A . 
J 4 HOH 82  2082 2082 HOH HOH A . 
J 4 HOH 83  2083 2083 HOH HOH A . 
J 4 HOH 84  2084 2084 HOH HOH A . 
J 4 HOH 85  2085 2085 HOH HOH A . 
J 4 HOH 86  2086 2086 HOH HOH A . 
J 4 HOH 87  2087 2087 HOH HOH A . 
J 4 HOH 88  2088 2088 HOH HOH A . 
J 4 HOH 89  2089 2089 HOH HOH A . 
J 4 HOH 90  2090 2090 HOH HOH A . 
J 4 HOH 91  2091 2091 HOH HOH A . 
J 4 HOH 92  2092 2092 HOH HOH A . 
J 4 HOH 93  2093 2093 HOH HOH A . 
J 4 HOH 94  2094 2094 HOH HOH A . 
J 4 HOH 95  2095 2095 HOH HOH A . 
J 4 HOH 96  2096 2096 HOH HOH A . 
J 4 HOH 97  2097 2097 HOH HOH A . 
J 4 HOH 98  2098 2098 HOH HOH A . 
J 4 HOH 99  2099 2099 HOH HOH A . 
J 4 HOH 100 2100 2100 HOH HOH A . 
J 4 HOH 101 2101 2101 HOH HOH A . 
J 4 HOH 102 2102 2102 HOH HOH A . 
J 4 HOH 103 2103 2103 HOH HOH A . 
J 4 HOH 104 2104 2104 HOH HOH A . 
J 4 HOH 105 2105 2105 HOH HOH A . 
J 4 HOH 106 2106 2106 HOH HOH A . 
J 4 HOH 107 2107 2107 HOH HOH A . 
J 4 HOH 108 2108 2108 HOH HOH A . 
J 4 HOH 109 2109 2109 HOH HOH A . 
J 4 HOH 110 2110 2110 HOH HOH A . 
J 4 HOH 111 2111 2111 HOH HOH A . 
J 4 HOH 112 2112 2112 HOH HOH A . 
J 4 HOH 113 2113 2113 HOH HOH A . 
J 4 HOH 114 2114 2114 HOH HOH A . 
J 4 HOH 115 2115 2115 HOH HOH A . 
J 4 HOH 116 2116 2116 HOH HOH A . 
J 4 HOH 117 2117 2117 HOH HOH A . 
J 4 HOH 118 2118 2118 HOH HOH A . 
J 4 HOH 119 2119 2119 HOH HOH A . 
J 4 HOH 120 2120 2120 HOH HOH A . 
J 4 HOH 121 2121 2121 HOH HOH A . 
J 4 HOH 122 2122 2122 HOH HOH A . 
J 4 HOH 123 2123 2123 HOH HOH A . 
J 4 HOH 124 2124 2124 HOH HOH A . 
J 4 HOH 125 2125 2125 HOH HOH A . 
J 4 HOH 126 2126 2126 HOH HOH A . 
J 4 HOH 127 2127 2127 HOH HOH A . 
J 4 HOH 128 2128 2128 HOH HOH A . 
J 4 HOH 129 2129 2129 HOH HOH A . 
J 4 HOH 130 2130 2130 HOH HOH A . 
J 4 HOH 131 2131 2131 HOH HOH A . 
J 4 HOH 132 2132 2132 HOH HOH A . 
J 4 HOH 133 2133 2133 HOH HOH A . 
J 4 HOH 134 2134 2134 HOH HOH A . 
J 4 HOH 135 2135 2135 HOH HOH A . 
J 4 HOH 136 2136 2136 HOH HOH A . 
J 4 HOH 137 2137 2137 HOH HOH A . 
J 4 HOH 138 2138 2138 HOH HOH A . 
J 4 HOH 139 2139 2139 HOH HOH A . 
J 4 HOH 140 2140 2140 HOH HOH A . 
J 4 HOH 141 2141 2141 HOH HOH A . 
J 4 HOH 142 2142 2142 HOH HOH A . 
J 4 HOH 143 2143 2143 HOH HOH A . 
J 4 HOH 144 2144 2144 HOH HOH A . 
J 4 HOH 145 2145 2145 HOH HOH A . 
J 4 HOH 146 2146 2146 HOH HOH A . 
J 4 HOH 147 2147 2147 HOH HOH A . 
J 4 HOH 148 2148 2148 HOH HOH A . 
J 4 HOH 149 2149 2149 HOH HOH A . 
J 4 HOH 150 2150 2150 HOH HOH A . 
J 4 HOH 151 2151 2151 HOH HOH A . 
J 4 HOH 152 2152 2152 HOH HOH A . 
J 4 HOH 153 2153 2153 HOH HOH A . 
J 4 HOH 154 2154 2154 HOH HOH A . 
J 4 HOH 155 2155 2155 HOH HOH A . 
J 4 HOH 156 2156 2156 HOH HOH A . 
J 4 HOH 157 2157 2157 HOH HOH A . 
J 4 HOH 158 2158 2158 HOH HOH A . 
J 4 HOH 159 2159 2159 HOH HOH A . 
J 4 HOH 160 2160 2160 HOH HOH A . 
J 4 HOH 161 2161 2161 HOH HOH A . 
J 4 HOH 162 2162 2162 HOH HOH A . 
J 4 HOH 163 2163 2163 HOH HOH A . 
J 4 HOH 164 2164 2164 HOH HOH A . 
J 4 HOH 165 2165 2165 HOH HOH A . 
J 4 HOH 166 2166 2166 HOH HOH A . 
J 4 HOH 167 2167 2167 HOH HOH A . 
J 4 HOH 168 2168 2168 HOH HOH A . 
J 4 HOH 169 2169 2169 HOH HOH A . 
J 4 HOH 170 2170 2170 HOH HOH A . 
J 4 HOH 171 2171 2171 HOH HOH A . 
J 4 HOH 172 2172 2172 HOH HOH A . 
J 4 HOH 173 2173 2173 HOH HOH A . 
J 4 HOH 174 2174 2174 HOH HOH A . 
J 4 HOH 175 2175 2175 HOH HOH A . 
J 4 HOH 176 2176 2176 HOH HOH A . 
J 4 HOH 177 2177 2177 HOH HOH A . 
J 4 HOH 178 2178 2178 HOH HOH A . 
J 4 HOH 179 2179 2179 HOH HOH A . 
J 4 HOH 180 2180 2180 HOH HOH A . 
J 4 HOH 181 2181 2181 HOH HOH A . 
J 4 HOH 182 2182 2182 HOH HOH A . 
J 4 HOH 183 2183 2183 HOH HOH A . 
J 4 HOH 184 2184 2184 HOH HOH A . 
J 4 HOH 185 2185 2185 HOH HOH A . 
J 4 HOH 186 2186 2186 HOH HOH A . 
J 4 HOH 187 2187 2187 HOH HOH A . 
J 4 HOH 188 2188 2188 HOH HOH A . 
J 4 HOH 189 2189 2189 HOH HOH A . 
J 4 HOH 190 2190 2190 HOH HOH A . 
J 4 HOH 191 2191 2191 HOH HOH A . 
J 4 HOH 192 2192 2192 HOH HOH A . 
J 4 HOH 193 2193 2193 HOH HOH A . 
J 4 HOH 194 2194 2194 HOH HOH A . 
J 4 HOH 195 2195 2195 HOH HOH A . 
J 4 HOH 196 2196 2196 HOH HOH A . 
J 4 HOH 197 2197 2197 HOH HOH A . 
J 4 HOH 198 2198 2198 HOH HOH A . 
J 4 HOH 199 2199 2199 HOH HOH A . 
J 4 HOH 200 2200 2200 HOH HOH A . 
J 4 HOH 201 2201 2201 HOH HOH A . 
J 4 HOH 202 2202 2202 HOH HOH A . 
J 4 HOH 203 2203 2203 HOH HOH A . 
J 4 HOH 204 2204 2204 HOH HOH A . 
J 4 HOH 205 2205 2205 HOH HOH A . 
J 4 HOH 206 2206 2206 HOH HOH A . 
J 4 HOH 207 2207 2207 HOH HOH A . 
J 4 HOH 208 2208 2208 HOH HOH A . 
J 4 HOH 209 2209 2209 HOH HOH A . 
J 4 HOH 210 2210 2210 HOH HOH A . 
J 4 HOH 211 2211 2211 HOH HOH A . 
J 4 HOH 212 2212 2212 HOH HOH A . 
J 4 HOH 213 2213 2213 HOH HOH A . 
J 4 HOH 214 2214 2214 HOH HOH A . 
J 4 HOH 215 2215 2215 HOH HOH A . 
J 4 HOH 216 2216 2216 HOH HOH A . 
J 4 HOH 217 2217 2217 HOH HOH A . 
J 4 HOH 218 2218 2218 HOH HOH A . 
J 4 HOH 219 2219 2219 HOH HOH A . 
J 4 HOH 220 2220 2220 HOH HOH A . 
J 4 HOH 221 2221 2221 HOH HOH A . 
J 4 HOH 222 2222 2222 HOH HOH A . 
J 4 HOH 223 2223 2223 HOH HOH A . 
J 4 HOH 224 2224 2224 HOH HOH A . 
J 4 HOH 225 2225 2225 HOH HOH A . 
J 4 HOH 226 2226 2226 HOH HOH A . 
J 4 HOH 227 2227 2227 HOH HOH A . 
J 4 HOH 228 2228 2228 HOH HOH A . 
J 4 HOH 229 2229 2229 HOH HOH A . 
J 4 HOH 230 2230 2230 HOH HOH A . 
J 4 HOH 231 2231 2231 HOH HOH A . 
J 4 HOH 232 2232 2232 HOH HOH A . 
J 4 HOH 233 2233 2233 HOH HOH A . 
J 4 HOH 234 2234 2234 HOH HOH A . 
J 4 HOH 235 2235 2235 HOH HOH A . 
J 4 HOH 236 2236 2236 HOH HOH A . 
J 4 HOH 237 2237 2237 HOH HOH A . 
J 4 HOH 238 2238 2238 HOH HOH A . 
J 4 HOH 239 2239 2239 HOH HOH A . 
J 4 HOH 240 2240 2240 HOH HOH A . 
J 4 HOH 241 2241 2241 HOH HOH A . 
J 4 HOH 242 2242 2242 HOH HOH A . 
J 4 HOH 243 2243 2243 HOH HOH A . 
J 4 HOH 244 2244 2244 HOH HOH A . 
J 4 HOH 245 2245 2245 HOH HOH A . 
J 4 HOH 246 2246 2246 HOH HOH A . 
J 4 HOH 247 2247 2247 HOH HOH A . 
J 4 HOH 248 2248 2248 HOH HOH A . 
J 4 HOH 249 2249 2249 HOH HOH A . 
J 4 HOH 250 2250 2250 HOH HOH A . 
J 4 HOH 251 2251 2251 HOH HOH A . 
J 4 HOH 252 2252 2252 HOH HOH A . 
J 4 HOH 253 2253 2253 HOH HOH A . 
J 4 HOH 254 2254 2254 HOH HOH A . 
J 4 HOH 255 2255 2255 HOH HOH A . 
J 4 HOH 256 2256 2256 HOH HOH A . 
J 4 HOH 257 2257 2257 HOH HOH A . 
J 4 HOH 258 2258 2258 HOH HOH A . 
J 4 HOH 259 2259 2259 HOH HOH A . 
J 4 HOH 260 2260 2260 HOH HOH A . 
J 4 HOH 261 2261 2261 HOH HOH A . 
J 4 HOH 262 2262 2262 HOH HOH A . 
J 4 HOH 263 2263 2263 HOH HOH A . 
J 4 HOH 264 2264 2264 HOH HOH A . 
J 4 HOH 265 2265 2265 HOH HOH A . 
J 4 HOH 266 2266 2266 HOH HOH A . 
J 4 HOH 267 2267 2267 HOH HOH A . 
J 4 HOH 268 2268 2268 HOH HOH A . 
J 4 HOH 269 2269 2269 HOH HOH A . 
J 4 HOH 270 2270 2270 HOH HOH A . 
J 4 HOH 271 2271 2271 HOH HOH A . 
J 4 HOH 272 2272 2272 HOH HOH A . 
J 4 HOH 273 2273 2273 HOH HOH A . 
J 4 HOH 274 2274 2274 HOH HOH A . 
J 4 HOH 275 2275 2275 HOH HOH A . 
J 4 HOH 276 2276 2276 HOH HOH A . 
J 4 HOH 277 2277 2277 HOH HOH A . 
J 4 HOH 278 2278 2278 HOH HOH A . 
J 4 HOH 279 2279 2279 HOH HOH A . 
J 4 HOH 280 2280 2280 HOH HOH A . 
J 4 HOH 281 2281 2281 HOH HOH A . 
J 4 HOH 282 2282 2282 HOH HOH A . 
J 4 HOH 283 2283 2283 HOH HOH A . 
J 4 HOH 284 2284 2284 HOH HOH A . 
J 4 HOH 285 2285 2285 HOH HOH A . 
J 4 HOH 286 2286 2286 HOH HOH A . 
J 4 HOH 287 2287 2287 HOH HOH A . 
J 4 HOH 288 2288 2288 HOH HOH A . 
J 4 HOH 289 2289 2289 HOH HOH A . 
J 4 HOH 290 2290 2290 HOH HOH A . 
J 4 HOH 291 2291 2291 HOH HOH A . 
J 4 HOH 292 2292 2292 HOH HOH A . 
J 4 HOH 293 2293 2293 HOH HOH A . 
J 4 HOH 294 2294 2294 HOH HOH A . 
J 4 HOH 295 2295 2295 HOH HOH A . 
J 4 HOH 296 2296 2296 HOH HOH A . 
J 4 HOH 297 2297 2297 HOH HOH A . 
J 4 HOH 298 2298 2298 HOH HOH A . 
J 4 HOH 299 2299 2299 HOH HOH A . 
J 4 HOH 300 2300 2300 HOH HOH A . 
J 4 HOH 301 2301 2301 HOH HOH A . 
J 4 HOH 302 2302 2302 HOH HOH A . 
J 4 HOH 303 2303 2303 HOH HOH A . 
J 4 HOH 304 2304 2304 HOH HOH A . 
J 4 HOH 305 2305 2305 HOH HOH A . 
J 4 HOH 306 2306 2306 HOH HOH A . 
J 4 HOH 307 2307 2307 HOH HOH A . 
J 4 HOH 308 2308 2308 HOH HOH A . 
J 4 HOH 309 2309 2309 HOH HOH A . 
J 4 HOH 310 2310 2310 HOH HOH A . 
J 4 HOH 311 2311 2311 HOH HOH A . 
J 4 HOH 312 2312 2312 HOH HOH A . 
J 4 HOH 313 2313 2313 HOH HOH A . 
J 4 HOH 314 2314 2314 HOH HOH A . 
J 4 HOH 315 2315 2315 HOH HOH A . 
J 4 HOH 316 2316 2316 HOH HOH A . 
J 4 HOH 317 2317 2317 HOH HOH A . 
J 4 HOH 318 2318 2318 HOH HOH A . 
J 4 HOH 319 2319 2319 HOH HOH A . 
J 4 HOH 320 2320 2320 HOH HOH A . 
J 4 HOH 321 2321 2321 HOH HOH A . 
J 4 HOH 322 2322 2322 HOH HOH A . 
J 4 HOH 323 2323 2323 HOH HOH A . 
J 4 HOH 324 2324 2324 HOH HOH A . 
J 4 HOH 325 2325 2325 HOH HOH A . 
J 4 HOH 326 2326 2326 HOH HOH A . 
J 4 HOH 327 2327 2327 HOH HOH A . 
J 4 HOH 328 2328 2328 HOH HOH A . 
J 4 HOH 329 2329 2329 HOH HOH A . 
J 4 HOH 330 2330 2330 HOH HOH A . 
J 4 HOH 331 2331 2331 HOH HOH A . 
J 4 HOH 332 2332 2332 HOH HOH A . 
J 4 HOH 333 2333 2333 HOH HOH A . 
J 4 HOH 334 2334 2334 HOH HOH A . 
J 4 HOH 335 2335 2335 HOH HOH A . 
J 4 HOH 336 2336 2336 HOH HOH A . 
J 4 HOH 337 2337 2337 HOH HOH A . 
J 4 HOH 338 2338 2338 HOH HOH A . 
J 4 HOH 339 2339 2339 HOH HOH A . 
J 4 HOH 340 2340 2340 HOH HOH A . 
J 4 HOH 341 2341 2341 HOH HOH A . 
J 4 HOH 342 2342 2342 HOH HOH A . 
J 4 HOH 343 2343 2343 HOH HOH A . 
J 4 HOH 344 2344 2344 HOH HOH A . 
J 4 HOH 345 2345 2345 HOH HOH A . 
J 4 HOH 346 2346 2346 HOH HOH A . 
J 4 HOH 347 2347 2347 HOH HOH A . 
J 4 HOH 348 2348 2348 HOH HOH A . 
J 4 HOH 349 2349 2349 HOH HOH A . 
J 4 HOH 350 2350 2350 HOH HOH A . 
J 4 HOH 351 2351 2351 HOH HOH A . 
J 4 HOH 352 2352 2352 HOH HOH A . 
J 4 HOH 353 2353 2353 HOH HOH A . 
J 4 HOH 354 2354 2354 HOH HOH A . 
J 4 HOH 355 2355 2355 HOH HOH A . 
J 4 HOH 356 2356 2356 HOH HOH A . 
J 4 HOH 357 2357 2357 HOH HOH A . 
J 4 HOH 358 2358 2358 HOH HOH A . 
J 4 HOH 359 2359 2359 HOH HOH A . 
J 4 HOH 360 2360 2360 HOH HOH A . 
J 4 HOH 361 2361 2361 HOH HOH A . 
J 4 HOH 362 2362 2362 HOH HOH A . 
J 4 HOH 363 2363 2363 HOH HOH A . 
J 4 HOH 364 2364 2364 HOH HOH A . 
J 4 HOH 365 2365 2365 HOH HOH A . 
J 4 HOH 366 2366 2366 HOH HOH A . 
J 4 HOH 367 2367 2367 HOH HOH A . 
J 4 HOH 368 2368 2368 HOH HOH A . 
J 4 HOH 369 2369 2369 HOH HOH A . 
J 4 HOH 370 2370 2370 HOH HOH A . 
J 4 HOH 371 2371 2371 HOH HOH A . 
J 4 HOH 372 2372 2372 HOH HOH A . 
J 4 HOH 373 2373 2373 HOH HOH A . 
J 4 HOH 374 2374 2374 HOH HOH A . 
J 4 HOH 375 2375 2375 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    KCX 
_pdbx_struct_mod_residue.label_seq_id     103 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     KCX 
_pdbx_struct_mod_residue.auth_seq_id      1556 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          'LYSINE NZ-CARBOXYLIC ACID' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3640   ? 
1 MORE         -296.8 ? 
1 'SSA (A^2)'  26650  ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A FMT 2827 ? G FMT . 
2 1 A FMT 2827 ? G FMT . 
3 1 A HOH 2025 ? J HOH . 
4 1 A HOH 2055 ? J HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 20  ? A HIS 1473 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 OQ2 ? A KCX 103 ? A KCX 1556 ? 1_555 91.8  ? 
2  NE2 ? A HIS 20  ? A HIS 1473 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 O   ? J HOH .   ? A HOH 2066 ? 1_555 126.8 ? 
3  OQ2 ? A KCX 103 ? A KCX 1556 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 O   ? J HOH .   ? A HOH 2066 ? 1_555 92.3  ? 
4  NE2 ? A HIS 20  ? A HIS 1473 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 NE2 ? A HIS 18  ? A HIS 1471 ? 1_555 115.5 ? 
5  OQ2 ? A KCX 103 ? A KCX 1556 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 NE2 ? A HIS 18  ? A HIS 1471 ? 1_555 92.4  ? 
6  O   ? J HOH .   ? A HOH 2066 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 NE2 ? A HIS 18  ? A HIS 1471 ? 1_555 117.3 ? 
7  NE2 ? A HIS 20  ? A HIS 1473 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 OD1 ? A ASP 233 ? A ASP 1686 ? 1_555 89.6  ? 
8  OQ2 ? A KCX 103 ? A KCX 1556 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 OD1 ? A ASP 233 ? A ASP 1686 ? 1_555 176.8 ? 
9  O   ? J HOH .   ? A HOH 2066 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 OD1 ? A ASP 233 ? A ASP 1686 ? 1_555 89.1  ? 
10 NE2 ? A HIS 18  ? A HIS 1471 ? 1_555 ZN ? B ZN . ? A ZN 2822 ? 1_555 OD1 ? A ASP 233 ? A ASP 1686 ? 1_555 84.4  ? 
11 ND1 ? A HIS 137 ? A HIS 1590 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 O   ? J HOH .   ? A HOH 2066 ? 1_555 128.1 ? 
12 ND1 ? A HIS 137 ? A HIS 1590 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 NE2 ? A HIS 161 ? A HIS 1614 ? 1_555 93.8  ? 
13 O   ? J HOH .   ? A HOH 2066 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 NE2 ? A HIS 161 ? A HIS 1614 ? 1_555 107.7 ? 
14 ND1 ? A HIS 137 ? A HIS 1590 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 OQ1 ? A KCX 103 ? A KCX 1556 ? 1_555 105.8 ? 
15 O   ? J HOH .   ? A HOH 2066 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 OQ1 ? A KCX 103 ? A KCX 1556 ? 1_555 108.3 ? 
16 NE2 ? A HIS 161 ? A HIS 1614 ? 1_555 ZN ? C ZN . ? A ZN 2823 ? 1_555 OQ1 ? A KCX 103 ? A KCX 1556 ? 1_555 112.4 ? 
17 SG  ? A CYS 160 ? A CYS 1613 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 O   ? J HOH .   ? A HOH 2065 ? 1_555 111.8 ? 
18 SG  ? A CYS 160 ? A CYS 1613 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 OE2 ? A GLU 184 ? A GLU 1637 ? 1_555 113.6 ? 
19 O   ? J HOH .   ? A HOH 2065 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 OE2 ? A GLU 184 ? A GLU 1637 ? 1_555 107.2 ? 
20 SG  ? A CYS 160 ? A CYS 1613 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 ND1 ? A HIS 18  ? A HIS 1471 ? 1_555 112.4 ? 
21 O   ? J HOH .   ? A HOH 2065 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 ND1 ? A HIS 18  ? A HIS 1471 ? 1_555 118.0 ? 
22 OE2 ? A GLU 184 ? A GLU 1637 ? 1_555 ZN ? D ZN . ? A ZN 2824 ? 1_555 ND1 ? A HIS 18  ? A HIS 1471 ? 1_555 92.3  ? 
23 O   ? J HOH .   ? A HOH 2290 ? 1_555 ZN ? E ZN . ? A ZN 2825 ? 1_555 O   ? J HOH .   ? A HOH 2289 ? 1_555 109.3 ? 
24 O   ? J HOH .   ? A HOH 2290 ? 1_555 ZN ? E ZN . ? A ZN 2825 ? 1_555 ND1 ? A HIS 288 ? A HIS 1741 ? 3_554 114.7 ? 
25 O   ? J HOH .   ? A HOH 2289 ? 1_555 ZN ? E ZN . ? A ZN 2825 ? 1_555 ND1 ? A HIS 288 ? A HIS 1741 ? 3_554 112.4 ? 
26 O   ? J HOH .   ? A HOH 2290 ? 1_555 ZN ? E ZN . ? A ZN 2825 ? 1_555 NE2 ? A HIS 281 ? A HIS 1734 ? 1_555 107.4 ? 
27 O   ? J HOH .   ? A HOH 2289 ? 1_555 ZN ? E ZN . ? A ZN 2825 ? 1_555 NE2 ? A HIS 281 ? A HIS 1734 ? 1_555 105.3 ? 
28 ND1 ? A HIS 288 ? A HIS 1741 ? 3_554 ZN ? E ZN . ? A ZN 2825 ? 1_555 NE2 ? A HIS 281 ? A HIS 1734 ? 1_555 107.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-01-08 
2 'Structure model' 1 1 2014-02-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
XSCALE 'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HZ3 A LYS 1482 ? ? HD1 A HIS 1690 ? ? 1.31 
2 1 HD1 A HIS 1611 ? ? HG1 A THR 1635 ? ? 1.31 
3 1 OE1 A GLN 1593 ? ? O   A HOH 2168 ? ? 1.94 
4 1 O   A HOH 2015 ? ? O   A HOH 2157 ? ? 2.13 
5 1 NH1 A ARG 1785 ? B O   A HOH 2340 ? ? 2.16 
6 1 OD1 A ASP 1747 ? A O   A HOH 2304 ? ? 2.17 
7 1 O   A LYS 1460 ? ? O   A HOH 2057 ? ? 2.17 
8 1 O   A HOH 2021 ? ? O   A HOH 2022 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 HD1 A HIS 1741 ? ? 1_555 ZN A ZN  2825 ? ? 3_554 1.31 
2 1 OE1 A GLN 1798 ? ? 1_555 O  A HOH 2100 ? ? 6_444 2.02 
3 1 O   A HOH 2290 ? ? 1_555 O  A HOH 2298 ? ? 3_554 2.13 
4 1 O   A HOH 2059 ? ? 1_555 O  A HOH 2373 ? ? 3_554 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 1483 ? ? 175.81  154.13  
2  1 ASN A 1505 ? ? -87.09  48.02   
3  1 ASN A 1560 ? ? -111.61 -134.60 
4  1 GLU A 1561 ? ? -38.58  -86.22  
5  1 THR A 1562 ? ? 72.69   157.34  
6  1 SER A 1564 ? ? -35.67  -38.79  
7  1 GLN A 1593 ? ? 51.96   -125.31 
8  1 HIS A 1614 ? ? 21.14   75.82   
9  1 HIS A 1733 ? ? -147.41 -68.27  
10 1 ASP A 1796 ? ? 38.56   59.87   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2056 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.86 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 1460 ? CG  ? A LYS 7   CG  
2  1 Y 1 A LYS 1460 ? CD  ? A LYS 7   CD  
3  1 Y 1 A LYS 1460 ? CE  ? A LYS 7   CE  
4  1 Y 1 A LYS 1460 ? NZ  ? A LYS 7   NZ  
5  1 Y 1 A THR 1562 ? OG1 ? A THR 109 OG1 
6  1 Y 1 A THR 1562 ? CG2 ? A THR 109 CG2 
7  1 Y 1 A PHE 1563 ? CG  ? A PHE 110 CG  
8  1 Y 1 A PHE 1563 ? CD1 ? A PHE 110 CD1 
9  1 Y 1 A PHE 1563 ? CD2 ? A PHE 110 CD2 
10 1 Y 1 A PHE 1563 ? CE1 ? A PHE 110 CE1 
11 1 Y 1 A PHE 1563 ? CE2 ? A PHE 110 CE2 
12 1 Y 1 A PHE 1563 ? CZ  ? A PHE 110 CZ  
13 1 Y 1 A SER 1564 ? OG  ? A SER 111 OG  
14 1 Y 1 A ARG 1667 ? CG  ? A ARG 214 CG  
15 1 Y 1 A ARG 1667 ? CD  ? A ARG 214 CD  
16 1 Y 1 A ARG 1667 ? NE  ? A ARG 214 NE  
17 1 Y 1 A ARG 1667 ? CZ  ? A ARG 214 CZ  
18 1 Y 1 A ARG 1667 ? NH1 ? A ARG 214 NH1 
19 1 Y 1 A ARG 1667 ? NH2 ? A ARG 214 NH2 
20 1 Y 1 A GLU 1755 ? CG  ? A GLU 302 CG  
21 1 Y 1 A GLU 1755 ? CD  ? A GLU 302 CD  
22 1 Y 1 A GLU 1755 ? OE1 ? A GLU 302 OE1 
23 1 Y 1 A GLU 1755 ? OE2 ? A GLU 302 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 1454 ? A GLY 1   
2  1 Y 1 A PRO 1455 ? A PRO 2   
3  1 Y 1 A MET 1456 ? A MET 3   
4  1 Y 1 A THR 1457 ? A THR 4   
5  1 Y 1 A SER 1458 ? A SER 5   
6  1 Y 1 A GLN 1459 ? A GLN 6   
7  1 Y 1 A PRO 1822 ? A PRO 369 
8  1 Y 1 A SER 1823 ? A SER 370 
9  1 Y 1 A ALA 1824 ? A ALA 371 
10 1 Y 1 A PRO 1825 ? A PRO 372 
11 1 Y 1 A ALA 1826 ? A ALA 373 
12 1 Y 1 A THR 1827 ? A THR 374 
13 1 Y 1 A SER 1828 ? A SER 375 
14 1 Y 1 A GLU 1829 ? A GLU 376 
15 1 Y 1 A MET 1830 ? A MET 377 
16 1 Y 1 A THR 1831 ? A THR 378 
17 1 Y 1 A THR 1832 ? A THR 379 
18 1 Y 1 A THR 1833 ? A THR 380 
19 1 Y 1 A PRO 1834 ? A PRO 381 
20 1 Y 1 A GLU 1835 ? A GLU 382 
21 1 Y 1 A ARG 1836 ? A ARG 383 
22 1 Y 1 A PRO 1837 ? A PRO 384 
23 1 Y 1 A ARG 1838 ? A ARG 385 
24 1 Y 1 A ARG 1839 ? A ARG 386 
25 1 Y 1 A GLY 1840 ? A GLY 387 
26 1 Y 1 A ILE 1841 ? A ILE 388 
27 1 Y 1 A PRO 1842 ? A PRO 389 
28 1 Y 1 A GLY 1843 ? A GLY 390 
29 1 Y 1 A LEU 1844 ? A LEU 391 
30 1 Y 1 A PRO 1845 ? A PRO 392 
31 1 Y 1 A ASP 1846 ? A ASP 393 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'FORMIC ACID' FMT 
4 water         HOH 
#