data_4CBO
# 
_entry.id   4CBO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.383 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   4CBO         pdb_00004cbo 10.2210/pdb4cbo/pdb 
PDBE  EBI-58740    ?            ?                   
WWPDB D_1290058740 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4CBN 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF COMPLEMENT FACTOR D MUTANT R202A AFTER CONVENTIONAL REFINEMENT' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4CBO 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Forneris, F.'  1 
'Burnley, B.T.' 2 
'Gros, P.'      3 
# 
_citation.id                        primary 
_citation.title                     
'Ensemble Refinement Shows Conformational Flexibility in Crystal Structures of Human Complement Factor D' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            70 
_citation.page_first                733 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24598742 
_citation.pdbx_database_id_DOI      10.1107/S1399004713032549 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Forneris, F.'  1 ? 
primary 'Burnley, B.T.' 2 ? 
primary 'Gros, P.'      3 ? 
# 
_cell.entry_id           4CBO 
_cell.length_a           44.140 
_cell.length_b           67.310 
_cell.length_c           133.140 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4CBO 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'COMPLEMENT FACTOR D' 24352.691 2   3.4.21.46 YES 'RESIDUES 26-253' ? 
2 non-polymer syn GLYCEROL              92.094    2   ?         ?   ?                 ? 
3 water       nat water                 18.015    261 ?         ?   ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ADIPSIN, C3 CONVERTASE ACTIVATOR, PROPERDIN FACTOR D' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSAVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSAVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LEU n 
1 3   GLY n 
1 4   GLY n 
1 5   ARG n 
1 6   GLU n 
1 7   ALA n 
1 8   GLU n 
1 9   ALA n 
1 10  HIS n 
1 11  ALA n 
1 12  ARG n 
1 13  PRO n 
1 14  TYR n 
1 15  MET n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  GLN n 
1 20  LEU n 
1 21  ASN n 
1 22  GLY n 
1 23  ALA n 
1 24  HIS n 
1 25  LEU n 
1 26  CYS n 
1 27  GLY n 
1 28  GLY n 
1 29  VAL n 
1 30  LEU n 
1 31  VAL n 
1 32  ALA n 
1 33  GLU n 
1 34  GLN n 
1 35  TRP n 
1 36  VAL n 
1 37  LEU n 
1 38  SER n 
1 39  ALA n 
1 40  ALA n 
1 41  HIS n 
1 42  CYS n 
1 43  LEU n 
1 44  GLU n 
1 45  ASP n 
1 46  ALA n 
1 47  ALA n 
1 48  ASP n 
1 49  GLY n 
1 50  LYS n 
1 51  VAL n 
1 52  GLN n 
1 53  VAL n 
1 54  LEU n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  HIS n 
1 59  SER n 
1 60  LEU n 
1 61  SER n 
1 62  GLN n 
1 63  PRO n 
1 64  GLU n 
1 65  PRO n 
1 66  SER n 
1 67  LYS n 
1 68  ARG n 
1 69  LEU n 
1 70  TYR n 
1 71  ASP n 
1 72  VAL n 
1 73  LEU n 
1 74  ARG n 
1 75  ALA n 
1 76  VAL n 
1 77  PRO n 
1 78  HIS n 
1 79  PRO n 
1 80  ASP n 
1 81  SER n 
1 82  GLN n 
1 83  PRO n 
1 84  ASP n 
1 85  THR n 
1 86  ILE n 
1 87  ASP n 
1 88  HIS n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  LEU n 
1 94  GLN n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ALA n 
1 100 THR n 
1 101 LEU n 
1 102 GLY n 
1 103 PRO n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 PRO n 
1 108 LEU n 
1 109 PRO n 
1 110 TRP n 
1 111 GLN n 
1 112 ARG n 
1 113 VAL n 
1 114 ASP n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 ALA n 
1 119 PRO n 
1 120 GLY n 
1 121 THR n 
1 122 LEU n 
1 123 CYS n 
1 124 ASP n 
1 125 VAL n 
1 126 ALA n 
1 127 GLY n 
1 128 TRP n 
1 129 GLY n 
1 130 ILE n 
1 131 VAL n 
1 132 ASN n 
1 133 HIS n 
1 134 ALA n 
1 135 GLY n 
1 136 ARG n 
1 137 ARG n 
1 138 PRO n 
1 139 ASP n 
1 140 SER n 
1 141 LEU n 
1 142 GLN n 
1 143 HIS n 
1 144 VAL n 
1 145 LEU n 
1 146 LEU n 
1 147 PRO n 
1 148 VAL n 
1 149 LEU n 
1 150 ASP n 
1 151 ARG n 
1 152 ALA n 
1 153 THR n 
1 154 CYS n 
1 155 ASN n 
1 156 ARG n 
1 157 ARG n 
1 158 THR n 
1 159 HIS n 
1 160 HIS n 
1 161 ASP n 
1 162 GLY n 
1 163 ALA n 
1 164 ILE n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 LEU n 
1 169 MET n 
1 170 CYS n 
1 171 ALA n 
1 172 GLU n 
1 173 SER n 
1 174 ASN n 
1 175 ARG n 
1 176 ARG n 
1 177 ASP n 
1 178 SER n 
1 179 CYS n 
1 180 LYS n 
1 181 GLY n 
1 182 ASP n 
1 183 SER n 
1 184 GLY n 
1 185 GLY n 
1 186 PRO n 
1 187 LEU n 
1 188 VAL n 
1 189 CYS n 
1 190 GLY n 
1 191 GLY n 
1 192 VAL n 
1 193 LEU n 
1 194 GLU n 
1 195 GLY n 
1 196 VAL n 
1 197 VAL n 
1 198 THR n 
1 199 SER n 
1 200 GLY n 
1 201 SER n 
1 202 ALA n 
1 203 VAL n 
1 204 CYS n 
1 205 GLY n 
1 206 ASN n 
1 207 ARG n 
1 208 LYS n 
1 209 LYS n 
1 210 PRO n 
1 211 GLY n 
1 212 ILE n 
1 213 TYR n 
1 214 THR n 
1 215 ARG n 
1 216 VAL n 
1 217 ALA n 
1 218 SER n 
1 219 TYR n 
1 220 ALA n 
1 221 ALA n 
1 222 TRP n 
1 223 ILE n 
1 224 ASP n 
1 225 SER n 
1 226 VAL n 
1 227 LEU n 
1 228 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               HUMAN 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CFAD_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P00746 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4CBO A 1 ? 228 ? P00746 26 ? 253 ? 1 228 
2 1 4CBO B 1 ? 228 ? P00746 26 ? 253 ? 1 228 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4CBO ALA A 202 ? UNP P00746 ARG 227 'engineered mutation' 202 1 
2 4CBO ALA B 202 ? UNP P00746 ARG 227 'engineered mutation' 202 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4CBO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.66 
_exptl_crystal.density_percent_sol   66 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '15% PEG 6000, 50 MM MES/NAOH PH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4CBO 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.33 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   37211 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.84 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.51 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        3.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4CBO 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     37154 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.332 
_refine.ls_d_res_high                            1.800 
_refine.ls_percent_reflns_obs                    98.69 
_refine.ls_R_factor_obs                          0.1660 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1634 
_refine.ls_R_factor_R_free                       0.2116 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1857 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.70 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'NUMBER OF STRUCTURES IN THE ENSEMBLE IS 77' 
_refine.pdbx_starting_model                      'PDB ENTRY 1DSU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.13 
_refine.pdbx_overall_phase_error                 19.77 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3412 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             261 
_refine_hist.number_atoms_total               3685 
_refine_hist.d_res_high                       1.800 
_refine_hist.d_res_low                        47.332 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          1.789 ? ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.63 ? ? . 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.094 ? ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.8000 1.8487  2683 0.2361 99.00  0.2670 . . 148 . . 
'X-RAY DIFFRACTION' . 1.8487 1.9031  2658 0.2228 99.00  0.2714 . . 144 . . 
'X-RAY DIFFRACTION' . 1.9031 1.9645  2694 0.2049 100.00 0.2655 . . 150 . . 
'X-RAY DIFFRACTION' . 1.9645 2.0347  2689 0.1772 99.00  0.2534 . . 137 . . 
'X-RAY DIFFRACTION' . 2.0347 2.1162  2723 0.1629 99.00  0.2294 . . 120 . . 
'X-RAY DIFFRACTION' . 2.1162 2.2125  2654 0.1573 98.00  0.2284 . . 158 . . 
'X-RAY DIFFRACTION' . 2.2125 2.3291  2731 0.1590 100.00 0.2060 . . 133 . . 
'X-RAY DIFFRACTION' . 2.3291 2.4751  2669 0.1559 98.00  0.2236 . . 154 . . 
'X-RAY DIFFRACTION' . 2.4751 2.6662  2723 0.1505 99.00  0.2053 . . 134 . . 
'X-RAY DIFFRACTION' . 2.6662 2.9344  2712 0.1439 98.00  0.2156 . . 157 . . 
'X-RAY DIFFRACTION' . 2.9344 3.3589  2751 0.1422 99.00  0.2095 . . 137 . . 
'X-RAY DIFFRACTION' . 3.3589 4.2315  2709 0.1505 96.00  0.1795 . . 130 . . 
'X-RAY DIFFRACTION' . 4.2315 47.3479 2901 0.1780 98.00  0.1912 . . 155 . . 
# 
_struct.entry_id                  4CBO 
_struct.title                     'Crystal structure of Complement Factor D mutant R202A after ensemble refinement' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4CBO 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, FACTOR D, ENSEMBLE REFINEMENT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 150 ? ASN A 155 ? ASP A 150 ASN A 155 1 ? 6  
HELX_P HELX_P2 2 TYR A 219 ? ALA A 228 ? TYR A 219 ALA A 228 1 ? 10 
HELX_P HELX_P3 3 ASP B 150 ? ASN B 155 ? ASP B 150 ASN B 155 1 ? 6  
HELX_P HELX_P4 4 TYR B 219 ? SER B 225 ? TYR B 219 SER B 225 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 26  SG ? ? ? 1_555 A CYS 42  SG ? ? A CYS 26  A CYS 42  1_555 ? ? ? ? ? ? ? 2.073 ? ? 
disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 123 A CYS 189 1_555 ? ? ? ? ? ? ? 2.057 ? ? 
disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 170 SG ? ? A CYS 154 A CYS 170 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf4 disulf ? ? A CYS 179 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 179 A CYS 204 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf5 disulf ? ? B CYS 26  SG ? ? ? 1_555 B CYS 42  SG ? ? B CYS 26  B CYS 42  1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf6 disulf ? ? B CYS 123 SG ? ? ? 1_555 B CYS 189 SG ? ? B CYS 123 B CYS 189 1_555 ? ? ? ? ? ? ? 2.067 ? ? 
disulf7 disulf ? ? B CYS 154 SG ? ? ? 1_555 B CYS 170 SG ? ? B CYS 154 B CYS 170 1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf8 disulf ? ? B CYS 179 SG ? ? ? 1_555 B CYS 204 SG ? ? B CYS 179 B CYS 204 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 1  -19.63 
2   GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 1  4.16   
3   ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 1  2.78   
4   GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 1  -7.86  
5   CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 1  0.06   
6   ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 2  -6.97  
7   GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 2  -13.99 
8   ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 2  -1.82  
9   GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 2  -14.95 
10  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 2  -4.94  
11  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 3  3.27   
12  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 3  22.32  
13  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 3  0.16   
14  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 3  20.82  
15  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 3  1.90   
16  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 4  1.40   
17  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 4  12.60  
18  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 4  10.15  
19  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 4  13.60  
20  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 5  -10.90 
21  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 5  -16.62 
22  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 5  -6.24  
23  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 5  -2.58  
24  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 5  1.17   
25  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 6  -10.24 
26  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 6  -8.93  
27  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 6  -11.05 
28  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 6  -22.16 
29  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 6  6.04   
30  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 7  2.32   
31  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 7  4.01   
32  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 7  12.55  
33  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 7  -9.07  
34  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 8  8.48   
35  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 8  24.96  
36  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 8  -7.96  
37  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 8  16.75  
38  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 8  -4.06  
39  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 9  -4.26  
40  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 9  9.07   
41  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 9  24.08  
42  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 9  -4.07  
43  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 9  -7.13  
44  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 10 1.63   
45  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 10 19.12  
46  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 10 -6.85  
47  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 10 -4.20  
48  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 10 14.39  
49  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 11 1.38   
50  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 11 11.21  
51  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 11 -10.29 
52  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 11 -21.97 
53  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 12 -10.94 
54  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 12 -8.59  
55  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 12 17.31  
56  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 12 24.66  
57  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 12 -19.19 
58  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 13 6.27   
59  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 13 3.93   
60  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 13 -7.75  
61  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 14 25.19  
62  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 14 -10.06 
63  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 14 11.33  
64  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 14 -19.59 
65  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 15 22.91  
66  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 15 5.26   
67  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 15 -15.16 
68  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 15 4.15   
69  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 15 15.55  
70  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 16 -3.28  
71  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 16 24.09  
72  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 16 7.05   
73  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 16 -26.14 
74  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 16 9.86   
75  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 17 -15.31 
76  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 17 -7.21  
77  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 17 21.59  
78  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 17 7.71   
79  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 18 -13.18 
80  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 18 2.27   
81  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 18 18.06  
82  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 18 -6.79  
83  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 18 -14.35 
84  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 19 -0.90  
85  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 19 -28.38 
86  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 19 6.88   
87  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 19 -0.51  
88  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 19 -23.43 
89  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 20 26.68  
90  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 20 -2.52  
91  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 20 -14.30 
92  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 20 11.26  
93  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 20 -11.62 
94  ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 21 20.20  
95  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 21 -12.94 
96  ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 21 -9.63  
97  GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 21 -20.49 
98  CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 21 17.68  
99  GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 22 8.31   
100 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 22 -12.06 
101 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 22 -0.79  
102 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 22 -6.80  
103 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 23 2.02   
104 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 23 5.43   
105 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 23 3.13   
106 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 23 -5.76  
107 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 23 18.44  
108 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 24 -4.59  
109 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 24 11.29  
110 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 24 -0.19  
111 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 24 -1.67  
112 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 24 1.73   
113 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 25 -12.63 
114 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 25 -11.81 
115 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 25 11.62  
116 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 25 14.30  
117 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 25 11.08  
118 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 26 11.98  
119 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 26 -13.14 
120 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 26 12.27  
121 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 26 15.87  
122 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 27 -21.29 
123 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 27 -0.80  
124 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 27 0.23   
125 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 27 -1.19  
126 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 27 -10.88 
127 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 28 23.59  
128 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 28 -10.25 
129 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 28 -8.51  
130 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 28 -0.23  
131 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 29 10.78  
132 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 29 -25.57 
133 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 29 15.70  
134 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 29 12.73  
135 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 29 -4.78  
136 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 30 12.49  
137 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 30 0.06   
138 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 30 12.40  
139 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 30 -4.07  
140 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 30 8.00   
141 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 31 14.49  
142 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 31 7.38   
143 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 31 -20.09 
144 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 31 -21.39 
145 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 31 3.30   
146 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 32 -22.80 
147 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 32 4.39   
148 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 32 -2.16  
149 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 32 -5.95  
150 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 33 18.86  
151 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 33 13.67  
152 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 33 25.57  
153 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 33 -7.66  
154 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 33 -22.75 
155 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 34 13.56  
156 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 34 23.02  
157 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 34 4.40   
158 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 34 -13.20 
159 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 34 -15.62 
160 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 35 -20.98 
161 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 35 20.22  
162 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 35 23.53  
163 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 35 -8.92  
164 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 36 27.97  
165 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 36 11.95  
166 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 36 13.00  
167 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 36 -14.88 
168 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 36 14.58  
169 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 37 -28.66 
170 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 37 -10.22 
171 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 37 18.01  
172 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 37 10.56  
173 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 38 23.30  
174 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 38 15.78  
175 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 38 3.08   
176 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 38 7.79   
177 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 39 23.90  
178 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 39 13.84  
179 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 39 -9.72  
180 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 39 13.14  
181 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 39 2.24   
182 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 40 -24.20 
183 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 40 -12.00 
184 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 40 25.14  
185 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 40 -18.61 
186 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 40 -7.29  
187 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 41 -18.58 
188 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 41 -14.87 
189 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 41 -6.78  
190 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 41 25.53  
191 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 41 2.67   
192 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 42 -21.79 
193 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 42 -6.88  
194 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 42 12.50  
195 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 42 -9.15  
196 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 42 -4.39  
197 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 43 19.56  
198 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 43 25.43  
199 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 43 1.35   
200 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 43 -19.97 
201 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 43 -5.74  
202 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 44 -26.39 
203 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 44 21.63  
204 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 44 -7.47  
205 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 44 -1.81  
206 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 45 -19.00 
207 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 45 -6.43  
208 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 45 0.71   
209 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 45 2.99   
210 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 45 -6.84  
211 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 46 6.76   
212 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 46 7.92   
213 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 46 15.23  
214 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 46 24.93  
215 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 46 10.26  
216 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 47 15.98  
217 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 47 6.22   
218 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 47 -3.29  
219 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 47 12.63  
220 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 47 -17.15 
221 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 48 17.18  
222 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 48 4.42   
223 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 48 -13.27 
224 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 48 -0.41  
225 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 49 11.45  
226 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 49 -9.44  
227 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 49 -13.39 
228 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 49 6.21   
229 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 49 -8.32  
230 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 50 -21.70 
231 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 50 0.82   
232 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 50 8.74   
233 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 50 20.89  
234 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 50 10.29  
235 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 51 26.65  
236 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 51 -0.40  
237 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 51 4.79   
238 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 51 6.04   
239 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 51 -6.70  
240 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 52 -11.96 
241 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 52 -7.67  
242 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 52 6.68   
243 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 52 -0.22  
244 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 52 -14.06 
245 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 53 -6.51  
246 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 53 1.59   
247 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 53 10.15  
248 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 53 -11.41 
249 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 53 -15.80 
250 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 54 7.10   
251 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 54 -27.15 
252 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 54 4.19   
253 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 54 -2.62  
254 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 55 24.83  
255 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 55 -8.82  
256 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 55 -5.50  
257 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 55 -2.00  
258 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 55 2.33   
259 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 56 -20.39 
260 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 56 -6.93  
261 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 56 4.95   
262 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 56 5.55   
263 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 56 4.68   
264 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 57 12.45  
265 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 57 21.56  
266 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 57 3.23   
267 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 57 -14.03 
268 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 57 -4.23  
269 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 58 -10.19 
270 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 58 -9.44  
271 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 58 -13.40 
272 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 58 0.08   
273 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 59 7.58   
274 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 59 18.34  
275 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 59 20.04  
276 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 59 -14.90 
277 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 59 -6.54  
278 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 60 -13.76 
279 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 60 -14.48 
280 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 60 5.18   
281 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 60 10.29  
282 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 60 27.73  
283 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 61 -3.72  
284 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 61 10.89  
285 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 61 13.67  
286 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 61 -0.77  
287 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 61 -15.14 
288 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 62 18.11  
289 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 62 25.35  
290 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 62 14.82  
291 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 62 9.96   
292 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 62 -18.00 
293 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 63 25.32  
294 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 63 -15.46 
295 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 63 -11.07 
296 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 63 9.60   
297 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 64 -20.05 
298 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 64 2.07   
299 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 64 5.80   
300 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 64 -15.32 
301 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 64 -2.65  
302 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 65 -13.90 
303 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 65 -16.55 
304 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 65 19.10  
305 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 65 -7.48  
306 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 65 -22.65 
307 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 66 12.55  
308 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 66 -29.68 
309 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 66 13.41  
310 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 66 18.73  
311 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 67 9.11   
312 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 67 -4.10  
313 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 67 11.82  
314 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 67 -13.79 
315 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 67 -5.69  
316 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 68 -13.73 
317 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 68 -3.79  
318 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 68 5.86   
319 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 68 -14.94 
320 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 68 -24.36 
321 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 69 -10.38 
322 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 69 -3.07  
323 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 69 5.18   
324 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 69 -2.34  
325 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 70 -19.58 
326 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 70 7.80   
327 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 70 -28.02 
328 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 71 -24.69 
329 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 71 3.98   
330 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 71 -7.12  
331 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 71 -5.22  
332 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 71 2.26   
333 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 72 -27.16 
334 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 72 13.13  
335 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 72 17.10  
336 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 72 2.69   
337 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 72 -29.19 
338 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 73 -0.38  
339 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 73 -19.17 
340 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 73 15.37  
341 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 73 -6.18  
342 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 73 -15.03 
343 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 74 -4.98  
344 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 74 -9.38  
345 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 74 24.73  
346 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 74 -3.30  
347 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 74 -9.97  
348 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 75 -3.49  
349 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 75 -23.90 
350 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 75 7.40   
351 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 75 1.84   
352 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 75 7.43   
353 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 76 0.14   
354 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 76 9.70   
355 ALA 47  B . ? ALA 47  B ASP 48  B ? ASP 48  B 76 15.37  
356 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 76 7.03   
357 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 76 0.38   
358 ASP 48  A . ? ASP 48  A GLY 49  A ? GLY 49  A 77 -9.76  
359 GLY 200 A . ? GLY 200 A SER 201 A ? SER 201 A 77 13.39  
360 GLY 200 B . ? GLY 200 B SER 201 B ? SER 201 B 77 6.46   
361 CYS 204 B . ? CYS 204 B GLY 205 B ? GLY 205 B 77 -23.98 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 7 ? 
C ? 8 ? 
D ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 5   ? GLU A 6   ? ARG A 5   GLU A 6   
A 2 GLN A 142 ? LEU A 149 ? GLN A 142 LEU A 149 
A 3 LEU A 168 ? GLU A 172 ? LEU A 168 GLU A 172 
A 4 PRO A 210 ? ARG A 215 ? PRO A 210 ARG A 215 
A 5 VAL A 192 ? VAL A 197 ? VAL A 192 VAL A 197 
A 6 PRO A 186 ? CYS A 189 ? PRO A 186 CYS A 189 
A 7 LEU A 122 ? GLY A 127 ? LEU A 122 GLY A 127 
A 8 GLN A 142 ? LEU A 149 ? GLN A 142 LEU A 149 
B 1 MET A 15  ? LEU A 20  ? MET A 15  LEU A 20  
B 2 ALA A 23  ? ALA A 32  ? ALA A 23  ALA A 32  
B 3 TRP A 35  ? SER A 38  ? TRP A 35  SER A 38  
B 4 LEU A 91  ? LEU A 95  ? LEU A 91  LEU A 95  
B 5 ARG A 68  ? PRO A 77  ? ARG A 68  PRO A 77  
B 6 VAL A 51  ? LEU A 55  ? VAL A 51  LEU A 55  
B 7 MET A 15  ? LEU A 20  ? MET A 15  LEU A 20  
C 1 ARG B 5   ? GLU B 6   ? ARG B 5   GLU B 6   
C 2 GLN B 142 ? LEU B 149 ? GLN B 142 LEU B 149 
C 3 LEU B 168 ? ALA B 171 ? LEU B 168 ALA B 171 
C 4 GLY B 211 ? ARG B 215 ? GLY B 211 ARG B 215 
C 5 VAL B 192 ? VAL B 197 ? VAL B 192 VAL B 197 
C 6 PRO B 186 ? CYS B 189 ? PRO B 186 CYS B 189 
C 7 LEU B 122 ? GLY B 127 ? LEU B 122 GLY B 127 
C 8 GLN B 142 ? LEU B 149 ? GLN B 142 LEU B 149 
D 1 MET B 15  ? LEU B 20  ? MET B 15  LEU B 20  
D 2 ALA B 23  ? ALA B 32  ? ALA B 23  ALA B 32  
D 3 TRP B 35  ? SER B 38  ? TRP B 35  SER B 38  
D 4 LEU B 91  ? LEU B 95  ? LEU B 91  LEU B 95  
D 5 ARG B 68  ? PRO B 77  ? ARG B 68  PRO B 77  
D 6 VAL B 51  ? LEU B 55  ? VAL B 51  LEU B 55  
D 7 MET B 15  ? LEU B 20  ? MET B 15  LEU B 20  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 5   ? N ARG A 5   O HIS A 143 ? O HIS A 143 
A 2 3 N LEU A 149 ? N LEU A 149 O CYS A 170 ? O CYS A 170 
A 3 4 N MET A 169 ? N MET A 169 O TYR A 213 ? O TYR A 213 
A 4 5 O THR A 214 ? O THR A 214 N VAL A 196 ? N VAL A 196 
A 5 6 O VAL A 192 ? O VAL A 192 N CYS A 189 ? N CYS A 189 
A 6 7 O VAL A 188 ? O VAL A 188 N ASP A 124 ? N ASP A 124 
A 7 8 N CYS A 123 ? N CYS A 123 O LEU A 146 ? O LEU A 146 
B 1 2 N VAL A 18  ? N VAL A 18  O LEU A 25  ? O LEU A 25  
B 2 3 N VAL A 29  ? N VAL A 29  O LEU A 37  ? O LEU A 37  
B 3 4 N SER A 38  ? N SER A 38  O LEU A 91  ? O LEU A 91  
B 4 5 O LEU A 92  ? O LEU A 92  N VAL A 76  ? N VAL A 76  
B 5 6 O TYR A 70  ? O TYR A 70  N VAL A 53  ? N VAL A 53  
B 6 7 O GLN A 52  ? O GLN A 52  N GLN A 19  ? N GLN A 19  
C 1 2 N ARG B 5   ? N ARG B 5   O HIS B 143 ? O HIS B 143 
C 2 3 N LEU B 149 ? N LEU B 149 O CYS B 170 ? O CYS B 170 
C 3 4 N MET B 169 ? N MET B 169 O TYR B 213 ? O TYR B 213 
C 4 5 O THR B 214 ? O THR B 214 N VAL B 196 ? N VAL B 196 
C 5 6 O GLY B 195 ? O GLY B 195 N LEU B 187 ? N LEU B 187 
C 6 7 O VAL B 188 ? O VAL B 188 N ASP B 124 ? N ASP B 124 
C 7 8 N CYS B 123 ? N CYS B 123 O LEU B 146 ? O LEU B 146 
D 1 2 N VAL B 18  ? N VAL B 18  O LEU B 25  ? O LEU B 25  
D 2 3 N VAL B 29  ? N VAL B 29  O LEU B 37  ? O LEU B 37  
D 3 4 N SER B 38  ? N SER B 38  O LEU B 91  ? O LEU B 91  
D 4 5 O GLN B 94  ? O GLN B 94  N LEU B 73  ? N LEU B 73  
D 5 6 O TYR B 70  ? O TYR B 70  N VAL B 53  ? N VAL B 53  
D 6 7 O GLN B 52  ? O GLN B 52  N GLN B 19  ? N GLN B 19  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 1000 ? 9  'BINDING SITE FOR RESIDUE GOL A 1000' 
AC2 Software B GOL 1000 ? 10 'BINDING SITE FOR RESIDUE GOL B 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  VAL A 117 ? VAL A 117  . ? 1_555 ? 
2  AC1 9  PRO A 119 ? PRO A 119  . ? 1_555 ? 
3  AC1 9  VAL A 148 ? VAL A 148  . ? 1_555 ? 
4  AC1 9  LEU A 149 ? LEU A 149  . ? 1_555 ? 
5  AC1 9  ASP A 150 ? ASP A 150  . ? 1_555 ? 
6  AC1 9  ARG A 151 ? ARG A 151  . ? 1_555 ? 
7  AC1 9  MET A 169 ? MET A 169  . ? 1_555 ? 
8  AC1 9  CYS A 170 ? CYS A 170  . ? 1_555 ? 
9  AC1 9  HOH E .   ? HOH A 1179 . ? 1_555 ? 
10 AC2 10 VAL B 117 ? VAL B 117  . ? 1_555 ? 
11 AC2 10 PRO B 119 ? PRO B 119  . ? 1_555 ? 
12 AC2 10 VAL B 148 ? VAL B 148  . ? 1_555 ? 
13 AC2 10 LEU B 149 ? LEU B 149  . ? 1_555 ? 
14 AC2 10 ASP B 150 ? ASP B 150  . ? 1_555 ? 
15 AC2 10 ARG B 151 ? ARG B 151  . ? 1_555 ? 
16 AC2 10 MET B 169 ? MET B 169  . ? 1_555 ? 
17 AC2 10 CYS B 170 ? CYS B 170  . ? 1_555 ? 
18 AC2 10 HOH F .   ? HOH B 1101 . ? 1_555 ? 
19 AC2 10 HOH F .   ? HOH B 1103 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4CBO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4CBO 
_atom_sites.fract_transf_matrix[1][1]   0.022655 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014857 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007511 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . ILE A 1 1   ? -10.808 28.544 -6.526  0.010 33.85  ? 1    ILE A N    1  
ATOM   2      C CA   . ILE A 1 1   ? -9.786  29.394 -7.223  0.010 34.08  ? 1    ILE A CA   1  
ATOM   3      C C    . ILE A 1 1   ? -8.864  30.100 -6.249  0.010 36.48  ? 1    ILE A C    1  
ATOM   4      O O    . ILE A 1 1   ? -9.293  30.573 -5.203  0.010 38.55  ? 1    ILE A O    1  
ATOM   5      C CB   . ILE A 1 1   ? -10.432 30.609 -7.994  0.010 34.47  ? 1    ILE A CB   1  
ATOM   6      C CG1  . ILE A 1 1   ? -9.384  31.300 -8.906  0.010 34.38  ? 1    ILE A CG1  1  
ATOM   7      C CG2  . ILE A 1 1   ? -11.098 31.665 -7.021  0.010 37.01  ? 1    ILE A CG2  1  
ATOM   8      C CD1  . ILE A 1 1   ? -9.369  32.866 -8.832  0.010 36.90  ? 1    ILE A CD1  1  
ATOM   9      H H1   . ILE A 1 1   ? -10.459 28.178 -5.793  0.010 34.86  ? 1    ILE A H1   1  
ATOM   10     H H2   . ILE A 1 1   ? -11.504 29.041 -6.297  0.010 34.27  ? 1    ILE A H2   1  
ATOM   11     H H3   . ILE A 1 1   ? -11.076 27.897 -7.078  0.010 32.34  ? 1    ILE A H3   1  
ATOM   12     H HA   . ILE A 1 1   ? -9.281  28.855 -7.821  0.010 32.71  ? 1    ILE A HA   1  
ATOM   13     H HB   . ILE A 1 1   ? -11.129 30.250 -8.564  0.010 33.20  ? 1    ILE A HB   1  
ATOM   14     H HG12 . ILE A 1 1   ? -8.499  30.983 -8.683  0.010 34.16  ? 1    ILE A HG12 1  
ATOM   15     H HG13 . ILE A 1 1   ? -9.581  31.061 -9.827  0.010 33.07  ? 1    ILE A HG13 1  
ATOM   16     H HG21 . ILE A 1 1   ? -11.592 31.211 -6.323  0.010 37.23  ? 1    ILE A HG21 1  
ATOM   17     H HG22 . ILE A 1 1   ? -10.416 32.213 -6.605  0.010 38.48  ? 1    ILE A HG22 1  
ATOM   18     H HG23 . ILE A 1 1   ? -11.694 32.232 -7.532  0.010 37.06  ? 1    ILE A HG23 1  
ATOM   19     H HD11 . ILE A 1 1   ? -10.272 33.205 -8.905  0.010 37.44  ? 1    ILE A HD11 1  
ATOM   20     H HD12 . ILE A 1 1   ? -8.977  33.142 -7.991  0.010 38.26  ? 1    ILE A HD12 1  
ATOM   21     H HD13 . ILE A 1 1   ? -8.838  33.207 -9.568  0.010 36.64  ? 1    ILE A HD13 1  
ATOM   22     N N    . LEU A 1 2   ? -7.584  30.093 -6.578  0.010 36.25  ? 2    LEU A N    1  
ATOM   23     C CA   . LEU A 1 2   ? -6.799  31.293 -6.443  0.010 38.29  ? 2    LEU A CA   1  
ATOM   24     C C    . LEU A 1 2   ? -5.875  31.421 -7.652  0.010 36.88  ? 2    LEU A C    1  
ATOM   25     O O    . LEU A 1 2   ? -5.077  32.373 -7.745  0.010 38.26  ? 2    LEU A O    1  
ATOM   26     C CB   . LEU A 1 2   ? -6.034  31.341 -5.100  0.010 40.44  ? 2    LEU A CB   1  
ATOM   27     C CG   . LEU A 1 2   ? -5.940  32.681 -4.373  0.010 43.60  ? 2    LEU A CG   1  
ATOM   28     C CD1  . LEU A 1 2   ? -5.612  32.551 -2.849  0.010 46.04  ? 2    LEU A CD1  1  
ATOM   29     C CD2  . LEU A 1 2   ? -4.961  33.697 -4.963  0.010 44.68  ? 2    LEU A CD2  1  
ATOM   30     H H    . LEU A 1 2   ? -7.151  29.406 -6.861  0.010 35.02  ? 2    LEU A H    1  
ATOM   31     H HA   . LEU A 1 2   ? -7.414  32.035 -6.380  0.010 39.31  ? 2    LEU A HA   1  
ATOM   32     H HB2  . LEU A 1 2   ? -6.545  30.638 -4.591  0.010 40.24  ? 2    LEU A HB2  1  
ATOM   33     H HB3  . LEU A 1 2   ? -5.149  31.012 -5.161  0.010 40.18  ? 2    LEU A HB3  1  
ATOM   34     H HG   . LEU A 1 2   ? -6.776  33.163 -4.369  0.010 43.63  ? 2    LEU A HG   1  
ATOM   35     H HD11 . LEU A 1 2   ? -4.910  31.894 -2.749  0.010 45.64  ? 2    LEU A HD11 1  
ATOM   36     H HD12 . LEU A 1 2   ? -5.301  33.401 -2.498  0.010 48.14  ? 2    LEU A HD12 1  
ATOM   37     H HD13 . LEU A 1 2   ? -6.402  32.265 -2.365  0.010 45.96  ? 2    LEU A HD13 1  
ATOM   38     H HD21 . LEU A 1 2   ? -4.129  33.236 -5.153  0.010 44.60  ? 2    LEU A HD21 1  
ATOM   39     H HD22 . LEU A 1 2   ? -5.331  34.067 -5.780  0.010 43.42  ? 2    LEU A HD22 1  
ATOM   40     H HD23 . LEU A 1 2   ? -4.786  34.413 -4.329  0.010 46.82  ? 2    LEU A HD23 1  
ATOM   41     N N    . GLY A 1 3   ? -6.002  30.476 -8.584  0.010 34.31  ? 3    GLY A N    1  
ATOM   42     C CA   . GLY A 1 3   ? -5.544  30.627 -9.941  0.010 32.92  ? 3    GLY A CA   1  
ATOM   43     C C    . GLY A 1 3   ? -6.716  30.859 -10.880 0.010 32.08  ? 3    GLY A C    1  
ATOM   44     O O    . GLY A 1 3   ? -7.638  30.036 -10.954 0.010 30.81  ? 3    GLY A O    1  
ATOM   45     H H    . GLY A 1 3   ? -6.344  29.702 -8.449  0.010 33.42  ? 3    GLY A H    1  
ATOM   46     H HA2  . GLY A 1 3   ? -4.964  31.399 -10.006 0.010 33.99  ? 3    GLY A HA2  1  
ATOM   47     H HA3  . GLY A 1 3   ? -5.055  29.836 -10.224 0.010 31.60  ? 3    GLY A HA3  1  
ATOM   48     N N    . GLY A 1 4   ? -6.702  32.004 -11.562 0.010 33.06  ? 4    GLY A N    1  
ATOM   49     C CA   . GLY A 1 4   ? -7.367  32.082 -12.856 0.010 31.90  ? 4    GLY A CA   1  
ATOM   50     C C    . GLY A 1 4   ? -8.623  32.918 -13.074 0.010 32.92  ? 4    GLY A C    1  
ATOM   51     O O    . GLY A 1 4   ? -8.839  33.999 -12.480 0.010 35.11  ? 4    GLY A O    1  
ATOM   52     H H    . GLY A 1 4   ? -6.317  32.727 -11.305 0.010 34.49  ? 4    GLY A H    1  
ATOM   53     H HA2  . GLY A 1 4   ? -6.713  32.406 -13.494 0.010 31.73  ? 4    GLY A HA2  1  
ATOM   54     H HA3  . GLY A 1 4   ? -7.587  31.179 -13.128 0.010 30.41  ? 4    GLY A HA3  1  
ATOM   55     N N    . ARG A 1 5   ? -9.444  32.424 -13.995 0.010 31.44  ? 5    ARG A N    1  
ATOM   56     C CA   . ARG A 1 5   ? -10.607 33.191 -14.441 0.010 32.19  ? 5    ARG A CA   1  
ATOM   57     C C    . ARG A 1 5   ? -11.825 32.362 -14.883 0.010 30.65  ? 5    ARG A C    1  
ATOM   58     O O    . ARG A 1 5   ? -11.723 31.176 -15.198 0.010 28.78  ? 5    ARG A O    1  
ATOM   59     C CB   . ARG A 1 5   ? -10.184 34.111 -15.569 0.010 32.57  ? 5    ARG A CB   1  
ATOM   60     C CG   . ARG A 1 5   ? -10.893 35.354 -15.713 0.010 34.46  ? 5    ARG A CG   1  
ATOM   61     C CD   . ARG A 1 5   ? -10.123 36.477 -15.090 0.010 36.91  ? 5    ARG A CD   1  
ATOM   62     N NE   . ARG A 1 5   ? -11.144 37.241 -14.447 0.010 38.47  ? 5    ARG A NE   1  
ATOM   63     C CZ   . ARG A 1 5   ? -12.010 37.988 -15.087 0.010 39.30  ? 5    ARG A CZ   1  
ATOM   64     N NH1  . ARG A 1 5   ? -11.900 38.131 -16.382 0.010 38.80  ? 5    ARG A NH1  1  
ATOM   65     N NH2  . ARG A 1 5   ? -12.963 38.602 -14.399 0.010 40.82  ? 5    ARG A NH2  1  
ATOM   66     H H    . ARG A 1 5   ? -9.365  31.651 -14.360 0.010 30.06  ? 5    ARG A H    1  
ATOM   67     H HA   . ARG A 1 5   ? -10.904 33.747 -13.703 0.010 33.67  ? 5    ARG A HA   1  
ATOM   68     H HB2  . ARG A 1 5   ? -9.249  34.318 -15.450 0.010 33.02  ? 5    ARG A HB2  1  
ATOM   69     H HB3  . ARG A 1 5   ? -10.301 33.620 -16.395 0.010 31.26  ? 5    ARG A HB3  1  
ATOM   70     H HG2  . ARG A 1 5   ? -10.914 35.540 -16.733 0.010 34.53  ? 5    ARG A HG2  1  
ATOM   71     H HG3  . ARG A 1 5   ? -11.831 35.299 -15.308 0.010 34.27  ? 5    ARG A HG3  1  
ATOM   72     H HD2  . ARG A 1 5   ? -9.432  36.203 -14.470 0.010 36.67  ? 5    ARG A HD2  1  
ATOM   73     H HD3  . ARG A 1 5   ? -9.774  37.014 -15.819 0.010 37.87  ? 5    ARG A HD3  1  
ATOM   74     H HE   . ARG A 1 5   ? -11.050 37.395 -13.608 0.010 39.33  ? 5    ARG A HE   1  
ATOM   75     H HH11 . ARG A 1 5   ? -11.288 37.717 -16.817 0.010 37.92  ? 5    ARG A HH11 1  
ATOM   76     H HH12 . ARG A 1 5   ? -12.457 38.634 -16.800 0.010 39.44  ? 5    ARG A HH12 1  
ATOM   77     H HH21 . ARG A 1 5   ? -13.000 38.508 -13.544 0.010 41.29  ? 5    ARG A HH21 1  
ATOM   78     H HH22 . ARG A 1 5   ? -13.515 39.125 -14.792 0.010 41.42  ? 5    ARG A HH22 1  
ATOM   79     N N    . GLU A 1 6   ? -12.979 33.032 -14.926 0.010 31.58  ? 6    GLU A N    1  
ATOM   80     C CA   . GLU A 1 6   ? -14.198 32.391 -15.419 0.010 30.34  ? 6    GLU A CA   1  
ATOM   81     C C    . GLU A 1 6   ? -14.099 32.155 -16.928 0.010 29.25  ? 6    GLU A C    1  
ATOM   82     O O    . GLU A 1 6   ? -13.763 33.045 -17.698 0.010 30.23  ? 6    GLU A O    1  
ATOM   83     C CB   . GLU A 1 6   ? -15.465 33.199 -15.100 0.010 31.74  ? 6    GLU A CB   1  
ATOM   84     C CG   . GLU A 1 6   ? -16.799 32.395 -15.340 0.010 30.51  ? 6    GLU A CG   1  
ATOM   85     C CD   . GLU A 1 6   ? -18.033 33.258 -15.231 0.010 31.92  ? 6    GLU A CD   1  
ATOM   86     O OE1  . GLU A 1 6   ? -17.929 34.340 -14.631 0.010 33.90  ? 6    GLU A OE1  1  
ATOM   87     O OE2  . GLU A 1 6   ? -19.098 32.855 -15.747 0.010 31.17  ? 6    GLU A OE2  1  
ATOM   88     H H    . GLU A 1 6   ? -13.073 33.851 -14.681 0.010 32.98  ? 6    GLU A H    1  
ATOM   89     H HA   . GLU A 1 6   ? -14.280 31.529 -14.985 0.010 29.37  ? 6    GLU A HA   1  
ATOM   90     H HB2  . GLU A 1 6   ? -15.441 33.467 -14.168 0.010 32.72  ? 6    GLU A HB2  1  
ATOM   91     H HB3  . GLU A 1 6   ? -15.484 33.984 -15.669 0.010 32.61  ? 6    GLU A HB3  1  
ATOM   92     H HG2  . GLU A 1 6   ? -16.789 32.003 -16.226 0.010 29.54  ? 6    GLU A HG2  1  
ATOM   93     H HG3  . GLU A 1 6   ? -16.874 31.697 -14.670 0.010 29.90  ? 6    GLU A HG3  1  
ATOM   94     N N    . ALA A 1 7   ? -14.373 30.926 -17.346 0.010 27.41  ? 7    ALA A N    1  
ATOM   95     C CA   . ALA A 1 7   ? -14.331 30.580 -18.757 0.010 26.44  ? 7    ALA A CA   1  
ATOM   96     C C    . ALA A 1 7   ? -15.538 31.128 -19.486 0.010 27.04  ? 7    ALA A C    1  
ATOM   97     O O    . ALA A 1 7   ? -16.598 31.304 -18.895 0.010 27.50  ? 7    ALA A O    1  
ATOM   98     C CB   . ALA A 1 7   ? -14.279 29.061 -18.935 0.010 24.53  ? 7    ALA A CB   1  
ATOM   99     H H    . ALA A 1 7   ? -14.576 30.271 -16.829 0.010 26.81  ? 7    ALA A H    1  
ATOM   100    H HA   . ALA A 1 7   ? -13.531 30.960 -19.155 0.010 26.77  ? 7    ALA A HA   1  
ATOM   101    H HB1  . ALA A 1 7   ? -15.012 28.659 -18.445 0.010 24.29  ? 7    ALA A HB1  1  
ATOM   102    H HB2  . ALA A 1 7   ? -14.372 28.859 -19.878 0.010 24.06  ? 7    ALA A HB2  1  
ATOM   103    H HB3  . ALA A 1 7   ? -13.432 28.726 -18.602 0.010 24.20  ? 7    ALA A HB3  1  
ATOM   104    N N    . GLU A 1 8   ? -15.354 31.359 -20.778 0.010 27.10  ? 8    GLU A N    1  
ATOM   105    C CA   . GLU A 1 8   ? -16.439 31.628 -21.694 0.010 27.54  ? 8    GLU A CA   1  
ATOM   106    C C    . GLU A 1 8   ? -17.413 30.439 -21.613 0.010 26.23  ? 8    GLU A C    1  
ATOM   107    O O    . GLU A 1 8   ? -16.999 29.274 -21.675 0.010 24.77  ? 8    GLU A O    1  
ATOM   108    C CB   . GLU A 1 8   ? -15.863 31.783 -23.103 0.010 27.69  ? 8    GLU A CB   1  
ATOM   109    C CG   . GLU A 1 8   ? -16.762 32.515 -24.100 0.010 28.80  ? 8    GLU A CG   1  
ATOM   110    C CD   . GLU A 1 8   ? -15.998 32.975 -25.357 0.010 29.63  ? 8    GLU A CD   1  
ATOM   111    O OE1  . GLU A 1 8   ? -16.659 33.285 -26.377 0.010 30.64  ? 8    GLU A OE1  1  
ATOM   112    O OE2  . GLU A 1 8   ? -14.747 33.043 -25.324 0.010 29.45  ? 8    GLU A OE2  1  
ATOM   113    H H    . GLU A 1 8   ? -14.582 31.358 -21.158 0.010 26.98  ? 8    GLU A H    1  
ATOM   114    H HA   . GLU A 1 8   ? -16.902 32.442 -21.443 0.010 28.72  ? 8    GLU A HA   1  
ATOM   115    H HB2  . GLU A 1 8   ? -15.037 32.283 -23.031 0.010 28.35  ? 8    GLU A HB2  1  
ATOM   116    H HB3  . GLU A 1 8   ? -15.674 30.904 -23.463 0.010 26.55  ? 8    GLU A HB3  1  
ATOM   117    H HG2  . GLU A 1 8   ? -17.479 31.921 -24.378 0.010 28.11  ? 8    GLU A HG2  1  
ATOM   118    H HG3  . GLU A 1 8   ? -17.133 33.305 -23.673 0.010 29.87  ? 8    GLU A HG3  1  
ATOM   119    N N    . ALA A 1 9   ? -18.704 30.720 -21.449 0.010 26.90  ? 9    ALA A N    1  
ATOM   120    C CA   . ALA A 1 9   ? -19.663 29.631 -21.286 0.010 25.90  ? 9    ALA A CA   1  
ATOM   121    C C    . ALA A 1 9   ? -19.729 28.751 -22.536 0.010 24.98  ? 9    ALA A C    1  
ATOM   122    O O    . ALA A 1 9   ? -19.960 29.209 -23.642 0.010 25.71  ? 9    ALA A O    1  
ATOM   123    C CB   . ALA A 1 9   ? -21.044 30.136 -20.908 0.010 26.95  ? 9    ALA A CB   1  
ATOM   124    H H    . ALA A 1 9   ? -19.039 31.508 -21.431 0.010 27.97  ? 9    ALA A H    1  
ATOM   125    H HA   . ALA A 1 9   ? -19.357 29.074 -20.554 0.010 25.23  ? 9    ALA A HA   1  
ATOM   126    H HB1  . ALA A 1 9   ? -21.294 30.852 -21.510 0.010 27.64  ? 9    ALA A HB1  1  
ATOM   127    H HB2  . ALA A 1 9   ? -21.675 29.407 -20.991 0.010 26.31  ? 9    ALA A HB2  1  
ATOM   128    H HB3  . ALA A 1 9   ? -21.028 30.452 -19.993 0.010 27.67  ? 9    ALA A HB3  1  
ATOM   129    N N    . HIS A 1 10  ? -19.478 27.466 -22.327 0.010 23.58  ? 10   HIS A N    1  
ATOM   130    C CA   . HIS A 1 10  ? -19.619 26.448 -23.363 0.010 22.80  ? 10   HIS A CA   1  
ATOM   131    C C    . HIS A 1 10  ? -18.587 26.510 -24.503 0.010 22.72  ? 10   HIS A C    1  
ATOM   132    O O    . HIS A 1 10  ? -18.780 25.878 -25.533 0.010 22.51  ? 10   HIS A O    1  
ATOM   133    C CB   . HIS A 1 10  ? -21.035 26.436 -23.947 0.010 23.46  ? 10   HIS A CB   1  
ATOM   134    C CG   . HIS A 1 10  ? -22.118 26.501 -22.915 0.010 23.77  ? 10   HIS A CG   1  
ATOM   135    N ND1  . HIS A 1 10  ? -22.366 25.471 -22.033 0.010 22.91  ? 10   HIS A ND1  1  
ATOM   136    C CD2  . HIS A 1 10  ? -23.027 27.465 -22.633 0.010 25.01  ? 10   HIS A CD2  1  
ATOM   137    C CE1  . HIS A 1 10  ? -23.374 25.800 -21.247 0.010 23.59  ? 10   HIS A CE1  1  
ATOM   138    N NE2  . HIS A 1 10  ? -23.791 27.006 -21.588 0.010 24.84  ? 10   HIS A NE2  1  
ATOM   139    H H    . HIS A 1 10  ? -19.213 27.157 -21.573 0.010 23.16  ? 10   HIS A H    1  
ATOM   140    H HA   . HIS A 1 10  ? -19.510 25.588 -22.933 0.010 21.96  ? 10   HIS A HA   1  
ATOM   141    H HB2  . HIS A 1 10  ? -21.135 27.198 -24.538 0.010 24.34  ? 10   HIS A HB2  1  
ATOM   142    H HB3  . HIS A 1 10  ? -21.156 25.614 -24.450 0.010 22.96  ? 10   HIS A HB3  1  
ATOM   143    H HD1  . HIS A 1 10  ? -21.933 24.730 -21.995 0.010 22.13  ? 10   HIS A HD1  1  
ATOM   144    H HD2  . HIS A 1 10  ? -23.112 28.284 -23.059 0.010 25.90  ? 10   HIS A HD2  1  
ATOM   145    H HE1  . HIS A 1 10  ? -23.730 25.272 -20.570 0.010 23.34  ? 10   HIS A HE1  1  
ATOM   146    H HE2  . HIS A 1 10  ? -24.440 27.427 -21.219 0.010 25.53  ? 10   HIS A HE2  1  
ATOM   147    N N    . ALA A 1 11  ? -17.474 27.218 -24.298 0.010 23.03  ? 11   ALA A N    1  
ATOM   148    C CA   . ALA A 1 11  ? -16.390 27.284 -25.296 0.010 23.08  ? 11   ALA A CA   1  
ATOM   149    C C    . ALA A 1 11  ? -15.360 26.161 -25.104 0.010 21.73  ? 11   ALA A C    1  
ATOM   150    O O    . ALA A 1 11  ? -14.396 26.058 -25.863 0.010 21.69  ? 11   ALA A O    1  
ATOM   151    C CB   . ALA A 1 11  ? -15.697 28.633 -25.236 0.010 24.31  ? 11   ALA A CB   1  
ATOM   152    H H    . ALA A 1 11  ? -17.314 27.664 -23.582 0.010 23.29  ? 11   ALA A H    1  
ATOM   153    H HA   . ALA A 1 11  ? -16.765 27.182 -26.184 0.010 23.38  ? 11   ALA A HA   1  
ATOM   154    H HB1  . ALA A 1 11  ? -15.417 28.794 -24.322 0.010 24.16  ? 11   ALA A HB1  1  
ATOM   155    H HB2  . ALA A 1 11  ? -14.923 28.617 -25.819 0.010 24.40  ? 11   ALA A HB2  1  
ATOM   156    H HB3  . ALA A 1 11  ? -16.308 29.327 -25.526 0.010 25.27  ? 11   ALA A HB3  1  
ATOM   157    N N    . ARG A 1 12  ? -15.585 25.340 -24.089 0.010 20.81  ? 12   ARG A N    1  
ATOM   158    C CA   . ARG A 1 12  ? -14.855 24.094 -23.893 0.010 19.60  ? 12   ARG A CA   1  
ATOM   159    C C    . ARG A 1 12  ? -15.857 22.930 -23.855 0.010 18.98  ? 12   ARG A C    1  
ATOM   160    O O    . ARG A 1 12  ? -16.137 22.375 -22.797 0.010 18.52  ? 12   ARG A O    1  
ATOM   161    C CB   . ARG A 1 12  ? -14.045 24.176 -22.609 0.010 19.35  ? 12   ARG A CB   1  
ATOM   162    C CG   . ARG A 1 12  ? -12.881 25.179 -22.695 0.010 20.04  ? 12   ARG A CG   1  
ATOM   163    C CD   . ARG A 1 12  ? -12.417 25.579 -21.311 0.010 20.36  ? 12   ARG A CD   1  
ATOM   164    N NE   . ARG A 1 12  ? -11.299 26.503 -21.348 0.010 21.14  ? 12   ARG A NE   1  
ATOM   165    C CZ   . ARG A 1 12  ? -11.432 27.801 -21.576 0.010 22.47  ? 12   ARG A CZ   1  
ATOM   166    N NH1  . ARG A 1 12  ? -12.630 28.321 -21.815 0.010 23.11  ? 12   ARG A NH1  1  
ATOM   167    N NH2  . ARG A 1 12  ? -10.365 28.573 -21.593 0.010 23.30  ? 12   ARG A NH2  1  
ATOM   168    H H    . ARG A 1 12  ? -16.166 25.485 -23.476 0.010 20.96  ? 12   ARG A H    1  
ATOM   169    H HA   . ARG A 1 12  ? -14.240 23.943 -24.622 0.010 19.51  ? 12   ARG A HA   1  
ATOM   170    H HB2  . ARG A 1 12  ? -14.620 24.457 -21.883 0.010 19.64  ? 12   ARG A HB2  1  
ATOM   171    H HB3  . ARG A 1 12  ? -13.673 23.301 -22.417 0.010 18.61  ? 12   ARG A HB3  1  
ATOM   172    H HG2  . ARG A 1 12  ? -12.140 24.785 -23.177 0.010 19.65  ? 12   ARG A HG2  1  
ATOM   173    H HG3  . ARG A 1 12  ? -13.183 25.981 -23.148 0.010 20.83  ? 12   ARG A HG3  1  
ATOM   174    H HD2  . ARG A 1 12  ? -13.147 25.996 -20.829 0.010 20.88  ? 12   ARG A HD2  1  
ATOM   175    H HD3  . ARG A 1 12  ? -12.125 24.784 -20.839 0.010 19.66  ? 12   ARG A HD3  1  
ATOM   176    H HE   . ARG A 1 12  ? -10.523 26.165 -21.497 0.010 20.75  ? 12   ARG A HE   1  
ATOM   177    H HH11 . ARG A 1 12  ? -13.333 27.828 -21.809 0.010 22.65  ? 12   ARG A HH11 1  
ATOM   178    H HH12 . ARG A 1 12  ? -12.700 29.163 -21.967 0.010 24.07  ? 12   ARG A HH12 1  
ATOM   179    H HH21 . ARG A 1 12  ? -9.591  28.235 -21.443 0.010 22.93  ? 12   ARG A HH21 1  
ATOM   180    H HH22 . ARG A 1 12  ? -10.444 29.414 -21.749 0.010 24.28  ? 12   ARG A HH22 1  
ATOM   181    N N    . PRO A 1 13  ? -16.399 22.580 -25.028 0.010 19.19  ? 13   PRO A N    1  
ATOM   182    C CA   . PRO A 1 13  ? -17.533 21.651 -25.108 0.010 19.01  ? 13   PRO A CA   1  
ATOM   183    C C    . PRO A 1 13  ? -17.137 20.212 -24.694 0.010 18.03  ? 13   PRO A C    1  
ATOM   184    O O    . PRO A 1 13  ? -18.015 19.362 -24.537 0.010 17.94  ? 13   PRO A O    1  
ATOM   185    C CB   . PRO A 1 13  ? -17.995 21.769 -26.572 0.010 19.75  ? 13   PRO A CB   1  
ATOM   186    C CG   . PRO A 1 13  ? -16.813 22.408 -27.325 0.010 19.96  ? 13   PRO A CG   1  
ATOM   187    C CD   . PRO A 1 13  ? -16.105 23.239 -26.314 0.010 19.98  ? 13   PRO A CD   1  
ATOM   188    H HA   . PRO A 1 13  ? -18.251 21.955 -24.532 0.010 19.28  ? 13   PRO A HA   1  
ATOM   189    H HB2  . PRO A 1 13  ? -18.222 20.897 -26.916 0.010 19.54  ? 13   PRO A HB2  1  
ATOM   190    H HB3  . PRO A 1 13  ? -18.763 22.359 -26.617 0.010 20.44  ? 13   PRO A HB3  1  
ATOM   191    H HG2  . PRO A 1 13  ? -16.226 21.722 -27.678 0.010 19.42  ? 13   PRO A HG2  1  
ATOM   192    H HG3  . PRO A 1 13  ? -17.153 22.970 -28.039 0.010 20.74  ? 13   PRO A HG3  1  
ATOM   193    H HD2  . PRO A 1 13  ? -15.153 23.261 -26.490 0.010 19.86  ? 13   PRO A HD2  1  
ATOM   194    H HD3  . PRO A 1 13  ? -16.485 24.131 -26.317 0.010 20.74  ? 13   PRO A HD3  1  
ATOM   195    N N    . TYR A 1 14  ? -15.840 19.991 -24.462 0.010 17.47  ? 14   TYR A N    1  
ATOM   196    C CA   . TYR A 1 14  ? -15.345 18.719 -23.958 0.010 16.67  ? 14   TYR A CA   1  
ATOM   197    C C    . TYR A 1 14  ? -15.351 18.586 -22.437 0.010 16.36  ? 14   TYR A C    1  
ATOM   198    O O    . TYR A 1 14  ? -15.088 17.503 -21.869 0.010 15.87  ? 14   TYR A O    1  
ATOM   199    C CB   . TYR A 1 14  ? -13.894 18.537 -24.431 0.010 16.34  ? 14   TYR A CB   1  
ATOM   200    C CG   . TYR A 1 14  ? -12.986 19.681 -24.045 0.010 16.51  ? 14   TYR A CG   1  
ATOM   201    C CD1  . TYR A 1 14  ? -12.366 19.733 -22.809 0.010 16.20  ? 14   TYR A CD1  1  
ATOM   202    C CD2  . TYR A 1 14  ? -12.758 20.716 -24.937 0.010 17.21  ? 14   TYR A CD2  1  
ATOM   203    C CE1  . TYR A 1 14  ? -11.510 20.802 -22.487 0.010 16.59  ? 14   TYR A CE1  1  
ATOM   204    C CE2  . TYR A 1 14  ? -11.937 21.760 -24.638 0.010 17.58  ? 14   TYR A CE2  1  
ATOM   205    C CZ   . TYR A 1 14  ? -11.306 21.808 -23.410 0.010 17.26  ? 14   TYR A CZ   1  
ATOM   206    O OH   . TYR A 1 14  ? -10.499 22.893 -23.169 0.010 17.84  ? 14   TYR A OH   1  
ATOM   207    H H    . TYR A 1 14  ? -15.229 20.575 -24.595 0.010 17.62  ? 14   TYR A H    1  
ATOM   208    H HA   . TYR A 1 14  ? -15.884 18.003 -24.322 0.010 16.68  ? 14   TYR A HA   1  
ATOM   209    H HB2  . TYR A 1 14  ? -13.536 17.728 -24.041 0.010 15.89  ? 14   TYR A HB2  1  
ATOM   210    H HB3  . TYR A 1 14  ? -13.886 18.467 -25.398 0.010 16.63  ? 14   TYR A HB3  1  
ATOM   211    H HD1  . TYR A 1 14  ? -12.503 19.046 -22.194 0.010 15.86  ? 14   TYR A HD1  1  
ATOM   212    H HD2  . TYR A 1 14  ? -13.164 20.690 -25.772 0.010 17.56  ? 14   TYR A HD2  1  
ATOM   213    H HE1  . TYR A 1 14  ? -11.094 20.839 -21.659 0.010 16.52  ? 14   TYR A HE1  1  
ATOM   214    H HE2  . TYR A 1 14  ? -11.801 22.433 -25.258 0.010 18.17  ? 14   TYR A HE2  1  
ATOM   215    H HH   . TYR A 1 14  ? -10.291 22.931 -22.347 0.010 17.77  ? 14   TYR A HH   1  
ATOM   216    N N    . MET A 1 15  ? -15.549 19.701 -21.754 0.010 16.82  ? 15   MET A N    1  
ATOM   217    C CA   . MET A 1 15  ? -15.446 19.703 -20.307 0.010 16.80  ? 15   MET A CA   1  
ATOM   218    C C    . MET A 1 15  ? -16.603 18.935 -19.639 0.010 16.86  ? 15   MET A C    1  
ATOM   219    O O    . MET A 1 15  ? -17.798 19.130 -19.961 0.010 17.29  ? 15   MET A O    1  
ATOM   220    C CB   . MET A 1 15  ? -15.360 21.137 -19.822 0.010 17.57  ? 15   MET A CB   1  
ATOM   221    C CG   . MET A 1 15  ? -15.017 21.270 -18.381 0.010 17.84  ? 15   MET A CG   1  
ATOM   222    S SD   . MET A 1 15  ? -13.203 20.917 -18.171 0.010 17.34  ? 15   MET A SD   1  
ATOM   223    C CE   . MET A 1 15  ? -13.215 20.449 -16.495 0.010 17.79  ? 15   MET A CE   1  
ATOM   224    H H    . MET A 1 15  ? -15.739 20.459 -22.098 0.010 17.26  ? 15   MET A H    1  
ATOM   225    H HA   . MET A 1 15  ? -14.617 19.271 -20.053 0.010 16.44  ? 15   MET A HA   1  
ATOM   226    H HB2  . MET A 1 15  ? -14.674 21.593 -20.330 0.010 17.64  ? 15   MET A HB2  1  
ATOM   227    H HB3  . MET A 1 15  ? -16.211 21.572 -19.974 0.010 18.01  ? 15   MET A HB3  1  
ATOM   228    H HG2  . MET A 1 15  ? -15.216 22.167 -18.074 0.010 18.52  ? 15   MET A HG2  1  
ATOM   229    H HG3  . MET A 1 15  ? -15.531 20.626 -17.872 0.010 17.73  ? 15   MET A HG3  1  
ATOM   230    H HE1  . MET A 1 15  ? -13.925 19.803 -16.358 0.010 17.71  ? 15   MET A HE1  1  
ATOM   231    H HE2  . MET A 1 15  ? -12.359 20.056 -16.278 0.010 17.55  ? 15   MET A HE2  1  
ATOM   232    H HE3  . MET A 1 15  ? -13.371 21.233 -15.954 0.010 18.52  ? 15   MET A HE3  1  
ATOM   233    N N    . ALA A 1 16  ? -16.227 18.063 -18.714 0.010 16.58  ? 16   ALA A N    1  
ATOM   234    C CA   . ALA A 1 16  ? -17.192 17.316 -17.889 0.010 16.82  ? 16   ALA A CA   1  
ATOM   235    C C    . ALA A 1 16  ? -17.012 17.508 -16.394 0.010 17.33  ? 16   ALA A C    1  
ATOM   236    O O    . ALA A 1 16  ? -15.899 17.657 -15.888 0.010 17.31  ? 16   ALA A O    1  
ATOM   237    C CB   . ALA A 1 16  ? -17.120 15.855 -18.219 0.010 16.37  ? 16   ALA A CB   1  
ATOM   238    H H    . ALA A 1 16  ? -15.411 17.874 -18.545 0.010 16.34  ? 16   ALA A H    1  
ATOM   239    H HA   . ALA A 1 16  ? -18.093 17.607 -18.104 0.010 17.14  ? 16   ALA A HA   1  
ATOM   240    H HB1  . ALA A 1 16  ? -16.229 15.527 -18.010 0.010 16.03  ? 16   ALA A HB1  1  
ATOM   241    H HB2  . ALA A 1 16  ? -17.780 15.382 -17.692 0.010 16.62  ? 16   ALA A HB2  1  
ATOM   242    H HB3  . ALA A 1 16  ? -17.304 15.738 -19.163 0.010 16.30  ? 16   ALA A HB3  1  
ATOM   243    N N    . SER A 1 17  ? -18.122 17.493 -15.678 0.010 17.96  ? 17   SER A N    1  
ATOM   244    C CA   . SER A 1 17  ? -18.099 17.456 -14.228 0.010 18.68  ? 17   SER A CA   1  
ATOM   245    C C    . SER A 1 17  ? -18.410 16.043 -13.782 0.010 18.66  ? 17   SER A C    1  
ATOM   246    O O    . SER A 1 17  ? -19.482 15.566 -14.019 0.010 18.80  ? 17   SER A O    1  
ATOM   247    C CB   . SER A 1 17  ? -19.160 18.367 -13.620 0.010 19.70  ? 17   SER A CB   1  
ATOM   248    O OG   . SER A 1 17  ? -19.286 18.100 -12.240 0.010 20.58  ? 17   SER A OG   1  
ATOM   249    H H    . SER A 1 17  ? -18.906 17.490 -16.018 0.010 18.08  ? 17   SER A H    1  
ATOM   250    H HA   . SER A 1 17  ? -17.235 17.716 -13.883 0.010 18.71  ? 17   SER A HA   1  
ATOM   251    H HB2  . SER A 1 17  ? -18.915 19.295 -13.750 0.010 19.91  ? 17   SER A HB2  1  
ATOM   252    H HB3  . SER A 1 17  ? -20.004 18.185 -14.052 0.010 19.68  ? 17   SER A HB3  1  
ATOM   253    H HG   . SER A 1 17  ? -19.719 18.721 -11.864 0.010 21.24  ? 17   SER A HG   1  
ATOM   254    N N    . VAL A 1 18  ? -17.453 15.393 -13.132 0.010 18.63  ? 18   VAL A N    1  
ATOM   255    C CA   . VAL A 1 18  ? -17.710 14.076 -12.537 0.010 18.92  ? 18   VAL A CA   1  
ATOM   256    C C    . VAL A 1 18  ? -18.330 14.230 -11.166 0.010 20.15  ? 18   VAL A C    1  
ATOM   257    O O    . VAL A 1 18  ? -17.738 14.861 -10.316 0.010 20.74  ? 18   VAL A O    1  
ATOM   258    C CB   . VAL A 1 18  ? -16.404 13.299 -12.348 0.010 18.59  ? 18   VAL A CB   1  
ATOM   259    C CG1  . VAL A 1 18  ? -16.668 12.055 -11.543 0.010 19.22  ? 18   VAL A CG1  1  
ATOM   260    C CG2  . VAL A 1 18  ? -15.807 12.985 -13.676 0.010 17.54  ? 18   VAL A CG2  1  
ATOM   261    H H    . VAL A 1 18  ? -16.661 15.697 -13.010 0.010 18.54  ? 18   VAL A H    1  
ATOM   262    H HA   . VAL A 1 18  ? -18.318 13.564 -13.093 0.010 18.73  ? 18   VAL A HA   1  
ATOM   263    H HB   . VAL A 1 18  ? -15.777 13.848 -11.854 0.010 18.84  ? 18   VAL A HB   1  
ATOM   264    H HG11 . VAL A 1 18  ? -17.581 11.766 -11.692 0.010 19.24  ? 18   VAL A HG11 1  
ATOM   265    H HG12 . VAL A 1 18  ? -16.061 11.356 -11.829 0.010 18.95  ? 18   VAL A HG12 1  
ATOM   266    H HG13 . VAL A 1 18  ? -16.532 12.255 -10.605 0.010 20.00  ? 18   VAL A HG13 1  
ATOM   267    H HG21 . VAL A 1 18  ? -15.645 13.811 -14.154 0.010 17.29  ? 18   VAL A HG21 1  
ATOM   268    H HG22 . VAL A 1 18  ? -14.972 12.506 -13.545 0.010 17.40  ? 18   VAL A HG22 1  
ATOM   269    H HG23 . VAL A 1 18  ? -16.427 12.435 -14.178 0.010 17.40  ? 18   VAL A HG23 1  
ATOM   270    N N    . GLN A 1 19  ? -19.491 13.621 -10.944 0.010 20.71  ? 19   GLN A N    1  
ATOM   271    C CA   . GLN A 1 19  ? -20.295 13.911 -9.765  0.010 22.04  ? 19   GLN A CA   1  
ATOM   272    C C    . GLN A 1 19  ? -20.540 12.674 -8.905  0.010 22.91  ? 19   GLN A C    1  
ATOM   273    O O    . GLN A 1 19  ? -20.698 11.580 -9.435  0.010 22.54  ? 19   GLN A O    1  
ATOM   274    C CB   . GLN A 1 19  ? -21.628 14.521 -10.185 0.010 22.32  ? 19   GLN A CB   1  
ATOM   275    C CG   . GLN A 1 19  ? -21.486 15.687 -11.157 0.010 21.60  ? 19   GLN A CG   1  
ATOM   276    C CD   . GLN A 1 19  ? -22.492 16.802 -10.893 0.010 22.48  ? 19   GLN A CD   1  
ATOM   277    O OE1  . GLN A 1 19  ? -23.626 16.543 -10.505 0.010 23.27  ? 19   GLN A OE1  1  
ATOM   278    N NE2  . GLN A 1 19  ? -22.076 18.036 -11.093 0.010 22.49  ? 19   GLN A NE2  1  
ATOM   279    H H    . GLN A 1 19  ? -19.843 13.035 -11.463 0.010 20.44  ? 19   GLN A H    1  
ATOM   280    H HA   . GLN A 1 19  ? -19.840 14.568 -9.223  0.010 22.42  ? 19   GLN A HA   1  
ATOM   281    H HB2  . GLN A 1 19  ? -22.177 13.843 -10.606 0.010 22.22  ? 19   GLN A HB2  1  
ATOM   282    H HB3  . GLN A 1 19  ? -22.072 14.847 -9.391  0.010 23.26  ? 19   GLN A HB3  1  
ATOM   283    H HG2  . GLN A 1 19  ? -20.595 16.054 -11.069 0.010 21.35  ? 19   GLN A HG2  1  
ATOM   284    H HG3  . GLN A 1 19  ? -21.626 15.367 -12.061 0.010 20.94  ? 19   GLN A HG3  1  
ATOM   285    H HE21 . GLN A 1 19  ? -21.879 18.536 -10.424 0.010 23.16  ? 19   GLN A HE21 1  
ATOM   286    H HE22 . GLN A 1 19  ? -22.000 18.337 -11.893 0.010 21.92  ? 19   GLN A HE22 1  
ATOM   287    N N    . LEU A 1 20  ? -20.551 12.878 -7.590  0.010 24.27  ? 20   LEU A N    1  
ATOM   288    C CA   . LEU A 1 20  ? -20.937 11.844 -6.629  0.010 25.55  ? 20   LEU A CA   1  
ATOM   289    C C    . LEU A 1 20  ? -22.184 12.331 -5.930  0.010 26.94  ? 20   LEU A C    1  
ATOM   290    O O    . LEU A 1 20  ? -22.186 13.405 -5.334  0.010 27.69  ? 20   LEU A O    1  
ATOM   291    C CB   . LEU A 1 20  ? -19.826 11.565 -5.610  0.010 26.23  ? 20   LEU A CB   1  
ATOM   292    C CG   . LEU A 1 20  ? -20.142 10.579 -4.475  0.010 28.11  ? 20   LEU A CG   1  
ATOM   293    C CD1  . LEU A 1 20  ? -20.980 9.392  -4.986  0.010 28.50  ? 20   LEU A CD1  1  
ATOM   294    C CD2  . LEU A 1 20  ? -18.874 10.046 -3.801  0.010 28.50  ? 20   LEU A CD2  1  
ATOM   295    H H    . LEU A 1 20  ? -20.335 13.622 -7.224  0.010 24.62  ? 20   LEU A H    1  
ATOM   296    H HA   . LEU A 1 20  ? -21.141 11.017 -7.090  0.010 25.24  ? 20   LEU A HA   1  
ATOM   297    H HB2  . LEU A 1 20  ? -19.060 11.220 -6.093  0.010 25.43  ? 20   LEU A HB2  1  
ATOM   298    H HB3  . LEU A 1 20  ? -19.579 12.403 -5.191  0.010 26.34  ? 20   LEU A HB3  1  
ATOM   299    H HG   . LEU A 1 20  ? -20.655 11.040 -3.796  0.010 29.08  ? 20   LEU A HG   1  
ATOM   300    H HD11 . LEU A 1 20  ? -20.508 8.971  -5.722  0.010 27.70  ? 20   LEU A HD11 1  
ATOM   301    H HD12 . LEU A 1 20  ? -21.096 8.754  -4.263  0.010 29.83  ? 20   LEU A HD12 1  
ATOM   302    H HD13 . LEU A 1 20  ? -21.846 9.705  -5.282  0.010 28.38  ? 20   LEU A HD13 1  
ATOM   303    H HD21 . LEU A 1 20  ? -18.289 10.792 -3.596  0.010 28.56  ? 20   LEU A HD21 1  
ATOM   304    H HD22 . LEU A 1 20  ? -19.113 9.583  -2.985  0.010 29.77  ? 20   LEU A HD22 1  
ATOM   305    H HD23 . LEU A 1 20  ? -18.430 9.435  -4.407  0.010 27.51  ? 20   LEU A HD23 1  
ATOM   306    N N    . ASN A 1 21  ? -23.258 11.559 -6.057  0.010 27.37  ? 21   ASN A N    1  
ATOM   307    C CA   . ASN A 1 21  ? -24.513 11.865 -5.378  0.010 28.78  ? 21   ASN A CA   1  
ATOM   308    C C    . ASN A 1 21  ? -24.999 13.278 -5.724  0.010 28.60  ? 21   ASN A C    1  
ATOM   309    O O    . ASN A 1 21  ? -25.594 13.979 -4.910  0.010 29.97  ? 21   ASN A O    1  
ATOM   310    C CB   . ASN A 1 21  ? -24.354 11.647 -3.862  0.010 30.75  ? 21   ASN A CB   1  
ATOM   311    C CG   . ASN A 1 21  ? -24.043 10.189 -3.516  0.010 31.16  ? 21   ASN A CG   1  
ATOM   312    O OD1  . ASN A 1 21  ? -23.217 9.884  -2.639  0.010 32.05  ? 21   ASN A OD1  1  
ATOM   313    N ND2  . ASN A 1 21  ? -24.691 9.284  -4.224  0.010 30.73  ? 21   ASN A ND2  1  
ATOM   314    H H    . ASN A 1 21  ? -23.284 10.846 -6.537  0.010 26.94  ? 21   ASN A H    1  
ATOM   315    H HA   . ASN A 1 21  ? -25.184 11.244 -5.699  0.010 28.74  ? 21   ASN A HA   1  
ATOM   316    H HB2  . ASN A 1 21  ? -23.625 12.196 -3.535  0.010 31.00  ? 21   ASN A HB2  1  
ATOM   317    H HB3  . ASN A 1 21  ? -25.180 11.888 -3.414  0.010 31.72  ? 21   ASN A HB3  1  
ATOM   318    H HD21 . ASN A 1 21  ? -25.553 9.300  -4.260  0.010 29.86  ? 21   ASN A HD21 1  
ATOM   319    H HD22 . ASN A 1 21  ? -24.252 8.682  -4.648  0.010 31.43  ? 21   ASN A HD22 1  
ATOM   320    N N    . GLY A 1 22  ? -24.733 13.685 -6.960  0.010 27.06  ? 22   GLY A N    1  
ATOM   321    C CA   . GLY A 1 22  ? -25.179 14.969 -7.461  0.010 26.88  ? 22   GLY A CA   1  
ATOM   322    C C    . GLY A 1 22  ? -24.359 16.159 -7.000  0.010 27.02  ? 22   GLY A C    1  
ATOM   323    O O    . GLY A 1 22  ? -24.826 17.294 -7.086  0.010 27.33  ? 22   GLY A O    1  
ATOM   324    H H    . GLY A 1 22  ? -24.288 13.223 -7.534  0.010 26.20  ? 22   GLY A H    1  
ATOM   325    H HA2  . GLY A 1 22  ? -25.158 14.954 -8.431  0.010 25.90  ? 22   GLY A HA2  1  
ATOM   326    H HA3  . GLY A 1 22  ? -26.095 15.111 -7.182  0.010 27.77  ? 22   GLY A HA3  1  
ATOM   327    N N    . ALA A 1 23  ? -23.154 15.910 -6.495  0.010 26.96  ? 23   ALA A N    1  
ATOM   328    C CA   . ALA A 1 23  ? -22.231 16.990 -6.192  0.010 27.25  ? 23   ALA A CA   1  
ATOM   329    C C    . ALA A 1 23  ? -20.928 16.765 -6.961  0.010 25.69  ? 23   ALA A C    1  
ATOM   330    O O    . ALA A 1 23  ? -20.459 15.631 -7.138  0.010 25.02  ? 23   ALA A O    1  
ATOM   331    C CB   . ALA A 1 23  ? -21.975 17.083 -4.701  0.010 28.98  ? 23   ALA A CB   1  
ATOM   332    H H    . ALA A 1 23  ? -22.850 15.126 -6.314  0.010 26.84  ? 23   ALA A H    1  
ATOM   333    H HA   . ALA A 1 23  ? -22.601 17.835 -6.485  0.010 27.49  ? 23   ALA A HA   1  
ATOM   334    H HB1  . ALA A 1 23  ? -22.802 16.897 -4.235  0.010 30.07  ? 23   ALA A HB1  1  
ATOM   335    H HB2  . ALA A 1 23  ? -21.305 16.425 -4.454  0.010 28.87  ? 23   ALA A HB2  1  
ATOM   336    H HB3  . ALA A 1 23  ? -21.666 17.976 -4.487  0.010 29.23  ? 23   ALA A HB3  1  
ATOM   337    N N    . HIS A 1 24  ? -20.390 17.861 -7.453  0.010 25.24  ? 24   HIS A N    1  
ATOM   338    C CA   . HIS A 1 24  ? -19.135 17.862 -8.161  0.010 24.05  ? 24   HIS A CA   1  
ATOM   339    C C    . HIS A 1 24  ? -18.005 17.266 -7.323  0.010 24.44  ? 24   HIS A C    1  
ATOM   340    O O    . HIS A 1 24  ? -17.732 17.712 -6.211  0.010 25.88  ? 24   HIS A O    1  
ATOM   341    C CB   . HIS A 1 24  ? -18.763 19.289 -8.570  0.010 24.03  ? 24   HIS A CB   1  
ATOM   342    C CG   . HIS A 1 24  ? -17.451 19.371 -9.275  0.010 23.02  ? 24   HIS A CG   1  
ATOM   343    N ND1  . HIS A 1 24  ? -17.312 19.095 -10.614 0.010 21.60  ? 24   HIS A ND1  1  
ATOM   344    C CD2  . HIS A 1 24  ? -16.211 19.656 -8.819  0.010 23.37  ? 24   HIS A CD2  1  
ATOM   345    C CE1  . HIS A 1 24  ? -16.046 19.209 -10.958 0.010 21.08  ? 24   HIS A CE1  1  
ATOM   346    N NE2  . HIS A 1 24  ? -15.357 19.559 -9.888  0.010 22.10  ? 24   HIS A NE2  1  
ATOM   347    H H    . HIS A 1 24  ? -20.752 18.635 -7.398  0.010 25.66  ? 24   HIS A H    1  
ATOM   348    H HA   . HIS A 1 24  ? -19.230 17.328 -8.965  0.010 23.07  ? 24   HIS A HA   1  
ATOM   349    H HB2  . HIS A 1 24  ? -19.449 19.641 -9.160  0.010 23.74  ? 24   HIS A HB2  1  
ATOM   350    H HB3  . HIS A 1 24  ? -18.693 19.839 -7.780  0.010 25.13  ? 24   HIS A HB3  1  
ATOM   351    H HD1  . HIS A 1 24  ? -17.951 18.872 -11.140 0.010 21.21  ? 24   HIS A HD1  1  
ATOM   352    H HD2  . HIS A 1 24  ? -15.983 19.884 -7.947  0.010 24.40  ? 24   HIS A HD2  1  
ATOM   353    H HE1  . HIS A 1 24  ? -15.702 19.083 -11.810 0.010 20.25  ? 24   HIS A HE1  1  
ATOM   354    H HE2  . HIS A 1 24  ? -14.513 19.702 -9.865  0.010 22.08  ? 24   HIS A HE2  1  
ATOM   355    N N    . LEU A 1 25  ? -17.378 16.242 -7.881  0.010 23.31  ? 25   LEU A N    1  
ATOM   356    C CA   . LEU A 1 25  ? -16.261 15.566 -7.262  0.010 23.56  ? 25   LEU A CA   1  
ATOM   357    C C    . LEU A 1 25  ? -14.976 15.996 -7.956  0.010 22.64  ? 25   LEU A C    1  
ATOM   358    O O    . LEU A 1 25  ? -14.049 16.473 -7.312  0.010 23.37  ? 25   LEU A O    1  
ATOM   359    C CB   . LEU A 1 25  ? -16.439 14.057 -7.415  0.010 23.17  ? 25   LEU A CB   1  
ATOM   360    C CG   . LEU A 1 25  ? -15.208 13.166 -7.193  0.010 23.14  ? 25   LEU A CG   1  
ATOM   361    C CD1  . LEU A 1 25  ? -14.848 12.977 -5.712  0.010 24.88  ? 25   LEU A CD1  1  
ATOM   362    C CD2  . LEU A 1 25  ? -15.445 11.833 -7.883  0.010 22.68  ? 25   LEU A CD2  1  
ATOM   363    H H    . LEU A 1 25  ? -17.597 15.908 -8.641  0.010 22.46  ? 25   LEU A H    1  
ATOM   364    H HA   . LEU A 1 25  ? -16.209 15.781 -6.319  0.010 24.73  ? 25   LEU A HA   1  
ATOM   365    H HB2  . LEU A 1 25  ? -17.123 13.765 -6.795  0.010 24.01  ? 25   LEU A HB2  1  
ATOM   366    H HB3  . LEU A 1 25  ? -16.745 13.882 -8.318  0.010 22.22  ? 25   LEU A HB3  1  
ATOM   367    H HG   . LEU A 1 25  ? -14.450 13.570 -7.632  0.010 22.45  ? 25   LEU A HG   1  
ATOM   368    H HD11 . LEU A 1 25  ? -15.325 13.640 -5.183  0.010 25.33  ? 25   LEU A HD11 1  
ATOM   369    H HD12 . LEU A 1 25  ? -15.100 12.083 -5.434  0.010 25.65  ? 25   LEU A HD12 1  
ATOM   370    H HD13 . LEU A 1 25  ? -13.891 13.096 -5.607  0.010 24.89  ? 25   LEU A HD13 1  
ATOM   371    H HD21 . LEU A 1 25  ? -16.370 11.574 -7.753  0.010 22.80  ? 25   LEU A HD21 1  
ATOM   372    H HD22 . LEU A 1 25  ? -15.259 11.933 -8.829  0.010 21.68  ? 25   LEU A HD22 1  
ATOM   373    H HD23 . LEU A 1 25  ? -14.854 11.168 -7.498  0.010 23.42  ? 25   LEU A HD23 1  
ATOM   374    N N    . CYS A 1 26  ? -14.945 15.830 -9.274  0.010 21.20  ? 26   CYS A N    1  
ATOM   375    C CA   . CYS A 1 26  ? -13.727 15.986 -10.059 0.010 20.28  ? 26   CYS A CA   1  
ATOM   376    C C    . CYS A 1 26  ? -14.046 16.508 -11.427 0.010 19.28  ? 26   CYS A C    1  
ATOM   377    O O    . CYS A 1 26  ? -15.150 16.392 -11.899 0.010 19.07  ? 26   CYS A O    1  
ATOM   378    C CB   . CYS A 1 26  ? -13.013 14.626 -10.208 0.010 19.73  ? 26   CYS A CB   1  
ATOM   379    S SG   . CYS A 1 26  ? -12.135 14.138 -8.712  0.010 21.06  ? 26   CYS A SG   1  
ATOM   380    H H    . CYS A 1 26  ? -15.629 15.622 -9.747  0.010 20.82  ? 26   CYS A H    1  
ATOM   381    H HA   . CYS A 1 26  ? -13.128 16.609 -9.622  0.010 20.80  ? 26   CYS A HA   1  
ATOM   382    H HB2  . CYS A 1 26  ? -13.671 13.943 -10.410 0.010 19.50  ? 26   CYS A HB2  1  
ATOM   383    H HB3  . CYS A 1 26  ? -12.374 14.674 -10.932 0.010 19.04  ? 26   CYS A HB3  1  
ATOM   384    N N    . GLY A 1 27  ? -13.058 17.088 -12.074 0.010 18.81  ? 27   GLY A N    1  
ATOM   385    C CA   . GLY A 1 27  ? -13.147 17.354 -13.491 0.010 17.90  ? 27   GLY A CA   1  
ATOM   386    C C    . GLY A 1 27  ? -12.987 16.081 -14.314 0.010 16.98  ? 27   GLY A C    1  
ATOM   387    O O    . GLY A 1 27  ? -12.570 15.022 -13.812 0.010 16.99  ? 27   GLY A O    1  
ATOM   388    H H    . GLY A 1 27  ? -12.328 17.349 -11.708 0.010 19.12  ? 27   GLY A H    1  
ATOM   389    H HA2  . GLY A 1 27  ? -13.998 17.759 -13.702 0.010 18.04  ? 27   GLY A HA2  1  
ATOM   390    H HA3  . GLY A 1 27  ? -12.450 17.967 -13.754 0.010 17.87  ? 27   GLY A HA3  1  
ATOM   391    N N    . GLY A 1 28  ? -13.325 16.216 -15.590 0.010 16.39  ? 28   GLY A N    1  
ATOM   392    C CA   . GLY A 1 28  ? -13.047 15.209 -16.593 0.010 15.70  ? 28   GLY A CA   1  
ATOM   393    C C    . GLY A 1 28  ? -13.154 15.758 -18.000 0.010 15.37  ? 28   GLY A C    1  
ATOM   394    O O    . GLY A 1 28  ? -13.522 16.924 -18.228 0.010 15.68  ? 28   GLY A O    1  
ATOM   395    H H    . GLY A 1 28  ? -13.719 16.907 -15.906 0.010 16.51  ? 28   GLY A H    1  
ATOM   396    H HA2  . GLY A 1 28  ? -12.147 14.873 -16.471 0.010 15.53  ? 28   GLY A HA2  1  
ATOM   397    H HA3  . GLY A 1 28  ? -13.667 14.469 -16.495 0.010 15.75  ? 28   GLY A HA3  1  
ATOM   398    N N    . VAL A 1 29  ? -12.867 14.901 -18.962 0.010 14.95  ? 29   VAL A N    1  
ATOM   399    C CA   . VAL A 1 29  ? -12.846 15.321 -20.351 0.010 14.84  ? 29   VAL A CA   1  
ATOM   400    C C    . VAL A 1 29  ? -13.483 14.280 -21.266 0.010 14.84  ? 29   VAL A C    1  
ATOM   401    O O    . VAL A 1 29  ? -13.187 13.073 -21.198 0.010 14.72  ? 29   VAL A O    1  
ATOM   402    C CB   . VAL A 1 29  ? -11.410 15.605 -20.847 0.010 14.59  ? 29   VAL A CB   1  
ATOM   403    C CG1  . VAL A 1 29  ? -10.519 14.435 -20.577 0.010 14.28  ? 29   VAL A CG1  1  
ATOM   404    C CG2  . VAL A 1 29  ? -11.434 15.932 -22.323 0.010 14.71  ? 29   VAL A CG2  1  
ATOM   405    H H    . VAL A 1 29  ? -12.688 14.076 -18.837 0.010 14.85  ? 29   VAL A H    1  
ATOM   406    H HA   . VAL A 1 29  ? -13.343 16.144 -20.457 0.010 15.10  ? 29   VAL A HA   1  
ATOM   407    H HB   . VAL A 1 29  ? -11.051 16.368 -20.366 0.010 14.72  ? 29   VAL A HB   1  
ATOM   408    H HG11 . VAL A 1 29  ? -10.815 13.668 -21.089 0.010 14.25  ? 29   VAL A HG11 1  
ATOM   409    H HG12 . VAL A 1 29  ? -9.617  14.679 -20.842 0.010 14.19  ? 29   VAL A HG12 1  
ATOM   410    H HG13 . VAL A 1 29  ? -10.541 14.232 -19.630 0.010 14.33  ? 29   VAL A HG13 1  
ATOM   411    H HG21 . VAL A 1 29  ? -12.049 16.661 -22.482 0.010 15.01  ? 29   VAL A HG21 1  
ATOM   412    H HG22 . VAL A 1 29  ? -10.548 16.196 -22.603 0.010 14.69  ? 29   VAL A HG22 1  
ATOM   413    H HG23 . VAL A 1 29  ? -11.707 15.150 -22.824 0.010 14.66  ? 29   VAL A HG23 1  
ATOM   414    N N    . LEU A 1 30  ? -14.361 14.769 -22.122 0.010 15.16  ? 30   LEU A N    1  
ATOM   415    C CA   . LEU A 1 30  ? -15.040 13.913 -23.061 0.010 15.45  ? 30   LEU A CA   1  
ATOM   416    C C    . LEU A 1 30  ? -14.027 13.571 -24.144 0.010 15.40  ? 30   LEU A C    1  
ATOM   417    O O    . LEU A 1 30  ? -13.624 14.447 -24.911 0.010 15.56  ? 30   LEU A O    1  
ATOM   418    C CB   . LEU A 1 30  ? -16.237 14.624 -23.686 0.010 16.03  ? 30   LEU A CB   1  
ATOM   419    C CG   . LEU A 1 30  ? -17.145 13.726 -24.562 0.010 16.61  ? 30   LEU A CG   1  
ATOM   420    C CD1  . LEU A 1 30  ? -16.439 13.005 -25.601 0.010 16.83  ? 30   LEU A CD1  1  
ATOM   421    C CD2  . LEU A 1 30  ? -17.850 12.733 -23.685 0.010 16.61  ? 30   LEU A CD2  1  
ATOM   422    H H    . LEU A 1 30  ? -14.572 15.594 -22.188 0.010 15.34  ? 30   LEU A H    1  
ATOM   423    H HA   . LEU A 1 30  ? -15.347 13.108 -22.616 0.010 15.46  ? 30   LEU A HA   1  
ATOM   424    H HB2  . LEU A 1 30  ? -16.776 14.988 -22.968 0.010 16.06  ? 30   LEU A HB2  1  
ATOM   425    H HB3  . LEU A 1 30  ? -15.924 15.353 -24.237 0.010 16.16  ? 30   LEU A HB3  1  
ATOM   426    H HG   . LEU A 1 30  ? -17.818 14.272 -24.991 0.010 17.01  ? 30   LEU A HG   1  
ATOM   427    H HD11 . LEU A 1 30  ? -15.835 13.612 -25.998 0.010 16.90  ? 30   LEU A HD11 1  
ATOM   428    H HD12 . LEU A 1 30  ? -15.944 12.284 -25.192 0.010 16.51  ? 30   LEU A HD12 1  
ATOM   429    H HD13 . LEU A 1 30  ? -17.066 12.643 -26.243 0.010 17.39  ? 30   LEU A HD13 1  
ATOM   430    H HD21 . LEU A 1 30  ? -18.225 13.190 -22.918 0.010 16.49  ? 30   LEU A HD21 1  
ATOM   431    H HD22 . LEU A 1 30  ? -18.556 12.319 -24.201 0.010 17.11  ? 30   LEU A HD22 1  
ATOM   432    H HD23 . LEU A 1 30  ? -17.228 12.055 -23.387 0.010 16.37  ? 30   LEU A HD23 1  
ATOM   433    N N    . VAL A 1 31  ? -13.668 12.289 -24.239 0.010 15.37  ? 31   VAL A N    1  
ATOM   434    C CA   . VAL A 1 31  ? -12.700 11.846 -25.235 0.010 15.45  ? 31   VAL A CA   1  
ATOM   435    C C    . VAL A 1 31  ? -13.293 10.964 -26.360 0.010 16.22  ? 31   VAL A C    1  
ATOM   436    O O    . VAL A 1 31  ? -12.680 10.762 -27.406 0.010 16.64  ? 31   VAL A O    1  
ATOM   437    C CB   . VAL A 1 31  ? -11.483 11.141 -24.548 0.010 15.01  ? 31   VAL A CB   1  
ATOM   438    C CG1  . VAL A 1 31  ? -10.748 12.110 -23.588 0.010 14.51  ? 31   VAL A CG1  1  
ATOM   439    C CG2  . VAL A 1 31  ? -11.953 9.899  -23.807 0.010 15.15  ? 31   VAL A CG2  1  
ATOM   440    H H    . VAL A 1 31  ? -13.969 11.665 -23.737 0.010 15.38  ? 31   VAL A H    1  
ATOM   441    H HA   . VAL A 1 31  ? -12.346 12.625 -25.685 0.010 15.46  ? 31   VAL A HA   1  
ATOM   442    H HB   . VAL A 1 31  ? -10.848 10.879 -25.230 0.010 15.15  ? 31   VAL A HB   1  
ATOM   443    H HG11 . VAL A 1 31  ? -10.982 13.019 -23.828 0.010 14.57  ? 31   VAL A HG11 1  
ATOM   444    H HG12 . VAL A 1 31  ? -11.029 11.930 -22.679 0.010 14.41  ? 31   VAL A HG12 1  
ATOM   445    H HG13 . VAL A 1 31  ? -9.790  11.988 -23.662 0.010 14.37  ? 31   VAL A HG13 1  
ATOM   446    H HG21 . VAL A 1 31  ? -12.395 9.304  -24.432 0.010 15.60  ? 31   VAL A HG21 1  
ATOM   447    H HG22 . VAL A 1 31  ? -11.191 9.445  -23.411 0.010 15.05  ? 31   VAL A HG22 1  
ATOM   448    H HG23 . VAL A 1 31  ? -12.576 10.163 -23.114 0.010 15.03  ? 31   VAL A HG23 1  
ATOM   449    N N    . ALA A 1 32  ? -14.507 10.476 -26.161 0.010 16.60  ? 32   ALA A N    1  
ATOM   450    C CA   . ALA A 1 32  ? -15.246 9.790  -27.219 0.010 17.60  ? 32   ALA A CA   1  
ATOM   451    C C    . ALA A 1 32  ? -16.738 9.949  -26.894 0.010 17.95  ? 32   ALA A C    1  
ATOM   452    O O    . ALA A 1 32  ? -17.067 10.180 -25.728 0.010 17.42  ? 32   ALA A O    1  
ATOM   453    C CB   . ALA A 1 32  ? -14.852 8.303  -27.311 0.010 18.08  ? 32   ALA A CB   1  
ATOM   454    H H    . ALA A 1 32  ? -14.925 10.515 -25.416 0.010 16.39  ? 32   ALA A H    1  
ATOM   455    H HA   . ALA A 1 32  ? -15.065 10.214 -28.068 0.010 17.92  ? 32   ALA A HA   1  
ATOM   456    H HB1  . ALA A 1 32  ? -13.884 8.237  -27.351 0.010 17.82  ? 32   ALA A HB1  1  
ATOM   457    H HB2  . ALA A 1 32  ? -15.179 7.834  -26.530 0.010 17.97  ? 32   ALA A HB2  1  
ATOM   458    H HB3  . ALA A 1 32  ? -15.245 7.919  -28.110 0.010 18.90  ? 32   ALA A HB3  1  
ATOM   459    N N    . GLU A 1 33  ? -17.620 9.842  -27.889 0.010 19.00  ? 33   GLU A N    1  
ATOM   460    C CA   . GLU A 1 33  ? -19.050 10.140 -27.672 0.010 19.45  ? 33   GLU A CA   1  
ATOM   461    C C    . GLU A 1 33  ? -19.566 9.595  -26.345 0.010 19.20  ? 33   GLU A C    1  
ATOM   462    O O    . GLU A 1 33  ? -20.274 10.316 -25.618 0.010 19.04  ? 33   GLU A O    1  
ATOM   463    C CB   . GLU A 1 33  ? -19.936 9.677  -28.843 0.010 20.88  ? 33   GLU A CB   1  
ATOM   464    C CG   . GLU A 1 33  ? -19.992 10.716 -29.959 0.010 21.45  ? 33   GLU A CG   1  
ATOM   465    C CD   . GLU A 1 33  ? -20.631 10.179 -31.233 0.010 23.11  ? 33   GLU A CD   1  
ATOM   466    O OE1  . GLU A 1 33  ? -21.494 9.279  -31.154 0.010 23.80  ? 33   GLU A OE1  1  
ATOM   467    O OE2  . GLU A 1 33  ? -20.253 10.668 -32.319 0.010 23.90  ? 33   GLU A OE2  1  
ATOM   468    H H    . GLU A 1 33  ? -17.424 9.611  -28.692 0.010 19.55  ? 33   GLU A H    1  
ATOM   469    H HA   . GLU A 1 33  ? -19.142 11.104 -27.627 0.010 19.14  ? 33   GLU A HA   1  
ATOM   470    H HB2  . GLU A 1 33  ? -19.582 8.857  -29.219 0.010 21.29  ? 33   GLU A HB2  1  
ATOM   471    H HB3  . GLU A 1 33  ? -20.837 9.526  -28.521 0.010 21.24  ? 33   GLU A HB3  1  
ATOM   472    H HG2  . GLU A 1 33  ? -20.498 11.490 -29.663 0.010 21.39  ? 33   GLU A HG2  1  
ATOM   473    H HG3  . GLU A 1 33  ? -19.089 10.988 -30.173 0.010 21.00  ? 33   GLU A HG3  1  
ATOM   474    N N    . GLN A 1 34  ? -19.142 8.379  -25.993 0.010 19.26  ? 34   GLN A N    1  
ATOM   475    C CA   . GLN A 1 34  ? -19.638 7.717  -24.788 0.010 19.30  ? 34   GLN A CA   1  
ATOM   476    C C    . GLN A 1 34  ? -18.647 7.549  -23.642 0.010 18.49  ? 34   GLN A C    1  
ATOM   477    O O    . GLN A 1 34  ? -18.886 6.781  -22.727 0.010 18.78  ? 34   GLN A O    1  
ATOM   478    C CB   . GLN A 1 34  ? -20.169 6.342  -25.147 0.010 20.53  ? 34   GLN A CB   1  
ATOM   479    C CG   . GLN A 1 34  ? -21.403 5.943  -24.350 0.010 21.12  ? 34   GLN A CG   1  
ATOM   480    C CD   . GLN A 1 34  ? -21.852 4.555  -24.696 0.010 22.31  ? 34   GLN A CD   1  
ATOM   481    O OE1  . GLN A 1 34  ? -22.191 3.751  -23.822 0.010 22.54  ? 34   GLN A OE1  1  
ATOM   482    N NE2  . GLN A 1 34  ? -21.881 4.256  -25.990 0.010 23.28  ? 34   GLN A NE2  1  
ATOM   483    H H    . GLN A 1 34  ? -18.572 7.919  -26.436 0.010 19.37  ? 34   GLN A H    1  
ATOM   484    H HA   . GLN A 1 34  ? -20.376 8.233  -24.434 0.010 19.29  ? 34   GLN A HA   1  
ATOM   485    H HB2  . GLN A 1 34  ? -20.406 6.328  -26.088 0.010 21.13  ? 34   GLN A HB2  1  
ATOM   486    H HB3  . GLN A 1 34  ? -19.473 5.690  -24.974 0.010 20.54  ? 34   GLN A HB3  1  
ATOM   487    H HG2  . GLN A 1 34  ? -21.209 5.983  -23.401 0.010 20.57  ? 34   GLN A HG2  1  
ATOM   488    H HG3  . GLN A 1 34  ? -22.123 6.552  -24.565 0.010 21.46  ? 34   GLN A HG3  1  
ATOM   489    H HE21 . GLN A 1 34  ? -22.158 4.835  -26.561 0.010 23.38  ? 34   GLN A HE21 1  
ATOM   490    H HE22 . GLN A 1 34  ? -21.633 3.477  -26.255 0.010 23.92  ? 34   GLN A HE22 1  
ATOM   491    N N    . TRP A 1 35  ? -17.553 8.292  -23.685 0.010 17.63  ? 35   TRP A N    1  
ATOM   492    C CA   . TRP A 1 35  ? -16.463 8.044  -22.761 0.010 17.01  ? 35   TRP A CA   1  
ATOM   493    C C    . TRP A 1 35  ? -15.814 9.349  -22.240 0.010 16.19  ? 35   TRP A C    1  
ATOM   494    O O    . TRP A 1 35  ? -15.474 10.221 -23.025 0.010 15.95  ? 35   TRP A O    1  
ATOM   495    C CB   . TRP A 1 35  ? -15.403 7.224  -23.453 0.010 17.09  ? 35   TRP A CB   1  
ATOM   496    C CG   . TRP A 1 35  ? -15.750 5.785  -23.661 0.010 18.03  ? 35   TRP A CG   1  
ATOM   497    C CD1  . TRP A 1 35  ? -16.257 5.198  -24.795 0.010 18.98  ? 35   TRP A CD1  1  
ATOM   498    C CD2  . TRP A 1 35  ? -15.552 4.737  -22.721 0.010 18.34  ? 35   TRP A CD2  1  
ATOM   499    N NE1  . TRP A 1 35  ? -16.382 3.837  -24.603 0.010 19.88  ? 35   TRP A NE1  1  
ATOM   500    C CE2  . TRP A 1 35  ? -15.964 3.532  -23.334 0.010 19.50  ? 35   TRP A CE2  1  
ATOM   501    C CE3  . TRP A 1 35  ? -15.078 4.696  -21.414 0.010 17.97  ? 35   TRP A CE3  1  
ATOM   502    C CZ2  . TRP A 1 35  ? -15.905 2.315  -22.681 0.010 20.25  ? 35   TRP A CZ2  1  
ATOM   503    C CZ3  . TRP A 1 35  ? -15.036 3.487  -20.762 0.010 18.73  ? 35   TRP A CZ3  1  
ATOM   504    C CH2  . TRP A 1 35  ? -15.460 2.307  -21.396 0.010 19.85  ? 35   TRP A CH2  1  
ATOM   505    H H    . TRP A 1 35  ? -17.424 8.936  -24.234 0.010 17.49  ? 35   TRP A H    1  
ATOM   506    H HA   . TRP A 1 35  ? -16.782 7.539  -21.999 0.010 17.23  ? 35   TRP A HA   1  
ATOM   507    H HB2  . TRP A 1 35  ? -15.219 7.609  -24.322 0.010 17.09  ? 35   TRP A HB2  1  
ATOM   508    H HB3  . TRP A 1 35  ? -14.602 7.255  -22.910 0.010 16.64  ? 35   TRP A HB3  1  
ATOM   509    H HD1  . TRP A 1 35  ? -16.457 5.647  -25.583 0.010 19.13  ? 35   TRP A HD1  1  
ATOM   510    H HE1  . TRP A 1 35  ? -16.682 3.277  -25.176 0.010 20.68  ? 35   TRP A HE1  1  
ATOM   511    H HE3  . TRP A 1 35  ? -14.803 5.471  -20.985 0.010 17.37  ? 35   TRP A HE3  1  
ATOM   512    H HZ2  . TRP A 1 35  ? -16.194 1.538  -23.096 0.010 21.15  ? 35   TRP A HZ2  1  
ATOM   513    H HZ3  . TRP A 1 35  ? -14.718 3.456  -19.889 0.010 18.62  ? 35   TRP A HZ3  1  
ATOM   514    H HH2  . TRP A 1 35  ? -15.411 1.503  -20.934 0.010 20.46  ? 35   TRP A HH2  1  
ATOM   515    N N    . VAL A 1 36  ? -15.674 9.437  -20.930 0.010 15.99  ? 36   VAL A N    1  
ATOM   516    C CA   . VAL A 1 36  ? -15.073 10.592 -20.272 0.010 15.50  ? 36   VAL A CA   1  
ATOM   517    C C    . VAL A 1 36  ? -13.831 10.099 -19.517 0.010 15.27  ? 36   VAL A C    1  
ATOM   518    O O    . VAL A 1 36  ? -13.872 9.095  -18.852 0.010 15.62  ? 36   VAL A O    1  
ATOM   519    C CB   . VAL A 1 36  ? -16.071 11.276 -19.302 0.010 15.78  ? 36   VAL A CB   1  
ATOM   520    C CG1  . VAL A 1 36  ? -15.379 12.309 -18.407 0.010 15.58  ? 36   VAL A CG1  1  
ATOM   521    C CG2  . VAL A 1 36  ? -17.175 11.940 -20.099 0.010 16.05  ? 36   VAL A CG2  1  
ATOM   522    H H    . VAL A 1 36  ? -15.924 8.831  -20.382 0.010 16.26  ? 36   VAL A H    1  
ATOM   523    H HA   . VAL A 1 36  ? -14.800 11.244 -20.934 0.010 15.29  ? 36   VAL A HA   1  
ATOM   524    H HB   . VAL A 1 36  ? -16.477 10.607 -18.730 0.010 16.12  ? 36   VAL A HB   1  
ATOM   525    H HG11 . VAL A 1 36  ? -14.855 12.900 -18.968 0.010 15.30  ? 36   VAL A HG11 1  
ATOM   526    H HG12 . VAL A 1 36  ? -16.065 12.807 -17.938 0.010 15.87  ? 36   VAL A HG12 1  
ATOM   527    H HG13 . VAL A 1 36  ? -14.806 11.862 -17.769 0.010 15.59  ? 36   VAL A HG13 1  
ATOM   528    H HG21 . VAL A 1 36  ? -17.402 11.380 -20.857 0.010 16.21  ? 36   VAL A HG21 1  
ATOM   529    H HG22 . VAL A 1 36  ? -17.945 12.060 -19.524 0.010 16.38  ? 36   VAL A HG22 1  
ATOM   530    H HG23 . VAL A 1 36  ? -16.866 12.804 -20.405 0.010 15.85  ? 36   VAL A HG23 1  
ATOM   531    N N    . LEU A 1 37  ? -12.731 10.807 -19.694 0.010 14.83  ? 37   LEU A N    1  
ATOM   532    C CA   . LEU A 1 37  ? -11.479 10.532 -18.996 0.010 14.70  ? 37   LEU A CA   1  
ATOM   533    C C    . LEU A 1 37  ? -11.301 11.469 -17.804 0.010 14.81  ? 37   LEU A C    1  
ATOM   534    O O    . LEU A 1 37  ? -11.554 12.673 -17.905 0.010 14.78  ? 37   LEU A O    1  
ATOM   535    C CB   . LEU A 1 37  ? -10.327 10.718 -19.971 0.010 14.34  ? 37   LEU A CB   1  
ATOM   536    C CG   . LEU A 1 37  ? -8.939  10.389 -19.410 0.010 14.26  ? 37   LEU A CG   1  
ATOM   537    C CD1  . LEU A 1 37  ? -8.837  8.911  -19.020 0.010 14.61  ? 37   LEU A CD1  1  
ATOM   538    C CD2  . LEU A 1 37  ? -7.860  10.787 -20.428 0.010 14.00  ? 37   LEU A CD2  1  
ATOM   539    H H    . LEU A 1 37  ? -12.676 11.467 -20.236 0.010 14.69  ? 37   LEU A H    1  
ATOM   540    H HA   . LEU A 1 37  ? -11.466 9.621  -18.673 0.010 14.93  ? 37   LEU A HA   1  
ATOM   541    H HB2  . LEU A 1 37  ? -10.488 10.152 -20.742 0.010 14.43  ? 37   LEU A HB2  1  
ATOM   542    H HB3  . LEU A 1 37  ? -10.316 11.640 -20.259 0.010 14.22  ? 37   LEU A HB3  1  
ATOM   543    H HG   . LEU A 1 37  ? -8.793  10.911 -18.607 0.010 14.32  ? 37   LEU A HG   1  
ATOM   544    H HD11 . LEU A 1 37  ? -9.299  8.383  -19.691 0.010 14.73  ? 37   LEU A HD11 1  
ATOM   545    H HD12 . LEU A 1 37  ? -7.902  8.656  -18.989 0.010 14.58  ? 37   LEU A HD12 1  
ATOM   546    H HD13 . LEU A 1 37  ? -9.239  8.778  -18.148 0.010 14.88  ? 37   LEU A HD13 1  
ATOM   547    H HD21 . LEU A 1 37  ? -8.238  10.777 -21.319 0.010 14.01  ? 37   LEU A HD21 1  
ATOM   548    H HD22 . LEU A 1 37  ? -7.532  11.671 -20.216 0.010 13.92  ? 37   LEU A HD22 1  
ATOM   549    H HD23 . LEU A 1 37  ? -7.123  10.163 -20.373 0.010 14.04  ? 37   LEU A HD23 1  
ATOM   550    N N    . SER A 1 38  ? -10.899 10.900 -16.675 0.010 15.17  ? 38   SER A N    1  
ATOM   551    C CA   . SER A 1 38  ? -10.736 11.637 -15.430 0.010 15.62  ? 38   SER A CA   1  
ATOM   552    C C    . SER A 1 38  ? -9.610  10.961 -14.673 0.010 15.92  ? 38   SER A C    1  
ATOM   553    O O    . SER A 1 38  ? -8.791  10.257 -15.278 0.010 15.61  ? 38   SER A O    1  
ATOM   554    C CB   . SER A 1 38  ? -12.066 11.682 -14.639 0.010 16.22  ? 38   SER A CB   1  
ATOM   555    O OG   . SER A 1 38  ? -11.961 12.426 -13.447 0.010 16.90  ? 38   SER A OG   1  
ATOM   556    H H    . SER A 1 38  ? -10.708 10.070 -16.601 0.010 15.28  ? 38   SER A H    1  
ATOM   557    H HA   . SER A 1 38  ? -10.455 12.548 -15.609 0.010 15.49  ? 38   SER A HA   1  
ATOM   558    H HB2  . SER A 1 38  ? -12.744 12.084 -15.200 0.010 16.04  ? 38   SER A HB2  1  
ATOM   559    H HB3  . SER A 1 38  ? -12.328 10.777 -14.414 0.010 16.47  ? 38   SER A HB3  1  
ATOM   560    H HG   . SER A 1 38  ? -11.664 13.202 -13.616 0.010 16.77  ? 38   SER A HG   1  
ATOM   561    N N    . ALA A 1 39  ? -9.547  11.183 -13.377 0.010 16.69  ? 39   ALA A N    1  
ATOM   562    C CA   . ALA A 1 39  ? -8.475  10.588 -12.603 0.010 17.21  ? 39   ALA A CA   1  
ATOM   563    C C    . ALA A 1 39  ? -9.005  9.531  -11.660 0.010 18.08  ? 39   ALA A C    1  
ATOM   564    O O    . ALA A 1 39  ? -10.061 9.676  -11.058 0.010 18.62  ? 39   ALA A O    1  
ATOM   565    C CB   . ALA A 1 39  ? -7.734  11.628 -11.843 0.010 17.76  ? 39   ALA A CB   1  
ATOM   566    H H    . ALA A 1 39  ? -10.095 11.661 -12.927 0.010 17.02  ? 39   ALA A H    1  
ATOM   567    H HA   . ALA A 1 39  ? -7.837  10.160 -13.188 0.010 16.81  ? 39   ALA A HA   1  
ATOM   568    H HB1  . ALA A 1 39  ? -8.360  12.138 -11.304 0.010 18.22  ? 39   ALA A HB1  1  
ATOM   569    H HB2  . ALA A 1 39  ? -7.090  11.188 -11.266 0.010 18.26  ? 39   ALA A HB2  1  
ATOM   570    H HB3  . ALA A 1 39  ? -7.280  12.209 -12.476 0.010 17.29  ? 39   ALA A HB3  1  
ATOM   571    N N    . ALA A 1 40  ? -8.229  8.466  -11.527 0.010 18.37  ? 40   ALA A N    1  
ATOM   572    C CA   . ALA A 1 40  ? -8.606  7.347  -10.668 0.010 19.40  ? 40   ALA A CA   1  
ATOM   573    C C    . ALA A 1 40  ? -8.840  7.751  -9.203  0.010 20.68  ? 40   ALA A C    1  
ATOM   574    O O    . ALA A 1 40  ? -9.733  7.220  -8.559  0.010 21.55  ? 40   ALA A O    1  
ATOM   575    C CB   . ALA A 1 40  ? -7.542  6.253  -10.740 0.010 19.67  ? 40   ALA A CB   1  
ATOM   576    H H    . ALA A 1 40  ? -7.479  8.365  -11.934 0.010 18.06  ? 40   ALA A H    1  
ATOM   577    H HA   . ALA A 1 40  ? -9.434  6.969  -11.001 0.010 19.29  ? 40   ALA A HA   1  
ATOM   578    H HB1  . ALA A 1 40  ? -6.706  6.606  -10.409 0.010 19.79  ? 40   ALA A HB1  1  
ATOM   579    H HB2  . ALA A 1 40  ? -7.824  5.500  -10.197 0.010 20.49  ? 40   ALA A HB2  1  
ATOM   580    H HB3  . ALA A 1 40  ? -7.432  5.980  -11.662 0.010 19.02  ? 40   ALA A HB3  1  
ATOM   581    N N    . HIS A 1 41  ? -8.048  8.683  -8.683  0.010 20.99  ? 41   HIS A N    1  
ATOM   582    C CA   . HIS A 1 41  ? -8.162  9.040  -7.266  0.010 22.48  ? 41   HIS A CA   1  
ATOM   583    C C    . HIS A 1 41  ? -9.551  9.613  -6.949  0.010 22.78  ? 41   HIS A C    1  
ATOM   584    O O    . HIS A 1 41  ? -9.972  9.642  -5.795  0.010 24.22  ? 41   HIS A O    1  
ATOM   585    C CB   . HIS A 1 41  ? -7.070  10.030 -6.823  0.010 22.81  ? 41   HIS A CB   1  
ATOM   586    C CG   . HIS A 1 41  ? -5.866  9.373  -6.200  0.010 23.73  ? 41   HIS A CG   1  
ATOM   587    N ND1  . HIS A 1 41  ? -4.615  9.966  -6.184  0.010 23.58  ? 41   HIS A ND1  1  
ATOM   588    C CD2  . HIS A 1 41  ? -5.731  8.194  -5.539  0.010 25.02  ? 41   HIS A CD2  1  
ATOM   589    C CE1  . HIS A 1 41  ? -3.761  9.159  -5.577  0.010 24.65  ? 41   HIS A CE1  1  
ATOM   590    N NE2  . HIS A 1 41  ? -4.413  8.082  -5.178  0.010 25.56  ? 41   HIS A NE2  1  
ATOM   591    H H    . HIS A 1 41  ? -7.463  9.130  -9.121  0.010 20.47  ? 41   HIS A H    1  
ATOM   592    H HA   . HIS A 1 41  ? -8.062  8.235  -6.743  0.010 23.30  ? 41   HIS A HA   1  
ATOM   593    H HB2  . HIS A 1 41  ? -6.770  10.544 -7.590  0.010 21.84  ? 41   HIS A HB2  1  
ATOM   594    H HB3  . HIS A 1 41  ? -7.445  10.632 -6.161  0.010 23.55  ? 41   HIS A HB3  1  
ATOM   595    H HD1  . HIS A 1 41  ? -4.417  10.725 -6.536  0.010 22.95  ? 41   HIS A HD1  1  
ATOM   596    H HD2  . HIS A 1 41  ? -6.396  7.563  -5.382  0.010 25.51  ? 41   HIS A HD2  1  
ATOM   597    H HE1  . HIS A 1 41  ? -2.857  9.327  -5.440  0.010 24.85  ? 41   HIS A HE1  1  
ATOM   598    H HE2  . HIS A 1 41  ? -4.072  7.420  -4.751  0.010 26.44  ? 41   HIS A HE2  1  
ATOM   599    N N    . CYS A 1 42  ? -10.245 10.072 -7.985  0.010 21.55  ? 42   CYS A N    1  
ATOM   600    C CA   . CYS A 1 42  ? -11.504 10.749 -7.783  0.010 21.77  ? 42   CYS A CA   1  
ATOM   601    C C    . CYS A 1 42  ? -12.490 9.821  -7.183  0.010 22.70  ? 42   CYS A C    1  
ATOM   602    O O    . CYS A 1 42  ? -13.072 10.087 -6.150  0.010 23.89  ? 42   CYS A O    1  
ATOM   603    C CB   . CYS A 1 42  ? -12.062 11.200 -9.103  0.010 20.39  ? 42   CYS A CB   1  
ATOM   604    S SG   . CYS A 1 42  ? -11.199 12.581 -9.710  0.010 19.69  ? 42   CYS A SG   1  
ATOM   605    H H    . CYS A 1 42  ? -10.014 10.007 -8.809  0.010 20.67  ? 42   CYS A H    1  
ATOM   606    H HA   . CYS A 1 42  ? -11.385 11.515 -7.201  0.010 22.38  ? 42   CYS A HA   1  
ATOM   607    H HB2  . CYS A 1 42  ? -12.001 10.482 -9.749  0.010 19.81  ? 42   CYS A HB2  1  
ATOM   608    H HB3  . CYS A 1 42  ? -12.989 11.452 -8.981  0.010 20.62  ? 42   CYS A HB3  1  
ATOM   609    N N    . LEU A 1 43  ? -12.686 8.742  -7.914  0.010 22.29  ? 43   LEU A N    1  
ATOM   610    C CA   . LEU A 1 43  ? -13.670 7.750  -7.606  0.010 23.12  ? 43   LEU A CA   1  
ATOM   611    C C    . LEU A 1 43  ? -13.027 6.770  -6.655  0.010 24.59  ? 43   LEU A C    1  
ATOM   612    O O    . LEU A 1 43  ? -13.603 5.740  -6.372  0.010 25.71  ? 43   LEU A O    1  
ATOM   613    C CB   . LEU A 1 43  ? -14.098 7.051  -8.912  0.010 22.18  ? 43   LEU A CB   1  
ATOM   614    C CG   . LEU A 1 43  ? -15.381 7.320  -9.703  0.010 21.61  ? 43   LEU A CG   1  
ATOM   615    C CD1  . LEU A 1 43  ? -15.333 8.495  -10.700 0.010 20.28  ? 43   LEU A CD1  1  
ATOM   616    C CD2  . LEU A 1 43  ? -15.654 6.030  -10.441 0.010 21.69  ? 43   LEU A CD2  1  
ATOM   617    H H    . LEU A 1 43  ? -12.237 8.565  -8.624  0.010 21.63  ? 43   LEU A H    1  
ATOM   618    H HA   . LEU A 1 43  ? -14.442 8.151  -7.176  0.010 23.52  ? 43   LEU A HA   1  
ATOM   619    H HB2  . LEU A 1 43  ? -13.385 7.198  -9.551  0.010 21.37  ? 43   LEU A HB2  1  
ATOM   620    H HB3  . LEU A 1 43  ? -14.126 6.100  -8.719  0.010 22.87  ? 43   LEU A HB3  1  
ATOM   621    H HG   . LEU A 1 43  ? -16.110 7.478  -9.083  0.010 22.31  ? 43   LEU A HG   1  
ATOM   622    H HD11 . LEU A 1 43  ? -14.509 8.992  -10.577 0.010 20.04  ? 43   LEU A HD11 1  
ATOM   623    H HD12 . LEU A 1 43  ? -15.382 8.142  -11.598 0.010 19.70  ? 43   LEU A HD12 1  
ATOM   624    H HD13 . LEU A 1 43  ? -16.096 9.070  -10.539 0.010 20.41  ? 43   LEU A HD13 1  
ATOM   625    H HD21 . LEU A 1 43  ? -14.824 5.716  -10.832 0.010 21.64  ? 43   LEU A HD21 1  
ATOM   626    H HD22 . LEU A 1 43  ? -15.985 5.372  -9.809  0.010 22.63  ? 43   LEU A HD22 1  
ATOM   627    H HD23 . LEU A 1 43  ? -16.308 6.190  -11.139 0.010 21.02  ? 43   LEU A HD23 1  
ATOM   628    N N    . GLU A 1 44  ? -11.824 7.056  -6.172  0.010 24.77  ? 44   GLU A N    1  
ATOM   629    C CA   . GLU A 1 44  ? -11.235 6.179  -5.189  0.010 26.36  ? 44   GLU A CA   1  
ATOM   630    C C    . GLU A 1 44  ? -11.909 6.420  -3.844  0.010 28.19  ? 44   GLU A C    1  
ATOM   631    O O    . GLU A 1 44  ? -12.473 7.491  -3.578  0.010 28.29  ? 44   GLU A O    1  
ATOM   632    C CB   . GLU A 1 44  ? -9.709  6.353  -5.020  0.010 26.44  ? 44   GLU A CB   1  
ATOM   633    C CG   . GLU A 1 44  ? -8.898  5.056  -5.314  0.010 26.25  ? 44   GLU A CG   1  
ATOM   634    C CD   . GLU A 1 44  ? -7.689  4.896  -4.417  0.010 27.18  ? 44   GLU A CD   1  
ATOM   635    O OE1  . GLU A 1 44  ? -7.150  3.769  -4.187  0.010 27.77  ? 44   GLU A OE1  1  
ATOM   636    O OE2  . GLU A 1 44  ? -7.272  5.978  -3.964  0.010 27.50  ? 44   GLU A OE2  1  
ATOM   637    H H    . GLU A 1 44  ? -11.335 7.728  -6.387  0.010 24.09  ? 44   GLU A H    1  
ATOM   638    H HA   . GLU A 1 44  ? -11.386 5.257  -5.457  0.010 26.40  ? 44   GLU A HA   1  
ATOM   639    H HB2  . GLU A 1 44  ? -9.396  7.084  -5.573  0.010 25.49  ? 44   GLU A HB2  1  
ATOM   640    H HB3  . GLU A 1 44  ? -9.520  6.617  -4.087  0.010 27.71  ? 44   GLU A HB3  1  
ATOM   641    H HG2  . GLU A 1 44  ? -9.478  4.303  -5.133  0.010 26.94  ? 44   GLU A HG2  1  
ATOM   642    H HG3  . GLU A 1 44  ? -8.601  5.040  -6.238  0.010 24.98  ? 44   GLU A HG3  1  
ATOM   643    N N    . ASP A 1 45  ? -11.788 5.367  -3.039  0.010 29.77  ? 45   ASP A N    1  
ATOM   644    C CA   . ASP A 1 45  ? -12.467 5.077  -1.779  0.010 31.84  ? 45   ASP A CA   1  
ATOM   645    C C    . ASP A 1 45  ? -13.127 3.706  -1.951  0.010 32.08  ? 45   ASP A C    1  
ATOM   646    O O    . ASP A 1 45  ? -12.483 2.763  -2.427  0.010 31.23  ? 45   ASP A O    1  
ATOM   647    C CB   . ASP A 1 45  ? -13.394 6.210  -1.246  0.010 32.17  ? 45   ASP A CB   1  
ATOM   648    C CG   . ASP A 1 45  ? -14.820 6.237  -1.873  0.010 31.22  ? 45   ASP A CG   1  
ATOM   649    O OD1  . ASP A 1 45  ? -15.079 7.021  -2.798  0.010 29.70  ? 45   ASP A OD1  1  
ATOM   650    O OD2  . ASP A 1 45  ? -15.708 5.495  -1.383  0.010 32.22  ? 45   ASP A OD2  1  
ATOM   651    H H    . ASP A 1 45  ? -11.253 4.726  -3.237  0.010 29.76  ? 45   ASP A H    1  
ATOM   652    H HA   . ASP A 1 45  ? -11.780 4.951  -1.105  0.010 33.07  ? 45   ASP A HA   1  
ATOM   653    H HB2  . ASP A 1 45  ? -13.506 6.070  -0.293  0.010 33.82  ? 45   ASP A HB2  1  
ATOM   654    H HB3  . ASP A 1 45  ? -12.976 7.069  -1.384  0.010 31.64  ? 45   ASP A HB3  1  
ATOM   655    N N    . ALA A 1 46  ? -14.378 3.594  -1.529  0.010 33.41  ? 46   ALA A N    1  
ATOM   656    C CA   . ALA A 1 46  ? -15.193 2.430  -1.760  0.010 33.66  ? 46   ALA A CA   1  
ATOM   657    C C    . ALA A 1 46  ? -16.624 2.858  -2.092  0.010 33.39  ? 46   ALA A C    1  
ATOM   658    O O    . ALA A 1 46  ? -16.950 3.278  -3.221  0.010 31.63  ? 46   ALA A O    1  
ATOM   659    C CB   . ALA A 1 46  ? -15.188 1.570  -0.507  0.010 36.17  ? 46   ALA A CB   1  
ATOM   660    H H    . ALA A 1 46  ? -14.775 4.165  -1.037  0.010 34.28  ? 46   ALA A H    1  
ATOM   661    H HA   . ALA A 1 46  ? -14.843 1.915  -2.502  0.010 32.56  ? 46   ALA A HA   1  
ATOM   662    H HB1  . ALA A 1 46  ? -15.298 2.149  0.264   0.010 37.40  ? 46   ALA A HB1  1  
ATOM   663    H HB2  . ALA A 1 46  ? -15.913 0.926  -0.545  0.010 36.48  ? 46   ALA A HB2  1  
ATOM   664    H HB3  . ALA A 1 46  ? -14.337 1.109  -0.443  0.010 36.31  ? 46   ALA A HB3  1  
ATOM   665    N N    . ALA A 1 47  ? -17.445 2.831  -1.052  0.010 35.34  ? 47   ALA A N    1  
ATOM   666    C CA   . ALA A 1 47  ? -18.879 2.688  -1.187  0.010 35.92  ? 47   ALA A CA   1  
ATOM   667    C C    . ALA A 1 47  ? -19.518 3.680  -2.121  0.010 33.99  ? 47   ALA A C    1  
ATOM   668    O O    . ALA A 1 47  ? -19.709 4.838  -1.759  0.010 33.84  ? 47   ALA A O    1  
ATOM   669    C CB   . ALA A 1 47  ? -19.558 2.756  0.199   0.010 38.18  ? 47   ALA A CB   1  
ATOM   670    H H    . ALA A 1 47  ? -17.189 2.909  -0.235  0.010 36.50  ? 47   ALA A H    1  
ATOM   671    H HA   . ALA A 1 47  ? -19.059 1.808  -1.550  0.010 36.42  ? 47   ALA A HA   1  
ATOM   672    H HB1  . ALA A 1 47  ? -19.369 3.622  0.593   0.010 37.80  ? 47   ALA A HB1  1  
ATOM   673    H HB2  . ALA A 1 47  ? -20.516 2.640  0.095   0.010 38.72  ? 47   ALA A HB2  1  
ATOM   674    H HB3  . ALA A 1 47  ? -19.200 2.051  0.762   0.010 39.54  ? 47   ALA A HB3  1  
ATOM   675    N N    . ASP A 1 48  ? -19.861 3.205  -3.318  0.010 32.78  ? 48   ASP A N    1  
ATOM   676    C CA   . ASP A 1 48  ? -20.844 3.877  -4.163  0.010 31.52  ? 48   ASP A CA   1  
ATOM   677    C C    . ASP A 1 48  ? -20.284 5.217  -4.626  0.010 29.91  ? 48   ASP A C    1  
ATOM   678    O O    . ASP A 1 48  ? -19.154 5.576  -4.222  0.010 29.83  ? 48   ASP A O    1  
ATOM   679    C CB   . ASP A 1 48  ? -22.150 4.119  -3.393  0.010 32.99  ? 48   ASP A CB   1  
ATOM   680    C CG   . ASP A 1 48  ? -22.456 3.020  -2.385  0.010 35.39  ? 48   ASP A CG   1  
ATOM   681    O OD1  . ASP A 1 48  ? -23.204 3.278  -1.407  0.010 37.00  ? 48   ASP A OD1  1  
ATOM   682    O OD2  . ASP A 1 48  ? -21.966 1.890  -2.566  0.010 35.84  ? 48   ASP A OD2  1  
ATOM   683    H H    . ASP A 1 48  ? -19.528 2.497  -3.671  0.010 32.77  ? 48   ASP A H    1  
ATOM   684    H HA   . ASP A 1 48  ? -21.044 3.304  -4.917  0.010 30.92  ? 48   ASP A HA   1  
ATOM   685    H HB2  . ASP A 1 48  ? -22.089 4.961  -2.913  0.010 32.98  ? 48   ASP A HB2  1  
ATOM   686    H HB3  . ASP A 1 48  ? -22.882 4.143  -4.025  0.010 32.62  ? 48   ASP A HB3  1  
ATOM   687    N N    . GLY A 1 49  ? -20.995 5.920  -5.522  0.010 28.73  ? 49   GLY A N    1  
ATOM   688    C CA   . GLY A 1 49  ? -22.026 5.363  -6.388  0.010 28.61  ? 49   GLY A CA   1  
ATOM   689    C C    . GLY A 1 49  ? -23.138 6.340  -6.477  0.010 28.45  ? 49   GLY A C    1  
ATOM   690    O O    . GLY A 1 49  ? -23.365 7.052  -5.516  0.010 29.17  ? 49   GLY A O    1  
ATOM   691    H H    . GLY A 1 49  ? -20.894 6.766  -5.634  0.010 28.07  ? 49   GLY A H    1  
ATOM   692    H HA2  . GLY A 1 49  ? -21.685 5.254  -7.285  0.010 27.57  ? 49   GLY A HA2  1  
ATOM   693    H HA3  . GLY A 1 49  ? -22.382 4.525  -6.075  0.010 29.68  ? 49   GLY A HA3  1  
ATOM   694    N N    . LYS A 1 50  ? -23.858 6.317  -7.605  0.010 27.73  ? 50   LYS A N    1  
ATOM   695    C CA   . LYS A 1 50  ? -24.427 7.508  -8.168  0.010 26.90  ? 50   LYS A CA   1  
ATOM   696    C C    . LYS A 1 50  ? -23.200 8.362  -8.414  0.010 25.59  ? 50   LYS A C    1  
ATOM   697    O O    . LYS A 1 50  ? -22.974 9.413  -7.801  0.010 25.67  ? 50   LYS A O    1  
ATOM   698    C CB   . LYS A 1 50  ? -25.463 8.137  -7.281  0.010 28.06  ? 50   LYS A CB   1  
ATOM   699    C CG   . LYS A 1 50  ? -26.571 7.207  -7.010  0.010 29.52  ? 50   LYS A CG   1  
ATOM   700    C CD   . LYS A 1 50  ? -27.474 7.052  -8.213  0.010 29.05  ? 50   LYS A CD   1  
ATOM   701    C CE   . LYS A 1 50  ? -28.082 5.673  -8.223  0.010 30.07  ? 50   LYS A CE   1  
ATOM   702    N NZ   . LYS A 1 50  ? -28.377 5.112  -6.859  0.010 32.08  ? 50   LYS A NZ   1  
ATOM   703    H H    . LYS A 1 50  ? -24.020 5.607  -8.066  0.010 27.84  ? 50   LYS A H    1  
ATOM   704    H HA   . LYS A 1 50  ? -24.837 7.308  -9.027  0.010 26.49  ? 50   LYS A HA   1  
ATOM   705    H HB2  . LYS A 1 50  ? -25.069 8.419  -6.449  0.010 28.57  ? 50   LYS A HB2  1  
ATOM   706    H HB3  . LYS A 1 50  ? -25.826 8.902  -7.743  0.010 27.47  ? 50   LYS A HB3  1  
ATOM   707    H HG2  . LYS A 1 50  ? -26.211 6.342  -6.777  0.010 30.11  ? 50   LYS A HG2  1  
ATOM   708    H HG3  . LYS A 1 50  ? -27.106 7.560  -6.282  0.010 30.38  ? 50   LYS A HG3  1  
ATOM   709    H HD2  . LYS A 1 50  ? -28.204 7.691  -8.155  0.010 29.40  ? 50   LYS A HD2  1  
ATOM   710    H HD3  . LYS A 1 50  ? -26.981 7.186  -9.039  0.010 27.86  ? 50   LYS A HD3  1  
ATOM   711    H HE2  . LYS A 1 50  ? -28.926 5.716  -8.698  0.010 29.93  ? 50   LYS A HE2  1  
ATOM   712    H HE3  . LYS A 1 50  ? -27.473 5.071  -8.679  0.010 29.74  ? 50   LYS A HE3  1  
ATOM   713    H HZ1  . LYS A 1 50  ? -28.920 5.658  -6.410  0.010 32.51  ? 50   LYS A HZ1  1  
ATOM   714    H HZ2  . LYS A 1 50  ? -28.773 4.319  -6.947  0.010 32.78  ? 50   LYS A HZ2  1  
ATOM   715    H HZ3  . LYS A 1 50  ? -27.625 5.002  -6.394  0.010 32.31  ? 50   LYS A HZ3  1  
ATOM   716    N N    . VAL A 1 51  ? -22.365 7.779  -9.252  0.010 24.62  ? 51   VAL A N    1  
ATOM   717    C CA   . VAL A 1 51  ? -21.379 8.507  -9.998  0.010 23.19  ? 51   VAL A CA   1  
ATOM   718    C C    . VAL A 1 51  ? -22.049 8.808  -11.318 0.010 22.35  ? 51   VAL A C    1  
ATOM   719    O O    . VAL A 1 51  ? -22.589 7.931  -11.958 0.010 22.52  ? 51   VAL A O    1  
ATOM   720    C CB   . VAL A 1 51  ? -20.097 7.681  -10.162 0.010 22.83  ? 51   VAL A CB   1  
ATOM   721    C CG1  . VAL A 1 51  ? -19.167 8.298  -11.189 0.010 21.35  ? 51   VAL A CG1  1  
ATOM   722    C CG2  . VAL A 1 51  ? -19.398 7.555  -8.834  0.010 23.75  ? 51   VAL A CG2  1  
ATOM   723    H H    . VAL A 1 51  ? -22.363 6.936  -9.413  0.010 24.88  ? 51   VAL A H    1  
ATOM   724    H HA   . VAL A 1 51  ? -21.167 9.329  -9.544  0.010 23.24  ? 51   VAL A HA   1  
ATOM   725    H HB   . VAL A 1 51  ? -20.330 6.792  -10.468 0.010 23.16  ? 51   VAL A HB   1  
ATOM   726    H HG11 . VAL A 1 51  ? -19.079 9.247  -11.008 0.010 21.09  ? 51   VAL A HG11 1  
ATOM   727    H HG12 . VAL A 1 51  ? -18.301 7.864  -11.129 0.010 21.23  ? 51   VAL A HG12 1  
ATOM   728    H HG13 . VAL A 1 51  ? -19.541 8.147  -12.071 0.010 20.96  ? 51   VAL A HG13 1  
ATOM   729    H HG21 . VAL A 1 51  ? -20.026 7.761  -8.125  0.010 24.70  ? 51   VAL A HG21 1  
ATOM   730    H HG22 . VAL A 1 51  ? -19.082 6.644  -8.746  0.010 23.97  ? 51   VAL A HG22 1  
ATOM   731    H HG23 . VAL A 1 51  ? -18.648 8.169  -8.801  0.010 23.28  ? 51   VAL A HG23 1  
ATOM   732    N N    . GLN A 1 52  ? -22.045 10.077 -11.687 0.010 21.69  ? 52   GLN A N    1  
ATOM   733    C CA   . GLN A 1 52  ? -22.661 10.503 -12.918 0.010 21.10  ? 52   GLN A CA   1  
ATOM   734    C C    . GLN A 1 52  ? -21.774 11.538 -13.528 0.010 20.08  ? 52   GLN A C    1  
ATOM   735    O O    . GLN A 1 52  ? -20.899 12.033 -12.864 0.010 20.00  ? 52   GLN A O    1  
ATOM   736    C CB   . GLN A 1 52  ? -24.026 11.126 -12.627 0.010 21.90  ? 52   GLN A CB   1  
ATOM   737    C CG   . GLN A 1 52  ? -25.041 10.139 -12.082 0.010 23.11  ? 52   GLN A CG   1  
ATOM   738    C CD   . GLN A 1 52  ? -26.304 10.836 -11.602 0.010 24.01  ? 52   GLN A CD   1  
ATOM   739    O OE1  . GLN A 1 52  ? -26.246 11.702 -10.729 0.010 24.44  ? 52   GLN A OE1  1  
ATOM   740    N NE2  . GLN A 1 52  ? -27.440 10.485 -12.195 0.010 24.44  ? 52   GLN A NE2  1  
ATOM   741    H H    . GLN A 1 52  ? -21.692 10.712 -11.233 0.010 21.68  ? 52   GLN A H    1  
ATOM   742    H HA   . GLN A 1 52  ? -22.756 9.768  -13.544 0.010 21.00  ? 52   GLN A HA   1  
ATOM   743    H HB2  . GLN A 1 52  ? -23.913 11.836 -11.977 0.010 22.11  ? 52   GLN A HB2  1  
ATOM   744    H HB3  . GLN A 1 52  ? -24.388 11.491 -13.448 0.010 21.57  ? 52   GLN A HB3  1  
ATOM   745    H HG2  . GLN A 1 52  ? -25.281 9.505  -12.776 0.010 23.03  ? 52   GLN A HG2  1  
ATOM   746    H HG3  . GLN A 1 52  ? -24.657 9.674  -11.323 0.010 23.54  ? 52   GLN A HG3  1  
ATOM   747    H HE21 . GLN A 1 52  ? -27.448 10.301 -13.034 0.010 23.98  ? 52   GLN A HE21 1  
ATOM   748    H HE22 . GLN A 1 52  ? -28.167 10.448 -11.740 0.010 25.24  ? 52   GLN A HE22 1  
ATOM   749    N N    . VAL A 1 53  ? -21.985 11.839 -14.800 0.010 19.49  ? 53   VAL A N    1  
ATOM   750    C CA   . VAL A 1 53  ? -21.287 12.961 -15.398 0.010 18.78  ? 53   VAL A CA   1  
ATOM   751    C C    . VAL A 1 53  ? -22.186 14.002 -16.065 0.010 18.95  ? 53   VAL A C    1  
ATOM   752    O O    . VAL A 1 53  ? -23.113 13.715 -16.808 0.010 19.21  ? 53   VAL A O    1  
ATOM   753    C CB   . VAL A 1 53  ? -20.011 12.585 -16.228 0.010 17.88  ? 53   VAL A CB   1  
ATOM   754    C CG1  . VAL A 1 53  ? -19.674 11.116 -16.188 0.010 17.91  ? 53   VAL A CG1  1  
ATOM   755    C CG2  . VAL A 1 53  ? -19.929 13.225 -17.620 0.010 17.41  ? 53   VAL A CG2  1  
ATOM   756    H H    . VAL A 1 53  ? -22.503 11.408 -15.330 0.010 19.60  ? 53   VAL A H    1  
ATOM   757    H HA   . VAL A 1 53  ? -20.918 13.458 -14.658 0.010 18.92  ? 53   VAL A HA   1  
ATOM   758    H HB   . VAL A 1 53  ? -19.273 13.005 -15.751 0.010 17.73  ? 53   VAL A HB   1  
ATOM   759    H HG11 . VAL A 1 53  ? -19.666 10.833 -15.262 0.010 18.33  ? 53   VAL A HG11 1  
ATOM   760    H HG12 . VAL A 1 53  ? -20.335 10.622 -16.691 0.010 18.14  ? 53   VAL A HG12 1  
ATOM   761    H HG13 . VAL A 1 53  ? -18.797 10.992 -16.578 0.010 17.43  ? 53   VAL A HG13 1  
ATOM   762    H HG21 . VAL A 1 53  ? -20.208 14.152 -17.580 0.010 17.54  ? 53   VAL A HG21 1  
ATOM   763    H HG22 . VAL A 1 53  ? -19.008 13.185 -17.908 0.010 16.94  ? 53   VAL A HG22 1  
ATOM   764    H HG23 . VAL A 1 53  ? -20.482 12.719 -18.234 0.010 17.57  ? 53   VAL A HG23 1  
ATOM   765    N N    . LEU A 1 54  ? -21.861 15.239 -15.724 0.010 18.99  ? 54   LEU A N    1  
ATOM   766    C CA   . LEU A 1 54  ? -22.574 16.386 -16.221 0.010 19.32  ? 54   LEU A CA   1  
ATOM   767    C C    . LEU A 1 54  ? -21.820 16.973 -17.408 0.010 18.70  ? 54   LEU A C    1  
ATOM   768    O O    . LEU A 1 54  ? -20.701 17.461 -17.256 0.010 18.35  ? 54   LEU A O    1  
ATOM   769    C CB   . LEU A 1 54  ? -22.732 17.424 -15.101 0.010 20.07  ? 54   LEU A CB   1  
ATOM   770    C CG   . LEU A 1 54  ? -23.484 18.694 -15.500 0.010 20.63  ? 54   LEU A CG   1  
ATOM   771    C CD1  . LEU A 1 54  ? -24.921 18.350 -15.786 0.010 21.15  ? 54   LEU A CD1  1  
ATOM   772    C CD2  . LEU A 1 54  ? -23.382 19.761 -14.419 0.010 21.51  ? 54   LEU A CD2  1  
ATOM   773    H H    . LEU A 1 54  ? -21.220 15.431 -15.190 0.010 18.93  ? 54   LEU A H    1  
ATOM   774    H HA   . LEU A 1 54  ? -23.451 16.120 -16.525 0.010 19.63  ? 54   LEU A HA   1  
ATOM   775    H HB2  . LEU A 1 54  ? -23.204 17.013 -14.363 0.010 20.57  ? 54   LEU A HB2  1  
ATOM   776    H HB3  . LEU A 1 54  ? -21.855 17.695 -14.807 0.010 19.88  ? 54   LEU A HB3  1  
ATOM   777    H HG   . LEU A 1 54  ? -23.092 19.046 -16.315 0.010 20.23  ? 54   LEU A HG   1  
ATOM   778    H HD11 . LEU A 1 54  ? -25.010 17.394 -15.874 0.010 20.92  ? 54   LEU A HD11 1  
ATOM   779    H HD12 . LEU A 1 54  ? -25.469 18.650 -15.049 0.010 21.86  ? 54   LEU A HD12 1  
ATOM   780    H HD13 . LEU A 1 54  ? -25.187 18.782 -16.612 0.010 21.13  ? 54   LEU A HD13 1  
ATOM   781    H HD21 . LEU A 1 54  ? -22.450 19.966 -14.262 0.010 21.26  ? 54   LEU A HD21 1  
ATOM   782    H HD22 . LEU A 1 54  ? -23.840 20.558 -14.720 0.010 21.93  ? 54   LEU A HD22 1  
ATOM   783    H HD23 . LEU A 1 54  ? -23.783 19.426 -13.606 0.010 22.02  ? 54   LEU A HD23 1  
ATOM   784    N N    . LEU A 1 55  ? -22.458 16.939 -18.571 0.010 18.76  ? 55   LEU A N    1  
ATOM   785    C CA   . LEU A 1 55  ? -21.934 17.535 -19.786 0.010 18.50  ? 55   LEU A CA   1  
ATOM   786    C C    . LEU A 1 55  ? -22.686 18.794 -20.188 0.010 19.21  ? 55   LEU A C    1  
ATOM   787    O O    . LEU A 1 55  ? -23.810 19.000 -19.773 0.010 19.89  ? 55   LEU A O    1  
ATOM   788    C CB   . LEU A 1 55  ? -22.021 16.531 -20.934 0.010 18.32  ? 55   LEU A CB   1  
ATOM   789    C CG   . LEU A 1 55  ? -21.174 15.255 -20.790 0.010 17.74  ? 55   LEU A CG   1  
ATOM   790    C CD1  . LEU A 1 55  ? -21.284 14.409 -22.049 0.010 17.86  ? 55   LEU A CD1  1  
ATOM   791    C CD2  . LEU A 1 55  ? -19.728 15.564 -20.459 0.010 17.08  ? 55   LEU A CD2  1  
ATOM   792    H H    . LEU A 1 55  ? -23.215 16.554 -18.680 0.010 19.08  ? 55   LEU A H    1  
ATOM   793    H HA   . LEU A 1 55  ? -21.008 17.784 -19.660 0.010 18.13  ? 55   LEU A HA   1  
ATOM   794    H HB2  . LEU A 1 55  ? -22.943 16.253 -21.024 0.010 18.78  ? 55   LEU A HB2  1  
ATOM   795    H HB3  . LEU A 1 55  ? -21.739 16.974 -21.747 0.010 18.32  ? 55   LEU A HB3  1  
ATOM   796    H HG   . LEU A 1 55  ? -21.526 14.728 -20.057 0.010 17.88  ? 55   LEU A HG   1  
ATOM   797    H HD11 . LEU A 1 55  ? -22.214 14.352 -22.308 0.010 18.40  ? 55   LEU A HD11 1  
ATOM   798    H HD12 . LEU A 1 55  ? -20.781 14.828 -22.762 0.010 17.75  ? 55   LEU A HD12 1  
ATOM   799    H HD13 . LEU A 1 55  ? -20.934 13.523 -21.872 0.010 17.66  ? 55   LEU A HD13 1  
ATOM   800    H HD21 . LEU A 1 55  ? -19.394 16.229 -21.076 0.010 17.03  ? 55   LEU A HD21 1  
ATOM   801    H HD22 . LEU A 1 55  ? -19.684 15.899 -19.551 0.010 17.15  ? 55   LEU A HD22 1  
ATOM   802    H HD23 . LEU A 1 55  ? -19.201 14.754 -20.537 0.010 16.78  ? 55   LEU A HD23 1  
ATOM   803    N N    . GLY A 1 56  ? -22.056 19.606 -21.025 0.010 19.19  ? 56   GLY A N    1  
ATOM   804    C CA   . GLY A 1 56  ? -22.680 20.805 -21.547 0.010 20.03  ? 56   GLY A CA   1  
ATOM   805    C C    . GLY A 1 56  ? -22.944 21.884 -20.515 0.010 20.68  ? 56   GLY A C    1  
ATOM   806    O O    . GLY A 1 56  ? -23.816 22.724 -20.728 0.010 21.59  ? 56   GLY A O    1  
ATOM   807    H H    . GLY A 1 56  ? -21.263 19.479 -21.306 0.010 18.78  ? 56   GLY A H    1  
ATOM   808    H HA2  . GLY A 1 56  ? -22.117 21.174 -22.239 0.010 20.01  ? 56   GLY A HA2  1  
ATOM   809    H HA3  . GLY A 1 56  ? -23.525 20.572 -21.955 0.010 20.40  ? 56   GLY A HA3  1  
ATOM   810    N N    . ALA A 1 57  ? -22.202 21.876 -19.412 0.010 20.40  ? 57   ALA A N    1  
ATOM   811    C CA   . ALA A 1 57  ? -22.436 22.809 -18.307 0.010 21.24  ? 57   ALA A CA   1  
ATOM   812    C C    . ALA A 1 57  ? -21.452 23.961 -18.309 0.010 21.60  ? 57   ALA A C    1  
ATOM   813    O O    . ALA A 1 57  ? -20.312 23.816 -18.724 0.010 20.97  ? 57   ALA A O    1  
ATOM   814    C CB   . ALA A 1 57  ? -22.341 22.107 -17.004 0.010 21.12  ? 57   ALA A CB   1  
ATOM   815    H H    . ALA A 1 57  ? -21.553 21.337 -19.275 0.010 19.83  ? 57   ALA A H    1  
ATOM   816    H HA   . ALA A 1 57  ? -23.328 23.181 -18.374 0.010 21.87  ? 57   ALA A HA   1  
ATOM   817    H HB1  . ALA A 1 57  ? -21.489 21.653 -16.950 0.010 20.51  ? 57   ALA A HB1  1  
ATOM   818    H HB2  . ALA A 1 57  ? -22.398 22.766 -16.298 0.010 21.80  ? 57   ALA A HB2  1  
ATOM   819    H HB3  . ALA A 1 57  ? -23.068 21.472 -16.922 0.010 21.14  ? 57   ALA A HB3  1  
ATOM   820    N N    . HIS A 1 58  ? -21.923 25.101 -17.821 0.010 22.78  ? 58   HIS A N    1  
ATOM   821    C CA   . HIS A 1 58  ? -21.040 26.177 -17.399 0.010 23.49  ? 58   HIS A CA   1  
ATOM   822    C C    . HIS A 1 58  ? -21.235 26.324 -15.910 0.010 24.26  ? 58   HIS A C    1  
ATOM   823    O O    . HIS A 1 58  ? -20.320 26.125 -15.147 0.010 24.14  ? 58   HIS A O    1  
ATOM   824    C CB   . HIS A 1 58  ? -21.324 27.476 -18.133 0.010 24.59  ? 58   HIS A CB   1  
ATOM   825    C CG   . HIS A 1 58  ? -20.397 28.576 -17.742 0.010 25.54  ? 58   HIS A CG   1  
ATOM   826    N ND1  . HIS A 1 58  ? -19.030 28.401 -17.694 0.010 24.98  ? 58   HIS A ND1  1  
ATOM   827    C CD2  . HIS A 1 58  ? -20.627 29.847 -17.342 0.010 27.16  ? 58   HIS A CD2  1  
ATOM   828    C CE1  . HIS A 1 58  ? -18.459 29.514 -17.284 0.010 26.24  ? 58   HIS A CE1  1  
ATOM   829    N NE2  . HIS A 1 58  ? -19.403 30.415 -17.080 0.010 27.61  ? 58   HIS A NE2  1  
ATOM   830    H H    . HIS A 1 58  ? -22.756 25.275 -17.721 0.010 23.30  ? 58   HIS A H    1  
ATOM   831    H HA   . HIS A 1 58  ? -20.118 25.934 -17.557 0.010 22.90  ? 58   HIS A HA   1  
ATOM   832    H HB2  . HIS A 1 58  ? -21.231 27.332 -19.087 0.010 24.20  ? 58   HIS A HB2  1  
ATOM   833    H HB3  . HIS A 1 58  ? -22.231 27.753 -17.933 0.010 25.25  ? 58   HIS A HB3  1  
ATOM   834    H HD1  . HIS A 1 58  ? -18.616 27.674 -17.888 0.010 24.05  ? 58   HIS A HD1  1  
ATOM   835    H HD2  . HIS A 1 58  ? -21.455 30.264 -17.270 0.010 27.93  ? 58   HIS A HD2  1  
ATOM   836    H HE1  . HIS A 1 58  ? -17.544 29.647 -17.185 0.010 26.25  ? 58   HIS A HE1  1  
ATOM   837    H HE2  . HIS A 1 58  ? -19.276 31.223 -16.812 0.010 28.70  ? 58   HIS A HE2  1  
ATOM   838    N N    . SER A 1 59  ? -22.460 26.630 -15.488 0.010 25.19  ? 59   SER A N    1  
ATOM   839    C CA   . SER A 1 59  ? -22.802 26.629 -14.078 0.010 26.07  ? 59   SER A CA   1  
ATOM   840    C C    . SER A 1 59  ? -23.150 25.239 -13.594 0.010 25.27  ? 59   SER A C    1  
ATOM   841    O O    . SER A 1 59  ? -23.891 24.535 -14.257 0.010 24.63  ? 59   SER A O    1  
ATOM   842    C CB   . SER A 1 59  ? -24.037 27.501 -13.829 0.010 27.55  ? 59   SER A CB   1  
ATOM   843    O OG   . SER A 1 59  ? -24.551 27.263 -12.535 0.010 28.39  ? 59   SER A OG   1  
ATOM   844    H H    . SER A 1 59  ? -23.107 26.843 -16.005 0.010 25.42  ? 59   SER A H    1  
ATOM   845    H HA   . SER A 1 59  ? -22.069 26.976 -13.548 0.010 26.45  ? 59   SER A HA   1  
ATOM   846    H HB2  . SER A 1 59  ? -23.789 28.434 -13.912 0.010 28.34  ? 59   SER A HB2  1  
ATOM   847    H HB3  . SER A 1 59  ? -24.715 27.277 -14.484 0.010 27.25  ? 59   SER A HB3  1  
ATOM   848    H HG   . SER A 1 59  ? -23.970 27.456 -11.950 0.010 28.80  ? 59   SER A HG   1  
ATOM   849    N N    . LEU A 1 60  ? -22.684 24.892 -12.399 0.010 25.61  ? 60   LEU A N    1  
ATOM   850    C CA   . LEU A 1 60  ? -23.020 23.610 -11.789 0.010 25.21  ? 60   LEU A CA   1  
ATOM   851    C C    . LEU A 1 60  ? -24.439 23.597 -11.236 0.010 26.27  ? 60   LEU A C    1  
ATOM   852    O O    . LEU A 1 60  ? -24.992 22.529 -11.020 0.010 26.00  ? 60   LEU A O    1  
ATOM   853    C CB   . LEU A 1 60  ? -22.075 23.298 -10.643 0.010 25.54  ? 60   LEU A CB   1  
ATOM   854    C CG   . LEU A 1 60  ? -20.632 22.975 -11.034 0.010 24.45  ? 60   LEU A CG   1  
ATOM   855    C CD1  . LEU A 1 60  ? -19.813 22.878 -9.784  0.010 25.17  ? 60   LEU A CD1  1  
ATOM   856    C CD2  . LEU A 1 60  ? -20.590 21.716 -11.864 0.010 22.91  ? 60   LEU A CD2  1  
ATOM   857    H H    . LEU A 1 60  ? -22.178 25.387 -11.915 0.010 26.20  ? 60   LEU A H    1  
ATOM   858    H HA   . LEU A 1 60  ? -22.952 22.905 -12.448 0.010 24.22  ? 60   LEU A HA   1  
ATOM   859    H HB2  . LEU A 1 60  ? -22.013 24.098 -10.112 0.010 26.63  ? 60   LEU A HB2  1  
ATOM   860    H HB3  . LEU A 1 60  ? -22.430 22.567 -10.113 0.010 25.56  ? 60   LEU A HB3  1  
ATOM   861    H HG   . LEU A 1 60  ? -20.283 23.700 -11.573 0.010 24.50  ? 60   LEU A HG   1  
ATOM   862    H HD11 . LEU A 1 60  ? -20.280 22.320 -9.144  0.010 25.38  ? 60   LEU A HD11 1  
ATOM   863    H HD12 . LEU A 1 60  ? -18.951 22.493 -10.003 0.010 24.47  ? 60   LEU A HD12 1  
ATOM   864    H HD13 . LEU A 1 60  ? -19.696 23.768 -9.416  0.010 26.24  ? 60   LEU A HD13 1  
ATOM   865    H HD21 . LEU A 1 60  ? -21.092 21.026 -11.405 0.010 22.97  ? 60   LEU A HD21 1  
ATOM   866    H HD22 . LEU A 1 60  ? -20.986 21.892 -12.731 0.010 22.58  ? 60   LEU A HD22 1  
ATOM   867    H HD23 . LEU A 1 60  ? -19.668 21.441 -11.975 0.010 22.34  ? 60   LEU A HD23 1  
ATOM   868    N N    . SER A 1 61  ? -25.000 24.782 -10.989 0.010 27.61  ? 61   SER A N    1  
ATOM   869    C CA   . SER A 1 61  ? -26.288 24.881 -10.273 0.010 28.93  ? 61   SER A CA   1  
ATOM   870    C C    . SER A 1 61  ? -27.444 25.500 -11.070 0.010 29.35  ? 61   SER A C    1  
ATOM   871    O O    . SER A 1 61  ? -28.629 25.250 -10.746 0.010 30.05  ? 61   SER A O    1  
ATOM   872    C CB   . SER A 1 61  ? -26.119 25.627 -8.931  0.010 30.72  ? 61   SER A CB   1  
ATOM   873    O OG   . SER A 1 61  ? -25.809 26.987 -9.129  0.010 31.56  ? 61   SER A OG   1  
ATOM   874    H H    . SER A 1 61  ? -24.665 25.536 -11.223 0.010 27.88  ? 61   SER A H    1  
ATOM   875    H HA   . SER A 1 61  ? -26.576 23.987 -10.044 0.010 28.62  ? 61   SER A HA   1  
ATOM   876    H HB2  . SER A 1 61  ? -26.947 25.571 -8.431  0.010 31.60  ? 61   SER A HB2  1  
ATOM   877    H HB3  . SER A 1 61  ? -25.406 25.215 -8.421  0.010 30.57  ? 61   SER A HB3  1  
ATOM   878    H HG   . SER A 1 61  ? -25.057 27.061 -9.515  0.010 30.85  ? 61   SER A HG   1  
ATOM   879    N N    . GLN A 1 62  ? -27.128 26.291 -12.093 0.010 29.08  ? 62   GLN A N    1  
ATOM   880    C CA   . GLN A 1 62  ? -28.161 27.070 -12.782 0.010 29.88  ? 62   GLN A CA   1  
ATOM   881    C C    . GLN A 1 62  ? -28.673 26.438 -14.086 0.010 28.82  ? 62   GLN A C    1  
ATOM   882    O O    . GLN A 1 62  ? -27.953 25.725 -14.762 0.010 27.44  ? 62   GLN A O    1  
ATOM   883    C CB   . GLN A 1 62  ? -27.682 28.502 -13.026 0.010 30.90  ? 62   GLN A CB   1  
ATOM   884    C CG   . GLN A 1 62  ? -27.671 29.360 -11.766 0.010 32.69  ? 62   GLN A CG   1  
ATOM   885    C CD   . GLN A 1 62  ? -29.088 29.741 -11.293 0.010 34.24  ? 62   GLN A CD   1  
ATOM   886    O OE1  . GLN A 1 62  ? -30.013 28.948 -11.385 0.010 33.81  ? 62   GLN A OE1  1  
ATOM   887    N NE2  . GLN A 1 62  ? -29.244 30.967 -10.806 0.010 36.19  ? 62   GLN A NE2  1  
ATOM   888    H H    . GLN A 1 62  ? -26.339 26.393 -12.409 0.010 28.55  ? 62   GLN A H    1  
ATOM   889    H HA   . GLN A 1 62  ? -28.908 27.117 -12.178 0.010 30.75  ? 62   GLN A HA   1  
ATOM   890    H HB2  . GLN A 1 62  ? -26.780 28.479 -13.377 0.010 30.19  ? 62   GLN A HB2  1  
ATOM   891    H HB3  . GLN A 1 62  ? -28.270 28.925 -13.669 0.010 31.28  ? 62   GLN A HB3  1  
ATOM   892    H HG2  . GLN A 1 62  ? -27.237 28.871 -11.051 0.010 32.47  ? 62   GLN A HG2  1  
ATOM   893    H HG3  . GLN A 1 62  ? -27.183 30.178 -11.947 0.010 33.25  ? 62   GLN A HG3  1  
ATOM   894    H HE21 . GLN A 1 62  ? -28.559 31.462 -10.656 0.010 36.60  ? 62   GLN A HE21 1  
ATOM   895    H HE22 . GLN A 1 62  ? -30.033 31.268 -10.640 0.010 37.14  ? 62   GLN A HE22 1  
ATOM   896    N N    . PRO A 1 63  ? -29.948 26.690 -14.431 0.010 29.64  ? 63   PRO A N    1  
ATOM   897    C CA   . PRO A 1 63  ? -30.503 26.137 -15.665 0.010 28.97  ? 63   PRO A CA   1  
ATOM   898    C C    . PRO A 1 63  ? -29.723 26.519 -16.891 0.010 28.33  ? 63   PRO A C    1  
ATOM   899    O O    . PRO A 1 63  ? -29.358 27.670 -17.059 0.010 29.06  ? 63   PRO A O    1  
ATOM   900    C CB   . PRO A 1 63  ? -31.915 26.772 -15.743 0.010 30.44  ? 63   PRO A CB   1  
ATOM   901    C CG   . PRO A 1 63  ? -32.235 27.117 -14.361 0.010 31.61  ? 63   PRO A CG   1  
ATOM   902    C CD   . PRO A 1 63  ? -30.952 27.487 -13.694 0.010 31.41  ? 63   PRO A CD   1  
ATOM   903    H HA   . PRO A 1 63  ? -30.576 25.175 -15.608 0.010 28.30  ? 63   PRO A HA   1  
ATOM   904    H HB2  . PRO A 1 63  ? -31.902 27.562 -16.303 0.010 30.88  ? 63   PRO A HB2  1  
ATOM   905    H HB3  . PRO A 1 63  ? -32.546 26.120 -16.087 0.010 30.25  ? 63   PRO A HB3  1  
ATOM   906    H HG2  . PRO A 1 63  ? -32.848 27.868 -14.353 0.010 32.71  ? 63   PRO A HG2  1  
ATOM   907    H HG3  . PRO A 1 63  ? -32.632 26.349 -13.923 0.010 31.52  ? 63   PRO A HG3  1  
ATOM   908    H HD2  . PRO A 1 63  ? -30.776 28.434 -13.788 0.010 32.12  ? 63   PRO A HD2  1  
ATOM   909    H HD3  . PRO A 1 63  ? -30.982 27.216 -12.766 0.010 31.78  ? 63   PRO A HD3  1  
ATOM   910    N N    . GLU A 1 64  ? -29.463 25.539 -17.746 0.010 27.15  ? 64   GLU A N    1  
ATOM   911    C CA   . GLU A 1 64  ? -28.879 25.802 -19.036 0.010 26.75  ? 64   GLU A CA   1  
ATOM   912    C C    . GLU A 1 64  ? -29.395 24.763 -20.012 0.010 26.25  ? 64   GLU A C    1  
ATOM   913    O O    . GLU A 1 64  ? -29.483 23.574 -19.661 0.010 25.55  ? 64   GLU A O    1  
ATOM   914    C CB   . GLU A 1 64  ? -27.345 25.744 -18.951 0.010 25.77  ? 64   GLU A CB   1  
ATOM   915    C CG   . GLU A 1 64  ? -26.749 26.655 -17.881 0.010 26.40  ? 64   GLU A CG   1  
ATOM   916    C CD   . GLU A 1 64  ? -25.233 26.457 -17.704 0.010 25.48  ? 64   GLU A CD   1  
ATOM   917    O OE1  . GLU A 1 64  ? -24.699 25.480 -18.270 0.010 24.28  ? 64   GLU A OE1  1  
ATOM   918    O OE2  . GLU A 1 64  ? -24.622 27.256 -16.969 0.010 26.12  ? 64   GLU A OE2  1  
ATOM   919    H H    . GLU A 1 64  ? -29.618 24.711 -17.595 0.010 26.69  ? 64   GLU A H    1  
ATOM   920    H HA   . GLU A 1 64  ? -29.135 26.687 -19.316 0.010 27.60  ? 64   GLU A HA   1  
ATOM   921    H HB2  . GLU A 1 64  ? -27.081 24.835 -18.754 0.010 24.96  ? 64   GLU A HB2  1  
ATOM   922    H HB3  . GLU A 1 64  ? -26.979 26.006 -19.808 0.010 25.66  ? 64   GLU A HB3  1  
ATOM   923    H HG2  . GLU A 1 64  ? -26.900 27.580 -18.124 0.010 27.26  ? 64   GLU A HG2  1  
ATOM   924    H HG3  . GLU A 1 64  ? -27.156 26.461 -17.028 0.010 26.70  ? 64   GLU A HG3  1  
ATOM   925    N N    . PRO A 1 65  ? -29.730 25.197 -21.234 0.010 26.79  ? 65   PRO A N    1  
ATOM   926    C CA   . PRO A 1 65  ? -30.385 24.282 -22.166 0.010 26.76  ? 65   PRO A CA   1  
ATOM   927    C C    . PRO A 1 65  ? -29.501 23.104 -22.547 0.010 25.47  ? 65   PRO A C    1  
ATOM   928    O O    . PRO A 1 65  ? -30.006 22.031 -22.849 0.010 25.32  ? 65   PRO A O    1  
ATOM   929    C CB   . PRO A 1 65  ? -30.687 25.151 -23.391 0.010 27.60  ? 65   PRO A CB   1  
ATOM   930    C CG   . PRO A 1 65  ? -30.579 26.550 -22.936 0.010 28.45  ? 65   PRO A CG   1  
ATOM   931    C CD   . PRO A 1 65  ? -29.633 26.565 -21.786 0.010 27.68  ? 65   PRO A CD   1  
ATOM   932    H HA   . PRO A 1 65  ? -31.220 23.964 -21.791 0.010 27.26  ? 65   PRO A HA   1  
ATOM   933    H HB2  . PRO A 1 65  ? -30.037 24.967 -24.088 0.010 27.05  ? 65   PRO A HB2  1  
ATOM   934    H HB3  . PRO A 1 65  ? -31.589 24.969 -23.700 0.010 28.27  ? 65   PRO A HB3  1  
ATOM   935    H HG2  . PRO A 1 65  ? -30.236 27.096 -23.660 0.010 28.74  ? 65   PRO A HG2  1  
ATOM   936    H HG3  . PRO A 1 65  ? -31.452 26.861 -22.663 0.010 29.33  ? 65   PRO A HG3  1  
ATOM   937    H HD2  . PRO A 1 65  ? -28.735 26.749 -22.094 0.010 27.17  ? 65   PRO A HD2  1  
ATOM   938    H HD3  . PRO A 1 65  ? -29.930 27.225 -21.144 0.010 28.43  ? 65   PRO A HD3  1  
ATOM   939    N N    . SER A 1 66  ? -28.194 23.287 -22.506 0.010 24.67  ? 66   SER A N    1  
ATOM   940    C CA   . SER A 1 66  ? -27.284 22.238 -22.954 0.010 23.61  ? 66   SER A CA   1  
ATOM   941    C C    . SER A 1 66  ? -26.939 21.196 -21.888 0.010 22.68  ? 66   SER A C    1  
ATOM   942    O O    . SER A 1 66  ? -26.347 20.174 -22.220 0.010 21.91  ? 66   SER A O    1  
ATOM   943    C CB   . SER A 1 66  ? -25.976 22.860 -23.486 0.010 23.27  ? 66   SER A CB   1  
ATOM   944    O OG   . SER A 1 66  ? -25.488 23.795 -22.563 0.010 23.34  ? 66   SER A OG   1  
ATOM   945    H H    . SER A 1 66  ? -27.812 24.004 -22.233 0.010 24.80  ? 66   SER A H    1  
ATOM   946    H HA   . SER A 1 66  ? -27.705 21.776 -23.689 0.010 23.87  ? 66   SER A HA   1  
ATOM   947    H HB2  . SER A 1 66  ? -25.313 22.162 -23.593 0.010 22.53  ? 66   SER A HB2  1  
ATOM   948    H HB3  . SER A 1 66  ? -26.128 23.293 -24.338 0.010 23.89  ? 66   SER A HB3  1  
ATOM   949    H HG   . SER A 1 66  ? -25.803 23.640 -21.790 0.010 23.34  ? 66   SER A HG   1  
ATOM   950    N N    . LYS A 1 67  ? -27.246 21.471 -20.624 0.010 22.91  ? 67   LYS A N    1  
ATOM   951    C CA   . LYS A 1 67  ? -26.868 20.583 -19.523 0.010 22.29  ? 67   LYS A CA   1  
ATOM   952    C C    . LYS A 1 67  ? -27.510 19.205 -19.637 0.010 22.22  ? 67   LYS A C    1  
ATOM   953    O O    . LYS A 1 67  ? -28.705 19.070 -19.864 0.010 23.01  ? 67   LYS A O    1  
ATOM   954    C CB   . LYS A 1 67  ? -27.176 21.217 -18.157 0.010 22.91  ? 67   LYS A CB   1  
ATOM   955    C CG   . LYS A 1 67  ? -26.082 22.226 -17.702 0.010 22.86  ? 67   LYS A CG   1  
ATOM   956    C CD   . LYS A 1 67  ? -26.559 23.257 -16.645 0.010 23.98  ? 67   LYS A CD   1  
ATOM   957    C CE   . LYS A 1 67  ? -26.832 22.600 -15.308 0.010 24.12  ? 67   LYS A CE   1  
ATOM   958    N NZ   . LYS A 1 67  ? -26.693 23.502 -14.126 0.010 25.32  ? 67   LYS A NZ   1  
ATOM   959    H H    . LYS A 1 67  ? -27.660 22.178 -20.372 0.010 23.54  ? 67   LYS A H    1  
ATOM   960    H HA   . LYS A 1 67  ? -25.909 20.447 -19.565 0.010 21.64  ? 67   LYS A HA   1  
ATOM   961    H HB2  . LYS A 1 67  ? -28.019 21.687 -18.210 0.010 23.66  ? 67   LYS A HB2  1  
ATOM   962    H HB3  . LYS A 1 67  ? -27.229 20.515 -17.492 0.010 22.75  ? 67   LYS A HB3  1  
ATOM   963    H HG2  . LYS A 1 67  ? -25.348 21.731 -17.314 0.010 22.23  ? 67   LYS A HG2  1  
ATOM   964    H HG3  . LYS A 1 67  ? -25.776 22.714 -18.479 0.010 22.88  ? 67   LYS A HG3  1  
ATOM   965    H HD2  . LYS A 1 67  ? -25.878 23.933 -16.517 0.010 24.12  ? 67   LYS A HD2  1  
ATOM   966    H HD3  . LYS A 1 67  ? -27.382 23.666 -16.951 0.010 24.65  ? 67   LYS A HD3  1  
ATOM   967    H HE2  . LYS A 1 67  ? -27.726 22.238 -15.329 0.010 24.28  ? 67   LYS A HE2  1  
ATOM   968    H HE3  . LYS A 1 67  ? -26.197 21.872 -15.197 0.010 23.42  ? 67   LYS A HE3  1  
ATOM   969    H HZ1  . LYS A 1 67  ? -25.943 23.972 -14.188 0.010 25.31  ? 67   LYS A HZ1  1  
ATOM   970    H HZ2  . LYS A 1 67  ? -27.381 24.058 -14.084 0.010 26.02  ? 67   LYS A HZ2  1  
ATOM   971    H HZ3  . LYS A 1 67  ? -26.670 23.026 -13.376 0.010 25.49  ? 67   LYS A HZ3  1  
ATOM   972    N N    . ARG A 1 68  ? -26.683 18.179 -19.519 0.010 21.39  ? 68   ARG A N    1  
ATOM   973    C CA   . ARG A 1 68  ? -27.197 16.822 -19.540 0.010 21.48  ? 68   ARG A CA   1  
ATOM   974    C C    . ARG A 1 68  ? -26.416 16.002 -18.518 0.010 20.94  ? 68   ARG A C    1  
ATOM   975    O O    . ARG A 1 68  ? -25.193 16.038 -18.512 0.010 20.17  ? 68   ARG A O    1  
ATOM   976    C CB   . ARG A 1 68  ? -27.062 16.235 -20.944 0.010 21.39  ? 68   ARG A CB   1  
ATOM   977    C CG   . ARG A 1 68  ? -28.021 16.803 -22.041 0.010 22.32  ? 68   ARG A CG   1  
ATOM   978    C CD   . ARG A 1 68  ? -27.412 16.761 -23.507 0.010 22.35  ? 68   ARG A CD   1  
ATOM   979    N NE   . ARG A 1 68  ? -26.708 18.022 -23.976 0.010 22.19  ? 68   ARG A NE   1  
ATOM   980    C CZ   . ARG A 1 68  ? -27.343 18.983 -24.654 0.010 23.11  ? 68   ARG A CZ   1  
ATOM   981    N NH1  . ARG A 1 68  ? -28.647 18.819 -24.925 0.010 24.16  ? 68   ARG A NH1  1  
ATOM   982    N NH2  . ARG A 1 68  ? -26.715 20.103 -25.076 0.010 23.17  ? 68   ARG A NH2  1  
ATOM   983    H H    . ARG A 1 68  ? -25.836 18.242 -19.422 0.010 20.87  ? 68   ARG A H    1  
ATOM   984    H HA   . ARG A 1 68  ? -28.131 16.809 -19.283 0.010 22.14  ? 68   ARG A HA   1  
ATOM   985    H HB2  . ARG A 1 68  ? -26.155 16.385 -21.251 0.010 20.82  ? 68   ARG A HB2  1  
ATOM   986    H HB3  . ARG A 1 68  ? -27.232 15.283 -20.882 0.010 21.47  ? 68   ARG A HB3  1  
ATOM   987    H HG2  . ARG A 1 68  ? -28.834 16.270 -22.046 0.010 22.87  ? 68   ARG A HG2  1  
ATOM   988    H HG3  . ARG A 1 68  ? -28.235 17.726 -21.837 0.010 22.57  ? 68   ARG A HG3  1  
ATOM   989    H HD2  . ARG A 1 68  ? -26.820 16.006 -23.549 0.010 21.93  ? 68   ARG A HD2  1  
ATOM   990    H HD3  . ARG A 1 68  ? -28.148 16.585 -24.113 0.010 23.11  ? 68   ARG A HD3  1  
ATOM   991    H HE   . ARG A 1 68  ? -25.861 18.091 -23.875 0.010 21.59  ? 68   ARG A HE   1  
ATOM   992    H HH11 . ARG A 1 68  ? -29.067 18.115 -24.671 0.010 24.26  ? 68   ARG A HH11 1  
ATOM   993    H HH12 . ARG A 1 68  ? -29.066 19.429 -25.365 0.010 24.83  ? 68   ARG A HH12 1  
ATOM   994    H HH21 . ARG A 1 68  ? -25.878 20.226 -24.907 0.010 22.60  ? 68   ARG A HH21 1  
ATOM   995    H HH22 . ARG A 1 68  ? -27.154 20.705 -25.511 0.010 23.88  ? 68   ARG A HH22 1  
ATOM   996    N N    . LEU A 1 69  ? -27.142 15.291 -17.651 0.010 21.53  ? 69   LEU A N    1  
ATOM   997    C CA   . LEU A 1 69  ? -26.531 14.444 -16.630 0.010 21.33  ? 69   LEU A CA   1  
ATOM   998    C C    . LEU A 1 69  ? -26.619 13.020 -17.112 0.010 21.35  ? 69   LEU A C    1  
ATOM   999    O O    . LEU A 1 69  ? -27.710 12.545 -17.393 0.010 22.14  ? 69   LEU A O    1  
ATOM   1000   C CB   . LEU A 1 69  ? -27.313 14.464 -15.332 0.010 22.27  ? 69   LEU A CB   1  
ATOM   1001   C CG   . LEU A 1 69  ? -26.774 14.897 -13.990 0.010 22.47  ? 69   LEU A CG   1  
ATOM   1002   C CD1  . LEU A 1 69  ? -25.302 14.567 -13.751 0.010 21.69  ? 69   LEU A CD1  1  
ATOM   1003   C CD2  . LEU A 1 69  ? -27.004 16.396 -13.931 0.010 22.63  ? 69   LEU A CD2  1  
ATOM   1004   H H    . LEU A 1 69  ? -27.998 15.275 -17.645 0.010 22.13  ? 69   LEU A H    1  
ATOM   1005   H HA   . LEU A 1 69  ? -25.608 14.687 -16.472 0.010 20.78  ? 69   LEU A HA   1  
ATOM   1006   H HB2  . LEU A 1 69  ? -28.097 15.014 -15.486 0.010 22.78  ? 69   LEU A HB2  1  
ATOM   1007   H HB3  . LEU A 1 69  ? -27.602 13.551 -15.184 0.010 22.55  ? 69   LEU A HB3  1  
ATOM   1008   H HG   . LEU A 1 69  ? -27.303 14.483 -13.285 0.010 23.21  ? 69   LEU A HG   1  
ATOM   1009   H HD11 . LEU A 1 69  ? -24.764 14.987 -14.438 0.010 21.01  ? 69   LEU A HD11 1  
ATOM   1010   H HD12 . LEU A 1 69  ? -25.049 14.909 -12.881 0.010 22.02  ? 69   LEU A HD12 1  
ATOM   1011   H HD13 . LEU A 1 69  ? -25.191 13.607 -13.774 0.010 21.71  ? 69   LEU A HD13 1  
ATOM   1012   H HD21 . LEU A 1 69  ? -26.862 16.757 -14.819 0.010 22.29  ? 69   LEU A HD21 1  
ATOM   1013   H HD22 . LEU A 1 69  ? -27.915 16.563 -13.642 0.010 23.44  ? 69   LEU A HD22 1  
ATOM   1014   H HD23 . LEU A 1 69  ? -26.374 16.789 -13.306 0.010 22.40  ? 69   LEU A HD23 1  
ATOM   1015   N N    . TYR A 1 70  ? -25.486 12.346 -17.152 0.010 20.67  ? 70   TYR A N    1  
ATOM   1016   C CA   . TYR A 1 70  ? -25.432 10.982 -17.644 0.010 20.84  ? 70   TYR A CA   1  
ATOM   1017   C C    . TYR A 1 70  ? -25.079 10.056 -16.495 0.010 21.14  ? 70   TYR A C    1  
ATOM   1018   O O    . TYR A 1 70  ? -24.169 10.296 -15.743 0.010 20.75  ? 70   TYR A O    1  
ATOM   1019   C CB   . TYR A 1 70  ? -24.391 10.845 -18.749 0.010 20.07  ? 70   TYR A CB   1  
ATOM   1020   C CG   . TYR A 1 70  ? -24.726 11.607 -20.019 0.010 20.05  ? 70   TYR A CG   1  
ATOM   1021   C CD1  . TYR A 1 70  ? -24.415 12.956 -20.156 0.010 19.60  ? 70   TYR A CD1  1  
ATOM   1022   C CD2  . TYR A 1 70  ? -25.344 10.972 -21.085 0.010 20.72  ? 70   TYR A CD2  1  
ATOM   1023   C CE1  . TYR A 1 70  ? -24.727 13.638 -21.316 0.010 19.80  ? 70   TYR A CE1  1  
ATOM   1024   C CE2  . TYR A 1 70  ? -25.662 11.648 -22.222 0.010 20.95  ? 70   TYR A CE2  1  
ATOM   1025   C CZ   . TYR A 1 70  ? -25.353 12.979 -22.340 0.010 20.48  ? 70   TYR A CZ   1  
ATOM   1026   O OH   . TYR A 1 70  ? -25.695 13.619 -23.496 0.010 20.93  ? 70   TYR A OH   1  
ATOM   1027   H H    . TYR A 1 70  ? -24.735 12.647 -16.876 0.010 20.20  ? 70   TYR A H    1  
ATOM   1028   H HA   . TYR A 1 70  ? -26.293 10.715 -18.003 0.010 21.45  ? 70   TYR A HA   1  
ATOM   1029   H HB2  . TYR A 1 70  ? -23.565 11.214 -18.404 0.010 19.49  ? 70   TYR A HB2  1  
ATOM   1030   H HB3  . TYR A 1 70  ? -24.277 9.909  -18.970 0.010 20.30  ? 70   TYR A HB3  1  
ATOM   1031   H HD1  . TYR A 1 70  ? -23.997 13.400 -19.457 0.010 19.29  ? 70   TYR A HD1  1  
ATOM   1032   H HD2  . TYR A 1 70  ? -25.566 10.074 -21.014 0.010 21.16  ? 70   TYR A HD2  1  
ATOM   1033   H HE1  . TYR A 1 70  ? -24.526 14.540 -21.399 0.010 19.63  ? 70   TYR A HE1  1  
ATOM   1034   H HE2  . TYR A 1 70  ? -26.085 11.205 -22.921 0.010 21.55  ? 70   TYR A HE2  1  
ATOM   1035   H HH   . TYR A 1 70  ? -26.169 13.113 -23.987 0.010 21.48  ? 70   TYR A HH   1  
ATOM   1036   N N    . ASP A 1 71  ? -25.824 8.982  -16.350 0.010 22.06  ? 71   ASP A N    1  
ATOM   1037   C CA   . ASP A 1 71  ? -25.339 7.912  -15.502 0.010 22.48  ? 71   ASP A CA   1  
ATOM   1038   C C    . ASP A 1 71  ? -24.204 7.158  -16.204 0.010 21.87  ? 71   ASP A C    1  
ATOM   1039   O O    . ASP A 1 71  ? -23.990 7.304  -17.407 0.010 21.37  ? 71   ASP A O    1  
ATOM   1040   C CB   . ASP A 1 71  ? -26.493 7.029  -15.076 0.010 23.88  ? 71   ASP A CB   1  
ATOM   1041   C CG   . ASP A 1 71  ? -27.421 7.787  -14.165 0.010 24.53  ? 71   ASP A CG   1  
ATOM   1042   O OD1  . ASP A 1 71  ? -27.312 7.653  -12.932 0.010 25.22  ? 71   ASP A OD1  1  
ATOM   1043   O OD2  . ASP A 1 71  ? -28.151 8.640  -14.692 0.010 24.38  ? 71   ASP A OD2  1  
ATOM   1044   H H    . ASP A 1 71  ? -26.588 8.850  -16.719 0.010 22.54  ? 71   ASP A H    1  
ATOM   1045   H HA   . ASP A 1 71  ? -24.985 8.293  -14.685 0.010 22.39  ? 71   ASP A HA   1  
ATOM   1046   H HB2  . ASP A 1 71  ? -26.983 6.760  -15.869 0.010 24.11  ? 71   ASP A HB2  1  
ATOM   1047   H HB3  . ASP A 1 71  ? -26.165 6.249  -14.610 0.010 24.30  ? 71   ASP A HB3  1  
ATOM   1048   N N    . VAL A 1 72  ? -23.462 6.404  -15.412 0.010 22.04  ? 72   VAL A N    1  
ATOM   1049   C CA   . VAL A 1 72  ? -22.275 5.731  -15.881 0.010 21.55  ? 72   VAL A CA   1  
ATOM   1050   C C    . VAL A 1 72  ? -22.447 4.223  -15.826 0.010 22.66  ? 72   VAL A C    1  
ATOM   1051   O O    . VAL A 1 72  ? -22.740 3.679  -14.779 0.010 23.62  ? 72   VAL A O    1  
ATOM   1052   C CB   . VAL A 1 72  ? -21.124 6.140  -15.015 0.010 21.00  ? 72   VAL A CB   1  
ATOM   1053   C CG1  . VAL A 1 72  ? -19.890 5.345  -15.323 0.010 20.79  ? 72   VAL A CG1  1  
ATOM   1054   C CG2  . VAL A 1 72  ? -20.883 7.630  -15.198 0.010 20.00  ? 72   VAL A CG2  1  
ATOM   1055   H H    . VAL A 1 72  ? -23.624 6.280  -14.579 0.010 22.53  ? 72   VAL A H    1  
ATOM   1056   H HA   . VAL A 1 72  ? -22.072 5.990  -16.791 0.010 21.00  ? 72   VAL A HA   1  
ATOM   1057   H HB   . VAL A 1 72  ? -21.364 5.971  -14.089 0.010 21.64  ? 72   VAL A HB   1  
ATOM   1058   H HG11 . VAL A 1 72  ? -19.979 4.923  -16.191 0.010 20.79  ? 72   VAL A HG11 1  
ATOM   1059   H HG12 . VAL A 1 72  ? -19.134 5.949  -15.329 0.010 20.08  ? 72   VAL A HG12 1  
ATOM   1060   H HG13 . VAL A 1 72  ? -19.770 4.670  -14.638 0.010 21.48  ? 72   VAL A HG13 1  
ATOM   1061   H HG21 . VAL A 1 72  ? -21.688 8.116  -14.970 0.010 20.21  ? 72   VAL A HG21 1  
ATOM   1062   H HG22 . VAL A 1 72  ? -20.159 7.907  -14.618 0.010 19.87  ? 72   VAL A HG22 1  
ATOM   1063   H HG23 . VAL A 1 72  ? -20.656 7.791  -16.125 0.010 19.42  ? 72   VAL A HG23 1  
ATOM   1064   N N    . LEU A 1 73  ? -22.273 3.580  -16.974 0.010 22.72  ? 73   LEU A N    1  
ATOM   1065   C CA   . LEU A 1 73  ? -22.386 2.125  -17.117 0.010 23.97  ? 73   LEU A CA   1  
ATOM   1066   C C    . LEU A 1 73  ? -21.186 1.409  -16.557 0.010 23.99  ? 73   LEU A C    1  
ATOM   1067   O O    . LEU A 1 73  ? -21.290 0.272  -16.109 0.010 25.25  ? 73   LEU A O    1  
ATOM   1068   C CB   . LEU A 1 73  ? -22.477 1.758  -18.590 0.010 24.17  ? 73   LEU A CB   1  
ATOM   1069   C CG   . LEU A 1 73  ? -23.820 1.541  -19.270 0.010 25.23  ? 73   LEU A CG   1  
ATOM   1070   C CD1  . LEU A 1 73  ? -24.990 2.024  -18.460 0.010 25.55  ? 73   LEU A CD1  1  
ATOM   1071   C CD2  . LEU A 1 73  ? -23.774 2.178  -20.634 0.010 24.68  ? 73   LEU A CD2  1  
ATOM   1072   H H    . LEU A 1 73  ? -22.089 3.975  -17.712 0.010 22.17  ? 73   LEU A H    1  
ATOM   1073   H HA   . LEU A 1 73  ? -23.166 1.799  -16.646 0.010 24.86  ? 73   LEU A HA   1  
ATOM   1074   H HB2  . LEU A 1 73  ? -22.033 2.458  -19.093 0.010 23.23  ? 73   LEU A HB2  1  
ATOM   1075   H HB3  . LEU A 1 73  ? -21.979 0.938  -18.716 0.010 24.64  ? 73   LEU A HB3  1  
ATOM   1076   H HG   . LEU A 1 73  ? -23.941 0.586  -19.404 0.010 26.28  ? 73   LEU A HG   1  
ATOM   1077   H HD11 . LEU A 1 73  ? -24.856 2.956  -18.236 0.010 24.62  ? 73   LEU A HD11 1  
ATOM   1078   H HD12 . LEU A 1 73  ? -25.795 1.916  -18.988 0.010 26.15  ? 73   LEU A HD12 1  
ATOM   1079   H HD13 . LEU A 1 73  ? -25.061 1.494  -17.653 0.010 26.23  ? 73   LEU A HD13 1  
ATOM   1080   H HD21 . LEU A 1 73  ? -23.016 1.814  -21.118 0.010 24.54  ? 73   LEU A HD21 1  
ATOM   1081   H HD22 . LEU A 1 73  ? -24.595 1.981  -21.110 0.010 25.52  ? 73   LEU A HD22 1  
ATOM   1082   H HD23 . LEU A 1 73  ? -23.668 3.131  -20.528 0.010 23.77  ? 73   LEU A HD23 1  
ATOM   1083   N N    . ARG A 1 74  ? -20.032 2.057  -16.653 0.010 22.72  ? 74   ARG A N    1  
ATOM   1084   C CA   . ARG A 1 74  ? -18.814 1.446  -16.187 0.010 22.72  ? 74   ARG A CA   1  
ATOM   1085   C C    . ARG A 1 74  ? -17.765 2.465  -15.800 0.010 21.44  ? 74   ARG A C    1  
ATOM   1086   O O    . ARG A 1 74  ? -17.533 3.434  -16.499 0.010 20.39  ? 74   ARG A O    1  
ATOM   1087   C CB   . ARG A 1 74  ? -18.261 0.525  -17.249 0.010 23.06  ? 74   ARG A CB   1  
ATOM   1088   C CG   . ARG A 1 74  ? -16.913 -0.009 -16.850 0.010 22.89  ? 74   ARG A CG   1  
ATOM   1089   C CD   . ARG A 1 74  ? -16.692 -1.339 -17.508 0.010 24.09  ? 74   ARG A CD   1  
ATOM   1090   N NE   . ARG A 1 74  ? -16.392 -1.171 -18.917 0.010 23.75  ? 74   ARG A NE   1  
ATOM   1091   C CZ   . ARG A 1 74  ? -15.270 -1.591 -19.513 0.010 23.45  ? 74   ARG A CZ   1  
ATOM   1092   N NH1  . ARG A 1 74  ? -14.322 -2.233 -18.833 0.010 23.38  ? 74   ARG A NH1  1  
ATOM   1093   N NH2  . ARG A 1 74  ? -15.094 -1.370 -20.807 0.010 23.38  ? 74   ARG A NH2  1  
ATOM   1094   H H    . ARG A 1 74  ? -19.935 2.843  -16.984 0.010 21.94  ? 74   ARG A H    1  
ATOM   1095   H HA   . ARG A 1 74  ? -19.004 0.906  -15.405 0.010 23.54  ? 74   ARG A HA   1  
ATOM   1096   H HB2  . ARG A 1 74  ? -18.867 -0.221 -17.379 0.010 24.13  ? 74   ARG A HB2  1  
ATOM   1097   H HB3  . ARG A 1 74  ? -18.158 1.018  -18.079 0.010 22.50  ? 74   ARG A HB3  1  
ATOM   1098   H HG2  . ARG A 1 74  ? -16.243 0.616  -17.145 0.010 21.93  ? 74   ARG A HG2  1  
ATOM   1099   H HG3  . ARG A 1 74  ? -16.878 -0.123 -15.887 0.010 23.13  ? 74   ARG A HG3  1  
ATOM   1100   H HD2  . ARG A 1 74  ? -15.965 -1.797 -17.062 0.010 24.29  ? 74   ARG A HD2  1  
ATOM   1101   H HD3  . ARG A 1 74  ? -17.502 -1.864 -17.436 0.010 25.09  ? 74   ARG A HD3  1  
ATOM   1102   H HE   . ARG A 1 74  ? -17.020 -0.851 -19.412 0.010 23.99  ? 74   ARG A HE   1  
ATOM   1103   H HH11 . ARG A 1 74  ? -14.406 -2.390 -17.994 0.010 23.55  ? 74   ARG A HH11 1  
ATOM   1104   H HH12 . ARG A 1 74  ? -13.613 -2.495 -19.243 0.010 23.23  ? 74   ARG A HH12 1  
ATOM   1105   H HH21 . ARG A 1 74  ? -15.696 -0.959 -21.262 0.010 23.53  ? 74   ARG A HH21 1  
ATOM   1106   H HH22 . ARG A 1 74  ? -14.378 -1.644 -21.195 0.010 23.26  ? 74   ARG A HH22 1  
ATOM   1107   N N    . ALA A 1 75  ? -17.126 2.199  -14.679 0.010 21.78  ? 75   ALA A N    1  
ATOM   1108   C CA   . ALA A 1 75  ? -15.990 2.990  -14.235 0.010 20.89  ? 75   ALA A CA   1  
ATOM   1109   C C    . ALA A 1 75  ? -14.766 2.090  -14.355 0.010 21.05  ? 75   ALA A C    1  
ATOM   1110   O O    . ALA A 1 75  ? -14.730 1.004  -13.786 0.010 22.21  ? 75   ALA A O    1  
ATOM   1111   C CB   . ALA A 1 75  ? -16.185 3.444  -12.820 0.010 21.41  ? 75   ALA A CB   1  
ATOM   1112   H H    . ALA A 1 75  ? -17.328 1.554  -14.151 0.010 22.64  ? 75   ALA A H    1  
ATOM   1113   H HA   . ALA A 1 75  ? -15.867 3.767  -14.798 0.010 20.04  ? 75   ALA A HA   1  
ATOM   1114   H HB1  . ALA A 1 75  ? -16.451 2.689  -12.275 0.010 22.40  ? 75   ALA A HB1  1  
ATOM   1115   H HB2  . ALA A 1 75  ? -15.349 3.805  -12.492 0.010 21.04  ? 75   ALA A HB2  1  
ATOM   1116   H HB3  . ALA A 1 75  ? -16.868 4.129  -12.807 0.010 21.27  ? 75   ALA A HB3  1  
ATOM   1117   N N    . VAL A 1 76  ? -13.793 2.541  -15.135 0.010 20.01  ? 76   VAL A N    1  
ATOM   1118   C CA   . VAL A 1 76  ? -12.597 1.772  -15.423 0.010 20.12  ? 76   VAL A CA   1  
ATOM   1119   C C    . VAL A 1 76  ? -11.332 2.561  -15.018 0.010 19.38  ? 76   VAL A C    1  
ATOM   1120   O O    . VAL A 1 76  ? -10.767 3.305  -15.820 0.010 18.39  ? 76   VAL A O    1  
ATOM   1121   C CB   . VAL A 1 76  ? -12.499 1.395  -16.903 0.010 19.86  ? 76   VAL A CB   1  
ATOM   1122   C CG1  . VAL A 1 76  ? -11.298 0.448  -17.120 0.010 20.25  ? 76   VAL A CG1  1  
ATOM   1123   C CG2  . VAL A 1 76  ? -13.766 0.787  -17.377 0.010 20.66  ? 76   VAL A CG2  1  
ATOM   1124   H H    . VAL A 1 76  ? -13.806 3.310  -15.515 0.010 19.30  ? 76   VAL A H    1  
ATOM   1125   H HA   . VAL A 1 76  ? -12.615 0.937  -14.938 0.010 21.02  ? 76   VAL A HA   1  
ATOM   1126   H HB   . VAL A 1 76  ? -12.354 2.195  -17.427 0.010 19.04  ? 76   VAL A HB   1  
ATOM   1127   H HG11 . VAL A 1 76  ? -11.213 -0.136 -16.350 0.010 21.00  ? 76   VAL A HG11 1  
ATOM   1128   H HG12 . VAL A 1 76  ? -11.438 -0.084 -17.920 0.010 20.56  ? 76   VAL A HG12 1  
ATOM   1129   H HG13 . VAL A 1 76  ? -10.496 0.988  -17.214 0.010 19.57  ? 76   VAL A HG13 1  
ATOM   1130   H HG21 . VAL A 1 76  ? -14.112 0.199  -16.690 0.010 21.55  ? 76   VAL A HG21 1  
ATOM   1131   H HG22 . VAL A 1 76  ? -14.386 1.509  -17.557 0.010 20.29  ? 76   VAL A HG22 1  
ATOM   1132   H HG23 . VAL A 1 76  ? -13.606 0.282  -18.188 0.010 20.78  ? 76   VAL A HG23 1  
ATOM   1133   N N    . PRO A 1 77  ? -10.906 2.394  -13.761 0.010 20.05  ? 77   PRO A N    1  
ATOM   1134   C CA   . PRO A 1 77  ? -9.667  2.983  -13.254 0.010 19.70  ? 77   PRO A CA   1  
ATOM   1135   C C    . PRO A 1 77  ? -8.510  2.213  -13.870 0.010 19.68  ? 77   PRO A C    1  
ATOM   1136   O O    . PRO A 1 77  ? -8.640  1.006  -14.078 0.010 20.47  ? 77   PRO A O    1  
ATOM   1137   C CB   . PRO A 1 77  ? -9.745  2.727  -11.740 0.010 20.91  ? 77   PRO A CB   1  
ATOM   1138   C CG   . PRO A 1 77  ? -10.694 1.640  -11.580 0.010 21.99  ? 77   PRO A CG   1  
ATOM   1139   C CD   . PRO A 1 77  ? -11.596 1.589  -12.738 0.010 21.41  ? 77   PRO A CD   1  
ATOM   1140   H HA   . PRO A 1 77  ? -9.602  3.929  -13.449 0.010 18.97  ? 77   PRO A HA   1  
ATOM   1141   H HB2  . PRO A 1 77  ? -8.874  2.464  -11.407 0.010 21.20  ? 77   PRO A HB2  1  
ATOM   1142   H HB3  . PRO A 1 77  ? -10.056 3.520  -11.280 0.010 20.82  ? 77   PRO A HB3  1  
ATOM   1143   H HG2  . PRO A 1 77  ? -10.213 0.803  -11.497 0.010 22.55  ? 77   PRO A HG2  1  
ATOM   1144   H HG3  . PRO A 1 77  ? -11.214 1.801  -10.779 0.010 22.66  ? 77   PRO A HG3  1  
ATOM   1145   H HD2  . PRO A 1 77  ? -11.696 0.676  -13.039 0.010 22.00  ? 77   PRO A HD2  1  
ATOM   1146   H HD3  . PRO A 1 77  ? -12.451 1.983  -12.514 0.010 21.44  ? 77   PRO A HD3  1  
ATOM   1147   N N    . HIS A 1 78  ? -7.420  2.883  -14.180 0.010 18.94  ? 78   HIS A N    1  
ATOM   1148   C CA   . HIS A 1 78  ? -6.279  2.172  -14.718 0.010 19.05  ? 78   HIS A CA   1  
ATOM   1149   C C    . HIS A 1 78  ? -5.932  1.024  -13.744 0.010 20.41  ? 78   HIS A C    1  
ATOM   1150   O O    . HIS A 1 78  ? -5.859  1.224  -12.548 0.010 21.01  ? 78   HIS A O    1  
ATOM   1151   C CB   . HIS A 1 78  ? -5.089  3.089  -14.902 0.010 18.31  ? 78   HIS A CB   1  
ATOM   1152   C CG   . HIS A 1 78  ? -3.948  2.409  -15.579 0.010 18.39  ? 78   HIS A CG   1  
ATOM   1153   N ND1  . HIS A 1 78  ? -3.129  1.545  -14.907 0.010 19.32  ? 78   HIS A ND1  1  
ATOM   1154   C CD2  . HIS A 1 78  ? -3.510  2.429  -16.855 0.010 17.84  ? 78   HIS A CD2  1  
ATOM   1155   C CE1  . HIS A 1 78  ? -2.218  1.065  -15.730 0.010 19.28  ? 78   HIS A CE1  1  
ATOM   1156   N NE2  . HIS A 1 78  ? -2.423  1.597  -16.920 0.010 18.40  ? 78   HIS A NE2  1  
ATOM   1157   H H    . HIS A 1 78  ? -7.311  3.724  -14.088 0.010 18.48  ? 78   HIS A H    1  
ATOM   1158   H HA   . HIS A 1 78  ? -6.505  1.821  -15.590 0.010 18.90  ? 78   HIS A HA   1  
ATOM   1159   H HB2  . HIS A 1 78  ? -5.345  3.861  -15.430 0.010 17.60  ? 78   HIS A HB2  1  
ATOM   1160   H HB3  . HIS A 1 78  ? -4.783  3.379  -14.029 0.010 18.63  ? 78   HIS A HB3  1  
ATOM   1161   H HD1  . HIS A 1 78  ? -3.212  1.384  -14.081 0.010 19.89  ? 78   HIS A HD1  1  
ATOM   1162   H HD2  . HIS A 1 78  ? -3.870  2.925  -17.554 0.010 17.29  ? 78   HIS A HD2  1  
ATOM   1163   H HE1  . HIS A 1 78  ? -1.542  0.474  -15.504 0.010 19.86  ? 78   HIS A HE1  1  
ATOM   1164   H HE2  . HIS A 1 78  ? -1.961  1.440  -17.624 0.010 18.29  ? 78   HIS A HE2  1  
ATOM   1165   N N    . PRO A 1 79  ? -5.742  -0.184 -14.264 0.010 21.10  ? 79   PRO A N    1  
ATOM   1166   C CA   . PRO A 1 79  ? -5.385  -1.302 -13.373 0.010 22.60  ? 79   PRO A CA   1  
ATOM   1167   C C    . PRO A 1 79  ? -4.219  -1.054 -12.394 0.010 23.02  ? 79   PRO A C    1  
ATOM   1168   O O    . PRO A 1 79  ? -4.232  -1.582 -11.292 0.010 24.35  ? 79   PRO A O    1  
ATOM   1169   C CB   . PRO A 1 79  ? -5.007  -2.424 -14.353 0.010 23.05  ? 79   PRO A CB   1  
ATOM   1170   C CG   . PRO A 1 79  ? -5.766  -2.148 -15.575 0.010 22.32  ? 79   PRO A CG   1  
ATOM   1171   C CD   . PRO A 1 79  ? -5.850  -0.608 -15.667 0.010 20.79  ? 79   PRO A CD   1  
ATOM   1172   H HA   . PRO A 1 79  ? -6.158  -1.580 -12.861 0.010 23.26  ? 79   PRO A HA   1  
ATOM   1173   H HB2  . PRO A 1 79  ? -4.054  -2.402 -14.527 0.010 22.77  ? 79   PRO A HB2  1  
ATOM   1174   H HB3  . PRO A 1 79  ? -5.268  -3.280 -13.981 0.010 24.18  ? 79   PRO A HB3  1  
ATOM   1175   H HG2  . PRO A 1 79  ? -5.287  -2.508 -16.338 0.010 22.39  ? 79   PRO A HG2  1  
ATOM   1176   H HG3  . PRO A 1 79  ? -6.650  -2.545 -15.503 0.010 22.85  ? 79   PRO A HG3  1  
ATOM   1177   H HD2  . PRO A 1 79  ? -5.108  -0.263 -16.181 0.010 20.27  ? 79   PRO A HD2  1  
ATOM   1178   H HD3  . PRO A 1 79  ? -6.696  -0.338 -16.047 0.010 20.42  ? 79   PRO A HD3  1  
ATOM   1179   N N    . ASP A 1 80  ? -3.193  -0.334 -12.827 0.010 22.10  ? 80   ASP A N    1  
ATOM   1180   C CA   . ASP A 1 80  ? -2.012  -0.080 -11.970 0.010 22.63  ? 80   ASP A CA   1  
ATOM   1181   C C    . ASP A 1 80  ? -2.124  1.152  -11.079 0.010 22.37  ? 80   ASP A C    1  
ATOM   1182   O O    . ASP A 1 80  ? -1.153  1.505  -10.427 0.010 22.79  ? 80   ASP A O    1  
ATOM   1183   C CB   . ASP A 1 80  ? -0.712  -0.023 -12.796 0.010 22.18  ? 80   ASP A CB   1  
ATOM   1184   C CG   . ASP A 1 80  ? -0.412  -1.337 -13.478 0.010 22.99  ? 80   ASP A CG   1  
ATOM   1185   O OD1  . ASP A 1 80  ? -0.356  -2.376 -12.759 0.010 24.47  ? 80   ASP A OD1  1  
ATOM   1186   O OD2  . ASP A 1 80  ? -0.297  -1.322 -14.725 0.010 22.31  ? 80   ASP A OD2  1  
ATOM   1187   H H    . ASP A 1 80  ? -3.116  -0.083 -13.624 0.010 21.32  ? 80   ASP A H    1  
ATOM   1188   H HA   . ASP A 1 80  ? -1.908  -0.838 -11.371 0.010 23.75  ? 80   ASP A HA   1  
ATOM   1189   H HB2  . ASP A 1 80  ? -0.787  0.659  -13.478 0.010 21.18  ? 80   ASP A HB2  1  
ATOM   1190   H HB3  . ASP A 1 80  ? 0.028   0.185  -12.208 0.010 22.49  ? 80   ASP A HB3  1  
ATOM   1191   N N    . SER A 1 81  ? -3.302  1.789  -11.023 0.010 21.87  ? 81   SER A N    1  
ATOM   1192   C CA   . SER A 1 81  ? -3.510  2.896  -10.103 0.010 21.96  ? 81   SER A CA   1  
ATOM   1193   C C    . SER A 1 81  ? -3.508  2.401  -8.680  0.010 23.67  ? 81   SER A C    1  
ATOM   1194   O O    . SER A 1 81  ? -3.938  1.280  -8.414  0.010 24.62  ? 81   SER A O    1  
ATOM   1195   C CB   . SER A 1 81  ? -4.830  3.640  -10.385 0.010 21.11  ? 81   SER A CB   1  
ATOM   1196   O OG   . SER A 1 81  ? -5.927  2.772  -10.347 0.010 21.63  ? 81   SER A OG   1  
ATOM   1197   H H    . SER A 1 81  ? -3.986  1.601  -11.507 0.010 21.57  ? 81   SER A H    1  
ATOM   1198   H HA   . SER A 1 81  ? -2.782  3.527  -10.199 0.010 21.63  ? 81   SER A HA   1  
ATOM   1199   H HB2  . SER A 1 81  ? -4.951  4.323  -9.710  0.010 21.27  ? 81   SER A HB2  1  
ATOM   1200   H HB3  . SER A 1 81  ? -4.791  4.054  -11.260 0.010 20.15  ? 81   SER A HB3  1  
ATOM   1201   H HG   . SER A 1 81  ? -6.577  3.108  -10.776 0.010 21.03  ? 81   SER A HG   1  
ATOM   1202   N N    . GLN A 1 82  ? -3.027  3.252  -7.777  0.010 24.24  ? 82   GLN A N    1  
ATOM   1203   C CA   . GLN A 1 82  ? -2.835  2.909  -6.362  0.010 26.15  ? 82   GLN A CA   1  
ATOM   1204   C C    . GLN A 1 82  ? -3.210  4.117  -5.539  0.010 26.51  ? 82   GLN A C    1  
ATOM   1205   O O    . GLN A 1 82  ? -2.904  5.240  -5.915  0.010 25.58  ? 82   GLN A O    1  
ATOM   1206   C CB   . GLN A 1 82  ? -1.368  2.586  -6.066  0.010 27.01  ? 82   GLN A CB   1  
ATOM   1207   C CG   . GLN A 1 82  ? -0.987  1.177  -5.728  0.010 28.17  ? 82   GLN A CG   1  
ATOM   1208   C CD   . GLN A 1 82  ? -1.643  0.152  -6.594  0.010 27.47  ? 82   GLN A CD   1  
ATOM   1209   O OE1  . GLN A 1 82  ? -1.188  -0.139 -7.705  0.010 26.26  ? 82   GLN A OE1  1  
ATOM   1210   N NE2  . GLN A 1 82  ? -2.742  -0.409 -6.100  0.010 28.47  ? 82   GLN A NE2  1  
ATOM   1211   H H    . GLN A 1 82  ? -2.788  4.053  -7.965  0.010 23.66  ? 82   GLN A H    1  
ATOM   1212   H HA   . GLN A 1 82  ? -3.391  2.153  -6.122  0.010 26.81  ? 82   GLN A HA   1  
ATOM   1213   H HB2  . GLN A 1 82  ? -0.841  2.841  -6.830  0.010 26.03  ? 82   GLN A HB2  1  
ATOM   1214   H HB3  . GLN A 1 82  ? -1.114  3.100  -5.289  0.010 27.95  ? 82   GLN A HB3  1  
ATOM   1215   H HG2  . GLN A 1 82  ? -0.030  1.095  -5.837  0.010 28.25  ? 82   GLN A HG2  1  
ATOM   1216   H HG3  . GLN A 1 82  ? -1.230  0.999  -4.808  0.010 29.53  ? 82   GLN A HG3  1  
ATOM   1217   H HE21 . GLN A 1 82  ? -3.052  -0.145 -5.345  0.010 29.31  ? 82   GLN A HE21 1  
ATOM   1218   H HE22 . GLN A 1 82  ? -3.145  -1.029 -6.535  0.010 28.36  ? 82   GLN A HE22 1  
ATOM   1219   N N    . PRO A 1 83  ? -3.847  3.889  -4.385  0.010 28.13  ? 83   PRO A N    1  
ATOM   1220   C CA   . PRO A 1 83  ? -4.235  5.017  -3.532  0.010 28.76  ? 83   PRO A CA   1  
ATOM   1221   C C    . PRO A 1 83  ? -3.067  5.853  -3.055  0.010 29.45  ? 83   PRO A C    1  
ATOM   1222   O O    . PRO A 1 83  ? -3.268  7.050  -2.838  0.010 29.44  ? 83   PRO A O    1  
ATOM   1223   C CB   . PRO A 1 83  ? -4.868  4.338  -2.321  0.010 30.75  ? 83   PRO A CB   1  
ATOM   1224   C CG   . PRO A 1 83  ? -4.335  2.948  -2.328  0.010 31.61  ? 83   PRO A CG   1  
ATOM   1225   C CD   . PRO A 1 83  ? -4.220  2.602  -3.785  0.010 29.72  ? 83   PRO A CD   1  
ATOM   1226   H HA   . PRO A 1 83  ? -4.878  5.582  -3.983  0.010 27.73  ? 83   PRO A HA   1  
ATOM   1227   H HB2  . PRO A 1 83  ? -4.584  4.797  -1.516  0.010 31.89  ? 83   PRO A HB2  1  
ATOM   1228   H HB3  . PRO A 1 83  ? -5.830  4.349  -2.390  0.010 30.43  ? 83   PRO A HB3  1  
ATOM   1229   H HG2  . PRO A 1 83  ? -3.463  2.932  -1.901  0.010 32.60  ? 83   PRO A HG2  1  
ATOM   1230   H HG3  . PRO A 1 83  ? -4.953  2.353  -1.875  0.010 32.49  ? 83   PRO A HG3  1  
ATOM   1231   H HD2  . PRO A 1 83  ? -3.521  1.945  -3.921  0.010 30.14  ? 83   PRO A HD2  1  
ATOM   1232   H HD3  . PRO A 1 83  ? -5.071  2.297  -4.133  0.010 29.30  ? 83   PRO A HD3  1  
ATOM   1233   N N    . ASP A 1 84  ? -1.895  5.232  -2.905  0.010 30.13  ? 84   ASP A N    1  
ATOM   1234   C CA   . ASP A 1 84  ? -0.751  5.853  -2.215  0.010 31.44  ? 84   ASP A CA   1  
ATOM   1235   C C    . ASP A 1 84  ? 0.390   6.288  -3.165  0.010 30.14  ? 84   ASP A C    1  
ATOM   1236   O O    . ASP A 1 84  ? 1.575   6.259  -2.787  0.010 31.17  ? 84   ASP A O    1  
ATOM   1237   C CB   . ASP A 1 84  ? -0.193  4.908  -1.127  0.010 33.43  ? 84   ASP A CB   1  
ATOM   1238   C CG   . ASP A 1 84  ? -1.095  4.817  0.135   0.010 35.78  ? 84   ASP A CG   1  
ATOM   1239   O OD1  . ASP A 1 84  ? -2.339  4.766  -0.006  0.010 35.78  ? 84   ASP A OD1  1  
ATOM   1240   O OD2  . ASP A 1 84  ? -0.551  4.764  1.275   0.010 37.84  ? 84   ASP A OD2  1  
ATOM   1241   H H    . ASP A 1 84  ? -1.736  4.441  -3.200  0.010 29.93  ? 84   ASP A H    1  
ATOM   1242   H HA   . ASP A 1 84  ? -1.067  6.654  -1.767  0.010 32.16  ? 84   ASP A HA   1  
ATOM   1243   H HB2  . ASP A 1 84  ? -0.105  4.018  -1.505  0.010 32.93  ? 84   ASP A HB2  1  
ATOM   1244   H HB3  . ASP A 1 84  ? 0.675   5.227  -0.837  0.010 33.90  ? 84   ASP A HB3  1  
ATOM   1245   N N    . THR A 1 85  ? 0.003   6.769  -4.345  0.010 28.06  ? 85   THR A N    1  
ATOM   1246   C CA   . THR A 1 85  ? 0.901   7.000  -5.473  0.010 26.70  ? 85   THR A CA   1  
ATOM   1247   C C    . THR A 1 85  ? 0.176   7.909  -6.494  0.010 24.95  ? 85   THR A C    1  
ATOM   1248   O O    . THR A 1 85  ? -1.035  7.809  -6.642  0.010 24.48  ? 85   THR A O    1  
ATOM   1249   C CB   . THR A 1 85  ? 1.167   5.660  -6.163  0.010 26.13  ? 85   THR A CB   1  
ATOM   1250   O OG1  . THR A 1 85  ? -0.055  4.947  -6.142  0.010 25.79  ? 85   THR A OG1  1  
ATOM   1251   C CG2  . THR A 1 85  ? 2.259   4.796  -5.438  0.010 27.83  ? 85   THR A CG2  1  
ATOM   1252   H H    . THR A 1 85  ? -0.813  6.974  -4.524  0.010 27.49  ? 85   THR A H    1  
ATOM   1253   H HA   . THR A 1 85  ? 1.735   7.406  -5.187  0.010 27.33  ? 85   THR A HA   1  
ATOM   1254   H HB   . THR A 1 85  ? 1.442   5.804  -7.083  0.010 25.07  ? 85   THR A HB   1  
ATOM   1255   H HG1  . THR A 1 85  ? -0.360  4.891  -5.352  0.010 26.84  ? 85   THR A HG1  1  
ATOM   1256   H HG21 . THR A 1 85  ? 2.611   5.258  -4.665  0.010 28.94  ? 85   THR A HG21 1  
ATOM   1257   H HG22 . THR A 1 85  ? 1.876   3.952  -5.155  0.010 28.33  ? 85   THR A HG22 1  
ATOM   1258   H HG23 . THR A 1 85  ? 2.995   4.614  -6.044  0.010 27.42  ? 85   THR A HG23 1  
ATOM   1259   N N    . ILE A 1 86  ? 0.889   8.790  -7.195  0.010 24.10  ? 86   ILE A N    1  
ATOM   1260   C CA   . ILE A 1 86  ? 0.246   9.573  -8.258  0.010 22.61  ? 86   ILE A CA   1  
ATOM   1261   C C    . ILE A 1 86  ? 0.522   8.958  -9.652  0.010 21.15  ? 86   ILE A C    1  
ATOM   1262   O O    . ILE A 1 86  ? 0.440   9.612  -10.674 0.010 20.04  ? 86   ILE A O    1  
ATOM   1263   C CB   . ILE A 1 86  ? 0.597   11.068 -8.179  0.010 22.96  ? 86   ILE A CB   1  
ATOM   1264   C CG1  . ILE A 1 86  ? 2.104   11.285 -8.240  0.010 23.52  ? 86   ILE A CG1  1  
ATOM   1265   C CG2  . ILE A 1 86  ? 0.001   11.649 -6.892  0.010 24.49  ? 86   ILE A CG2  1  
ATOM   1266   C CD1  . ILE A 1 86  ? 2.498   12.650 -8.868  0.010 23.38  ? 86   ILE A CD1  1  
ATOM   1267   H H    . ILE A 1 86  ? 1.723   8.952  -7.084  0.010 24.44  ? 86   ILE A H    1  
ATOM   1268   H HA   . ILE A 1 86  ? -0.715  9.541  -8.138  0.010 22.50  ? 86   ILE A HA   1  
ATOM   1269   H HB   . ILE A 1 86  ? 0.190   11.521 -8.933  0.010 22.04  ? 86   ILE A HB   1  
ATOM   1270   H HG12 . ILE A 1 86  ? 2.448   11.268 -7.333  0.010 24.77  ? 86   ILE A HG12 1  
ATOM   1271   H HG13 . ILE A 1 86  ? 2.519   10.576 -8.758  0.010 22.92  ? 86   ILE A HG13 1  
ATOM   1272   H HG21 . ILE A 1 86  ? 0.249   11.086 -6.142  0.010 25.51  ? 86   ILE A HG21 1  
ATOM   1273   H HG22 . ILE A 1 86  ? 0.344   12.547 -6.758  0.010 24.90  ? 86   ILE A HG22 1  
ATOM   1274   H HG23 . ILE A 1 86  ? -0.966  11.673 -6.978  0.010 24.14  ? 86   ILE A HG23 1  
ATOM   1275   H HD11 . ILE A 1 86  ? 1.836   12.897 -9.532  0.010 22.34  ? 86   ILE A HD11 1  
ATOM   1276   H HD12 . ILE A 1 86  ? 2.526   13.322 -8.172  0.010 24.35  ? 86   ILE A HD12 1  
ATOM   1277   H HD13 . ILE A 1 86  ? 3.371   12.566 -9.279  0.010 23.49  ? 86   ILE A HD13 1  
ATOM   1278   N N    . ASP A 1 87  ? 0.841   7.671  -9.665  0.010 21.37  ? 87   ASP A N    1  
ATOM   1279   C CA   . ASP A 1 87  ? 1.146   6.972  -10.904 0.010 20.33  ? 87   ASP A CA   1  
ATOM   1280   C C    . ASP A 1 87  ? -0.114  6.350  -11.528 0.010 19.64  ? 87   ASP A C    1  
ATOM   1281   O O    . ASP A 1 87  ? -0.955  5.854  -10.812 0.010 20.27  ? 87   ASP A O    1  
ATOM   1282   C CB   . ASP A 1 87  ? 2.185   5.871  -10.582 0.010 21.19  ? 87   ASP A CB   1  
ATOM   1283   C CG   . ASP A 1 87  ? 3.441   6.437  -9.921  0.010 22.10  ? 87   ASP A CG   1  
ATOM   1284   O OD1  . ASP A 1 87  ? 3.906   7.509  -10.366 0.010 21.60  ? 87   ASP A OD1  1  
ATOM   1285   O OD2  . ASP A 1 87  ? 3.967   5.818  -8.958  0.010 23.47  ? 87   ASP A OD2  1  
ATOM   1286   H H    . ASP A 1 87  ? 0.892   7.176  -8.965  0.010 22.23  ? 87   ASP A H    1  
ATOM   1287   H HA   . ASP A 1 87  ? 1.531   7.586  -11.546 0.010 19.72  ? 87   ASP A HA   1  
ATOM   1288   H HB2  . ASP A 1 87  ? 1.786   5.230  -9.976  0.010 21.87  ? 87   ASP A HB2  1  
ATOM   1289   H HB3  . ASP A 1 87  ? 2.447   5.431  -11.402 0.010 20.63  ? 87   ASP A HB3  1  
ATOM   1290   N N    . HIS A 1 88  ? -0.209  6.366  -12.856 0.010 18.54  ? 88   HIS A N    1  
ATOM   1291   C CA   . HIS A 1 88  ? -1.261  5.668  -13.580 0.010 18.07  ? 88   HIS A CA   1  
ATOM   1292   C C    . HIS A 1 88  ? -2.667  6.131  -13.135 0.010 18.02  ? 88   HIS A C    1  
ATOM   1293   O O    . HIS A 1 88  ? -3.584  5.334  -13.046 0.010 18.31  ? 88   HIS A O    1  
ATOM   1294   C CB   . HIS A 1 88  ? -1.122  4.155  -13.376 0.010 18.88  ? 88   HIS A CB   1  
ATOM   1295   C CG   . HIS A 1 88  ? 0.295   3.685  -13.373 0.010 19.34  ? 88   HIS A CG   1  
ATOM   1296   N ND1  . HIS A 1 88  ? 1.184   3.980  -14.388 0.010 18.70  ? 88   HIS A ND1  1  
ATOM   1297   C CD2  . HIS A 1 88  ? 0.992   2.978  -12.455 0.010 20.52  ? 88   HIS A CD2  1  
ATOM   1298   C CE1  . HIS A 1 88  ? 2.361   3.442  -14.108 0.010 19.41  ? 88   HIS A CE1  1  
ATOM   1299   N NE2  . HIS A 1 88  ? 2.272   2.831  -12.936 0.010 20.52  ? 88   HIS A NE2  1  
ATOM   1300   H H    . HIS A 1 88  ? 0.337   6.779  -13.368 0.010 18.15  ? 88   HIS A H    1  
ATOM   1301   H HA   . HIS A 1 88  ? -1.166  5.853  -14.526 0.010 17.41  ? 88   HIS A HA   1  
ATOM   1302   H HB2  . HIS A 1 88  ? -1.515  3.910  -12.525 0.010 19.57  ? 88   HIS A HB2  1  
ATOM   1303   H HB3  . HIS A 1 88  ? -1.585  3.700  -14.095 0.010 18.58  ? 88   HIS A HB3  1  
ATOM   1304   H HD1  . HIS A 1 88  ? 0.999   4.419  -15.101 0.010 18.04  ? 88   HIS A HD1  1  
ATOM   1305   H HD2  . HIS A 1 88  ? 0.665   2.639  -11.653 0.010 21.29  ? 88   HIS A HD2  1  
ATOM   1306   H HE1  . HIS A 1 88  ? 3.121   3.492  -14.638 0.010 19.25  ? 88   HIS A HE1  1  
ATOM   1307   H HE2  . HIS A 1 88  ? 2.905   2.412  -12.539 0.010 21.22  ? 88   HIS A HE2  1  
ATOM   1308   N N    . ASP A 1 89  ? -2.794  7.426  -12.847 0.010 17.80  ? 89   ASP A N    1  
ATOM   1309   C CA   . ASP A 1 89  ? -3.971  7.956  -12.135 0.010 18.09  ? 89   ASP A CA   1  
ATOM   1310   C C    . ASP A 1 89  ? -5.015  8.388  -13.138 0.010 17.18  ? 89   ASP A C    1  
ATOM   1311   O O    . ASP A 1 89  ? -5.386  9.578  -13.209 0.010 16.91  ? 89   ASP A O    1  
ATOM   1312   C CB   . ASP A 1 89  ? -3.557  9.136  -11.230 0.010 18.68  ? 89   ASP A CB   1  
ATOM   1313   C CG   . ASP A 1 89  ? -4.714  9.697  -10.394 0.010 19.26  ? 89   ASP A CG   1  
ATOM   1314   O OD1  . ASP A 1 89  ? -5.649  8.925  -10.054 0.010 19.58  ? 89   ASP A OD1  1  
ATOM   1315   O OD2  . ASP A 1 89  ? -4.665  10.912 -10.055 0.010 19.56  ? 89   ASP A OD2  1  
ATOM   1316   H H    . ASP A 1 89  ? -2.215  8.021  -13.056 0.010 17.58  ? 89   ASP A H    1  
ATOM   1317   H HA   . ASP A 1 89  ? -4.354  7.261  -11.576 0.010 18.69  ? 89   ASP A HA   1  
ATOM   1318   H HB2  . ASP A 1 89  ? -2.870  8.838  -10.620 0.010 19.37  ? 89   ASP A HB2  1  
ATOM   1319   H HB3  . ASP A 1 89  ? -3.211  9.845  -11.793 0.010 18.17  ? 89   ASP A HB3  1  
ATOM   1320   N N    . LEU A 1 90  ? -5.471  7.423  -13.935 0.010 16.87  ? 90   LEU A N    1  
ATOM   1321   C CA   . LEU A 1 90  ? -6.479  7.675  -14.946 0.010 16.22  ? 90   LEU A CA   1  
ATOM   1322   C C    . LEU A 1 90  ? -7.726  6.851  -14.716 0.010 16.66  ? 90   LEU A C    1  
ATOM   1323   O O    . LEU A 1 90  ? -7.683  5.796  -14.105 0.010 17.42  ? 90   LEU A O    1  
ATOM   1324   C CB   . LEU A 1 90  ? -5.958  7.389  -16.346 0.010 15.63  ? 90   LEU A CB   1  
ATOM   1325   C CG   . LEU A 1 90  ? -4.797  8.265  -16.836 0.010 15.20  ? 90   LEU A CG   1  
ATOM   1326   C CD1  . LEU A 1 90  ? -4.368  7.829  -18.198 0.010 14.87  ? 90   LEU A CD1  1  
ATOM   1327   C CD2  . LEU A 1 90  ? -5.206  9.742  -16.868 0.010 14.91  ? 90   LEU A CD2  1  
ATOM   1328   H H    . LEU A 1 90  ? -5.206  6.609  -13.906 0.010 17.16  ? 90   LEU A H    1  
ATOM   1329   H HA   . LEU A 1 90  ? -6.741  8.606  -14.913 0.010 16.00  ? 90   LEU A HA   1  
ATOM   1330   H HB2  . LEU A 1 90  ? -5.666  6.467  -16.383 0.010 15.93  ? 90   LEU A HB2  1  
ATOM   1331   H HB3  . LEU A 1 90  ? -6.688  7.511  -16.971 0.010 15.37  ? 90   LEU A HB3  1  
ATOM   1332   H HG   . LEU A 1 90  ? -4.050  8.162  -16.233 0.010 15.52  ? 90   LEU A HG   1  
ATOM   1333   H HD11 . LEU A 1 90  ? -4.747  6.956  -18.384 0.010 14.99  ? 90   LEU A HD11 1  
ATOM   1334   H HD12 . LEU A 1 90  ? -4.694  8.466  -18.852 0.010 14.53  ? 90   LEU A HD12 1  
ATOM   1335   H HD13 . LEU A 1 90  ? -3.403  7.777  -18.231 0.010 15.01  ? 90   LEU A HD13 1  
ATOM   1336   H HD21 . LEU A 1 90  ? -6.002  9.843  -17.407 0.010 14.71  ? 90   LEU A HD21 1  
ATOM   1337   H HD22 . LEU A 1 90  ? -5.377  10.033 -15.964 0.010 15.27  ? 90   LEU A HD22 1  
ATOM   1338   H HD23 . LEU A 1 90  ? -4.487  10.262 -17.250 0.010 14.71  ? 90   LEU A HD23 1  
ATOM   1339   N N    . LEU A 1 91  ? -8.826  7.353  -15.261 0.010 16.30  ? 91   LEU A N    1  
ATOM   1340   C CA   . LEU A 1 91  ? -10.142 6.788  -15.022 0.010 16.80  ? 91   LEU A CA   1  
ATOM   1341   C C    . LEU A 1 91  ? -11.011 7.027  -16.251 0.010 16.32  ? 91   LEU A C    1  
ATOM   1342   O O    . LEU A 1 91  ? -11.161 8.156  -16.696 0.010 15.80  ? 91   LEU A O    1  
ATOM   1343   C CB   . LEU A 1 91  ? -10.762 7.460  -13.797 0.010 17.30  ? 91   LEU A CB   1  
ATOM   1344   C CG   . LEU A 1 91  ? -12.243 7.148  -13.558 0.010 17.83  ? 91   LEU A CG   1  
ATOM   1345   C CD1  . LEU A 1 91  ? -12.409 5.775  -12.977 0.010 18.81  ? 91   LEU A CD1  1  
ATOM   1346   C CD2  . LEU A 1 91  ? -12.873 8.179  -12.647 0.010 18.20  ? 91   LEU A CD2  1  
ATOM   1347   H H    . LEU A 1 91  ? -8.829  8.024  -15.790 0.010 15.85  ? 91   LEU A H    1  
ATOM   1348   H HA   . LEU A 1 91  ? -10.080 5.837  -14.859 0.010 17.27  ? 91   LEU A HA   1  
ATOM   1349   H HB2  . LEU A 1 91  ? -10.269 7.178  -13.013 0.010 17.82  ? 91   LEU A HB2  1  
ATOM   1350   H HB3  . LEU A 1 91  ? -10.672 8.419  -13.899 0.010 16.92  ? 91   LEU A HB3  1  
ATOM   1351   H HG   . LEU A 1 91  ? -12.732 7.179  -14.395 0.010 17.45  ? 91   LEU A HG   1  
ATOM   1352   H HD11 . LEU A 1 91  ? -11.825 5.155  -13.439 0.010 18.67  ? 91   LEU A HD11 1  
ATOM   1353   H HD12 . LEU A 1 91  ? -12.181 5.798  -12.036 0.010 19.36  ? 91   LEU A HD12 1  
ATOM   1354   H HD13 . LEU A 1 91  ? -13.331 5.501  -13.089 0.010 19.15  ? 91   LEU A HD13 1  
ATOM   1355   H HD21 . LEU A 1 91  ? -12.374 9.008  -12.702 0.010 17.84  ? 91   LEU A HD21 1  
ATOM   1356   H HD22 . LEU A 1 91  ? -13.779 8.331  -12.953 0.010 18.18  ? 91   LEU A HD22 1  
ATOM   1357   H HD23 . LEU A 1 91  ? -12.876 7.847  -11.737 0.010 18.96  ? 91   LEU A HD23 1  
ATOM   1358   N N    . LEU A 1 92  ? -11.534 5.961  -16.824 0.010 16.70  ? 92   LEU A N    1  
ATOM   1359   C CA   . LEU A 1 92  ? -12.450 6.096  -17.943 0.010 16.55  ? 92   LEU A CA   1  
ATOM   1360   C C    . LEU A 1 92  ? -13.847 5.749  -17.444 0.010 17.24  ? 92   LEU A C    1  
ATOM   1361   O O    . LEU A 1 92  ? -14.030 4.787  -16.715 0.010 18.04  ? 92   LEU A O    1  
ATOM   1362   C CB   . LEU A 1 92  ? -12.024 5.226  -19.135 0.010 16.68  ? 92   LEU A CB   1  
ATOM   1363   C CG   . LEU A 1 92  ? -10.933 5.815  -20.040 0.010 16.01  ? 92   LEU A CG   1  
ATOM   1364   C CD1  . LEU A 1 92  ? -10.327 4.739  -20.923 0.010 16.44  ? 92   LEU A CD1  1  
ATOM   1365   C CD2  . LEU A 1 92  ? -11.449 6.937  -20.918 0.010 15.59  ? 92   LEU A CD2  1  
ATOM   1366   H H    . LEU A 1 92  ? -11.381 5.155  -16.586 0.010 17.16  ? 92   LEU A H    1  
ATOM   1367   H HA   . LEU A 1 92  ? -12.472 7.009  -18.257 0.010 16.07  ? 92   LEU A HA   1  
ATOM   1368   H HB2  . LEU A 1 92  ? -11.698 4.378  -18.795 0.010 17.12  ? 92   LEU A HB2  1  
ATOM   1369   H HB3  . LEU A 1 92  ? -12.805 5.071  -19.689 0.010 16.95  ? 92   LEU A HB3  1  
ATOM   1370   H HG   . LEU A 1 92  ? -10.229 6.170  -19.483 0.010 15.74  ? 92   LEU A HG   1  
ATOM   1371   H HD11 . LEU A 1 92  ? -10.023 4.005  -20.368 0.010 16.73  ? 92   LEU A HD11 1  
ATOM   1372   H HD12 . LEU A 1 92  ? -10.994 4.420  -21.547 0.010 16.91  ? 92   LEU A HD12 1  
ATOM   1373   H HD13 . LEU A 1 92  ? -9.581  5.120  -21.409 0.010 16.11  ? 92   LEU A HD13 1  
ATOM   1374   H HD21 . LEU A 1 92  ? -11.748 7.661  -20.350 0.010 15.39  ? 92   LEU A HD21 1  
ATOM   1375   H HD22 . LEU A 1 92  ? -10.737 7.234  -21.500 0.010 15.32  ? 92   LEU A HD22 1  
ATOM   1376   H HD23 . LEU A 1 92  ? -12.185 6.618  -21.458 0.010 15.95  ? 92   LEU A HD23 1  
ATOM   1377   N N    . LEU A 1 93  ? -14.800 6.593  -17.817 0.010 17.04  ? 93   LEU A N    1  
ATOM   1378   C CA   . LEU A 1 93  ? -16.195 6.456  -17.426 0.010 17.70  ? 93   LEU A CA   1  
ATOM   1379   C C    . LEU A 1 93  ? -17.017 6.280  -18.697 0.010 17.89  ? 93   LEU A C    1  
ATOM   1380   O O    . LEU A 1 93  ? -17.000 7.140  -19.567 0.010 17.38  ? 93   LEU A O    1  
ATOM   1381   C CB   . LEU A 1 93  ? -16.643 7.726  -16.667 0.010 17.51  ? 93   LEU A CB   1  
ATOM   1382   C CG   . LEU A 1 93  ? -15.881 7.990  -15.362 0.010 17.63  ? 93   LEU A CG   1  
ATOM   1383   C CD1  . LEU A 1 93  ? -16.164 9.372  -14.822 0.010 17.56  ? 93   LEU A CD1  1  
ATOM   1384   C CD2  . LEU A 1 93  ? -16.155 6.915  -14.298 0.010 18.66  ? 93   LEU A CD2  1  
ATOM   1385   H H    . LEU A 1 93  ? -14.656 7.271  -18.318 0.010 16.59  ? 93   LEU A H    1  
ATOM   1386   H HA   . LEU A 1 93  ? -16.325 5.687  -16.855 0.010 18.30  ? 93   LEU A HA   1  
ATOM   1387   H HB2  . LEU A 1 93  ? -16.508 8.489  -17.244 0.010 16.99  ? 93   LEU A HB2  1  
ATOM   1388   H HB3  . LEU A 1 93  ? -17.583 7.645  -16.453 0.010 17.96  ? 93   LEU A HB3  1  
ATOM   1389   H HG   . LEU A 1 93  ? -14.931 7.955  -15.555 0.010 17.25  ? 93   LEU A HG   1  
ATOM   1390   H HD11 . LEU A 1 93  ? -17.114 9.556  -14.890 0.010 17.86  ? 93   LEU A HD11 1  
ATOM   1391   H HD12 . LEU A 1 93  ? -15.882 9.406  -13.893 0.010 17.91  ? 93   LEU A HD12 1  
ATOM   1392   H HD13 . LEU A 1 93  ? -15.662 10.020 -15.340 0.010 17.00  ? 93   LEU A HD13 1  
ATOM   1393   H HD21 . LEU A 1 93  ? -15.866 6.059  -14.641 0.010 18.79  ? 93   LEU A HD21 1  
ATOM   1394   H HD22 . LEU A 1 93  ? -15.666 7.114  -13.489 0.010 18.85  ? 93   LEU A HD22 1  
ATOM   1395   H HD23 . LEU A 1 93  ? -17.104 6.895  -14.114 0.010 19.12  ? 93   LEU A HD23 1  
ATOM   1396   N N    . GLN A 1 94  ? -17.726 5.153  -18.813 0.010 18.84  ? 94   GLN A N    1  
ATOM   1397   C CA   . GLN A 1 94  ? -18.598 4.914  -19.943 0.010 19.35  ? 94   GLN A CA   1  
ATOM   1398   C C    . GLN A 1 94  ? -20.007 5.473  -19.652 0.010 19.75  ? 94   GLN A C    1  
ATOM   1399   O O    . GLN A 1 94  ? -20.638 5.094  -18.683 0.010 20.41  ? 94   GLN A O    1  
ATOM   1400   C CB   . GLN A 1 94  ? -18.685 3.409  -20.243 0.010 20.44  ? 94   GLN A CB   1  
ATOM   1401   C CG   . GLN A 1 94  ? -19.116 3.157  -21.656 0.010 20.98  ? 94   GLN A CG   1  
ATOM   1402   C CD   . GLN A 1 94  ? -19.358 1.698  -21.949 0.010 22.37  ? 94   GLN A CD   1  
ATOM   1403   O OE1  . GLN A 1 94  ? -18.981 0.828  -21.163 0.010 22.86  ? 94   GLN A OE1  1  
ATOM   1404   N NE2  . GLN A 1 94  ? -19.966 1.418  -23.101 0.010 23.23  ? 94   GLN A NE2  1  
ATOM   1405   H H    . GLN A 1 94  ? -17.716 4.512  -18.244 0.010 19.31  ? 94   GLN A H    1  
ATOM   1406   H HA   . GLN A 1 94  ? -18.245 5.346  -20.734 0.010 18.92  ? 94   GLN A HA   1  
ATOM   1407   H HB2  . GLN A 1 94  ? -17.817 3.001  -20.121 0.010 20.30  ? 94   GLN A HB2  1  
ATOM   1408   H HB3  . GLN A 1 94  ? -19.323 3.000  -19.643 0.010 21.10  ? 94   GLN A HB3  1  
ATOM   1409   H HG2  . GLN A 1 94  ? -19.934 3.647  -21.834 0.010 21.13  ? 94   GLN A HG2  1  
ATOM   1410   H HG3  . GLN A 1 94  ? -18.418 3.464  -22.251 0.010 20.45  ? 94   GLN A HG3  1  
ATOM   1411   H HE21 . GLN A 1 94  ? -19.746 1.845  -23.815 0.010 22.91  ? 94   GLN A HE21 1  
ATOM   1412   H HE22 . GLN A 1 94  ? -20.576 0.814  -23.135 0.010 24.20  ? 94   GLN A HE22 1  
ATOM   1413   N N    . LEU A 1 95  ? -20.466 6.402  -20.480 0.010 19.46  ? 95   LEU A N    1  
ATOM   1414   C CA   . LEU A 1 95  ? -21.778 7.016  -20.255 0.010 19.90  ? 95   LEU A CA   1  
ATOM   1415   C C    . LEU A 1 95  ? -22.899 6.048  -20.623 0.010 21.18  ? 95   LEU A C    1  
ATOM   1416   O O    . LEU A 1 95  ? -22.724 5.177  -21.460 0.010 21.70  ? 95   LEU A O    1  
ATOM   1417   C CB   . LEU A 1 95  ? -21.912 8.292  -21.076 0.010 19.45  ? 95   LEU A CB   1  
ATOM   1418   C CG   . LEU A 1 95  ? -20.926 9.409  -20.713 0.010 18.41  ? 95   LEU A CG   1  
ATOM   1419   C CD1  . LEU A 1 95  ? -21.150 10.569 -21.648 0.010 18.29  ? 95   LEU A CD1  1  
ATOM   1420   C CD2  . LEU A 1 95  ? -21.096 9.823  -19.250 0.010 18.28  ? 95   LEU A CD2  1  
ATOM   1421   H H    . LEU A 1 95  ? -20.049 6.694  -21.172 0.010 19.10  ? 95   LEU A H    1  
ATOM   1422   H HA   . LEU A 1 95  ? -21.873 7.243  -19.319 0.010 19.84  ? 95   LEU A HA   1  
ATOM   1423   H HB2  . LEU A 1 95  ? -21.780 8.071  -22.010 0.010 19.66  ? 95   LEU A HB2  1  
ATOM   1424   H HB3  . LEU A 1 95  ? -22.811 8.642  -20.954 0.010 19.81  ? 95   LEU A HB3  1  
ATOM   1425   H HG   . LEU A 1 95  ? -20.021 9.091  -20.834 0.010 18.07  ? 95   LEU A HG   1  
ATOM   1426   H HD11 . LEU A 1 95  ? -21.403 10.244 -22.523 0.010 18.71  ? 95   LEU A HD11 1  
ATOM   1427   H HD12 . LEU A 1 95  ? -21.847 11.134 -21.285 0.010 18.48  ? 95   LEU A HD12 1  
ATOM   1428   H HD13 . LEU A 1 95  ? -20.320 11.065 -21.713 0.010 17.74  ? 95   LEU A HD13 1  
ATOM   1429   H HD21 . LEU A 1 95  ? -20.996 9.052  -18.675 0.010 18.44  ? 95   LEU A HD21 1  
ATOM   1430   H HD22 . LEU A 1 95  ? -20.417 10.479 -19.029 0.010 17.76  ? 95   LEU A HD22 1  
ATOM   1431   H HD23 . LEU A 1 95  ? -21.968 10.205 -19.136 0.010 18.69  ? 95   LEU A HD23 1  
ATOM   1432   N N    . SER A 1 96  ? -24.056 6.229  -19.984 0.010 21.82  ? 96   SER A N    1  
ATOM   1433   C CA   . SER A 1 96  ? -25.234 5.428  -20.270 0.010 23.20  ? 96   SER A CA   1  
ATOM   1434   C C    . SER A 1 96  ? -25.652 5.388  -21.747 0.010 23.76  ? 96   SER A C    1  
ATOM   1435   O O    . SER A 1 96  ? -26.279 4.432  -22.197 0.010 25.04  ? 96   SER A O    1  
ATOM   1436   C CB   . SER A 1 96  ? -26.399 5.936  -19.428 0.010 23.77  ? 96   SER A CB   1  
ATOM   1437   O OG   . SER A 1 96  ? -26.655 7.287  -19.722 0.010 23.14  ? 96   SER A OG   1  
ATOM   1438   H H    . SER A 1 96  ? -24.178 6.807  -19.362 0.010 21.57  ? 96   SER A H    1  
ATOM   1439   H HA   . SER A 1 96  ? -25.063 4.519  -19.992 0.010 23.66  ? 96   SER A HA   1  
ATOM   1440   H HB2  . SER A 1 96  ? -27.187 5.406  -19.622 0.010 24.74  ? 96   SER A HB2  1  
ATOM   1441   H HB3  . SER A 1 96  ? -26.169 5.858  -18.489 0.010 23.73  ? 96   SER A HB3  1  
ATOM   1442   H HG   . SER A 1 96  ? -26.227 7.789  -19.186 0.010 22.51  ? 96   SER A HG   1  
ATOM   1443   N N    . GLU A 1 97  ? -25.286 6.414  -22.504 0.010 23.01  ? 97   GLU A N    1  
ATOM   1444   C CA   . GLU A 1 97  ? -25.597 6.454  -23.933 0.010 23.69  ? 97   GLU A CA   1  
ATOM   1445   C C    . GLU A 1 97  ? -24.620 7.403  -24.603 0.010 22.63  ? 97   GLU A C    1  
ATOM   1446   O O    . GLU A 1 97  ? -23.957 8.163  -23.919 0.010 21.50  ? 97   GLU A O    1  
ATOM   1447   C CB   . GLU A 1 97  ? -27.036 6.972  -24.176 0.010 24.53  ? 97   GLU A CB   1  
ATOM   1448   C CG   . GLU A 1 97  ? -27.369 8.277  -23.433 0.010 23.90  ? 97   GLU A CG   1  
ATOM   1449   C CD   . GLU A 1 97  ? -28.593 9.027  -24.010 0.010 24.65  ? 97   GLU A CD   1  
ATOM   1450   O OE1  . GLU A 1 97  ? -29.350 8.435  -24.796 0.010 25.89  ? 97   GLU A OE1  1  
ATOM   1451   O OE2  . GLU A 1 97  ? -28.818 10.205 -23.676 0.010 24.19  ? 97   GLU A OE2  1  
ATOM   1452   H H    . GLU A 1 97  ? -24.852 7.099  -22.219 0.010 22.22  ? 97   GLU A H    1  
ATOM   1453   H HA   . GLU A 1 97  ? -25.508 5.573  -24.328 0.010 24.40  ? 97   GLU A HA   1  
ATOM   1454   H HB2  . GLU A 1 97  ? -27.148 7.151  -25.121 0.010 24.69  ? 97   GLU A HB2  1  
ATOM   1455   H HB3  . GLU A 1 97  ? -27.676 6.300  -23.894 0.010 25.50  ? 97   GLU A HB3  1  
ATOM   1456   H HG2  . GLU A 1 97  ? -27.561 8.061  -22.507 0.010 24.08  ? 97   GLU A HG2  1  
ATOM   1457   H HG3  . GLU A 1 97  ? -26.601 8.866  -23.482 0.010 22.96  ? 97   GLU A HG3  1  
ATOM   1458   N N    . LYS A 1 98  ? -24.547 7.384  -25.929 0.010 23.17  ? 98   LYS A N    1  
ATOM   1459   C CA   . LYS A 1 98  ? -23.746 8.384  -26.649 0.010 22.40  ? 98   LYS A CA   1  
ATOM   1460   C C    . LYS A 1 98  ? -24.171 9.774  -26.208 0.010 21.91  ? 98   LYS A C    1  
ATOM   1461   O O    . LYS A 1 98  ? -25.366 10.052 -26.081 0.010 22.63  ? 98   LYS A O    1  
ATOM   1462   C CB   . LYS A 1 98  ? -23.872 8.236  -28.174 0.010 23.47  ? 98   LYS A CB   1  
ATOM   1463   C CG   . LYS A 1 98  ? -25.339 8.205  -28.743 0.010 25.04  ? 98   LYS A CG   1  
ATOM   1464   C CD   . LYS A 1 98  ? -25.472 7.358  -30.031 0.010 26.67  ? 98   LYS A CD   1  
ATOM   1465   C CE   . LYS A 1 98  ? -24.134 7.273  -30.827 0.010 26.35  ? 98   LYS A CE   1  
ATOM   1466   N NZ   . LYS A 1 98  ? -24.309 6.632  -32.194 0.010 27.96  ? 98   LYS A NZ   1  
ATOM   1467   H H    . LYS A 1 98  ? -24.935 6.812  -26.435 0.010 24.08  ? 98   LYS A H    1  
ATOM   1468   H HA   . LYS A 1 98  ? -22.814 8.260  -26.422 0.010 21.67  ? 98   LYS A HA   1  
ATOM   1469   H HB2  . LYS A 1 98  ? -23.411 8.980  -28.594 0.010 23.04  ? 98   LYS A HB2  1  
ATOM   1470   H HB3  . LYS A 1 98  ? -23.428 7.405  -28.402 0.010 23.72  ? 98   LYS A HB3  1  
ATOM   1471   H HG2  . LYS A 1 98  ? -25.941 7.845  -28.085 0.010 25.24  ? 98   LYS A HG2  1  
ATOM   1472   H HG3  . LYS A 1 98  ? -25.613 9.107  -28.968 0.010 24.97  ? 98   LYS A HG3  1  
ATOM   1473   H HD2  . LYS A 1 98  ? -25.751 6.458  -29.800 0.010 27.42  ? 98   LYS A HD2  1  
ATOM   1474   H HD3  . LYS A 1 98  ? -26.132 7.778  -30.605 0.010 27.35  ? 98   LYS A HD3  1  
ATOM   1475   H HE2  . LYS A 1 98  ? -23.769 8.164  -30.946 0.010 25.31  ? 98   LYS A HE2  1  
ATOM   1476   H HE3  . LYS A 1 98  ? -23.502 6.717  -30.342 0.010 26.25  ? 98   LYS A HE3  1  
ATOM   1477   H HZ1  . LYS A 1 98  ? -24.735 5.855  -32.112 0.010 28.73  ? 98   LYS A HZ1  1  
ATOM   1478   H HZ2  . LYS A 1 98  ? -24.780 7.168  -32.726 0.010 28.69  ? 98   LYS A HZ2  1  
ATOM   1479   H HZ3  . LYS A 1 98  ? -23.513 6.487  -32.566 0.010 27.55  ? 98   LYS A HZ3  1  
ATOM   1480   N N    . ALA A 1 99  ? -23.199 10.629 -25.922 0.010 20.80  ? 99   ALA A N    1  
ATOM   1481   C CA   . ALA A 1 99  ? -23.511 12.002 -25.572 0.010 20.49  ? 99   ALA A CA   1  
ATOM   1482   C C    . ALA A 1 99  ? -24.205 12.634 -26.772 0.010 21.45  ? 99   ALA A C    1  
ATOM   1483   O O    . ALA A 1 99  ? -23.861 12.344 -27.910 0.010 21.99  ? 99   ALA A O    1  
ATOM   1484   C CB   . ALA A 1 99  ? -22.252 12.764 -25.237 0.010 19.42  ? 99   ALA A CB   1  
ATOM   1485   H H    . ALA A 1 99  ? -22.363 10.438 -25.930 0.010 20.32  ? 99   ALA A H    1  
ATOM   1486   H HA   . ALA A 1 99  ? -24.103 12.029 -24.805 0.010 20.54  ? 99   ALA A HA   1  
ATOM   1487   H HB1  . ALA A 1 99  ? -21.677 12.778 -26.016 0.010 19.43  ? 99   ALA A HB1  1  
ATOM   1488   H HB2  . ALA A 1 99  ? -22.489 13.670 -24.987 0.010 19.35  ? 99   ALA A HB2  1  
ATOM   1489   H HB3  . ALA A 1 99  ? -21.806 12.324 -24.497 0.010 18.93  ? 99   ALA A HB3  1  
ATOM   1490   N N    . THR A 1 100 ? -25.184 13.491 -26.521 0.010 21.84  ? 100  THR A N    1  
ATOM   1491   C CA   . THR A 1 100 ? -25.775 14.256 -27.596 0.010 22.84  ? 100  THR A CA   1  
ATOM   1492   C C    . THR A 1 100 ? -24.851 15.424 -27.841 0.010 22.36  ? 100  THR A C    1  
ATOM   1493   O O    . THR A 1 100 ? -24.582 16.209 -26.929 0.010 21.69  ? 100  THR A O    1  
ATOM   1494   C CB   . THR A 1 100 ? -27.218 14.697 -27.273 0.010 23.71  ? 100  THR A CB   1  
ATOM   1495   O OG1  . THR A 1 100 ? -27.278 15.199 -25.945 0.010 23.01  ? 100  THR A OG1  1  
ATOM   1496   C CG2  . THR A 1 100 ? -28.155 13.520 -27.373 0.010 24.53  ? 100  THR A CG2  1  
ATOM   1497   H H    . THR A 1 100 ? -25.514 13.648 -25.743 0.010 21.62  ? 100  THR A H    1  
ATOM   1498   H HA   . THR A 1 100 ? -25.797 13.722 -28.404 0.010 23.46  ? 100  THR A HA   1  
ATOM   1499   H HB   . THR A 1 100 ? -27.508 15.380 -27.899 0.010 24.39  ? 100  THR A HB   1  
ATOM   1500   H HG1  . THR A 1 100 ? -27.241 14.558 -25.387 0.010 22.73  ? 100  THR A HG1  1  
ATOM   1501   H HG21 . THR A 1 100 ? -27.671 12.724 -27.634 0.010 24.43  ? 100  THR A HG21 1  
ATOM   1502   H HG22 . THR A 1 100 ? -28.583 13.366 -26.520 0.010 24.30  ? 100  THR A HG22 1  
ATOM   1503   H HG23 . THR A 1 100 ? -28.834 13.697 -28.040 0.010 25.53  ? 100  THR A HG23 1  
ATOM   1504   N N    . LEU A 1 101 ? -24.338 15.491 -29.069 0.010 22.87  ? 101  LEU A N    1  
ATOM   1505   C CA   . LEU A 1 101 ? -23.315 16.453 -29.459 0.010 22.54  ? 101  LEU A CA   1  
ATOM   1506   C C    . LEU A 1 101 ? -23.899 17.719 -30.059 0.010 23.53  ? 101  LEU A C    1  
ATOM   1507   O O    . LEU A 1 101 ? -24.945 17.690 -30.690 0.010 24.80  ? 101  LEU A O    1  
ATOM   1508   C CB   . LEU A 1 101 ? -22.349 15.821 -30.469 0.010 22.73  ? 101  LEU A CB   1  
ATOM   1509   C CG   . LEU A 1 101 ? -21.636 14.516 -30.043 0.010 21.97  ? 101  LEU A CG   1  
ATOM   1510   C CD1  . LEU A 1 101 ? -20.366 14.220 -30.864 0.010 21.90  ? 101  LEU A CD1  1  
ATOM   1511   C CD2  . LEU A 1 101 ? -21.326 14.501 -28.566 0.010 20.69  ? 101  LEU A CD2  1  
ATOM   1512   H H    . LEU A 1 101 ? -24.564 14.967 -29.708 0.010 23.51  ? 101  LEU A H    1  
ATOM   1513   H HA   . LEU A 1 101 ? -22.815 16.710 -28.672 0.010 21.67  ? 101  LEU A HA   1  
ATOM   1514   H HB2  . LEU A 1 101 ? -22.859 15.614 -31.267 0.010 23.76  ? 101  LEU A HB2  1  
ATOM   1515   H HB3  . LEU A 1 101 ? -21.664 16.473 -30.687 0.010 22.54  ? 101  LEU A HB3  1  
ATOM   1516   H HG   . LEU A 1 101 ? -22.252 13.785 -30.209 0.010 22.59  ? 101  LEU A HG   1  
ATOM   1517   H HD11 . LEU A 1 101 ? -19.840 15.030 -30.944 0.010 22.04  ? 101  LEU A HD11 1  
ATOM   1518   H HD12 . LEU A 1 101 ? -19.847 13.537 -30.410 0.010 21.03  ? 101  LEU A HD12 1  
ATOM   1519   H HD13 . LEU A 1 101 ? -20.627 13.903 -31.742 0.010 22.69  ? 101  LEU A HD13 1  
ATOM   1520   H HD21 . LEU A 1 101 ? -22.147 14.607 -28.065 0.010 20.88  ? 101  LEU A HD21 1  
ATOM   1521   H HD22 . LEU A 1 101 ? -20.912 13.654 -28.336 0.010 20.33  ? 101  LEU A HD22 1  
ATOM   1522   H HD23 . LEU A 1 101 ? -20.720 15.231 -28.367 0.010 20.21  ? 101  LEU A HD23 1  
ATOM   1523   N N    . GLY A 1 102 ? -23.203 18.827 -29.838 0.010 23.11  ? 102  GLY A N    1  
ATOM   1524   C CA   . GLY A 1 102 ? -23.573 20.114 -30.420 0.010 24.20  ? 102  GLY A CA   1  
ATOM   1525   C C    . GLY A 1 102 ? -22.596 21.169 -29.929 0.010 23.65  ? 102  GLY A C    1  
ATOM   1526   O O    . GLY A 1 102 ? -21.596 20.806 -29.304 0.010 22.46  ? 102  GLY A O    1  
ATOM   1527   H H    . GLY A 1 102 ? -22.509 18.857 -29.332 0.010 22.31  ? 102  GLY A H    1  
ATOM   1528   H HA2  . GLY A 1 102 ? -23.530 20.055 -31.387 0.010 25.01  ? 102  GLY A HA2  1  
ATOM   1529   H HA3  . GLY A 1 102 ? -24.473 20.348 -30.147 0.010 24.61  ? 102  GLY A HA3  1  
ATOM   1530   N N    . PRO A 1 103 ? -22.896 22.468 -30.163 0.010 24.67  ? 103  PRO A N    1  
ATOM   1531   C CA   . PRO A 1 103 ? -21.951 23.528 -29.799 0.010 24.57  ? 103  PRO A CA   1  
ATOM   1532   C C    . PRO A 1 103 ? -21.473 23.488 -28.373 0.010 23.29  ? 103  PRO A C    1  
ATOM   1533   O O    . PRO A 1 103 ? -20.408 24.028 -28.111 0.010 22.92  ? 103  PRO A O    1  
ATOM   1534   C CB   . PRO A 1 103 ? -22.778 24.794 -30.048 0.010 26.00  ? 103  PRO A CB   1  
ATOM   1535   C CG   . PRO A 1 103 ? -23.581 24.448 -31.212 0.010 27.17  ? 103  PRO A CG   1  
ATOM   1536   C CD   . PRO A 1 103 ? -24.032 23.026 -30.901 0.010 26.33  ? 103  PRO A CD   1  
ATOM   1537   H HA   . PRO A 1 103 ? -21.184 23.506 -30.395 0.010 24.71  ? 103  PRO A HA   1  
ATOM   1538   H HB2  . PRO A 1 103 ? -23.334 24.969 -29.274 0.010 25.82  ? 103  PRO A HB2  1  
ATOM   1539   H HB3  . PRO A 1 103 ? -22.201 25.548 -30.235 0.010 26.42  ? 103  PRO A HB3  1  
ATOM   1540   H HG2  . PRO A 1 103 ? -24.332 25.055 -31.288 0.010 28.00  ? 103  PRO A HG2  1  
ATOM   1541   H HG3  . PRO A 1 103 ? -23.034 24.473 -32.011 0.010 27.73  ? 103  PRO A HG3  1  
ATOM   1542   H HD2  . PRO A 1 103 ? -24.826 23.056 -30.340 0.010 26.51  ? 103  PRO A HD2  1  
ATOM   1543   H HD3  . PRO A 1 103 ? -24.182 22.506 -31.754 0.010 26.81  ? 103  PRO A HD3  1  
ATOM   1544   N N    . ALA A 1 104 ? -22.226 22.855 -27.482 0.010 22.78  ? 104  ALA A N    1  
ATOM   1545   C CA   . ALA A 1 104 ? -21.866 22.817 -26.074 0.010 21.87  ? 104  ALA A CA   1  
ATOM   1546   C C    . ALA A 1 104 ? -21.248 21.481 -25.637 0.010 20.65  ? 104  ALA A C    1  
ATOM   1547   O O    . ALA A 1 104 ? -20.794 21.369 -24.522 0.010 20.00  ? 104  ALA A O    1  
ATOM   1548   C CB   . ALA A 1 104 ? -23.072 23.100 -25.212 0.010 22.33  ? 104  ALA A CB   1  
ATOM   1549   H H    . ALA A 1 104 ? -22.955 22.444 -27.667 0.010 23.06  ? 104  ALA A H    1  
ATOM   1550   H HA   . ALA A 1 104 ? -21.222 23.514 -25.896 0.010 21.91  ? 104  ALA A HA   1  
ATOM   1551   H HB1  . ALA A 1 104 ? -23.568 23.830 -25.610 0.010 23.18  ? 104  ALA A HB1  1  
ATOM   1552   H HB2  . ALA A 1 104 ? -23.627 22.307 -25.178 0.010 22.28  ? 104  ALA A HB2  1  
ATOM   1553   H HB3  . ALA A 1 104 ? -22.777 23.341 -24.322 0.010 21.95  ? 104  ALA A HB3  1  
ATOM   1554   N N    . VAL A 1 105 ? -21.295 20.486 -26.509 0.010 20.58  ? 105  VAL A N    1  
ATOM   1555   C CA   . VAL A 1 105 ? -20.910 19.107 -26.161 0.010 19.70  ? 105  VAL A CA   1  
ATOM   1556   C C    . VAL A 1 105 ? -20.237 18.440 -27.360 0.010 19.76  ? 105  VAL A C    1  
ATOM   1557   O O    . VAL A 1 105 ? -20.832 18.274 -28.426 0.010 20.66  ? 105  VAL A O    1  
ATOM   1558   C CB   . VAL A 1 105 ? -22.117 18.235 -25.708 0.010 19.89  ? 105  VAL A CB   1  
ATOM   1559   C CG1  . VAL A 1 105 ? -21.623 16.852 -25.306 0.010 19.19  ? 105  VAL A CG1  1  
ATOM   1560   C CG2  . VAL A 1 105 ? -22.853 18.863 -24.553 0.010 20.02  ? 105  VAL A CG2  1  
ATOM   1561   H H    . VAL A 1 105 ? -21.543 20.578 -27.327 0.010 21.16  ? 105  VAL A H    1  
ATOM   1562   H HA   . VAL A 1 105 ? -20.281 19.118 -25.429 0.010 19.10  ? 105  VAL A HA   1  
ATOM   1563   H HB   . VAL A 1 105 ? -22.736 18.142 -26.450 0.010 20.56  ? 105  VAL A HB   1  
ATOM   1564   H HG11 . VAL A 1 105 ? -20.778 16.943 -24.843 0.010 18.59  ? 105  VAL A HG11 1  
ATOM   1565   H HG12 . VAL A 1 105 ? -22.276 16.440 -24.720 0.010 19.23  ? 105  VAL A HG12 1  
ATOM   1566   H HG13 . VAL A 1 105 ? -21.511 16.313 -26.102 0.010 19.45  ? 105  VAL A HG13 1  
ATOM   1567   H HG21 . VAL A 1 105 ? -23.045 19.791 -24.749 0.010 20.44  ? 105  VAL A HG21 1  
ATOM   1568   H HG22 . VAL A 1 105 ? -23.685 18.386 -24.416 0.010 20.37  ? 105  VAL A HG22 1  
ATOM   1569   H HG23 . VAL A 1 105 ? -22.304 18.788 -23.758 0.010 19.45  ? 105  VAL A HG23 1  
ATOM   1570   N N    . ARG A 1 106 ? -18.987 18.024 -27.169 0.010 18.96  ? 106  ARG A N    1  
ATOM   1571   C CA   . ARG A 1 106 ? -18.164 17.710 -28.296 0.010 19.18  ? 106  ARG A CA   1  
ATOM   1572   C C    . ARG A 1 106 ? -16.835 17.135 -27.761 0.010 18.21  ? 106  ARG A C    1  
ATOM   1573   O O    . ARG A 1 106 ? -16.157 17.786 -26.968 0.010 17.67  ? 106  ARG A O    1  
ATOM   1574   C CB   . ARG A 1 106 ? -17.919 19.008 -29.057 0.010 19.82  ? 106  ARG A CB   1  
ATOM   1575   C CG   . ARG A 1 106 ? -16.845 18.960 -30.057 0.010 20.72  ? 106  ARG A CG   1  
ATOM   1576   C CD   . ARG A 1 106 ? -17.210 18.068 -31.203 0.010 21.10  ? 106  ARG A CD   1  
ATOM   1577   N NE   . ARG A 1 106 ? -18.599 18.052 -31.648 0.010 22.21  ? 106  ARG A NE   1  
ATOM   1578   C CZ   . ARG A 1 106 ? -19.120 18.839 -32.567 0.010 23.57  ? 106  ARG A CZ   1  
ATOM   1579   N NH1  . ARG A 1 106 ? -18.407 19.830 -33.108 0.010 24.06  ? 106  ARG A NH1  1  
ATOM   1580   N NH2  . ARG A 1 106 ? -20.393 18.643 -32.912 0.010 24.61  ? 106  ARG A NH2  1  
ATOM   1581   H H    . ARG A 1 106 ? -18.605 17.926 -26.405 0.010 18.38  ? 106  ARG A H    1  
ATOM   1582   H HA   . ARG A 1 106 ? -18.617 17.081 -28.875 0.010 19.68  ? 106  ARG A HA   1  
ATOM   1583   H HB2  . ARG A 1 106 ? -18.732 19.289 -29.504 0.010 20.31  ? 106  ARG A HB2  1  
ATOM   1584   H HB3  . ARG A 1 106 ? -17.653 19.673 -28.409 0.010 19.35  ? 106  ARG A HB3  1  
ATOM   1585   H HG2  . ARG A 1 106 ? -16.653 19.849 -30.393 0.010 21.54  ? 106  ARG A HG2  1  
ATOM   1586   H HG3  . ARG A 1 106 ? -16.047 18.603 -29.643 0.010 20.49  ? 106  ARG A HG3  1  
ATOM   1587   H HD2  . ARG A 1 106 ? -16.695 18.339 -31.977 0.010 21.50  ? 106  ARG A HD2  1  
ATOM   1588   H HD3  . ARG A 1 106 ? -16.998 17.163 -30.955 0.010 20.39  ? 106  ARG A HD3  1  
ATOM   1589   H HE   . ARG A 1 106 ? -19.163 17.777 -31.059 0.010 22.05  ? 106  ARG A HE   1  
ATOM   1590   H HH11 . ARG A 1 106 ? -17.584 19.943 -32.887 0.010 23.47  ? 106  ARG A HH11 1  
ATOM   1591   H HH12 . ARG A 1 106 ? -18.766 20.350 -33.692 0.010 25.06  ? 106  ARG A HH12 1  
ATOM   1592   H HH21 . ARG A 1 106 ? -20.844 18.012 -32.545 0.010 24.38  ? 106  ARG A HH21 1  
ATOM   1593   H HH22 . ARG A 1 106 ? -20.772 19.162 -33.481 0.010 25.59  ? 106  ARG A HH22 1  
ATOM   1594   N N    . PRO A 1 107 ? -16.496 15.908 -28.161 0.010 18.16  ? 107  PRO A N    1  
ATOM   1595   C CA   . PRO A 1 107 ? -15.226 15.332 -27.697 0.010 17.35  ? 107  PRO A CA   1  
ATOM   1596   C C    . PRO A 1 107 ? -14.016 16.127 -28.198 0.010 17.37  ? 107  PRO A C    1  
ATOM   1597   O O    . PRO A 1 107 ? -14.127 16.786 -29.201 0.010 18.17  ? 107  PRO A O    1  
ATOM   1598   C CB   . PRO A 1 107 ? -15.215 13.937 -28.360 0.010 17.67  ? 107  PRO A CB   1  
ATOM   1599   C CG   . PRO A 1 107 ? -16.592 13.708 -28.890 0.010 18.53  ? 107  PRO A CG   1  
ATOM   1600   C CD   . PRO A 1 107 ? -17.159 15.043 -29.150 0.010 18.92  ? 107  PRO A CD   1  
ATOM   1601   H HA   . PRO A 1 107 ? -15.197 15.292 -26.734 0.010 16.82  ? 107  PRO A HA   1  
ATOM   1602   H HB2  . PRO A 1 107 ? -14.600 13.955 -29.105 0.010 17.94  ? 107  PRO A HB2  1  
ATOM   1603   H HB3  . PRO A 1 107 ? -14.959 13.240 -27.742 0.010 17.20  ? 107  PRO A HB3  1  
ATOM   1604   H HG2  . PRO A 1 107 ? -16.534 13.203 -29.715 0.010 19.16  ? 107  PRO A HG2  1  
ATOM   1605   H HG3  . PRO A 1 107 ? -17.130 13.237 -28.242 0.010 18.36  ? 107  PRO A HG3  1  
ATOM   1606   H HD2  . PRO A 1 107 ? -16.942 15.313 -30.052 0.010 19.64  ? 107  PRO A HD2  1  
ATOM   1607   H HD3  . PRO A 1 107 ? -18.116 15.020 -29.003 0.010 19.03  ? 107  PRO A HD3  1  
ATOM   1608   N N    . LEU A 1 108 ? -12.895 16.009 -27.501 0.010 16.64  ? 108  LEU A N    1  
ATOM   1609   C CA   . LEU A 1 108 ? -11.660 16.726 -27.818 0.010 16.69  ? 108  LEU A CA   1  
ATOM   1610   C C    . LEU A 1 108 ? -10.657 15.723 -28.314 0.010 16.56  ? 108  LEU A C    1  
ATOM   1611   O O    . LEU A 1 108 ? -10.530 14.688 -27.702 0.010 16.02  ? 108  LEU A O    1  
ATOM   1612   C CB   . LEU A 1 108 ? -11.094 17.327 -26.544 0.010 16.13  ? 108  LEU A CB   1  
ATOM   1613   C CG   . LEU A 1 108 ? -9.977  18.353 -26.703 0.010 16.41  ? 108  LEU A CG   1  
ATOM   1614   C CD1  . LEU A 1 108 ? -10.518 19.684 -27.258 0.010 17.28  ? 108  LEU A CD1  1  
ATOM   1615   C CD2  . LEU A 1 108 ? -9.366  18.506 -25.364 0.010 15.90  ? 108  LEU A CD2  1  
ATOM   1616   H H    . LEU A 1 108 ? -12.826 15.502 -26.815 0.010 16.19  ? 108  LEU A H    1  
ATOM   1617   H HA   . LEU A 1 108 ? -11.804 17.421 -28.475 0.010 17.29  ? 108  LEU A HA   1  
ATOM   1618   H HB2  . LEU A 1 108 ? -11.814 17.761 -26.064 0.010 16.17  ? 108  LEU A HB2  1  
ATOM   1619   H HB3  . LEU A 1 108 ? -10.742 16.612 -25.992 0.010 15.65  ? 108  LEU A HB3  1  
ATOM   1620   H HG   . LEU A 1 108 ? -9.303  18.011 -27.313 0.010 16.53  ? 108  LEU A HG   1  
ATOM   1621   H HD11 . LEU A 1 108 ? -11.473 19.599 -27.400 0.010 17.48  ? 108  LEU A HD11 1  
ATOM   1622   H HD12 . LEU A 1 108 ? -10.343 20.397 -26.621 0.010 17.27  ? 108  LEU A HD12 1  
ATOM   1623   H HD13 . LEU A 1 108 ? -10.079 19.882 -28.100 0.010 17.75  ? 108  LEU A HD13 1  
ATOM   1624   H HD21 . LEU A 1 108 ? -10.063 18.710 -24.723 0.010 15.84  ? 108  LEU A HD21 1  
ATOM   1625   H HD22 . LEU A 1 108 ? -8.938  17.674 -25.126 0.010 15.48  ? 108  LEU A HD22 1  
ATOM   1626   H HD23 . LEU A 1 108 ? -8.715  19.221 -25.386 0.010 16.19  ? 108  LEU A HD23 1  
ATOM   1627   N N    . PRO A 1 109 ? -9.957  16.014 -29.420 0.010 17.20  ? 109  PRO A N    1  
ATOM   1628   C CA   . PRO A 1 109 ? -8.868  15.093 -29.773 0.010 17.11  ? 109  PRO A CA   1  
ATOM   1629   C C    . PRO A 1 109 ? -7.822  14.999 -28.672 0.010 16.27  ? 109  PRO A C    1  
ATOM   1630   O O    . PRO A 1 109 ? -7.614  15.961 -27.951 0.010 16.03  ? 109  PRO A O    1  
ATOM   1631   C CB   . PRO A 1 109 ? -8.270  15.699 -31.068 0.010 18.11  ? 109  PRO A CB   1  
ATOM   1632   C CG   . PRO A 1 109 ? -8.782  17.086 -31.138 0.010 18.50  ? 109  PRO A CG   1  
ATOM   1633   C CD   . PRO A 1 109 ? -10.096 17.111 -30.394 0.010 18.19  ? 109  PRO A CD   1  
ATOM   1634   H HA   . PRO A 1 109 ? -9.218  14.210 -29.951 0.010 17.18  ? 109  PRO A HA   1  
ATOM   1635   H HB2  . PRO A 1 109 ? -7.304  15.700 -31.011 0.010 17.98  ? 109  PRO A HB2  1  
ATOM   1636   H HB3  . PRO A 1 109 ? -8.561  15.187 -31.836 0.010 18.73  ? 109  PRO A HB3  1  
ATOM   1637   H HG2  . PRO A 1 109 ? -8.144  17.685 -30.718 0.010 18.19  ? 109  PRO A HG2  1  
ATOM   1638   H HG3  . PRO A 1 109 ? -8.918  17.326 -32.066 0.010 19.36  ? 109  PRO A HG3  1  
ATOM   1639   H HD2  . PRO A 1 109 ? -10.208 17.961 -29.940 0.010 18.16  ? 109  PRO A HD2  1  
ATOM   1640   H HD3  . PRO A 1 109 ? -10.826 16.928 -31.001 0.010 18.77  ? 109  PRO A HD3  1  
ATOM   1641   N N    . TRP A 1 110 ? -7.204  13.817 -28.529 0.010 16.00  ? 110  TRP A N    1  
ATOM   1642   C CA   . TRP A 1 110 ? -6.221  13.587 -27.496 0.010 15.35  ? 110  TRP A CA   1  
ATOM   1643   C C    . TRP A 1 110 ? -5.017  12.943 -28.143 0.010 15.63  ? 110  TRP A C    1  
ATOM   1644   O O    . TRP A 1 110 ? -5.127  12.289 -29.181 0.010 16.26  ? 110  TRP A O    1  
ATOM   1645   C CB   . TRP A 1 110 ? -6.757  12.782 -26.294 0.010 14.81  ? 110  TRP A CB   1  
ATOM   1646   C CG   . TRP A 1 110 ? -7.202  11.408 -26.613 0.010 15.04  ? 110  TRP A CG   1  
ATOM   1647   C CD1  . TRP A 1 110 ? -8.428  11.021 -27.045 0.010 15.46  ? 110  TRP A CD1  1  
ATOM   1648   C CD2  . TRP A 1 110 ? -6.413  10.223 -26.521 0.010 15.09  ? 110  TRP A CD2  1  
ATOM   1649   N NE1  . TRP A 1 110 ? -8.453  9.655  -27.236 0.010 15.82  ? 110  TRP A NE1  1  
ATOM   1650   C CE2  . TRP A 1 110 ? -7.222  9.148  -26.910 0.010 15.59  ? 110  TRP A CE2  1  
ATOM   1651   C CE3  . TRP A 1 110 ? -5.103  9.972  -26.139 0.010 14.88  ? 110  TRP A CE3  1  
ATOM   1652   C CZ2  . TRP A 1 110 ? -6.757  7.840  -26.932 0.010 15.94  ? 110  TRP A CZ2  1  
ATOM   1653   C CZ3  . TRP A 1 110 ? -4.645  8.667  -26.170 0.010 15.16  ? 110  TRP A CZ3  1  
ATOM   1654   C CH2  . TRP A 1 110 ? -5.474  7.622  -26.548 0.010 15.70  ? 110  TRP A CH2  1  
ATOM   1655   H H    . TRP A 1 110 ? -7.341  13.141 -29.036 0.010 16.30  ? 110  TRP A H    1  
ATOM   1656   H HA   . TRP A 1 110 ? -5.927  14.443 -27.148 0.010 15.26  ? 110  TRP A HA   1  
ATOM   1657   H HB2  . TRP A 1 110 ? -6.068  12.713 -25.620 0.010 14.52  ? 110  TRP A HB2  1  
ATOM   1658   H HB3  . TRP A 1 110 ? -7.514  13.255 -25.922 0.010 14.73  ? 110  TRP A HB3  1  
ATOM   1659   H HD1  . TRP A 1 110 ? -9.138  11.597 -27.198 0.010 15.58  ? 110  TRP A HD1  1  
ATOM   1660   H HE1  . TRP A 1 110 ? -9.126  9.199  -27.507 0.010 16.21  ? 110  TRP A HE1  1  
ATOM   1661   H HE3  . TRP A 1 110 ? -4.552  10.674 -25.876 0.010 14.66  ? 110  TRP A HE3  1  
ATOM   1662   H HZ2  . TRP A 1 110 ? -7.310  7.138  -27.198 0.010 16.43  ? 110  TRP A HZ2  1  
ATOM   1663   H HZ3  . TRP A 1 110 ? -3.773  8.483  -25.914 0.010 15.09  ? 110  TRP A HZ3  1  
ATOM   1664   H HH2  . TRP A 1 110 ? -5.141  6.755  -26.565 0.010 16.01  ? 110  TRP A HH2  1  
ATOM   1665   N N    . GLN A 1 111 ? -3.864  13.235 -27.561 0.010 15.34  ? 111  GLN A N    1  
ATOM   1666   C CA   . GLN A 1 111 ? -2.577  12.881 -28.155 0.010 15.69  ? 111  GLN A CA   1  
ATOM   1667   C C    . GLN A 1 111 ? -2.256  11.391 -28.014 0.010 15.63  ? 111  GLN A C    1  
ATOM   1668   O O    . GLN A 1 111 ? -2.173  10.886 -26.913 0.010 15.13  ? 111  GLN A O    1  
ATOM   1669   C CB   . GLN A 1 111 ? -1.456  13.661 -27.494 0.010 15.54  ? 111  GLN A CB   1  
ATOM   1670   C CG   . GLN A 1 111 ? -0.100  13.505 -28.192 0.010 16.08  ? 111  GLN A CG   1  
ATOM   1671   C CD   . GLN A 1 111 ? -0.036  14.295 -29.495 0.010 16.94  ? 111  GLN A CD   1  
ATOM   1672   O OE1  . GLN A 1 111 ? 0.006   13.730 -30.586 0.010 17.60  ? 111  GLN A OE1  1  
ATOM   1673   N NE2  . GLN A 1 111 ? -0.031  15.603 -29.383 0.010 17.16  ? 111  GLN A NE2  1  
ATOM   1674   H H    . GLN A 1 111 ? -3.800  13.641 -26.810 0.010 15.02  ? 111  GLN A H    1  
ATOM   1675   H HA   . GLN A 1 111 ? -2.593  13.111 -29.095 0.010 16.24  ? 111  GLN A HA   1  
ATOM   1676   H HB2  . GLN A 1 111 ? -1.698  14.600 -27.512 0.010 15.65  ? 111  GLN A HB2  1  
ATOM   1677   H HB3  . GLN A 1 111 ? -1.361  13.366 -26.577 0.010 15.13  ? 111  GLN A HB3  1  
ATOM   1678   H HG2  . GLN A 1 111 ? 0.587   13.849 -27.607 0.010 15.97  ? 111  GLN A HG2  1  
ATOM   1679   H HG3  . GLN A 1 111 ? 0.073   12.573 -28.388 0.010 16.13  ? 111  GLN A HG3  1  
ATOM   1680   H HE21 . GLN A 1 111 ? -0.018  15.966 -28.610 0.010 16.82  ? 111  GLN A HE21 1  
ATOM   1681   H HE22 . GLN A 1 111 ? -0.038  16.088 -30.086 0.010 17.74  ? 111  GLN A HE22 1  
ATOM   1682   N N    . ARG A 1 112 ? -2.070  10.729 -29.145 0.010 16.33  ? 112  ARG A N    1  
ATOM   1683   C CA   . ARG A 1 112 ? -1.769  9.305  -29.159 0.010 16.58  ? 112  ARG A CA   1  
ATOM   1684   C C    . ARG A 1 112 ? -0.245  9.111  -29.267 0.010 16.79  ? 112  ARG A C    1  
ATOM   1685   O O    . ARG A 1 112 ? 0.280   8.116  -28.781 0.010 16.66  ? 112  ARG A O    1  
ATOM   1686   C CB   . ARG A 1 112 ? -2.503  8.568  -30.301 0.010 17.51  ? 112  ARG A CB   1  
ATOM   1687   C CG   . ARG A 1 112 ? -3.968  8.175  -29.979 0.010 17.41  ? 112  ARG A CG   1  
ATOM   1688   C CD   . ARG A 1 112 ? -4.286  6.794  -30.621 0.010 18.13  ? 112  ARG A CD   1  
ATOM   1689   N NE   . ARG A 1 112 ? -3.998  5.698  -29.667 0.010 17.89  ? 112  ARG A NE   1  
ATOM   1690   C CZ   . ARG A 1 112 ? -3.027  4.800  -29.751 0.010 18.42  ? 112  ARG A CZ   1  
ATOM   1691   N NH1  . ARG A 1 112 ? -2.249  4.780  -30.786 0.010 19.15  ? 112  ARG A NH1  1  
ATOM   1692   N NH2  . ARG A 1 112 ? -2.866  3.888  -28.808 0.010 18.37  ? 112  ARG A NH2  1  
ATOM   1693   H H    . ARG A 1 112 ? -2.107  11.086 -29.922 0.010 16.81  ? 112  ARG A H    1  
ATOM   1694   H HA   . ARG A 1 112 ? -2.057  8.895  -28.331 0.010 16.16  ? 112  ARG A HA   1  
ATOM   1695   H HB2  . ARG A 1 112 ? -2.522  9.134  -31.086 0.010 18.03  ? 112  ARG A HB2  1  
ATOM   1696   H HB3  . ARG A 1 112 ? -2.019  7.755  -30.502 0.010 17.84  ? 112  ARG A HB3  1  
ATOM   1697   H HG2  . ARG A 1 112 ? -4.096  8.101  -29.020 0.010 16.72  ? 112  ARG A HG2  1  
ATOM   1698   H HG3  . ARG A 1 112 ? -4.571  8.834  -30.348 0.010 17.74  ? 112  ARG A HG3  1  
ATOM   1699   H HD2  . ARG A 1 112 ? -5.237  6.776  -30.833 0.010 18.19  ? 112  ARG A HD2  1  
ATOM   1700   H HD3  . ARG A 1 112 ? -3.761  6.684  -31.428 0.010 18.94  ? 112  ARG A HD3  1  
ATOM   1701   H HE   . ARG A 1 112 ? -4.494  5.657  -28.967 0.010 17.49  ? 112  ARG A HE   1  
ATOM   1702   H HH11 . ARG A 1 112 ? -2.341  5.352  -31.415 0.010 19.32  ? 112  ARG A HH11 1  
ATOM   1703   H HH12 . ARG A 1 112 ? -1.650  4.181  -30.821 0.010 19.54  ? 112  ARG A HH12 1  
ATOM   1704   H HH21 . ARG A 1 112 ? -3.380  3.889  -28.122 0.010 17.99  ? 112  ARG A HH21 1  
ATOM   1705   H HH22 . ARG A 1 112 ? -2.247  3.297  -28.882 0.010 18.77  ? 112  ARG A HH22 1  
ATOM   1706   N N    . VAL A 1 113 ? 0.453   10.048 -29.899 0.010 17.25  ? 113  VAL A N    1  
ATOM   1707   C CA   . VAL A 1 113 ? 1.905   9.903  -30.099 0.010 17.56  ? 113  VAL A CA   1  
ATOM   1708   C C    . VAL A 1 113 ? 2.660   10.265 -28.810 0.010 16.84  ? 113  VAL A C    1  
ATOM   1709   O O    . VAL A 1 113 ? 2.434   11.306 -28.218 0.010 16.46  ? 113  VAL A O    1  
ATOM   1710   C CB   . VAL A 1 113 ? 2.373   10.740 -31.305 0.010 18.43  ? 113  VAL A CB   1  
ATOM   1711   C CG1  . VAL A 1 113 ? 3.889   10.853 -31.348 0.010 18.79  ? 113  VAL A CG1  1  
ATOM   1712   C CG2  . VAL A 1 113 ? 1.835   10.159 -32.619 0.010 19.47  ? 113  VAL A CG2  1  
ATOM   1713   H H    . VAL A 1 113 ? 0.125   10.772 -30.223 0.010 17.46  ? 113  VAL A H    1  
ATOM   1714   H HA   . VAL A 1 113 ? 2.110   8.975  -30.289 0.010 17.88  ? 113  VAL A HA   1  
ATOM   1715   H HB   . VAL A 1 113 ? 2.013   11.635 -31.218 0.010 18.26  ? 113  VAL A HB   1  
ATOM   1716   H HG11 . VAL A 1 113 ? 4.282   9.989  -31.156 0.010 18.79  ? 113  VAL A HG11 1  
ATOM   1717   H HG12 . VAL A 1 113 ? 4.160   11.147 -32.231 0.010 19.55  ? 113  VAL A HG12 1  
ATOM   1718   H HG13 . VAL A 1 113 ? 4.171   11.506 -30.689 0.010 18.37  ? 113  VAL A HG13 1  
ATOM   1719   H HG21 . VAL A 1 113 ? 1.928   9.194  -32.606 0.010 19.68  ? 113  VAL A HG21 1  
ATOM   1720   H HG22 . VAL A 1 113 ? 0.901   10.397 -32.715 0.010 19.34  ? 113  VAL A HG22 1  
ATOM   1721   H HG23 . VAL A 1 113 ? 2.337   10.532 -33.359 0.010 20.18  ? 113  VAL A HG23 1  
ATOM   1722   N N    . ASP A 1 114 ? 3.538   9.370  -28.373 0.010 16.84  ? 114  ASP A N    1  
ATOM   1723   C CA   . ASP A 1 114 ? 4.135   9.511  -27.063 0.010 16.39  ? 114  ASP A CA   1  
ATOM   1724   C C    . ASP A 1 114 ? 5.349   10.396 -27.173 0.010 16.73  ? 114  ASP A C    1  
ATOM   1725   O O    . ASP A 1 114 ? 6.496   9.929  -27.156 0.010 17.12  ? 114  ASP A O    1  
ATOM   1726   C CB   . ASP A 1 114 ? 4.452   8.155  -26.465 0.010 16.46  ? 114  ASP A CB   1  
ATOM   1727   C CG   . ASP A 1 114 ? 4.837   8.219  -24.989 0.010 16.18  ? 114  ASP A CG   1  
ATOM   1728   O OD1  . ASP A 1 114 ? 5.169   7.140  -24.471 0.010 16.40  ? 114  ASP A OD1  1  
ATOM   1729   O OD2  . ASP A 1 114 ? 4.832   9.297  -24.336 0.010 15.94  ? 114  ASP A OD2  1  
ATOM   1730   H H    . ASP A 1 114 ? 3.802   8.685  -28.812 0.010 17.21  ? 114  ASP A H    1  
ATOM   1731   H HA   . ASP A 1 114 ? 3.509   9.948  -26.472 0.010 15.95  ? 114  ASP A HA   1  
ATOM   1732   H HB2  . ASP A 1 114 ? 3.654   7.608  -26.527 0.010 16.34  ? 114  ASP A HB2  1  
ATOM   1733   H HB3  . ASP A 1 114 ? 5.175   7.738  -26.959 0.010 16.95  ? 114  ASP A HB3  1  
ATOM   1734   N N    . ARG A 1 115 ? 5.068   11.684 -27.312 0.010 16.72  ? 115  ARG A N    1  
ATOM   1735   C CA   . ARG A 1 115 ? 6.087   12.694 -27.186 0.010 17.14  ? 115  ARG A CA   1  
ATOM   1736   C C    . ARG A 1 115 ? 5.707   13.780 -26.182 0.010 16.84  ? 115  ARG A C    1  
ATOM   1737   O O    . ARG A 1 115 ? 4.540   14.168 -26.079 0.010 16.47  ? 115  ARG A O    1  
ATOM   1738   C CB   . ARG A 1 115 ? 6.478   13.264 -28.552 0.010 17.95  ? 115  ARG A CB   1  
ATOM   1739   C CG   . ARG A 1 115 ? 7.340   12.274 -29.395 0.010 18.64  ? 115  ARG A CG   1  
ATOM   1740   C CD   . ARG A 1 115 ? 8.464   11.625 -28.537 0.010 18.81  ? 115  ARG A CD   1  
ATOM   1741   N NE   . ARG A 1 115 ? 9.369   12.641 -28.028 0.010 19.10  ? 115  ARG A NE   1  
ATOM   1742   C CZ   . ARG A 1 115 ? 10.413  13.052 -28.722 0.010 20.00  ? 115  ARG A CZ   1  
ATOM   1743   N NH1  . ARG A 1 115 ? 10.624  12.493 -29.903 0.010 20.71  ? 115  ARG A NH1  1  
ATOM   1744   N NH2  . ARG A 1 115 ? 11.226  14.016 -28.290 0.010 20.39  ? 115  ARG A NH2  1  
ATOM   1745   H H    . ARG A 1 115 ? 4.291   11.991 -27.492 0.010 16.56  ? 115  ARG A H    1  
ATOM   1746   H HA   . ARG A 1 115 ? 6.854   12.280 -26.778 0.010 17.27  ? 115  ARG A HA   1  
ATOM   1747   H HB2  . ARG A 1 115 ? 5.681   13.491 -29.054 0.010 17.94  ? 115  ARG A HB2  1  
ATOM   1748   H HB3  . ARG A 1 115 ? 7.010   14.060 -28.402 0.010 18.24  ? 115  ARG A HB3  1  
ATOM   1749   H HG2  . ARG A 1 115 ? 6.776   11.577 -29.749 0.010 18.52  ? 115  ARG A HG2  1  
ATOM   1750   H HG3  . ARG A 1 115 ? 7.780   12.760 -30.116 0.010 19.29  ? 115  ARG A HG3  1  
ATOM   1751   H HD2  . ARG A 1 115 ? 8.126   11.176 -27.767 0.010 18.32  ? 115  ARG A HD2  1  
ATOM   1752   H HD3  . ARG A 1 115 ? 8.951   10.978 -29.067 0.010 19.36  ? 115  ARG A HD3  1  
ATOM   1753   H HE   . ARG A 1 115 ? 9.321   12.852 -27.195 0.010 18.74  ? 115  ARG A HE   1  
ATOM   1754   H HH11 . ARG A 1 115 ? 10.098  11.890 -30.212 0.010 20.62  ? 115  ARG A HH11 1  
ATOM   1755   H HH12 . ARG A 1 115 ? 11.295  12.747 -30.376 0.010 21.33  ? 115  ARG A HH12 1  
ATOM   1756   H HH21 . ARG A 1 115 ? 11.099  14.377 -27.516 0.010 20.06  ? 115  ARG A HH21 1  
ATOM   1757   H HH22 . ARG A 1 115 ? 11.906  14.250 -28.766 0.010 21.03  ? 115  ARG A HH22 1  
ATOM   1758   N N    . ASP A 1 116 ? 6.713   14.253 -25.458 0.010 17.19  ? 116  ASP A N    1  
ATOM   1759   C CA   . ASP A 1 116 ? 6.471   15.206 -24.383 0.010 17.25  ? 116  ASP A CA   1  
ATOM   1760   C C    . ASP A 1 116 ? 5.987   16.520 -24.999 0.010 17.63  ? 116  ASP A C    1  
ATOM   1761   O O    . ASP A 1 116 ? 6.402   16.889 -26.094 0.010 18.23  ? 116  ASP A O    1  
ATOM   1762   C CB   . ASP A 1 116 ? 7.736   15.544 -23.586 0.010 17.92  ? 116  ASP A CB   1  
ATOM   1763   C CG   . ASP A 1 116 ? 8.189   14.446 -22.659 0.010 17.75  ? 116  ASP A CG   1  
ATOM   1764   O OD1  . ASP A 1 116 ? 7.353   13.613 -22.243 0.010 17.12  ? 116  ASP A OD1  1  
ATOM   1765   O OD2  . ASP A 1 116 ? 9.408   14.464 -22.320 0.010 18.42  ? 116  ASP A OD2  1  
ATOM   1766   H H    . ASP A 1 116 ? 7.536   14.054 -25.578 0.010 17.51  ? 116  ASP A H    1  
ATOM   1767   H HA   . ASP A 1 116 ? 5.785   14.874 -23.781 0.010 16.80  ? 116  ASP A HA   1  
ATOM   1768   H HB2  . ASP A 1 116 ? 8.458   15.708 -24.210 0.010 18.33  ? 116  ASP A HB2  1  
ATOM   1769   H HB3  . ASP A 1 116 ? 7.579   16.333 -23.044 0.010 18.23  ? 116  ASP A HB3  1  
ATOM   1770   N N    . VAL A 1 117 ? 5.128   17.217 -24.267 0.010 17.44  ? 117  VAL A N    1  
ATOM   1771   C CA   . VAL A 1 117 ? 4.860   18.601 -24.566 0.010 18.07  ? 117  VAL A CA   1  
ATOM   1772   C C    . VAL A 1 117 ? 6.124   19.425 -24.369 0.010 19.10  ? 117  VAL A C    1  
ATOM   1773   O O    . VAL A 1 117 ? 6.800   19.276 -23.373 0.010 19.27  ? 117  VAL A O    1  
ATOM   1774   C CB   . VAL A 1 117 ? 3.848   19.197 -23.612 0.010 17.88  ? 117  VAL A CB   1  
ATOM   1775   C CG1  . VAL A 1 117 ? 3.554   20.644 -24.017 0.010 18.66  ? 117  VAL A CG1  1  
ATOM   1776   C CG2  . VAL A 1 117 ? 2.582   18.346 -23.588 0.010 16.91  ? 117  VAL A CG2  1  
ATOM   1777   H H    . VAL A 1 117 ? 4.708   16.906 -23.589 0.010 17.06  ? 117  VAL A H    1  
ATOM   1778   H HA   . VAL A 1 117 ? 4.551   18.691 -25.479 0.010 18.16  ? 117  VAL A HA   1  
ATOM   1779   H HB   . VAL A 1 117 ? 4.233   19.202 -22.719 0.010 18.05  ? 117  VAL A HB   1  
ATOM   1780   H HG11 . VAL A 1 117 ? 3.579   20.715 -24.982 0.010 18.79  ? 117  VAL A HG11 1  
ATOM   1781   H HG12 . VAL A 1 117 ? 2.672   20.884 -23.696 0.010 18.45  ? 117  VAL A HG12 1  
ATOM   1782   H HG13 . VAL A 1 117 ? 4.214   21.233 -23.624 0.010 19.37  ? 117  VAL A HG13 1  
ATOM   1783   H HG21 . VAL A 1 117 ? 2.347   18.100 -24.494 0.010 16.84  ? 117  VAL A HG21 1  
ATOM   1784   H HG22 . VAL A 1 117 ? 2.745   17.551 -23.060 0.010 16.55  ? 117  VAL A HG22 1  
ATOM   1785   H HG23 . VAL A 1 117 ? 1.870   18.859 -23.184 0.010 16.87  ? 117  VAL A HG23 1  
ATOM   1786   N N    . ALA A 1 118 ? 6.424   20.308 -25.306 0.010 19.99  ? 118  ALA A N    1  
ATOM   1787   C CA   . ALA A 1 118 ? 7.676   21.063 -25.206 0.010 21.16  ? 118  ALA A CA   1  
ATOM   1788   C C    . ALA A 1 118 ? 7.577   22.054 -24.033 0.010 21.77  ? 118  ALA A C    1  
ATOM   1789   O O    . ALA A 1 118 ? 6.552   22.699 -23.870 0.010 21.75  ? 118  ALA A O    1  
ATOM   1790   C CB   . ALA A 1 118 ? 7.968   21.782 -26.514 0.010 22.19  ? 118  ALA A CB   1  
ATOM   1791   H H    . ALA A 1 118 ? 5.938   20.501 -25.985 0.010 20.05  ? 118  ALA A H    1  
ATOM   1792   H HA   . ALA A 1 118 ? 8.399   20.440 -25.048 0.010 21.05  ? 118  ALA A HA   1  
ATOM   1793   H HB1  . ALA A 1 118 ? 7.277   22.441 -26.684 0.010 22.41  ? 118  ALA A HB1  1  
ATOM   1794   H HB2  . ALA A 1 118 ? 8.828   22.217 -26.441 0.010 23.02  ? 118  ALA A HB2  1  
ATOM   1795   H HB3  . ALA A 1 118 ? 7.985   21.134 -27.236 0.010 21.92  ? 118  ALA A HB3  1  
ATOM   1796   N N    . PRO A 1 119 ? 8.619   22.127 -23.183 0.010 22.41  ? 119  PRO A N    1  
ATOM   1797   C CA   . PRO A 1 119 ? 8.653   23.096 -22.084 0.010 23.39  ? 119  PRO A CA   1  
ATOM   1798   C C    . PRO A 1 119 ? 8.385   24.514 -22.602 0.010 24.58  ? 119  PRO A C    1  
ATOM   1799   O O    . PRO A 1 119 ? 8.843   24.856 -23.678 0.010 25.17  ? 119  PRO A O    1  
ATOM   1800   C CB   . PRO A 1 119 ? 10.093  22.960 -21.549 0.010 24.28  ? 119  PRO A CB   1  
ATOM   1801   C CG   . PRO A 1 119 ? 10.425  21.556 -21.863 0.010 23.19  ? 119  PRO A CG   1  
ATOM   1802   C CD   . PRO A 1 119 ? 9.839   21.296 -23.192 0.010 22.46  ? 119  PRO A CD   1  
ATOM   1803   H HA   . PRO A 1 119 ? 8.023   22.857 -21.388 0.010 22.90  ? 119  PRO A HA   1  
ATOM   1804   H HB2  . PRO A 1 119 ? 10.679  23.574 -22.019 0.010 25.20  ? 119  PRO A HB2  1  
ATOM   1805   H HB3  . PRO A 1 119 ? 10.116  23.115 -20.593 0.010 24.64  ? 119  PRO A HB3  1  
ATOM   1806   H HG2  . PRO A 1 119 ? 11.387  21.441 -21.882 0.010 23.75  ? 119  PRO A HG2  1  
ATOM   1807   H HG3  . PRO A 1 119 ? 10.024  20.970 -21.201 0.010 22.56  ? 119  PRO A HG3  1  
ATOM   1808   H HD2  . PRO A 1 119 ? 10.436  21.564 -23.903 0.010 23.06  ? 119  PRO A HD2  1  
ATOM   1809   H HD3  . PRO A 1 119 ? 9.605   20.360 -23.262 0.010 21.58  ? 119  PRO A HD3  1  
ATOM   1810   N N    . GLY A 1 120 ? 7.612   25.291 -21.853 0.010 25.04  ? 120  GLY A N    1  
ATOM   1811   C CA   . GLY A 1 120 ? 7.277   26.640 -22.250 0.010 26.33  ? 120  GLY A CA   1  
ATOM   1812   C C    . GLY A 1 120 ? 5.947   26.743 -22.990 0.010 25.61  ? 120  GLY A C    1  
ATOM   1813   O O    . GLY A 1 120 ? 5.394   27.830 -23.108 0.010 26.61  ? 120  GLY A O    1  
ATOM   1814   H H    . GLY A 1 120 ? 7.270   25.057 -21.101 0.010 24.72  ? 120  GLY A H    1  
ATOM   1815   H HA2  . GLY A 1 120 ? 7.232   27.192 -21.455 0.010 27.11  ? 120  GLY A HA2  1  
ATOM   1816   H HA3  . GLY A 1 120 ? 7.965   27.006 -22.826 0.010 27.12  ? 120  GLY A HA3  1  
ATOM   1817   N N    . THR A 1 121 ? 5.464   25.622 -23.520 0.010 24.07  ? 121  THR A N    1  
ATOM   1818   C CA   . THR A 1 121 ? 4.202   25.594 -24.224 0.010 23.44  ? 121  THR A CA   1  
ATOM   1819   C C    . THR A 1 121 ? 3.092   26.085 -23.270 0.010 23.43  ? 121  THR A C    1  
ATOM   1820   O O    . THR A 1 121 ? 3.028   25.680 -22.128 0.010 23.01  ? 121  THR A O    1  
ATOM   1821   C CB   . THR A 1 121 ? 3.866   24.154 -24.729 0.010 21.88  ? 121  THR A CB   1  
ATOM   1822   O OG1  . THR A 1 121 ? 4.836   23.722 -25.691 0.010 22.04  ? 121  THR A OG1  1  
ATOM   1823   C CG2  . THR A 1 121 ? 2.466   24.119 -25.360 0.010 21.43  ? 121  THR A CG2  1  
ATOM   1824   H H    . THR A 1 121 ? 5.856   24.862 -23.478 0.010 23.47  ? 121  THR A H    1  
ATOM   1825   H HA   . THR A 1 121 ? 4.247   26.179 -24.994 0.010 24.19  ? 121  THR A HA   1  
ATOM   1826   H HB   . THR A 1 121 ? 3.883   23.541 -23.978 0.010 21.23  ? 121  THR A HB   1  
ATOM   1827   H HG1  . THR A 1 121 ? 4.792   24.206 -26.386 0.010 22.65  ? 121  THR A HG1  1  
ATOM   1828   H HG21 . THR A 1 121 ? 2.192   25.007 -25.640 0.010 22.28  ? 121  THR A HG21 1  
ATOM   1829   H HG22 . THR A 1 121 ? 2.465   23.532 -26.130 0.010 20.97  ? 121  THR A HG22 1  
ATOM   1830   H HG23 . THR A 1 121 ? 1.829   23.781 -24.714 0.010 20.86  ? 121  THR A HG23 1  
ATOM   1831   N N    . LEU A 1 122 ? 2.245   26.988 -23.743 0.010 24.06  ? 122  LEU A N    1  
ATOM   1832   C CA   . LEU A 1 122 ? 1.117   27.472 -22.952 0.010 24.19  ? 122  LEU A CA   1  
ATOM   1833   C C    . LEU A 1 122 ? -0.082  26.550 -23.116 0.010 22.72  ? 122  LEU A C    1  
ATOM   1834   O O    . LEU A 1 122 ? -0.598  26.417 -24.210 0.010 22.47  ? 122  LEU A O    1  
ATOM   1835   C CB   . LEU A 1 122 ? 0.724   28.882 -23.414 0.010 25.80  ? 122  LEU A CB   1  
ATOM   1836   C CG   . LEU A 1 122 ? 1.866   29.874 -23.297 0.010 27.57  ? 122  LEU A CG   1  
ATOM   1837   C CD1  . LEU A 1 122 ? 1.385   31.271 -23.655 0.010 29.31  ? 122  LEU A CD1  1  
ATOM   1838   C CD2  . LEU A 1 122 ? 2.472   29.793 -21.903 0.010 27.84  ? 122  LEU A CD2  1  
ATOM   1839   H H    . LEU A 1 122 ? 2.304   27.342 -24.523 0.010 24.52  ? 122  LEU A H    1  
ATOM   1840   H HA   . LEU A 1 122 ? 1.345   27.495 -22.012 0.010 24.36  ? 122  LEU A HA   1  
ATOM   1841   H HB2  . LEU A 1 122 ? 0.441   28.858 -24.341 0.010 25.68  ? 122  LEU A HB2  1  
ATOM   1842   H HB3  . LEU A 1 122 ? 0.003   29.196 -22.853 0.010 26.00  ? 122  LEU A HB3  1  
ATOM   1843   H HG   . LEU A 1 122 ? 2.556   29.633 -23.935 0.010 27.54  ? 122  LEU A HG   1  
ATOM   1844   H HD11 . LEU A 1 122 ? 0.666   31.522 -23.056 0.010 29.39  ? 122  LEU A HD11 1  
ATOM   1845   H HD12 . LEU A 1 122 ? 2.126   31.891 -23.571 0.010 30.57  ? 122  LEU A HD12 1  
ATOM   1846   H HD13 . LEU A 1 122 ? 1.063   31.256 -24.569 0.010 29.16  ? 122  LEU A HD13 1  
ATOM   1847   H HD21 . LEU A 1 122 ? 1.760   29.765 -21.246 0.010 27.57  ? 122  LEU A HD21 1  
ATOM   1848   H HD22 . LEU A 1 122 ? 3.020   28.993 -21.844 0.010 27.04  ? 122  LEU A HD22 1  
ATOM   1849   H HD23 . LEU A 1 122 ? 3.031   30.576 -21.759 0.010 29.23  ? 122  LEU A HD23 1  
ATOM   1850   N N    . CYS A 1 123 ? -0.525  25.931 -22.028 0.010 21.93  ? 123  CYS A N    1  
ATOM   1851   C CA   . CYS A 1 123 ? -1.648  25.018 -22.095 0.010 20.67  ? 123  CYS A CA   1  
ATOM   1852   C C    . CYS A 1 123 ? -2.755  25.532 -21.188 0.010 21.00  ? 123  CYS A C    1  
ATOM   1853   O O    . CYS A 1 123 ? -2.528  26.365 -20.311 0.010 22.10  ? 123  CYS A O    1  
ATOM   1854   C CB   . CYS A 1 123 ? -1.253  23.624 -21.663 0.010 19.50  ? 123  CYS A CB   1  
ATOM   1855   S SG   . CYS A 1 123 ? 0.111   22.929 -22.654 0.010 19.26  ? 123  CYS A SG   1  
ATOM   1856   H H    . CYS A 1 123 ? -0.202  26.030 -21.240 0.010 22.22  ? 123  CYS A H    1  
ATOM   1857   H HA   . CYS A 1 123 ? -1.982  24.965 -23.000 0.010 20.52  ? 123  CYS A HA   1  
ATOM   1858   H HB2  . CYS A 1 123 ? -0.941  23.695 -20.754 0.010 19.73  ? 123  CYS A HB2  1  
ATOM   1859   H HB3  . CYS A 1 123 ? -2.014  23.030 -21.718 0.010 18.79  ? 123  CYS A HB3  1  
ATOM   1860   N N    . ASP A 1 124 ? -3.946  25.038 -21.457 0.010 20.24  ? 124  ASP A N    1  
ATOM   1861   C CA   . ASP A 1 124 ? -5.153  25.471 -20.789 0.010 20.56  ? 124  ASP A CA   1  
ATOM   1862   C C    . ASP A 1 124 ? -5.649  24.369 -19.861 0.010 19.59  ? 124  ASP A C    1  
ATOM   1863   O O    . ASP A 1 124 ? -5.767  23.218 -20.280 0.010 18.51  ? 124  ASP A O    1  
ATOM   1864   C CB   . ASP A 1 124 ? -6.191  25.754 -21.864 0.010 20.69  ? 124  ASP A CB   1  
ATOM   1865   C CG   . ASP A 1 124 ? -7.529  26.210 -21.300 0.010 21.15  ? 124  ASP A CG   1  
ATOM   1866   O OD1  . ASP A 1 124 ? -7.761  27.425 -21.301 0.010 22.44  ? 124  ASP A OD1  1  
ATOM   1867   O OD2  . ASP A 1 124 ? -8.357  25.356 -20.899 0.010 20.36  ? 124  ASP A OD2  1  
ATOM   1868   H H    . ASP A 1 124 ? -4.084  24.439 -22.053 0.010 19.62  ? 124  ASP A H    1  
ATOM   1869   H HA   . ASP A 1 124 ? -5.003  26.278 -20.277 0.010 21.48  ? 124  ASP A HA   1  
ATOM   1870   H HB2  . ASP A 1 124 ? -5.855  26.453 -22.444 0.010 21.42  ? 124  ASP A HB2  1  
ATOM   1871   H HB3  . ASP A 1 124 ? -6.335  24.942 -22.372 0.010 19.88  ? 124  ASP A HB3  1  
ATOM   1872   N N    . VAL A 1 125 ? -5.895  24.733 -18.605 0.010 20.20  ? 125  VAL A N    1  
ATOM   1873   C CA   . VAL A 1 125 ? -6.557  23.867 -17.637 0.010 19.63  ? 125  VAL A CA   1  
ATOM   1874   C C    . VAL A 1 125 ? -7.855  24.511 -17.148 0.010 20.31  ? 125  VAL A C    1  
ATOM   1875   O O    . VAL A 1 125 ? -7.889  25.697 -16.818 0.010 21.61  ? 125  VAL A O    1  
ATOM   1876   C CB   . VAL A 1 125 ? -5.690  23.596 -16.388 0.010 19.96  ? 125  VAL A CB   1  
ATOM   1877   C CG1  . VAL A 1 125 ? -6.307  22.484 -15.544 0.010 19.47  ? 125  VAL A CG1  1  
ATOM   1878   C CG2  . VAL A 1 125 ? -4.327  23.197 -16.788 0.010 19.51  ? 125  VAL A CG2  1  
ATOM   1879   H H    . VAL A 1 125 ? -5.685  25.499 -18.285 0.010 21.08  ? 125  VAL A H    1  
ATOM   1880   H HA   . VAL A 1 125 ? -6.784  23.032 -18.052 0.010 18.76  ? 125  VAL A HA   1  
ATOM   1881   H HB   . VAL A 1 125 ? -5.631  24.402 -15.849 0.010 20.97  ? 125  VAL A HB   1  
ATOM   1882   H HG11 . VAL A 1 125 ? -6.996  22.039 -16.057 0.010 18.70  ? 125  VAL A HG11 1  
ATOM   1883   H HG12 . VAL A 1 125 ? -5.633  21.838 -15.294 0.010 19.39  ? 125  VAL A HG12 1  
ATOM   1884   H HG13 . VAL A 1 125 ? -6.687  22.876 -14.744 0.010 20.17  ? 125  VAL A HG13 1  
ATOM   1885   H HG21 . VAL A 1 125 ? -4.407  22.661 -17.589 0.010 18.62  ? 125  VAL A HG21 1  
ATOM   1886   H HG22 . VAL A 1 125 ? -3.806  23.994 -16.968 0.010 19.98  ? 125  VAL A HG22 1  
ATOM   1887   H HG23 . VAL A 1 125 ? -3.919  22.675 -16.085 0.010 19.80  ? 125  VAL A HG23 1  
ATOM   1888   N N    . ALA A 1 126 ? -8.874  23.693 -17.018 0.010 19.58  ? 126  ALA A N    1  
ATOM   1889   C CA   . ALA A 1 126 ? -10.215 24.139 -16.626 0.010 20.11  ? 126  ALA A CA   1  
ATOM   1890   C C    . ALA A 1 126 ? -10.830 23.264 -15.506 0.010 19.92  ? 126  ALA A C    1  
ATOM   1891   O O    . ALA A 1 126 ? -10.509 22.083 -15.405 0.010 19.07  ? 126  ALA A O    1  
ATOM   1892   C CB   . ALA A 1 126 ? -11.096 24.139 -17.846 0.010 19.66  ? 126  ALA A CB   1  
ATOM   1893   H H    . ALA A 1 126 ? -8.819  22.847 -17.150 0.010 18.83  ? 126  ALA A H    1  
ATOM   1894   H HA   . ALA A 1 126 ? -10.163 25.045 -16.293 0.010 21.08  ? 126  ALA A HA   1  
ATOM   1895   H HB1  . ALA A 1 126 ? -11.036 23.275 -18.282 0.010 18.82  ? 126  ALA A HB1  1  
ATOM   1896   H HB2  . ALA A 1 126 ? -12.011 24.299 -17.563 0.010 19.97  ? 126  ALA A HB2  1  
ATOM   1897   H HB3  . ALA A 1 126 ? -10.809 24.840 -18.452 0.010 20.07  ? 126  ALA A HB3  1  
ATOM   1898   N N    . GLY A 1 127 ? -11.676 23.841 -14.640 0.010 20.91  ? 127  GLY A N    1  
ATOM   1899   C CA   . GLY A 1 127 ? -12.402 23.031 -13.652 0.010 20.94  ? 127  GLY A CA   1  
ATOM   1900   C C    . GLY A 1 127 ? -13.314 23.811 -12.716 0.010 22.31  ? 127  GLY A C    1  
ATOM   1901   O O    . GLY A 1 127 ? -13.494 24.992 -12.938 0.010 23.21  ? 127  GLY A O    1  
ATOM   1902   H H    . GLY A 1 127 ? -11.840 24.681 -14.598 0.010 21.67  ? 127  GLY A H    1  
ATOM   1903   H HA2  . GLY A 1 127 ? -12.949 22.387 -14.126 0.010 20.19  ? 127  GLY A HA2  1  
ATOM   1904   H HA3  . GLY A 1 127 ? -11.771 22.545 -13.101 0.010 20.92  ? 127  GLY A HA3  1  
ATOM   1905   N N    . TRP A 1 128 ? -13.779 23.173 -11.638 0.010 22.67  ? 128  TRP A N    1  
ATOM   1906   C CA   . TRP A 1 128 ? -14.695 23.809 -10.653 0.010 24.16  ? 128  TRP A CA   1  
ATOM   1907   C C    . TRP A 1 128 ? -14.442 23.771 -9.064  0.010 25.60  ? 128  TRP A C    1  
ATOM   1908   O O    . TRP A 1 128 ? -15.406 23.842 -8.296  0.010 26.64  ? 128  TRP A O    1  
ATOM   1909   C CB   . TRP A 1 128 ? -16.078 23.174 -10.888 0.010 23.71  ? 128  TRP A CB   1  
ATOM   1910   C CG   . TRP A 1 128 ? -16.904 23.484 -12.117 0.010 23.03  ? 128  TRP A CG   1  
ATOM   1911   C CD1  . TRP A 1 128 ? -17.829 24.492 -12.236 0.010 23.91  ? 128  TRP A CD1  1  
ATOM   1912   C CD2  . TRP A 1 128 ? -17.034 22.690 -13.320 0.010 21.58  ? 128  TRP A CD2  1  
ATOM   1913   N NE1  . TRP A 1 128 ? -18.478 24.404 -13.446 0.010 23.09  ? 128  TRP A NE1  1  
ATOM   1914   C CE2  . TRP A 1 128 ? -18.009 23.316 -14.132 0.010 21.70  ? 128  TRP A CE2  1  
ATOM   1915   C CE3  . TRP A 1 128 ? -16.412 21.529 -13.793 0.010 20.38  ? 128  TRP A CE3  1  
ATOM   1916   C CZ2  . TRP A 1 128 ? -18.369 22.827 -15.382 0.010 20.73  ? 128  TRP A CZ2  1  
ATOM   1917   C CZ3  . TRP A 1 128 ? -16.763 21.049 -15.039 0.010 19.42  ? 128  TRP A CZ3  1  
ATOM   1918   C CH2  . TRP A 1 128 ? -17.754 21.687 -15.815 0.010 19.63  ? 128  TRP A CH2  1  
ATOM   1919   H H    . TRP A 1 128 ? -13.584 22.357 -11.454 0.010 22.17  ? 128  TRP A H    1  
ATOM   1920   H HA   . TRP A 1 128 ? -14.770 24.746 -10.886 0.010 24.80  ? 128  TRP A HA   1  
ATOM   1921   H HB2  . TRP A 1 128 ? -15.961 22.211 -10.886 0.010 23.05  ? 128  TRP A HB2  1  
ATOM   1922   H HB3  . TRP A 1 128 ? -16.656 23.418 -10.151 0.010 24.71  ? 128  TRP A HB3  1  
ATOM   1923   H HD1  . TRP A 1 128 ? -17.989 25.146 -11.596 0.010 25.02  ? 128  TRP A HD1  1  
ATOM   1924   H HE1  . TRP A 1 128 ? -19.073 24.951 -13.733 0.010 23.49  ? 128  TRP A HE1  1  
ATOM   1925   H HE3  . TRP A 1 128 ? -15.771 21.093 -13.280 0.010 20.36  ? 128  TRP A HE3  1  
ATOM   1926   H HZ2  . TRP A 1 128 ? -19.006 23.260 -15.900 0.010 20.95  ? 128  TRP A HZ2  1  
ATOM   1927   H HZ3  . TRP A 1 128 ? -16.354 20.283 -15.363 0.010 18.75  ? 128  TRP A HZ3  1  
ATOM   1928   H HH2  . TRP A 1 128 ? -17.958 21.356 -16.658 0.010 19.12  ? 128  TRP A HH2  1  
ATOM   1929   N N    . GLY A 1 129 ? -13.223 23.661 -8.531  0.010 25.89  ? 129  GLY A N    1  
ATOM   1930   C CA   . GLY A 1 129 ? -13.021 23.823 -7.063  0.010 27.77  ? 129  GLY A CA   1  
ATOM   1931   C C    . GLY A 1 129 ? -13.644 22.793 -6.060  0.010 28.40  ? 129  GLY A C    1  
ATOM   1932   O O    . GLY A 1 129 ? -14.737 22.280 -6.319  0.010 27.84  ? 129  GLY A O    1  
ATOM   1933   H H    . GLY A 1 129 ? -12.506 23.497 -8.980  0.010 25.19  ? 129  GLY A H    1  
ATOM   1934   H HA2  . GLY A 1 129 ? -12.069 23.888 -6.889  0.010 28.04  ? 129  GLY A HA2  1  
ATOM   1935   H HA3  . GLY A 1 129 ? -13.389 24.684 -6.808  0.010 28.82  ? 129  GLY A HA3  1  
ATOM   1936   N N    . ILE A 1 130 ? -13.008 22.532 -4.902  0.010 29.88  ? 130  ILE A N    1  
ATOM   1937   C CA   . ILE A 1 130 ? -13.240 21.323 -4.061  0.010 30.40  ? 130  ILE A CA   1  
ATOM   1938   C C    . ILE A 1 130 ? -14.076 21.502 -2.747  0.010 32.72  ? 130  ILE A C    1  
ATOM   1939   O O    . ILE A 1 130 ? -15.015 22.302 -2.759  0.010 33.57  ? 130  ILE A O    1  
ATOM   1940   C CB   . ILE A 1 130 ? -11.824 20.658 -3.805  0.010 30.28  ? 130  ILE A CB   1  
ATOM   1941   C CG1  . ILE A 1 130 ? -11.939 19.169 -3.389  0.010 30.17  ? 130  ILE A CG1  1  
ATOM   1942   C CG2  . ILE A 1 130 ? -10.999 21.461 -2.762  0.010 32.39  ? 130  ILE A CG2  1  
ATOM   1943   C CD1  . ILE A 1 130 ? -12.199 18.236 -4.510  0.010 28.29  ? 130  ILE A CD1  1  
ATOM   1944   H H    . ILE A 1 130 ? -12.400 23.041 -4.580  0.010 30.75  ? 130  ILE A H    1  
ATOM   1945   H HA   . ILE A 1 130 ? -13.757 20.681 -4.585  0.010 29.31  ? 130  ILE A HA   1  
ATOM   1946   H HB   . ILE A 1 130 ? -11.308 20.695 -4.668  0.010 28.99  ? 130  ILE A HB   1  
ATOM   1947   H HG12 . ILE A 1 130 ? -11.130 18.895 -2.930  0.010 31.56  ? 130  ILE A HG12 1  
ATOM   1948   H HG13 . ILE A 1 130 ? -12.703 19.002 -2.822  0.010 30.15  ? 130  ILE A HG13 1  
ATOM   1949   H HG21 . ILE A 1 130 ? -11.311 22.380 -2.781  0.010 32.64  ? 130  ILE A HG21 1  
ATOM   1950   H HG22 . ILE A 1 130 ? -11.078 21.094 -1.863  0.010 33.83  ? 130  ILE A HG22 1  
ATOM   1951   H HG23 . ILE A 1 130 ? -10.073 21.413 -3.058  0.010 32.16  ? 130  ILE A HG23 1  
ATOM   1952   H HD11 . ILE A 1 130 ? -11.901 18.699 -5.265  0.010 28.84  ? 130  ILE A HD11 1  
ATOM   1953   H HD12 . ILE A 1 130 ? -11.674 17.289 -4.281  0.010 27.20  ? 130  ILE A HD12 1  
ATOM   1954   H HD13 . ILE A 1 130 ? -13.151 18.212 -4.553  0.010 27.82  ? 130  ILE A HD13 1  
ATOM   1955   N N    . VAL A 1 131 ? -13.720 20.756 -1.676  0.010 33.85  ? 131  VAL A N    1  
ATOM   1956   C CA   . VAL A 1 131 ? -14.552 20.404 -0.481  0.010 35.55  ? 131  VAL A CA   1  
ATOM   1957   C C    . VAL A 1 131 ? -16.022 20.884 -0.444  0.010 35.65  ? 131  VAL A C    1  
ATOM   1958   O O    . VAL A 1 131 ? -16.979 20.132 -0.628  0.010 34.63  ? 131  VAL A O    1  
ATOM   1959   C CB   . VAL A 1 131 ? -13.819 20.858 0.831   0.010 38.41  ? 131  VAL A CB   1  
ATOM   1960   C CG1  . VAL A 1 131 ? -12.985 19.713 1.429   0.010 38.93  ? 131  VAL A CG1  1  
ATOM   1961   C CG2  . VAL A 1 131 ? -12.930 22.039 0.531   0.010 39.15  ? 131  VAL A CG2  1  
ATOM   1962   H H    . VAL A 1 131 ? -12.939 20.421 -1.593  0.010 33.82  ? 131  VAL A H    1  
ATOM   1963   H HA   . VAL A 1 131 ? -14.611 19.436 -0.443  0.010 34.94  ? 131  VAL A HA   1  
ATOM   1964   H HB   . VAL A 1 131 ? -14.471 21.129 1.499   0.010 39.66  ? 131  VAL A HB   1  
ATOM   1965   H HG11 . VAL A 1 131 ? -13.288 18.861 1.079   0.010 37.83  ? 131  VAL A HG11 1  
ATOM   1966   H HG12 . VAL A 1 131 ? -12.052 19.845 1.204   0.010 38.54  ? 131  VAL A HG12 1  
ATOM   1967   H HG13 . VAL A 1 131 ? -13.088 19.724 2.394   0.010 40.87  ? 131  VAL A HG13 1  
ATOM   1968   H HG21 . VAL A 1 131 ? -13.378 22.612 -0.110  0.010 38.40  ? 131  VAL A HG21 1  
ATOM   1969   H HG22 . VAL A 1 131 ? -12.772 22.533 1.350   0.010 41.19  ? 131  VAL A HG22 1  
ATOM   1970   H HG23 . VAL A 1 131 ? -12.087 21.730 0.165   0.010 38.50  ? 131  VAL A HG23 1  
ATOM   1971   N N    . ASN A 1 132 ? -16.188 22.144 -0.130  0.010 37.14  ? 132  ASN A N    1  
ATOM   1972   C CA   . ASN A 1 132 ? -17.152 22.933 -0.838  0.010 36.52  ? 132  ASN A CA   1  
ATOM   1973   C C    . ASN A 1 132 ? -16.569 24.300 -0.700  0.010 37.90  ? 132  ASN A C    1  
ATOM   1974   O O    . ASN A 1 132 ? -16.905 25.064 0.202   0.010 40.36  ? 132  ASN A O    1  
ATOM   1975   C CB   . ASN A 1 132 ? -18.605 22.793 -0.348  0.010 37.59  ? 132  ASN A CB   1  
ATOM   1976   C CG   . ASN A 1 132 ? -19.575 22.477 -1.510  0.010 35.72  ? 132  ASN A CG   1  
ATOM   1977   O OD1  . ASN A 1 132 ? -20.723 22.919 -1.505  0.010 36.47  ? 132  ASN A OD1  1  
ATOM   1978   N ND2  . ASN A 1 132 ? -19.098 21.723 -2.511  0.010 33.42  ? 132  ASN A ND2  1  
ATOM   1979   H H    . ASN A 1 132 ? -15.754 22.562 0.483   0.010 38.63  ? 132  ASN A H    1  
ATOM   1980   H HA   . ASN A 1 132 ? -17.116 22.701 -1.773  0.010 34.77  ? 132  ASN A HA   1  
ATOM   1981   H HB2  . ASN A 1 132 ? -18.664 22.071 0.295   0.010 38.15  ? 132  ASN A HB2  1  
ATOM   1982   H HB3  . ASN A 1 132 ? -18.895 23.620 0.067   0.010 39.10  ? 132  ASN A HB3  1  
ATOM   1983   H HD21 . ASN A 1 132 ? -18.348 21.314 -2.422  0.010 32.82  ? 132  ASN A HD21 1  
ATOM   1984   H HD22 . ASN A 1 132 ? -19.544 21.646 -3.243  0.010 32.63  ? 132  ASN A HD22 1  
ATOM   1985   N N    . HIS A 1 133 ? -15.612 24.584 -1.583  0.010 36.50  ? 133  HIS A N    1  
ATOM   1986   C CA   . HIS A 1 133 ? -14.998 25.884 -1.517  0.010 37.89  ? 133  HIS A CA   1  
ATOM   1987   C C    . HIS A 1 133 ? -16.025 26.911 -1.954  0.010 38.21  ? 133  HIS A C    1  
ATOM   1988   O O    . HIS A 1 133 ? -15.920 27.473 -3.046  0.010 37.25  ? 133  HIS A O    1  
ATOM   1989   C CB   . HIS A 1 133 ? -13.719 25.986 -2.337  0.010 36.72  ? 133  HIS A CB   1  
ATOM   1990   C CG   . HIS A 1 133 ? -12.794 27.032 -1.809  0.010 38.81  ? 133  HIS A CG   1  
ATOM   1991   N ND1  . HIS A 1 133 ? -13.146 28.367 -1.731  0.010 40.31  ? 133  HIS A ND1  1  
ATOM   1992   C CD2  . HIS A 1 133 ? -11.564 26.935 -1.252  0.010 39.94  ? 133  HIS A CD2  1  
ATOM   1993   C CE1  . HIS A 1 133 ? -12.150 29.050 -1.197  0.010 42.23  ? 133  HIS A CE1  1  
ATOM   1994   N NE2  . HIS A 1 133 ? -11.185 28.204 -0.883  0.010 42.06  ? 133  HIS A NE2  1  
ATOM   1995   H H    . HIS A 1 133 ? -15.320 24.066 -2.206  0.010 34.91  ? 133  HIS A H    1  
ATOM   1996   H HA   . HIS A 1 133 ? -14.758 26.070 -0.595  0.010 39.71  ? 133  HIS A HA   1  
ATOM   1997   H HB2  . HIS A 1 133 ? -13.262 25.130 -2.297  0.010 35.99  ? 133  HIS A HB2  1  
ATOM   1998   H HB3  . HIS A 1 133 ? -13.930 26.191 -3.262  0.010 35.43  ? 133  HIS A HB3  1  
ATOM   1999   H HD1  . HIS A 1 133 ? -13.885 28.707 -2.012  0.010 40.08  ? 133  HIS A HD1  1  
ATOM   2000   H HD2  . HIS A 1 133 ? -11.065 26.156 -1.150  0.010 39.46  ? 133  HIS A HD2  1  
ATOM   2001   H HE1  . HIS A 1 133 ? -12.133 29.968 -1.043  0.010 43.62  ? 133  HIS A HE1  1  
ATOM   2002   H HE2  . HIS A 1 133 ? -10.434 28.418 -0.521  0.010 43.19  ? 133  HIS A HE2  1  
ATOM   2003   N N    . ALA A 1 134 ? -17.009 27.121 -1.071  0.010 39.68  ? 134  ALA A N    1  
ATOM   2004   C CA   . ALA A 1 134 ? -18.104 28.098 -1.218  0.010 40.92  ? 134  ALA A CA   1  
ATOM   2005   C C    . ALA A 1 134 ? -19.455 27.502 -1.699  0.010 39.79  ? 134  ALA A C    1  
ATOM   2006   O O    . ALA A 1 134 ? -20.139 28.114 -2.555  0.010 39.48  ? 134  ALA A O    1  
ATOM   2007   C CB   . ALA A 1 134 ? -17.682 29.307 -2.070  0.010 41.05  ? 134  ALA A CB   1  
ATOM   2008   H H    . ALA A 1 134 ? -17.060 26.692 -0.329  0.010 40.12  ? 134  ALA A H    1  
ATOM   2009   H HA   . ALA A 1 134 ? -18.283 28.456 -0.334  0.010 42.88  ? 134  ALA A HA   1  
ATOM   2010   H HB1  . ALA A 1 134 ? -16.804 29.600 -1.778  0.010 41.70  ? 134  ALA A HB1  1  
ATOM   2011   H HB2  . ALA A 1 134 ? -17.655 29.061 -3.007  0.010 39.31  ? 134  ALA A HB2  1  
ATOM   2012   H HB3  . ALA A 1 134 ? -18.326 30.020 -1.937  0.010 42.39  ? 134  ALA A HB3  1  
ATOM   2013   N N    . GLY A 1 135 ? -19.794 26.301 -1.172  0.010 39.33  ? 135  GLY A N    1  
ATOM   2014   C CA   . GLY A 1 135 ? -21.162 25.727 -1.115  0.010 39.36  ? 135  GLY A CA   1  
ATOM   2015   C C    . GLY A 1 135 ? -21.735 25.345 -2.475  0.010 37.07  ? 135  GLY A C    1  
ATOM   2016   O O    . GLY A 1 135 ? -22.486 24.363 -2.708  0.010 36.33  ? 135  GLY A O    1  
ATOM   2017   H H    . GLY A 1 135 ? -19.208 25.771 -0.831  0.010 39.08  ? 135  GLY A H    1  
ATOM   2018   H HA2  . GLY A 1 135 ? -21.170 24.964 -0.518  0.010 39.71  ? 135  GLY A HA2  1  
ATOM   2019   H HA3  . GLY A 1 135 ? -21.756 26.392 -0.732  0.010 40.85  ? 135  GLY A HA3  1  
ATOM   2020   N N    . ARG A 1 136 ? -21.421 26.232 -3.398  0.010 36.27  ? 136  ARG A N    1  
ATOM   2021   C CA   . ARG A 1 136 ? -21.733 26.109 -4.816  0.010 33.98  ? 136  ARG A CA   1  
ATOM   2022   C C    . ARG A 1 136 ? -20.367 26.069 -5.431  0.010 33.20  ? 136  ARG A C    1  
ATOM   2023   O O    . ARG A 1 136 ? -20.252 25.923 -6.652  0.010 31.98  ? 136  ARG A O    1  
ATOM   2024   C CB   . ARG A 1 136 ? -22.672 27.269 -5.205  0.010 34.19  ? 136  ARG A CB   1  
ATOM   2025   C CG   . ARG A 1 136 ? -24.206 26.782 -5.412  0.010 34.65  ? 136  ARG A CG   1  
ATOM   2026   C CD   . ARG A 1 136 ? -25.326 27.683 -4.820  0.010 36.66  ? 136  ARG A CD   1  
ATOM   2027   N NE   . ARG A 1 136 ? -26.435 26.937 -4.169  0.010 37.73  ? 136  ARG A NE   1  
ATOM   2028   C CZ   . ARG A 1 136 ? -26.429 26.451 -2.920  0.010 39.04  ? 136  ARG A CZ   1  
ATOM   2029   N NH1  . ARG A 1 136 ? -25.346 26.584 -2.156  0.010 39.41  ? 136  ARG A NH1  1  
ATOM   2030   N NH2  . ARG A 1 136 ? -27.496 25.800 -2.434  0.010 40.13  ? 136  ARG A NH2  1  
ATOM   2031   H H    . ARG A 1 136 ? -21.040 26.971 -3.217  0.010 37.18  ? 136  ARG A H    1  
ATOM   2032   H HA   . ARG A 1 136 ? -22.160 25.285 -5.077  0.010 33.03  ? 136  ARG A HA   1  
ATOM   2033   H HB2  . ARG A 1 136 ? -22.724 27.889 -4.362  0.010 35.47  ? 136  ARG A HB2  1  
ATOM   2034   H HB3  . ARG A 1 136 ? -22.348 27.696 -6.017  0.010 32.86  ? 136  ARG A HB3  1  
ATOM   2035   H HG2  . ARG A 1 136 ? -24.390 26.602 -6.355  0.010 33.40  ? 136  ARG A HG2  1  
ATOM   2036   H HG3  . ARG A 1 136 ? -24.282 25.966 -4.901  0.010 35.02  ? 136  ARG A HG3  1  
ATOM   2037   H HD2  . ARG A 1 136 ? -24.954 28.339 -4.208  0.010 37.87  ? 136  ARG A HD2  1  
ATOM   2038   H HD3  . ARG A 1 136 ? -25.766 28.153 -5.548  0.010 36.19  ? 136  ARG A HD3  1  
ATOM   2039   H HE   . ARG A 1 136 ? -27.086 26.688 -4.673  0.010 37.34  ? 136  ARG A HE   1  
ATOM   2040   H HH11 . ARG A 1 136 ? -24.651 26.997 -2.450  0.010 38.77  ? 136  ARG A HH11 1  
ATOM   2041   H HH12 . ARG A 1 136 ? -25.346 26.262 -1.358  0.010 40.37  ? 136  ARG A HH12 1  
ATOM   2042   H HH21 . ARG A 1 136 ? -28.202 25.698 -2.915  0.010 39.95  ? 136  ARG A HH21 1  
ATOM   2043   H HH22 . ARG A 1 136 ? -27.473 25.484 -1.635  0.010 41.08  ? 136  ARG A HH22 1  
ATOM   2044   N N    . ARG A 1 137 ? -19.368 26.188 -4.544  0.010 34.14  ? 137  ARG A N    1  
ATOM   2045   C CA   . ARG A 1 137 ? -17.962 26.121 -4.867  0.010 33.47  ? 137  ARG A CA   1  
ATOM   2046   C C    . ARG A 1 137 ? -17.642 27.345 -5.675  0.010 33.85  ? 137  ARG A C    1  
ATOM   2047   O O    . ARG A 1 137 ? -18.383 28.295 -5.628  0.010 35.45  ? 137  ARG A O    1  
ATOM   2048   C CB   . ARG A 1 137 ? -17.690 24.842 -5.656  0.010 31.04  ? 137  ARG A CB   1  
ATOM   2049   C CG   . ARG A 1 137 ? -18.371 23.669 -5.029  0.010 30.87  ? 137  ARG A CG   1  
ATOM   2050   C CD   . ARG A 1 137 ? -19.188 22.866 -5.956  0.010 29.11  ? 137  ARG A CD   1  
ATOM   2051   N NE   . ARG A 1 137 ? -18.876 21.505 -5.603  0.010 28.78  ? 137  ARG A NE   1  
ATOM   2052   C CZ   . ARG A 1 137 ? -19.708 20.477 -5.617  0.010 28.40  ? 137  ARG A CZ   1  
ATOM   2053   N NH1  . ARG A 1 137 ? -20.959 20.560 -6.068  0.010 28.12  ? 137  ARG A NH1  1  
ATOM   2054   N NH2  . ARG A 1 137 ? -19.227 19.324 -5.213  0.010 28.41  ? 137  ARG A NH2  1  
ATOM   2055   H H    . ARG A 1 137 ? -19.462 26.341 -3.713  0.010 35.23  ? 137  ARG A H    1  
ATOM   2056   H HA   . ARG A 1 137 ? -17.433 26.111 -4.062  0.010 34.46  ? 137  ARG A HA   1  
ATOM   2057   H HB2  . ARG A 1 137 ? -17.969 24.929 -6.579  0.010 30.13  ? 137  ARG A HB2  1  
ATOM   2058   H HB3  . ARG A 1 137 ? -16.737 24.660 -5.614  0.010 30.63  ? 137  ARG A HB3  1  
ATOM   2059   H HG2  . ARG A 1 137 ? -17.681 23.086 -4.673  0.010 30.83  ? 137  ARG A HG2  1  
ATOM   2060   H HG3  . ARG A 1 137 ? -18.949 23.945 -4.302  0.010 32.17  ? 137  ARG A HG3  1  
ATOM   2061   H HD2  . ARG A 1 137 ? -20.131 23.038 -5.809  0.010 29.53  ? 137  ARG A HD2  1  
ATOM   2062   H HD3  . ARG A 1 137 ? -18.931 23.030 -6.874  0.010 27.97  ? 137  ARG A HD3  1  
ATOM   2063   H HE   . ARG A 1 137 ? -18.042 21.298 -5.629  0.010 28.55  ? 137  ARG A HE   1  
ATOM   2064   H HH11 . ARG A 1 137 ? -21.281 21.313 -6.331  0.010 28.19  ? 137  ARG A HH11 1  
ATOM   2065   H HH12 . ARG A 1 137 ? -21.454 19.858 -6.077  0.010 27.96  ? 137  ARG A HH12 1  
ATOM   2066   H HH21 . ARG A 1 137 ? -18.413 19.280 -4.939  0.010 28.65  ? 137  ARG A HH21 1  
ATOM   2067   H HH22 . ARG A 1 137 ? -19.719 18.621 -5.233  0.010 28.26  ? 137  ARG A HH22 1  
ATOM   2068   N N    . PRO A 1 138 ? -16.511 27.347 -6.392  0.010 32.56  ? 138  PRO A N    1  
ATOM   2069   C CA   . PRO A 1 138 ? -16.758 28.111 -7.612  0.010 31.97  ? 138  PRO A CA   1  
ATOM   2070   C C    . PRO A 1 138 ? -17.952 27.491 -8.355  0.010 30.55  ? 138  PRO A C    1  
ATOM   2071   O O    . PRO A 1 138 ? -17.928 26.293 -8.628  0.010 29.02  ? 138  PRO A O    1  
ATOM   2072   C CB   . PRO A 1 138 ? -15.462 27.924 -8.416  0.010 30.71  ? 138  PRO A CB   1  
ATOM   2073   C CG   . PRO A 1 138 ? -14.579 27.020 -7.575  0.010 30.56  ? 138  PRO A CG   1  
ATOM   2074   C CD   . PRO A 1 138 ? -15.077 27.120 -6.175  0.010 32.40  ? 138  PRO A CD   1  
ATOM   2075   H HA   . PRO A 1 138 ? -16.907 29.052 -7.423  0.010 33.33  ? 138  PRO A HA   1  
ATOM   2076   H HB2  . PRO A 1 138 ? -15.663 27.502 -9.266  0.010 29.34  ? 138  PRO A HB2  1  
ATOM   2077   H HB3  . PRO A 1 138 ? -15.040 28.786 -8.553  0.010 31.58  ? 138  PRO A HB3  1  
ATOM   2078   H HG2  . PRO A 1 138 ? -14.683 26.115 -7.891  0.010 29.21  ? 138  PRO A HG2  1  
ATOM   2079   H HG3  . PRO A 1 138 ? -13.658 27.301 -7.640  0.010 30.82  ? 138  PRO A HG3  1  
ATOM   2080   H HD2  . PRO A 1 138 ? -14.930 26.288 -5.695  0.010 32.06  ? 138  PRO A HD2  1  
ATOM   2081   H HD3  . PRO A 1 138 ? -14.669 27.874 -5.726  0.010 33.83  ? 138  PRO A HD3  1  
ATOM   2082   N N    . ASP A 1 139 ? -18.964 28.276 -8.698  0.010 31.16  ? 139  ASP A N    1  
ATOM   2083   C CA   . ASP A 1 139 ? -20.132 27.687 -9.354  0.010 30.08  ? 139  ASP A CA   1  
ATOM   2084   C C    . ASP A 1 139 ? -19.979 27.509 -10.866 0.010 28.37  ? 139  ASP A C    1  
ATOM   2085   O O    . ASP A 1 139 ? -20.442 26.521 -11.409 0.010 27.00  ? 139  ASP A O    1  
ATOM   2086   C CB   . ASP A 1 139 ? -21.389 28.495 -9.057  0.010 31.59  ? 139  ASP A CB   1  
ATOM   2087   C CG   . ASP A 1 139 ? -22.602 27.941 -9.772  0.010 30.67  ? 139  ASP A CG   1  
ATOM   2088   O OD1  . ASP A 1 139 ? -23.070 26.829 -9.399  0.010 29.98  ? 139  ASP A OD1  1  
ATOM   2089   O OD2  . ASP A 1 139 ? -23.068 28.610 -10.713 0.010 30.82  ? 139  ASP A OD2  1  
ATOM   2090   H H    . ASP A 1 139 ? -19.007 29.124 -8.568  0.010 32.23  ? 139  ASP A H    1  
ATOM   2091   H HA   . ASP A 1 139 ? -20.282 26.804 -8.983  0.010 29.61  ? 139  ASP A HA   1  
ATOM   2092   H HB2  . ASP A 1 139 ? -21.561 28.474 -8.107  0.010 32.64  ? 139  ASP A HB2  1  
ATOM   2093   H HB3  . ASP A 1 139 ? -21.253 29.409 -9.350  0.010 32.31  ? 139  ASP A HB3  1  
ATOM   2094   N N    . SER A 1 140 ? -19.353 28.466 -11.541 0.010 28.66  ? 140  SER A N    1  
ATOM   2095   C CA   . SER A 1 140 ? -19.157 28.398 -12.989 0.010 27.43  ? 140  SER A CA   1  
ATOM   2096   C C    . SER A 1 140 ? -17.720 27.998 -13.338 0.010 26.44  ? 140  SER A C    1  
ATOM   2097   O O    . SER A 1 140 ? -16.806 28.235 -12.569 0.010 27.11  ? 140  SER A O    1  
ATOM   2098   C CB   . SER A 1 140 ? -19.508 29.727 -13.654 0.010 28.64  ? 140  SER A CB   1  
ATOM   2099   O OG   . SER A 1 140 ? -20.916 29.907 -13.655 0.010 29.31  ? 140  SER A OG   1  
ATOM   2100   H H    . SER A 1 140 ? -19.026 29.174 -11.180 0.010 29.70  ? 140  SER A H    1  
ATOM   2101   H HA   . SER A 1 140 ? -19.748 27.731 -13.363 0.010 26.62  ? 140  SER A HA   1  
ATOM   2102   H HB2  . SER A 1 140 ? -19.089 30.453 -13.166 0.010 29.74  ? 140  SER A HB2  1  
ATOM   2103   H HB3  . SER A 1 140 ? -19.191 29.717 -14.568 0.010 28.00  ? 140  SER A HB3  1  
ATOM   2104   H HG   . SER A 1 140 ? -21.297 29.232 -14.005 0.010 28.44  ? 140  SER A HG   1  
ATOM   2105   N N    . LEU A 1 141 ? -17.566 27.386 -14.506 0.010 25.01  ? 141  LEU A N    1  
ATOM   2106   C CA   . LEU A 1 141 ? -16.282 26.853 -14.976 0.010 23.96  ? 141  LEU A CA   1  
ATOM   2107   C C    . LEU A 1 141 ? -15.204 27.938 -15.029 0.010 24.92  ? 141  LEU A C    1  
ATOM   2108   O O    . LEU A 1 141 ? -15.440 29.044 -15.536 0.010 25.89  ? 141  LEU A O    1  
ATOM   2109   C CB   . LEU A 1 141 ? -16.424 26.275 -16.366 0.010 22.70  ? 141  LEU A CB   1  
ATOM   2110   C CG   . LEU A 1 141 ? -15.235 25.483 -16.951 0.010 21.52  ? 141  LEU A CG   1  
ATOM   2111   C CD1  . LEU A 1 141 ? -14.894 24.201 -16.183 0.010 20.76  ? 141  LEU A CD1  1  
ATOM   2112   C CD2  . LEU A 1 141 ? -15.524 25.182 -18.397 0.010 20.77  ? 141  LEU A CD2  1  
ATOM   2113   H H    . LEU A 1 141 ? -18.207 27.265 -15.064 0.010 24.70  ? 141  LEU A H    1  
ATOM   2114   H HA   . LEU A 1 141 ? -15.991 26.139 -14.386 0.010 23.58  ? 141  LEU A HA   1  
ATOM   2115   H HB2  . LEU A 1 141 ? -17.191 25.685 -16.359 0.010 22.30  ? 141  LEU A HB2  1  
ATOM   2116   H HB3  . LEU A 1 141 ? -16.598 27.007 -16.974 0.010 23.18  ? 141  LEU A HB3  1  
ATOM   2117   H HG   . LEU A 1 141 ? -14.443 26.044 -16.922 0.010 21.95  ? 141  LEU A HG   1  
ATOM   2118   H HD11 . LEU A 1 141 ? -15.702 23.680 -16.052 0.010 20.70  ? 141  LEU A HD11 1  
ATOM   2119   H HD12 . LEU A 1 141 ? -14.251 23.687 -16.698 0.010 19.94  ? 141  LEU A HD12 1  
ATOM   2120   H HD13 . LEU A 1 141 ? -14.510 24.437 -15.325 0.010 21.29  ? 141  LEU A HD13 1  
ATOM   2121   H HD21 . LEU A 1 141 ? -16.481 25.070 -18.500 0.010 20.67  ? 141  LEU A HD21 1  
ATOM   2122   H HD22 . LEU A 1 141 ? -15.218 25.921 -18.945 0.010 21.31  ? 141  LEU A HD22 1  
ATOM   2123   H HD23 . LEU A 1 141 ? -15.067 24.366 -18.654 0.010 20.00  ? 141  LEU A HD23 1  
ATOM   2124   N N    . GLN A 1 142 ? -14.025 27.578 -14.541 0.010 24.73  ? 142  GLN A N    1  
ATOM   2125   C CA   . GLN A 1 142 ? -12.877 28.473 -14.520 0.010 25.68  ? 142  GLN A CA   1  
ATOM   2126   C C    . GLN A 1 142 ? -11.806 27.909 -15.453 0.010 24.45  ? 142  GLN A C    1  
ATOM   2127   O O    . GLN A 1 142 ? -11.854 26.757 -15.841 0.010 22.99  ? 142  GLN A O    1  
ATOM   2128   C CB   . GLN A 1 142 ? -12.295 28.590 -13.101 0.010 26.84  ? 142  GLN A CB   1  
ATOM   2129   C CG   . GLN A 1 142 ? -13.235 29.105 -11.979 0.010 28.33  ? 142  GLN A CG   1  
ATOM   2130   C CD   . GLN A 1 142 ? -13.910 30.396 -12.296 0.010 29.64  ? 142  GLN A CD   1  
ATOM   2131   O OE1  . GLN A 1 142 ? -15.145 30.464 -12.427 0.010 29.45  ? 142  GLN A OE1  1  
ATOM   2132   N NE2  . GLN A 1 142 ? -13.127 31.451 -12.389 0.010 31.18  ? 142  GLN A NE2  1  
ATOM   2133   H H    . GLN A 1 142 ? -13.864 26.802 -14.216 0.010 24.14  ? 142  GLN A H    1  
ATOM   2134   H HA   . GLN A 1 142 ? -13.136 29.350 -14.829 0.010 26.53  ? 142  GLN A HA   1  
ATOM   2135   H HB2  . GLN A 1 142 ? -12.019 27.700 -12.833 0.010 26.05  ? 142  GLN A HB2  1  
ATOM   2136   H HB3  . GLN A 1 142 ? -11.519 29.170 -13.127 0.010 27.58  ? 142  GLN A HB3  1  
ATOM   2137   H HG2  . GLN A 1 142 ? -13.928 28.445 -11.831 0.010 27.66  ? 142  GLN A HG2  1  
ATOM   2138   H HG3  . GLN A 1 142 ? -12.723 29.234 -11.167 0.010 29.25  ? 142  GLN A HG3  1  
ATOM   2139   H HE21 . GLN A 1 142 ? -12.381 31.470 -11.964 0.010 31.72  ? 142  GLN A HE21 1  
ATOM   2140   H HE22 . GLN A 1 142 ? -13.371 32.124 -12.861 0.010 31.75  ? 142  GLN A HE22 1  
ATOM   2141   N N    . HIS A 1 143 ? -10.829 28.713 -15.825 0.010 25.18  ? 143  HIS A N    1  
ATOM   2142   C CA   . HIS A 1 143 ? -9.684  28.159 -16.522 0.010 24.23  ? 143  HIS A CA   1  
ATOM   2143   C C    . HIS A 1 143 ? -8.473  29.027 -16.282 0.010 25.51  ? 143  HIS A C    1  
ATOM   2144   O O    . HIS A 1 143 ? -8.577  30.143 -15.805 0.010 27.19  ? 143  HIS A O    1  
ATOM   2145   C CB   . HIS A 1 143 ? -9.920  28.122 -18.022 0.010 23.57  ? 143  HIS A CB   1  
ATOM   2146   C CG   . HIS A 1 143 ? -9.734  29.454 -18.674 0.010 24.98  ? 143  HIS A CG   1  
ATOM   2147   N ND1  . HIS A 1 143 ? -8.749  29.705 -19.606 0.010 25.12  ? 143  HIS A ND1  1  
ATOM   2148   C CD2  . HIS A 1 143 ? -10.374 30.633 -18.474 0.010 26.53  ? 143  HIS A CD2  1  
ATOM   2149   C CE1  . HIS A 1 143 ? -8.822  30.972 -19.983 0.010 26.71  ? 143  HIS A CE1  1  
ATOM   2150   N NE2  . HIS A 1 143 ? -9.792  31.555 -19.305 0.010 27.59  ? 143  HIS A NE2  1  
ATOM   2151   H H    . HIS A 1 143 ? -10.805 29.562 -15.700 0.010 26.29  ? 143  HIS A H    1  
ATOM   2152   H HA   . HIS A 1 143 ? -9.505  27.269 -16.193 0.010 23.39  ? 143  HIS A HA   1  
ATOM   2153   H HB2  . HIS A 1 143 ? -9.305  27.496 -18.428 0.010 22.76  ? 143  HIS A HB2  1  
ATOM   2154   H HB3  . HIS A 1 143 ? -10.831 27.843 -18.189 0.010 23.18  ? 143  HIS A HB3  1  
ATOM   2155   H HD1  . HIS A 1 143 ? -8.196  29.126 -19.914 0.010 24.38  ? 143  HIS A HD1  1  
ATOM   2156   H HD2  . HIS A 1 143 ? -11.082 30.783 -17.893 0.010 26.91  ? 143  HIS A HD2  1  
ATOM   2157   H HE1  . HIS A 1 143 ? -8.278  31.394 -20.607 0.010 27.23  ? 143  HIS A HE1  1  
ATOM   2158   H HE2  . HIS A 1 143 ? -10.024 32.377 -19.377 0.010 28.73  ? 143  HIS A HE2  1  
ATOM   2159   N N    . VAL A 1 144 ? -7.323  28.491 -16.649 0.010 24.84  ? 144  VAL A N    1  
ATOM   2160   C CA   . VAL A 1 144 ? -6.124  29.314 -16.702 0.010 26.05  ? 144  VAL A CA   1  
ATOM   2161   C C    . VAL A 1 144 ? -5.109  28.731 -17.685 0.010 25.05  ? 144  VAL A C    1  
ATOM   2162   O O    . VAL A 1 144 ? -5.177  27.526 -18.019 0.010 23.46  ? 144  VAL A O    1  
ATOM   2163   C CB   . VAL A 1 144 ? -5.545  29.564 -15.293 0.010 27.33  ? 144  VAL A CB   1  
ATOM   2164   C CG1  . VAL A 1 144 ? -5.316  28.284 -14.528 0.010 26.29  ? 144  VAL A CG1  1  
ATOM   2165   C CG2  . VAL A 1 144 ? -4.256  30.430 -15.367 0.010 28.72  ? 144  VAL A CG2  1  
ATOM   2166   H H    . VAL A 1 144 ? -7.214  27.671 -16.871 0.010 23.79  ? 144  VAL A H    1  
ATOM   2167   H HA   . VAL A 1 144 ? -6.381  30.181 -17.052 0.010 26.94  ? 144  VAL A HA   1  
ATOM   2168   H HB   . VAL A 1 144 ? -6.197  30.075 -14.787 0.010 28.23  ? 144  VAL A HB   1  
ATOM   2169   H HG11 . VAL A 1 144 ? -5.740  27.538 -14.979 0.010 24.96  ? 144  VAL A HG11 1  
ATOM   2170   H HG12 . VAL A 1 144 ? -4.362  28.128 -14.460 0.010 26.78  ? 144  VAL A HG12 1  
ATOM   2171   H HG13 . VAL A 1 144 ? -5.690  28.398 -13.640 0.010 26.67  ? 144  VAL A HG13 1  
ATOM   2172   H HG21 . VAL A 1 144 ? -4.318  31.043 -16.111 0.010 29.21  ? 144  VAL A HG21 1  
ATOM   2173   H HG22 . VAL A 1 144 ? -4.167  30.927 -14.538 0.010 29.94  ? 144  VAL A HG22 1  
ATOM   2174   H HG23 . VAL A 1 144 ? -3.488  29.852 -15.482 0.010 27.98  ? 144  VAL A HG23 1  
ATOM   2175   N N    . LEU A 1 145 ? -4.259  29.607 -18.232 0.010 26.11  ? 145  LEU A N    1  
ATOM   2176   C CA   . LEU A 1 145 ? -3.188  29.184 -19.128 0.010 25.48  ? 145  LEU A CA   1  
ATOM   2177   C C    . LEU A 1 145 ? -1.925  29.070 -18.303 0.010 26.04  ? 145  LEU A C    1  
ATOM   2178   O O    . LEU A 1 145 ? -1.560  30.007 -17.596 0.010 27.74  ? 145  LEU A O    1  
ATOM   2179   C CB   . LEU A 1 145 ? -2.984  30.151 -20.307 0.010 26.43  ? 145  LEU A CB   1  
ATOM   2180   C CG   . LEU A 1 145 ? -2.957  29.525 -21.706 0.010 25.42  ? 145  LEU A CG   1  
ATOM   2181   C CD1  . LEU A 1 145 ? -4.403  29.191 -22.109 0.010 24.59  ? 145  LEU A CD1  1  
ATOM   2182   C CD2  . LEU A 1 145 ? -2.241  30.428 -22.760 0.010 26.84  ? 145  LEU A CD2  1  
ATOM   2183   H H    . LEU A 1 145 ? -4.285  30.452 -18.096 0.010 27.29  ? 145  LEU A H    1  
ATOM   2184   H HA   . LEU A 1 145 ? -3.409  28.320 -19.488 0.010 24.23  ? 145  LEU A HA   1  
ATOM   2185   H HB2  . LEU A 1 145 ? -3.703  30.802 -20.299 0.010 26.91  ? 145  LEU A HB2  1  
ATOM   2186   H HB3  . LEU A 1 145 ? -2.140  30.609 -20.181 0.010 27.51  ? 145  LEU A HB3  1  
ATOM   2187   H HG   . LEU A 1 145 ? -2.461  28.694 -21.662 0.010 24.54  ? 145  LEU A HG   1  
ATOM   2188   H HD11 . LEU A 1 145 ? -4.917  30.011 -22.139 0.010 25.54  ? 145  LEU A HD11 1  
ATOM   2189   H HD12 . LEU A 1 145 ? -4.404  28.769 -22.982 0.010 23.93  ? 145  LEU A HD12 1  
ATOM   2190   H HD13 . LEU A 1 145 ? -4.776  28.590 -21.446 0.010 23.95  ? 145  LEU A HD13 1  
ATOM   2191   H HD21 . LEU A 1 145 ? -1.448  30.814 -22.355 0.010 27.54  ? 145  LEU A HD21 1  
ATOM   2192   H HD22 . LEU A 1 145 ? -1.981  29.889 -23.523 0.010 26.29  ? 145  LEU A HD22 1  
ATOM   2193   H HD23 . LEU A 1 145 ? -2.846  31.134 -23.042 0.010 27.72  ? 145  LEU A HD23 1  
ATOM   2194   N N    . LEU A 1 146 ? -1.298  27.904 -18.361 0.010 24.77  ? 146  LEU A N    1  
ATOM   2195   C CA   . LEU A 1 146 ? -0.068  27.621 -17.613 0.010 25.19  ? 146  LEU A CA   1  
ATOM   2196   C C    . LEU A 1 146 ? 1.049   27.183 -18.569 0.010 24.74  ? 146  LEU A C    1  
ATOM   2197   O O    . LEU A 1 146 ? 0.819   26.409 -19.480 0.010 23.45  ? 146  LEU A O    1  
ATOM   2198   C CB   . LEU A 1 146 ? -0.307  26.513 -16.573 0.010 24.29  ? 146  LEU A CB   1  
ATOM   2199   C CG   . LEU A 1 146 ? -1.456  26.657 -15.545 0.010 24.54  ? 146  LEU A CG   1  
ATOM   2200   C CD1  . LEU A 1 146 ? -1.815  25.290 -14.949 0.010 23.36  ? 146  LEU A CD1  1  
ATOM   2201   C CD2  . LEU A 1 146 ? -1.116  27.655 -14.422 0.010 26.59  ? 146  LEU A CD2  1  
ATOM   2202   H H    . LEU A 1 146 ? -1.576  27.243 -18.832 0.010 23.71  ? 146  LEU A H    1  
ATOM   2203   H HA   . LEU A 1 146 ? 0.205   28.420 -17.143 0.010 26.52  ? 146  LEU A HA   1  
ATOM   2204   H HB2  . LEU A 1 146 ? -0.454  25.681 -17.048 0.010 23.08  ? 146  LEU A HB2  1  
ATOM   2205   H HB3  . LEU A 1 146 ? 0.510   26.427 -16.059 0.010 24.83  ? 146  LEU A HB3  1  
ATOM   2206   H HG   . LEU A 1 146 ? -2.243  26.992 -16.003 0.010 24.30  ? 146  LEU A HG   1  
ATOM   2207   H HD11 . LEU A 1 146 ? -1.057  24.694 -15.051 0.010 23.01  ? 146  LEU A HD11 1  
ATOM   2208   H HD12 . LEU A 1 146 ? -2.025  25.393 -14.009 0.010 24.05  ? 146  LEU A HD12 1  
ATOM   2209   H HD13 . LEU A 1 146 ? -2.582  24.929 -15.418 0.010 22.40  ? 146  LEU A HD13 1  
ATOM   2210   H HD21 . LEU A 1 146 ? -0.612  28.397 -14.790 0.010 27.44  ? 146  LEU A HD21 1  
ATOM   2211   H HD22 . LEU A 1 146 ? -1.937  27.981 -14.024 0.010 26.80  ? 146  LEU A HD22 1  
ATOM   2212   H HD23 . LEU A 1 146 ? -0.587  27.194 -13.752 0.010 26.96  ? 146  LEU A HD23 1  
ATOM   2213   N N    . PRO A 1 147 ? 2.271   27.683 -18.363 0.010 25.96  ? 147  PRO A N    1  
ATOM   2214   C CA   . PRO A 1 147 ? 3.384   27.215 -19.193 0.010 25.60  ? 147  PRO A CA   1  
ATOM   2215   C C    . PRO A 1 147 ? 3.864   25.824 -18.740 0.010 24.41  ? 147  PRO A C    1  
ATOM   2216   O O    . PRO A 1 147 ? 3.952   25.552 -17.550 0.010 24.71  ? 147  PRO A O    1  
ATOM   2217   C CB   . PRO A 1 147 ? 4.487   28.226 -18.895 0.010 27.55  ? 147  PRO A CB   1  
ATOM   2218   C CG   . PRO A 1 147 ? 4.272   28.559 -17.487 0.010 28.50  ? 147  PRO A CG   1  
ATOM   2219   C CD   . PRO A 1 147 ? 2.739   28.538 -17.266 0.010 27.77  ? 147  PRO A CD   1  
ATOM   2220   H HA   . PRO A 1 147 ? 3.164   27.224 -20.136 0.010 25.19  ? 147  PRO A HA   1  
ATOM   2221   H HB2  . PRO A 1 147 ? 5.349   27.811 -19.027 0.010 27.45  ? 147  PRO A HB2  1  
ATOM   2222   H HB3  . PRO A 1 147 ? 4.391   29.007 -19.457 0.010 28.31  ? 147  PRO A HB3  1  
ATOM   2223   H HG2  . PRO A 1 147 ? 4.712   27.910 -16.921 0.010 28.18  ? 147  PRO A HG2  1  
ATOM   2224   H HG3  . PRO A 1 147 ? 4.619   29.438 -17.329 0.010 29.97  ? 147  PRO A HG3  1  
ATOM   2225   H HD2  . PRO A 1 147 ? 2.517   28.131 -16.414 0.010 27.58  ? 147  PRO A HD2  1  
ATOM   2226   H HD3  . PRO A 1 147 ? 2.361   29.426 -17.348 0.010 28.74  ? 147  PRO A HD3  1  
ATOM   2227   N N    . VAL A 1 148 ? 4.202   24.976 -19.689 0.010 23.32  ? 148  VAL A N    1  
ATOM   2228   C CA   . VAL A 1 148 ? 4.745   23.680 -19.342 0.010 22.42  ? 148  VAL A CA   1  
ATOM   2229   C C    . VAL A 1 148 ? 6.162   23.867 -18.772 0.010 23.58  ? 148  VAL A C    1  
ATOM   2230   O O    . VAL A 1 148 ? 6.940   24.638 -19.322 0.010 24.60  ? 148  VAL A O    1  
ATOM   2231   C CB   . VAL A 1 148 ? 4.776   22.759 -20.583 0.010 21.21  ? 148  VAL A CB   1  
ATOM   2232   C CG1  . VAL A 1 148 ? 5.515   21.522 -20.277 0.010 20.58  ? 148  VAL A CG1  1  
ATOM   2233   C CG2  . VAL A 1 148 ? 3.378   22.444 -21.052 0.010 20.21  ? 148  VAL A CG2  1  
ATOM   2234   H H    . VAL A 1 148 ? 4.132   25.122 -20.529 0.010 23.19  ? 148  VAL A H    1  
ATOM   2235   H HA   . VAL A 1 148 ? 4.200   23.259 -18.659 0.010 22.02  ? 148  VAL A HA   1  
ATOM   2236   H HB   . VAL A 1 148 ? 5.233   23.222 -21.301 0.010 21.69  ? 148  VAL A HB   1  
ATOM   2237   H HG11 . VAL A 1 148 ? 5.103   21.073 -19.521 0.010 19.80  ? 148  VAL A HG11 1  
ATOM   2238   H HG12 . VAL A 1 148 ? 5.515   20.948 -21.059 0.010 20.43  ? 148  VAL A HG12 1  
ATOM   2239   H HG13 . VAL A 1 148 ? 6.423   21.768 -20.066 0.010 21.21  ? 148  VAL A HG13 1  
ATOM   2240   H HG21 . VAL A 1 148 ? 2.756   22.655 -20.340 0.010 20.21  ? 148  VAL A HG21 1  
ATOM   2241   H HG22 . VAL A 1 148 ? 3.174   22.974 -21.837 0.010 20.52  ? 148  VAL A HG22 1  
ATOM   2242   H HG23 . VAL A 1 148 ? 3.325   21.500 -21.269 0.010 19.39  ? 148  VAL A HG23 1  
ATOM   2243   N N    . LEU A 1 149 ? 6.440   23.177 -17.664 0.010 23.57  ? 149  LEU A N    1  
ATOM   2244   C CA   . LEU A 1 149 ? 7.739   23.175 -16.999 0.010 24.69  ? 149  LEU A CA   1  
ATOM   2245   C C    . LEU A 1 149 ? 8.560   21.935 -17.394 0.010 23.82  ? 149  LEU A C    1  
ATOM   2246   O O    . LEU A 1 149 ? 8.023   20.824 -17.465 0.010 22.52  ? 149  LEU A O    1  
ATOM   2247   C CB   . LEU A 1 149 ? 7.532   23.212 -15.483 0.010 25.54  ? 149  LEU A CB   1  
ATOM   2248   C CG   . LEU A 1 149 ? 8.733   23.060 -14.559 0.010 26.72  ? 149  LEU A CG   1  
ATOM   2249   C CD1  . LEU A 1 149 ? 9.712   24.212 -14.729 0.010 28.40  ? 149  LEU A CD1  1  
ATOM   2250   C CD2  . LEU A 1 149 ? 8.298   22.996 -13.110 0.010 27.63  ? 149  LEU A CD2  1  
ATOM   2251   H H    . LEU A 1 149 ? 5.871   22.683 -17.260 0.010 23.00  ? 149  LEU A H    1  
ATOM   2252   H HA   . LEU A 1 149 ? 8.237   23.962 -17.259 0.010 25.65  ? 149  LEU A HA   1  
ATOM   2253   H HB2  . LEU A 1 149 ? 7.114   24.056 -15.259 0.010 26.36  ? 149  LEU A HB2  1  
ATOM   2254   H HB3  . LEU A 1 149 ? 6.919   22.497 -15.258 0.010 24.64  ? 149  LEU A HB3  1  
ATOM   2255   H HG   . LEU A 1 149 ? 9.186   22.229 -14.773 0.010 25.99  ? 149  LEU A HG   1  
ATOM   2256   H HD11 . LEU A 1 149 ? 9.907   24.325 -15.672 0.010 27.92  ? 149  LEU A HD11 1  
ATOM   2257   H HD12 . LEU A 1 149 ? 9.312   25.022 -14.378 0.010 29.33  ? 149  LEU A HD12 1  
ATOM   2258   H HD13 . LEU A 1 149 ? 10.523  24.002 -14.241 0.010 29.12  ? 149  LEU A HD13 1  
ATOM   2259   H HD21 . LEU A 1 149 ? 7.621   22.307 -13.012 0.010 26.64  ? 149  LEU A HD21 1  
ATOM   2260   H HD22 . LEU A 1 149 ? 9.067   22.783 -12.560 0.010 28.51  ? 149  LEU A HD22 1  
ATOM   2261   H HD23 . LEU A 1 149 ? 7.940   23.859 -12.851 0.010 28.44  ? 149  LEU A HD23 1  
ATOM   2262   N N    . ASP A 1 150 ? 9.852   22.111 -17.668 0.010 24.66  ? 150  ASP A N    1  
ATOM   2263   C CA   . ASP A 1 150 ? 10.679  20.961 -18.022 0.010 24.04  ? 150  ASP A CA   1  
ATOM   2264   C C    . ASP A 1 150 ? 10.712  19.932 -16.882 0.010 23.82  ? 150  ASP A C    1  
ATOM   2265   O O    . ASP A 1 150 ? 10.778  20.273 -15.714 0.010 24.86  ? 150  ASP A O    1  
ATOM   2266   C CB   . ASP A 1 150 ? 12.095  21.370 -18.449 0.010 25.19  ? 150  ASP A CB   1  
ATOM   2267   C CG   . ASP A 1 150 ? 12.869  22.079 -17.346 0.010 26.98  ? 150  ASP A CG   1  
ATOM   2268   O OD1  . ASP A 1 150 ? 12.673  23.306 -17.171 0.010 28.15  ? 150  ASP A OD1  1  
ATOM   2269   O OD2  . ASP A 1 150 ? 13.683  21.390 -16.684 0.010 27.37  ? 150  ASP A OD2  1  
ATOM   2270   H H    . ASP A 1 150 ? 10.260  22.864 -17.653 0.010 25.65  ? 150  ASP A H    1  
ATOM   2271   H HA   . ASP A 1 150 ? 10.277  20.531 -18.789 0.010 23.07  ? 150  ASP A HA   1  
ATOM   2272   H HB2  . ASP A 1 150 ? 12.585  20.574 -18.693 0.010 24.77  ? 150  ASP A HB2  1  
ATOM   2273   H HB3  . ASP A 1 150 ? 12.041  21.967 -19.209 0.010 25.37  ? 150  ASP A HB3  1  
ATOM   2274   N N    . ARG A 1 151 ? 10.657  18.651 -17.252 0.010 22.66  ? 151  ARG A N    1  
ATOM   2275   C CA   . ARG A 1 151 ? 10.567  17.591 -16.250 0.010 22.48  ? 151  ARG A CA   1  
ATOM   2276   C C    . ARG A 1 151 ? 11.748  17.618 -15.299 0.010 23.94  ? 151  ARG A C    1  
ATOM   2277   O O    . ARG A 1 151 ? 11.605  17.366 -14.116 0.010 24.57  ? 151  ARG A O    1  
ATOM   2278   C CB   . ARG A 1 151 ? 10.441  16.190 -16.897 0.010 21.26  ? 151  ARG A CB   1  
ATOM   2279   C CG   . ARG A 1 151 ? 10.142  15.069 -15.902 0.010 21.14  ? 151  ARG A CG   1  
ATOM   2280   C CD   . ARG A 1 151 ? 9.970   13.713 -16.610 0.010 20.13  ? 151  ARG A CD   1  
ATOM   2281   N NE   . ARG A 1 151 ? 8.784   13.732 -17.428 0.010 19.04  ? 151  ARG A NE   1  
ATOM   2282   C CZ   . ARG A 1 151 ? 8.732   13.906 -18.749 0.010 18.51  ? 151  ARG A CZ   1  
ATOM   2283   N NH1  . ARG A 1 151 ? 9.811   13.998 -19.487 0.010 18.91  ? 151  ARG A NH1  1  
ATOM   2284   N NH2  . ARG A 1 151 ? 7.562   13.955 -19.354 0.010 17.72  ? 151  ARG A NH2  1  
ATOM   2285   H H    . ARG A 1 151 ? 10.662  18.376 -18.065 0.010 22.09  ? 151  ARG A H    1  
ATOM   2286   H HA   . ARG A 1 151 ? 9.768   17.739 -15.722 0.010 22.38  ? 151  ARG A HA   1  
ATOM   2287   H HB2  . ARG A 1 151 ? 9.727   16.206 -17.551 0.010 20.49  ? 151  ARG A HB2  1  
ATOM   2288   H HB3  . ARG A 1 151 ? 11.278  15.969 -17.338 0.010 21.47  ? 151  ARG A HB3  1  
ATOM   2289   H HG2  . ARG A 1 151 ? 10.859  14.995 -15.259 0.010 21.98  ? 151  ARG A HG2  1  
ATOM   2290   H HG3  . ARG A 1 151 ? 9.315   15.276 -15.442 0.010 21.02  ? 151  ARG A HG3  1  
ATOM   2291   H HD2  . ARG A 1 151 ? 10.740  13.512 -17.157 0.010 20.24  ? 151  ARG A HD2  1  
ATOM   2292   H HD3  . ARG A 1 151 ? 9.852   13.028 -15.939 0.010 20.25  ? 151  ARG A HD3  1  
ATOM   2293   H HE   . ARG A 1 151 ? 8.041   13.619 -17.019 0.010 18.79  ? 151  ARG A HE   1  
ATOM   2294   H HH11 . ARG A 1 151 ? 10.584  13.982 -19.124 0.010 19.47  ? 151  ARG A HH11 1  
ATOM   2295   H HH12 . ARG A 1 151 ? 9.731   14.095 -20.337 0.010 18.67  ? 151  ARG A HH12 1  
ATOM   2296   H HH21 . ARG A 1 151 ? 6.841   13.881 -18.900 0.010 17.49  ? 151  ARG A HH21 1  
ATOM   2297   H HH22 . ARG A 1 151 ? 7.523   14.036 -20.206 0.010 17.51  ? 151  ARG A HH22 1  
ATOM   2298   N N    . ALA A 1 152 ? 12.916  17.932 -15.840 0.010 24.63  ? 152  ALA A N    1  
ATOM   2299   C CA   . ALA A 1 152 ? 14.120  17.927 -15.051 0.010 26.11  ? 152  ALA A CA   1  
ATOM   2300   C C    . ALA A 1 152 ? 13.962  18.860 -13.837 0.010 27.60  ? 152  ALA A C    1  
ATOM   2301   O O    . ALA A 1 152 ? 14.157  18.464 -12.697 0.010 28.51  ? 152  ALA A O    1  
ATOM   2302   C CB   . ALA A 1 152 ? 15.309  18.345 -15.938 0.010 26.75  ? 152  ALA A CB   1  
ATOM   2303   H H    . ALA A 1 152 ? 13.031  18.149 -16.662 0.010 24.35  ? 152  ALA A H    1  
ATOM   2304   H HA   . ALA A 1 152 ? 14.281  17.032 -14.723 0.010 25.92  ? 152  ALA A HA   1  
ATOM   2305   H HB1  . ALA A 1 152 ? 15.075  19.146 -16.428 0.010 26.72  ? 152  ALA A HB1  1  
ATOM   2306   H HB2  . ALA A 1 152 ? 16.078  18.513 -15.376 0.010 27.96  ? 152  ALA A HB2  1  
ATOM   2307   H HB3  . ALA A 1 152 ? 15.502  17.631 -16.563 0.010 26.09  ? 152  ALA A HB3  1  
ATOM   2308   N N    . THR A 1 153 ? 13.556  20.095 -14.105 0.010 28.00  ? 153  THR A N    1  
ATOM   2309   C CA   . THR A 1 153 ? 13.424  21.085 -13.046 0.010 29.65  ? 153  THR A CA   1  
ATOM   2310   C C    . THR A 1 153 ? 12.256  20.716 -12.113 0.010 29.27  ? 153  THR A C    1  
ATOM   2311   O O    . THR A 1 153 ? 12.335  20.868 -10.903 0.010 30.73  ? 153  THR A O    1  
ATOM   2312   C CB   . THR A 1 153 ? 13.245  22.493 -13.640 0.010 30.25  ? 153  THR A CB   1  
ATOM   2313   O OG1  . THR A 1 153 ? 14.331  22.771 -14.538 0.010 30.83  ? 153  THR A OG1  1  
ATOM   2314   C CG2  . THR A 1 153 ? 13.247  23.544 -12.534 0.010 32.23  ? 153  THR A CG2  1  
ATOM   2315   H H    . THR A 1 153 ? 13.348  20.381 -14.888 0.010 27.44  ? 153  THR A H    1  
ATOM   2316   H HA   . THR A 1 153 ? 14.234  21.086 -12.519 0.010 30.84  ? 153  THR A HA   1  
ATOM   2317   H HB   . THR A 1 153 ? 12.404  22.548 -14.119 0.010 29.15  ? 153  THR A HB   1  
ATOM   2318   H HG1  . THR A 1 153 ? 14.384  23.604 -14.689 0.010 31.90  ? 153  THR A HG1  1  
ATOM   2319   H HG21 . THR A 1 153 ? 13.962  23.358 -11.907 0.010 33.36  ? 153  THR A HG21 1  
ATOM   2320   H HG22 . THR A 1 153 ? 13.380  24.426 -12.915 0.010 32.90  ? 153  THR A HG22 1  
ATOM   2321   H HG23 . THR A 1 153 ? 12.401  23.526 -12.061 0.010 31.86  ? 153  THR A HG23 1  
ATOM   2322   N N    . CYS A 1 154 ? 11.184  20.194 -12.693 0.010 27.46  ? 154  CYS A N    1  
ATOM   2323   C CA   . CYS A 1 154 ? 10.039  19.753 -11.896 0.010 27.06  ? 154  CYS A CA   1  
ATOM   2324   C C    . CYS A 1 154 ? 10.486  18.719 -10.856 0.010 27.69  ? 154  CYS A C    1  
ATOM   2325   O O    . CYS A 1 154 ? 9.958   18.644 -9.752  0.010 28.50  ? 154  CYS A O    1  
ATOM   2326   C CB   . CYS A 1 154 ? 8.941   19.195 -12.794 0.010 25.06  ? 154  CYS A CB   1  
ATOM   2327   S SG   . CYS A 1 154 ? 7.363   19.108 -11.930 0.010 24.86  ? 154  CYS A SG   1  
ATOM   2328   H H    . CYS A 1 154 ? 11.092  20.094 -13.541 0.010 26.55  ? 154  CYS A H    1  
ATOM   2329   H HA   . CYS A 1 154 ? 9.671   20.514 -11.422 0.010 27.88  ? 154  CYS A HA   1  
ATOM   2330   H HB2  . CYS A 1 154 ? 8.826   19.781 -13.558 0.010 24.72  ? 154  CYS A HB2  1  
ATOM   2331   H HB3  . CYS A 1 154 ? 9.182   18.305 -13.092 0.010 24.36  ? 154  CYS A HB3  1  
ATOM   2332   N N    . ASN A 1 155 ? 11.511  17.956 -11.209 0.010 27.54  ? 155  ASN A N    1  
ATOM   2333   C CA   . ASN A 1 155 ? 12.015  16.918 -10.337 0.010 28.25  ? 155  ASN A CA   1  
ATOM   2334   C C    . ASN A 1 155 ? 13.025  17.405 -9.307  0.010 30.54  ? 155  ASN A C    1  
ATOM   2335   O O    . ASN A 1 155 ? 13.602  16.595 -8.596  0.010 31.40  ? 155  ASN A O    1  
ATOM   2336   C CB   . ASN A 1 155 ? 12.645  15.796 -11.161 0.010 27.21  ? 155  ASN A CB   1  
ATOM   2337   C CG   . ASN A 1 155 ? 11.653  14.700 -11.518 0.010 25.60  ? 155  ASN A CG   1  
ATOM   2338   O OD1  . ASN A 1 155 ? 10.852  14.264 -10.684 0.010 25.73  ? 155  ASN A OD1  1  
ATOM   2339   N ND2  . ASN A 1 155 ? 11.692  14.260 -12.770 0.010 24.25  ? 155  ASN A ND2  1  
ATOM   2340   H H    . ASN A 1 155 ? 11.924  18.017 -11.958 0.010 27.10  ? 155  ASN A H    1  
ATOM   2341   H HA   . ASN A 1 155 ? 11.270  16.542 -9.848  0.010 28.05  ? 155  ASN A HA   1  
ATOM   2342   H HB2  . ASN A 1 155 ? 12.991  16.170 -11.986 0.010 26.84  ? 155  ASN A HB2  1  
ATOM   2343   H HB3  . ASN A 1 155 ? 13.367  15.390 -10.659 0.010 28.11  ? 155  ASN A HB3  1  
ATOM   2344   H HD21 . ASN A 1 155 ? 12.225  14.623 -13.336 0.010 24.27  ? 155  ASN A HD21 1  
ATOM   2345   H HD22 . ASN A 1 155 ? 11.186  13.613 -13.015 0.010 23.46  ? 155  ASN A HD22 1  
ATOM   2346   N N    . ARG A 1 156 ? 13.226  18.715 -9.215  0.010 31.74  ? 156  ARG A N    1  
ATOM   2347   C CA   . ARG A 1 156 ? 14.203  19.239 -8.248  0.010 34.21  ? 156  ARG A CA   1  
ATOM   2348   C C    . ARG A 1 156 ? 13.830  18.866 -6.807  0.010 35.54  ? 156  ARG A C    1  
ATOM   2349   O O    . ARG A 1 156 ? 12.679  18.586 -6.499  0.010 34.86  ? 156  ARG A O    1  
ATOM   2350   C CB   . ARG A 1 156 ? 14.421  20.768 -8.389  0.010 35.63  ? 156  ARG A CB   1  
ATOM   2351   C CG   . ARG A 1 156 ? 15.553  21.299 -7.487  0.010 38.41  ? 156  ARG A CG   1  
ATOM   2352   C CD   . ARG A 1 156 ? 16.378  22.432 -8.110  0.010 39.35  ? 156  ARG A CD   1  
ATOM   2353   N NE   . ARG A 1 156 ? 17.620  22.705 -7.373  0.010 42.16  ? 156  ARG A NE   1  
ATOM   2354   C CZ   . ARG A 1 156 ? 18.730  21.970 -7.443  0.010 42.94  ? 156  ARG A CZ   1  
ATOM   2355   N NH1  . ARG A 1 156 ? 18.769  20.892 -8.215  0.010 41.12  ? 156  ARG A NH1  1  
ATOM   2356   N NH2  . ARG A 1 156 ? 19.808  22.302 -6.728  0.010 45.73  ? 156  ARG A NH2  1  
ATOM   2357   H H    . ARG A 1 156 ? 12.826  19.313 -9.687  0.010 31.31  ? 156  ARG A H    1  
ATOM   2358   H HA   . ARG A 1 156 ? 15.054  18.815 -8.435  0.010 34.36  ? 156  ARG A HA   1  
ATOM   2359   H HB2  . ARG A 1 156 ? 14.654  20.968 -9.309  0.010 34.86  ? 156  ARG A HB2  1  
ATOM   2360   H HB3  . ARG A 1 156 ? 13.607  21.234 -8.142  0.010 35.74  ? 156  ARG A HB3  1  
ATOM   2361   H HG2  . ARG A 1 156 ? 15.166  21.631 -6.662  0.010 39.64  ? 156  ARG A HG2  1  
ATOM   2362   H HG3  . ARG A 1 156 ? 16.162  20.568 -7.303  0.010 38.55  ? 156  ARG A HG3  1  
ATOM   2363   H HD2  . ARG A 1 156 ? 16.609  22.189 -9.020  0.010 38.23  ? 156  ARG A HD2  1  
ATOM   2364   H HD3  . ARG A 1 156 ? 15.848  23.243 -8.108  0.010 39.33  ? 156  ARG A HD3  1  
ATOM   2365   H HE   . ARG A 1 156 ? 17.591  23.309 -6.761  0.010 43.51  ? 156  ARG A HE   1  
ATOM   2366   H HH11 . ARG A 1 156 ? 18.082  20.663 -8.677  0.010 39.45  ? 156  ARG A HH11 1  
ATOM   2367   H HH12 . ARG A 1 156 ? 19.488  20.420 -8.255  0.010 41.71  ? 156  ARG A HH12 1  
ATOM   2368   H HH21 . ARG A 1 156 ? 19.796  22.999 -6.224  0.010 47.07  ? 156  ARG A HH21 1  
ATOM   2369   H HH22 . ARG A 1 156 ? 20.521  21.823 -6.778  0.010 46.29  ? 156  ARG A HH22 1  
ATOM   2370   N N    . ARG A 1 157 ? 14.828  18.872 -5.925  0.010 37.64  ? 157  ARG A N    1  
ATOM   2371   C CA   . ARG A 1 157 ? 14.649  18.438 -4.542  0.010 39.33  ? 157  ARG A CA   1  
ATOM   2372   C C    . ARG A 1 157 ? 13.683  19.307 -3.734  0.010 40.52  ? 157  ARG A C    1  
ATOM   2373   O O    . ARG A 1 157 ? 13.347  18.969 -2.592  0.010 41.91  ? 157  ARG A O    1  
ATOM   2374   C CB   . ARG A 1 157 ? 16.011  18.374 -3.831  0.010 41.73  ? 157  ARG A CB   1  
ATOM   2375   C CG   . ARG A 1 157 ? 16.916  17.245 -4.330  0.010 40.95  ? 157  ARG A CG   1  
ATOM   2376   C CD   . ARG A 1 157 ? 18.308  17.210 -3.654  0.010 43.51  ? 157  ARG A CD   1  
ATOM   2377   N NE   . ARG A 1 157 ? 18.282  17.532 -2.226  0.010 46.24  ? 157  ARG A NE   1  
ATOM   2378   C CZ   . ARG A 1 157 ? 19.269  17.275 -1.377  0.010 48.72  ? 157  ARG A CZ   1  
ATOM   2379   N NH1  . ARG A 1 157 ? 20.366  16.652 -1.782  0.010 48.71  ? 157  ARG A NH1  1  
ATOM   2380   N NH2  . ARG A 1 157 ? 19.146  17.618 -0.102  0.010 51.36  ? 157  ARG A NH2  1  
ATOM   2381   H H    . ARG A 1 157 ? 15.630  19.116 -6.107  0.010 38.21  ? 157  ARG A H    1  
ATOM   2382   H HA   . ARG A 1 157 ? 14.279  17.544 -4.558  0.010 38.33  ? 157  ARG A HA   1  
ATOM   2383   H HB2  . ARG A 1 157 ? 16.476  19.213 -3.976  0.010 42.64  ? 157  ARG A HB2  1  
ATOM   2384   H HB3  . ARG A 1 157 ? 15.861  18.243 -2.882  0.010 43.11  ? 157  ARG A HB3  1  
ATOM   2385   H HG2  . ARG A 1 157 ? 16.481  16.395 -4.164  0.010 40.25  ? 157  ARG A HG2  1  
ATOM   2386   H HG3  . ARG A 1 157 ? 17.054  17.360 -5.283  0.010 39.63  ? 157  ARG A HG3  1  
ATOM   2387   H HD2  . ARG A 1 157 ? 18.676  16.317 -3.748  0.010 43.14  ? 157  ARG A HD2  1  
ATOM   2388   H HD3  . ARG A 1 157 ? 18.888  17.852 -4.093  0.010 43.88  ? 157  ARG A HD3  1  
ATOM   2389   H HE   . ARG A 1 157 ? 17.507  17.649 -1.874  0.010 46.18  ? 157  ARG A HE   1  
ATOM   2390   H HH11 . ARG A 1 157 ? 20.454  16.422 -2.602  0.010 47.13  ? 157  ARG A HH11 1  
ATOM   2391   H HH12 . ARG A 1 157 ? 20.994  16.484 -1.219  0.010 50.38  ? 157  ARG A HH12 1  
ATOM   2392   H HH21 . ARG A 1 157 ? 18.434  18.017 0.169   0.010 51.45  ? 157  ARG A HH21 1  
ATOM   2393   H HH22 . ARG A 1 157 ? 19.779  17.443 0.454   0.010 53.08  ? 157  ARG A HH22 1  
ATOM   2394   N N    . THR A 1 158 ? 13.249  20.413 -4.330  0.010 40.14  ? 158  THR A N    1  
ATOM   2395   C CA   . THR A 1 158 ? 12.432  21.405 -3.640  0.010 41.44  ? 158  THR A CA   1  
ATOM   2396   C C    . THR A 1 158 ? 11.084  21.480 -4.338  0.010 39.22  ? 158  THR A C    1  
ATOM   2397   O O    . THR A 1 158 ? 10.073  21.768 -3.704  0.010 39.73  ? 158  THR A O    1  
ATOM   2398   C CB   . THR A 1 158 ? 13.130  22.816 -3.580  0.010 43.48  ? 158  THR A CB   1  
ATOM   2399   O OG1  . THR A 1 158 ? 13.334  23.338 -4.902  0.010 41.95  ? 158  THR A OG1  1  
ATOM   2400   C CG2  . THR A 1 158 ? 14.481  22.748 -2.843  0.010 45.07  ? 158  THR A CG2  1  
ATOM   2401   H H    . THR A 1 158 ? 13.418  20.619 -5.147  0.010 39.24  ? 158  THR A H    1  
ATOM   2402   H HA   . THR A 1 158 ? 12.269  21.116 -2.730  0.010 42.66  ? 158  THR A HA   1  
ATOM   2403   H HB   . THR A 1 158 ? 12.560  23.427 -3.088  0.010 45.00  ? 158  THR A HB   1  
ATOM   2404   H HG1  . THR A 1 158 ? 13.747  24.080 -4.864  0.010 43.18  ? 158  THR A HG1  1  
ATOM   2405   H HG21 . THR A 1 158 ? 15.042  22.066 -3.244  0.010 43.69  ? 158  THR A HG21 1  
ATOM   2406   H HG22 . THR A 1 158 ? 14.936  23.603 -2.905  0.010 46.70  ? 158  THR A HG22 1  
ATOM   2407   H HG23 . THR A 1 158 ? 14.343  22.534 -1.907  0.010 45.99  ? 158  THR A HG23 1  
ATOM   2408   N N    . HIS A 1 159 ? 11.074  21.195 -5.640  0.010 36.92  ? 159  HIS A N    1  
ATOM   2409   C CA   . HIS A 1 159 ? 9.837   21.004 -6.371  0.010 34.64  ? 159  HIS A CA   1  
ATOM   2410   C C    . HIS A 1 159 ? 9.311   19.626 -5.988  0.010 33.69  ? 159  HIS A C    1  
ATOM   2411   O O    . HIS A 1 159 ? 8.781   19.454 -4.894  0.010 35.01  ? 159  HIS A O    1  
ATOM   2412   C CB   . HIS A 1 159 ? 10.034  21.132 -7.896  0.010 32.82  ? 159  HIS A CB   1  
ATOM   2413   C CG   . HIS A 1 159 ? 10.217  22.544 -8.373  0.010 33.72  ? 159  HIS A CG   1  
ATOM   2414   N ND1  . HIS A 1 159 ? 10.101  23.632 -7.533  0.010 36.03  ? 159  HIS A ND1  1  
ATOM   2415   C CD2  . HIS A 1 159 ? 10.499  23.046 -9.600  0.010 32.83  ? 159  HIS A CD2  1  
ATOM   2416   C CE1  . HIS A 1 159 ? 10.319  24.738 -8.218  0.010 36.51  ? 159  HIS A CE1  1  
ATOM   2417   N NE2  . HIS A 1 159 ? 10.549  24.415 -9.477  0.010 34.59  ? 159  HIS A NE2  1  
ATOM   2418   H H    . HIS A 1 159 ? 11.778  21.104 -6.124  0.010 36.75  ? 159  HIS A H    1  
ATOM   2419   H HA   . HIS A 1 159 ? 9.192   21.667 -6.093  0.010 35.12  ? 159  HIS A HA   1  
ATOM   2420   H HB2  . HIS A 1 159 ? 10.817  20.621 -8.155  0.010 32.64  ? 159  HIS A HB2  1  
ATOM   2421   H HB3  . HIS A 1 159 ? 9.250   20.777 -8.340  0.010 31.35  ? 159  HIS A HB3  1  
ATOM   2422   H HD1  . HIS A 1 159 ? 9.930   23.596 -6.691  0.010 37.12  ? 159  HIS A HD1  1  
ATOM   2423   H HD2  . HIS A 1 159 ? 10.630  22.561 -10.382 0.010 31.44  ? 159  HIS A HD2  1  
ATOM   2424   H HE1  . HIS A 1 159 ? 10.293  25.601 -7.873  0.010 38.07  ? 159  HIS A HE1  1  
ATOM   2425   H HE2  . HIS A 1 159 ? 10.715  24.971 -10.112 0.010 34.57  ? 159  HIS A HE2  1  
ATOM   2426   N N    . HIS A 1 160 ? 9.506   18.639 -6.857  0.010 31.67  ? 160  HIS A N    1  
ATOM   2427   C CA   . HIS A 1 160 ? 8.916   17.311 -6.650  0.010 30.79  ? 160  HIS A CA   1  
ATOM   2428   C C    . HIS A 1 160 ? 9.899   16.145 -6.522  0.010 31.06  ? 160  HIS A C    1  
ATOM   2429   O O    . HIS A 1 160 ? 9.482   15.006 -6.549  0.010 30.38  ? 160  HIS A O    1  
ATOM   2430   C CB   . HIS A 1 160 ? 7.832   17.040 -7.706  0.010 28.52  ? 160  HIS A CB   1  
ATOM   2431   C CG   . HIS A 1 160 ? 6.629   17.909 -7.545  0.010 28.54  ? 160  HIS A CG   1  
ATOM   2432   N ND1  . HIS A 1 160 ? 6.084   18.188 -6.309  0.010 29.88  ? 160  HIS A ND1  1  
ATOM   2433   C CD2  . HIS A 1 160 ? 5.895   18.603 -8.447  0.010 27.61  ? 160  HIS A CD2  1  
ATOM   2434   C CE1  . HIS A 1 160 ? 5.046   18.991 -6.460  0.010 29.70  ? 160  HIS A CE1  1  
ATOM   2435   N NE2  . HIS A 1 160 ? 4.916   19.266 -7.744  0.010 28.34  ? 160  HIS A NE2  1  
ATOM   2436   H H    . HIS A 1 160 ? 9.976   18.705 -7.573  0.010 30.89  ? 160  HIS A H    1  
ATOM   2437   H HA   . HIS A 1 160 ? 8.449   17.325 -5.803  0.010 31.75  ? 160  HIS A HA   1  
ATOM   2438   H HB2  . HIS A 1 160 ? 8.197   17.200 -8.588  0.010 27.63  ? 160  HIS A HB2  1  
ATOM   2439   H HB3  . HIS A 1 160 ? 7.533   16.122 -7.633  0.010 28.04  ? 160  HIS A HB3  1  
ATOM   2440   H HD1  . HIS A 1 160 ? 6.363   17.874 -5.559  0.010 30.78  ? 160  HIS A HD1  1  
ATOM   2441   H HD2  . HIS A 1 160 ? 6.026   18.623 -9.368  0.010 26.75  ? 160  HIS A HD2  1  
ATOM   2442   H HE1  . HIS A 1 160 ? 4.508   19.320 -5.775  0.010 30.50  ? 160  HIS A HE1  1  
ATOM   2443   H HE2  . HIS A 1 160 ? 4.311   19.771 -8.084  0.010 28.03  ? 160  HIS A HE2  1  
ATOM   2444   N N    . ASP A 1 161 ? 11.195  16.432 -6.384  0.010 32.24  ? 161  ASP A N    1  
ATOM   2445   C CA   . ASP A 1 161 ? 12.137  15.481 -5.788  0.010 33.41  ? 161  ASP A CA   1  
ATOM   2446   C C    . ASP A 1 161 ? 12.122  14.070 -6.383  0.010 31.95  ? 161  ASP A C    1  
ATOM   2447   O O    . ASP A 1 161 ? 12.096  13.081 -5.644  0.010 32.78  ? 161  ASP A O    1  
ATOM   2448   C CB   . ASP A 1 161 ? 11.845  15.376 -4.286  0.010 35.49  ? 161  ASP A CB   1  
ATOM   2449   C CG   . ASP A 1 161 ? 13.033  14.904 -3.485  0.010 37.55  ? 161  ASP A CG   1  
ATOM   2450   O OD1  . ASP A 1 161 ? 14.182  15.238 -3.851  0.010 37.99  ? 161  ASP A OD1  1  
ATOM   2451   O OD2  . ASP A 1 161 ? 12.812  14.207 -2.468  0.010 38.89  ? 161  ASP A OD2  1  
ATOM   2452   H H    . ASP A 1 161 ? 11.555  17.171 -6.635  0.010 32.45  ? 161  ASP A H    1  
ATOM   2453   H HA   . ASP A 1 161 ? 13.032  15.831 -5.901  0.010 34.11  ? 161  ASP A HA   1  
ATOM   2454   H HB2  . ASP A 1 161 ? 11.589  16.248 -3.950  0.010 36.30  ? 161  ASP A HB2  1  
ATOM   2455   H HB3  . ASP A 1 161 ? 11.123  14.745 -4.143  0.010 34.88  ? 161  ASP A HB3  1  
ATOM   2456   N N    . GLY A 1 162 ? 12.125  13.980 -7.709  0.010 30.00  ? 162  GLY A N    1  
ATOM   2457   C CA   . GLY A 1 162 ? 12.202  12.697 -8.382  0.010 28.79  ? 162  GLY A CA   1  
ATOM   2458   C C    . GLY A 1 162 ? 10.873  12.012 -8.628  0.010 27.31  ? 162  GLY A C    1  
ATOM   2459   O O    . GLY A 1 162 ? 10.861  10.954 -9.244  0.010 26.37  ? 162  GLY A O    1  
ATOM   2460   H H    . GLY A 1 162 ? 12.087  14.653 -8.242  0.010 29.47  ? 162  GLY A H    1  
ATOM   2461   H HA2  . GLY A 1 162 ? 12.631  12.824 -9.242  0.010 28.13  ? 162  GLY A HA2  1  
ATOM   2462   H HA3  . GLY A 1 162 ? 12.756  12.095 -7.863  0.010 29.75  ? 162  GLY A HA3  1  
ATOM   2463   N N    . ALA A 1 163 ? 9.765   12.599 -8.177  0.010 27.22  ? 163  ALA A N    1  
ATOM   2464   C CA   . ALA A 1 163 ? 8.447   11.973 -8.346  0.010 25.98  ? 163  ALA A CA   1  
ATOM   2465   C C    . ALA A 1 163 ? 7.986   11.898 -9.795  0.010 24.05  ? 163  ALA A C    1  
ATOM   2466   O O    . ALA A 1 163 ? 7.163   11.063 -10.128 0.010 23.07  ? 163  ALA A O    1  
ATOM   2467   C CB   . ALA A 1 163 ? 7.394   12.703 -7.541  0.010 26.46  ? 163  ALA A CB   1  
ATOM   2468   H H    . ALA A 1 163 ? 9.746   13.356 -7.771  0.010 27.93  ? 163  ALA A H    1  
ATOM   2469   H HA   . ALA A 1 163 ? 8.494   11.066 -8.008  0.010 26.25  ? 163  ALA A HA   1  
ATOM   2470   H HB1  . ALA A 1 163 ? 7.767   12.947 -6.679  0.010 27.88  ? 163  ALA A HB1  1  
ATOM   2471   H HB2  . ALA A 1 163 ? 7.134   13.503 -8.024  0.010 25.95  ? 163  ALA A HB2  1  
ATOM   2472   H HB3  . ALA A 1 163 ? 6.628   12.121 -7.423  0.010 25.98  ? 163  ALA A HB3  1  
ATOM   2473   N N    . ILE A 1 164 ? 8.510   12.771 -10.651 0.010 23.70  ? 164  ILE A N    1  
ATOM   2474   C CA   . ILE A 1 164 ? 7.932   12.969 -11.970 0.010 22.15  ? 164  ILE A CA   1  
ATOM   2475   C C    . ILE A 1 164 ? 8.536   12.023 -12.988 0.010 21.42  ? 164  ILE A C    1  
ATOM   2476   O O    . ILE A 1 164 ? 9.566   12.283 -13.569 0.010 21.68  ? 164  ILE A O    1  
ATOM   2477   C CB   . ILE A 1 164 ? 8.072   14.416 -12.471 0.010 22.24  ? 164  ILE A CB   1  
ATOM   2478   C CG1  . ILE A 1 164 ? 7.678   15.413 -11.382 0.010 23.42  ? 164  ILE A CG1  1  
ATOM   2479   C CG2  . ILE A 1 164 ? 7.218   14.601 -13.692 0.010 20.82  ? 164  ILE A CG2  1  
ATOM   2480   C CD1  . ILE A 1 164 ? 6.333   15.156 -10.738 0.010 23.17  ? 164  ILE A CD1  1  
ATOM   2481   H H    . ILE A 1 164 ? 9.207   13.247 -10.497 0.010 24.44  ? 164  ILE A H    1  
ATOM   2482   H HA   . ILE A 1 164 ? 6.982   12.780 -11.930 0.010 21.58  ? 164  ILE A HA   1  
ATOM   2483   H HB   . ILE A 1 164 ? 8.999   14.579 -12.709 0.010 22.64  ? 164  ILE A HB   1  
ATOM   2484   H HG12 . ILE A 1 164 ? 8.349   15.391 -10.684 0.010 24.52  ? 164  ILE A HG12 1  
ATOM   2485   H HG13 . ILE A 1 164 ? 7.651   16.295 -11.777 0.010 23.44  ? 164  ILE A HG13 1  
ATOM   2486   H HG21 . ILE A 1 164 ? 6.345   14.226 -13.511 0.010 20.40  ? 164  ILE A HG21 1  
ATOM   2487   H HG22 . ILE A 1 164 ? 7.136   15.544 -13.885 0.010 21.01  ? 164  ILE A HG22 1  
ATOM   2488   H HG23 . ILE A 1 164 ? 7.617   14.141 -14.443 0.010 20.30  ? 164  ILE A HG23 1  
ATOM   2489   H HD11 . ILE A 1 164 ? 6.328   14.278 -10.330 0.010 23.17  ? 164  ILE A HD11 1  
ATOM   2490   H HD12 . ILE A 1 164 ? 6.178   15.829 -10.057 0.010 24.14  ? 164  ILE A HD12 1  
ATOM   2491   H HD13 . ILE A 1 164 ? 5.642   15.214 -11.416 0.010 22.20  ? 164  ILE A HD13 1  
ATOM   2492   N N    . THR A 1 165 ? 7.871   10.909 -13.191 0.010 20.68  ? 165  THR A N    1  
ATOM   2493   C CA   . THR A 1 165 ? 8.289   9.942  -14.182 0.010 20.08  ? 165  THR A CA   1  
ATOM   2494   C C    . THR A 1 165 ? 8.046   10.484 -15.588 0.010 19.05  ? 165  THR A C    1  
ATOM   2495   O O    . THR A 1 165 ? 7.445   11.552 -15.753 0.010 18.71  ? 165  THR A O    1  
ATOM   2496   C CB   . THR A 1 165 ? 7.471   8.654  -14.025 0.010 19.84  ? 165  THR A CB   1  
ATOM   2497   O OG1  . THR A 1 165 ? 6.114   8.938  -14.391 0.010 18.96  ? 165  THR A OG1  1  
ATOM   2498   C CG2  . THR A 1 165 ? 7.541   8.128  -12.599 0.010 21.05  ? 165  THR A CG2  1  
ATOM   2499   H H    . THR A 1 165 ? 7.173   10.685 -12.751 0.010 20.62  ? 165  THR A H    1  
ATOM   2500   H HA   . THR A 1 165 ? 9.230   9.738  -14.077 0.010 20.65  ? 165  THR A HA   1  
ATOM   2501   H HB   . THR A 1 165 ? 7.830   7.973  -14.614 0.010 19.67  ? 165  THR A HB   1  
ATOM   2502   H HG1  . THR A 1 165 ? 5.973   8.737  -15.201 0.010 18.49  ? 165  THR A HG1  1  
ATOM   2503   H HG21 . THR A 1 165 ? 7.191   8.783  -11.978 0.010 21.41  ? 165  THR A HG21 1  
ATOM   2504   H HG22 . THR A 1 165 ? 7.015   7.317  -12.519 0.010 20.98  ? 165  THR A HG22 1  
ATOM   2505   H HG23 . THR A 1 165 ? 8.458   7.931  -12.364 0.010 21.70  ? 165  THR A HG23 1  
ATOM   2506   N N    . GLU A 1 166 ? 8.454   9.748  -16.617 0.010 18.68  ? 166  GLU A N    1  
ATOM   2507   C CA   . GLU A 1 166 ? 8.238   10.234 -17.991 0.010 17.97  ? 166  GLU A CA   1  
ATOM   2508   C C    . GLU A 1 166 ? 6.805   10.040 -18.474 0.010 17.13  ? 166  GLU A C    1  
ATOM   2509   O O    . GLU A 1 166 ? 6.475   10.417 -19.575 0.010 16.65  ? 166  GLU A O    1  
ATOM   2510   C CB   . GLU A 1 166 ? 9.243   9.650  -18.982 0.010 18.08  ? 166  GLU A CB   1  
ATOM   2511   C CG   . GLU A 1 166 ? 10.662  9.939  -18.525 0.010 18.97  ? 166  GLU A CG   1  
ATOM   2512   C CD   . GLU A 1 166 ? 11.608  10.504 -19.571 0.010 19.10  ? 166  GLU A CD   1  
ATOM   2513   O OE1  . GLU A 1 166 ? 12.260  11.520 -19.233 0.010 19.38  ? 166  GLU A OE1  1  
ATOM   2514   O OE2  . GLU A 1 166 ? 11.769  9.852  -20.644 0.010 19.11  ? 166  GLU A OE2  1  
ATOM   2515   H H    . GLU A 1 166 ? 8.848   8.994  -16.558 0.010 18.94  ? 166  GLU A H    1  
ATOM   2516   H HA   . GLU A 1 166 ? 8.393   11.191 -17.997 0.010 18.12  ? 166  GLU A HA   1  
ATOM   2517   H HB2  . GLU A 1 166 ? 9.119   8.692  -19.034 0.010 18.00  ? 166  GLU A HB2  1  
ATOM   2518   H HB3  . GLU A 1 166 ? 9.113   10.052 -19.852 0.010 17.77  ? 166  GLU A HB3  1  
ATOM   2519   H HG2  . GLU A 1 166 ? 10.620  10.587 -17.804 0.010 19.36  ? 166  GLU A HG2  1  
ATOM   2520   H HG3  . GLU A 1 166 ? 11.048  9.114  -18.197 0.010 19.25  ? 166  GLU A HG3  1  
ATOM   2521   N N    . ARG A 1 167 ? 5.990   9.417  -17.628 0.010 17.14  ? 167  ARG A N    1  
ATOM   2522   C CA   . ARG A 1 167 ? 4.560   9.283  -17.874 0.010 16.49  ? 167  ARG A CA   1  
ATOM   2523   C C    . ARG A 1 167 ? 3.774   10.459 -17.276 0.010 16.39  ? 167  ARG A C    1  
ATOM   2524   O O    . ARG A 1 167 ? 2.547   10.538 -17.411 0.010 15.92  ? 167  ARG A O    1  
ATOM   2525   C CB   . ARG A 1 167 ? 4.075   7.982  -17.281 0.010 16.72  ? 167  ARG A CB   1  
ATOM   2526   C CG   . ARG A 1 167 ? 5.010   6.795  -17.565 0.010 17.16  ? 167  ARG A CG   1  
ATOM   2527   C CD   . ARG A 1 167 ? 4.309   5.462  -17.382 0.010 17.40  ? 167  ARG A CD   1  
ATOM   2528   N NE   . ARG A 1 167 ? 3.329   5.182  -18.428 0.010 16.86  ? 167  ARG A NE   1  
ATOM   2529   C CZ   . ARG A 1 167 ? 2.666   4.027  -18.507 0.010 17.17  ? 167  ARG A CZ   1  
ATOM   2530   N NH1  . ARG A 1 167 ? 2.903   3.096  -17.605 0.010 17.98  ? 167  ARG A NH1  1  
ATOM   2531   N NH2  . ARG A 1 167 ? 1.801   3.792  -19.489 0.010 16.86  ? 167  ARG A NH2  1  
ATOM   2532   H H    . ARG A 1 167 ? 6.246   9.049  -16.899 0.010 17.59  ? 167  ARG A H    1  
ATOM   2533   H HA   . ARG A 1 167 ? 4.397   9.265  -18.830 0.010 16.12  ? 167  ARG A HA   1  
ATOM   2534   H HB2  . ARG A 1 167 ? 4.018   8.092  -16.321 0.010 17.14  ? 167  ARG A HB2  1  
ATOM   2535   H HB3  . ARG A 1 167 ? 3.201   7.778  -17.640 0.010 16.34  ? 167  ARG A HB3  1  
ATOM   2536   H HG2  . ARG A 1 167 ? 5.331   6.847  -18.479 0.010 16.93  ? 167  ARG A HG2  1  
ATOM   2537   H HG3  . ARG A 1 167 ? 5.757   6.824  -16.947 0.010 17.69  ? 167  ARG A HG3  1  
ATOM   2538   H HD2  . ARG A 1 167 ? 4.971   4.757  -17.407 0.010 17.89  ? 167  ARG A HD2  1  
ATOM   2539   H HD3  . ARG A 1 167 ? 3.858   5.449  -16.527 0.010 17.62  ? 167  ARG A HD3  1  
ATOM   2540   H HE   . ARG A 1 167 ? 3.356   5.666  -19.135 0.010 16.50  ? 167  ARG A HE   1  
ATOM   2541   H HH11 . ARG A 1 167 ? 3.459   3.231  -16.970 0.010 18.29  ? 167  ARG A HH11 1  
ATOM   2542   H HH12 . ARG A 1 167 ? 2.478   2.355  -17.643 0.010 18.29  ? 167  ARG A HH12 1  
ATOM   2543   H HH21 . ARG A 1 167 ? 1.651   4.391  -20.084 0.010 16.45  ? 167  ARG A HH21 1  
ATOM   2544   H HH22 . ARG A 1 167 ? 1.380   3.045  -19.522 0.010 17.18  ? 167  ARG A HH22 1  
ATOM   2545   N N    . LEU A 1 168 ? 4.492   11.337 -16.579 0.010 17.01  ? 168  LEU A N    1  
ATOM   2546   C CA   . LEU A 1 168 ? 3.898   12.520 -15.975 0.010 17.24  ? 168  LEU A CA   1  
ATOM   2547   C C    . LEU A 1 168 ? 4.465   13.781 -16.607 0.010 17.43  ? 168  LEU A C    1  
ATOM   2548   O O    . LEU A 1 168 ? 5.549   13.766 -17.173 0.010 17.70  ? 168  LEU A O    1  
ATOM   2549   C CB   . LEU A 1 168 ? 4.155   12.536 -14.469 0.010 18.27  ? 168  LEU A CB   1  
ATOM   2550   C CG   . LEU A 1 168 ? 3.513   11.412 -13.655 0.010 18.45  ? 168  LEU A CG   1  
ATOM   2551   C CD1  . LEU A 1 168 ? 4.085   11.290 -12.258 0.010 19.79  ? 168  LEU A CD1  1  
ATOM   2552   C CD2  . LEU A 1 168 ? 2.028   11.635 -13.555 0.010 17.98  ? 168  LEU A CD2  1  
ATOM   2553   H H    . LEU A 1 168 ? 5.335   11.272 -16.438 0.010 17.40  ? 168  LEU A H    1  
ATOM   2554   H HA   . LEU A 1 168 ? 2.940   12.516 -16.114 0.010 16.81  ? 168  LEU A HA   1  
ATOM   2555   H HB2  . LEU A 1 168 ? 5.113   12.486 -14.329 0.010 18.76  ? 168  LEU A HB2  1  
ATOM   2556   H HB3  . LEU A 1 168 ? 3.819   13.375 -14.117 0.010 18.56  ? 168  LEU A HB3  1  
ATOM   2557   H HG   . LEU A 1 168 ? 3.654   10.571 -14.115 0.010 18.16  ? 168  LEU A HG   1  
ATOM   2558   H HD11 . LEU A 1 168 ? 3.938   12.126 -11.789 0.010 20.21  ? 168  LEU A HD11 1  
ATOM   2559   H HD12 . LEU A 1 168 ? 3.636   10.569 -11.792 0.010 19.98  ? 168  LEU A HD12 1  
ATOM   2560   H HD13 . LEU A 1 168 ? 5.036   11.103 -12.314 0.010 20.16  ? 168  LEU A HD13 1  
ATOM   2561   H HD21 . LEU A 1 168 ? 1.865   12.531 -13.230 0.010 18.26  ? 168  LEU A HD21 1  
ATOM   2562   H HD22 . LEU A 1 168 ? 1.638   11.516 -14.433 0.010 17.24  ? 168  LEU A HD22 1  
ATOM   2563   H HD23 . LEU A 1 168 ? 1.654   10.993 -12.933 0.010 18.27  ? 168  LEU A HD23 1  
ATOM   2564   N N    . MET A 1 169 ? 3.731   14.883 -16.492 0.010 17.47  ? 169  MET A N    1  
ATOM   2565   C CA   . MET A 1 169 ? 4.285   16.182 -16.882 0.010 18.00  ? 169  MET A CA   1  
ATOM   2566   C C    . MET A 1 169 ? 3.948   17.219 -15.826 0.010 18.92  ? 169  MET A C    1  
ATOM   2567   O O    . MET A 1 169 ? 3.198   16.935 -14.916 0.010 19.03  ? 169  MET A O    1  
ATOM   2568   C CB   . MET A 1 169 ? 3.802   16.571 -18.264 0.010 17.38  ? 169  MET A CB   1  
ATOM   2569   C CG   . MET A 1 169 ? 2.287   16.614 -18.417 0.010 16.75  ? 169  MET A CG   1  
ATOM   2570   S SD   . MET A 1 169 ? 1.782   17.221 -20.034 0.010 16.39  ? 169  MET A SD   1  
ATOM   2571   C CE   . MET A 1 169 ? 2.333   18.925 -19.943 0.010 17.49  ? 169  MET A CE   1  
ATOM   2572   H H    . MET A 1 169 ? 2.927   14.905 -16.201 0.010 17.28  ? 169  MET A H    1  
ATOM   2573   H HA   . MET A 1 169 ? 5.250   16.117 -16.930 0.010 18.38  ? 169  MET A HA   1  
ATOM   2574   H HB2  . MET A 1 169 ? 4.159   17.442 -18.489 0.010 17.86  ? 169  MET A HB2  1  
ATOM   2575   H HB3  . MET A 1 169 ? 4.127   15.915 -18.899 0.010 17.02  ? 169  MET A HB3  1  
ATOM   2576   H HG2  . MET A 1 169 ? 1.929   15.724 -18.298 0.010 16.31  ? 169  MET A HG2  1  
ATOM   2577   H HG3  . MET A 1 169 ? 1.930   17.204 -17.742 0.010 17.13  ? 169  MET A HG3  1  
ATOM   2578   H HE1  . MET A 1 169 ? 3.301   18.944 -19.865 0.010 17.87  ? 169  MET A HE1  1  
ATOM   2579   H HE2  . MET A 1 169 ? 2.064   19.387 -20.751 0.010 17.51  ? 169  MET A HE2  1  
ATOM   2580   H HE3  . MET A 1 169 ? 1.938   19.347 -19.166 0.010 17.85  ? 169  MET A HE3  1  
ATOM   2581   N N    . CYS A 1 170 ? 4.545   18.405 -15.943 0.010 19.77  ? 170  CYS A N    1  
ATOM   2582   C CA   . CYS A 1 170 ? 4.318   19.492 -14.994 0.010 20.96  ? 170  CYS A CA   1  
ATOM   2583   C C    . CYS A 1 170 ? 4.040   20.811 -15.672 0.010 21.33  ? 170  CYS A C    1  
ATOM   2584   O O    . CYS A 1 170 ? 4.491   21.058 -16.793 0.010 21.09  ? 170  CYS A O    1  
ATOM   2585   C CB   . CYS A 1 170 ? 5.516   19.703 -14.064 0.010 22.38  ? 170  CYS A CB   1  
ATOM   2586   S SG   . CYS A 1 170 ? 6.075   18.217 -13.233 0.010 22.37  ? 170  CYS A SG   1  
ATOM   2587   H H    . CYS A 1 170 ? 5.074   18.606 -16.582 0.010 19.78  ? 170  CYS A H    1  
ATOM   2588   H HA   . CYS A 1 170 ? 3.555   19.260 -14.458 0.010 20.82  ? 170  CYS A HA   1  
ATOM   2589   H HB2  . CYS A 1 170 ? 6.265   20.047 -14.581 0.010 22.66  ? 170  CYS A HB2  1  
ATOM   2590   H HB3  . CYS A 1 170 ? 5.266   20.345 -13.380 0.010 23.26  ? 170  CYS A HB3  1  
ATOM   2591   N N    . ALA A 1 171 ? 3.296   21.647 -14.941 0.010 22.10  ? 171  ALA A N    1  
ATOM   2592   C CA   . ALA A 1 171 ? 3.069   23.053 -15.279 0.010 23.02  ? 171  ALA A CA   1  
ATOM   2593   C C    . ALA A 1 171 ? 3.476   23.902 -14.072 0.010 24.91  ? 171  ALA A C    1  
ATOM   2594   O O    . ALA A 1 171 ? 3.308   23.483 -12.931 0.010 25.36  ? 171  ALA A O    1  
ATOM   2595   C CB   . ALA A 1 171 ? 1.574   23.299 -15.631 0.010 22.40  ? 171  ALA A CB   1  
ATOM   2596   H H    . ALA A 1 171 ? 2.902   21.411 -14.217 0.010 22.21  ? 171  ALA A H    1  
ATOM   2597   H HA   . ALA A 1 171 ? 3.609   23.307 -16.042 0.010 23.02  ? 171  ALA A HA   1  
ATOM   2598   H HB1  . ALA A 1 171 ? 1.029   22.971 -14.902 0.010 22.40  ? 171  ALA A HB1  1  
ATOM   2599   H HB2  . ALA A 1 171 ? 1.423   24.250 -15.744 0.010 23.17  ? 171  ALA A HB2  1  
ATOM   2600   H HB3  . ALA A 1 171 ? 1.353   22.832 -16.452 0.010 21.38  ? 171  ALA A HB3  1  
ATOM   2601   N N    . GLU A 1 172 ? 4.009   25.095 -14.333 0.010 26.21  ? 172  GLU A N    1  
ATOM   2602   C CA   . GLU A 1 172 ? 4.278   26.078 -13.270 0.010 28.32  ? 172  GLU A CA   1  
ATOM   2603   C C    . GLU A 1 172 ? 2.960   26.185 -12.522 0.010 28.29  ? 172  GLU A C    1  
ATOM   2604   O O    . GLU A 1 172 ? 1.927   26.160 -13.149 0.010 27.39  ? 172  GLU A O    1  
ATOM   2605   C CB   . GLU A 1 172 ? 4.655   27.432 -13.893 0.010 29.68  ? 172  GLU A CB   1  
ATOM   2606   C CG   . GLU A 1 172 ? 5.958   28.161 -13.356 0.010 31.84  ? 172  GLU A CG   1  
ATOM   2607   C CD   . GLU A 1 172 ? 5.643   29.193 -12.297 0.010 34.08  ? 172  GLU A CD   1  
ATOM   2608   O OE1  . GLU A 1 172 ? 4.433   29.516 -12.201 0.010 34.26  ? 172  GLU A OE1  1  
ATOM   2609   O OE2  . GLU A 1 172 ? 6.572   29.689 -11.591 0.010 35.86  ? 172  GLU A OE2  1  
ATOM   2610   H H    . GLU A 1 172 ? 4.217   25.363 -15.121 0.010 26.05  ? 172  GLU A H    1  
ATOM   2611   H HA   . GLU A 1 172 ? 4.975   25.770 -12.670 0.010 28.95  ? 172  GLU A HA   1  
ATOM   2612   H HB2  . GLU A 1 172 ? 4.798   27.284 -14.838 0.010 28.85  ? 172  GLU A HB2  1  
ATOM   2613   H HB3  . GLU A 1 172 ? 3.892   28.019 -13.798 0.010 30.17  ? 172  GLU A HB3  1  
ATOM   2614   H HG2  . GLU A 1 172 ? 6.567   27.508 -12.975 0.010 31.53  ? 172  GLU A HG2  1  
ATOM   2615   H HG3  . GLU A 1 172 ? 6.389   28.623 -14.095 0.010 32.27  ? 172  GLU A HG3  1  
ATOM   2616   N N    . SER A 1 173 ? 2.949   26.272 -11.200 0.010 29.41  ? 173  SER A N    1  
ATOM   2617   C CA   . SER A 1 173 ? 1.644   26.263 -10.583 0.010 29.40  ? 173  SER A CA   1  
ATOM   2618   C C    . SER A 1 173 ? 1.063   27.656 -10.612 0.010 31.15  ? 173  SER A C    1  
ATOM   2619   O O    . SER A 1 173 ? 0.240   27.986 -11.476 0.010 30.62  ? 173  SER A O    1  
ATOM   2620   C CB   . SER A 1 173 ? 1.646   25.678 -9.186  0.010 29.76  ? 173  SER A CB   1  
ATOM   2621   O OG   . SER A 1 173 ? 0.306   25.523 -8.743  0.010 29.89  ? 173  SER A OG   1  
ATOM   2622   H H    . SER A 1 173 ? 3.626   26.338 -10.676 0.010 30.25  ? 173  SER A H    1  
ATOM   2623   H HA   . SER A 1 173 ? 1.048   25.693 -11.092 0.010 28.05  ? 173  SER A HA   1  
ATOM   2624   H HB2  . SER A 1 173 ? 2.058   24.799 -9.220  0.010 28.61  ? 173  SER A HB2  1  
ATOM   2625   H HB3  . SER A 1 173 ? 2.118   26.267 -8.577  0.010 31.22  ? 173  SER A HB3  1  
ATOM   2626   H HG   . SER A 1 173 ? -0.228  25.716 -9.377  0.010 30.93  ? 173  SER A HG   1  
ATOM   2627   N N    . ASN A 1 174 ? 1.552   28.468 -9.672  0.010 33.43  ? 174  ASN A N    1  
ATOM   2628   C CA   . ASN A 1 174 ? 1.067   29.806 -9.483  0.010 35.25  ? 174  ASN A CA   1  
ATOM   2629   C C    . ASN A 1 174 ? 1.626   30.487 -8.246  0.010 38.06  ? 174  ASN A C    1  
ATOM   2630   O O    . ASN A 1 174 ? 1.515   30.025 -7.097  0.010 38.80  ? 174  ASN A O    1  
ATOM   2631   C CB   . ASN A 1 174 ? -0.443  29.843 -9.414  0.010 34.61  ? 174  ASN A CB   1  
ATOM   2632   C CG   . ASN A 1 174 ? -0.923  31.169 -9.060  0.010 36.98  ? 174  ASN A CG   1  
ATOM   2633   O OD1  . ASN A 1 174 ? -1.376  31.391 -7.947  0.010 38.39  ? 174  ASN A OD1  1  
ATOM   2634   N ND2  . ASN A 1 174 ? -0.761  32.108 -9.977  0.010 37.62  ? 174  ASN A ND2  1  
ATOM   2635   H H    . ASN A 1 174 ? 2.180   28.254 -9.125  0.010 34.06  ? 174  ASN A H    1  
ATOM   2636   H HA   . ASN A 1 174 ? 1.335   30.343 -10.246 0.010 35.22  ? 174  ASN A HA   1  
ATOM   2637   H HB2  . ASN A 1 174 ? -0.828  29.641 -10.280 0.010 33.46  ? 174  ASN A HB2  1  
ATOM   2638   H HB3  . ASN A 1 174 ? -0.753  29.210 -8.747  0.010 33.94  ? 174  ASN A HB3  1  
ATOM   2639   H HD21 . ASN A 1 174 ? -0.142  32.029 -10.568 0.010 37.35  ? 174  ASN A HD21 1  
ATOM   2640   H HD22 . ASN A 1 174 ? -1.274  32.798 -9.982  0.010 38.38  ? 174  ASN A HD22 1  
ATOM   2641   N N    . ARG A 1 175 ? 2.236   31.616 -8.526  0.010 39.82  ? 175  ARG A N    1  
ATOM   2642   C CA   . ARG A 1 175 ? 2.766   32.467 -7.467  0.010 42.95  ? 175  ARG A CA   1  
ATOM   2643   C C    . ARG A 1 175 ? 1.596   33.307 -6.963  0.010 44.38  ? 175  ARG A C    1  
ATOM   2644   O O    . ARG A 1 175 ? 0.455   33.095 -7.396  0.010 42.80  ? 175  ARG A O    1  
ATOM   2645   C CB   . ARG A 1 175 ? 3.951   33.338 -7.957  0.010 44.55  ? 175  ARG A CB   1  
ATOM   2646   C CG   . ARG A 1 175 ? 3.560   34.685 -8.613  0.010 45.87  ? 175  ARG A CG   1  
ATOM   2647   C CD   . ARG A 1 175 ? 4.768   35.510 -9.141  0.010 47.09  ? 175  ARG A CD   1  
ATOM   2648   N NE   . ARG A 1 175 ? 4.329   36.840 -9.595  0.010 48.91  ? 175  ARG A NE   1  
ATOM   2649   C CZ   . ARG A 1 175 ? 4.948   37.596 -10.507 0.010 50.05  ? 175  ARG A CZ   1  
ATOM   2650   N NH1  . ARG A 1 175 ? 6.064   37.184 -11.100 0.010 49.54  ? 175  ARG A NH1  1  
ATOM   2651   N NH2  . ARG A 1 175 ? 4.446   38.783 -10.834 0.010 51.86  ? 175  ARG A NH2  1  
ATOM   2652   H H    . ARG A 1 175 ? 2.349   31.915 -9.324  0.010 39.37  ? 175  ARG A H    1  
ATOM   2653   H HA   . ARG A 1 175 ? 3.082   31.914 -6.735  0.010 43.30  ? 175  ARG A HA   1  
ATOM   2654   H HB2  . ARG A 1 175 ? 4.517   33.535 -7.194  0.010 46.32  ? 175  ARG A HB2  1  
ATOM   2655   H HB3  . ARG A 1 175 ? 4.461   32.831 -8.608  0.010 43.19  ? 175  ARG A HB3  1  
ATOM   2656   H HG2  . ARG A 1 175 ? 2.970   34.512 -9.363  0.010 44.33  ? 175  ARG A HG2  1  
ATOM   2657   H HG3  . ARG A 1 175 ? 3.104   35.236 -7.961  0.010 47.67  ? 175  ARG A HG3  1  
ATOM   2658   H HD2  . ARG A 1 175 ? 5.415   35.625 -8.428  0.010 48.54  ? 175  ARG A HD2  1  
ATOM   2659   H HD3  . ARG A 1 175 ? 5.171   35.046 -9.891  0.010 45.37  ? 175  ARG A HD3  1  
ATOM   2660   H HE   . ARG A 1 175 ? 3.619   37.164 -9.232  0.010 49.48  ? 175  ARG A HE   1  
ATOM   2661   H HH11 . ARG A 1 175 ? 6.403   36.419 -10.902 0.010 48.45  ? 175  ARG A HH11 1  
ATOM   2662   H HH12 . ARG A 1 175 ? 6.448   37.684 -11.685 0.010 50.39  ? 175  ARG A HH12 1  
ATOM   2663   H HH21 . ARG A 1 175 ? 3.725   39.062 -10.459 0.010 52.26  ? 175  ARG A HH21 1  
ATOM   2664   H HH22 . ARG A 1 175 ? 4.841   39.269 -11.422 0.010 52.70  ? 175  ARG A HH22 1  
ATOM   2665   N N    . ARG A 1 176 ? 1.913   34.226 -6.047  0.010 47.48  ? 176  ARG A N    1  
ATOM   2666   C CA   . ARG A 1 176 ? 0.999   35.180 -5.397  0.010 49.68  ? 176  ARG A CA   1  
ATOM   2667   C C    . ARG A 1 176 ? 0.277   34.666 -4.139  0.010 50.38  ? 176  ARG A C    1  
ATOM   2668   O O    . ARG A 1 176 ? 0.331   35.333 -3.091  0.010 53.41  ? 176  ARG A O    1  
ATOM   2669   C CB   . ARG A 1 176 ? 0.048   35.869 -6.404  0.010 48.87  ? 176  ARG A CB   1  
ATOM   2670   C CG   . ARG A 1 176 ? 0.787   37.006 -7.177  0.010 50.44  ? 176  ARG A CG   1  
ATOM   2671   C CD   . ARG A 1 176 ? -0.138  38.098 -7.716  0.010 51.43  ? 176  ARG A CD   1  
ATOM   2672   N NE   . ARG A 1 176 ? -0.983  37.648 -8.832  0.010 48.64  ? 176  ARG A NE   1  
ATOM   2673   C CZ   . ARG A 1 176 ? -0.527  37.268 -10.029 0.010 46.60  ? 176  ARG A CZ   1  
ATOM   2674   N NH1  . ARG A 1 176 ? 0.775   37.271 -10.302 0.010 46.87  ? 176  ARG A NH1  1  
ATOM   2675   N NH2  . ARG A 1 176 ? -1.379  36.902 -10.970 0.010 44.45  ? 176  ARG A NH2  1  
ATOM   2676   H H    . ARG A 1 176 ? 2.719   34.324 -5.764  0.010 48.56  ? 176  ARG A H    1  
ATOM   2677   H HA   . ARG A 1 176 ? 1.568   35.892 -5.064  0.010 51.87  ? 176  ARG A HA   1  
ATOM   2678   H HB2  . ARG A 1 176 ? -0.283  35.233 -7.053  0.010 46.59  ? 176  ARG A HB2  1  
ATOM   2679   H HB3  . ARG A 1 176 ? -0.699  36.264 -5.936  0.010 49.85  ? 176  ARG A HB3  1  
ATOM   2680   H HG2  . ARG A 1 176 ? 1.447   37.419 -6.602  0.010 52.47  ? 176  ARG A HG2  1  
ATOM   2681   H HG3  . ARG A 1 176 ? 1.241   36.600 -7.932  0.010 48.90  ? 176  ARG A HG3  1  
ATOM   2682   H HD2  . ARG A 1 176 ? -0.717  38.407 -7.002  0.010 52.70  ? 176  ARG A HD2  1  
ATOM   2683   H HD3  . ARG A 1 176 ? 0.409   38.831 -8.036  0.010 52.88  ? 176  ARG A HD3  1  
ATOM   2684   H HE   . ARG A 1 176 ? -1.828  37.797 -8.764  0.010 48.77  ? 176  ARG A HE   1  
ATOM   2685   H HH11 . ARG A 1 176 ? 1.344   37.516 -9.706  0.010 48.36  ? 176  ARG A HH11 1  
ATOM   2686   H HH12 . ARG A 1 176 ? 1.049   37.024 -11.081 0.010 45.63  ? 176  ARG A HH12 1  
ATOM   2687   H HH21 . ARG A 1 176 ? -2.224  36.893 -10.807 0.010 44.28  ? 176  ARG A HH21 1  
ATOM   2688   H HH22 . ARG A 1 176 ? -1.086  36.654 -11.739 0.010 43.28  ? 176  ARG A HH22 1  
ATOM   2689   N N    . ASP A 1 177 ? -0.383  33.508 -4.236  0.010 47.86  ? 177  ASP A N    1  
ATOM   2690   C CA   . ASP A 1 177 ? -0.979  32.849 -3.060  0.010 48.50  ? 177  ASP A CA   1  
ATOM   2691   C C    . ASP A 1 177 ? -1.088  31.329 -3.322  0.010 45.66  ? 177  ASP A C    1  
ATOM   2692   O O    . ASP A 1 177 ? -0.045  30.672 -3.447  0.010 44.88  ? 177  ASP A O    1  
ATOM   2693   C CB   . ASP A 1 177 ? -2.313  33.517 -2.682  0.010 49.27  ? 177  ASP A CB   1  
ATOM   2694   C CG   . ASP A 1 177 ? -2.643  33.411 -1.192  0.010 51.51  ? 177  ASP A CG   1  
ATOM   2695   O OD1  . ASP A 1 177 ? -3.360  32.454 -0.816  0.010 50.30  ? 177  ASP A OD1  1  
ATOM   2696   O OD2  . ASP A 1 177 ? -2.210  34.297 -0.409  0.010 54.72  ? 177  ASP A OD2  1  
ATOM   2697   H H    . ASP A 1 177 ? -0.506  33.083 -4.974  0.010 45.88  ? 177  ASP A H    1  
ATOM   2698   H HA   . ASP A 1 177 ? -0.377  32.966 -2.308  0.010 50.47  ? 177  ASP A HA   1  
ATOM   2699   H HB2  . ASP A 1 177 ? -2.238  34.455 -2.870  0.010 50.61  ? 177  ASP A HB2  1  
ATOM   2700   H HB3  . ASP A 1 177 ? -3.035  33.134 -3.198  0.010 47.28  ? 177  ASP A HB3  1  
ATOM   2701   N N    . SER A 1 178 ? -2.296  30.752 -3.420  0.010 44.26  ? 178  SER A N    1  
ATOM   2702   C CA   . SER A 1 178 ? -2.376  29.293 -3.658  0.010 41.55  ? 178  SER A CA   1  
ATOM   2703   C C    . SER A 1 178 ? -3.667  28.579 -4.128  0.010 39.53  ? 178  SER A C    1  
ATOM   2704   O O    . SER A 1 178 ? -4.745  28.683 -3.539  0.010 40.52  ? 178  SER A O    1  
ATOM   2705   C CB   . SER A 1 178 ? -1.889  28.525 -2.421  0.010 42.55  ? 178  SER A CB   1  
ATOM   2706   O OG   . SER A 1 178 ? -1.660  27.168 -2.780  0.010 40.11  ? 178  SER A OG   1  
ATOM   2707   H H    . SER A 1 178 ? -3.053  31.153 -3.363  0.010 44.90  ? 178  SER A H    1  
ATOM   2708   H HA   . SER A 1 178 ? -1.732  29.097 -4.357  0.010 40.35  ? 178  SER A HA   1  
ATOM   2709   H HB2  . SER A 1 178 ? -1.065  28.914 -2.089  0.010 43.84  ? 178  SER A HB2  1  
ATOM   2710   H HB3  . SER A 1 178 ? -2.573  28.564 -1.733  0.010 43.72  ? 178  SER A HB3  1  
ATOM   2711   H HG   . SER A 1 178 ? -1.396  27.123 -3.586  0.010 39.14  ? 178  SER A HG   1  
ATOM   2712   N N    . CYS A 1 179 ? -3.482  27.837 -5.211  0.010 36.88  ? 179  CYS A N    1  
ATOM   2713   C CA   . CYS A 1 179 ? -4.144  26.549 -5.480  0.010 34.69  ? 179  CYS A CA   1  
ATOM   2714   C C    . CYS A 1 179 ? -5.645  26.394 -5.808  0.010 33.28  ? 179  CYS A C    1  
ATOM   2715   O O    . CYS A 1 179 ? -6.459  27.315 -5.714  0.010 34.17  ? 179  CYS A O    1  
ATOM   2716   C CB   . CYS A 1 179 ? -3.695  25.503 -4.461  0.010 35.48  ? 179  CYS A CB   1  
ATOM   2717   S SG   . CYS A 1 179 ? -1.896  25.392 -4.440  0.010 35.01  ? 179  CYS A SG   1  
ATOM   2718   H H    . CYS A 1 179 ? -2.945  28.065 -5.845  0.010 36.39  ? 179  CYS A H    1  
ATOM   2719   H HA   . CYS A 1 179 ? -3.712  26.268 -6.291  0.010 33.38  ? 179  CYS A HA   1  
ATOM   2720   H HB2  . CYS A 1 179 ? -4.012  25.738 -3.576  0.010 37.36  ? 179  CYS A HB2  1  
ATOM   2721   H HB3  . CYS A 1 179 ? -4.033  24.633 -4.720  0.010 34.47  ? 179  CYS A HB3  1  
ATOM   2722   N N    . LYS A 1 180 ? -5.982  25.151 -6.133  0.010 31.33  ? 180  LYS A N    1  
ATOM   2723   C CA   . LYS A 1 180 ? -6.654  24.856 -7.385  0.010 29.11  ? 180  LYS A CA   1  
ATOM   2724   C C    . LYS A 1 180 ? -6.811  23.335 -7.662  0.010 27.40  ? 180  LYS A C    1  
ATOM   2725   O O    . LYS A 1 180 ? -7.304  22.587 -6.830  0.010 27.91  ? 180  LYS A O    1  
ATOM   2726   C CB   . LYS A 1 180 ? -5.780  25.467 -8.474  0.010 28.67  ? 180  LYS A CB   1  
ATOM   2727   C CG   . LYS A 1 180 ? -4.266  25.026 -8.365  0.010 28.84  ? 180  LYS A CG   1  
ATOM   2728   C CD   . LYS A 1 180 ? -3.762  24.041 -9.407  0.010 26.77  ? 180  LYS A CD   1  
ATOM   2729   C CE   . LYS A 1 180 ? -4.152  24.465 -10.792 0.010 25.64  ? 180  LYS A CE   1  
ATOM   2730   N NZ   . LYS A 1 180 ? -4.189  25.969 -10.848 0.010 27.07  ? 180  LYS A NZ   1  
ATOM   2731   H H    . LYS A 1 180 ? -5.852  24.465 -5.632  0.010 31.40  ? 180  LYS A H    1  
ATOM   2732   H HA   . LYS A 1 180 ? -7.529  25.273 -7.404  0.010 29.15  ? 180  LYS A HA   1  
ATOM   2733   H HB2  . LYS A 1 180 ? -6.138  25.243 -9.342  0.010 27.32  ? 180  LYS A HB2  1  
ATOM   2734   H HB3  . LYS A 1 180 ? -5.795  26.433 -8.366  0.010 29.79  ? 180  LYS A HB3  1  
ATOM   2735   H HG2  . LYS A 1 180 ? -3.708  25.817 -8.407  0.010 29.81  ? 180  LYS A HG2  1  
ATOM   2736   H HG3  . LYS A 1 180 ? -4.129  24.590 -7.511  0.010 29.50  ? 180  LYS A HG3  1  
ATOM   2737   H HD2  . LYS A 1 180 ? -2.794  24.026 -9.374  0.010 27.08  ? 180  LYS A HD2  1  
ATOM   2738   H HD3  . LYS A 1 180 ? -4.098  23.156 -9.219  0.010 26.04  ? 180  LYS A HD3  1  
ATOM   2739   H HE2  . LYS A 1 180 ? -3.483  24.152 -11.418 0.010 24.94  ? 180  LYS A HE2  1  
ATOM   2740   H HE3  . LYS A 1 180 ? -5.029  24.112 -11.015 0.010 24.80  ? 180  LYS A HE3  1  
ATOM   2741   H HZ1  . LYS A 1 180 ? -3.520  26.307 -10.369 0.010 28.27  ? 180  LYS A HZ1  1  
ATOM   2742   H HZ2  . LYS A 1 180 ? -4.090  26.235 -11.689 0.010 26.62  ? 180  LYS A HZ2  1  
ATOM   2743   H HZ3  . LYS A 1 180 ? -4.960  26.283 -10.542 0.010 27.29  ? 180  LYS A HZ3  1  
ATOM   2744   N N    . GLY A 1 181 ? -6.396  22.879 -8.832  0.010 25.59  ? 181  GLY A N    1  
ATOM   2745   C CA   . GLY A 1 181 ? -6.510  21.464 -9.194  0.010 24.14  ? 181  GLY A CA   1  
ATOM   2746   C C    . GLY A 1 181 ? -7.853  20.837 -8.900  0.010 23.85  ? 181  GLY A C    1  
ATOM   2747   O O    . GLY A 1 181 ? -8.034  20.156 -7.881  0.010 24.78  ? 181  GLY A O    1  
ATOM   2748   H H    . GLY A 1 181 ? -6.059  23.352 -9.459  0.010 25.27  ? 181  GLY A H    1  
ATOM   2749   H HA2  . GLY A 1 181 ? -6.348  21.372 -10.147 0.010 23.05  ? 181  GLY A HA2  1  
ATOM   2750   H HA3  . GLY A 1 181 ? -5.831  20.956 -8.722  0.010 24.54  ? 181  GLY A HA3  1  
ATOM   2751   N N    . ASP A 1 182 ? -8.814  21.095 -9.778  0.010 22.80  ? 182  ASP A N    1  
ATOM   2752   C CA   . ASP A 1 182 ? -10.135 20.487 -9.740  0.010 22.32  ? 182  ASP A CA   1  
ATOM   2753   C C    . ASP A 1 182 ? -10.126 19.009 -9.427  0.010 21.66  ? 182  ASP A C    1  
ATOM   2754   O O    . ASP A 1 182 ? -11.003 18.457 -8.714  0.010 21.94  ? 182  ASP A O    1  
ATOM   2755   C CB   . ASP A 1 182 ? -10.562 20.538 -11.163 0.010 21.10  ? 182  ASP A CB   1  
ATOM   2756   C CG   . ASP A 1 182 ? -9.410  20.133 -12.106 0.010 20.04  ? 182  ASP A CG   1  
ATOM   2757   O OD1  . ASP A 1 182 ? -8.790  21.081 -12.630 0.010 20.25  ? 182  ASP A OD1  1  
ATOM   2758   O OD2  . ASP A 1 182 ? -9.105  18.904 -12.248 0.010 19.25  ? 182  ASP A OD2  1  
ATOM   2759   H H    . ASP A 1 182 ? -8.712  21.644 -10.438 0.010 22.45  ? 182  ASP A H    1  
ATOM   2760   H HA   . ASP A 1 182 ? -10.756 20.985 -9.162  0.010 23.26  ? 182  ASP A HA   1  
ATOM   2761   H HB2  . ASP A 1 182 ? -11.283 19.912 -11.262 0.010 20.60  ? 182  ASP A HB2  1  
ATOM   2762   H HB3  . ASP A 1 182 ? -10.852 21.430 -11.394 0.010 21.58  ? 182  ASP A HB3  1  
ATOM   2763   N N    . SER A 1 183 ? -9.045  18.453 -9.998  0.010 20.95  ? 183  SER A N    1  
ATOM   2764   C CA   . SER A 1 183 ? -8.650  17.058 -10.262 0.010 20.04  ? 183  SER A CA   1  
ATOM   2765   C C    . SER A 1 183 ? -9.477  16.262 -11.268 0.010 18.89  ? 183  SER A C    1  
ATOM   2766   O O    . SER A 1 183 ? -10.666 16.453 -11.438 0.010 18.95  ? 183  SER A O    1  
ATOM   2767   C CB   . SER A 1 183 ? -8.317  16.261 -9.012  0.010 20.94  ? 183  SER A CB   1  
ATOM   2768   O OG   . SER A 1 183 ? -9.258  16.490 -8.018  0.010 22.31  ? 183  SER A OG   1  
ATOM   2769   H H    . SER A 1 183 ? -8.419  18.958 -10.281 0.010 21.08  ? 183  SER A H    1  
ATOM   2770   H HA   . SER A 1 183 ? -7.792  17.143 -10.707 0.010 19.68  ? 183  SER A HA   1  
ATOM   2771   H HB2  . SER A 1 183 ? -8.294  15.317 -9.234  0.010 20.47  ? 183  SER A HB2  1  
ATOM   2772   H HB3  . SER A 1 183 ? -7.444  16.545 -8.694  0.010 21.18  ? 183  SER A HB3  1  
ATOM   2773   H HG   . SER A 1 183 ? -10.038 16.516 -8.354  0.010 22.11  ? 183  SER A HG   1  
ATOM   2774   N N    . GLY A 1 184 ? -8.765  15.434 -12.012 0.010 17.98  ? 184  GLY A N    1  
ATOM   2775   C CA   . GLY A 1 184 ? -9.387  14.672 -13.049 0.010 17.05  ? 184  GLY A CA   1  
ATOM   2776   C C    . GLY A 1 184 ? -9.525  15.567 -14.239 0.010 16.51  ? 184  GLY A C    1  
ATOM   2777   O O    . GLY A 1 184 ? -9.836  15.094 -15.314 0.010 15.82  ? 184  GLY A O    1  
ATOM   2778   H H    . GLY A 1 184 ? -7.919  15.311 -11.939 0.010 17.99  ? 184  GLY A H    1  
ATOM   2779   H HA2  . GLY A 1 184 ? -8.847  13.901 -13.281 0.010 16.69  ? 184  GLY A HA2  1  
ATOM   2780   H HA3  . GLY A 1 184 ? -10.262 14.368 -12.766 0.010 17.27  ? 184  GLY A HA3  1  
ATOM   2781   N N    . GLY A 1 185 ? -9.252  16.861 -14.051 0.010 17.05  ? 185  GLY A N    1  
ATOM   2782   C CA   . GLY A 1 185 ? -9.537  17.833 -15.062 0.010 16.89  ? 185  GLY A CA   1  
ATOM   2783   C C    . GLY A 1 185 ? -8.458  17.851 -16.123 0.010 16.31  ? 185  GLY A C    1  
ATOM   2784   O O    . GLY A 1 185 ? -7.414  17.228 -15.962 0.010 16.14  ? 185  GLY A O    1  
ATOM   2785   H H    . GLY A 1 185 ? -8.878  17.200 -13.357 0.010 17.64  ? 185  GLY A H    1  
ATOM   2786   H HA2  . GLY A 1 185 ? -10.389 17.614 -15.466 0.010 16.66  ? 185  GLY A HA2  1  
ATOM   2787   H HA3  . GLY A 1 185 ? -9.588  18.714 -14.668 0.010 17.53  ? 185  GLY A HA3  1  
ATOM   2788   N N    . PRO A 1 186 ? -8.707  18.572 -17.208 0.010 16.16  ? 186  PRO A N    1  
ATOM   2789   C CA   . PRO A 1 186 ? -7.819  18.447 -18.357 0.010 15.72  ? 186  PRO A CA   1  
ATOM   2790   C C    . PRO A 1 186 ? -6.831  19.605 -18.559 0.010 16.28  ? 186  PRO A C    1  
ATOM   2791   O O    . PRO A 1 186 ? -7.081  20.762 -18.178 0.010 17.07  ? 186  PRO A O    1  
ATOM   2792   C CB   . PRO A 1 186 ? -8.805  18.376 -19.516 0.010 15.43  ? 186  PRO A CB   1  
ATOM   2793   C CG   . PRO A 1 186 ? -9.970  19.248 -19.055 0.010 16.01  ? 186  PRO A CG   1  
ATOM   2794   C CD   . PRO A 1 186 ? -10.019 19.130 -17.583 0.010 16.27  ? 186  PRO A CD   1  
ATOM   2795   H HA   . PRO A 1 186 ? -7.327  17.612 -18.324 0.010 15.37  ? 186  PRO A HA   1  
ATOM   2796   H HB2  . PRO A 1 186 ? -8.406  18.725 -20.326 0.010 15.44  ? 186  PRO A HB2  1  
ATOM   2797   H HB3  . PRO A 1 186 ? -9.099  17.462 -19.644 0.010 15.06  ? 186  PRO A HB3  1  
ATOM   2798   H HG2  . PRO A 1 186 ? -9.816  20.169 -19.320 0.010 16.46  ? 186  PRO A HG2  1  
ATOM   2799   H HG3  . PRO A 1 186 ? -10.800 18.924 -19.433 0.010 15.88  ? 186  PRO A HG3  1  
ATOM   2800   H HD2  . PRO A 1 186 ? -10.146 19.997 -17.173 0.010 16.87  ? 186  PRO A HD2  1  
ATOM   2801   H HD3  . PRO A 1 186 ? -10.729 18.513 -17.354 0.010 16.03  ? 186  PRO A HD3  1  
ATOM   2802   N N    . LEU A 1 187 ? -5.709  19.236 -19.180 0.010 15.99  ? 187  LEU A N    1  
ATOM   2803   C CA   . LEU A 1 187 ? -4.653  20.151 -19.634 0.010 16.53  ? 187  LEU A CA   1  
ATOM   2804   C C    . LEU A 1 187 ? -4.565  20.044 -21.141 0.010 16.24  ? 187  LEU A C    1  
ATOM   2805   O O    . LEU A 1 187 ? -4.198  18.971 -21.683 0.010 15.65  ? 187  LEU A O    1  
ATOM   2806   C CB   . LEU A 1 187 ? -3.311  19.749 -18.987 0.010 16.64  ? 187  LEU A CB   1  
ATOM   2807   C CG   . LEU A 1 187 ? -2.106  20.649 -18.636 0.010 17.52  ? 187  LEU A CG   1  
ATOM   2808   C CD1  . LEU A 1 187 ? -0.809  20.160 -19.261 0.010 17.31  ? 187  LEU A CD1  1  
ATOM   2809   C CD2  . LEU A 1 187 ? -2.253  22.145 -18.828 0.010 18.40  ? 187  LEU A CD2  1  
ATOM   2810   H H    . LEU A 1 187 ? -5.535  18.415 -19.354 0.010 15.55  ? 187  LEU A H    1  
ATOM   2811   H HA   . LEU A 1 187 ? -4.867  21.064 -19.395 0.010 17.14  ? 187  LEU A HA   1  
ATOM   2812   H HB2  . LEU A 1 187 ? -3.551  19.336 -18.144 0.010 16.67  ? 187  LEU A HB2  1  
ATOM   2813   H HB3  . LEU A 1 187 ? -2.938  19.054 -19.551 0.010 16.14  ? 187  LEU A HB3  1  
ATOM   2814   H HG   . LEU A 1 187 ? -1.956  20.547 -17.685 0.010 17.92  ? 187  LEU A HG   1  
ATOM   2815   H HD11 . LEU A 1 187 ? -0.748  19.195 -19.186 0.010 17.06  ? 187  LEU A HD11 1  
ATOM   2816   H HD12 . LEU A 1 187 ? -0.796  20.421 -20.195 0.010 16.90  ? 187  LEU A HD12 1  
ATOM   2817   H HD13 . LEU A 1 187 ? -0.070  20.572 -18.788 0.010 17.97  ? 187  LEU A HD13 1  
ATOM   2818   H HD21 . LEU A 1 187 ? -3.098  22.358 -19.254 0.010 18.12  ? 187  LEU A HD21 1  
ATOM   2819   H HD22 . LEU A 1 187 ? -2.186  22.563 -17.960 0.010 18.90  ? 187  LEU A HD22 1  
ATOM   2820   H HD23 . LEU A 1 187 ? -1.514  22.436 -19.367 0.010 18.88  ? 187  LEU A HD23 1  
ATOM   2821   N N    . VAL A 1 188 ? -4.953  21.116 -21.819 0.010 16.83  ? 188  VAL A N    1  
ATOM   2822   C CA   . VAL A 1 188 ? -5.124  21.111 -23.263 0.010 16.85  ? 188  VAL A CA   1  
ATOM   2823   C C    . VAL A 1 188 ? -4.124  22.037 -23.934 0.010 17.68  ? 188  VAL A C    1  
ATOM   2824   O O    . VAL A 1 188 ? -4.002  23.178 -23.523 0.010 18.54  ? 188  VAL A O    1  
ATOM   2825   C CB   . VAL A 1 188 ? -6.553  21.595 -23.621 0.010 17.10  ? 188  VAL A CB   1  
ATOM   2826   C CG1  . VAL A 1 188 ? -6.759  21.636 -25.129 0.010 17.40  ? 188  VAL A CG1  1  
ATOM   2827   C CG2  . VAL A 1 188 ? -7.577  20.732 -22.899 0.010 16.43  ? 188  VAL A CG2  1  
ATOM   2828   H H    . VAL A 1 188 ? -5.131  21.865 -21.453 0.010 17.35  ? 188  VAL A H    1  
ATOM   2829   H HA   . VAL A 1 188 ? -4.995  20.223 -23.622 0.010 16.35  ? 188  VAL A HA   1  
ATOM   2830   H HB   . VAL A 1 188 ? -6.659  22.498 -23.289 0.010 17.69  ? 188  VAL A HB   1  
ATOM   2831   H HG11 . VAL A 1 188 ? -6.346  20.853 -25.525 0.010 17.03  ? 188  VAL A HG11 1  
ATOM   2832   H HG12 . VAL A 1 188 ? -7.709  21.643 -25.326 0.010 17.43  ? 188  VAL A HG12 1  
ATOM   2833   H HG13 . VAL A 1 188 ? -6.352  22.444 -25.480 0.010 18.08  ? 188  VAL A HG13 1  
ATOM   2834   H HG21 . VAL A 1 188 ? -7.240  19.824 -22.853 0.010 15.92  ? 188  VAL A HG21 1  
ATOM   2835   H HG22 . VAL A 1 188 ? -7.693  21.077 -22.001 0.010 16.60  ? 188  VAL A HG22 1  
ATOM   2836   H HG23 . VAL A 1 188 ? -8.421  20.757 -23.378 0.010 16.50  ? 188  VAL A HG23 1  
ATOM   2837   N N    . CYS A 1 189 ? -3.404  21.533 -24.933 0.010 17.60  ? 189  CYS A N    1  
ATOM   2838   C CA   . CYS A 1 189 ? -2.357  22.316 -25.611 0.010 18.51  ? 189  CYS A CA   1  
ATOM   2839   C C    . CYS A 1 189 ? -2.656  22.374 -27.103 0.010 19.00  ? 189  CYS A C    1  
ATOM   2840   O O    . CYS A 1 189 ? -2.740  21.348 -27.756 0.010 18.55  ? 189  CYS A O    1  
ATOM   2841   C CB   . CYS A 1 189 ? -0.964  21.689 -25.378 0.010 18.29  ? 189  CYS A CB   1  
ATOM   2842   S SG   . CYS A 1 189 ? -0.619  21.279 -23.641 0.010 17.81  ? 189  CYS A SG   1  
ATOM   2843   H H    . CYS A 1 189 ? -3.492  20.740 -25.238 0.010 17.13  ? 189  CYS A H    1  
ATOM   2844   H HA   . CYS A 1 189 ? -2.333  23.222 -25.268 0.010 19.14  ? 189  CYS A HA   1  
ATOM   2845   H HB2  . CYS A 1 189 ? -0.885  20.876 -25.895 0.010 17.88  ? 189  CYS A HB2  1  
ATOM   2846   H HB3  . CYS A 1 189 ? -0.296  22.322 -25.676 0.010 19.00  ? 189  CYS A HB3  1  
ATOM   2847   N N    . GLY A 1 190 ? -2.796  23.581 -27.651 0.010 20.14  ? 190  GLY A N    1  
ATOM   2848   C CA   . GLY A 1 190 ? -3.179  23.711 -29.042 0.010 20.89  ? 190  GLY A CA   1  
ATOM   2849   C C    . GLY A 1 190 ? -4.436  22.914 -29.411 0.010 20.30  ? 190  GLY A C    1  
ATOM   2850   O O    . GLY A 1 190 ? -4.494  22.359 -30.495 0.010 20.56  ? 190  GLY A O    1  
ATOM   2851   H H    . GLY A 1 190 ? -2.668  24.325 -27.243 0.010 20.61  ? 190  GLY A H    1  
ATOM   2852   H HA2  . GLY A 1 190 ? -3.341  24.643 -29.244 0.010 21.76  ? 190  GLY A HA2  1  
ATOM   2853   H HA3  . GLY A 1 190 ? -2.455  23.399 -29.600 0.010 21.11  ? 190  GLY A HA3  1  
ATOM   2854   N N    . GLY A 1 191 ? -5.420  22.844 -28.519 0.010 19.68  ? 191  GLY A N    1  
ATOM   2855   C CA   . GLY A 1 191 ? -6.676  22.164 -28.818 0.010 19.32  ? 191  GLY A CA   1  
ATOM   2856   C C    . GLY A 1 191 ? -6.615  20.654 -28.707 0.010 18.29  ? 191  GLY A C    1  
ATOM   2857   O O    . GLY A 1 191 ? -7.578  19.973 -29.043 0.010 18.11  ? 191  GLY A O    1  
ATOM   2858   H H    . GLY A 1 191 ? -5.383  23.170 -27.729 0.010 19.55  ? 191  GLY A H    1  
ATOM   2859   H HA2  . GLY A 1 191 ? -7.366  22.477 -28.218 0.010 19.23  ? 191  GLY A HA2  1  
ATOM   2860   H HA3  . GLY A 1 191 ? -6.943  22.377 -29.720 0.010 20.01  ? 191  GLY A HA3  1  
ATOM   2861   N N    . VAL A 1 192 ? -5.492  20.148 -28.197 0.010 17.77  ? 192  VAL A N    1  
ATOM   2862   C CA   . VAL A 1 192 ? -5.294  18.722 -27.991 0.010 16.95  ? 192  VAL A CA   1  
ATOM   2863   C C    . VAL A 1 192 ? -5.122  18.379 -26.518 0.010 16.15  ? 192  VAL A C    1  
ATOM   2864   O O    . VAL A 1 192 ? -4.311  18.974 -25.827 0.010 16.24  ? 192  VAL A O    1  
ATOM   2865   C CB   . VAL A 1 192 ? -4.024  18.238 -28.706 0.010 17.17  ? 192  VAL A CB   1  
ATOM   2866   C CG1  . VAL A 1 192 ? -3.913  16.717 -28.547 0.010 16.52  ? 192  VAL A CG1  1  
ATOM   2867   C CG2  . VAL A 1 192 ? -4.029  18.648 -30.154 0.010 18.25  ? 192  VAL A CG2  1  
ATOM   2868   H H    . VAL A 1 192 ? -4.818  20.617 -27.951 0.010 17.97  ? 192  VAL A H    1  
ATOM   2869   H HA   . VAL A 1 192 ? -6.048  18.220 -28.335 0.010 16.90  ? 192  VAL A HA   1  
ATOM   2870   H HB   . VAL A 1 192 ? -3.247  18.646 -28.292 0.010 17.19  ? 192  VAL A HB   1  
ATOM   2871   H HG11 . VAL A 1 192 ? -4.780  16.311 -28.695 0.010 16.47  ? 192  VAL A HG11 1  
ATOM   2872   H HG12 . VAL A 1 192 ? -3.276  16.381 -29.193 0.010 16.82  ? 192  VAL A HG12 1  
ATOM   2873   H HG13 . VAL A 1 192 ? -3.601  16.524 -27.650 0.010 16.02  ? 192  VAL A HG13 1  
ATOM   2874   H HG21 . VAL A 1 192 ? -4.034  19.615 -30.206 0.010 18.75  ? 192  VAL A HG21 1  
ATOM   2875   H HG22 . VAL A 1 192 ? -3.232  18.306 -30.582 0.010 18.44  ? 192  VAL A HG22 1  
ATOM   2876   H HG23 . VAL A 1 192 ? -4.821  18.294 -30.585 0.010 18.38  ? 192  VAL A HG23 1  
ATOM   2877   N N    . LEU A 1 193 ? -5.855  17.370 -26.055 0.010 15.55  ? 193  LEU A N    1  
ATOM   2878   C CA   . LEU A 1 193 ? -5.680  16.889 -24.708 0.010 14.98  ? 193  LEU A CA   1  
ATOM   2879   C C    . LEU A 1 193 ? -4.275  16.283 -24.544 0.010 14.81  ? 193  LEU A C    1  
ATOM   2880   O O    . LEU A 1 193 ? -3.947  15.318 -25.217 0.010 14.72  ? 193  LEU A O    1  
ATOM   2881   C CB   . LEU A 1 193 ? -6.708  15.806 -24.366 0.010 14.59  ? 193  LEU A CB   1  
ATOM   2882   C CG   . LEU A 1 193 ? -6.707  15.321 -22.914 0.010 14.23  ? 193  LEU A CG   1  
ATOM   2883   C CD1  . LEU A 1 193 ? -7.022  16.467 -21.914 0.010 14.47  ? 193  LEU A CD1  1  
ATOM   2884   C CD2  . LEU A 1 193 ? -7.609  14.114 -22.692 0.010 14.04  ? 193  LEU A CD2  1  
ATOM   2885   H H    . LEU A 1 193 ? -6.444  16.949 -26.511 0.010 15.58  ? 193  LEU A H    1  
ATOM   2886   H HA   . LEU A 1 193 ? -5.780  17.626 -24.088 0.010 15.11  ? 193  LEU A HA   1  
ATOM   2887   H HB2  . LEU A 1 193 ? -7.590  16.164 -24.540 0.010 14.75  ? 193  LEU A HB2  1  
ATOM   2888   H HB3  . LEU A 1 193 ? -6.554  15.043 -24.940 0.010 14.58  ? 193  LEU A HB3  1  
ATOM   2889   H HG   . LEU A 1 193 ? -5.807  15.016 -22.712 0.010 14.15  ? 193  LEU A HG   1  
ATOM   2890   H HD11 . LEU A 1 193 ? -7.811  16.948 -22.201 0.010 14.63  ? 193  LEU A HD11 1  
ATOM   2891   H HD12 . LEU A 1 193 ? -7.164  16.086 -21.036 0.010 14.37  ? 193  LEU A HD12 1  
ATOM   2892   H HD13 . LEU A 1 193 ? -6.266  17.071 -21.879 0.010 14.68  ? 193  LEU A HD13 1  
ATOM   2893   H HD21 . LEU A 1 193 ? -8.491  14.325 -23.030 0.010 14.17  ? 193  LEU A HD21 1  
ATOM   2894   H HD22 . LEU A 1 193 ? -7.254  13.355 -23.179 0.010 14.00  ? 193  LEU A HD22 1  
ATOM   2895   H HD23 . LEU A 1 193 ? -7.651  13.910 -21.745 0.010 13.96  ? 193  LEU A HD23 1  
ATOM   2896   N N    . GLU A 1 194 ? -3.496  16.832 -23.610 0.010 14.91  ? 194  GLU A N    1  
ATOM   2897   C CA   . GLU A 1 194 ? -2.171  16.280 -23.305 0.010 14.86  ? 194  GLU A CA   1  
ATOM   2898   C C    . GLU A 1 194 ? -2.040  15.727 -21.892 0.010 14.66  ? 194  GLU A C    1  
ATOM   2899   O O    . GLU A 1 194 ? -1.280  14.793 -21.664 0.010 14.54  ? 194  GLU A O    1  
ATOM   2900   C CB   . GLU A 1 194 ? -1.107  17.328 -23.518 0.010 15.47  ? 194  GLU A CB   1  
ATOM   2901   C CG   . GLU A 1 194 ? -0.933  17.722 -24.967 0.010 15.91  ? 194  GLU A CG   1  
ATOM   2902   C CD   . GLU A 1 194 ? -0.168  16.706 -25.798 0.010 15.85  ? 194  GLU A CD   1  
ATOM   2903   O OE1  . GLU A 1 194 ? 0.357   15.740 -25.230 0.010 15.49  ? 194  GLU A OE1  1  
ATOM   2904   O OE2  . GLU A 1 194 ? -0.144  16.898 -27.030 0.010 16.34  ? 194  GLU A OE2  1  
ATOM   2905   H H    . GLU A 1 194 ? -3.705  17.518 -23.144 0.010 15.10  ? 194  GLU A H    1  
ATOM   2906   H HA   . GLU A 1 194 ? -1.979  15.551 -23.915 0.010 14.75  ? 194  GLU A HA   1  
ATOM   2907   H HB2  . GLU A 1 194 ? -1.347  18.122 -23.017 0.010 15.73  ? 194  GLU A HB2  1  
ATOM   2908   H HB3  . GLU A 1 194 ? -0.264  16.984 -23.196 0.010 15.49  ? 194  GLU A HB3  1  
ATOM   2909   H HG2  . GLU A 1 194 ? -1.808  17.829 -25.369 0.010 15.89  ? 194  GLU A HG2  1  
ATOM   2910   H HG3  . GLU A 1 194 ? -0.444  18.557 -25.011 0.010 16.41  ? 194  GLU A HG3  1  
ATOM   2911   N N    . GLY A 1 195 ? -2.759  16.323 -20.956 0.010 14.80  ? 195  GLY A N    1  
ATOM   2912   C CA   . GLY A 1 195 ? -2.666  15.954 -19.560 0.010 14.91  ? 195  GLY A CA   1  
ATOM   2913   C C    . GLY A 1 195 ? -3.973  15.896 -18.800 0.010 14.86  ? 195  GLY A C    1  
ATOM   2914   O O    . GLY A 1 195 ? -4.956  16.475 -19.214 0.010 14.87  ? 195  GLY A O    1  
ATOM   2915   H H    . GLY A 1 195 ? -3.297  16.972 -21.108 0.010 14.96  ? 195  GLY A H    1  
ATOM   2916   H HA2  . GLY A 1 195 ? -2.245  15.095 -19.498 0.010 14.74  ? 195  GLY A HA2  1  
ATOM   2917   H HA3  . GLY A 1 195 ? -2.105  16.592 -19.100 0.010 15.35  ? 195  GLY A HA3  1  
ATOM   2918   N N    . VAL A 1 196 ? -3.940  15.185 -17.679 0.010 14.95  ? 196  VAL A N    1  
ATOM   2919   C CA   . VAL A 1 196 ? -5.048  15.137 -16.726 0.010 15.19  ? 196  VAL A CA   1  
ATOM   2920   C C    . VAL A 1 196 ? -4.501  15.460 -15.324 0.010 16.01  ? 196  VAL A C    1  
ATOM   2921   O O    . VAL A 1 196 ? -3.485  14.921 -14.906 0.010 16.24  ? 196  VAL A O    1  
ATOM   2922   C CB   . VAL A 1 196 ? -5.716  13.745 -16.721 0.010 14.90  ? 196  VAL A CB   1  
ATOM   2923   C CG1  . VAL A 1 196 ? -6.854  13.692 -15.729 0.010 15.34  ? 196  VAL A CG1  1  
ATOM   2924   C CG2  . VAL A 1 196 ? -6.215  13.395 -18.088 0.010 14.36  ? 196  VAL A CG2  1  
ATOM   2925   H H    . VAL A 1 196 ? -3.265  14.714 -17.437 0.010 14.97  ? 196  VAL A H    1  
ATOM   2926   H HA   . VAL A 1 196 ? -5.713  15.800 -16.954 0.010 15.22  ? 196  VAL A HA   1  
ATOM   2927   H HB   . VAL A 1 196 ? -5.062  13.078 -16.461 0.010 14.94  ? 196  VAL A HB   1  
ATOM   2928   H HG11 . VAL A 1 196 ? -7.427  14.461 -15.863 0.010 15.41  ? 196  VAL A HG11 1  
ATOM   2929   H HG12 . VAL A 1 196 ? -7.351  12.873 -15.867 0.010 15.20  ? 196  VAL A HG12 1  
ATOM   2930   H HG13 . VAL A 1 196 ? -6.488  13.706 -14.833 0.010 15.82  ? 196  VAL A HG13 1  
ATOM   2931   H HG21 . VAL A 1 196 ? -6.055  14.138 -18.689 0.010 14.27  ? 196  VAL A HG21 1  
ATOM   2932   H HG22 . VAL A 1 196 ? -5.741  12.607 -18.397 0.010 14.24  ? 196  VAL A HG22 1  
ATOM   2933   H HG23 . VAL A 1 196 ? -7.165  13.207 -18.041 0.010 14.39  ? 196  VAL A HG23 1  
ATOM   2934   N N    . VAL A 1 197 ? -5.158  16.359 -14.608 0.010 16.64  ? 197  VAL A N    1  
ATOM   2935   C CA   . VAL A 1 197 ? -4.685  16.734 -13.284 0.010 17.72  ? 197  VAL A CA   1  
ATOM   2936   C C    . VAL A 1 197 ? -4.562  15.529 -12.373 0.010 18.03  ? 197  VAL A C    1  
ATOM   2937   O O    . VAL A 1 197 ? -5.426  14.654 -12.363 0.010 17.83  ? 197  VAL A O    1  
ATOM   2938   C CB   . VAL A 1 197 ? -5.597  17.814 -12.644 0.010 18.55  ? 197  VAL A CB   1  
ATOM   2939   C CG1  . VAL A 1 197 ? -5.234  18.083 -11.183 0.010 19.93  ? 197  VAL A CG1  1  
ATOM   2940   C CG2  . VAL A 1 197 ? -5.468  19.082 -13.460 0.010 18.63  ? 197  VAL A CG2  1  
ATOM   2941   H H    . VAL A 1 197 ? -5.868  16.762 -14.864 0.010 16.57  ? 197  VAL A H    1  
ATOM   2942   H HA   . VAL A 1 197 ? -3.795  17.113 -13.372 0.010 17.95  ? 197  VAL A HA   1  
ATOM   2943   H HB   . VAL A 1 197 ? -6.518  17.519 -12.674 0.010 18.31  ? 197  VAL A HB   1  
ATOM   2944   H HG11 . VAL A 1 197 ? -5.233  17.261 -10.670 0.010 20.03  ? 197  VAL A HG11 1  
ATOM   2945   H HG12 . VAL A 1 197 ? -4.357  18.492 -11.150 0.010 20.28  ? 197  VAL A HG12 1  
ATOM   2946   H HG13 . VAL A 1 197 ? -5.891  18.692 -10.812 0.010 20.53  ? 197  VAL A HG13 1  
ATOM   2947   H HG21 . VAL A 1 197 ? -4.922  18.910 -14.237 0.010 18.19  ? 197  VAL A HG21 1  
ATOM   2948   H HG22 . VAL A 1 197 ? -6.355  19.362 -13.739 0.010 18.36  ? 197  VAL A HG22 1  
ATOM   2949   H HG23 . VAL A 1 197 ? -5.054  19.769 -12.914 0.010 19.54  ? 197  VAL A HG23 1  
ATOM   2950   N N    . THR A 1 198 ? -3.443  15.503 -11.659 0.010 18.73  ? 198  THR A N    1  
ATOM   2951   C CA   . THR A 1 198 ? -3.220  14.643 -10.516 0.010 19.55  ? 198  THR A CA   1  
ATOM   2952   C C    . THR A 1 198 ? -2.931  15.567 -9.302  0.010 21.07  ? 198  THR A C    1  
ATOM   2953   O O    . THR A 1 198 ? -2.763  16.780 -9.494  0.010 21.34  ? 198  THR A O    1  
ATOM   2954   C CB   . THR A 1 198 ? -2.100  13.603 -10.858 0.010 19.33  ? 198  THR A CB   1  
ATOM   2955   O OG1  . THR A 1 198 ? -0.966  13.747 -9.997  0.010 20.65  ? 198  THR A OG1  1  
ATOM   2956   C CG2  . THR A 1 198 ? -1.608  13.799 -12.287 0.010 18.67  ? 198  THR A CG2  1  
ATOM   2957   H H    . THR A 1 198 ? -2.766  15.999 -11.835 0.010 18.84  ? 198  THR A H    1  
ATOM   2958   H HA   . THR A 1 198 ? -4.036  14.156 -10.330 0.010 19.49  ? 198  THR A HA   1  
ATOM   2959   H HB   . THR A 1 198 ? -2.468  12.711 -10.772 0.010 18.88  ? 198  THR A HB   1  
ATOM   2960   H HG1  . THR A 1 198 ? -0.413  14.292 -10.343 0.010 20.61  ? 198  THR A HG1  1  
ATOM   2961   H HG21 . THR A 1 198 ? -1.200  14.674 -12.380 0.010 19.14  ? 198  THR A HG21 1  
ATOM   2962   H HG22 . THR A 1 198 ? -0.940  13.128 -12.495 0.010 18.74  ? 198  THR A HG22 1  
ATOM   2963   H HG23 . THR A 1 198 ? -2.336  13.712 -12.921 0.010 17.85  ? 198  THR A HG23 1  
ATOM   2964   N N    . SER A 1 199 ? -2.941  15.057 -8.061  0.010 22.28  ? 199  SER A N    1  
ATOM   2965   C CA   . SER A 1 199 ? -2.901  15.965 -6.875  0.010 24.01  ? 199  SER A CA   1  
ATOM   2966   C C    . SER A 1 199 ? -1.558  16.731 -6.796  0.010 24.74  ? 199  SER A C    1  
ATOM   2967   O O    . SER A 1 199 ? -0.690  16.533 -5.931  0.010 25.82  ? 199  SER A O    1  
ATOM   2968   C CB   . SER A 1 199 ? -3.307  15.249 -5.569  0.010 25.48  ? 199  SER A CB   1  
ATOM   2969   O OG   . SER A 1 199 ? -4.735  15.163 -5.458  0.010 25.68  ? 199  SER A OG   1  
ATOM   2970   H H    . SER A 1 199 ? -2.972  14.219 -7.869  0.010 22.27  ? 199  SER A H    1  
ATOM   2971   H HA   . SER A 1 199 ? -3.577  16.648 -7.020  0.010 23.94  ? 199  SER A HA   1  
ATOM   2972   H HB2  . SER A 1 199 ? -2.939  14.352 -5.567  0.010 25.17  ? 199  SER A HB2  1  
ATOM   2973   H HB3  . SER A 1 199 ? -2.958  15.750 -4.815  0.010 26.74  ? 199  SER A HB3  1  
ATOM   2974   H HG   . SER A 1 199 ? -5.043  14.611 -6.028  0.010 24.86  ? 199  SER A HG   1  
ATOM   2975   N N    . GLY A 1 200 ? -1.436  17.600 -7.796  0.010 24.19  ? 200  GLY A N    1  
ATOM   2976   C CA   . GLY A 1 200 ? -0.286  18.429 -8.078  0.010 24.78  ? 200  GLY A CA   1  
ATOM   2977   C C    . GLY A 1 200 ? -0.925  19.784 -8.328  0.010 24.94  ? 200  GLY A C    1  
ATOM   2978   O O    . GLY A 1 200 ? -1.520  19.969 -9.396  0.010 23.54  ? 200  GLY A O    1  
ATOM   2979   H H    . GLY A 1 200 ? -2.070  17.744 -8.358  0.010 23.54  ? 200  GLY A H    1  
ATOM   2980   H HA2  . GLY A 1 200 ? 0.374   18.400 -7.374  0.010 25.97  ? 200  GLY A HA2  1  
ATOM   2981   H HA3  . GLY A 1 200 ? 0.131   18.132 -8.901  0.010 23.87  ? 200  GLY A HA3  1  
ATOM   2982   N N    . SER A 1 201 ? -0.876  20.716 -7.370  0.010 26.73  ? 201  SER A N    1  
ATOM   2983   C CA   . SER A 1 201 ? -0.159  20.544 -6.104  0.010 28.67  ? 201  SER A CA   1  
ATOM   2984   C C    . SER A 1 201 ? -1.070  20.608 -4.881  0.010 30.24  ? 201  SER A C    1  
ATOM   2985   O O    . SER A 1 201 ? -1.764  21.591 -4.651  0.010 30.98  ? 201  SER A O    1  
ATOM   2986   C CB   . SER A 1 201 ? 0.972   21.562 -6.009  0.010 29.93  ? 201  SER A CB   1  
ATOM   2987   O OG   . SER A 1 201 ? 2.159   20.968 -6.540  0.010 30.05  ? 201  SER A OG   1  
ATOM   2988   H H    . SER A 1 201 ? -1.262  21.480 -7.437  0.010 26.98  ? 201  SER A H    1  
ATOM   2989   H HA   . SER A 1 201 ? 0.272   19.690 -6.033  0.010 28.42  ? 201  SER A HA   1  
ATOM   2990   H HB2  . SER A 1 201 ? 0.744   22.359 -6.516  0.010 29.17  ? 201  SER A HB2  1  
ATOM   2991   H HB3  . SER A 1 201 ? 1.110   21.786 -5.074  0.010 31.49  ? 201  SER A HB3  1  
ATOM   2992   H HG   . SER A 1 201 ? 1.924   20.248 -6.957  0.010 29.85  ? 201  SER A HG   1  
ATOM   2993   N N    . ALA A 1 202 ? -1.077  19.514 -4.126  0.010 30.82  ? 202  ALA A N    1  
ATOM   2994   C CA   . ALA A 1 202 ? -1.916  19.381 -2.947  0.010 32.43  ? 202  ALA A CA   1  
ATOM   2995   C C    . ALA A 1 202 ? -1.024  19.402 -1.721  0.010 34.94  ? 202  ALA A C    1  
ATOM   2996   O O    . ALA A 1 202 ? -1.398  18.926 -0.645  0.010 36.48  ? 202  ALA A O    1  
ATOM   2997   C CB   . ALA A 1 202 ? -2.723  18.077 -3.040  0.010 31.34  ? 202  ALA A CB   1  
ATOM   2998   H H    . ALA A 1 202 ? -0.601  18.815 -4.288  0.010 30.35  ? 202  ALA A H    1  
ATOM   2999   H HA   . ALA A 1 202 ? -2.531  20.125 -2.883  0.010 32.77  ? 202  ALA A HA   1  
ATOM   3000   H HB1  . ALA A 1 202 ? -2.120  17.334 -3.152  0.010 31.02  ? 202  ALA A HB1  1  
ATOM   3001   H HB2  . ALA A 1 202 ? -3.254  17.963 -2.234  0.010 32.50  ? 202  ALA A HB2  1  
ATOM   3002   H HB3  . ALA A 1 202 ? -3.304  18.128 -3.812  0.010 29.92  ? 202  ALA A HB3  1  
ATOM   3003   N N    . VAL A 1 203 ? 0.156   19.992 -1.925  0.010 35.44  ? 203  VAL A N    1  
ATOM   3004   C CA   . VAL A 1 203 ? 1.222   20.076 -0.953  0.010 37.78  ? 203  VAL A CA   1  
ATOM   3005   C C    . VAL A 1 203 ? 1.766   21.501 -1.125  0.010 38.80  ? 203  VAL A C    1  
ATOM   3006   O O    . VAL A 1 203 ? 2.962   21.765 -0.965  0.010 39.97  ? 203  VAL A O    1  
ATOM   3007   C CB   . VAL A 1 203 ? 2.278   19.000 -1.276  0.010 36.97  ? 203  VAL A CB   1  
ATOM   3008   C CG1  . VAL A 1 203 ? 3.127   18.693 -0.073  0.010 39.53  ? 203  VAL A CG1  1  
ATOM   3009   C CG2  . VAL A 1 203 ? 1.564   17.712 -1.774  0.010 34.86  ? 203  VAL A CG2  1  
ATOM   3010   H H    . VAL A 1 203 ? 0.374   20.371 -2.665  0.010 34.49  ? 203  VAL A H    1  
ATOM   3011   H HA   . VAL A 1 203 ? 0.884   19.951 -0.051  0.010 39.25  ? 203  VAL A HA   1  
ATOM   3012   H HB   . VAL A 1 203 ? 2.862   19.320 -1.983  0.010 36.21  ? 203  VAL A HB   1  
ATOM   3013   H HG11 . VAL A 1 203 ? 2.882   19.288 0.655   0.010 41.22  ? 203  VAL A HG11 1  
ATOM   3014   H HG12 . VAL A 1 203 ? 2.973   17.771 0.188   0.010 39.33  ? 203  VAL A HG12 1  
ATOM   3015   H HG13 . VAL A 1 203 ? 4.061   18.823 -0.301  0.010 39.78  ? 203  VAL A HG13 1  
ATOM   3016   H HG21 . VAL A 1 203 ? 0.911   17.436 -1.112  0.010 35.36  ? 203  VAL A HG21 1  
ATOM   3017   H HG22 . VAL A 1 203 ? 1.119   17.889 -2.617  0.010 33.20  ? 203  VAL A HG22 1  
ATOM   3018   H HG23 . VAL A 1 203 ? 2.223   17.010 -1.894  0.010 34.85  ? 203  VAL A HG23 1  
ATOM   3019   N N    . CYS A 1 204 ? 0.843   22.420 -1.428  0.010 38.46  ? 204  CYS A N    1  
ATOM   3020   C CA   . CYS A 1 204 ? 1.166   23.749 -1.941  0.010 39.28  ? 204  CYS A CA   1  
ATOM   3021   C C    . CYS A 1 204 ? 2.027   24.576 -1.023  0.010 42.39  ? 204  CYS A C    1  
ATOM   3022   O O    . CYS A 1 204 ? 1.659   24.852 0.120   0.010 44.56  ? 204  CYS A O    1  
ATOM   3023   C CB   . CYS A 1 204 ? -0.117  24.545 -2.171  0.010 39.09  ? 204  CYS A CB   1  
ATOM   3024   S SG   . CYS A 1 204 ? -1.288  23.833 -3.282  0.010 35.95  ? 204  CYS A SG   1  
ATOM   3025   H H    . CYS A 1 204 ? -0.004  22.293 -1.336  0.010 37.85  ? 204  CYS A H    1  
ATOM   3026   H HA   . CYS A 1 204 ? 1.633   23.668 -2.790  0.010 38.10  ? 204  CYS A HA   1  
ATOM   3027   H HB2  . CYS A 1 204 ? -0.566  24.652 -1.321  0.010 40.60  ? 204  CYS A HB2  1  
ATOM   3028   H HB3  . CYS A 1 204 ? 0.128   25.419 -2.517  0.010 39.47  ? 204  CYS A HB3  1  
ATOM   3029   N N    . GLY A 1 205 ? 3.168   25.006 -1.536  0.010 42.74  ? 205  GLY A N    1  
ATOM   3030   C CA   . GLY A 1 205 ? 3.934   26.044 -0.871  0.010 45.68  ? 205  GLY A CA   1  
ATOM   3031   C C    . GLY A 1 205 ? 5.262   26.198 -1.566  0.010 45.62  ? 205  GLY A C    1  
ATOM   3032   O O    . GLY A 1 205 ? 6.034   25.251 -1.569  0.010 44.94  ? 205  GLY A O    1  
ATOM   3033   H H    . GLY A 1 205 ? 3.522   24.705 -2.259  0.010 41.39  ? 205  GLY A H    1  
ATOM   3034   H HA2  . GLY A 1 205 ? 3.456   26.888 -0.878  0.010 46.07  ? 205  GLY A HA2  1  
ATOM   3035   H HA3  . GLY A 1 205 ? 4.096   25.787 0.050   0.010 47.45  ? 205  GLY A HA3  1  
ATOM   3036   N N    . ASN A 1 206 ? 5.505   27.347 -2.198  0.010 46.26  ? 206  ASN A N    1  
ATOM   3037   C CA   . ASN A 1 206 ? 6.867   27.817 -2.522  0.010 47.45  ? 206  ASN A CA   1  
ATOM   3038   C C    . ASN A 1 206 ? 6.918   29.151 -3.303  0.010 47.90  ? 206  ASN A C    1  
ATOM   3039   O O    . ASN A 1 206 ? 7.208   30.206 -2.704  0.010 50.74  ? 206  ASN A O    1  
ATOM   3040   C CB   . ASN A 1 206 ? 7.712   26.740 -3.220  0.010 45.53  ? 206  ASN A CB   1  
ATOM   3041   C CG   . ASN A 1 206 ? 6.927   25.922 -4.192  0.010 42.10  ? 206  ASN A CG   1  
ATOM   3042   O OD1  . ASN A 1 206 ? 6.860   26.287 -5.337  0.010 40.69  ? 206  ASN A OD1  1  
ATOM   3043   N ND2  . ASN A 1 206 ? 6.383   24.781 -3.755  0.010 40.96  ? 206  ASN A ND2  1  
ATOM   3044   H H    . ASN A 1 206 ? 4.890   27.887 -2.456  0.010 46.15  ? 206  ASN A H    1  
ATOM   3045   H HA   . ASN A 1 206 ? 7.308   27.992 -1.674  0.010 49.65  ? 206  ASN A HA   1  
ATOM   3046   H HB2  . ASN A 1 206 ? 8.423   27.180 -3.712  0.010 46.04  ? 206  ASN A HB2  1  
ATOM   3047   H HB3  . ASN A 1 206 ? 8.100   26.135 -2.568  0.010 46.15  ? 206  ASN A HB3  1  
ATOM   3048   H HD21 . ASN A 1 206 ? 6.832   24.053 -3.806  0.010 40.43  ? 206  ASN A HD21 1  
ATOM   3049   H HD22 . ASN A 1 206 ? 5.590   24.768 -3.433  0.010 40.90  ? 206  ASN A HD22 1  
ATOM   3050   N N    . ARG A 1 207 ? 6.643   29.095 -4.612  0.010 45.29  ? 207  ARG A N    1  
ATOM   3051   C CA   . ARG A 1 207 ? 6.810   30.233 -5.529  0.010 45.51  ? 207  ARG A CA   1  
ATOM   3052   C C    . ARG A 1 207 ? 6.891   29.659 -6.917  0.010 42.43  ? 207  ARG A C    1  
ATOM   3053   O O    . ARG A 1 207 ? 6.248   30.145 -7.867  0.010 41.29  ? 207  ARG A O    1  
ATOM   3054   C CB   . ARG A 1 207 ? 8.106   31.004 -5.261  0.010 47.92  ? 207  ARG A CB   1  
ATOM   3055   C CG   . ARG A 1 207 ? 7.907   32.449 -4.818  0.010 50.78  ? 207  ARG A CG   1  
ATOM   3056   C CD   . ARG A 1 207 ? 8.263   33.469 -5.910  0.010 51.12  ? 207  ARG A CD   1  
ATOM   3057   N NE   . ARG A 1 207 ? 9.326   34.373 -5.470  0.010 54.66  ? 207  ARG A NE   1  
ATOM   3058   C CZ   . ARG A 1 207 ? 9.309   35.695 -5.623  0.010 56.87  ? 207  ARG A CZ   1  
ATOM   3059   N NH1  . ARG A 1 207 ? 8.287   36.300 -6.220  0.010 55.95  ? 207  ARG A NH1  1  
ATOM   3060   N NH2  . ARG A 1 207 ? 10.333  36.422 -5.189  0.010 60.24  ? 207  ARG A NH2  1  
ATOM   3061   H H    . ARG A 1 207 ? 6.341   28.392 -5.003  0.010 43.46  ? 207  ARG A H    1  
ATOM   3062   H HA   . ARG A 1 207 ? 6.052   30.835 -5.479  0.010 46.19  ? 207  ARG A HA   1  
ATOM   3063   H HB2  . ARG A 1 207 ? 8.624   30.546 -4.584  0.010 48.88  ? 207  ARG A HB2  1  
ATOM   3064   H HB3  . ARG A 1 207 ? 8.620   31.013 -6.079  0.010 46.78  ? 207  ARG A HB3  1  
ATOM   3065   H HG2  . ARG A 1 207 ? 6.981   32.583 -4.565  0.010 50.45  ? 207  ARG A HG2  1  
ATOM   3066   H HG3  . ARG A 1 207 ? 8.482   32.618 -4.057  0.010 52.92  ? 207  ARG A HG3  1  
ATOM   3067   H HD2  . ARG A 1 207 ? 8.567   33.015 -6.711  0.010 49.68  ? 207  ARG A HD2  1  
ATOM   3068   H HD3  . ARG A 1 207 ? 7.472   33.988 -6.112  0.010 50.55  ? 207  ARG A HD3  1  
ATOM   3069   H HE   . ARG A 1 207 ? 10.055  34.016 -5.183  0.010 55.57  ? 207  ARG A HE   1  
ATOM   3070   H HH11 . ARG A 1 207 ? 7.616   35.851 -6.511  0.010 53.88  ? 207  ARG A HH11 1  
ATOM   3071   H HH12 . ARG A 1 207 ? 8.295   37.156 -6.311  0.010 57.53  ? 207  ARG A HH12 1  
ATOM   3072   H HH21 . ARG A 1 207 ? 10.997  36.038 -4.803  0.010 60.93  ? 207  ARG A HH21 1  
ATOM   3073   H HH22 . ARG A 1 207 ? 10.325  37.276 -5.287  0.010 61.82  ? 207  ARG A HH22 1  
ATOM   3074   N N    . LYS A 1 208 ? 7.692   28.609 -7.028  0.010 41.25  ? 208  LYS A N    1  
ATOM   3075   C CA   . LYS A 1 208 ? 7.755   27.863 -8.274  0.010 38.46  ? 208  LYS A CA   1  
ATOM   3076   C C    . LYS A 1 208 ? 7.189   26.421 -8.058  0.010 36.70  ? 208  LYS A C    1  
ATOM   3077   O O    . LYS A 1 208 ? 7.688   25.440 -8.625  0.010 35.67  ? 208  LYS A O    1  
ATOM   3078   C CB   . LYS A 1 208 ? 9.167   27.883 -8.892  0.010 38.72  ? 208  LYS A CB   1  
ATOM   3079   C CG   . LYS A 1 208 ? 10.250  28.607 -8.081  0.010 41.69  ? 208  LYS A CG   1  
ATOM   3080   C CD   . LYS A 1 208 ? 10.301  30.137 -8.359  0.010 43.97  ? 208  LYS A CD   1  
ATOM   3081   C CE   . LYS A 1 208 ? 11.597  30.772 -7.864  0.010 46.50  ? 208  LYS A CE   1  
ATOM   3082   N NZ   . LYS A 1 208 ? 11.383  31.808 -6.800  0.010 49.61  ? 208  LYS A NZ   1  
ATOM   3083   H H    . LYS A 1 208 ? 8.197   28.311 -6.397  0.010 42.20  ? 208  LYS A H    1  
ATOM   3084   H HA   . LYS A 1 208 ? 7.157   28.279 -8.916  0.010 37.65  ? 208  LYS A HA   1  
ATOM   3085   H HB2  . LYS A 1 208 ? 9.462   26.984 -9.063  0.010 37.53  ? 208  LYS A HB2  1  
ATOM   3086   H HB3  . LYS A 1 208 ? 9.100   28.349 -9.741  0.010 38.29  ? 208  LYS A HB3  1  
ATOM   3087   H HG2  . LYS A 1 208 ? 10.086  28.487 -7.133  0.010 42.62  ? 208  LYS A HG2  1  
ATOM   3088   H HG3  . LYS A 1 208 ? 11.119  28.237 -8.309  0.010 41.42  ? 208  LYS A HG3  1  
ATOM   3089   H HD2  . LYS A 1 208 ? 10.248  30.280 -9.317  0.010 43.04  ? 208  LYS A HD2  1  
ATOM   3090   H HD3  . LYS A 1 208 ? 9.557   30.572 -7.918  0.010 44.90  ? 208  LYS A HD3  1  
ATOM   3091   H HE2  . LYS A 1 208 ? 12.181  30.084 -7.507  0.010 46.03  ? 208  LYS A HE2  1  
ATOM   3092   H HE3  . LYS A 1 208 ? 12.032  31.208 -8.614  0.010 46.73  ? 208  LYS A HE3  1  
ATOM   3093   H HZ1  . LYS A 1 208 ? 10.761  31.534 -6.227  0.010 49.33  ? 208  LYS A HZ1  1  
ATOM   3094   H HZ2  . LYS A 1 208 ? 12.143  31.943 -6.358  0.010 50.73  ? 208  LYS A HZ2  1  
ATOM   3095   H HZ3  . LYS A 1 208 ? 11.123  32.576 -7.167  0.010 50.80  ? 208  LYS A HZ3  1  
ATOM   3096   N N    . LYS A 1 209 ? 6.138   26.329 -7.246  0.010 36.77  ? 209  LYS A N    1  
ATOM   3097   C CA   . LYS A 1 209 ? 5.419   25.059 -7.006  0.010 35.31  ? 209  LYS A CA   1  
ATOM   3098   C C    . LYS A 1 209 ? 4.827   24.658 -8.318  0.010 32.64  ? 209  LYS A C    1  
ATOM   3099   O O    . LYS A 1 209 ? 4.255   25.522 -8.962  0.010 32.50  ? 209  LYS A O    1  
ATOM   3100   C CB   . LYS A 1 209 ? 4.302   25.231 -5.944  0.010 36.39  ? 209  LYS A CB   1  
ATOM   3101   C CG   . LYS A 1 209 ? 3.869   26.594 -5.483  0.010 38.51  ? 209  LYS A CG   1  
ATOM   3102   C CD   . LYS A 1 209 ? 3.095   26.473 -4.187  0.010 40.04  ? 209  LYS A CD   1  
ATOM   3103   C CE   . LYS A 1 209 ? 1.740   27.064 -4.339  0.010 39.43  ? 209  LYS A CE   1  
ATOM   3104   N NZ   . LYS A 1 209 ? 0.895   26.130 -5.066  0.010 36.59  ? 209  LYS A NZ   1  
ATOM   3105   H H    . LYS A 1 209 ? 5.820   27.010 -6.825  0.010 37.76  ? 209  LYS A H    1  
ATOM   3106   H HA   . LYS A 1 209 ? 6.037   24.394 -6.673  0.010 35.42  ? 209  LYS A HA   1  
ATOM   3107   H HB2  . LYS A 1 209 ? 3.520   24.811 -6.281  0.010 34.96  ? 209  LYS A HB2  1  
ATOM   3108   H HB3  . LYS A 1 209 ? 4.553   24.732 -5.171  0.010 37.14  ? 209  LYS A HB3  1  
ATOM   3109   H HG2  . LYS A 1 209 ? 4.624   27.172 -5.318  0.010 39.96  ? 209  LYS A HG2  1  
ATOM   3110   H HG3  . LYS A 1 209 ? 3.289   26.992 -6.148  0.010 37.70  ? 209  LYS A HG3  1  
ATOM   3111   H HD2  . LYS A 1 209 ? 2.967   25.535 -3.980  0.010 39.49  ? 209  LYS A HD2  1  
ATOM   3112   H HD3  . LYS A 1 209 ? 3.563   26.934 -3.482  0.010 42.12  ? 209  LYS A HD3  1  
ATOM   3113   H HE2  . LYS A 1 209 ? 1.339   27.199 -3.470  0.010 40.73  ? 209  LYS A HE2  1  
ATOM   3114   H HE3  . LYS A 1 209 ? 1.764   27.889 -4.842  0.010 39.72  ? 209  LYS A HE3  1  
ATOM   3115   H HZ1  . LYS A 1 209 ? 1.378   25.437 -5.342  0.010 36.33  ? 209  LYS A HZ1  1  
ATOM   3116   H HZ2  . LYS A 1 209 ? 0.234   25.832 -4.531  0.010 36.29  ? 209  LYS A HZ2  1  
ATOM   3117   H HZ3  . LYS A 1 209 ? 0.553   26.543 -5.768  0.010 35.52  ? 209  LYS A HZ3  1  
ATOM   3118   N N    . PRO A 1 210 ? 5.011   23.389 -8.755  0.010 30.77  ? 210  PRO A N    1  
ATOM   3119   C CA   . PRO A 1 210 ? 4.379   22.925 -10.010 0.010 28.45  ? 210  PRO A CA   1  
ATOM   3120   C C    . PRO A 1 210 ? 3.186   21.923 -9.931  0.010 26.96  ? 210  PRO A C    1  
ATOM   3121   O O    . PRO A 1 210 ? 3.143   20.954 -9.180  0.010 27.06  ? 210  PRO A O    1  
ATOM   3122   C CB   . PRO A 1 210 ? 5.554   22.250 -10.744 0.010 27.67  ? 210  PRO A CB   1  
ATOM   3123   C CG   . PRO A 1 210 ? 6.823   22.564 -9.868  0.010 29.74  ? 210  PRO A CG   1  
ATOM   3124   C CD   . PRO A 1 210 ? 6.232   22.598 -8.495  0.010 31.12  ? 210  PRO A CD   1  
ATOM   3125   H HA   . PRO A 1 210 ? 4.088   23.685 -10.538 0.010 28.48  ? 210  PRO A HA   1  
ATOM   3126   H HB2  . PRO A 1 210 ? 5.401   21.293 -10.768 0.010 26.87  ? 210  PRO A HB2  1  
ATOM   3127   H HB3  . PRO A 1 210 ? 5.655   22.608 -11.641 0.010 26.94  ? 210  PRO A HB3  1  
ATOM   3128   H HG2  . PRO A 1 210 ? 7.494   21.869 -9.953  0.010 29.49  ? 210  PRO A HG2  1  
ATOM   3129   H HG3  . PRO A 1 210 ? 7.190   23.431 -10.095 0.010 30.42  ? 210  PRO A HG3  1  
ATOM   3130   H HD2  . PRO A 1 210 ? 6.019   21.701 -8.207  0.010 30.56  ? 210  PRO A HD2  1  
ATOM   3131   H HD3  . PRO A 1 210 ? 6.829   23.028 -7.862  0.010 32.73  ? 210  PRO A HD3  1  
ATOM   3132   N N    . GLY A 1 211 ? 2.224   22.155 -10.802 0.010 25.64  ? 211  GLY A N    1  
ATOM   3133   C CA   . GLY A 1 211 ? 1.152   21.206 -10.994 0.010 24.18  ? 211  GLY A CA   1  
ATOM   3134   C C    . GLY A 1 211 ? 1.627   19.961 -11.736 0.010 22.73  ? 211  GLY A C    1  
ATOM   3135   O O    . GLY A 1 211 ? 2.454   20.021 -12.630 0.010 22.32  ? 211  GLY A O    1  
ATOM   3136   H H    . GLY A 1 211 ? 2.180   22.856 -11.298 0.010 25.65  ? 211  GLY A H    1  
ATOM   3137   H HA2  . GLY A 1 211 ? 0.803   20.933 -10.134 0.010 24.72  ? 211  GLY A HA2  1  
ATOM   3138   H HA3  . GLY A 1 211 ? 0.435   21.615 -11.498 0.010 23.74  ? 211  GLY A HA3  1  
ATOM   3139   N N    . ILE A 1 212 ? 1.045   18.827 -11.365 0.010 22.12  ? 212  ILE A N    1  
ATOM   3140   C CA   . ILE A 1 212 ? 1.429   17.537 -11.907 0.010 20.99  ? 212  ILE A CA   1  
ATOM   3141   C C    . ILE A 1 212 ? 0.245   17.008 -12.712 0.010 19.63  ? 212  ILE A C    1  
ATOM   3142   O O    . ILE A 1 212 ? -0.914  17.078 -12.288 0.010 19.71  ? 212  ILE A O    1  
ATOM   3143   C CB   . ILE A 1 212 ? 1.822   16.518 -10.801 0.010 21.63  ? 212  ILE A CB   1  
ATOM   3144   C CG1  . ILE A 1 212 ? 2.943   17.077 -9.922  0.010 23.35  ? 212  ILE A CG1  1  
ATOM   3145   C CG2  . ILE A 1 212 ? 2.248   15.211 -11.431 0.010 20.63  ? 212  ILE A CG2  1  
ATOM   3146   C CD1  . ILE A 1 212 ? 3.127   16.380 -8.577  0.010 24.53  ? 212  ILE A CD1  1  
ATOM   3147   H H    . ILE A 1 212 ? 0.401   18.786 -10.802 0.010 22.44  ? 212  ILE A H    1  
ATOM   3148   H HA   . ILE A 1 212 ? 2.183   17.636 -12.503 0.010 20.81  ? 212  ILE A HA   1  
ATOM   3149   H HB   . ILE A 1 212 ? 1.050   16.346 -10.244 0.010 21.74  ? 212  ILE A HB   1  
ATOM   3150   H HG12 . ILE A 1 212 ? 3.781   17.015 -10.408 0.010 23.27  ? 212  ILE A HG12 1  
ATOM   3151   H HG13 . ILE A 1 212 ? 2.746   18.007 -9.730  0.010 24.01  ? 212  ILE A HG13 1  
ATOM   3152   H HG21 . ILE A 1 212 ? 2.810   15.393 -12.202 0.010 20.21  ? 212  ILE A HG21 1  
ATOM   3153   H HG22 . ILE A 1 212 ? 2.742   14.695 -10.775 0.010 21.26  ? 212  ILE A HG22 1  
ATOM   3154   H HG23 . ILE A 1 212 ? 1.460   14.721 -11.715 0.010 19.92  ? 212  ILE A HG23 1  
ATOM   3155   H HD11 . ILE A 1 212 ? 2.259   16.099 -8.247  0.010 24.76  ? 212  ILE A HD11 1  
ATOM   3156   H HD12 . ILE A 1 212 ? 3.701   15.609 -8.695  0.010 24.00  ? 212  ILE A HD12 1  
ATOM   3157   H HD13 . ILE A 1 212 ? 3.530   17.001 -7.951  0.010 25.71  ? 212  ILE A HD13 1  
ATOM   3158   N N    . TYR A 1 213 ? 0.548   16.553 -13.918 0.010 18.57  ? 213  TYR A N    1  
ATOM   3159   C CA   . TYR A 1 213 ? -0.441  16.014 -14.806 0.010 17.45  ? 213  TYR A CA   1  
ATOM   3160   C C    . TYR A 1 213 ? 0.002   14.689 -15.404 0.010 16.77  ? 213  TYR A C    1  
ATOM   3161   O O    . TYR A 1 213 ? 1.163   14.515 -15.783 0.010 16.86  ? 213  TYR A O    1  
ATOM   3162   C CB   . TYR A 1 213 ? -0.649  16.950 -15.960 0.010 17.06  ? 213  TYR A CB   1  
ATOM   3163   C CG   . TYR A 1 213 ? -1.035  18.340 -15.551 0.010 17.85  ? 213  TYR A CG   1  
ATOM   3164   C CD1  . TYR A 1 213 ? -0.078  19.261 -15.117 0.010 18.93  ? 213  TYR A CD1  1  
ATOM   3165   C CD2  . TYR A 1 213 ? -2.351  18.745 -15.632 0.010 17.67  ? 213  TYR A CD2  1  
ATOM   3166   C CE1  . TYR A 1 213 ? -0.443  20.511 -14.779 0.010 19.85  ? 213  TYR A CE1  1  
ATOM   3167   C CE2  . TYR A 1 213 ? -2.710  19.978 -15.279 0.010 18.52  ? 213  TYR A CE2  1  
ATOM   3168   C CZ   . TYR A 1 213 ? -1.775  20.862 -14.873 0.010 19.62  ? 213  TYR A CZ   1  
ATOM   3169   O OH   . TYR A 1 213 ? -2.184  22.106 -14.547 0.010 20.67  ? 213  TYR A OH   1  
ATOM   3170   H H    . TYR A 1 213 ? 1.338   16.561 -14.248 0.010 18.60  ? 213  TYR A H    1  
ATOM   3171   H HA   . TYR A 1 213 ? -1.284  15.890 -14.347 0.010 17.49  ? 213  TYR A HA   1  
ATOM   3172   H HB2  . TYR A 1 213 ? 0.182   17.012 -16.454 0.010 17.07  ? 213  TYR A HB2  1  
ATOM   3173   H HB3  . TYR A 1 213 ? -1.336  16.583 -16.534 0.010 16.44  ? 213  TYR A HB3  1  
ATOM   3174   H HD1  . TYR A 1 213 ? 0.818   19.014 -15.060 0.010 19.13  ? 213  TYR A HD1  1  
ATOM   3175   H HD2  . TYR A 1 213 ? -3.002  18.147 -15.925 0.010 17.05  ? 213  TYR A HD2  1  
ATOM   3176   H HE1  . TYR A 1 213 ? 0.190   21.122 -14.485 0.010 20.72  ? 213  TYR A HE1  1  
ATOM   3177   H HE2  . TYR A 1 213 ? -3.598  20.237 -15.347 0.010 18.44  ? 213  TYR A HE2  1  
ATOM   3178   H HH   . TYR A 1 213 ? -1.511  22.622 -14.479 0.010 21.31  ? 213  TYR A HH   1  
ATOM   3179   N N    . THR A 1 214 ? -0.942  13.765 -15.496 0.010 16.23  ? 214  THR A N    1  
ATOM   3180   C CA   . THR A 1 214 ? -0.696  12.520 -16.173 0.010 15.73  ? 214  THR A CA   1  
ATOM   3181   C C    . THR A 1 214 ? -0.728  12.751 -17.673 0.010 15.09  ? 214  THR A C    1  
ATOM   3182   O O    . THR A 1 214 ? -1.674  13.354 -18.186 0.010 14.80  ? 214  THR A O    1  
ATOM   3183   C CB   . THR A 1 214 ? -1.776  11.488 -15.794 0.010 15.63  ? 214  THR A CB   1  
ATOM   3184   O OG1  . THR A 1 214 ? -1.907  11.441 -14.384 0.010 16.42  ? 214  THR A OG1  1  
ATOM   3185   C CG2  . THR A 1 214 ? -1.421  10.120 -16.321 0.010 15.45  ? 214  THR A CG2  1  
ATOM   3186   H H    . THR A 1 214 ? -1.727  13.834 -15.168 0.010 16.24  ? 214  THR A H    1  
ATOM   3187   H HA   . THR A 1 214 ? 0.173   12.176 -15.925 0.010 16.02  ? 214  THR A HA   1  
ATOM   3188   H HB   . THR A 1 214 ? -2.621  11.756 -16.177 0.010 15.32  ? 214  THR A HB   1  
ATOM   3189   H HG1  . THR A 1 214 ? -1.147  11.453 -14.013 0.010 16.81  ? 214  THR A HG1  1  
ATOM   3190   H HG21 . THR A 1 214 ? -0.505  9.907  -16.076 0.010 15.75  ? 214  THR A HG21 1  
ATOM   3191   H HG22 . THR A 1 214 ? -2.010  9.444  -15.951 0.010 15.59  ? 214  THR A HG22 1  
ATOM   3192   H HG23 . THR A 1 214 ? -1.502  10.105 -17.287 0.010 15.03  ? 214  THR A HG23 1  
ATOM   3193   N N    . ARG A 1 215 ? 0.300   12.269 -18.372 0.010 15.03  ? 215  ARG A N    1  
ATOM   3194   C CA   . ARG A 1 215 ? 0.418   12.424 -19.813 0.010 14.70  ? 215  ARG A CA   1  
ATOM   3195   C C    . ARG A 1 215 ? -0.465  11.441 -20.526 0.010 14.35  ? 215  ARG A C    1  
ATOM   3196   O O    . ARG A 1 215 ? -0.176  10.245 -20.519 0.010 14.45  ? 215  ARG A O    1  
ATOM   3197   C CB   . ARG A 1 215 ? 1.861   12.159 -20.309 0.010 14.98  ? 215  ARG A CB   1  
ATOM   3198   C CG   . ARG A 1 215 ? 2.899   13.158 -19.845 0.010 15.55  ? 215  ARG A CG   1  
ATOM   3199   C CD   . ARG A 1 215 ? 4.154   13.069 -20.742 0.010 15.89  ? 215  ARG A CD   1  
ATOM   3200   N NE   . ARG A 1 215 ? 4.605   11.696 -20.903 0.010 15.81  ? 215  ARG A NE   1  
ATOM   3201   C CZ   . ARG A 1 215 ? 4.677   11.043 -22.042 0.010 15.67  ? 215  ARG A CZ   1  
ATOM   3202   N NH1  . ARG A 1 215 ? 4.311   11.588 -23.217 0.010 15.60  ? 215  ARG A NH1  1  
ATOM   3203   N NH2  . ARG A 1 215 ? 5.149   9.839  -21.980 0.010 15.82  ? 215  ARG A NH2  1  
ATOM   3204   H H    . ARG A 1 215 ? 0.953   11.844 -18.020 0.010 15.28  ? 215  ARG A H    1  
ATOM   3205   H HA   . ARG A 1 215 ? 0.158   13.316 -20.075 0.010 14.70  ? 215  ARG A HA   1  
ATOM   3206   H HB2  . ARG A 1 215 ? 2.142   11.281 -20.003 0.010 15.02  ? 215  ARG A HB2  1  
ATOM   3207   H HB3  . ARG A 1 215 ? 1.865   12.180 -21.279 0.010 14.91  ? 215  ARG A HB3  1  
ATOM   3208   H HG2  . ARG A 1 215 ? 2.532   14.056 -19.892 0.010 15.62  ? 215  ARG A HG2  1  
ATOM   3209   H HG3  . ARG A 1 215 ? 3.154   12.945 -18.933 0.010 15.78  ? 215  ARG A HG3  1  
ATOM   3210   H HD2  . ARG A 1 215 ? 4.006   13.404 -21.615 0.010 15.86  ? 215  ARG A HD2  1  
ATOM   3211   H HD3  . ARG A 1 215 ? 4.863   13.565 -20.321 0.010 16.35  ? 215  ARG A HD3  1  
ATOM   3212   H HE   . ARG A 1 215 ? 4.885   11.279 -20.200 0.010 15.88  ? 215  ARG A HE   1  
ATOM   3213   H HH11 . ARG A 1 215 ? 4.024   12.387 -23.255 0.010 15.59  ? 215  ARG A HH11 1  
ATOM   3214   H HH12 . ARG A 1 215 ? 4.372   11.135 -23.941 0.010 15.64  ? 215  ARG A HH12 1  
ATOM   3215   H HH21 . ARG A 1 215 ? 5.365   9.518  -21.211 0.010 15.97  ? 215  ARG A HH21 1  
ATOM   3216   H HH22 . ARG A 1 215 ? 5.208   9.347  -22.685 0.010 15.86  ? 215  ARG A HH22 1  
ATOM   3217   N N    . VAL A 1 216 ? -1.532  11.922 -21.153 0.010 14.13  ? 216  VAL A N    1  
ATOM   3218   C CA   . VAL A 1 216 ? -2.454  10.994 -21.809 0.010 14.00  ? 216  VAL A CA   1  
ATOM   3219   C C    . VAL A 1 216 ? -1.788  10.168 -22.928 0.010 14.19  ? 216  VAL A C    1  
ATOM   3220   O O    . VAL A 1 216 ? -2.165  9.024  -23.149 0.010 14.36  ? 216  VAL A O    1  
ATOM   3221   C CB   . VAL A 1 216 ? -3.755  11.717 -22.338 0.010 13.89  ? 216  VAL A CB   1  
ATOM   3222   C CG1  . VAL A 1 216 ? -4.437  12.368 -21.183 0.010 13.85  ? 216  VAL A CG1  1  
ATOM   3223   C CG2  . VAL A 1 216 ? -3.445  12.714 -23.408 0.010 14.06  ? 216  VAL A CG2  1  
ATOM   3224   H H    . VAL A 1 216 ? -1.742  12.749 -21.212 0.010 14.15  ? 216  VAL A H    1  
ATOM   3225   H HA   . VAL A 1 216 ? -2.743  10.361 -21.134 0.010 14.02  ? 216  VAL A HA   1  
ATOM   3226   H HB   . VAL A 1 216 ? -4.355  11.060 -22.722 0.010 13.92  ? 216  VAL A HB   1  
ATOM   3227   H HG11 . VAL A 1 216 ? -4.558  11.709 -20.486 0.010 13.87  ? 216  VAL A HG11 1  
ATOM   3228   H HG12 . VAL A 1 216 ? -3.892  13.099 -20.849 0.010 13.96  ? 216  VAL A HG12 1  
ATOM   3229   H HG13 . VAL A 1 216 ? -5.297  12.700 -21.478 0.010 13.83  ? 216  VAL A HG13 1  
ATOM   3230   H HG21 . VAL A 1 216 ? -2.482  12.773 -23.518 0.010 14.18  ? 216  VAL A HG21 1  
ATOM   3231   H HG22 . VAL A 1 216 ? -3.858  12.428 -24.239 0.010 14.16  ? 216  VAL A HG22 1  
ATOM   3232   H HG23 . VAL A 1 216 ? -3.792  13.582 -23.144 0.010 14.10  ? 216  VAL A HG23 1  
ATOM   3233   N N    . ALA A 1 217 ? -0.817  10.739 -23.636 0.010 14.35  ? 217  ALA A N    1  
ATOM   3234   C CA   . ALA A 1 217 ? -0.112  9.991  -24.714 0.010 14.73  ? 217  ALA A CA   1  
ATOM   3235   C C    . ALA A 1 217 ? 0.598   8.746  -24.188 0.010 14.92  ? 217  ALA A C    1  
ATOM   3236   O O    . ALA A 1 217 ? 0.709   7.714  -24.894 0.010 15.34  ? 217  ALA A O    1  
ATOM   3237   C CB   . ALA A 1 217 ? 0.865   10.896 -25.474 0.010 15.02  ? 217  ALA A CB   1  
ATOM   3238   H H    . ALA A 1 217 ? -0.543  11.541 -23.524 0.010 14.35  ? 217  ALA A H    1  
ATOM   3239   H HA   . ALA A 1 217 ? -0.762  9.672  -25.354 0.010 14.85  ? 217  ALA A HA   1  
ATOM   3240   H HB1  . ALA A 1 217 ? 1.365   11.427 -24.835 0.010 14.97  ? 217  ALA A HB1  1  
ATOM   3241   H HB2  . ALA A 1 217 ? 1.472   10.333 -25.974 0.010 15.35  ? 217  ALA A HB2  1  
ATOM   3242   H HB3  . ALA A 1 217 ? 0.376   11.473 -26.082 0.010 15.06  ? 217  ALA A HB3  1  
ATOM   3243   N N    . SER A 1 218 ? 1.050   8.833  -22.953 0.010 14.82  ? 218  SER A N    1  
ATOM   3244   C CA   . SER A 1 218 ? 1.769   7.711  -22.294 0.010 15.17  ? 218  SER A CA   1  
ATOM   3245   C C    . SER A 1 218 ? 0.841   6.522  -22.038 0.010 15.32  ? 218  SER A C    1  
ATOM   3246   O O    . SER A 1 218 ? 1.296   5.400  -21.860 0.010 15.82  ? 218  SER A O    1  
ATOM   3247   C CB   . SER A 1 218 ? 2.371   8.158  -20.954 0.010 15.25  ? 218  SER A CB   1  
ATOM   3248   O OG   . SER A 1 218 ? 3.262   7.188  -20.381 0.010 15.77  ? 218  SER A OG   1  
ATOM   3249   H H    . SER A 1 218 ? 0.953   9.522  -22.457 0.010 14.67  ? 218  SER A H    1  
ATOM   3250   H HA   . SER A 1 218 ? 2.493   7.419  -22.869 0.010 15.43  ? 218  SER A HA   1  
ATOM   3251   H HB2  . SER A 1 218 ? 2.864   8.981  -21.090 0.010 15.23  ? 218  SER A HB2  1  
ATOM   3252   H HB3  . SER A 1 218 ? 1.641   8.318  -20.339 0.010 15.11  ? 218  SER A HB3  1  
ATOM   3253   H HG   . SER A 1 218 ? 3.886   7.011  -20.925 0.010 15.93  ? 218  SER A HG   1  
ATOM   3254   N N    . TYR A 1 219 ? -0.453  6.802  -21.957 0.010 15.03  ? 219  TYR A N    1  
ATOM   3255   C CA   . TYR A 1 219 ? -1.458  5.767  -21.690 0.010 15.30  ? 219  TYR A CA   1  
ATOM   3256   C C    . TYR A 1 219 ? -2.358  5.518  -22.890 0.010 15.45  ? 219  TYR A C    1  
ATOM   3257   O O    . TYR A 1 219 ? -3.455  4.923  -22.763 0.010 15.70  ? 219  TYR A O    1  
ATOM   3258   C CB   . TYR A 1 219 ? -2.270  6.155  -20.444 0.010 15.12  ? 219  TYR A CB   1  
ATOM   3259   C CG   . TYR A 1 219 ? -1.429  6.171  -19.217 0.010 15.37  ? 219  TYR A CG   1  
ATOM   3260   C CD1  . TYR A 1 219 ? -0.720  7.316  -18.849 0.010 15.16  ? 219  TYR A CD1  1  
ATOM   3261   C CD2  . TYR A 1 219 ? -1.284  5.032  -18.450 0.010 16.02  ? 219  TYR A CD2  1  
ATOM   3262   C CE1  . TYR A 1 219 ? 0.089   7.320  -17.738 0.010 15.62  ? 219  TYR A CE1  1  
ATOM   3263   C CE2  . TYR A 1 219 ? -0.467  5.018  -17.337 0.010 16.47  ? 219  TYR A CE2  1  
ATOM   3264   C CZ   . TYR A 1 219 ? 0.223   6.162  -16.985 0.010 16.27  ? 219  TYR A CZ   1  
ATOM   3265   O OH   . TYR A 1 219 ? 1.018   6.154  -15.882 0.010 16.93  ? 219  TYR A OH   1  
ATOM   3266   H H    . TYR A 1 219 ? -0.779  7.591  -22.050 0.010 14.75  ? 219  TYR A H    1  
ATOM   3267   H HA   . TYR A 1 219 ? -1.014  4.928  -21.500 0.010 15.71  ? 219  TYR A HA   1  
ATOM   3268   H HB2  . TYR A 1 219 ? -2.633  7.042  -20.569 0.010 14.77  ? 219  TYR A HB2  1  
ATOM   3269   H HB3  . TYR A 1 219 ? -2.987  5.520  -20.312 0.010 15.36  ? 219  TYR A HB3  1  
ATOM   3270   H HD1  . TYR A 1 219 ? -0.800  8.087  -19.360 0.010 14.85  ? 219  TYR A HD1  1  
ATOM   3271   H HD2  . TYR A 1 219 ? -1.738  4.262  -18.697 0.010 16.29  ? 219  TYR A HD2  1  
ATOM   3272   H HE1  . TYR A 1 219 ? 0.552   8.087  -17.502 0.010 15.62  ? 219  TYR A HE1  1  
ATOM   3273   H HE2  . TYR A 1 219 ? -0.380  4.245  -16.830 0.010 17.03  ? 219  TYR A HE2  1  
ATOM   3274   H HH   . TYR A 1 219 ? 1.798   5.902  -16.097 0.010 17.08  ? 219  TYR A HH   1  
ATOM   3275   N N    . ALA A 1 220 ? -1.869  5.910  -24.065 0.010 15.50  ? 220  ALA A N    1  
ATOM   3276   C CA   . ALA A 1 220 ? -2.672  5.814  -25.270 0.010 15.84  ? 220  ALA A CA   1  
ATOM   3277   C C    . ALA A 1 220 ? -3.101  4.375  -25.552 0.010 16.67  ? 220  ALA A C    1  
ATOM   3278   O O    . ALA A 1 220 ? -4.230  4.139  -25.923 0.010 17.00  ? 220  ALA A O    1  
ATOM   3279   C CB   . ALA A 1 220 ? -1.943  6.390  -26.452 0.010 16.04  ? 220  ALA A CB   1  
ATOM   3280   H H    . ALA A 1 220 ? -1.081  6.226  -24.192 0.010 15.46  ? 220  ALA A H    1  
ATOM   3281   H HA   . ALA A 1 220 ? -3.470  6.345  -25.140 0.010 15.57  ? 220  ALA A HA   1  
ATOM   3282   H HB1  . ALA A 1 220 ? -1.067  5.976  -26.509 0.010 16.36  ? 220  ALA A HB1  1  
ATOM   3283   H HB2  . ALA A 1 220 ? -2.453  6.204  -27.257 0.010 16.40  ? 220  ALA A HB2  1  
ATOM   3284   H HB3  . ALA A 1 220 ? -1.851  7.348  -26.333 0.010 15.63  ? 220  ALA A HB3  1  
ATOM   3285   N N    . ALA A 1 221 ? -2.202  3.412  -25.361 0.010 17.17  ? 221  ALA A N    1  
ATOM   3286   C CA   . ALA A 1 221 ? -2.555  2.022  -25.603 0.010 18.18  ? 221  ALA A CA   1  
ATOM   3287   C C    . ALA A 1 221 ? -3.685  1.552  -24.663 0.010 18.23  ? 221  ALA A C    1  
ATOM   3288   O O    . ALA A 1 221 ? -4.613  0.853  -25.089 0.010 18.98  ? 221  ALA A O    1  
ATOM   3289   C CB   . ALA A 1 221 ? -1.320  1.126  -25.448 0.010 18.82  ? 221  ALA A CB   1  
ATOM   3290   H H    . ALA A 1 221 ? -1.399  3.533  -25.091 0.010 17.03  ? 221  ALA A H    1  
ATOM   3291   H HA   . ALA A 1 221 ? -2.870  1.933  -26.515 0.010 18.63  ? 221  ALA A HA   1  
ATOM   3292   H HB1  . ALA A 1 221 ? -0.947  1.262  -24.564 0.010 18.46  ? 221  ALA A HB1  1  
ATOM   3293   H HB2  . ALA A 1 221 ? -1.578  0.198  -25.562 0.010 19.62  ? 221  ALA A HB2  1  
ATOM   3294   H HB3  . ALA A 1 221 ? -0.673  1.369  -26.127 0.010 18.90  ? 221  ALA A HB3  1  
ATOM   3295   N N    . TRP A 1 222 ? -3.621  1.942  -23.398 0.010 17.62  ? 222  TRP A N    1  
ATOM   3296   C CA   . TRP A 1 222 ? -4.614  1.490  -22.444 0.010 17.86  ? 222  TRP A CA   1  
ATOM   3297   C C    . TRP A 1 222 ? -5.939  2.175  -22.772 0.010 17.52  ? 222  TRP A C    1  
ATOM   3298   O O    . TRP A 1 222 ? -6.929  1.520  -22.971 0.010 18.20  ? 222  TRP A O    1  
ATOM   3299   C CB   . TRP A 1 222 ? -4.188  1.739  -20.994 0.010 17.56  ? 222  TRP A CB   1  
ATOM   3300   C CG   . TRP A 1 222 ? -5.304  1.534  -20.047 0.010 17.82  ? 222  TRP A CG   1  
ATOM   3301   C CD1  . TRP A 1 222 ? -5.826  0.343  -19.633 0.010 18.86  ? 222  TRP A CD1  1  
ATOM   3302   C CD2  . TRP A 1 222 ? -6.078  2.550  -19.421 0.010 17.23  ? 222  TRP A CD2  1  
ATOM   3303   N NE1  . TRP A 1 222 ? -6.865  0.557  -18.764 0.010 18.93  ? 222  TRP A NE1  1  
ATOM   3304   C CE2  . TRP A 1 222 ? -7.048  1.907  -18.625 0.010 17.92  ? 222  TRP A CE2  1  
ATOM   3305   C CE3  . TRP A 1 222 ? -6.039  3.946  -19.443 0.010 16.33  ? 222  TRP A CE3  1  
ATOM   3306   C CZ2  . TRP A 1 222 ? -7.954  2.614  -17.852 0.010 17.70  ? 222  TRP A CZ2  1  
ATOM   3307   C CZ3  . TRP A 1 222 ? -6.939  4.636  -18.680 0.010 16.15  ? 222  TRP A CZ3  1  
ATOM   3308   C CH2  . TRP A 1 222 ? -7.884  3.971  -17.891 0.010 16.81  ? 222  TRP A CH2  1  
ATOM   3309   H H    . TRP A 1 222 ? -3.035  2.473  -23.073 0.010 17.18  ? 222  TRP A H    1  
ATOM   3310   H HA   . TRP A 1 222 ? -4.734  0.534  -22.549 0.010 18.64  ? 222  TRP A HA   1  
ATOM   3311   H HB2  . TRP A 1 222 ? -3.480  1.118  -20.760 0.010 18.00  ? 222  TRP A HB2  1  
ATOM   3312   H HB3  . TRP A 1 222 ? -3.876  2.654  -20.904 0.010 16.91  ? 222  TRP A HB3  1  
ATOM   3313   H HD1  . TRP A 1 222 ? -5.518  -0.493 -19.898 0.010 19.53  ? 222  TRP A HD1  1  
ATOM   3314   H HE1  . TRP A 1 222 ? -7.329  -0.053 -18.384 0.010 19.59  ? 222  TRP A HE1  1  
ATOM   3315   H HE3  . TRP A 1 222 ? -5.416  4.398  -19.959 0.010 15.98  ? 222  TRP A HE3  1  
ATOM   3316   H HZ2  . TRP A 1 222 ? -8.585  2.178  -17.327 0.010 18.25  ? 222  TRP A HZ2  1  
ATOM   3317   H HZ3  . TRP A 1 222 ? -6.922  5.565  -18.695 0.010 15.68  ? 222  TRP A HZ3  1  
ATOM   3318   H HH2  . TRP A 1 222 ? -8.490  4.464  -17.396 0.010 16.75  ? 222  TRP A HH2  1  
ATOM   3319   N N    . ILE A 1 223 ? -5.922  3.492  -22.939 0.010 16.66  ? 223  ILE A N    1  
ATOM   3320   C CA   . ILE A 1 223 ? -7.146  4.194  -23.320 0.010 16.44  ? 223  ILE A CA   1  
ATOM   3321   C C    . ILE A 1 223 ? -7.853  3.603  -24.535 0.010 17.25  ? 223  ILE A C    1  
ATOM   3322   O O    . ILE A 1 223 ? -9.040  3.225  -24.453 0.010 17.72  ? 223  ILE A O    1  
ATOM   3323   C CB   . ILE A 1 223 ? -6.882  5.698  -23.574 0.010 15.63  ? 223  ILE A CB   1  
ATOM   3324   C CG1  . ILE A 1 223 ? -6.637  6.416  -22.242 0.010 15.09  ? 223  ILE A CG1  1  
ATOM   3325   C CG2  . ILE A 1 223 ? -8.083  6.302  -24.233 0.010 15.65  ? 223  ILE A CG2  1  
ATOM   3326   C CD1  . ILE A 1 223 ? -5.968  7.815  -22.377 0.010 14.52  ? 223  ILE A CD1  1  
ATOM   3327   H H    . ILE A 1 223 ? -5.237  3.994  -22.839 0.010 16.29  ? 223  ILE A H    1  
ATOM   3328   H HA   . ILE A 1 223 ? -7.767  4.138  -22.579 0.010 16.44  ? 223  ILE A HA   1  
ATOM   3329   H HB   . ILE A 1 223 ? -6.106  5.796  -24.147 0.010 15.65  ? 223  ILE A HB   1  
ATOM   3330   H HG12 . ILE A 1 223 ? -7.487  6.534  -21.790 0.010 15.11  ? 223  ILE A HG12 1  
ATOM   3331   H HG13 . ILE A 1 223 ? -6.059  5.864  -21.694 0.010 15.24  ? 223  ILE A HG13 1  
ATOM   3332   H HG21 . ILE A 1 223 ? -8.886  5.956  -23.811 0.010 15.86  ? 223  ILE A HG21 1  
ATOM   3333   H HG22 . ILE A 1 223 ? -8.046  7.267  -24.120 0.010 15.20  ? 223  ILE A HG22 1  
ATOM   3334   H HG23 . ILE A 1 223 ? -8.081  6.077  -25.176 0.010 16.04  ? 223  ILE A HG23 1  
ATOM   3335   H HD11 . ILE A 1 223 ? -5.147  7.722  -22.885 0.010 14.53  ? 223  ILE A HD11 1  
ATOM   3336   H HD12 . ILE A 1 223 ? -6.569  8.422  -22.833 0.010 14.47  ? 223  ILE A HD12 1  
ATOM   3337   H HD13 . ILE A 1 223 ? -5.781  8.149  -21.486 0.010 14.35  ? 223  ILE A HD13 1  
ATOM   3338   N N    . ASP A 1 224 ? -7.144  3.516  -25.662 0.010 17.60  ? 224  ASP A N    1  
ATOM   3339   C CA   . ASP A 1 224 ? -7.776  3.022  -26.883 0.010 18.66  ? 224  ASP A CA   1  
ATOM   3340   C C    . ASP A 1 224 ? -8.383  1.644  -26.702 0.010 19.75  ? 224  ASP A C    1  
ATOM   3341   O O    . ASP A 1 224 ? -9.504  1.388  -27.143 0.010 20.54  ? 224  ASP A O    1  
ATOM   3342   C CB   . ASP A 1 224 ? -6.790  3.049  -28.044 0.010 19.13  ? 224  ASP A CB   1  
ATOM   3343   C CG   . ASP A 1 224 ? -6.806  4.376  -28.783 0.010 18.86  ? 224  ASP A CG   1  
ATOM   3344   O OD1  . ASP A 1 224 ? -7.860  5.042  -28.857 0.010 18.50  ? 224  ASP A OD1  1  
ATOM   3345   O OD2  . ASP A 1 224 ? -5.766  4.727  -29.325 0.010 19.20  ? 224  ASP A OD2  1  
ATOM   3346   H H    . ASP A 1 224 ? -6.319  3.736  -25.751 0.010 17.35  ? 224  ASP A H    1  
ATOM   3347   H HA   . ASP A 1 224 ? -8.511  3.609  -27.100 0.010 18.58  ? 224  ASP A HA   1  
ATOM   3348   H HB2  . ASP A 1 224 ? -5.897  2.911  -27.700 0.010 18.85  ? 224  ASP A HB2  1  
ATOM   3349   H HB3  . ASP A 1 224 ? -7.010  2.347  -28.674 0.010 20.09  ? 224  ASP A HB3  1  
ATOM   3350   N N    . SER A 1 225 ? -7.675  0.788  -25.978 0.010 19.96  ? 225  SER A N    1  
ATOM   3351   C CA   . SER A 1 225 ? -8.120  -0.564 -25.772 0.010 21.18  ? 225  SER A CA   1  
ATOM   3352   C C    . SER A 1 225 ? -9.392  -0.699 -24.963 0.010 21.32  ? 225  SER A C    1  
ATOM   3353   O O    . SER A 1 225 ? -10.119 -1.657 -25.146 0.010 22.57  ? 225  SER A O    1  
ATOM   3354   C CB   . SER A 1 225 ? -7.055  -1.400 -25.063 0.010 21.37  ? 225  SER A CB   1  
ATOM   3355   O OG   . SER A 1 225 ? -7.004  -1.098 -23.682 0.010 20.59  ? 225  SER A OG   1  
ATOM   3356   H H    . SER A 1 225 ? -6.941  0.984  -25.583 0.010 19.47  ? 225  SER A H    1  
ATOM   3357   H HA   . SER A 1 225 ? -8.287  -0.956 -26.642 0.010 22.07  ? 225  SER A HA   1  
ATOM   3358   H HB2  . SER A 1 225 ? -7.274  -2.339 -25.170 0.010 22.43  ? 225  SER A HB2  1  
ATOM   3359   H HB3  . SER A 1 225 ? -6.189  -1.212 -25.458 0.010 21.14  ? 225  SER A HB3  1  
ATOM   3360   H HG   . SER A 1 225 ? -6.481  -1.641 -23.293 0.010 20.85  ? 225  SER A HG   1  
ATOM   3361   N N    . VAL A 1 226 ? -9.614  0.240  -24.045 0.010 20.19  ? 226  VAL A N    1  
ATOM   3362   C CA   . VAL A 1 226 ? -10.786 0.215  -23.175 0.010 20.33  ? 226  VAL A CA   1  
ATOM   3363   C C    . VAL A 1 226 ? -11.906 0.720  -24.038 0.010 20.55  ? 226  VAL A C    1  
ATOM   3364   O O    . VAL A 1 226 ? -13.081 0.399  -23.832 0.010 21.37  ? 226  VAL A O    1  
ATOM   3365   C CB   . VAL A 1 226 ? -10.580 1.094  -21.886 0.010 19.22  ? 226  VAL A CB   1  
ATOM   3366   C CG1  . VAL A 1 226 ? -11.921 1.577  -21.237 0.010 19.24  ? 226  VAL A CG1  1  
ATOM   3367   C CG2  . VAL A 1 226 ? -9.718  0.359  -20.858 0.010 19.43  ? 226  VAL A CG2  1  
ATOM   3368   H H    . VAL A 1 226 ? -9.095  0.914  -23.913 0.010 19.43  ? 226  VAL A H    1  
ATOM   3369   H HA   . VAL A 1 226 ? -10.976 -0.695 -22.905 0.010 21.19  ? 226  VAL A HA   1  
ATOM   3370   H HB   . VAL A 1 226 ? -10.087 1.891  -22.140 0.010 18.46  ? 226  VAL A HB   1  
ATOM   3371   H HG11 . VAL A 1 226 ? -12.612 1.726  -21.893 0.010 19.66  ? 226  VAL A HG11 1  
ATOM   3372   H HG12 . VAL A 1 226 ? -12.219 0.915  -20.596 0.010 19.72  ? 226  VAL A HG12 1  
ATOM   3373   H HG13 . VAL A 1 226 ? -11.742 2.409  -20.779 0.010 18.47  ? 226  VAL A HG13 1  
ATOM   3374   H HG21 . VAL A 1 226 ? -9.182  -0.312 -21.306 0.010 19.82  ? 226  VAL A HG21 1  
ATOM   3375   H HG22 . VAL A 1 226 ? -9.142  1.007  -20.431 0.010 18.71  ? 226  VAL A HG22 1  
ATOM   3376   H HG23 . VAL A 1 226 ? -10.285 -0.063 -20.196 0.010 20.03  ? 226  VAL A HG23 1  
ATOM   3377   N N    . LEU A 1 227 ? -11.541 1.514  -25.029 0.010 19.95  ? 227  LEU A N    1  
ATOM   3378   C CA   . LEU A 1 227 ? -12.531 2.067  -25.917 0.010 20.19  ? 227  LEU A CA   1  
ATOM   3379   C C    . LEU A 1 227 ? -12.958 1.070  -26.986 0.010 21.75  ? 227  LEU A C    1  
ATOM   3380   O O    . LEU A 1 227 ? -14.012 1.265  -27.599 0.010 22.36  ? 227  LEU A O    1  
ATOM   3381   C CB   . LEU A 1 227 ? -11.990 3.358  -26.506 0.010 19.29  ? 227  LEU A CB   1  
ATOM   3382   C CG   . LEU A 1 227 ? -11.868 4.514  -25.494 0.010 18.01  ? 227  LEU A CG   1  
ATOM   3383   C CD1  . LEU A 1 227 ? -12.771 5.592  -26.014 0.010 17.93  ? 227  LEU A CD1  1  
ATOM   3384   C CD2  . LEU A 1 227 ? -12.175 4.135  -24.000 0.010 17.77  ? 227  LEU A CD2  1  
ATOM   3385   H H    . LEU A 1 227 ? -10.740 1.761  -25.207 0.010 19.49  ? 227  LEU A H    1  
ATOM   3386   H HA   . LEU A 1 227 ? -13.334 2.276  -25.416 0.010 20.06  ? 227  LEU A HA   1  
ATOM   3387   H HB2  . LEU A 1 227 ? -11.111 3.194  -26.873 0.010 19.29  ? 227  LEU A HB2  1  
ATOM   3388   H HB3  . LEU A 1 227 ? -12.584 3.641  -27.216 0.010 19.69  ? 227  LEU A HB3  1  
ATOM   3389   H HG   . LEU A 1 227 ? -10.958 4.858  -25.526 0.010 17.51  ? 227  LEU A HG   1  
ATOM   3390   H HD11 . LEU A 1 227 ? -13.650 5.206  -26.171 0.010 18.41  ? 227  LEU A HD11 1  
ATOM   3391   H HD12 . LEU A 1 227 ? -12.830 6.299  -25.354 0.010 17.22  ? 227  LEU A HD12 1  
ATOM   3392   H HD13 . LEU A 1 227 ? -12.406 5.945  -26.842 0.010 18.21  ? 227  LEU A HD13 1  
ATOM   3393   H HD21 . LEU A 1 227 ? -11.514 3.501  -23.683 0.010 18.09  ? 227  LEU A HD21 1  
ATOM   3394   H HD22 . LEU A 1 227 ? -12.137 4.935  -23.453 0.010 17.06  ? 227  LEU A HD22 1  
ATOM   3395   H HD23 . LEU A 1 227 ? -13.062 3.748  -23.938 0.010 18.13  ? 227  LEU A HD23 1  
ATOM   3396   N N    . ALA A 1 228 ? -12.178 -0.003 -27.169 0.010 22.57  ? 228  ALA A N    1  
ATOM   3397   C CA   . ALA A 1 228 ? -12.483 -1.056 -28.147 0.010 24.41  ? 228  ALA A CA   1  
ATOM   3398   C C    . ALA A 1 228 ? -12.679 -2.486 -27.580 0.010 25.55  ? 228  ALA A C    1  
ATOM   3399   O O    . ALA A 1 228 ? -12.780 -3.462 -28.320 0.010 27.31  ? 228  ALA A O    1  
ATOM   3400   C CB   . ALA A 1 228 ? -11.409 -1.072 -29.216 0.010 25.02  ? 228  ALA A CB   1  
ATOM   3401   O OXT  . ALA A 1 228 ? -12.735 -2.774 -26.391 0.010 25.00  ? 228  ALA A OXT  1  
ATOM   3402   H H    . ALA A 1 228 ? -11.452 -0.149 -26.735 0.010 22.19  ? 228  ALA A H    1  
ATOM   3403   H HA   . ALA A 1 228 ? -13.313 -0.823 -28.589 0.010 24.79  ? 228  ALA A HA   1  
ATOM   3404   H HB1  . ALA A 1 228 ? -10.539 -1.139 -28.795 0.010 24.51  ? 228  ALA A HB1  1  
ATOM   3405   H HB2  . ALA A 1 228 ? -11.556 -1.827 -29.805 0.010 26.39  ? 228  ALA A HB2  1  
ATOM   3406   H HB3  . ALA A 1 228 ? -11.468 -0.249 -29.723 0.010 24.68  ? 228  ALA A HB3  1  
ATOM   3407   N N    . ILE B 1 1   ? -9.134  26.632 -55.457 0.010 22.38  ? 1    ILE B N    1  
ATOM   3408   C CA   . ILE B 1 1   ? -10.289 27.419 -54.978 0.010 22.21  ? 1    ILE B CA   1  
ATOM   3409   C C    . ILE B 1 1   ? -10.382 28.695 -55.786 0.010 23.58  ? 1    ILE B C    1  
ATOM   3410   O O    . ILE B 1 1   ? -9.457  29.491 -55.777 0.010 23.99  ? 1    ILE B O    1  
ATOM   3411   C CB   . ILE B 1 1   ? -10.130 27.846 -53.492 0.010 21.10  ? 1    ILE B CB   1  
ATOM   3412   C CG1  . ILE B 1 1   ? -9.983  26.643 -52.567 0.010 19.89  ? 1    ILE B CG1  1  
ATOM   3413   C CG2  . ILE B 1 1   ? -11.313 28.750 -53.059 0.010 21.34  ? 1    ILE B CG2  1  
ATOM   3414   C CD1  . ILE B 1 1   ? -11.239 25.803 -52.477 0.010 19.70  ? 1    ILE B CD1  1  
ATOM   3415   H H1   . ILE B 1 1   ? -8.413  27.151 -55.470 0.010 22.63  ? 1    ILE B H1   1  
ATOM   3416   H H2   . ILE B 1 1   ? -8.994  25.945 -54.912 0.010 21.64  ? 1    ILE B H2   1  
ATOM   3417   H H3   . ILE B 1 1   ? -9.297  26.331 -56.276 0.010 23.13  ? 1    ILE B H3   1  
ATOM   3418   H HA   . ILE B 1 1   ? -11.109 26.911 -55.089 0.010 22.20  ? 1    ILE B HA   1  
ATOM   3419   H HB   . ILE B 1 1   ? -9.318  28.369 -53.421 0.010 21.26  ? 1    ILE B HB   1  
ATOM   3420   H HG12 . ILE B 1 1   ? -9.271  26.074 -52.894 0.010 19.91  ? 1    ILE B HG12 1  
ATOM   3421   H HG13 . ILE B 1 1   ? -9.766  26.961 -51.678 0.010 19.38  ? 1    ILE B HG13 1  
ATOM   3422   H HG21 . ILE B 1 1   ? -12.090 28.532 -53.594 0.010 21.84  ? 1    ILE B HG21 1  
ATOM   3423   H HG22 . ILE B 1 1   ? -11.503 28.607 -52.119 0.010 20.63  ? 1    ILE B HG22 1  
ATOM   3424   H HG23 . ILE B 1 1   ? -11.068 29.677 -53.203 0.010 21.88  ? 1    ILE B HG23 1  
ATOM   3425   H HD11 . ILE B 1 1   ? -11.458 25.476 -53.363 0.010 20.33  ? 1    ILE B HD11 1  
ATOM   3426   H HD12 . ILE B 1 1   ? -11.080 25.056 -51.877 0.010 19.07  ? 1    ILE B HD12 1  
ATOM   3427   H HD13 . ILE B 1 1   ? -11.963 26.349 -52.136 0.010 19.77  ? 1    ILE B HD13 1  
ATOM   3428   N N    . LEU B 1 2   ? -11.488 28.875 -56.493 0.010 24.48  ? 2    LEU B N    1  
ATOM   3429   C CA   . LEU B 1 2   ? -11.746 30.135 -57.180 0.010 25.95  ? 2    LEU B CA   1  
ATOM   3430   C C    . LEU B 1 2   ? -12.614 31.092 -56.357 0.010 25.86  ? 2    LEU B C    1  
ATOM   3431   O O    . LEU B 1 2   ? -13.611 30.695 -55.767 0.010 25.32  ? 2    LEU B O    1  
ATOM   3432   C CB   . LEU B 1 2   ? -12.407 29.871 -58.532 0.010 27.44  ? 2    LEU B CB   1  
ATOM   3433   C CG   . LEU B 1 2   ? -12.922 31.102 -59.283 0.010 29.23  ? 2    LEU B CG   1  
ATOM   3434   C CD1  . LEU B 1 2   ? -11.838 32.120 -59.492 0.010 30.10  ? 2    LEU B CD1  1  
ATOM   3435   C CD2  . LEU B 1 2   ? -13.520 30.747 -60.628 0.010 30.85  ? 2    LEU B CD2  1  
ATOM   3436   H H    . LEU B 1 2   ? -12.099 28.281 -56.597 0.010 24.38  ? 2    LEU B H    1  
ATOM   3437   H HA   . LEU B 1 2   ? -10.904 30.578 -57.355 0.010 26.33  ? 2    LEU B HA   1  
ATOM   3438   H HB2  . LEU B 1 2   ? -11.761 29.430 -59.105 0.010 27.83  ? 2    LEU B HB2  1  
ATOM   3439   H HB3  . LEU B 1 2   ? -13.162 29.279 -58.383 0.010 27.08  ? 2    LEU B HB3  1  
ATOM   3440   H HG   . LEU B 1 2   ? -13.623 31.519 -58.760 0.010 29.02  ? 2    LEU B HG   1  
ATOM   3441   H HD11 . LEU B 1 2   ? -11.408 32.317 -58.649 0.010 29.14  ? 2    LEU B HD11 1  
ATOM   3442   H HD12 . LEU B 1 2   ? -11.193 31.759 -60.119 0.010 30.71  ? 2    LEU B HD12 1  
ATOM   3443   H HD13 . LEU B 1 2   ? -12.235 32.925 -59.859 0.010 31.18  ? 2    LEU B HD13 1  
ATOM   3444   H HD21 . LEU B 1 2   ? -12.960 30.081 -61.056 0.010 31.03  ? 2    LEU B HD21 1  
ATOM   3445   H HD22 . LEU B 1 2   ? -14.415 30.394 -60.494 0.010 30.57  ? 2    LEU B HD22 1  
ATOM   3446   H HD23 . LEU B 1 2   ? -13.560 31.547 -61.177 0.010 32.14  ? 2    LEU B HD23 1  
ATOM   3447   N N    . GLY B 1 3   ? -12.246 32.367 -56.355 0.010 26.69  ? 3    GLY B N    1  
ATOM   3448   C CA   . GLY B 1 3   ? -13.039 33.407 -55.717 0.010 27.18  ? 3    GLY B CA   1  
ATOM   3449   C C    . GLY B 1 3   ? -12.913 33.410 -54.201 0.010 25.98  ? 3    GLY B C    1  
ATOM   3450   O O    . GLY B 1 3   ? -13.782 33.919 -53.498 0.010 26.41  ? 3    GLY B O    1  
ATOM   3451   H H    . GLY B 1 3   ? -11.527 32.659 -56.721 0.010 27.12  ? 3    GLY B H    1  
ATOM   3452   H HA2  . GLY B 1 3   ? -12.749 34.273 -56.043 0.010 28.25  ? 3    GLY B HA2  1  
ATOM   3453   H HA3  . GLY B 1 3   ? -13.972 33.298 -55.951 0.010 27.55  ? 3    GLY B HA3  1  
ATOM   3454   N N    . GLY B 1 4   ? -11.813 32.847 -53.716 0.010 24.73  ? 4    GLY B N    1  
ATOM   3455   C CA   . GLY B 1 4   ? -11.540 32.771 -52.301 0.010 23.75  ? 4    GLY B CA   1  
ATOM   3456   C C    . GLY B 1 4   ? -10.370 33.659 -51.946 0.010 24.14  ? 4    GLY B C    1  
ATOM   3457   O O    . GLY B 1 4   ? -10.108 34.667 -52.598 0.010 25.50  ? 4    GLY B O    1  
ATOM   3458   H H    . GLY B 1 4   ? -11.194 32.504 -54.201 0.010 24.55  ? 4    GLY B H    1  
ATOM   3459   H HA2  . GLY B 1 4   ? -12.311 33.064 -51.793 0.010 24.00  ? 4    GLY B HA2  1  
ATOM   3460   H HA3  . GLY B 1 4   ? -11.328 31.857 -52.060 0.010 22.77  ? 4    GLY B HA3  1  
ATOM   3461   N N    . ARG B 1 5   ? -9.664  33.278 -50.899 0.010 23.14  ? 5    ARG B N    1  
ATOM   3462   C CA   . ARG B 1 5   ? -8.390  33.883 -50.630 0.010 23.57  ? 5    ARG B CA   1  
ATOM   3463   C C    . ARG B 1 5   ? -7.584  33.047 -49.676 0.010 22.39  ? 5    ARG B C    1  
ATOM   3464   O O    . ARG B 1 5   ? -8.007  31.984 -49.241 0.010 21.24  ? 5    ARG B O    1  
ATOM   3465   C CB   . ARG B 1 5   ? -8.586  35.247 -50.046 0.010 24.71  ? 5    ARG B CB   1  
ATOM   3466   C CG   . ARG B 1 5   ? -9.441  35.257 -48.840 0.010 24.24  ? 5    ARG B CG   1  
ATOM   3467   C CD   . ARG B 1 5   ? -10.155 36.586 -48.837 0.010 25.79  ? 5    ARG B CD   1  
ATOM   3468   N NE   . ARG B 1 5   ? -11.026 36.678 -50.020 0.010 26.38  ? 5    ARG B NE   1  
ATOM   3469   C CZ   . ARG B 1 5   ? -11.250 37.786 -50.726 0.010 28.07  ? 5    ARG B CZ   1  
ATOM   3470   N NH1  . ARG B 1 5   ? -10.648 38.946 -50.437 0.010 29.40  ? 5    ARG B NH1  1  
ATOM   3471   N NH2  . ARG B 1 5   ? -12.068 37.733 -51.760 0.010 28.61  ? 5    ARG B NH2  1  
ATOM   3472   H H    . ARG B 1 5   ? -9.903  32.684 -50.330 0.010 22.33  ? 5    ARG B H    1  
ATOM   3473   H HA   . ARG B 1 5   ? -7.887  33.979 -51.454 0.010 24.14  ? 5    ARG B HA   1  
ATOM   3474   H HB2  . ARG B 1 5   ? -7.725  35.610 -49.793 0.010 25.14  ? 5    ARG B HB2  1  
ATOM   3475   H HB3  . ARG B 1 5   ? -8.979  35.814 -50.721 0.010 25.59  ? 5    ARG B HB3  1  
ATOM   3476   H HG2  . ARG B 1 5   ? -10.099 34.547 -48.874 0.010 23.46  ? 5    ARG B HG2  1  
ATOM   3477   H HG3  . ARG B 1 5   ? -8.891  35.176 -48.046 0.010 24.00  ? 5    ARG B HG3  1  
ATOM   3478   H HD2  . ARG B 1 5   ? -10.702 36.647 -48.039 0.010 25.70  ? 5    ARG B HD2  1  
ATOM   3479   H HD3  . ARG B 1 5   ? -9.499  37.302 -48.851 0.010 26.68  ? 5    ARG B HD3  1  
ATOM   3480   H HE   . ARG B 1 5   ? -11.336 35.945 -50.334 0.010 25.67  ? 5    ARG B HE   1  
ATOM   3481   H HH11 . ARG B 1 5   ? -10.111 38.998 -49.768 0.010 29.17  ? 5    ARG B HH11 1  
ATOM   3482   H HH12 . ARG B 1 5   ? -10.804 39.646 -50.917 0.010 30.59  ? 5    ARG B HH12 1  
ATOM   3483   H HH21 . ARG B 1 5   ? -12.455 36.987 -51.960 0.010 27.88  ? 5    ARG B HH21 1  
ATOM   3484   H HH22 . ARG B 1 5   ? -12.212 38.435 -52.233 0.010 29.79  ? 5    ARG B HH22 1  
ATOM   3485   N N    . GLU B 1 6   ? -6.407  33.559 -49.352 0.010 22.90  ? 6    GLU B N    1  
ATOM   3486   C CA   . GLU B 1 6   ? -5.471  32.808 -48.540 0.010 22.09  ? 6    GLU B CA   1  
ATOM   3487   C C    . GLU B 1 6   ? -6.071  32.588 -47.164 0.010 21.35  ? 6    GLU B C    1  
ATOM   3488   O O    . GLU B 1 6   ? -6.502  33.531 -46.492 0.010 22.05  ? 6    GLU B O    1  
ATOM   3489   C CB   . GLU B 1 6   ? -4.126  33.533 -48.419 0.010 23.15  ? 6    GLU B CB   1  
ATOM   3490   C CG   . GLU B 1 6   ? -3.113  32.679 -47.702 0.010 22.51  ? 6    GLU B CG   1  
ATOM   3491   C CD   . GLU B 1 6   ? -1.766  33.347 -47.539 0.010 23.73  ? 6    GLU B CD   1  
ATOM   3492   O OE1  . GLU B 1 6   ? -1.534  34.412 -48.183 0.010 25.14  ? 6    GLU B OE1  1  
ATOM   3493   O OE2  . GLU B 1 6   ? -0.960  32.800 -46.752 0.010 23.44  ? 6    GLU B OE2  1  
ATOM   3494   H H    . GLU B 1 6   ? -6.133  34.335 -49.589 0.010 23.83  ? 6    GLU B H    1  
ATOM   3495   H HA   . GLU B 1 6   ? -5.311  31.944 -48.944 0.010 21.53  ? 6    GLU B HA   1  
ATOM   3496   H HB2  . GLU B 1 6   ? -3.790  33.727 -49.308 0.010 23.82  ? 6    GLU B HB2  1  
ATOM   3497   H HB3  . GLU B 1 6   ? -4.240  34.361 -47.924 0.010 23.78  ? 6    GLU B HB3  1  
ATOM   3498   H HG2  . GLU B 1 6   ? -3.441  32.459 -46.819 0.010 21.94  ? 6    GLU B HG2  1  
ATOM   3499   H HG3  . GLU B 1 6   ? -2.981  31.869 -48.214 0.010 22.03  ? 6    GLU B HG3  1  
ATOM   3500   N N    . ALA B 1 7   ? -6.090  31.325 -46.755 0.010 20.17  ? 7    ALA B N    1  
ATOM   3501   C CA   . ALA B 1 7   ? -6.570  30.987 -45.432 0.010 19.63  ? 7    ALA B CA   1  
ATOM   3502   C C    . ALA B 1 7   ? -5.587  31.446 -44.373 0.010 20.17  ? 7    ALA B C    1  
ATOM   3503   O O    . ALA B 1 7   ? -4.408  31.663 -44.635 0.010 20.61  ? 7    ALA B O    1  
ATOM   3504   C CB   . ALA B 1 7   ? -6.788  29.482 -45.307 0.010 18.49  ? 7    ALA B CB   1  
ATOM   3505   H H    . ALA B 1 7   ? -5.825  30.655 -47.222 0.010 19.80  ? 7    ALA B H    1  
ATOM   3506   H HA   . ALA B 1 7   ? -7.418  31.428 -45.273 0.010 19.88  ? 7    ALA B HA   1  
ATOM   3507   H HB1  . ALA B 1 7   ? -6.802  29.083 -46.190 0.010 18.33  ? 7    ALA B HB1  1  
ATOM   3508   H HB2  . ALA B 1 7   ? -6.070  29.104 -44.777 0.010 18.34  ? 7    ALA B HB2  1  
ATOM   3509   H HB3  . ALA B 1 7   ? -7.637  29.325 -44.867 0.010 18.28  ? 7    ALA B HB3  1  
ATOM   3510   N N    . GLU B 1 8   ? -6.097  31.562 -43.160 0.010 20.34  ? 8    GLU B N    1  
ATOM   3511   C CA   . GLU B 1 8   ? -5.270  31.783 -42.009 0.010 20.92  ? 8    GLU B CA   1  
ATOM   3512   C C    . GLU B 1 8   ? -4.424  30.537 -41.782 0.010 20.09  ? 8    GLU B C    1  
ATOM   3513   O O    . GLU B 1 8   ? -4.944  29.408 -41.712 0.010 19.12  ? 8    GLU B O    1  
ATOM   3514   C CB   . GLU B 1 8   ? -6.127  32.101 -40.780 0.010 21.49  ? 8    GLU B CB   1  
ATOM   3515   C CG   . GLU B 1 8   ? -7.438  32.936 -41.052 0.010 21.98  ? 8    GLU B CG   1  
ATOM   3516   C CD   . GLU B 1 8   ? -8.746  32.086 -41.032 0.010 21.07  ? 8    GLU B CD   1  
ATOM   3517   O OE1  . GLU B 1 8   ? -9.585  32.285 -40.095 0.010 21.34  ? 8    GLU B OE1  1  
ATOM   3518   O OE2  . GLU B 1 8   ? -8.921  31.249 -41.963 0.010 20.36  ? 8    GLU B OE2  1  
ATOM   3519   H H    . GLU B 1 8   ? -6.935  31.512 -42.985 0.010 20.25  ? 8    GLU B H    1  
ATOM   3520   H HA   . GLU B 1 8   ? -4.681  32.534 -42.175 0.010 21.69  ? 8    GLU B HA   1  
ATOM   3521   H HB2  . GLU B 1 8   ? -6.407  31.266 -40.392 0.010 20.91  ? 8    GLU B HB2  1  
ATOM   3522   H HB3  . GLU B 1 8   ? -5.580  32.584 -40.140 0.010 22.36  ? 8    GLU B HB3  1  
ATOM   3523   H HG2  . GLU B 1 8   ? -7.524  33.618 -40.366 0.010 22.92  ? 8    GLU B HG2  1  
ATOM   3524   H HG3  . GLU B 1 8   ? -7.370  33.374 -41.916 0.010 22.18  ? 8    GLU B HG3  1  
ATOM   3525   N N    . ALA B 1 9   ? -3.108  30.752 -41.663 0.010 20.67  ? 9    ALA B N    1  
ATOM   3526   C CA   . ALA B 1 9   ? -2.151  29.661 -41.530 0.010 20.14  ? 9    ALA B CA   1  
ATOM   3527   C C    . ALA B 1 9   ? -2.537  28.740 -40.379 0.010 19.66  ? 9    ALA B C    1  
ATOM   3528   O O    . ALA B 1 9   ? -2.638  29.176 -39.227 0.010 20.35  ? 9    ALA B O    1  
ATOM   3529   C CB   . ALA B 1 9   ? -0.736  30.211 -41.314 0.010 21.20  ? 9    ALA B CB   1  
ATOM   3530   H H    . ALA B 1 9   ? -2.748  31.529 -41.651 0.010 21.48  ? 9    ALA B H    1  
ATOM   3531   H HA   . ALA B 1 9   ? -2.150  29.140 -42.346 0.010 19.58  ? 9    ALA B HA   1  
ATOM   3532   H HB1  . ALA B 1 9   ? -0.566  30.907 -41.967 0.010 21.64  ? 9    ALA B HB1  1  
ATOM   3533   H HB2  . ALA B 1 9   ? -0.676  30.579 -40.419 0.010 21.84  ? 9    ALA B HB2  1  
ATOM   3534   H HB3  . ALA B 1 9   ? -0.091  29.495 -41.422 0.010 20.94  ? 9    ALA B HB3  1  
ATOM   3535   N N    . HIS B 1 10  ? -2.793  27.474 -40.729 0.010 18.69  ? 10   HIS B N    1  
ATOM   3536   C CA   . HIS B 1 10  ? -3.024  26.403 -39.760 0.010 18.34  ? 10   HIS B CA   1  
ATOM   3537   C C    . HIS B 1 10  ? -4.344  26.545 -39.015 0.010 18.31  ? 10   HIS B C    1  
ATOM   3538   O O    . HIS B 1 10  ? -4.537  25.926 -37.957 0.010 18.46  ? 10   HIS B O    1  
ATOM   3539   C CB   . HIS B 1 10  ? -1.891  26.329 -38.737 0.010 19.14  ? 10   HIS B CB   1  
ATOM   3540   C CG   . HIS B 1 10  ? -0.530  26.356 -39.359 0.010 19.52  ? 10   HIS B CG   1  
ATOM   3541   N ND1  . HIS B 1 10  ? -0.122  25.434 -40.297 0.010 19.03  ? 10   HIS B ND1  1  
ATOM   3542   C CD2  . HIS B 1 10  ? 0.502   27.216 -39.200 0.010 20.59  ? 10   HIS B CD2  1  
ATOM   3543   C CE1  . HIS B 1 10  ? 1.109   25.724 -40.690 0.010 19.79  ? 10   HIS B CE1  1  
ATOM   3544   N NE2  . HIS B 1 10  ? 1.512   26.794 -40.032 0.010 20.73  ? 10   HIS B NE2  1  
ATOM   3545   H H    . HIS B 1 10  ? -2.857  27.212 -41.541 0.010 18.33  ? 10   HIS B H    1  
ATOM   3546   H HA   . HIS B 1 10  ? -3.048  25.568 -40.243 0.010 17.81  ? 10   HIS B HA   1  
ATOM   3547   H HB2  . HIS B 1 10  ? -1.958  27.076 -38.125 0.010 19.80  ? 10   HIS B HB2  1  
ATOM   3548   H HB3  . HIS B 1 10  ? -1.980  25.497 -38.248 0.010 18.95  ? 10   HIS B HB3  1  
ATOM   3549   H HD1  . HIS B 1 10  ? -0.593  24.779 -40.590 0.010 18.45  ? 10   HIS B HD1  1  
ATOM   3550   H HD2  . HIS B 1 10  ? 0.524   27.947 -38.629 0.010 21.27  ? 10   HIS B HD2  1  
ATOM   3551   H HE1  . HIS B 1 10  ? 1.614   25.251 -41.309 0.010 19.83  ? 10   HIS B HE1  1  
ATOM   3552   H HE2  . HIS B 1 10  ? 2.281   27.168 -40.114 0.010 21.45  ? 10   HIS B HE2  1  
ATOM   3553   N N    . ALA B 1 11  ? -5.237  27.360 -39.558 0.010 18.34  ? 11   ALA B N    1  
ATOM   3554   C CA   . ALA B 1 11  ? -6.533  27.593 -38.942 0.010 18.60  ? 11   ALA B CA   1  
ATOM   3555   C C    . ALA B 1 11  ? -7.490  26.418 -39.186 0.010 17.83  ? 11   ALA B C    1  
ATOM   3556   O O    . ALA B 1 11  ? -8.538  26.332 -38.558 0.010 18.14  ? 11   ALA B O    1  
ATOM   3557   C CB   . ALA B 1 11  ? -7.146  28.884 -39.474 0.010 19.19  ? 11   ALA B CB   1  
ATOM   3558   H H    . ALA B 1 11  ? -5.118  27.791 -40.291 0.010 18.34  ? 11   ALA B H    1  
ATOM   3559   H HA   . ALA B 1 11  ? -6.414  27.695 -37.988 0.010 19.15  ? 11   ALA B HA   1  
ATOM   3560   H HB1  . ALA B 1 11  ? -7.068  28.911 -40.439 0.010 18.79  ? 11   ALA B HB1  1  
ATOM   3561   H HB2  . ALA B 1 11  ? -8.083  28.909 -39.224 0.010 19.44  ? 11   ALA B HB2  1  
ATOM   3562   H HB3  . ALA B 1 11  ? -6.689  29.641 -39.075 0.010 19.90  ? 11   ALA B HB3  1  
ATOM   3563   N N    . ARG B 1 12  ? -7.127  25.541 -40.112 0.010 17.06  ? 12   ARG B N    1  
ATOM   3564   C CA   . ARG B 1 12  ? -7.925  24.376 -40.463 0.010 16.52  ? 12   ARG B CA   1  
ATOM   3565   C C    . ARG B 1 12  ? -6.994  23.180 -40.294 0.010 16.27  ? 12   ARG B C    1  
ATOM   3566   O O    . ARG B 1 12  ? -6.462  22.637 -41.266 0.010 15.94  ? 12   ARG B O    1  
ATOM   3567   C CB   . ARG B 1 12  ? -8.444  24.503 -41.904 0.010 16.21  ? 12   ARG B CB   1  
ATOM   3568   C CG   . ARG B 1 12  ? -9.364  25.687 -42.050 0.010 16.68  ? 12   ARG B CG   1  
ATOM   3569   C CD   . ARG B 1 12  ? -9.526  26.100 -43.497 0.010 16.66  ? 12   ARG B CD   1  
ATOM   3570   N NE   . ARG B 1 12  ? -10.527 27.151 -43.652 0.010 17.28  ? 12   ARG B NE   1  
ATOM   3571   C CZ   . ARG B 1 12  ? -10.323 28.430 -43.366 0.010 17.99  ? 12   ARG B CZ   1  
ATOM   3572   N NH1  . ARG B 1 12  ? -9.143  28.811 -42.886 0.010 18.14  ? 12   ARG B NH1  1  
ATOM   3573   N NH2  . ARG B 1 12  ? -11.317 29.312 -43.539 0.010 18.75  ? 12   ARG B NH2  1  
ATOM   3574   H H    . ARG B 1 12  ? -6.405  25.591 -40.565 0.010 16.98  ? 12   ARG B H    1  
ATOM   3575   H HA   . ARG B 1 12  ? -8.684  24.284 -39.870 0.010 16.74  ? 12   ARG B HA   1  
ATOM   3576   H HB2  . ARG B 1 12  ? -7.700  24.623 -42.513 0.010 16.13  ? 12   ARG B HB2  1  
ATOM   3577   H HB3  . ARG B 1 12  ? -8.942  23.709 -42.142 0.010 16.00  ? 12   ARG B HB3  1  
ATOM   3578   H HG2  . ARG B 1 12  ? -10.232 25.449 -41.694 0.010 16.82  ? 12   ARG B HG2  1  
ATOM   3579   H HG3  . ARG B 1 12  ? -9.003  26.434 -41.557 0.010 17.07  ? 12   ARG B HG3  1  
ATOM   3580   H HD2  . ARG B 1 12  ? -8.680  26.428 -43.833 0.010 16.72  ? 12   ARG B HD2  1  
ATOM   3581   H HD3  . ARG B 1 12  ? -9.805  25.331 -44.020 0.010 16.37  ? 12   ARG B HD3  1  
ATOM   3582   H HE   . ARG B 1 12  ? -11.348 26.897 -43.673 0.010 17.33  ? 12   ARG B HE   1  
ATOM   3583   H HH11 . ARG B 1 12  ? -8.511  28.244 -42.774 0.010 17.76  ? 12   ARG B HH11 1  
ATOM   3584   H HH12 . ARG B 1 12  ? -9.004  29.634 -42.699 0.010 18.72  ? 12   ARG B HH12 1  
ATOM   3585   H HH21 . ARG B 1 12  ? -12.076 29.053 -43.843 0.010 18.75  ? 12   ARG B HH21 1  
ATOM   3586   H HH22 . ARG B 1 12  ? -11.195 30.141 -43.353 0.010 19.33  ? 12   ARG B HH22 1  
ATOM   3587   N N    . PRO B 1 13  ? -6.755  22.811 -39.032 0.010 16.66  ? 13   PRO B N    1  
ATOM   3588   C CA   . PRO B 1 13  ? -5.676  21.861 -38.766 0.010 16.70  ? 13   PRO B CA   1  
ATOM   3589   C C    . PRO B 1 13  ? -5.991  20.435 -39.251 0.010 16.39  ? 13   PRO B C    1  
ATOM   3590   O O    . PRO B 1 13  ? -5.132  19.570 -39.155 0.010 16.56  ? 13   PRO B O    1  
ATOM   3591   C CB   . PRO B 1 13  ? -5.524  21.933 -37.245 0.010 17.47  ? 13   PRO B CB   1  
ATOM   3592   C CG   . PRO B 1 13  ? -6.911  22.245 -36.772 0.010 17.72  ? 13   PRO B CG   1  
ATOM   3593   C CD   . PRO B 1 13  ? -7.393  23.274 -37.789 0.010 17.35  ? 13   PRO B CD   1  
ATOM   3594   H HA   . PRO B 1 13  ? -4.855  22.159 -39.179 0.010 16.71  ? 13   PRO B HA   1  
ATOM   3595   H HB2  . PRO B 1 13  ? -5.208  21.087 -36.896 0.010 17.62  ? 13   PRO B HB2  1  
ATOM   3596   H HB3  . PRO B 1 13  ? -4.912  22.649 -37.023 0.010 17.80  ? 13   PRO B HB3  1  
ATOM   3597   H HG2  . PRO B 1 13  ? -7.461  21.448 -36.791 0.010 17.61  ? 13   PRO B HG2  1  
ATOM   3598   H HG3  . PRO B 1 13  ? -6.885  22.628 -35.883 0.010 18.37  ? 13   PRO B HG3  1  
ATOM   3599   H HD2  . PRO B 1 13  ? -8.357  23.256 -37.871 0.010 17.35  ? 13   PRO B HD2  1  
ATOM   3600   H HD3  . PRO B 1 13  ? -7.077  24.157 -37.547 0.010 17.72  ? 13   PRO B HD3  1  
ATOM   3601   N N    . TYR B 1 14  ? -7.191  20.236 -39.794 0.010 16.14  ? 14   TYR B N    1  
ATOM   3602   C CA   . TYR B 1 14  ? -7.604  18.976 -40.407 0.010 16.05  ? 14   TYR B CA   1  
ATOM   3603   C C    . TYR B 1 14  ? -7.245  18.860 -41.891 0.010 15.78  ? 14   TYR B C    1  
ATOM   3604   O O    . TYR B 1 14  ? -7.393  17.805 -42.489 0.010 15.94  ? 14   TYR B O    1  
ATOM   3605   C CB   . TYR B 1 14  ? -9.119  18.853 -40.299 0.010 16.20  ? 14   TYR B CB   1  
ATOM   3606   C CG   . TYR B 1 14  ? -9.865  20.083 -40.804 0.010 16.06  ? 14   TYR B CG   1  
ATOM   3607   C CD1  . TYR B 1 14  ? -10.092 20.272 -42.149 0.010 15.82  ? 14   TYR B CD1  1  
ATOM   3608   C CD2  . TYR B 1 14  ? -10.341 21.041 -39.925 0.010 16.43  ? 14   TYR B CD2  1  
ATOM   3609   C CE1  . TYR B 1 14  ? -10.793 21.413 -42.620 0.010 15.90  ? 14   TYR B CE1  1  
ATOM   3610   C CE2  . TYR B 1 14  ? -11.035 22.182 -40.386 0.010 16.54  ? 14   TYR B CE2  1  
ATOM   3611   C CZ   . TYR B 1 14  ? -11.263 22.347 -41.729 0.010 16.25  ? 14   TYR B CZ   1  
ATOM   3612   O OH   . TYR B 1 14  ? -11.965 23.464 -42.157 0.010 16.56  ? 14   TYR B OH   1  
ATOM   3613   H H    . TYR B 1 14  ? -7.791  20.843 -39.822 0.010 16.15  ? 14   TYR B H    1  
ATOM   3614   H HA   . TYR B 1 14  ? -7.195  18.239 -39.932 0.010 16.30  ? 14   TYR B HA   1  
ATOM   3615   H HB2  . TYR B 1 14  ? -9.415  18.095 -40.821 0.010 16.24  ? 14   TYR B HB2  1  
ATOM   3616   H HB3  . TYR B 1 14  ? -9.358  18.722 -39.370 0.010 16.56  ? 14   TYR B HB3  1  
ATOM   3617   H HD1  . TYR B 1 14  ? -9.784  19.641 -42.757 0.010 15.75  ? 14   TYR B HD1  1  
ATOM   3618   H HD2  . TYR B 1 14  ? -10.199 20.934 -39.014 0.010 16.76  ? 14   TYR B HD2  1  
ATOM   3619   H HE1  . TYR B 1 14  ? -10.942 21.518 -43.531 0.010 15.86  ? 14   TYR B HE1  1  
ATOM   3620   H HE2  . TYR B 1 14  ? -11.355 22.812 -39.781 0.010 16.96  ? 14   TYR B HE2  1  
ATOM   3621   H HH   . TYR B 1 14  ? -12.285 23.340 -42.932 0.010 16.53  ? 14   TYR B HH   1  
ATOM   3622   N N    . MET B 1 15  ? -6.793  19.950 -42.494 0.010 15.62  ? 15   MET B N    1  
ATOM   3623   C CA   . MET B 1 15  ? -6.599  19.966 -43.931 0.010 15.63  ? 15   MET B CA   1  
ATOM   3624   C C    . MET B 1 15  ? -5.338  19.231 -44.320 0.010 15.95  ? 15   MET B C    1  
ATOM   3625   O O    . MET B 1 15  ? -4.275  19.509 -43.788 0.010 16.12  ? 15   MET B O    1  
ATOM   3626   C CB   . MET B 1 15  ? -6.563  21.428 -44.451 0.010 15.65  ? 15   MET B CB   1  
ATOM   3627   C CG   . MET B 1 15  ? -6.354  21.549 -45.954 0.010 15.94  ? 15   MET B CG   1  
ATOM   3628   S SD   . MET B 1 15  ? -7.858  21.220 -46.912 0.010 16.08  ? 15   MET B SD   1  
ATOM   3629   C CE   . MET B 1 15  ? -7.202  20.181 -48.249 0.010 16.75  ? 15   MET B CE   1  
ATOM   3630   H H    . MET B 1 15  ? -6.602  20.684 -42.099 0.010 15.64  ? 15   MET B H    1  
ATOM   3631   H HA   . MET B 1 15  ? -7.343  19.517 -44.360 0.010 15.65  ? 15   MET B HA   1  
ATOM   3632   H HB2  . MET B 1 15  ? -7.410  21.850 -44.247 0.010 15.58  ? 15   MET B HB2  1  
ATOM   3633   H HB3  . MET B 1 15  ? -5.847  21.904 -44.009 0.010 15.74  ? 15   MET B HB3  1  
ATOM   3634   H HG2  . MET B 1 15  ? -6.076  22.454 -46.156 0.010 16.10  ? 15   MET B HG2  1  
ATOM   3635   H HG3  . MET B 1 15  ? -5.661  20.933 -46.235 0.010 16.13  ? 15   MET B HG3  1  
ATOM   3636   H HE1  . MET B 1 15  ? -6.244  20.110 -48.173 0.010 16.94  ? 15   MET B HE1  1  
ATOM   3637   H HE2  . MET B 1 15  ? -7.604  19.304 -48.181 0.010 16.80  ? 15   MET B HE2  1  
ATOM   3638   H HE3  . MET B 1 15  ? -7.432  20.585 -49.098 0.010 17.06  ? 15   MET B HE3  1  
ATOM   3639   N N    . ALA B 1 16  ? -5.472  18.333 -45.287 0.010 16.25  ? 16   ALA B N    1  
ATOM   3640   C CA   . ALA B 1 16  ? -4.371  17.514 -45.773 0.010 16.87  ? 16   ALA B CA   1  
ATOM   3641   C C    . ALA B 1 16  ? -4.100  17.780 -47.230 0.010 17.37  ? 16   ALA B C    1  
ATOM   3642   O O    . ALA B 1 16  ? -5.013  18.040 -47.994 0.010 17.33  ? 16   ALA B O    1  
ATOM   3643   C CB   . ALA B 1 16  ? -4.695  16.024 -45.602 0.010 17.26  ? 16   ALA B CB   1  
ATOM   3644   H H    . ALA B 1 16  ? -6.210  18.190 -45.700 0.010 16.25  ? 16   ALA B H    1  
ATOM   3645   H HA   . ALA B 1 16  ? -3.565  17.713 -45.275 0.010 16.95  ? 16   ALA B HA   1  
ATOM   3646   H HB1  . ALA B 1 16  ? -4.948  15.863 -44.682 0.010 17.05  ? 16   ALA B HB1  1  
ATOM   3647   H HB2  . ALA B 1 16  ? -5.417  15.782 -46.201 0.010 17.38  ? 16   ALA B HB2  1  
ATOM   3648   H HB3  . ALA B 1 16  ? -3.904  15.510 -45.819 0.010 17.79  ? 16   ALA B HB3  1  
ATOM   3649   N N    . SER B 1 17  ? -2.832  17.665 -47.611 0.010 18.09  ? 17   SER B N    1  
ATOM   3650   C CA   . SER B 1 17  ? -2.449  17.638 -49.017 0.010 18.98  ? 17   SER B CA   1  
ATOM   3651   C C    . SER B 1 17  ? -2.087  16.213 -49.407 0.010 19.99  ? 17   SER B C    1  
ATOM   3652   O O    . SER B 1 17  ? -1.114  15.656 -48.900 0.010 20.51  ? 17   SER B O    1  
ATOM   3653   C CB   . SER B 1 17  ? -1.265  18.559 -49.287 0.010 19.46  ? 17   SER B CB   1  
ATOM   3654   O OG   . SER B 1 17  ? -0.809  18.393 -50.604 0.010 20.66  ? 17   SER B OG   1  
ATOM   3655   H H    . SER B 1 17  ? -2.169  17.597 -47.069 0.010 18.21  ? 17   SER B H    1  
ATOM   3656   H HA   . SER B 1 17  ? -3.185  17.932 -49.573 0.010 18.87  ? 17   SER B HA   1  
ATOM   3657   H HB2  . SER B 1 17  ? -1.539  19.479 -49.166 0.010 19.01  ? 17   SER B HB2  1  
ATOM   3658   H HB3  . SER B 1 17  ? -0.550  18.347 -48.677 0.010 19.57  ? 17   SER B HB3  1  
ATOM   3659   H HG   . SER B 1 17  ? -1.347  17.911 -51.048 0.010 20.85  ? 17   SER B HG   1  
ATOM   3660   N N    . VAL B 1 18  ? -2.862  15.633 -50.310 0.010 20.47  ? 18   VAL B N    1  
ATOM   3661   C CA   . VAL B 1 18  ? -2.523  14.328 -50.854 0.010 21.77  ? 18   VAL B CA   1  
ATOM   3662   C C    . VAL B 1 18  ? -1.472  14.607 -51.901 0.010 23.08  ? 18   VAL B C    1  
ATOM   3663   O O    . VAL B 1 18  ? -1.735  15.350 -52.865 0.010 23.35  ? 18   VAL B O    1  
ATOM   3664   C CB   . VAL B 1 18  ? -3.721  13.627 -51.493 0.010 22.15  ? 18   VAL B CB   1  
ATOM   3665   C CG1  . VAL B 1 18  ? -3.281  12.317 -52.164 0.010 23.91  ? 18   VAL B CG1  1  
ATOM   3666   C CG2  . VAL B 1 18  ? -4.784  13.381 -50.454 0.010 21.10  ? 18   VAL B CG2  1  
ATOM   3667   H H    . VAL B 1 18  ? -3.584  15.971 -50.622 0.010 20.20  ? 18   VAL B H    1  
ATOM   3668   H HA   . VAL B 1 18  ? -2.156  13.759 -50.162 0.010 21.80  ? 18   VAL B HA   1  
ATOM   3669   H HB   . VAL B 1 18  ? -4.102  14.199 -52.179 0.010 22.16  ? 18   VAL B HB   1  
ATOM   3670   H HG11 . VAL B 1 18  ? -2.796  11.786 -51.514 0.010 24.07  ? 18   VAL B HG11 1  
ATOM   3671   H HG12 . VAL B 1 18  ? -4.066  11.836 -52.463 0.010 24.18  ? 18   VAL B HG12 1  
ATOM   3672   H HG13 . VAL B 1 18  ? -2.714  12.516 -52.926 0.010 24.75  ? 18   VAL B HG13 1  
ATOM   3673   H HG21 . VAL B 1 18  ? -4.385  13.444 -49.573 0.010 20.55  ? 18   VAL B HG21 1  
ATOM   3674   H HG22 . VAL B 1 18  ? -5.470  14.058 -50.544 0.010 20.55  ? 18   VAL B HG22 1  
ATOM   3675   H HG23 . VAL B 1 18  ? -5.165  12.501 -50.593 0.010 21.73  ? 18   VAL B HG23 1  
ATOM   3676   N N    . GLN B 1 19  ? -0.270  14.067 -51.680 0.010 24.07  ? 19   GLN B N    1  
ATOM   3677   C CA   . GLN B 1 19  ? 0.875   14.391 -52.510 0.010 25.49  ? 19   GLN B CA   1  
ATOM   3678   C C    . GLN B 1 19  ? 1.262   13.183 -53.353 0.010 27.49  ? 19   GLN B C    1  
ATOM   3679   O O    . GLN B 1 19  ? 1.296   12.040 -52.842 0.010 27.87  ? 19   GLN B O    1  
ATOM   3680   C CB   . GLN B 1 19  ? 2.055   14.842 -51.651 0.010 25.41  ? 19   GLN B CB   1  
ATOM   3681   C CG   . GLN B 1 19  ? 1.708   15.965 -50.672 0.010 23.66  ? 19   GLN B CG   1  
ATOM   3682   C CD   . GLN B 1 19  ? 2.795   17.012 -50.558 0.010 24.04  ? 19   GLN B CD   1  
ATOM   3683   O OE1  . GLN B 1 19  ? 3.990   16.697 -50.635 0.010 25.31  ? 19   GLN B OE1  1  
ATOM   3684   N NE2  . GLN B 1 19  ? 2.388   18.280 -50.382 0.010 23.15  ? 19   GLN B NE2  1  
ATOM   3685   H H    . GLN B 1 19  ? -0.095  13.518 -51.046 0.010 24.05  ? 19   GLN B H    1  
ATOM   3686   H HA   . GLN B 1 19  ? 0.649   15.118 -53.107 0.010 25.48  ? 19   GLN B HA   1  
ATOM   3687   H HB2  . GLN B 1 19  ? 2.384   14.085 -51.141 0.010 25.73  ? 19   GLN B HB2  1  
ATOM   3688   H HB3  . GLN B 1 19  ? 2.750   15.169 -52.240 0.010 26.40  ? 19   GLN B HB3  1  
ATOM   3689   H HG2  . GLN B 1 19  ? 0.896   16.401 -50.966 0.010 23.00  ? 19   GLN B HG2  1  
ATOM   3690   H HG3  . GLN B 1 19  ? 1.577   15.583 -49.790 0.010 23.10  ? 19   GLN B HG3  1  
ATOM   3691   H HE21 . GLN B 1 19  ? 1.584   18.501 -50.588 0.010 22.87  ? 19   GLN B HE21 1  
ATOM   3692   H HE22 . GLN B 1 19  ? 2.926   18.871 -50.065 0.010 22.96  ? 19   GLN B HE22 1  
ATOM   3693   N N    . LEU B 1 20  ? 1.542   13.445 -54.630 0.010 28.99  ? 20   LEU B N    1  
ATOM   3694   C CA   . LEU B 1 20  ? 1.868   12.409 -55.590 0.010 31.29  ? 20   LEU B CA   1  
ATOM   3695   C C    . LEU B 1 20  ? 3.274   12.658 -56.040 0.010 33.00  ? 20   LEU B C    1  
ATOM   3696   O O    . LEU B 1 20  ? 3.584   13.708 -56.611 0.010 33.17  ? 20   LEU B O    1  
ATOM   3697   C CB   . LEU B 1 20  ? 0.917   12.445 -56.790 0.010 32.02  ? 20   LEU B CB   1  
ATOM   3698   C CG   . LEU B 1 20  ? 1.000   11.296 -57.798 0.010 34.55  ? 20   LEU B CG   1  
ATOM   3699   C CD1  . LEU B 1 20  ? 0.829   9.918  -57.150 0.010 34.84  ? 20   LEU B CD1  1  
ATOM   3700   C CD2  . LEU B 1 20  ? -0.035  11.493 -58.879 0.010 35.08  ? 20   LEU B CD2  1  
ATOM   3701   H H    . LEU B 1 20  ? 1.557   14.234 -54.968 0.010 28.85  ? 20   LEU B H    1  
ATOM   3702   H HA   . LEU B 1 20  ? 1.819   11.536 -55.176 0.010 31.50  ? 20   LEU B HA   1  
ATOM   3703   H HB2  . LEU B 1 20  ? 0.008   12.459 -56.451 0.010 30.80  ? 20   LEU B HB2  1  
ATOM   3704   H HB3  . LEU B 1 20  ? 1.087   13.263 -57.281 0.010 32.20  ? 20   LEU B HB3  1  
ATOM   3705   H HG   . LEU B 1 20  ? 1.873   11.314 -58.221 0.010 35.99  ? 20   LEU B HG   1  
ATOM   3706   H HD11 . LEU B 1 20  ? 0.082   9.947  -56.533 0.010 33.36  ? 20   LEU B HD11 1  
ATOM   3707   H HD12 . LEU B 1 20  ? 0.656   9.263  -57.842 0.010 36.46  ? 20   LEU B HD12 1  
ATOM   3708   H HD13 . LEU B 1 20  ? 1.644   9.687  -56.676 0.010 35.06  ? 20   LEU B HD13 1  
ATOM   3709   H HD21 . LEU B 1 20  ? -0.885  11.716 -58.467 0.010 33.55  ? 20   LEU B HD21 1  
ATOM   3710   H HD22 . LEU B 1 20  ? 0.253   12.217 -59.455 0.010 35.59  ? 20   LEU B HD22 1  
ATOM   3711   H HD23 . LEU B 1 20  ? -0.118  10.674 -59.392 0.010 36.59  ? 20   LEU B HD23 1  
ATOM   3712   N N    . ASN B 1 21  ? 4.129   11.685 -55.775 0.010 34.47  ? 21   ASN B N    1  
ATOM   3713   C CA   . ASN B 1 21  ? 5.545   11.829 -56.052 0.010 36.35  ? 21   ASN B CA   1  
ATOM   3714   C C    . ASN B 1 21  ? 6.050   13.230 -55.685 0.010 35.31  ? 21   ASN B C    1  
ATOM   3715   O O    . ASN B 1 21  ? 6.746   13.883 -56.467 0.010 36.77  ? 21   ASN B O    1  
ATOM   3716   C CB   . ASN B 1 21  ? 5.847   11.489 -57.511 0.010 39.15  ? 21   ASN B CB   1  
ATOM   3717   C CG   . ASN B 1 21  ? 7.184   10.765 -57.672 0.010 41.81  ? 21   ASN B CG   1  
ATOM   3718   O OD1  . ASN B 1 21  ? 7.348   9.889  -58.538 0.010 44.14  ? 21   ASN B OD1  1  
ATOM   3719   N ND2  . ASN B 1 21  ? 8.140   11.107 -56.812 0.010 41.68  ? 21   ASN B ND2  1  
ATOM   3720   H H    . ASN B 1 21  ? 3.912   10.925 -55.438 0.010 34.56  ? 21   ASN B H    1  
ATOM   3721   H HA   . ASN B 1 21  ? 6.022   11.194 -55.497 0.010 36.75  ? 21   ASN B HA   1  
ATOM   3722   H HB2  . ASN B 1 21  ? 5.150   10.903 -57.846 0.010 39.28  ? 21   ASN B HB2  1  
ATOM   3723   H HB3  . ASN B 1 21  ? 5.867   12.302 -58.037 0.010 39.36  ? 21   ASN B HB3  1  
ATOM   3724   H HD21 . ASN B 1 21  ? 7.969   11.629 -56.152 0.010 41.23  ? 21   ASN B HD21 1  
ATOM   3725   H HD22 . ASN B 1 21  ? 8.938   10.802 -56.918 0.010 42.15  ? 21   ASN B HD22 1  
ATOM   3726   N N    . GLY B 1 22  ? 5.656   13.699 -54.505 0.010 32.97  ? 22   GLY B N    1  
ATOM   3727   C CA   . GLY B 1 22  ? 6.241   14.896 -53.918 0.010 32.18  ? 22   GLY B CA   1  
ATOM   3728   C C    . GLY B 1 22  ? 5.569   16.244 -54.208 0.010 30.99  ? 22   GLY B C    1  
ATOM   3729   O O    . GLY B 1 22  ? 5.947   17.259 -53.626 0.010 30.49  ? 22   GLY B O    1  
ATOM   3730   H H    . GLY B 1 22  ? 5.041   13.339 -54.026 0.010 31.94  ? 22   GLY B H    1  
ATOM   3731   H HA2  . GLY B 1 22  ? 6.261   14.778 -52.956 0.010 31.18  ? 22   GLY B HA2  1  
ATOM   3732   H HA3  . GLY B 1 22  ? 7.159   14.962 -54.220 0.010 33.67  ? 22   GLY B HA3  1  
ATOM   3733   N N    . ALA B 1 23  ? 4.586   16.259 -55.101 0.010 30.74  ? 23   ALA B N    1  
ATOM   3734   C CA   . ALA B 1 23  ? 3.792   17.456 -55.342 0.010 29.60  ? 23   ALA B CA   1  
ATOM   3735   C C    . ALA B 1 23  ? 2.331   17.248 -54.958 0.010 27.84  ? 23   ALA B C    1  
ATOM   3736   O O    . ALA B 1 23  ? 1.805   16.144 -55.010 0.010 27.98  ? 23   ALA B O    1  
ATOM   3737   C CB   . ALA B 1 23  ? 3.905   17.880 -56.799 0.010 31.42  ? 23   ALA B CB   1  
ATOM   3738   H H    . ALA B 1 23  ? 4.364   15.589 -55.590 0.010 31.35  ? 23   ALA B H    1  
ATOM   3739   H HA   . ALA B 1 23  ? 4.123   18.187 -54.800 0.010 28.95  ? 23   ALA B HA   1  
ATOM   3740   H HB1  . ALA B 1 23  ? 3.661   17.133 -57.366 0.010 32.13  ? 23   ALA B HB1  1  
ATOM   3741   H HB2  . ALA B 1 23  ? 3.311   18.629 -56.958 0.010 30.76  ? 23   ALA B HB2  1  
ATOM   3742   H HB3  . ALA B 1 23  ? 4.821   18.142 -56.974 0.010 32.68  ? 23   ALA B HB3  1  
ATOM   3743   N N    . HIS B 1 24  ? 1.692   18.335 -54.558 0.010 26.38  ? 24   HIS B N    1  
ATOM   3744   C CA   . HIS B 1 24  ? 0.271   18.318 -54.228 0.010 24.87  ? 24   HIS B CA   1  
ATOM   3745   C C    . HIS B 1 24  ? -0.574  17.758 -55.385 0.010 25.77  ? 24   HIS B C    1  
ATOM   3746   O O    . HIS B 1 24  ? -0.407  18.173 -56.532 0.010 27.14  ? 24   HIS B O    1  
ATOM   3747   C CB   . HIS B 1 24  ? -0.218  19.733 -53.901 0.010 23.80  ? 24   HIS B CB   1  
ATOM   3748   C CG   . HIS B 1 24  ? -1.698  19.808 -53.803 0.010 22.70  ? 24   HIS B CG   1  
ATOM   3749   N ND1  . HIS B 1 24  ? -2.378  19.552 -52.632 0.010 21.25  ? 24   HIS B ND1  1  
ATOM   3750   C CD2  . HIS B 1 24  ? -2.636  19.996 -54.754 0.010 23.12  ? 24   HIS B CD2  1  
ATOM   3751   C CE1  . HIS B 1 24  ? -3.675  19.620 -52.862 0.010 20.80  ? 24   HIS B CE1  1  
ATOM   3752   N NE2  . HIS B 1 24  ? -3.858  19.899 -54.140 0.010 21.89  ? 24   HIS B NE2  1  
ATOM   3753   H H    . HIS B 1 24  ? 2.066   19.103 -54.464 0.010 26.37  ? 24   HIS B H    1  
ATOM   3754   H HA   . HIS B 1 24  ? 0.127   17.761 -53.450 0.010 24.12  ? 24   HIS B HA   1  
ATOM   3755   H HB2  . HIS B 1 24  ? 0.154   20.019 -53.053 0.010 23.17  ? 24   HIS B HB2  1  
ATOM   3756   H HB3  . HIS B 1 24  ? 0.066   20.337 -54.608 0.010 24.66  ? 24   HIS B HB3  1  
ATOM   3757   H HD1  . HIS B 1 24  ? -2.014  19.387 -51.873 0.010 20.83  ? 24   HIS B HD1  1  
ATOM   3758   H HD2  . HIS B 1 24  ? -2.476  20.177 -55.650 0.010 24.18  ? 24   HIS B HD2  1  
ATOM   3759   H HE1  . HIS B 1 24  ? -4.341  19.512 -52.226 0.010 20.00  ? 24   HIS B HE1  1  
ATOM   3760   H HE2  . HIS B 1 24  ? -4.617  19.997 -54.526 0.010 21.96  ? 24   HIS B HE2  1  
ATOM   3761   N N    . LEU B 1 25  ? -1.492  16.839 -55.063 0.010 25.20  ? 25   LEU B N    1  
ATOM   3762   C CA   . LEU B 1 25  ? -2.380  16.209 -56.037 0.010 26.13  ? 25   LEU B CA   1  
ATOM   3763   C C    . LEU B 1 25  ? -3.854  16.494 -55.756 0.010 24.86  ? 25   LEU B C    1  
ATOM   3764   O O    . LEU B 1 25  ? -4.624  16.735 -56.659 0.010 25.51  ? 25   LEU B O    1  
ATOM   3765   C CB   . LEU B 1 25  ? -2.172  14.677 -56.061 0.010 27.17  ? 25   LEU B CB   1  
ATOM   3766   C CG   . LEU B 1 25  ? -3.139  13.912 -56.969 0.010 28.32  ? 25   LEU B CG   1  
ATOM   3767   C CD1  . LEU B 1 25  ? -2.814  14.157 -58.462 0.010 30.45  ? 25   LEU B CD1  1  
ATOM   3768   C CD2  . LEU B 1 25  ? -3.149  12.413 -56.658 0.010 29.03  ? 25   LEU B CD2  1  
ATOM   3769   H H    . LEU B 1 25  ? -1.620  16.562 -54.261 0.010 24.38  ? 25   LEU B H    1  
ATOM   3770   H HA   . LEU B 1 25  ? -2.179  16.545 -56.922 0.010 27.21  ? 25   LEU B HA   1  
ATOM   3771   H HB2  . LEU B 1 25  ? -1.273  14.494 -56.372 0.010 28.26  ? 25   LEU B HB2  1  
ATOM   3772   H HB3  . LEU B 1 25  ? -2.276  14.331 -55.164 0.010 26.23  ? 25   LEU B HB3  1  
ATOM   3773   H HG   . LEU B 1 25  ? -4.042  14.225 -56.815 0.010 27.46  ? 25   LEU B HG   1  
ATOM   3774   H HD11 . LEU B 1 25  ? -1.938  13.787 -58.659 0.010 31.49  ? 25   LEU B HD11 1  
ATOM   3775   H HD12 . LEU B 1 25  ? -3.488  13.724 -59.007 0.010 31.28  ? 25   LEU B HD12 1  
ATOM   3776   H HD13 . LEU B 1 25  ? -2.818  15.110 -58.636 0.010 30.07  ? 25   LEU B HD13 1  
ATOM   3777   H HD21 . LEU B 1 25  ? -2.321  12.173 -56.214 0.010 28.93  ? 25   LEU B HD21 1  
ATOM   3778   H HD22 . LEU B 1 25  ? -3.904  12.217 -56.082 0.010 28.18  ? 25   LEU B HD22 1  
ATOM   3779   H HD23 . LEU B 1 25  ? -3.229  11.922 -57.490 0.010 30.62  ? 25   LEU B HD23 1  
ATOM   3780   N N    . CYS B 1 26  ? -4.239  16.452 -54.488 0.010 23.27  ? 26   CYS B N    1  
ATOM   3781   C CA   . CYS B 1 26  ? -5.641  16.494 -54.097 0.010 22.33  ? 26   CYS B CA   1  
ATOM   3782   C C    . CYS B 1 26  ? -5.727  16.913 -52.653 0.010 20.73  ? 26   CYS B C    1  
ATOM   3783   O O    . CYS B 1 26  ? -4.771  16.760 -51.916 0.010 20.47  ? 26   CYS B O    1  
ATOM   3784   C CB   . CYS B 1 26  ? -6.292  15.117 -54.218 0.010 23.01  ? 26   CYS B CB   1  
ATOM   3785   S SG   . CYS B 1 26  ? -6.871  14.680 -55.853 0.010 25.01  ? 26   CYS B SG   1  
ATOM   3786   H H    . CYS B 1 26  ? -3.700  16.412 -53.823 0.010 22.83  ? 26   CYS B H    1  
ATOM   3787   H HA   . CYS B 1 26  ? -6.124  17.137 -54.641 0.010 22.46  ? 26   CYS B HA   1  
ATOM   3788   H HB2  . CYS B 1 26  ? -5.641  14.450 -53.950 0.010 23.31  ? 26   CYS B HB2  1  
ATOM   3789   H HB3  . CYS B 1 26  ? -7.048  15.071 -53.614 0.010 22.27  ? 26   CYS B HB3  1  
ATOM   3790   N N    . GLY B 1 27  ? -6.879  17.457 -52.282 0.010 19.91  ? 27   GLY B N    1  
ATOM   3791   C CA   . GLY B 1 27  ? -7.163  17.752 -50.904 0.010 18.69  ? 27   GLY B CA   1  
ATOM   3792   C C    . GLY B 1 27  ? -7.507  16.489 -50.153 0.010 18.63  ? 27   GLY B C    1  
ATOM   3793   O O    . GLY B 1 27  ? -7.667  15.418 -50.746 0.010 19.53  ? 27   GLY B O    1  
ATOM   3794   H H    . GLY B 1 27  ? -7.520  17.655 -52.818 0.010 20.18  ? 27   GLY B H    1  
ATOM   3795   H HA2  . GLY B 1 27  ? -6.393  18.171 -50.489 0.010 18.42  ? 27   GLY B HA2  1  
ATOM   3796   H HA3  . GLY B 1 27  ? -7.921  18.357 -50.853 0.010 18.37  ? 27   GLY B HA3  1  
ATOM   3797   N N    . GLY B 1 28  ? -7.625  16.625 -48.839 0.010 17.80  ? 28   GLY B N    1  
ATOM   3798   C CA   . GLY B 1 28  ? -8.000  15.528 -47.972 0.010 17.84  ? 28   GLY B CA   1  
ATOM   3799   C C    . GLY B 1 28  ? -8.258  16.036 -46.571 0.010 17.06  ? 28   GLY B C    1  
ATOM   3800   O O    . GLY B 1 28  ? -7.967  17.205 -46.248 0.010 16.52  ? 28   GLY B O    1  
ATOM   3801   H H    . GLY B 1 28  ? -7.494  17.361 -48.418 0.010 17.32  ? 28   GLY B H    1  
ATOM   3802   H HA2  . GLY B 1 28  ? -8.799  15.104 -48.308 0.010 18.20  ? 28   GLY B HA2  1  
ATOM   3803   H HA3  . GLY B 1 28  ? -7.283  14.876 -47.945 0.010 18.22  ? 28   GLY B HA3  1  
ATOM   3804   N N    . VAL B 1 29  ? -8.821  15.182 -45.732 0.010 17.21  ? 29   VAL B N    1  
ATOM   3805   C CA   . VAL B 1 29  ? -9.290  15.623 -44.418 0.010 16.78  ? 29   VAL B CA   1  
ATOM   3806   C C    . VAL B 1 29  ? -8.876  14.618 -43.360 0.010 17.18  ? 29   VAL B C    1  
ATOM   3807   O O    . VAL B 1 29  ? -9.199  13.437 -43.463 0.010 17.87  ? 29   VAL B O    1  
ATOM   3808   C CB   . VAL B 1 29  ? -10.854 15.836 -44.357 0.010 16.80  ? 29   VAL B CB   1  
ATOM   3809   C CG1  . VAL B 1 29  ? -11.640 14.513 -44.502 0.010 17.52  ? 29   VAL B CG1  1  
ATOM   3810   C CG2  . VAL B 1 29  ? -11.220 16.579 -43.084 0.010 16.77  ? 29   VAL B CG2  1  
ATOM   3811   H H    . VAL B 1 29  ? -8.937  14.347 -45.890 0.010 17.70  ? 29   VAL B H    1  
ATOM   3812   H HA   . VAL B 1 29  ? -8.865  16.462 -44.192 0.010 16.41  ? 29   VAL B HA   1  
ATOM   3813   H HB   . VAL B 1 29  ? -11.127 16.398 -45.100 0.010 16.55  ? 29   VAL B HB   1  
ATOM   3814   H HG11 . VAL B 1 29  ? -11.019 13.819 -44.746 0.010 17.83  ? 29   VAL B HG11 1  
ATOM   3815   H HG12 . VAL B 1 29  ? -12.095 14.308 -43.673 0.010 17.83  ? 29   VAL B HG12 1  
ATOM   3816   H HG13 . VAL B 1 29  ? -12.297 14.612 -45.207 0.010 17.54  ? 29   VAL B HG13 1  
ATOM   3817   H HG21 . VAL B 1 29  ? -10.546 17.254 -42.905 0.010 16.47  ? 29   VAL B HG21 1  
ATOM   3818   H HG22 . VAL B 1 29  ? -12.077 17.005 -43.211 0.010 16.82  ? 29   VAL B HG22 1  
ATOM   3819   H HG23 . VAL B 1 29  ? -11.263 15.953 -42.346 0.010 17.18  ? 29   VAL B HG23 1  
ATOM   3820   N N    . LEU B 1 30  ? -8.152  15.082 -42.347 0.010 16.94  ? 30   LEU B N    1  
ATOM   3821   C CA   . LEU B 1 30  ? -7.799  14.217 -41.251 0.010 17.48  ? 30   LEU B CA   1  
ATOM   3822   C C    . LEU B 1 30  ? -9.047  13.906 -40.431 0.010 17.86  ? 30   LEU B C    1  
ATOM   3823   O O    . LEU B 1 30  ? -9.574  14.782 -39.767 0.010 17.66  ? 30   LEU B O    1  
ATOM   3824   C CB   . LEU B 1 30  ? -6.730  14.863 -40.360 0.010 17.35  ? 30   LEU B CB   1  
ATOM   3825   C CG   . LEU B 1 30  ? -6.133  13.936 -39.300 0.010 18.12  ? 30   LEU B CG   1  
ATOM   3826   C CD1  . LEU B 1 30  ? -5.297  12.862 -39.956 0.010 18.70  ? 30   LEU B CD1  1  
ATOM   3827   C CD2  . LEU B 1 30  ? -5.318  14.762 -38.323 0.010 18.12  ? 30   LEU B CD2  1  
ATOM   3828   H H    . LEU B 1 30  ? -7.865  15.884 -42.269 0.010 16.60  ? 30   LEU B H    1  
ATOM   3829   H HA   . LEU B 1 30  ? -7.445  13.383 -41.597 0.010 17.92  ? 30   LEU B HA   1  
ATOM   3830   H HB2  . LEU B 1 30  ? -6.002  15.173 -40.920 0.010 17.17  ? 30   LEU B HB2  1  
ATOM   3831   H HB3  . LEU B 1 30  ? -7.123  15.613 -39.893 0.010 17.10  ? 30   LEU B HB3  1  
ATOM   3832   H HG   . LEU B 1 30  ? -6.852  13.507 -38.807 0.010 18.46  ? 30   LEU B HG   1  
ATOM   3833   H HD11 . LEU B 1 30  ? -4.776  13.256 -40.672 0.010 18.44  ? 30   LEU B HD11 1  
ATOM   3834   H HD12 . LEU B 1 30  ? -4.711  12.467 -39.293 0.010 19.23  ? 30   LEU B HD12 1  
ATOM   3835   H HD13 . LEU B 1 30  ? -5.893  12.187 -40.316 0.010 18.98  ? 30   LEU B HD13 1  
ATOM   3836   H HD21 . LEU B 1 30  ? -5.871  15.476 -37.969 0.010 17.88  ? 30   LEU B HD21 1  
ATOM   3837   H HD22 . LEU B 1 30  ? -5.011  14.188 -37.604 0.010 18.73  ? 30   LEU B HD22 1  
ATOM   3838   H HD23 . LEU B 1 30  ? -4.562  15.140 -38.799 0.010 17.92  ? 30   LEU B HD23 1  
ATOM   3839   N N    . VAL B 1 31  ? -9.488  12.643 -40.461 0.010 18.64  ? 31   VAL B N    1  
ATOM   3840   C CA   . VAL B 1 31  ? -10.686 12.250 -39.700 0.010 19.34  ? 31   VAL B CA   1  
ATOM   3841   C C    . VAL B 1 31  ? -10.334 11.263 -38.601 0.010 20.29  ? 31   VAL B C    1  
ATOM   3842   O O    . VAL B 1 31  ? -11.158 10.997 -37.739 0.010 21.08  ? 31   VAL B O    1  
ATOM   3843   C CB   . VAL B 1 31  ? -11.788 11.707 -40.620 0.010 19.86  ? 31   VAL B CB   1  
ATOM   3844   C CG1  . VAL B 1 31  ? -12.386 12.836 -41.417 0.010 19.17  ? 31   VAL B CG1  1  
ATOM   3845   C CG2  . VAL B 1 31  ? -11.254 10.634 -41.529 0.010 20.41  ? 31   VAL B CG2  1  
ATOM   3846   H H    . VAL B 1 31  ? -9.113  12.004 -40.895 0.010 18.93  ? 31   VAL B H    1  
ATOM   3847   H HA   . VAL B 1 31  ? -11.062 13.022 -39.251 0.010 19.09  ? 31   VAL B HA   1  
ATOM   3848   H HB   . VAL B 1 31  ? -12.492 11.318 -40.078 0.010 20.53  ? 31   VAL B HB   1  
ATOM   3849   H HG11 . VAL B 1 31  ? -12.135 13.685 -41.023 0.010 18.70  ? 31   VAL B HG11 1  
ATOM   3850   H HG12 . VAL B 1 31  ? -12.045 12.778 -42.320 0.010 18.89  ? 31   VAL B HG12 1  
ATOM   3851   H HG13 . VAL B 1 31  ? -13.351 12.741 -41.416 0.010 19.67  ? 31   VAL B HG13 1  
ATOM   3852   H HG21 . VAL B 1 31  ? -10.468 10.961 -41.988 0.010 19.89  ? 31   VAL B HG21 1  
ATOM   3853   H HG22 . VAL B 1 31  ? -11.032 9.851  -41.003 0.010 20.88  ? 31   VAL B HG22 1  
ATOM   3854   H HG23 . VAL B 1 31  ? -11.937 10.413 -42.180 0.010 20.99  ? 31   VAL B HG23 1  
ATOM   3855   N N    . ALA B 1 32  ? -9.103  10.754 -38.626 0.010 20.40  ? 32   ALA B N    1  
ATOM   3856   C CA   . ALA B 1 32  ? -8.545  10.023 -37.489 0.010 21.37  ? 32   ALA B CA   1  
ATOM   3857   C C    . ALA B 1 32  ? -7.044  10.225 -37.390 0.010 21.23  ? 32   ALA B C    1  
ATOM   3858   O O    . ALA B 1 32  ? -6.399  10.678 -38.322 0.010 20.57  ? 32   ALA B O    1  
ATOM   3859   C CB   . ALA B 1 32  ? -8.869  8.540  -37.594 0.010 22.68  ? 32   ALA B CB   1  
ATOM   3860   H H    . ALA B 1 32  ? -8.570  10.804 -39.295 0.010 20.06  ? 32   ALA B H    1  
ATOM   3861   H HA   . ALA B 1 32  ? -8.943  10.351 -36.669 0.010 21.55  ? 32   ALA B HA   1  
ATOM   3862   H HB1  . ALA B 1 32  ? -9.812  8.433  -37.787 0.010 22.84  ? 32   ALA B HB1  1  
ATOM   3863   H HB2  . ALA B 1 32  ? -8.331  8.150  -38.296 0.010 22.74  ? 32   ALA B HB2  1  
ATOM   3864   H HB3  . ALA B 1 32  ? -8.646  8.114  -36.753 0.010 23.45  ? 32   ALA B HB3  1  
ATOM   3865   N N    . GLU B 1 33  ? -6.499  9.883  -36.235 0.010 22.10  ? 33   GLU B N    1  
ATOM   3866   C CA   . GLU B 1 33  ? -5.079  9.965  -35.981 0.010 22.45  ? 33   GLU B CA   1  
ATOM   3867   C C    . GLU B 1 33  ? -4.306  9.389  -37.146 0.010 22.50  ? 33   GLU B C    1  
ATOM   3868   O O    . GLU B 1 33  ? -3.322  9.959  -37.572 0.010 22.15  ? 33   GLU B O    1  
ATOM   3869   C CB   . GLU B 1 33  ? -4.735  9.172  -34.722 0.010 23.99  ? 33   GLU B CB   1  
ATOM   3870   C CG   . GLU B 1 33  ? -5.376  7.792  -34.692 0.010 25.17  ? 33   GLU B CG   1  
ATOM   3871   C CD   . GLU B 1 33  ? -6.743  7.785  -34.094 0.010 25.79  ? 33   GLU B CD   1  
ATOM   3872   O OE1  . GLU B 1 33  ? -6.974  6.838  -33.321 0.010 27.38  ? 33   GLU B OE1  1  
ATOM   3873   O OE2  . GLU B 1 33  ? -7.570  8.690  -34.408 0.010 24.89  ? 33   GLU B OE2  1  
ATOM   3874   H H    . GLU B 1 33  ? -6.953  9.615  -35.567 0.010 22.65  ? 33   GLU B H    1  
ATOM   3875   H HA   . GLU B 1 33  ? -4.820  10.888 -35.855 0.010 21.91  ? 33   GLU B HA   1  
ATOM   3876   H HB2  . GLU B 1 33  ? -3.776  9.044  -34.678 0.010 24.38  ? 33   GLU B HB2  1  
ATOM   3877   H HB3  . GLU B 1 33  ? -5.039  9.664  -33.948 0.010 24.06  ? 33   GLU B HB3  1  
ATOM   3878   H HG2  . GLU B 1 33  ? -5.454  7.430  -35.587 0.010 24.81  ? 33   GLU B HG2  1  
ATOM   3879   H HG3  . GLU B 1 33  ? -4.825  7.204  -34.148 0.010 26.15  ? 33   GLU B HG3  1  
ATOM   3880   N N    . GLN B 1 34  ? -4.812  8.286  -37.703 0.010 23.10  ? 34   GLN B N    1  
ATOM   3881   C CA   . GLN B 1 34  ? -4.074  7.532  -38.692 0.010 23.65  ? 34   GLN B CA   1  
ATOM   3882   C C    . GLN B 1 34  ? -4.836  7.474  -40.023 0.010 23.26  ? 34   GLN B C    1  
ATOM   3883   O O    . GLN B 1 34  ? -4.408  6.786  -40.943 0.010 24.03  ? 34   GLN B O    1  
ATOM   3884   C CB   . GLN B 1 34  ? -3.756  6.111  -38.153 0.010 25.45  ? 34   GLN B CB   1  
ATOM   3885   C CG   . GLN B 1 34  ? -2.472  5.512  -38.732 0.010 26.35  ? 34   GLN B CG   1  
ATOM   3886   C CD   . GLN B 1 34  ? -2.001  4.200  -38.089 0.010 28.38  ? 34   GLN B CD   1  
ATOM   3887   O OE1  . GLN B 1 34  ? -2.315  3.875  -36.943 0.010 29.13  ? 34   GLN B OE1  1  
ATOM   3888   N NE2  . GLN B 1 34  ? -1.221  3.452  -38.848 0.010 29.48  ? 34   GLN B NE2  1  
ATOM   3889   H H    . GLN B 1 34  ? -5.592  7.970  -37.535 0.010 23.33  ? 34   GLN B H    1  
ATOM   3890   H HA   . GLN B 1 34  ? -3.225  7.965  -38.865 0.010 23.37  ? 34   GLN B HA   1  
ATOM   3891   H HB2  . GLN B 1 34  ? -3.643  6.157  -37.193 0.010 25.79  ? 34   GLN B HB2  1  
ATOM   3892   H HB3  . GLN B 1 34  ? -4.494  5.522  -38.375 0.010 25.92  ? 34   GLN B HB3  1  
ATOM   3893   H HG2  . GLN B 1 34  ? -2.618  5.328  -39.673 0.010 26.27  ? 34   GLN B HG2  1  
ATOM   3894   H HG3  . GLN B 1 34  ? -1.754  6.157  -38.631 0.010 25.92  ? 34   GLN B HG3  1  
ATOM   3895   H HE21 . GLN B 1 34  ? -0.371  3.576  -38.844 0.010 29.60  ? 34   GLN B HE21 1  
ATOM   3896   H HE22 . GLN B 1 34  ? -1.566  2.842  -39.346 0.010 30.19  ? 34   GLN B HE22 1  
ATOM   3897   N N    . TRP B 1 35  ? -5.945  8.209  -40.122 0.010 22.31  ? 35   TRP B N    1  
ATOM   3898   C CA   . TRP B 1 35  ? -6.776  8.179  -41.327 0.010 22.16  ? 35   TRP B CA   1  
ATOM   3899   C C    . TRP B 1 35  ? -7.151  9.545  -41.916 0.010 20.79  ? 35   TRP B C    1  
ATOM   3900   O O    . TRP B 1 35  ? -7.741  10.387 -41.248 0.010 20.06  ? 35   TRP B O    1  
ATOM   3901   C CB   . TRP B 1 35  ? -8.053  7.396  -41.076 0.010 22.97  ? 35   TRP B CB   1  
ATOM   3902   C CG   . TRP B 1 35  ? -7.805  5.953  -40.900 0.010 24.62  ? 35   TRP B CG   1  
ATOM   3903   C CD1  . TRP B 1 35  ? -7.586  5.297  -39.730 0.010 25.56  ? 35   TRP B CD1  1  
ATOM   3904   C CD2  . TRP B 1 35  ? -7.750  4.972  -41.931 0.010 25.81  ? 35   TRP B CD2  1  
ATOM   3905   N NE1  . TRP B 1 35  ? -7.425  3.960  -39.962 0.010 27.25  ? 35   TRP B NE1  1  
ATOM   3906   C CE2  . TRP B 1 35  ? -7.501  3.732  -41.309 0.010 27.46  ? 35   TRP B CE2  1  
ATOM   3907   C CE3  . TRP B 1 35  ? -7.899  5.012  -43.315 0.010 25.88  ? 35   TRP B CE3  1  
ATOM   3908   C CZ2  . TRP B 1 35  ? -7.416  2.540  -42.029 0.010 29.18  ? 35   TRP B CZ2  1  
ATOM   3909   C CZ3  . TRP B 1 35  ? -7.799  3.839  -44.025 0.010 27.59  ? 35   TRP B CZ3  1  
ATOM   3910   C CH2  . TRP B 1 35  ? -7.567  2.619  -43.383 0.010 29.23  ? 35   TRP B CH2  1  
ATOM   3911   H H    . TRP B 1 35  ? -6.239  8.737  -39.511 0.010 21.87  ? 35   TRP B H    1  
ATOM   3912   H HA   . TRP B 1 35  ? -6.301  7.698  -42.017 0.010 22.70  ? 35   TRP B HA   1  
ATOM   3913   H HB2  . TRP B 1 35  ? -8.495  7.730  -40.285 0.010 22.73  ? 35   TRP B HB2  1  
ATOM   3914   H HB3  . TRP B 1 35  ? -8.642  7.503  -41.838 0.010 22.85  ? 35   TRP B HB3  1  
ATOM   3915   H HD1  . TRP B 1 35  ? -7.567  5.699  -38.893 0.010 25.26  ? 35   TRP B HD1  1  
ATOM   3916   H HE1  . TRP B 1 35  ? -7.267  3.368  -39.366 0.010 28.16  ? 35   TRP B HE1  1  
ATOM   3917   H HE3  . TRP B 1 35  ? -8.068  5.813  -43.752 0.010 24.93  ? 35   TRP B HE3  1  
ATOM   3918   H HZ2  . TRP B 1 35  ? -7.248  1.729  -41.608 0.010 30.39  ? 35   TRP B HZ2  1  
ATOM   3919   H HZ3  . TRP B 1 35  ? -7.897  3.856  -44.949 0.010 27.81  ? 35   TRP B HZ3  1  
ATOM   3920   H HH2  . TRP B 1 35  ? -7.493  1.846  -43.894 0.010 30.52  ? 35   TRP B HH2  1  
ATOM   3921   N N    . VAL B 1 36  ? -6.856  9.690  -43.205 0.010 20.73  ? 36   VAL B N    1  
ATOM   3922   C CA   . VAL B 1 36  ? -7.253  10.847 -44.007 0.010 19.79  ? 36   VAL B CA   1  
ATOM   3923   C C    . VAL B 1 36  ? -8.287  10.449 -45.069 0.010 20.32  ? 36   VAL B C    1  
ATOM   3924   O O    . VAL B 1 36  ? -8.140  9.426  -45.757 0.010 21.45  ? 36   VAL B O    1  
ATOM   3925   C CB   . VAL B 1 36  ? -6.003  11.492 -44.673 0.010 19.53  ? 36   VAL B CB   1  
ATOM   3926   C CG1  . VAL B 1 36  ? -6.404  12.563 -45.683 0.010 18.89  ? 36   VAL B CG1  1  
ATOM   3927   C CG2  . VAL B 1 36  ? -5.081  12.079 -43.600 0.010 19.10  ? 36   VAL B CG2  1  
ATOM   3928   H H    . VAL B 1 36  ? -6.405  9.115  -43.654 0.010 21.38  ? 36   VAL B H    1  
ATOM   3929   H HA   . VAL B 1 36  ? -7.664  11.509 -43.433 0.010 19.18  ? 36   VAL B HA   1  
ATOM   3930   H HB   . VAL B 1 36  ? -5.505  10.810 -45.148 0.010 20.29  ? 36   VAL B HB   1  
ATOM   3931   H HG11 . VAL B 1 36  ? -7.059  12.224 -46.308 0.010 19.21  ? 36   VAL B HG11 1  
ATOM   3932   H HG12 . VAL B 1 36  ? -6.770  13.318 -45.201 0.010 18.20  ? 36   VAL B HG12 1  
ATOM   3933   H HG13 . VAL B 1 36  ? -5.612  12.831 -46.168 0.010 19.03  ? 36   VAL B HG13 1  
ATOM   3934   H HG21 . VAL B 1 36  ? -4.950  11.415 -42.904 0.010 19.54  ? 36   VAL B HG21 1  
ATOM   3935   H HG22 . VAL B 1 36  ? -4.231  12.310 -44.003 0.010 19.26  ? 36   VAL B HG22 1  
ATOM   3936   H HG23 . VAL B 1 36  ? -5.493  12.874 -43.223 0.010 18.41  ? 36   VAL B HG23 1  
ATOM   3937   N N    . LEU B 1 37  ? -9.363  11.219 -45.152 0.010 19.75  ? 37   LEU B N    1  
ATOM   3938   C CA   . LEU B 1 37  ? -10.391 11.030 -46.177 0.010 20.30  ? 37   LEU B CA   1  
ATOM   3939   C C    . LEU B 1 37  ? -10.182 11.948 -47.380 0.010 19.96  ? 37   LEU B C    1  
ATOM   3940   O O    . LEU B 1 37  ? -9.831  13.108 -47.229 0.010 19.01  ? 37   LEU B O    1  
ATOM   3941   C CB   . LEU B 1 37  ? -11.782 11.258 -45.581 0.010 20.22  ? 37   LEU B CB   1  
ATOM   3942   C CG   . LEU B 1 37  ? -13.031 11.097 -46.452 0.010 21.05  ? 37   LEU B CG   1  
ATOM   3943   C CD1  . LEU B 1 37  ? -13.254 9.628  -46.825 0.010 22.59  ? 37   LEU B CD1  1  
ATOM   3944   C CD2  . LEU B 1 37  ? -14.243 11.632 -45.721 0.010 20.93  ? 37   LEU B CD2  1  
ATOM   3945   H H    . LEU B 1 37  ? -9.524  11.870 -44.618 0.010 19.16  ? 37   LEU B H    1  
ATOM   3946   H HA   . LEU B 1 37  ? -10.353 10.117 -46.497 0.010 21.21  ? 37   LEU B HA   1  
ATOM   3947   H HB2  . LEU B 1 37  ? -11.873 10.640 -44.839 0.010 20.55  ? 37   LEU B HB2  1  
ATOM   3948   H HB3  . LEU B 1 37  ? -11.833 12.147 -45.238 0.010 19.45  ? 37   LEU B HB3  1  
ATOM   3949   H HG   . LEU B 1 37  ? -12.923 11.610 -47.268 0.010 20.90  ? 37   LEU B HG   1  
ATOM   3950   H HD11 . LEU B 1 37  ? -13.196 9.088  -46.021 0.010 22.83  ? 37   LEU B HD11 1  
ATOM   3951   H HD12 . LEU B 1 37  ? -14.132 9.524  -47.225 0.010 23.20  ? 37   LEU B HD12 1  
ATOM   3952   H HD13 . LEU B 1 37  ? -12.566 9.358  -47.454 0.010 22.86  ? 37   LEU B HD13 1  
ATOM   3953   H HD21 . LEU B 1 37  ? -14.114 12.575 -45.528 0.010 20.12  ? 37   LEU B HD21 1  
ATOM   3954   H HD22 . LEU B 1 37  ? -15.020 11.512 -46.288 0.010 21.55  ? 37   LEU B HD22 1  
ATOM   3955   H HD23 . LEU B 1 37  ? -14.358 11.136 -44.896 0.010 21.22  ? 37   LEU B HD23 1  
ATOM   3956   N N    . SER B 1 38  ? -10.382 11.409 -48.572 0.010 20.97  ? 38   SER B N    1  
ATOM   3957   C CA   . SER B 1 38  ? -10.113 12.127 -49.816 0.010 21.07  ? 38   SER B CA   1  
ATOM   3958   C C    . SER B 1 38  ? -11.021 11.554 -50.911 0.010 22.40  ? 38   SER B C    1  
ATOM   3959   O O    . SER B 1 38  ? -11.991 10.869 -50.606 0.010 22.98  ? 38   SER B O    1  
ATOM   3960   C CB   . SER B 1 38  ? -8.631  11.982 -50.208 0.010 21.38  ? 38   SER B CB   1  
ATOM   3961   O OG   . SER B 1 38  ? -8.285  12.837 -51.306 0.010 21.55  ? 38   SER B OG   1  
ATOM   3962   H H    . SER B 1 38  ? -10.676 10.612 -48.692 0.010 21.77  ? 38   SER B H    1  
ATOM   3963   H HA   . SER B 1 38  ? -10.315 13.069 -49.709 0.010 20.32  ? 38   SER B HA   1  
ATOM   3964   H HB2  . SER B 1 38  ? -8.081  12.205 -49.440 0.010 20.73  ? 38   SER B HB2  1  
ATOM   3965   H HB3  . SER B 1 38  ? -8.469  11.062 -50.465 0.010 22.34  ? 38   SER B HB3  1  
ATOM   3966   H HG   . SER B 1 38  ? -7.460  12.767 -51.484 0.010 21.81  ? 38   SER B HG   1  
ATOM   3967   N N    . ALA B 1 39  ? -10.693 11.815 -52.166 0.010 23.11  ? 39   ALA B N    1  
ATOM   3968   C CA   . ALA B 1 39  ? -11.567 11.436 -53.273 0.010 24.54  ? 39   ALA B CA   1  
ATOM   3969   C C    . ALA B 1 39  ? -11.021 10.184 -53.944 0.010 26.27  ? 39   ALA B C    1  
ATOM   3970   O O    . ALA B 1 39  ? -9.816  10.060 -54.158 0.010 26.50  ? 39   ALA B O    1  
ATOM   3971   C CB   . ALA B 1 39  ? -11.669 12.573 -54.287 0.010 24.59  ? 39   ALA B CB   1  
ATOM   3972   H H    . ALA B 1 39  ? -9.970  12.208 -52.409 0.010 22.93  ? 39   ALA B H    1  
ATOM   3973   H HA   . ALA B 1 39  ? -12.459 11.255 -52.944 0.010 24.58  ? 39   ALA B HA   1  
ATOM   3974   H HB1  . ALA B 1 39  ? -10.788 12.770 -54.634 0.010 24.68  ? 39   ALA B HB1  1  
ATOM   3975   H HB2  . ALA B 1 39  ? -12.252 12.298 -55.009 0.010 25.66  ? 39   ALA B HB2  1  
ATOM   3976   H HB3  . ALA B 1 39  ? -12.034 13.357 -53.848 0.010 23.62  ? 39   ALA B HB3  1  
ATOM   3977   N N    . ALA B 1 40  ? -11.911 9.272  -54.287 0.010 27.72  ? 40   ALA B N    1  
ATOM   3978   C CA   . ALA B 1 40  ? -11.473 8.033  -54.907 0.010 29.70  ? 40   ALA B CA   1  
ATOM   3979   C C    . ALA B 1 40  ? -10.768 8.297  -56.239 0.010 30.87  ? 40   ALA B C    1  
ATOM   3980   O O    . ALA B 1 40  ? -9.806  7.611  -56.572 0.010 32.09  ? 40   ALA B O    1  
ATOM   3981   C CB   . ALA B 1 40  ? -12.635 7.090  -55.099 0.010 31.30  ? 40   ALA B CB   1  
ATOM   3982   H H    . ALA B 1 40  ? -12.759 9.342  -54.176 0.010 27.74  ? 40   ALA B H    1  
ATOM   3983   H HA   . ALA B 1 40  ? -10.833 7.590  -54.334 0.010 29.50  ? 40   ALA B HA   1  
ATOM   3984   H HB1  . ALA B 1 40  ? -13.280 7.493  -55.699 0.010 31.69  ? 40   ALA B HB1  1  
ATOM   3985   H HB2  . ALA B 1 40  ? -12.303 6.262  -55.478 0.010 32.72  ? 40   ALA B HB2  1  
ATOM   3986   H HB3  . ALA B 1 40  ? -13.044 6.919  -54.237 0.010 30.68  ? 40   ALA B HB3  1  
ATOM   3987   N N    . HIS B 1 41  ? -11.238 9.279  -57.001 0.010 30.76  ? 41   HIS B N    1  
ATOM   3988   C CA   . HIS B 1 41  ? -10.698 9.464  -58.346 0.010 32.33  ? 41   HIS B CA   1  
ATOM   3989   C C    . HIS B 1 41  ? -9.241  9.904  -58.329 0.010 31.86  ? 41   HIS B C    1  
ATOM   3990   O O    . HIS B 1 41  ? -8.547  9.818  -59.334 0.010 33.51  ? 41   HIS B O    1  
ATOM   3991   C CB   . HIS B 1 41  ? -11.525 10.470 -59.141 0.010 32.43  ? 41   HIS B CB   1  
ATOM   3992   C CG   . HIS B 1 41  ? -11.353 11.883 -58.682 0.010 30.35  ? 41   HIS B CG   1  
ATOM   3993   N ND1  . HIS B 1 41  ? -10.152 12.556 -58.768 0.010 29.73  ? 41   HIS B ND1  1  
ATOM   3994   C CD2  . HIS B 1 41  ? -12.231 12.754 -58.129 0.010 28.99  ? 41   HIS B CD2  1  
ATOM   3995   C CE1  . HIS B 1 41  ? -10.301 13.783 -58.303 0.010 28.09  ? 41   HIS B CE1  1  
ATOM   3996   N NE2  . HIS B 1 41  ? -11.557 13.933 -57.919 0.010 27.62  ? 41   HIS B NE2  1  
ATOM   3997   H H    . HIS B 1 41  ? -11.859 9.827  -56.776 0.010 29.98  ? 41   HIS B H    1  
ATOM   3998   H HA   . HIS B 1 41  ? -10.739 8.619  -58.818 0.010 33.98  ? 41   HIS B HA   1  
ATOM   3999   H HB2  . HIS B 1 41  ? -11.245 10.426 -60.066 0.010 33.82  ? 41   HIS B HB2  1  
ATOM   4000   H HB3  . HIS B 1 41  ? -12.465 10.242 -59.078 0.010 32.72  ? 41   HIS B HB3  1  
ATOM   4001   H HD1  . HIS B 1 41  ? -9.420  12.234 -59.085 0.010 30.44  ? 41   HIS B HD1  1  
ATOM   4002   H HD2  . HIS B 1 41  ? -13.123 12.599 -57.955 0.010 29.13  ? 41   HIS B HD2  1  
ATOM   4003   H HE1  . HIS B 1 41  ? -9.634  14.427 -58.256 0.010 27.51  ? 41   HIS B HE1  1  
ATOM   4004   H HE2  . HIS B 1 41  ? -11.892 14.646 -57.570 0.010 26.73  ? 41   HIS B HE2  1  
ATOM   4005   N N    . CYS B 1 42  ? -8.764  10.404 -57.197 0.010 29.82  ? 42   CYS B N    1  
ATOM   4006   C CA   . CYS B 1 42  ? -7.399  10.915 -57.151 0.010 29.43  ? 42   CYS B CA   1  
ATOM   4007   C C    . CYS B 1 42  ? -6.309  9.841  -57.439 0.010 31.14  ? 42   CYS B C    1  
ATOM   4008   O O    . CYS B 1 42  ? -5.342  9.729  -56.719 0.010 30.56  ? 42   CYS B O    1  
ATOM   4009   C CB   . CYS B 1 42  ? -7.167  11.666 -55.837 0.010 27.09  ? 42   CYS B CB   1  
ATOM   4010   S SG   . CYS B 1 42  ? -8.274  13.198 -55.676 0.010 25.56  ? 42   CYS B SG   1  
ATOM   4011   H H    . CYS B 1 42  ? -9.199  10.466 -56.457 0.010 28.79  ? 42   CYS B H    1  
ATOM   4012   H HA   . CYS B 1 42  ? -7.321  11.580 -57.854 0.010 29.79  ? 42   CYS B HA   1  
ATOM   4013   H HB2  . CYS B 1 42  ? -7.361  11.076 -55.094 0.010 26.68  ? 42   CYS B HB2  1  
ATOM   4014   H HB3  . CYS B 1 42  ? -6.242  11.956 -55.797 0.010 26.98  ? 42   CYS B HB3  1  
ATOM   4015   N N    . LEU B 1 43  ? -6.460  9.085  -58.531 0.010 33.50  ? 43   LEU B N    1  
ATOM   4016   C CA   . LEU B 1 43  ? -5.414  8.166  -59.028 0.010 35.73  ? 43   LEU B CA   1  
ATOM   4017   C C    . LEU B 1 43  ? -5.558  7.991  -60.534 0.010 38.36  ? 43   LEU B C    1  
ATOM   4018   O O    . LEU B 1 43  ? -5.750  6.866  -61.061 0.010 40.57  ? 43   LEU B O    1  
ATOM   4019   C CB   . LEU B 1 43  ? -5.413  6.806  -58.308 0.010 36.32  ? 43   LEU B CB   1  
ATOM   4020   C CG   . LEU B 1 43  ? -6.699  6.319  -57.654 0.010 35.78  ? 43   LEU B CG   1  
ATOM   4021   C CD1  . LEU B 1 43  ? -6.845  6.914  -56.225 0.010 32.97  ? 43   LEU B CD1  1  
ATOM   4022   C CD2  . LEU B 1 43  ? -7.903  6.621  -58.516 0.010 36.65  ? 43   LEU B CD2  1  
ATOM   4023   H H    . LEU B 1 43  ? -7.154  9.090  -59.033 0.010 34.05  ? 43   LEU B H    1  
ATOM   4024   H HA   . LEU B 1 43  ? -4.547  8.573  -58.873 0.010 35.41  ? 43   LEU B HA   1  
ATOM   4025   H HB2  . LEU B 1 43  ? -5.132  6.118  -58.927 0.010 38.29  ? 43   LEU B HB2  1  
ATOM   4026   H HB3  . LEU B 1 43  ? -4.750  6.858  -57.606 0.010 35.37  ? 43   LEU B HB3  1  
ATOM   4027   H HG   . LEU B 1 43  ? -6.650  5.356  -57.561 0.010 36.94  ? 43   LEU B HG   1  
ATOM   4028   H HD11 . LEU B 1 43  ? -5.968  7.111  -55.865 0.010 32.40  ? 43   LEU B HD11 1  
ATOM   4029   H HD12 . LEU B 1 43  ? -7.363  7.732  -56.268 0.010 31.97  ? 43   LEU B HD12 1  
ATOM   4030   H HD13 . LEU B 1 43  ? -7.292  6.266  -55.657 0.010 33.00  ? 43   LEU B HD13 1  
ATOM   4031   H HD21 . LEU B 1 43  ? -7.635  6.657  -59.447 0.010 38.58  ? 43   LEU B HD21 1  
ATOM   4032   H HD22 . LEU B 1 43  ? -8.558  5.917  -58.392 0.010 36.54  ? 43   LEU B HD22 1  
ATOM   4033   H HD23 . LEU B 1 43  ? -8.278  7.468  -58.257 0.010 35.58  ? 43   LEU B HD23 1  
ATOM   4034   N N    . GLU B 1 44  ? -5.434  9.113  -61.234 0.010 38.43  ? 44   GLU B N    1  
ATOM   4035   C CA   . GLU B 1 44  ? -5.565  9.104  -62.690 0.010 41.10  ? 44   GLU B CA   1  
ATOM   4036   C C    . GLU B 1 44  ? -4.216  9.084  -63.441 0.010 43.27  ? 44   GLU B C    1  
ATOM   4037   O O    . GLU B 1 44  ? -4.100  8.424  -64.483 0.010 46.21  ? 44   GLU B O    1  
ATOM   4038   C CB   . GLU B 1 44  ? -6.397  10.286 -63.155 0.010 40.44  ? 44   GLU B CB   1  
ATOM   4039   C CG   . GLU B 1 44  ? -6.068  11.595 -62.493 0.010 37.90  ? 44   GLU B CG   1  
ATOM   4040   C CD   . GLU B 1 44  ? -7.023  11.967 -61.399 0.010 35.30  ? 44   GLU B CD   1  
ATOM   4041   O OE1  . GLU B 1 44  ? -6.600  11.859 -60.241 0.010 33.72  ? 44   GLU B OE1  1  
ATOM   4042   O OE2  . GLU B 1 44  ? -8.169  12.370 -61.691 0.010 35.04  ? 44   GLU B OE2  1  
ATOM   4043   H H    . GLU B 1 44  ? -5.269  9.882  -60.891 0.010 37.13  ? 44   GLU B H    1  
ATOM   4044   H HA   . GLU B 1 44  ? -6.051  8.307  -62.954 0.010 42.32  ? 44   GLU B HA   1  
ATOM   4045   H HB2  . GLU B 1 44  ? -6.182  10.407 -64.088 0.010 42.20  ? 44   GLU B HB2  1  
ATOM   4046   H HB3  . GLU B 1 44  ? -7.333  10.084 -63.042 0.010 40.31  ? 44   GLU B HB3  1  
ATOM   4047   H HG2  . GLU B 1 44  ? -5.203  11.511 -62.076 0.010 37.63  ? 44   GLU B HG2  1  
ATOM   4048   H HG3  . GLU B 1 44  ? -6.063  12.305 -63.155 0.010 38.39  ? 44   GLU B HG3  1  
ATOM   4049   N N    . ASP B 1 45  ? -3.234  9.838  -62.922 0.010 42.03  ? 45   ASP B N    1  
ATOM   4050   C CA   . ASP B 1 45  ? -1.814  9.735  -63.324 0.010 44.04  ? 45   ASP B CA   1  
ATOM   4051   C C    . ASP B 1 45  ? -1.057  8.805  -62.361 0.010 43.69  ? 45   ASP B C    1  
ATOM   4052   O O    . ASP B 1 45  ? -1.075  9.040  -61.156 0.010 41.12  ? 45   ASP B O    1  
ATOM   4053   C CB   . ASP B 1 45  ? -1.120  11.106 -63.286 0.010 43.39  ? 45   ASP B CB   1  
ATOM   4054   C CG   . ASP B 1 45  ? -2.085  12.266 -63.419 0.010 41.01  ? 45   ASP B CG   1  
ATOM   4055   O OD1  . ASP B 1 45  ? -3.192  12.167 -62.861 0.010 39.39  ? 45   ASP B OD1  1  
ATOM   4056   O OD2  . ASP B 1 45  ? -1.735  13.283 -64.060 0.010 40.95  ? 45   ASP B OD2  1  
ATOM   4057   H H    . ASP B 1 45  ? -3.370  10.432 -62.314 0.010 40.15  ? 45   ASP B H    1  
ATOM   4058   H HA   . ASP B 1 45  ? -1.749  9.378  -64.225 0.010 46.31  ? 45   ASP B HA   1  
ATOM   4059   H HB2  . ASP B 1 45  ? -0.658  11.198 -62.438 0.010 42.72  ? 45   ASP B HB2  1  
ATOM   4060   H HB3  . ASP B 1 45  ? -0.484  11.159 -64.015 0.010 45.41  ? 45   ASP B HB3  1  
ATOM   4061   N N    . ALA B 1 46  ? -0.365  7.788  -62.881 0.010 46.50  ? 46   ALA B N    1  
ATOM   4062   C CA   . ALA B 1 46  ? 0.238   6.751  -62.026 0.010 46.67  ? 46   ALA B CA   1  
ATOM   4063   C C    . ALA B 1 46  ? 1.207   5.767  -62.747 0.010 50.33  ? 46   ALA B C    1  
ATOM   4064   O O    . ALA B 1 46  ? 0.898   5.295  -63.842 0.010 52.90  ? 46   ALA B O    1  
ATOM   4065   C CB   . ALA B 1 46  ? -0.887  5.947  -61.375 0.010 45.46  ? 46   ALA B CB   1  
ATOM   4066   H H    . ALA B 1 46  ? -0.231  7.672  -63.724 0.010 48.46  ? 46   ALA B H    1  
ATOM   4067   H HA   . ALA B 1 46  ? 0.736   7.187  -61.316 0.010 45.23  ? 46   ALA B HA   1  
ATOM   4068   H HB1  . ALA B 1 46  ? -1.702  6.055  -61.889 0.010 45.59  ? 46   ALA B HB1  1  
ATOM   4069   H HB2  . ALA B 1 46  ? -0.619  5.020  -61.373 0.010 46.97  ? 46   ALA B HB2  1  
ATOM   4070   H HB3  . ALA B 1 46  ? -1.024  6.263  -60.467 0.010 43.28  ? 46   ALA B HB3  1  
ATOM   4071   N N    . ALA B 1 47  ? 2.373   5.507  -62.132 0.010 50.72  ? 47   ALA B N    1  
ATOM   4072   C CA   . ALA B 1 47  ? 3.087   4.205  -62.198 0.010 53.31  ? 47   ALA B CA   1  
ATOM   4073   C C    . ALA B 1 47  ? 4.470   4.145  -62.910 0.010 56.17  ? 47   ALA B C    1  
ATOM   4074   O O    . ALA B 1 47  ? 4.540   4.036  -64.151 0.010 59.17  ? 47   ALA B O    1  
ATOM   4075   C CB   . ALA B 1 47  ? 2.184   3.101  -62.725 0.010 55.48  ? 47   ALA B CB   1  
ATOM   4076   H H    . ALA B 1 47  ? 2.791   6.088  -61.654 0.010 49.60  ? 47   ALA B H    1  
ATOM   4077   H HA   . ALA B 1 47  ? 3.204   3.946  -61.280 0.010 51.84  ? 47   ALA B HA   1  
ATOM   4078   H HB1  . ALA B 1 47  ? 1.263   3.274  -62.492 0.010 53.83  ? 47   ALA B HB1  1  
ATOM   4079   H HB2  . ALA B 1 47  ? 2.276   3.039  -63.690 0.010 57.35  ? 47   ALA B HB2  1  
ATOM   4080   H HB3  . ALA B 1 47  ? 2.474   2.275  -62.313 0.010 56.79  ? 47   ALA B HB3  1  
ATOM   4081   N N    . ASP B 1 48  ? 5.561   4.150  -62.134 0.010 55.65  ? 48   ASP B N    1  
ATOM   4082   C CA   . ASP B 1 48  ? 5.508   4.149  -60.666 0.010 52.80  ? 48   ASP B CA   1  
ATOM   4083   C C    . ASP B 1 48  ? 4.976   5.463  -60.101 0.010 49.19  ? 48   ASP B C    1  
ATOM   4084   O O    . ASP B 1 48  ? 5.557   6.521  -60.343 0.010 48.98  ? 48   ASP B O    1  
ATOM   4085   C CB   . ASP B 1 48  ? 6.887   3.882  -60.074 0.010 54.03  ? 48   ASP B CB   1  
ATOM   4086   C CG   . ASP B 1 48  ? 6.806   3.292  -58.692 0.010 52.18  ? 48   ASP B CG   1  
ATOM   4087   O OD1  . ASP B 1 48  ? 6.867   2.051  -58.568 0.010 53.92  ? 48   ASP B OD1  1  
ATOM   4088   O OD2  . ASP B 1 48  ? 6.651   4.074  -57.735 0.010 49.18  ? 48   ASP B OD2  1  
ATOM   4089   H H    . ASP B 1 48  ? 6.363   4.150  -62.444 0.010 57.12  ? 48   ASP B H    1  
ATOM   4090   H HA   . ASP B 1 48  ? 4.937   3.427  -60.364 0.010 52.66  ? 48   ASP B HA   1  
ATOM   4091   H HB2  . ASP B 1 48  ? 7.371   3.263  -60.643 0.010 56.70  ? 48   ASP B HB2  1  
ATOM   4092   H HB3  . ASP B 1 48  ? 7.367   4.722  -60.007 0.010 53.59  ? 48   ASP B HB3  1  
ATOM   4093   N N    . GLY B 1 49  ? 3.893   5.388  -59.328 0.010 46.62  ? 49   GLY B N    1  
ATOM   4094   C CA   . GLY B 1 49  ? 3.287   6.567  -58.728 0.010 43.38  ? 49   GLY B CA   1  
ATOM   4095   C C    . GLY B 1 49  ? 3.196   6.452  -57.216 0.010 41.01  ? 49   GLY B C    1  
ATOM   4096   O O    . GLY B 1 49  ? 2.378   5.675  -56.714 0.010 40.20  ? 49   GLY B O    1  
ATOM   4097   H H    . GLY B 1 49  ? 3.488   4.654  -59.135 0.010 46.84  ? 49   GLY B H    1  
ATOM   4098   H HA2  . GLY B 1 49  ? 3.795   7.361  -58.950 0.010 43.36  ? 49   GLY B HA2  1  
ATOM   4099   H HA3  . GLY B 1 49  ? 2.387   6.668  -59.077 0.010 42.88  ? 49   GLY B HA3  1  
ATOM   4100   N N    . LYS B 1 50  ? 4.014   7.217  -56.481 0.010 40.10  ? 50   LYS B N    1  
ATOM   4101   C CA   . LYS B 1 50  ? 4.063   7.063  -55.016 0.010 38.46  ? 50   LYS B CA   1  
ATOM   4102   C C    . LYS B 1 50  ? 3.386   8.176  -54.197 0.010 35.34  ? 50   LYS B C    1  
ATOM   4103   O O    . LYS B 1 50  ? 3.625   9.398  -54.337 0.010 34.46  ? 50   LYS B O    1  
ATOM   4104   C CB   . LYS B 1 50  ? 5.487   6.786  -54.509 0.010 39.80  ? 50   LYS B CB   1  
ATOM   4105   C CG   . LYS B 1 50  ? 6.119   5.488  -55.055 0.010 42.97  ? 50   LYS B CG   1  
ATOM   4106   C CD   . LYS B 1 50  ? 5.510   4.205  -54.466 0.010 43.03  ? 50   LYS B CD   1  
ATOM   4107   C CE   . LYS B 1 50  ? 5.910   3.976  -53.018 0.010 42.09  ? 50   LYS B CE   1  
ATOM   4108   N NZ   . LYS B 1 50  ? 4.816   3.333  -52.226 0.010 40.72  ? 50   LYS B NZ   1  
ATOM   4109   H H    . LYS B 1 50  ? 4.548   7.813  -56.797 0.010 40.51  ? 50   LYS B H    1  
ATOM   4110   H HA   . LYS B 1 50  ? 3.564   6.262  -54.795 0.010 38.71  ? 50   LYS B HA   1  
ATOM   4111   H HB2  . LYS B 1 50  ? 6.056   7.526  -54.770 0.010 39.98  ? 50   LYS B HB2  1  
ATOM   4112   H HB3  . LYS B 1 50  ? 5.452   6.720  -53.543 0.010 38.58  ? 50   LYS B HB3  1  
ATOM   4113   H HG2  . LYS B 1 50  ? 5.971   5.472  -56.012 0.010 44.20  ? 50   LYS B HG2  1  
ATOM   4114   H HG3  . LYS B 1 50  ? 7.072   5.475  -54.877 0.010 43.98  ? 50   LYS B HG3  1  
ATOM   4115   H HD2  . LYS B 1 50  ? 4.542   4.247  -54.508 0.010 41.79  ? 50   LYS B HD2  1  
ATOM   4116   H HD3  . LYS B 1 50  ? 5.835   3.454  -54.987 0.010 45.21  ? 50   LYS B HD3  1  
ATOM   4117   H HE2  . LYS B 1 50  ? 6.680   3.384  -52.996 0.010 43.93  ? 50   LYS B HE2  1  
ATOM   4118   H HE3  . LYS B 1 50  ? 6.130   4.825  -52.605 0.010 40.73  ? 50   LYS B HE3  1  
ATOM   4119   H HZ1  . LYS B 1 50  ? 4.519   2.605  -52.641 0.010 42.04  ? 50   LYS B HZ1  1  
ATOM   4120   H HZ2  . LYS B 1 50  ? 5.120   3.104  -51.422 0.010 40.26  ? 50   LYS B HZ2  1  
ATOM   4121   H HZ3  . LYS B 1 50  ? 4.143   3.905  -52.127 0.010 39.17  ? 50   LYS B HZ3  1  
ATOM   4122   N N    . VAL B 1 51  ? 2.520   7.700  -53.323 0.010 33.92  ? 51   VAL B N    1  
ATOM   4123   C CA   . VAL B 1 51  ? 1.554   8.526  -52.656 0.010 31.35  ? 51   VAL B CA   1  
ATOM   4124   C C    . VAL B 1 51  ? 1.967   8.873  -51.225 0.010 30.00  ? 51   VAL B C    1  
ATOM   4125   O O    . VAL B 1 51  ? 2.559   8.077  -50.517 0.010 30.97  ? 51   VAL B O    1  
ATOM   4126   C CB   . VAL B 1 51  ? 0.191   7.805  -52.697 0.010 30.92  ? 51   VAL B CB   1  
ATOM   4127   C CG1  . VAL B 1 51  ? -0.821  8.507  -51.848 0.010 28.49  ? 51   VAL B CG1  1  
ATOM   4128   C CG2  . VAL B 1 51  ? -0.282  7.709  -54.144 0.010 32.20  ? 51   VAL B CG2  1  
ATOM   4129   H H    . VAL B 1 51  ? 2.466   6.871  -53.105 0.010 34.55  ? 51   VAL B H    1  
ATOM   4130   H HA   . VAL B 1 51  ? 1.462   9.358  -53.145 0.010 30.95  ? 51   VAL B HA   1  
ATOM   4131   H HB   . VAL B 1 51  ? 0.302   6.904  -52.356 0.010 31.70  ? 51   VAL B HB   1  
ATOM   4132   H HG11 . VAL B 1 51  ? -0.876  9.435  -52.122 0.010 27.77  ? 51   VAL B HG11 1  
ATOM   4133   H HG12 . VAL B 1 51  ? -1.680  8.075  -51.964 0.010 28.44  ? 51   VAL B HG12 1  
ATOM   4134   H HG13 . VAL B 1 51  ? -0.555  8.454  -50.921 0.010 27.91  ? 51   VAL B HG13 1  
ATOM   4135   H HG21 . VAL B 1 51  ? 0.159   8.400  -54.661 0.010 32.08  ? 51   VAL B HG21 1  
ATOM   4136   H HG22 . VAL B 1 51  ? -0.043  6.838  -54.492 0.010 33.94  ? 51   VAL B HG22 1  
ATOM   4137   H HG23 . VAL B 1 51  ? -1.242  7.833  -54.177 0.010 31.56  ? 51   VAL B HG23 1  
ATOM   4138   N N    . GLN B 1 52  ? 1.666   10.093 -50.814 0.010 27.97  ? 52   GLN B N    1  
ATOM   4139   C CA   . GLN B 1 52  ? 1.971   10.519 -49.461 0.010 26.71  ? 52   GLN B CA   1  
ATOM   4140   C C    . GLN B 1 52  ? 0.936   11.538 -48.984 0.010 24.66  ? 52   GLN B C    1  
ATOM   4141   O O    . GLN B 1 52  ? 0.169   12.046 -49.784 0.010 24.28  ? 52   GLN B O    1  
ATOM   4142   C CB   . GLN B 1 52  ? 3.362   11.121 -49.408 0.010 27.34  ? 52   GLN B CB   1  
ATOM   4143   C CG   . GLN B 1 52  ? 4.499   10.111 -49.550 0.010 29.49  ? 52   GLN B CG   1  
ATOM   4144   C CD   . GLN B 1 52  ? 5.829   10.795 -49.607 0.010 30.43  ? 52   GLN B CD   1  
ATOM   4145   O OE1  . GLN B 1 52  ? 6.552   10.860 -48.613 0.010 30.72  ? 52   GLN B OE1  1  
ATOM   4146   N NE2  . GLN B 1 52  ? 6.164   11.326 -50.779 0.010 31.22  ? 52   GLN B NE2  1  
ATOM   4147   H H    . GLN B 1 52  ? 1.284   10.692 -51.299 0.010 27.41  ? 52   GLN B H    1  
ATOM   4148   H HA   . GLN B 1 52  ? 1.943   9.760  -48.858 0.010 26.94  ? 52   GLN B HA   1  
ATOM   4149   H HB2  . GLN B 1 52  ? 3.446   11.762 -50.132 0.010 27.42  ? 52   GLN B HB2  1  
ATOM   4150   H HB3  . GLN B 1 52  ? 3.468   11.579 -48.559 0.010 26.45  ? 52   GLN B HB3  1  
ATOM   4151   H HG2  . GLN B 1 52  ? 4.492   9.506  -48.793 0.010 29.53  ? 52   GLN B HG2  1  
ATOM   4152   H HG3  . GLN B 1 52  ? 4.397   9.618  -50.378 0.010 30.54  ? 52   GLN B HG3  1  
ATOM   4153   H HE21 . GLN B 1 52  ? 5.671   11.187 -51.470 0.010 31.56  ? 52   GLN B HE21 1  
ATOM   4154   H HE22 . GLN B 1 52  ? 6.873   11.808 -50.847 0.010 31.50  ? 52   GLN B HE22 1  
ATOM   4155   N N    . VAL B 1 53  ? 0.902   11.797 -47.681 0.010 23.58  ? 53   VAL B N    1  
ATOM   4156   C CA   . VAL B 1 53  ? -0.008  12.806 -47.126 0.010 21.90  ? 53   VAL B CA   1  
ATOM   4157   C C    . VAL B 1 53  ? 0.727   13.824 -46.295 0.010 21.38  ? 53   VAL B C    1  
ATOM   4158   O O    . VAL B 1 53  ? 1.413   13.480 -45.343 0.010 21.81  ? 53   VAL B O    1  
ATOM   4159   C CB   . VAL B 1 53  ? -1.139  12.176 -46.257 0.010 21.27  ? 53   VAL B CB   1  
ATOM   4160   C CG1  . VAL B 1 53  ? -1.938  13.249 -45.529 0.010 19.83  ? 53   VAL B CG1  1  
ATOM   4161   C CG2  . VAL B 1 53  ? -2.071  11.276 -47.112 0.010 21.87  ? 53   VAL B CG2  1  
ATOM   4162   H H    . VAL B 1 53  ? 1.392   11.404 -47.096 0.010 23.94  ? 53   VAL B H    1  
ATOM   4163   H HA   . VAL B 1 53  ? -0.435  13.292 -47.845 0.010 21.67  ? 53   VAL B HA   1  
ATOM   4164   H HB   . VAL B 1 53  ? -0.732  11.617 -45.581 0.010 21.69  ? 53   VAL B HB   1  
ATOM   4165   H HG11 . VAL B 1 53  ? -1.827  14.103 -45.976 0.010 19.49  ? 53   VAL B HG11 1  
ATOM   4166   H HG12 . VAL B 1 53  ? -2.873  13.003 -45.549 0.010 19.58  ? 53   VAL B HG12 1  
ATOM   4167   H HG13 . VAL B 1 53  ? -1.632  13.301 -44.611 0.010 19.71  ? 53   VAL B HG13 1  
ATOM   4168   H HG21 . VAL B 1 53  ? -1.534  10.723 -47.702 0.010 22.93  ? 53   VAL B HG21 1  
ATOM   4169   H HG22 . VAL B 1 53  ? -2.592  10.714 -46.517 0.010 21.84  ? 53   VAL B HG22 1  
ATOM   4170   H HG23 . VAL B 1 53  ? -2.670  11.834 -47.635 0.010 21.39  ? 53   VAL B HG23 1  
ATOM   4171   N N    . LEU B 1 54  ? 0.527   15.102 -46.620 0.010 20.63  ? 54   LEU B N    1  
ATOM   4172   C CA   . LEU B 1 54  ? 1.170   16.176 -45.891 0.010 20.33  ? 54   LEU B CA   1  
ATOM   4173   C C    . LEU B 1 54  ? 0.171   16.817 -44.936 0.010 19.09  ? 54   LEU B C    1  
ATOM   4174   O O    . LEU B 1 54  ? -0.866  17.311 -45.375 0.010 18.41  ? 54   LEU B O    1  
ATOM   4175   C CB   . LEU B 1 54  ? 1.717   17.226 -46.861 0.010 20.76  ? 54   LEU B CB   1  
ATOM   4176   C CG   . LEU B 1 54  ? 2.283   18.506 -46.260 0.010 20.60  ? 54   LEU B CG   1  
ATOM   4177   C CD1  . LEU B 1 54  ? 3.510   18.254 -45.369 0.010 21.41  ? 54   LEU B CD1  1  
ATOM   4178   C CD2  . LEU B 1 54  ? 2.670   19.430 -47.389 0.010 21.25  ? 54   LEU B CD2  1  
ATOM   4179   H H    . LEU B 1 54  ? 0.017   15.369 -47.258 0.010 20.41  ? 54   LEU B H    1  
ATOM   4180   H HA   . LEU B 1 54  ? 1.911   15.827 -45.374 0.010 20.87  ? 54   LEU B HA   1  
ATOM   4181   H HB2  . LEU B 1 54  ? 2.439   16.820 -47.367 0.010 21.75  ? 54   LEU B HB2  1  
ATOM   4182   H HB3  . LEU B 1 54  ? 1.010   17.482 -47.469 0.010 20.43  ? 54   LEU B HB3  1  
ATOM   4183   H HG   . LEU B 1 54  ? 1.604   18.939 -45.725 0.010 19.76  ? 54   LEU B HG   1  
ATOM   4184   H HD11 . LEU B 1 54  ? 3.930   17.425 -45.648 0.010 22.05  ? 54   LEU B HD11 1  
ATOM   4185   H HD12 . LEU B 1 54  ? 4.133   18.985 -45.478 0.010 21.97  ? 54   LEU B HD12 1  
ATOM   4186   H HD13 . LEU B 1 54  ? 3.236   18.191 -44.441 0.010 20.90  ? 54   LEU B HD13 1  
ATOM   4187   H HD21 . LEU B 1 54  ? 1.924   19.528 -47.999 0.010 20.91  ? 54   LEU B HD21 1  
ATOM   4188   H HD22 . LEU B 1 54  ? 2.909   20.289 -47.010 0.010 21.17  ? 54   LEU B HD22 1  
ATOM   4189   H HD23 . LEU B 1 54  ? 3.429   19.056 -47.859 0.010 22.25  ? 54   LEU B HD23 1  
ATOM   4190   N N    . LEU B 1 55  ? 0.502   16.779 -43.644 0.010 19.06  ? 55   LEU B N    1  
ATOM   4191   C CA   . LEU B 1 55  ? -0.284  17.427 -42.607 0.010 18.26  ? 55   LEU B CA   1  
ATOM   4192   C C    . LEU B 1 55  ? 0.438   18.648 -42.042 0.010 18.42  ? 55   LEU B C    1  
ATOM   4193   O O    . LEU B 1 55  ? 1.659   18.761 -42.116 0.010 19.25  ? 55   LEU B O    1  
ATOM   4194   C CB   . LEU B 1 55  ? -0.608  16.449 -41.465 0.010 18.39  ? 55   LEU B CB   1  
ATOM   4195   C CG   . LEU B 1 55  ? -1.360  15.197 -41.922 0.010 18.48  ? 55   LEU B CG   1  
ATOM   4196   C CD1  . LEU B 1 55  ? -1.305  14.080 -40.804 0.010 19.25  ? 55   LEU B CD1  1  
ATOM   4197   C CD2  . LEU B 1 55  ? -2.785  15.574 -42.261 0.010 17.68  ? 55   LEU B CD2  1  
ATOM   4198   H H    . LEU B 1 55  ? 1.192   16.371 -43.341 0.010 19.64  ? 55   LEU B H    1  
ATOM   4199   H HA   . LEU B 1 55  ? -1.122  17.737 -42.981 0.010 17.72  ? 55   LEU B HA   1  
ATOM   4200   H HB2  . LEU B 1 55  ? 0.219   16.157 -41.060 0.010 19.01  ? 55   LEU B HB2  1  
ATOM   4201   H HB3  . LEU B 1 55  ? -1.144  16.895 -40.796 0.010 18.02  ? 55   LEU B HB3  1  
ATOM   4202   H HG   . LEU B 1 55  ? -0.942  14.846 -42.725 0.010 18.80  ? 55   LEU B HG   1  
ATOM   4203   H HD11 . LEU B 1 55  ? -0.565  14.254 -40.204 0.010 19.63  ? 55   LEU B HD11 1  
ATOM   4204   H HD12 . LEU B 1 55  ? -2.135  14.085 -40.304 0.010 18.99  ? 55   LEU B HD12 1  
ATOM   4205   H HD13 . LEU B 1 55  ? -1.170  13.219 -41.232 0.010 19.75  ? 55   LEU B HD13 1  
ATOM   4206   H HD21 . LEU B 1 55  ? -2.788  16.350 -42.838 0.010 17.28  ? 55   LEU B HD21 1  
ATOM   4207   H HD22 . LEU B 1 55  ? -3.213  14.830 -42.713 0.010 17.81  ? 55   LEU B HD22 1  
ATOM   4208   H HD23 . LEU B 1 55  ? -3.250  15.783 -41.439 0.010 17.60  ? 55   LEU B HD23 1  
ATOM   4209   N N    . GLY B 1 56  ? -0.363  19.546 -41.474 0.010 17.85  ? 56   GLY B N    1  
ATOM   4210   C CA   . GLY B 1 56  ? 0.111   20.693 -40.735 0.010 18.17  ? 56   GLY B CA   1  
ATOM   4211   C C    . GLY B 1 56  ? 0.622   21.794 -41.634 0.010 18.43  ? 56   GLY B C    1  
ATOM   4212   O O    . GLY B 1 56  ? 1.323   22.705 -41.173 0.010 19.08  ? 56   GLY B O    1  
ATOM   4213   H H    . GLY B 1 56  ? -1.216  19.508 -41.517 0.010 17.39  ? 56   GLY B H    1  
ATOM   4214   H HA2  . GLY B 1 56  ? -0.623  21.049 -40.213 0.010 17.86  ? 56   GLY B HA2  1  
ATOM   4215   H HA3  . GLY B 1 56  ? 0.816   20.428 -40.124 0.010 18.73  ? 56   GLY B HA3  1  
ATOM   4216   N N    . ALA B 1 57  ? 0.261   21.724 -42.911 0.010 18.15  ? 57   ALA B N    1  
ATOM   4217   C CA   . ALA B 1 57  ? 0.772   22.666 -43.906 0.010 18.65  ? 57   ALA B CA   1  
ATOM   4218   C C    . ALA B 1 57  ? -0.085  23.917 -44.132 0.010 18.34  ? 57   ALA B C    1  
ATOM   4219   O O    . ALA B 1 57  ? -1.320  23.918 -43.995 0.010 17.61  ? 57   ALA B O    1  
ATOM   4220   C CB   . ALA B 1 57  ? 0.981   21.944 -45.229 0.010 18.93  ? 57   ALA B CB   1  
ATOM   4221   H H    . ALA B 1 57  ? -0.277  21.140 -43.234 0.010 17.80  ? 57   ALA B H    1  
ATOM   4222   H HA   . ALA B 1 57  ? 1.644   22.973 -43.615 0.010 19.30  ? 57   ALA B HA   1  
ATOM   4223   H HB1  . ALA B 1 57  ? 1.499   21.140 -45.074 0.010 19.26  ? 57   ALA B HB1  1  
ATOM   4224   H HB2  . ALA B 1 57  ? 0.116   21.716 -45.604 0.010 18.41  ? 57   ALA B HB2  1  
ATOM   4225   H HB3  . ALA B 1 57  ? 1.457   22.524 -45.838 0.010 19.50  ? 57   ALA B HB3  1  
ATOM   4226   N N    . HIS B 1 58  ? 0.591   24.991 -44.498 0.010 19.12  ? 58   HIS B N    1  
ATOM   4227   C CA   . HIS B 1 58  ? -0.105  26.131 -45.078 0.010 19.16  ? 58   HIS B CA   1  
ATOM   4228   C C    . HIS B 1 58  ? 0.497   26.413 -46.443 0.010 20.01  ? 58   HIS B C    1  
ATOM   4229   O O    . HIS B 1 58  ? -0.192  26.409 -47.455 0.010 19.89  ? 58   HIS B O    1  
ATOM   4230   C CB   . HIS B 1 58  ? -0.014  27.352 -44.183 0.010 19.66  ? 58   HIS B CB   1  
ATOM   4231   C CG   . HIS B 1 58  ? -0.839  28.496 -44.680 0.010 19.84  ? 58   HIS B CG   1  
ATOM   4232   N ND1  . HIS B 1 58  ? -2.213  28.412 -44.807 0.010 19.10  ? 58   HIS B ND1  1  
ATOM   4233   C CD2  . HIS B 1 58  ? -0.494  29.730 -45.114 0.010 20.90  ? 58   HIS B CD2  1  
ATOM   4234   C CE1  . HIS B 1 58  ? -2.674  29.552 -45.290 0.010 19.67  ? 58   HIS B CE1  1  
ATOM   4235   N NE2  . HIS B 1 58  ? -1.655  30.373 -45.471 0.010 20.76  ? 58   HIS B NE2  1  
ATOM   4236   H H    . HIS B 1 58  ? 1.439   25.090 -44.420 0.010 19.75  ? 58   HIS B H    1  
ATOM   4237   H HA   . HIS B 1 58  ? -1.043  25.930 -45.205 0.010 18.54  ? 58   HIS B HA   1  
ATOM   4238   H HB2  . HIS B 1 58  ? -0.333  27.110 -43.301 0.010 19.30  ? 58   HIS B HB2  1  
ATOM   4239   H HB3  . HIS B 1 58  ? 0.906   27.644 -44.128 0.010 20.42  ? 58   HIS B HB3  1  
ATOM   4240   H HD1  . HIS B 1 58  ? -2.697  27.730 -44.608 0.010 18.48  ? 58   HIS B HD1  1  
ATOM   4241   H HD2  . HIS B 1 58  ? 0.365   30.086 -45.148 0.010 21.70  ? 58   HIS B HD2  1  
ATOM   4242   H HE1  . HIS B 1 58  ? -3.567  29.744 -45.456 0.010 19.46  ? 58   HIS B HE1  1  
ATOM   4243   H HE2  . HIS B 1 58  ? -1.708  31.172 -45.778 0.010 21.40  ? 58   HIS B HE2  1  
ATOM   4244   N N    . SER B 1 59  ? 1.800   26.670 -46.452 0.010 21.10  ? 59   SER B N    1  
ATOM   4245   C CA   . SER B 1 59  ? 2.542   26.794 -47.679 0.010 22.24  ? 59   SER B CA   1  
ATOM   4246   C C    . SER B 1 59  ? 2.986   25.408 -48.081 0.010 22.30  ? 59   SER B C    1  
ATOM   4247   O O    . SER B 1 59  ? 3.420   24.637 -47.230 0.010 22.08  ? 59   SER B O    1  
ATOM   4248   C CB   . SER B 1 59  ? 3.768   27.693 -47.486 0.010 23.70  ? 59   SER B CB   1  
ATOM   4249   O OG   . SER B 1 59  ? 4.740   27.440 -48.487 0.010 25.03  ? 59   SER B OG   1  
ATOM   4250   H H    . SER B 1 59  ? 2.277   26.775 -45.748 0.010 21.33  ? 59   SER B H    1  
ATOM   4251   H HA   . SER B 1 59  ? 1.986   27.169 -48.377 0.010 22.27  ? 59   SER B HA   1  
ATOM   4252   H HB2  . SER B 1 59  ? 3.492   28.621 -47.540 0.010 23.98  ? 59   SER B HB2  1  
ATOM   4253   H HB3  . SER B 1 59  ? 4.155   27.514 -46.617 0.010 23.65  ? 59   SER B HB3  1  
ATOM   4254   H HG   . SER B 1 59  ? 4.373   27.413 -49.251 0.010 24.96  ? 59   SER B HG   1  
ATOM   4255   N N    . LEU B 1 60  ? 2.872   25.107 -49.371 0.010 22.83  ? 60   LEU B N    1  
ATOM   4256   C CA   . LEU B 1 60  ? 3.359   23.846 -49.938 0.010 23.37  ? 60   LEU B CA   1  
ATOM   4257   C C    . LEU B 1 60  ? 4.883   23.789 -50.056 0.010 25.00  ? 60   LEU B C    1  
ATOM   4258   O O    . LEU B 1 60  ? 5.492   22.722 -49.883 0.010 25.39  ? 60   LEU B O    1  
ATOM   4259   C CB   . LEU B 1 60  ? 2.747   23.623 -51.321 0.010 23.79  ? 60   LEU B CB   1  
ATOM   4260   C CG   . LEU B 1 60  ? 1.240   23.281 -51.322 0.010 22.46  ? 60   LEU B CG   1  
ATOM   4261   C CD1  . LEU B 1 60  ? 0.748   23.160 -52.759 0.010 23.30  ? 60   LEU B CD1  1  
ATOM   4262   C CD2  . LEU B 1 60  ? 0.898   22.002 -50.523 0.010 21.52  ? 60   LEU B CD2  1  
ATOM   4263   H H    . LEU B 1 60  ? 2.507   25.626 -49.949 0.010 23.03  ? 60   LEU B H    1  
ATOM   4264   H HA   . LEU B 1 60  ? 3.091   23.120 -49.357 0.010 22.63  ? 60   LEU B HA   1  
ATOM   4265   H HB2  . LEU B 1 60  ? 2.857   24.433 -51.838 0.010 24.47  ? 60   LEU B HB2  1  
ATOM   4266   H HB3  . LEU B 1 60  ? 3.220   22.899 -51.758 0.010 24.53  ? 60   LEU B HB3  1  
ATOM   4267   H HG   . LEU B 1 60  ? 0.760   24.016 -50.911 0.010 21.86  ? 60   LEU B HG   1  
ATOM   4268   H HD11 . LEU B 1 60  ? 1.376   22.622 -53.262 0.010 24.29  ? 60   LEU B HD11 1  
ATOM   4269   H HD12 . LEU B 1 60  ? -0.124  22.735 -52.754 0.010 22.64  ? 60   LEU B HD12 1  
ATOM   4270   H HD13 . LEU B 1 60  ? 0.688   24.046 -53.150 0.010 23.68  ? 60   LEU B HD13 1  
ATOM   4271   H HD21 . LEU B 1 60  ? 1.265   22.060 -49.628 0.010 21.20  ? 60   LEU B HD21 1  
ATOM   4272   H HD22 . LEU B 1 60  ? -0.068  21.920 -50.469 0.010 20.76  ? 60   LEU B HD22 1  
ATOM   4273   H HD23 . LEU B 1 60  ? 1.263   21.231 -50.982 0.010 22.18  ? 60   LEU B HD23 1  
ATOM   4274   N N    . SER B 1 61  ? 5.469   24.940 -50.369 0.010 26.16  ? 61   SER B N    1  
ATOM   4275   C CA   . SER B 1 61  ? 6.891   25.053 -50.706 0.010 28.15  ? 61   SER B CA   1  
ATOM   4276   C C    . SER B 1 61  ? 7.762   25.345 -49.491 0.010 28.50  ? 61   SER B C    1  
ATOM   4277   O O    . SER B 1 61  ? 8.889   24.831 -49.383 0.010 29.90  ? 61   SER B O    1  
ATOM   4278   C CB   . SER B 1 61  ? 7.097   26.187 -51.719 0.010 29.55  ? 61   SER B CB   1  
ATOM   4279   O OG   . SER B 1 61  ? 6.770   27.421 -51.139 0.010 29.13  ? 61   SER B OG   1  
ATOM   4280   H H    . SER B 1 61  ? 5.052   25.690 -50.394 0.010 25.95  ? 61   SER B H    1  
ATOM   4281   H HA   . SER B 1 61  ? 7.197   24.230 -51.114 0.010 28.68  ? 61   SER B HA   1  
ATOM   4282   H HB2  . SER B 1 61  ? 8.027   26.207 -51.983 0.010 31.02  ? 61   SER B HB2  1  
ATOM   4283   H HB3  . SER B 1 61  ? 6.533   26.044 -52.497 0.010 29.46  ? 61   SER B HB3  1  
ATOM   4284   H HG   . SER B 1 61  ? 6.656   28.006 -51.743 0.010 29.75  ? 61   SER B HG   1  
ATOM   4285   N N    . GLN B 1 62  ? 7.275   26.217 -48.609 0.010 27.52  ? 62   GLN B N    1  
ATOM   4286   C CA   . GLN B 1 62  ? 8.103   26.756 -47.546 0.010 28.26  ? 62   GLN B CA   1  
ATOM   4287   C C    . GLN B 1 62  ? 8.107   25.912 -46.275 0.010 27.32  ? 62   GLN B C    1  
ATOM   4288   O O    . GLN B 1 62  ? 7.089   25.336 -45.892 0.010 25.68  ? 62   GLN B O    1  
ATOM   4289   C CB   . GLN B 1 62  ? 7.727   28.207 -47.232 0.010 28.34  ? 62   GLN B CB   1  
ATOM   4290   C CG   . GLN B 1 62  ? 8.920   29.187 -47.348 0.010 30.56  ? 62   GLN B CG   1  
ATOM   4291   C CD   . GLN B 1 62  ? 8.940   30.223 -46.217 0.010 31.02  ? 62   GLN B CD   1  
ATOM   4292   O OE1  . GLN B 1 62  ? 7.872   30.668 -45.739 0.010 29.86  ? 62   GLN B OE1  1  
ATOM   4293   N NE2  . GLN B 1 62  ? 10.136  30.604 -45.783 0.010 32.98  ? 62   GLN B NE2  1  
ATOM   4294   H H    . GLN B 1 62  ? 6.471   26.515 -48.609 0.010 26.55  ? 62   GLN B H    1  
ATOM   4295   H HA   . GLN B 1 62  ? 9.013   26.770 -47.881 0.010 29.65  ? 62   GLN B HA   1  
ATOM   4296   H HB2  . GLN B 1 62  ? 7.051   28.500 -47.860 0.010 27.96  ? 62   GLN B HB2  1  
ATOM   4297   H HB3  . GLN B 1 62  ? 7.375   28.252 -46.332 0.010 27.57  ? 62   GLN B HB3  1  
ATOM   4298   H HG2  . GLN B 1 62  ? 9.759   28.713 -47.339 0.010 31.45  ? 62   GLN B HG2  1  
ATOM   4299   H HG3  . GLN B 1 62  ? 8.854   29.645 -48.193 0.010 31.11  ? 62   GLN B HG3  1  
ATOM   4300   H HE21 . GLN B 1 62  ? 10.841  30.412 -46.236 0.010 34.09  ? 62   GLN B HE21 1  
ATOM   4301   H HE22 . GLN B 1 62  ? 10.206  31.045 -45.050 0.010 33.26  ? 62   GLN B HE22 1  
ATOM   4302   N N    . PRO B 1 63  ? 9.262   25.854 -45.603 0.010 28.58  ? 63   PRO B N    1  
ATOM   4303   C CA   . PRO B 1 63  ? 9.285   25.001 -44.417 0.010 28.02  ? 63   PRO B CA   1  
ATOM   4304   C C    . PRO B 1 63  ? 8.434   25.537 -43.286 0.010 26.94  ? 63   PRO B C    1  
ATOM   4305   O O    . PRO B 1 63  ? 8.478   26.736 -42.994 0.010 27.45  ? 63   PRO B O    1  
ATOM   4306   C CB   . PRO B 1 63  ? 10.761  25.028 -44.008 0.010 30.06  ? 63   PRO B CB   1  
ATOM   4307   C CG   . PRO B 1 63  ? 11.241  26.353 -44.488 0.010 31.38  ? 63   PRO B CG   1  
ATOM   4308   C CD   . PRO B 1 63  ? 10.543  26.563 -45.792 0.010 30.76  ? 63   PRO B CD   1  
ATOM   4309   H HA   . PRO B 1 63  ? 9.008   24.100 -44.637 0.010 27.44  ? 63   PRO B HA   1  
ATOM   4310   H HB2  . PRO B 1 63  ? 10.845  24.965 -43.045 0.010 30.04  ? 63   PRO B HB2  1  
ATOM   4311   H HB3  . PRO B 1 63  ? 11.237  24.307 -44.447 0.010 30.65  ? 63   PRO B HB3  1  
ATOM   4312   H HG2  . PRO B 1 63  ? 11.000  27.043 -43.851 0.010 31.20  ? 63   PRO B HG2  1  
ATOM   4313   H HG3  . PRO B 1 63  ? 12.202  26.323 -44.618 0.010 32.90  ? 63   PRO B HG3  1  
ATOM   4314   H HD2  . PRO B 1 63  ? 10.403  27.510 -45.909 0.010 31.04  ? 63   PRO B HD2  1  
ATOM   4315   H HD3  . PRO B 1 63  ? 11.050  26.175 -46.521 0.010 31.63  ? 63   PRO B HD3  1  
ATOM   4316   N N    . GLU B 1 64  ? 7.671   24.648 -42.648 0.010 25.73  ? 64   GLU B N    1  
ATOM   4317   C CA   . GLU B 1 64  ? 6.895   25.019 -41.473 0.010 24.75  ? 64   GLU B CA   1  
ATOM   4318   C C    . GLU B 1 64  ? 7.091   24.003 -40.371 0.010 24.77  ? 64   GLU B C    1  
ATOM   4319   O O    . GLU B 1 64  ? 7.109   22.803 -40.633 0.010 24.49  ? 64   GLU B O    1  
ATOM   4320   C CB   . GLU B 1 64  ? 5.401   25.132 -41.821 0.010 23.14  ? 64   GLU B CB   1  
ATOM   4321   C CG   . GLU B 1 64  ? 5.117   26.156 -42.936 0.010 23.20  ? 64   GLU B CG   1  
ATOM   4322   C CD   . GLU B 1 64  ? 3.700   26.106 -43.513 0.010 21.91  ? 64   GLU B CD   1  
ATOM   4323   O OE1  . GLU B 1 64  ? 3.015   25.078 -43.364 0.010 20.91  ? 64   GLU B OE1  1  
ATOM   4324   O OE2  . GLU B 1 64  ? 3.272   27.112 -44.118 0.010 22.08  ? 64   GLU B OE2  1  
ATOM   4325   H H    . GLU B 1 64  ? 7.583   23.827 -42.887 0.010 25.57  ? 64   GLU B H    1  
ATOM   4326   H HA   . GLU B 1 64  ? 7.197   25.881 -41.158 0.010 25.33  ? 64   GLU B HA   1  
ATOM   4327   H HB2  . GLU B 1 64  ? 5.073   24.266 -42.108 0.010 22.88  ? 64   GLU B HB2  1  
ATOM   4328   H HB3  . GLU B 1 64  ? 4.924   25.412 -41.032 0.010 22.50  ? 64   GLU B HB3  1  
ATOM   4329   H HG2  . GLU B 1 64  ? 5.247   27.040 -42.564 0.010 23.45  ? 64   GLU B HG2  1  
ATOM   4330   H HG3  . GLU B 1 64  ? 5.735   26.015 -43.669 0.010 24.05  ? 64   GLU B HG3  1  
ATOM   4331   N N    . PRO B 1 65  ? 7.210   24.479 -39.128 0.010 25.31  ? 65   PRO B N    1  
ATOM   4332   C CA   . PRO B 1 65  ? 7.498   23.541 -38.043 0.010 25.68  ? 65   PRO B CA   1  
ATOM   4333   C C    . PRO B 1 65  ? 6.382   22.502 -37.847 0.010 24.30  ? 65   PRO B C    1  
ATOM   4334   O O    . PRO B 1 65  ? 6.678   21.436 -37.374 0.010 24.71  ? 65   PRO B O    1  
ATOM   4335   C CB   . PRO B 1 65  ? 7.638   24.443 -36.816 0.010 26.67  ? 65   PRO B CB   1  
ATOM   4336   C CG   . PRO B 1 65  ? 6.940   25.701 -37.163 0.010 26.32  ? 65   PRO B CG   1  
ATOM   4337   C CD   . PRO B 1 65  ? 7.001   25.853 -38.644 0.010 25.94  ? 65   PRO B CD   1  
ATOM   4338   H HA   . PRO B 1 65  ? 8.338   23.084 -38.201 0.010 26.49  ? 65   PRO B HA   1  
ATOM   4339   H HB2  . PRO B 1 65  ? 7.221   24.019 -36.050 0.010 26.41  ? 65   PRO B HB2  1  
ATOM   4340   H HB3  . PRO B 1 65  ? 8.576   24.609 -36.645 0.010 27.91  ? 65   PRO B HB3  1  
ATOM   4341   H HG2  . PRO B 1 65  ? 6.020   25.663 -36.858 0.010 25.45  ? 65   PRO B HG2  1  
ATOM   4342   H HG3  . PRO B 1 65  ? 7.405   26.440 -36.739 0.010 27.42  ? 65   PRO B HG3  1  
ATOM   4343   H HD2  . PRO B 1 65  ? 6.167   26.212 -38.976 0.010 25.20  ? 65   PRO B HD2  1  
ATOM   4344   H HD3  . PRO B 1 65  ? 7.749   26.417 -38.900 0.010 27.05  ? 65   PRO B HD3  1  
ATOM   4345   N N    . SER B 1 66  ? 5.145   22.811 -38.212 0.010 22.94  ? 66   SER B N    1  
ATOM   4346   C CA   . SER B 1 66  ? 4.057   21.839 -38.116 0.010 21.84  ? 66   SER B CA   1  
ATOM   4347   C C    . SER B 1 66  ? 3.985   20.870 -39.293 0.010 21.36  ? 66   SER B C    1  
ATOM   4348   O O    . SER B 1 66  ? 3.283   19.850 -39.203 0.010 20.80  ? 66   SER B O    1  
ATOM   4349   C CB   . SER B 1 66  ? 2.700   22.546 -37.955 0.010 20.88  ? 66   SER B CB   1  
ATOM   4350   O OG   . SER B 1 66  ? 2.576   23.647 -38.842 0.010 20.72  ? 66   SER B OG   1  
ATOM   4351   H H    . SER B 1 66  ? 4.909   23.579 -38.515 0.010 22.75  ? 66   SER B H    1  
ATOM   4352   H HA   . SER B 1 66  ? 4.189   21.303 -37.320 0.010 22.24  ? 66   SER B HA   1  
ATOM   4353   H HB2  . SER B 1 66  ? 2.000   21.907 -38.150 0.010 20.18  ? 66   SER B HB2  1  
ATOM   4354   H HB3  . SER B 1 66  ? 2.616   22.857 -37.041 0.010 21.27  ? 66   SER B HB3  1  
ATOM   4355   H HG   . SER B 1 66  ? 2.872   23.438 -39.611 0.010 20.80  ? 66   SER B HG   1  
ATOM   4356   N N    . LYS B 1 67  ? 4.690   21.142 -40.394 0.010 21.81  ? 67   LYS B N    1  
ATOM   4357   C CA   . LYS B 1 67  ? 4.539   20.280 -41.564 0.010 21.59  ? 67   LYS B CA   1  
ATOM   4358   C C    . LYS B 1 67  ? 5.119   18.889 -41.317 0.010 22.35  ? 67   LYS B C    1  
ATOM   4359   O O    . LYS B 1 67  ? 6.231   18.741 -40.793 0.010 23.59  ? 67   LYS B O    1  
ATOM   4360   C CB   . LYS B 1 67  ? 5.136   20.900 -42.835 0.010 22.14  ? 67   LYS B CB   1  
ATOM   4361   C CG   . LYS B 1 67  ? 4.070   21.574 -43.722 0.010 21.19  ? 67   LYS B CG   1  
ATOM   4362   C CD   . LYS B 1 67  ? 4.612   21.815 -45.137 0.010 21.65  ? 67   LYS B CD   1  
ATOM   4363   C CE   . LYS B 1 67  ? 5.612   22.926 -45.095 0.010 23.08  ? 67   LYS B CE   1  
ATOM   4364   N NZ   . LYS B 1 67  ? 5.927   23.422 -46.472 0.010 23.75  ? 67   LYS B NZ   1  
ATOM   4365   H H    . LYS B 1 67  ? 5.243   21.791 -40.488 0.010 22.36  ? 67   LYS B H    1  
ATOM   4366   H HA   . LYS B 1 67  ? 3.594   20.170 -41.734 0.010 20.73  ? 67   LYS B HA   1  
ATOM   4367   H HB2  . LYS B 1 67  ? 5.785   21.573 -42.582 0.010 22.96  ? 67   LYS B HB2  1  
ATOM   4368   H HB3  . LYS B 1 67  ? 5.566   20.206 -43.358 0.010 22.47  ? 67   LYS B HB3  1  
ATOM   4369   H HG2  . LYS B 1 67  ? 3.289   21.005 -43.785 0.010 20.36  ? 67   LYS B HG2  1  
ATOM   4370   H HG3  . LYS B 1 67  ? 3.833   22.426 -43.327 0.010 21.27  ? 67   LYS B HG3  1  
ATOM   4371   H HD2  . LYS B 1 67  ? 5.058   21.016 -45.456 0.010 21.81  ? 67   LYS B HD2  1  
ATOM   4372   H HD3  . LYS B 1 67  ? 3.893   22.057 -45.741 0.010 21.08  ? 67   LYS B HD3  1  
ATOM   4373   H HE2  . LYS B 1 67  ? 5.254   23.658 -44.567 0.010 23.07  ? 67   LYS B HE2  1  
ATOM   4374   H HE3  . LYS B 1 67  ? 6.433   22.598 -44.695 0.010 23.82  ? 67   LYS B HE3  1  
ATOM   4375   H HZ1  . LYS B 1 67  ? 5.588   22.871 -47.081 0.010 23.24  ? 67   LYS B HZ1  1  
ATOM   4376   H HZ2  . LYS B 1 67  ? 5.578   24.233 -46.587 0.010 23.82  ? 67   LYS B HZ2  1  
ATOM   4377   H HZ3  . LYS B 1 67  ? 6.808   23.470 -46.580 0.010 24.77  ? 67   LYS B HZ3  1  
ATOM   4378   N N    . ARG B 1 68  ? 4.353   17.874 -41.681 0.010 21.77  ? 68   ARG B N    1  
ATOM   4379   C CA   . ARG B 1 68  ? 4.805   16.490 -41.508 0.010 22.65  ? 68   ARG B CA   1  
ATOM   4380   C C    . ARG B 1 68  ? 4.238   15.637 -42.626 0.010 22.43  ? 68   ARG B C    1  
ATOM   4381   O O    . ARG B 1 68  ? 3.018   15.556 -42.821 0.010 21.35  ? 68   ARG B O    1  
ATOM   4382   C CB   . ARG B 1 68  ? 4.397   15.962 -40.119 0.010 22.66  ? 68   ARG B CB   1  
ATOM   4383   C CG   . ARG B 1 68  ? 5.112   14.736 -39.607 0.010 24.14  ? 68   ARG B CG   1  
ATOM   4384   C CD   . ARG B 1 68  ? 5.061   14.664 -38.082 0.010 24.50  ? 68   ARG B CD   1  
ATOM   4385   N NE   . ARG B 1 68  ? 6.374   14.826 -37.450 0.010 25.97  ? 68   ARG B NE   1  
ATOM   4386   C CZ   . ARG B 1 68  ? 6.612   14.684 -36.147 0.010 26.62  ? 68   ARG B CZ   1  
ATOM   4387   N NH1  . ARG B 1 68  ? 5.619   14.443 -35.314 0.010 25.96  ? 68   ARG B NH1  1  
ATOM   4388   N NH2  . ARG B 1 68  ? 7.852   14.799 -35.678 0.010 28.16  ? 68   ARG B NH2  1  
ATOM   4389   H H    . ARG B 1 68  ? 3.577   17.954 -42.039 0.010 20.99  ? 68   ARG B H    1  
ATOM   4390   H HA   . ARG B 1 68  ? 5.772   16.452 -41.575 0.010 23.64  ? 68   ARG B HA   1  
ATOM   4391   H HB2  . ARG B 1 68  ? 4.550   16.664 -39.470 0.010 22.54  ? 68   ARG B HB2  1  
ATOM   4392   H HB3  . ARG B 1 68  ? 3.457   15.744 -40.142 0.010 22.01  ? 68   ARG B HB3  1  
ATOM   4393   H HG2  . ARG B 1 68  ? 4.688   13.942 -39.968 0.010 24.27  ? 68   ARG B HG2  1  
ATOM   4394   H HG3  . ARG B 1 68  ? 6.040   14.771 -39.885 0.010 24.95  ? 68   ARG B HG3  1  
ATOM   4395   H HD2  . ARG B 1 68  ? 4.453   15.345 -37.731 0.010 23.72  ? 68   ARG B HD2  1  
ATOM   4396   H HD3  . ARG B 1 68  ? 4.770   13.727 -37.856 0.010 24.71  ? 68   ARG B HD3  1  
ATOM   4397   H HE   . ARG B 1 68  ? 7.056   14.739 -37.966 0.010 26.66  ? 68   ARG B HE   1  
ATOM   4398   H HH11 . ARG B 1 68  ? 4.818   14.349 -35.613 0.010 25.07  ? 68   ARG B HH11 1  
ATOM   4399   H HH12 . ARG B 1 68  ? 5.776   14.359 -34.474 0.010 26.53  ? 68   ARG B HH12 1  
ATOM   4400   H HH21 . ARG B 1 68  ? 8.503   14.966 -36.214 0.010 28.73  ? 68   ARG B HH21 1  
ATOM   4401   H HH22 . ARG B 1 68  ? 7.999   14.733 -34.834 0.010 28.70  ? 68   ARG B HH22 1  
ATOM   4402   N N    . LEU B 1 69  ? 5.135   14.966 -43.335 0.010 23.71  ? 69   LEU B N    1  
ATOM   4403   C CA   . LEU B 1 69  ? 4.774   14.151 -44.469 0.010 24.00  ? 69   LEU B CA   1  
ATOM   4404   C C    . LEU B 1 69  ? 4.711   12.700 -44.043 0.010 24.75  ? 69   LEU B C    1  
ATOM   4405   O O    . LEU B 1 69  ? 5.698   12.146 -43.554 0.010 26.02  ? 69   LEU B O    1  
ATOM   4406   C CB   . LEU B 1 69  ? 5.803   14.346 -45.570 0.010 25.31  ? 69   LEU B CB   1  
ATOM   4407   C CG   . LEU B 1 69  ? 5.461   13.762 -46.941 0.010 25.95  ? 69   LEU B CG   1  
ATOM   4408   C CD1  . LEU B 1 69  ? 4.147   14.331 -47.450 0.010 24.55  ? 69   LEU B CD1  1  
ATOM   4409   C CD2  . LEU B 1 69  ? 6.573   14.033 -47.927 0.010 27.63  ? 69   LEU B CD2  1  
ATOM   4410   H H    . LEU B 1 69  ? 5.976   14.963 -43.165 0.010 24.59  ? 69   LEU B H    1  
ATOM   4411   H HA   . LEU B 1 69  ? 3.903   14.412 -44.797 0.010 23.08  ? 69   LEU B HA   1  
ATOM   4412   H HB2  . LEU B 1 69  ? 5.941   15.300 -45.689 0.010 24.97  ? 69   LEU B HB2  1  
ATOM   4413   H HB3  . LEU B 1 69  ? 6.633   13.937 -45.279 0.010 26.38  ? 69   LEU B HB3  1  
ATOM   4414   H HG   . LEU B 1 69  ? 5.369   12.800 -46.857 0.010 26.46  ? 69   LEU B HG   1  
ATOM   4415   H HD11 . LEU B 1 69  ? 4.233   15.292 -47.523 0.010 24.25  ? 69   LEU B HD11 1  
ATOM   4416   H HD12 . LEU B 1 69  ? 3.959   13.951 -48.321 0.010 25.10  ? 69   LEU B HD12 1  
ATOM   4417   H HD13 . LEU B 1 69  ? 3.432   14.108 -46.838 0.010 23.60  ? 69   LEU B HD13 1  
ATOM   4418   H HD21 . LEU B 1 69  ? 7.422   13.803 -47.519 0.010 28.54  ? 69   LEU B HD21 1  
ATOM   4419   H HD22 . LEU B 1 69  ? 6.430   13.496 -48.720 0.010 28.36  ? 69   LEU B HD22 1  
ATOM   4420   H HD23 . LEU B 1 69  ? 6.562   14.976 -48.155 0.010 27.22  ? 69   LEU B HD23 1  
ATOM   4421   N N    . TYR B 1 70  ? 3.537   12.108 -44.210 0.010 24.11  ? 70   TYR B N    1  
ATOM   4422   C CA   . TYR B 1 70  ? 3.320   10.718 -43.841 0.010 24.93  ? 70   TYR B CA   1  
ATOM   4423   C C    . TYR B 1 70  ? 3.262   9.820  -45.071 0.010 26.05  ? 70   TYR B C    1  
ATOM   4424   O O    . TYR B 1 70  ? 2.697   10.199 -46.082 0.010 25.59  ? 70   TYR B O    1  
ATOM   4425   C CB   . TYR B 1 70  ? 2.045   10.602 -43.025 0.010 23.81  ? 70   TYR B CB   1  
ATOM   4426   C CG   . TYR B 1 70  ? 2.124   11.322 -41.705 0.010 23.13  ? 70   TYR B CG   1  
ATOM   4427   C CD1  . TYR B 1 70  ? 1.984   12.711 -41.624 0.010 22.01  ? 70   TYR B CD1  1  
ATOM   4428   C CD2  . TYR B 1 70  ? 2.307   10.618 -40.527 0.010 23.83  ? 70   TYR B CD2  1  
ATOM   4429   C CE1  . TYR B 1 70  ? 2.065   13.369 -40.409 0.010 21.69  ? 70   TYR B CE1  1  
ATOM   4430   C CE2  . TYR B 1 70  ? 2.389   11.268 -39.306 0.010 23.49  ? 70   TYR B CE2  1  
ATOM   4431   C CZ   . TYR B 1 70  ? 2.258   12.640 -39.243 0.010 22.44  ? 70   TYR B CZ   1  
ATOM   4432   O OH   . TYR B 1 70  ? 2.359   13.268 -38.009 0.010 22.41  ? 70   TYR B OH   1  
ATOM   4433   H H    . TYR B 1 70  ? 2.842   12.494 -44.538 0.010 23.32  ? 70   TYR B H    1  
ATOM   4434   H HA   . TYR B 1 70  ? 4.051   10.412 -43.282 0.010 25.74  ? 70   TYR B HA   1  
ATOM   4435   H HB2  . TYR B 1 70  ? 1.309   10.983 -43.527 0.010 23.04  ? 70   TYR B HB2  1  
ATOM   4436   H HB3  . TYR B 1 70  ? 1.871   9.666  -42.852 0.010 24.50  ? 70   TYR B HB3  1  
ATOM   4437   H HD1  . TYR B 1 70  ? 1.861   13.204 -42.400 0.010 21.65  ? 70   TYR B HD1  1  
ATOM   4438   H HD2  . TYR B 1 70  ? 2.395   9.696  -40.560 0.010 24.69  ? 70   TYR B HD2  1  
ATOM   4439   H HE1  . TYR B 1 70  ? 1.985   14.293 -40.372 0.010 21.11  ? 70   TYR B HE1  1  
ATOM   4440   H HE2  . TYR B 1 70  ? 2.521   10.782 -38.526 0.010 24.12  ? 70   TYR B HE2  1  
ATOM   4441   H HH   . TYR B 1 70  ? 2.906   12.852 -37.511 0.010 23.23  ? 70   TYR B HH   1  
ATOM   4442   N N    . ASP B 1 71  ? 3.883   8.640  -44.985 0.010 27.76  ? 71   ASP B N    1  
ATOM   4443   C CA   . ASP B 1 71  ? 3.677   7.589  -45.994 0.010 29.11  ? 71   ASP B CA   1  
ATOM   4444   C C    . ASP B 1 71  ? 2.290   6.982  -45.788 0.010 28.38  ? 71   ASP B C    1  
ATOM   4445   O O    . ASP B 1 71  ? 1.746   7.057  -44.700 0.010 27.30  ? 71   ASP B O    1  
ATOM   4446   C CB   . ASP B 1 71  ? 4.714   6.464  -45.868 0.010 31.36  ? 71   ASP B CB   1  
ATOM   4447   C CG   . ASP B 1 71  ? 6.081   6.826  -46.473 0.010 32.81  ? 71   ASP B CG   1  
ATOM   4448   O OD1  . ASP B 1 71  ? 6.701   7.819  -46.042 0.010 32.10  ? 71   ASP B OD1  1  
ATOM   4449   O OD2  . ASP B 1 71  ? 6.552   6.095  -47.376 0.010 34.95  ? 71   ASP B OD2  1  
ATOM   4450   H H    . ASP B 1 71  ? 4.430   8.425  -44.358 0.010 28.31  ? 71   ASP B H    1  
ATOM   4451   H HA   . ASP B 1 71  ? 3.731   7.967  -46.887 0.010 29.26  ? 71   ASP B HA   1  
ATOM   4452   H HB2  . ASP B 1 71  ? 4.841   6.264  -44.930 0.010 31.25  ? 71   ASP B HB2  1  
ATOM   4453   H HB3  . ASP B 1 71  ? 4.375   5.682  -46.330 0.010 32.19  ? 71   ASP B HB3  1  
ATOM   4454   N N    . VAL B 1 72  ? 1.746   6.371  -46.835 0.010 29.27  ? 72   VAL B N    1  
ATOM   4455   C CA   . VAL B 1 72  ? 0.431   5.752  -46.789 0.010 28.98  ? 72   VAL B CA   1  
ATOM   4456   C C    . VAL B 1 72  ? 0.565   4.234  -46.627 0.010 31.01  ? 72   VAL B C    1  
ATOM   4457   O O    . VAL B 1 72  ? 1.362   3.606  -47.304 0.010 32.89  ? 72   VAL B O    1  
ATOM   4458   C CB   . VAL B 1 72  ? -0.363  6.091  -48.065 0.010 28.67  ? 72   VAL B CB   1  
ATOM   4459   C CG1  . VAL B 1 72  ? -1.736  5.451  -48.032 0.010 28.74  ? 72   VAL B CG1  1  
ATOM   4460   C CG2  . VAL B 1 72  ? -0.491  7.613  -48.198 0.010 26.77  ? 72   VAL B CG2  1  
ATOM   4461   H H    . VAL B 1 72  ? 2.127   6.301  -47.601 0.010 30.22  ? 72   VAL B H    1  
ATOM   4462   H HA   . VAL B 1 72  ? -0.066  6.092  -46.030 0.010 27.85  ? 72   VAL B HA   1  
ATOM   4463   H HB   . VAL B 1 72  ? 0.116   5.747  -48.836 0.010 29.89  ? 72   VAL B HB   1  
ATOM   4464   H HG11 . VAL B 1 72  ? -2.049  5.429  -47.115 0.010 28.08  ? 72   VAL B HG11 1  
ATOM   4465   H HG12 . VAL B 1 72  ? -2.344  5.981  -48.573 0.010 28.12  ? 72   VAL B HG12 1  
ATOM   4466   H HG13 . VAL B 1 72  ? -1.675  4.550  -48.386 0.010 30.24  ? 72   VAL B HG13 1  
ATOM   4467   H HG21 . VAL B 1 72  ? 0.391   7.999  -48.322 0.010 26.93  ? 72   VAL B HG21 1  
ATOM   4468   H HG22 . VAL B 1 72  ? -1.054  7.821  -48.957 0.010 26.69  ? 72   VAL B HG22 1  
ATOM   4469   H HG23 . VAL B 1 72  ? -0.895  7.964  -47.388 0.010 25.70  ? 72   VAL B HG23 1  
ATOM   4470   N N    . LEU B 1 73  ? -0.212  3.680  -45.701 0.010 30.81  ? 73   LEU B N    1  
ATOM   4471   C CA   . LEU B 1 73  ? -0.184  2.270  -45.330 0.010 32.78  ? 73   LEU B CA   1  
ATOM   4472   C C    . LEU B 1 73  ? -1.142  1.453  -46.167 0.010 33.87  ? 73   LEU B C    1  
ATOM   4473   O O    . LEU B 1 73  ? -0.867  0.301  -46.510 0.010 36.13  ? 73   LEU B O    1  
ATOM   4474   C CB   . LEU B 1 73  ? -0.604  2.124  -43.864 0.010 32.25  ? 73   LEU B CB   1  
ATOM   4475   C CG   . LEU B 1 73  ? 0.288   1.298  -42.949 0.010 33.80  ? 73   LEU B CG   1  
ATOM   4476   C CD1  . LEU B 1 73  ? 1.627   1.938  -42.913 0.010 33.77  ? 73   LEU B CD1  1  
ATOM   4477   C CD2  . LEU B 1 73  ? -0.290  1.207  -41.538 0.010 33.24  ? 73   LEU B CD2  1  
ATOM   4478   H H    . LEU B 1 73  ? -0.788  4.125  -45.250 0.010 29.65  ? 73   LEU B H    1  
ATOM   4479   H HA   . LEU B 1 73  ? 0.711   1.914  -45.441 0.010 33.98  ? 73   LEU B HA   1  
ATOM   4480   H HB2  . LEU B 1 73  ? -0.654  3.009  -43.472 0.010 30.76  ? 73   LEU B HB2  1  
ATOM   4481   H HB3  . LEU B 1 73  ? -1.484  1.718  -43.845 0.010 32.48  ? 73   LEU B HB3  1  
ATOM   4482   H HG   . LEU B 1 73  ? 0.377   0.402  -43.309 0.010 35.42  ? 73   LEU B HG   1  
ATOM   4483   H HD11 . LEU B 1 73  ? 1.607   2.732  -43.469 0.010 32.61  ? 73   LEU B HD11 1  
ATOM   4484   H HD12 . LEU B 1 73  ? 1.836   2.178  -41.997 0.010 33.53  ? 73   LEU B HD12 1  
ATOM   4485   H HD13 . LEU B 1 73  ? 2.285   1.310  -43.255 0.010 35.33  ? 73   LEU B HD13 1  
ATOM   4486   H HD21 . LEU B 1 73  ? -0.616  2.080  -41.273 0.010 31.67  ? 73   LEU B HD21 1  
ATOM   4487   H HD22 . LEU B 1 73  ? -1.019  0.567  -41.541 0.010 33.82  ? 73   LEU B HD22 1  
ATOM   4488   H HD23 . LEU B 1 73  ? 0.402   0.917  -40.926 0.010 34.05  ? 73   LEU B HD23 1  
ATOM   4489   N N    . ARG B 1 74  ? -2.299  2.032  -46.447 0.010 32.48  ? 74   ARG B N    1  
ATOM   4490   C CA   . ARG B 1 74  ? -3.295  1.379  -47.270 0.010 33.56  ? 74   ARG B CA   1  
ATOM   4491   C C    . ARG B 1 74  ? -4.174  2.478  -47.869 0.010 31.87  ? 74   ARG B C    1  
ATOM   4492   O O    . ARG B 1 74  ? -4.487  3.486  -47.206 0.010 29.87  ? 74   ARG B O    1  
ATOM   4493   C CB   . ARG B 1 74  ? -4.137  0.378  -46.461 0.010 34.56  ? 74   ARG B CB   1  
ATOM   4494   C CG   . ARG B 1 74  ? -4.512  -0.944 -47.217 0.010 37.26  ? 74   ARG B CG   1  
ATOM   4495   C CD   . ARG B 1 74  ? -4.973  -0.687 -48.671 0.010 37.60  ? 74   ARG B CD   1  
ATOM   4496   N NE   . ARG B 1 74  ? -5.010  -1.899 -49.486 0.010 40.48  ? 74   ARG B NE   1  
ATOM   4497   C CZ   . ARG B 1 74  ? -4.774  -1.918 -50.801 0.010 41.65  ? 74   ARG B CZ   1  
ATOM   4498   N NH1  . ARG B 1 74  ? -4.521  -0.792 -51.456 0.010 40.14  ? 74   ARG B NH1  1  
ATOM   4499   N NH2  . ARG B 1 74  ? -4.806  -3.058 -51.476 0.010 44.57  ? 74   ARG B NH2  1  
ATOM   4500   H H    . ARG B 1 74  ? -2.532  2.814  -46.172 0.010 31.03  ? 74   ARG B H    1  
ATOM   4501   H HA   . ARG B 1 74  ? -2.846  0.902  -47.985 0.010 34.96  ? 74   ARG B HA   1  
ATOM   4502   H HB2  . ARG B 1 74  ? -3.639  0.130  -45.668 0.010 34.72  ? 74   ARG B HB2  1  
ATOM   4503   H HB3  . ARG B 1 74  ? -4.964  0.814  -46.202 0.010 33.52  ? 74   ARG B HB3  1  
ATOM   4504   H HG2  . ARG B 1 74  ? -3.735  -1.524 -47.250 0.010 38.55  ? 74   ARG B HG2  1  
ATOM   4505   H HG3  . ARG B 1 74  ? -5.236  -1.392 -46.748 0.010 37.72  ? 74   ARG B HG3  1  
ATOM   4506   H HD2  . ARG B 1 74  ? -5.857  -0.286 -48.670 0.010 36.72  ? 74   ARG B HD2  1  
ATOM   4507   H HD3  . ARG B 1 74  ? -4.336  -0.105 -49.094 0.010 36.97  ? 74   ARG B HD3  1  
ATOM   4508   H HE   . ARG B 1 74  ? -5.520  -2.522 -49.189 0.010 41.36  ? 74   ARG B HE   1  
ATOM   4509   H HH11 . ARG B 1 74  ? -4.492  -0.041 -51.039 0.010 38.37  ? 74   ARG B HH11 1  
ATOM   4510   H HH12 . ARG B 1 74  ? -4.376  -0.814 -52.304 0.010 41.05  ? 74   ARG B HH12 1  
ATOM   4511   H HH21 . ARG B 1 74  ? -4.977  -3.799 -51.080 0.010 45.70  ? 74   ARG B HH21 1  
ATOM   4512   H HH22 . ARG B 1 74  ? -4.665  -3.053 -52.323 0.010 45.45  ? 74   ARG B HH22 1  
ATOM   4513   N N    . ALA B 1 75  ? -4.506  2.306  -49.142 0.010 32.89  ? 75   ALA B N    1  
ATOM   4514   C CA   . ALA B 1 75  ? -5.415  3.197  -49.845 0.010 31.79  ? 75   ALA B CA   1  
ATOM   4515   C C    . ALA B 1 75  ? -6.718  2.445  -50.096 0.010 32.85  ? 75   ALA B C    1  
ATOM   4516   O O    . ALA B 1 75  ? -6.713  1.330  -50.653 0.010 35.13  ? 75   ALA B O    1  
ATOM   4517   C CB   . ALA B 1 75  ? -4.777  3.659  -51.132 0.010 32.41  ? 75   ALA B CB   1  
ATOM   4518   H H    . ALA B 1 75  ? -4.194  1.683  -49.642 0.010 34.38  ? 75   ALA B H    1  
ATOM   4519   H HA   . ALA B 1 75  ? -5.610  3.979  -49.306 0.010 30.17  ? 75   ALA B HA   1  
ATOM   4520   H HB1  . ALA B 1 75  ? -3.868  3.938  -50.946 0.010 32.18  ? 75   ALA B HB1  1  
ATOM   4521   H HB2  . ALA B 1 75  ? -4.771  2.922  -51.763 0.010 34.12  ? 75   ALA B HB2  1  
ATOM   4522   H HB3  . ALA B 1 75  ? -5.284  4.406  -51.487 0.010 31.48  ? 75   ALA B HB3  1  
ATOM   4523   N N    . VAL B 1 76  ? -7.819  3.054  -49.669 0.010 31.44  ? 76   VAL B N    1  
ATOM   4524   C CA   . VAL B 1 76  ? -9.121  2.397  -49.593 0.010 32.38  ? 76   VAL B CA   1  
ATOM   4525   C C    . VAL B 1 76  ? -10.247 3.206  -50.248 0.010 31.64  ? 76   VAL B C    1  
ATOM   4526   O O    . VAL B 1 76  ? -10.912 3.999  -49.589 0.010 30.08  ? 76   VAL B O    1  
ATOM   4527   C CB   . VAL B 1 76  ? -9.483  2.141  -48.112 0.010 31.88  ? 76   VAL B CB   1  
ATOM   4528   C CG1  . VAL B 1 76  ? -10.712 1.275  -47.998 0.010 33.37  ? 76   VAL B CG1  1  
ATOM   4529   C CG2  . VAL B 1 76  ? -8.305  1.509  -47.379 0.010 32.52  ? 76   VAL B CG2  1  
ATOM   4530   H H    . VAL B 1 76  ? -7.837  3.868  -49.401 0.010 30.02  ? 76   VAL B H    1  
ATOM   4531   H HA   . VAL B 1 76  ? -9.076  1.532  -50.025 0.010 34.10  ? 76   VAL B HA   1  
ATOM   4532   H HB   . VAL B 1 76  ? -9.678  2.987  -47.679 0.010 30.35  ? 76   VAL B HB   1  
ATOM   4533   H HG11 . VAL B 1 76  ? -10.643 0.541  -48.629 0.010 35.01  ? 76   VAL B HG11 1  
ATOM   4534   H HG12 . VAL B 1 76  ? -10.768 0.933  -47.092 0.010 33.38  ? 76   VAL B HG12 1  
ATOM   4535   H HG13 . VAL B 1 76  ? -11.493 1.813  -48.194 0.010 32.84  ? 76   VAL B HG13 1  
ATOM   4536   H HG21 . VAL B 1 76  ? -7.990  0.743  -47.883 0.010 34.13  ? 76   VAL B HG21 1  
ATOM   4537   H HG22 . VAL B 1 76  ? -7.594  2.163  -47.293 0.010 31.52  ? 76   VAL B HG22 1  
ATOM   4538   H HG23 . VAL B 1 76  ? -8.599  1.225  -46.499 0.010 32.47  ? 76   VAL B HG23 1  
ATOM   4539   N N    . PRO B 1 77  ? -10.467 3.016  -51.552 0.010 32.98  ? 77   PRO B N    1  
ATOM   4540   C CA   . PRO B 1 77  ? -11.620 3.625  -52.232 0.010 32.89  ? 77   PRO B CA   1  
ATOM   4541   C C    . PRO B 1 77  ? -12.954 2.974  -51.883 0.010 33.91  ? 77   PRO B C    1  
ATOM   4542   O O    . PRO B 1 77  ? -12.991 1.855  -51.374 0.010 35.26  ? 77   PRO B O    1  
ATOM   4543   C CB   . PRO B 1 77  ? -11.300 3.412  -53.717 0.010 34.64  ? 77   PRO B CB   1  
ATOM   4544   C CG   . PRO B 1 77  ? -10.455 2.169  -53.732 0.010 36.34  ? 77   PRO B CG   1  
ATOM   4545   C CD   . PRO B 1 77  ? -9.591  2.299  -52.497 0.010 34.63  ? 77   PRO B CD   1  
ATOM   4546   H HA   . PRO B 1 77  ? -11.667 4.572  -52.045 0.010 31.36  ? 77   PRO B HA   1  
ATOM   4547   H HB2  . PRO B 1 77  ? -12.118 3.283  -54.218 0.010 35.68  ? 77   PRO B HB2  1  
ATOM   4548   H HB3  . PRO B 1 77  ? -10.804 4.169  -54.058 0.010 33.79  ? 77   PRO B HB3  1  
ATOM   4549   H HG2  . PRO B 1 77  ? -11.023 1.386  -53.668 0.010 37.71  ? 77   PRO B HG2  1  
ATOM   4550   H HG3  . PRO B 1 77  ? -9.916  2.141  -54.539 0.010 37.18  ? 77   PRO B HG3  1  
ATOM   4551   H HD2  . PRO B 1 77  ? -9.365  1.421  -52.158 0.010 35.67  ? 77   PRO B HD2  1  
ATOM   4552   H HD3  . PRO B 1 77  ? -8.796  2.824  -52.685 0.010 33.76  ? 77   PRO B HD3  1  
ATOM   4553   N N    . HIS B 1 78  ? -14.044 3.673  -52.165 0.010 33.48  ? 78   HIS B N    1  
ATOM   4554   C CA   . HIS B 1 78  ? -15.350 3.143  -51.873 0.010 34.59  ? 78   HIS B CA   1  
ATOM   4555   C C    . HIS B 1 78  ? -15.641 2.012  -52.835 0.010 37.41  ? 78   HIS B C    1  
ATOM   4556   O O    . HIS B 1 78  ? -15.460 2.160  -54.037 0.010 38.28  ? 78   HIS B O    1  
ATOM   4557   C CB   . HIS B 1 78  ? -16.440 4.183  -52.004 0.010 33.70  ? 78   HIS B CB   1  
ATOM   4558   C CG   . HIS B 1 78  ? -17.736 3.741  -51.414 0.010 34.70  ? 78   HIS B CG   1  
ATOM   4559   N ND1  . HIS B 1 78  ? -18.641 2.953  -52.096 0.010 37.08  ? 78   HIS B ND1  1  
ATOM   4560   C CD2  . HIS B 1 78  ? -18.267 3.952  -50.190 0.010 33.91  ? 78   HIS B CD2  1  
ATOM   4561   C CE1  . HIS B 1 78  ? -19.684 2.720  -51.322 0.010 37.67  ? 78   HIS B CE1  1  
ATOM   4562   N NE2  . HIS B 1 78  ? -19.478 3.306  -50.157 0.010 35.80  ? 78   HIS B NE2  1  
ATOM   4563   H H    . HIS B 1 78  ? -14.050 4.447  -52.533 0.010 32.69  ? 78   HIS B H    1  
ATOM   4564   H HA   . HIS B 1 78  ? -15.354 2.833  -50.959 0.010 34.33  ? 78   HIS B HA   1  
ATOM   4565   H HB2  . HIS B 1 78  ? -16.166 4.988  -51.540 0.010 32.03  ? 78   HIS B HB2  1  
ATOM   4566   H HB3  . HIS B 1 78  ? -16.582 4.363  -52.944 0.010 34.33  ? 78   HIS B HB3  1  
ATOM   4567   H HD1  . HIS B 1 78  ? -18.553 2.673  -52.900 0.010 38.14  ? 78   HIS B HD1  1  
ATOM   4568   H HD2  . HIS B 1 78  ? -17.881 4.448  -49.503 0.010 32.50  ? 78   HIS B HD2  1  
ATOM   4569   H HE1  . HIS B 1 78  ? -20.430 2.216  -51.554 0.010 39.29  ? 78   HIS B HE1  1  
ATOM   4570   H HE2  . HIS B 1 78  ? -20.019 3.293  -49.489 0.010 35.88  ? 78   HIS B HE2  1  
ATOM   4571   N N    . PRO B 1 79  ? -16.094 0.873  -52.305 0.010 39.07  ? 79   PRO B N    1  
ATOM   4572   C CA   . PRO B 1 79  ? -16.306 -0.311 -53.146 0.010 42.11  ? 79   PRO B CA   1  
ATOM   4573   C C    . PRO B 1 79  ? -17.148 -0.106 -54.420 0.010 43.56  ? 79   PRO B C    1  
ATOM   4574   O O    . PRO B 1 79  ? -17.192 -1.016 -55.253 0.010 46.29  ? 79   PRO B O    1  
ATOM   4575   C CB   . PRO B 1 79  ? -17.000 -1.282 -52.183 0.010 43.32  ? 79   PRO B CB   1  
ATOM   4576   C CG   . PRO B 1 79  ? -16.427 -0.931 -50.844 0.010 41.16  ? 79   PRO B CG   1  
ATOM   4577   C CD   . PRO B 1 79  ? -16.191 0.552  -50.869 0.010 38.41  ? 79   PRO B CD   1  
ATOM   4578   H HA   . PRO B 1 79  ? -15.446 -0.681 -53.401 0.010 42.65  ? 79   PRO B HA   1  
ATOM   4579   H HB2  . PRO B 1 79  ? -17.957 -1.128 -52.196 0.010 43.59  ? 79   PRO B HB2  1  
ATOM   4580   H HB3  . PRO B 1 79  ? -16.791 -2.198 -52.426 0.010 45.22  ? 79   PRO B HB3  1  
ATOM   4581   H HG2  . PRO B 1 79  ? -17.061 -1.163 -50.147 0.010 41.40  ? 79   PRO B HG2  1  
ATOM   4582   H HG3  . PRO B 1 79  ? -15.587 -1.398 -50.713 0.010 41.49  ? 79   PRO B HG3  1  
ATOM   4583   H HD2  . PRO B 1 79  ? -16.932 1.025  -50.460 0.010 37.71  ? 79   PRO B HD2  1  
ATOM   4584   H HD3  . PRO B 1 79  ? -15.352 0.754  -50.428 0.010 37.28  ? 79   PRO B HD3  1  
ATOM   4585   N N    . ASP B 1 80  ? -17.784 1.049  -54.580 0.010 42.02  ? 80   ASP B N    1  
ATOM   4586   C CA   . ASP B 1 80  ? -18.705 1.275  -55.693 0.010 43.48  ? 80   ASP B CA   1  
ATOM   4587   C C    . ASP B 1 80  ? -18.384 2.508  -56.542 0.010 42.12  ? 80   ASP B C    1  
ATOM   4588   O O    . ASP B 1 80  ? -19.194 2.913  -57.371 0.010 42.99  ? 80   ASP B O    1  
ATOM   4589   C CB   . ASP B 1 80  ? -20.135 1.375  -55.170 0.010 43.88  ? 80   ASP B CB   1  
ATOM   4590   C CG   . ASP B 1 80  ? -20.747 0.024  -54.912 0.010 46.52  ? 80   ASP B CG   1  
ATOM   4591   O OD1  . ASP B 1 80  ? -21.982 -0.086 -54.967 0.010 47.60  ? 80   ASP B OD1  1  
ATOM   4592   O OD2  . ASP B 1 80  ? -19.983 -0.917 -54.656 0.010 47.69  ? 80   ASP B OD2  1  
ATOM   4593   H H    . ASP B 1 80  ? -17.696 1.724  -54.062 0.010 40.24  ? 80   ASP B H    1  
ATOM   4594   H HA   . ASP B 1 80  ? -18.673 0.516  -56.293 0.010 45.50  ? 80   ASP B HA   1  
ATOM   4595   H HB2  . ASP B 1 80  ? -20.133 1.868  -54.335 0.010 42.16  ? 80   ASP B HB2  1  
ATOM   4596   H HB3  . ASP B 1 80  ? -20.691 1.830  -55.820 0.010 44.34  ? 80   ASP B HB3  1  
ATOM   4597   N N    . SER B 1 81  ? -17.197 3.077  -56.350 0.010 40.25  ? 81   SER B N    1  
ATOM   4598   C CA   . SER B 1 81  ? -16.727 4.158  -57.205 0.010 39.39  ? 81   SER B CA   1  
ATOM   4599   C C    . SER B 1 81  ? -16.375 3.611  -58.577 0.010 41.92  ? 81   SER B C    1  
ATOM   4600   O O    . SER B 1 81  ? -16.369 2.394  -58.793 0.010 44.16  ? 81   SER B O    1  
ATOM   4601   C CB   . SER B 1 81  ? -15.504 4.847  -56.581 0.010 37.00  ? 81   SER B CB   1  
ATOM   4602   O OG   . SER B 1 81  ? -14.581 3.898  -56.074 0.010 37.61  ? 81   SER B OG   1  
ATOM   4603   H H    . SER B 1 81  ? -16.644 2.854  -55.731 0.010 39.57  ? 81   SER B H    1  
ATOM   4604   H HA   . SER B 1 81  ? -17.430 4.817  -57.311 0.010 38.94  ? 81   SER B HA   1  
ATOM   4605   H HB2  . SER B 1 81  ? -15.062 5.378  -57.261 0.010 36.78  ? 81   SER B HB2  1  
ATOM   4606   H HB3  . SER B 1 81  ? -15.797 5.420  -55.855 0.010 35.47  ? 81   SER B HB3  1  
ATOM   4607   H HG   . SER B 1 81  ? -14.926 3.475  -55.423 0.010 38.38  ? 81   SER B HG   1  
ATOM   4608   N N    . GLN B 1 82  ? -16.083 4.513  -59.504 0.010 41.79  ? 82   GLN B N    1  
ATOM   4609   C CA   . GLN B 1 82  ? -15.679 4.132  -60.853 0.010 44.32  ? 82   GLN B CA   1  
ATOM   4610   C C    . GLN B 1 82  ? -15.260 5.411  -61.591 0.010 43.52  ? 82   GLN B C    1  
ATOM   4611   O O    . GLN B 1 82  ? -15.994 6.393  -61.553 0.010 42.42  ? 82   GLN B O    1  
ATOM   4612   C CB   . GLN B 1 82  ? -16.814 3.429  -61.592 0.010 47.19  ? 82   GLN B CB   1  
ATOM   4613   C CG   . GLN B 1 82  ? -16.534 1.937  -61.920 0.010 50.09  ? 82   GLN B CG   1  
ATOM   4614   C CD   . GLN B 1 82  ? -17.351 1.432  -63.092 0.010 53.55  ? 82   GLN B CD   1  
ATOM   4615   O OE1  . GLN B 1 82  ? -18.521 1.781  -63.240 0.010 53.90  ? 82   GLN B OE1  1  
ATOM   4616   N NE2  . GLN B 1 82  ? -16.733 0.601  -63.936 0.010 56.37  ? 82   GLN B NE2  1  
ATOM   4617   H H    . GLN B 1 82  ? -16.103 5.362  -59.374 0.010 40.37  ? 82   GLN B H    1  
ATOM   4618   H HA   . GLN B 1 82  ? -14.941 3.514  -60.778 0.010 44.89  ? 82   GLN B HA   1  
ATOM   4619   H HB2  . GLN B 1 82  ? -17.613 3.469  -61.042 0.010 46.61  ? 82   GLN B HB2  1  
ATOM   4620   H HB3  . GLN B 1 82  ? -16.971 3.890  -62.430 0.010 48.02  ? 82   GLN B HB3  1  
ATOM   4621   H HG2  . GLN B 1 82  ? -15.596 1.825  -62.141 0.010 50.23  ? 82   GLN B HG2  1  
ATOM   4622   H HG3  . GLN B 1 82  ? -16.759 1.391  -61.151 0.010 49.83  ? 82   GLN B HG3  1  
ATOM   4623   H HE21 . GLN B 1 82  ? -16.022 0.184  -63.688 0.010 56.19  ? 82   GLN B HE21 1  
ATOM   4624   H HE22 . GLN B 1 82  ? -17.048 0.479  -64.726 0.010 58.50  ? 82   GLN B HE22 1  
ATOM   4625   N N    . PRO B 1 83  ? -14.084 5.404  -62.252 0.010 44.31  ? 83   PRO B N    1  
ATOM   4626   C CA   . PRO B 1 83  ? -13.495 6.579  -62.925 0.010 43.73  ? 83   PRO B CA   1  
ATOM   4627   C C    . PRO B 1 83  ? -14.362 7.357  -63.932 0.010 44.52  ? 83   PRO B C    1  
ATOM   4628   O O    . PRO B 1 83  ? -13.833 8.311  -64.496 0.010 43.89  ? 83   PRO B O    1  
ATOM   4629   C CB   . PRO B 1 83  ? -12.284 5.984  -63.675 0.010 46.04  ? 83   PRO B CB   1  
ATOM   4630   C CG   . PRO B 1 83  ? -12.411 4.513  -63.571 0.010 47.98  ? 83   PRO B CG   1  
ATOM   4631   C CD   . PRO B 1 83  ? -13.182 4.245  -62.340 0.010 46.12  ? 83   PRO B CD   1  
ATOM   4632   H HA   . PRO B 1 83  ? -13.171 7.204  -62.258 0.010 41.67  ? 83   PRO B HA   1  
ATOM   4633   H HB2  . PRO B 1 83  ? -12.320 6.249  -64.608 0.010 47.51  ? 83   PRO B HB2  1  
ATOM   4634   H HB3  . PRO B 1 83  ? -11.460 6.290  -63.263 0.010 44.92  ? 83   PRO B HB3  1  
ATOM   4635   H HG2  . PRO B 1 83  ? -12.884 4.175  -64.346 0.010 50.06  ? 83   PRO B HG2  1  
ATOM   4636   H HG3  . PRO B 1 83  ? -11.528 4.115  -63.512 0.010 48.50  ? 83   PRO B HG3  1  
ATOM   4637   H HD2  . PRO B 1 83  ? -13.681 3.422  -62.448 0.010 47.68  ? 83   PRO B HD2  1  
ATOM   4638   H HD3  . PRO B 1 83  ? -12.591 4.212  -61.572 0.010 44.76  ? 83   PRO B HD3  1  
ATOM   4639   N N    . ASP B 1 84  ? -15.610 6.952  -64.181 0.010 46.15  ? 84   ASP B N    1  
ATOM   4640   C CA   . ASP B 1 84  ? -16.489 7.673  -65.107 0.010 47.31  ? 84   ASP B CA   1  
ATOM   4641   C C    . ASP B 1 84  ? -17.900 7.874  -64.555 0.010 46.76  ? 84   ASP B C    1  
ATOM   4642   O O    . ASP B 1 84  ? -18.863 8.026  -65.315 0.010 48.72  ? 84   ASP B O    1  
ATOM   4643   C CB   . ASP B 1 84  ? -16.572 6.929  -66.437 0.010 51.03  ? 84   ASP B CB   1  
ATOM   4644   C CG   . ASP B 1 84  ? -15.344 7.145  -67.302 0.010 51.96  ? 84   ASP B CG   1  
ATOM   4645   O OD1  . ASP B 1 84  ? -15.153 6.375  -68.272 0.010 55.21  ? 84   ASP B OD1  1  
ATOM   4646   O OD2  . ASP B 1 84  ? -14.579 8.092  -67.016 0.010 49.68  ? 84   ASP B OD2  1  
ATOM   4647   H H    . ASP B 1 84  ? -15.973 6.251  -63.841 0.010 46.76  ? 84   ASP B H    1  
ATOM   4648   H HA   . ASP B 1 84  ? -16.129 8.558  -65.273 0.010 46.29  ? 84   ASP B HA   1  
ATOM   4649   H HB2  . ASP B 1 84  ? -16.660 5.979  -66.262 0.010 52.13  ? 84   ASP B HB2  1  
ATOM   4650   H HB3  . ASP B 1 84  ? -17.337 7.245  -66.938 0.010 52.03  ? 84   ASP B HB3  1  
ATOM   4651   N N    . THR B 1 85  ? -18.017 7.825  -63.233 0.010 44.37  ? 85   THR B N    1  
ATOM   4652   C CA   . THR B 1 85  ? -19.195 8.332  -62.548 0.010 43.19  ? 85   THR B CA   1  
ATOM   4653   C C    . THR B 1 85  ? -18.682 9.236  -61.452 0.010 39.96  ? 85   THR B C    1  
ATOM   4654   O O    . THR B 1 85  ? -17.518 9.128  -61.059 0.010 38.83  ? 85   THR B O    1  
ATOM   4655   C CB   . THR B 1 85  ? -20.035 7.228  -61.922 0.010 44.09  ? 85   THR B CB   1  
ATOM   4656   O OG1  . THR B 1 85  ? -21.299 7.773  -61.515 0.010 43.50  ? 85   THR B OG1  1  
ATOM   4657   C CG2  . THR B 1 85  ? -19.320 6.623  -60.713 0.010 42.58  ? 85   THR B CG2  1  
ATOM   4658   H H    . THR B 1 85  ? -17.422 7.501  -62.704 0.010 43.50  ? 85   THR B H    1  
ATOM   4659   H HA   . THR B 1 85  ? -19.747 8.851  -63.152 0.010 43.96  ? 85   THR B HA   1  
ATOM   4660   H HB   . THR B 1 85  ? -20.180 6.524  -62.574 0.010 46.27  ? 85   THR B HB   1  
ATOM   4661   H HG1  . THR B 1 85  ? -21.772 7.171  -61.144 0.010 43.88  ? 85   THR B HG1  1  
ATOM   4662   H HG21 . THR B 1 85  ? -18.362 6.638  -60.852 0.010 42.35  ? 85   THR B HG21 1  
ATOM   4663   H HG22 . THR B 1 85  ? -19.529 7.120  -59.911 0.010 40.75  ? 85   THR B HG22 1  
ATOM   4664   H HG23 . THR B 1 85  ? -19.602 5.704  -60.589 0.010 43.85  ? 85   THR B HG23 1  
ATOM   4665   N N    . ILE B 1 86  ? -19.521 10.137 -60.957 0.010 38.67  ? 86   ILE B N    1  
ATOM   4666   C CA   . ILE B 1 86  ? -19.087 11.009 -59.876 0.010 35.86  ? 86   ILE B CA   1  
ATOM   4667   C C    . ILE B 1 86  ? -19.610 10.464 -58.541 0.010 35.06  ? 86   ILE B C    1  
ATOM   4668   O O    . ILE B 1 86  ? -19.430 11.075 -57.495 0.010 33.04  ? 86   ILE B O    1  
ATOM   4669   C CB   . ILE B 1 86  ? -19.434 12.514 -60.144 0.010 34.90  ? 86   ILE B CB   1  
ATOM   4670   C CG1  . ILE B 1 86  ? -20.905 12.835 -59.900 0.010 35.48  ? 86   ILE B CG1  1  
ATOM   4671   C CG2  . ILE B 1 86  ? -19.055 12.898 -61.576 0.010 36.20  ? 86   ILE B CG2  1  
ATOM   4672   C CD1  . ILE B 1 86  ? -21.252 13.119 -58.467 0.010 33.65  ? 86   ILE B CD1  1  
ATOM   4673   H H    . ILE B 1 86  ? -20.332 10.254 -61.218 0.010 39.51  ? 86   ILE B H    1  
ATOM   4674   H HA   . ILE B 1 86  ? -18.122 10.974 -59.820 0.010 35.19  ? 86   ILE B HA   1  
ATOM   4675   H HB   . ILE B 1 86  ? -18.902 13.058 -59.540 0.010 33.20  ? 86   ILE B HB   1  
ATOM   4676   H HG12 . ILE B 1 86  ? -21.147 13.618 -60.418 0.010 35.86  ? 86   ILE B HG12 1  
ATOM   4677   H HG13 . ILE B 1 86  ? -21.436 12.076 -60.187 0.010 36.97  ? 86   ILE B HG13 1  
ATOM   4678   H HG21 . ILE B 1 86  ? -18.343 12.314 -61.881 0.010 36.42  ? 86   ILE B HG21 1  
ATOM   4679   H HG22 . ILE B 1 86  ? -19.834 12.803 -62.145 0.010 37.88  ? 86   ILE B HG22 1  
ATOM   4680   H HG23 . ILE B 1 86  ? -18.748 13.818 -61.581 0.010 35.26  ? 86   ILE B HG23 1  
ATOM   4681   H HD11 . ILE B 1 86  ? -20.467 13.452 -58.007 0.010 32.15  ? 86   ILE B HD11 1  
ATOM   4682   H HD12 . ILE B 1 86  ? -21.952 13.786 -58.450 0.010 33.79  ? 86   ILE B HD12 1  
ATOM   4683   H HD13 . ILE B 1 86  ? -21.559 12.301 -58.051 0.010 34.06  ? 86   ILE B HD13 1  
ATOM   4684   N N    . ASP B 1 87  ? -20.189 9.265  -58.595 0.010 36.89  ? 87   ASP B N    1  
ATOM   4685   C CA   . ASP B 1 87  ? -20.781 8.592  -57.433 0.010 36.68  ? 87   ASP B CA   1  
ATOM   4686   C C    . ASP B 1 87  ? -19.791 7.834  -56.539 0.010 35.71  ? 87   ASP B C    1  
ATOM   4687   O O    . ASP B 1 87  ? -18.880 7.178  -57.036 0.010 36.44  ? 87   ASP B O    1  
ATOM   4688   C CB   . ASP B 1 87  ? -21.805 7.563  -57.914 0.010 39.42  ? 87   ASP B CB   1  
ATOM   4689   C CG   . ASP B 1 87  ? -22.867 8.164  -58.789 0.010 40.80  ? 87   ASP B CG   1  
ATOM   4690   O OD1  . ASP B 1 87  ? -23.177 9.356  -58.628 0.010 39.51  ? 87   ASP B OD1  1  
ATOM   4691   O OD2  . ASP B 1 87  ? -23.399 7.425  -59.637 0.010 43.41  ? 87   ASP B OD2  1  
ATOM   4692   H H    . ASP B 1 87  ? -20.265 8.806  -59.313 0.010 38.44  ? 87   ASP B H    1  
ATOM   4693   H HA   . ASP B 1 87  ? -21.241 9.248  -56.886 0.010 35.67  ? 87   ASP B HA   1  
ATOM   4694   H HB2  . ASP B 1 87  ? -21.349 6.878  -58.429 0.010 40.59  ? 87   ASP B HB2  1  
ATOM   4695   H HB3  . ASP B 1 87  ? -22.239 7.162  -57.145 0.010 39.38  ? 87   ASP B HB3  1  
ATOM   4696   N N    . HIS B 1 88  ? -20.021 7.888  -55.226 0.010 34.37  ? 88   HIS B N    1  
ATOM   4697   C CA   . HIS B 1 88  ? -19.257 7.089  -54.258 0.010 33.75  ? 88   HIS B CA   1  
ATOM   4698   C C    . HIS B 1 88  ? -17.758 7.419  -54.261 0.010 32.28  ? 88   HIS B C    1  
ATOM   4699   O O    . HIS B 1 88  ? -16.912 6.589  -53.920 0.010 32.45  ? 88   HIS B O    1  
ATOM   4700   C CB   . HIS B 1 88  ? -19.475 5.594  -54.536 0.010 36.16  ? 88   HIS B CB   1  
ATOM   4701   C CG   . HIS B 1 88  ? -20.883 5.266  -54.910 0.010 38.17  ? 88   HIS B CG   1  
ATOM   4702   N ND1  . HIS B 1 88  ? -21.958 5.677  -54.156 0.010 37.85  ? 88   HIS B ND1  1  
ATOM   4703   C CD2  . HIS B 1 88  ? -21.396 4.584  -55.960 0.010 40.75  ? 88   HIS B CD2  1  
ATOM   4704   C CE1  . HIS B 1 88  ? -23.074 5.249  -54.719 0.010 40.12  ? 88   HIS B CE1  1  
ATOM   4705   N NE2  . HIS B 1 88  ? -22.759 4.587  -55.816 0.010 41.90  ? 88   HIS B NE2  1  
ATOM   4706   H H    . HIS B 1 88  ? -20.630 8.376  -54.867 0.010 33.95  ? 88   HIS B H    1  
ATOM   4707   H HA   . HIS B 1 88  ? -19.600 7.272  -53.371 0.010 32.97  ? 88   HIS B HA   1  
ATOM   4708   H HB2  . HIS B 1 88  ? -18.899 5.315  -55.265 0.010 36.88  ? 88   HIS B HB2  1  
ATOM   4709   H HB3  . HIS B 1 88  ? -19.257 5.092  -53.735 0.010 35.89  ? 88   HIS B HB3  1  
ATOM   4710   H HD1  . HIS B 1 88  ? -21.911 6.128  -53.427 0.010 36.53  ? 88   HIS B HD1  1  
ATOM   4711   H HD2  . HIS B 1 88  ? -20.918 4.186  -56.648 0.010 41.72  ? 88   HIS B HD2  1  
ATOM   4712   H HE1  . HIS B 1 88  ? -23.936 5.394  -54.401 0.010 40.55  ? 88   HIS B HE1  1  
ATOM   4713   H HE2  . HIS B 1 88  ? -23.319 4.219  -56.352 0.010 43.63  ? 88   HIS B HE2  1  
ATOM   4714   N N    . ASP B 1 89  ? -17.438 8.653  -54.624 0.010 31.00  ? 89   ASP B N    1  
ATOM   4715   C CA   . ASP B 1 89  ? -16.062 9.044  -54.852 0.010 30.02  ? 89   ASP B CA   1  
ATOM   4716   C C    . ASP B 1 89  ? -15.349 9.387  -53.534 0.010 27.99  ? 89   ASP B C    1  
ATOM   4717   O O    . ASP B 1 89  ? -14.863 10.496 -53.348 0.010 26.48  ? 89   ASP B O    1  
ATOM   4718   C CB   . ASP B 1 89  ? -16.067 10.229 -55.835 0.010 29.85  ? 89   ASP B CB   1  
ATOM   4719   C CG   . ASP B 1 89  ? -14.692 10.624 -56.301 0.010 29.40  ? 89   ASP B CG   1  
ATOM   4720   O OD1  . ASP B 1 89  ? -13.783 9.780  -56.404 0.010 30.05  ? 89   ASP B OD1  1  
ATOM   4721   O OD2  . ASP B 1 89  ? -14.538 11.819 -56.599 0.010 28.59  ? 89   ASP B OD2  1  
ATOM   4722   H H    . ASP B 1 89  ? -18.006 9.287  -54.742 0.010 30.79  ? 89   ASP B H    1  
ATOM   4723   H HA   . ASP B 1 89  ? -15.583 8.312  -55.267 0.010 31.05  ? 89   ASP B HA   1  
ATOM   4724   H HB2  . ASP B 1 89  ? -16.583 9.990  -56.620 0.010 31.28  ? 89   ASP B HB2  1  
ATOM   4725   H HB3  . ASP B 1 89  ? -16.470 10.997 -55.404 0.010 28.84  ? 89   ASP B HB3  1  
ATOM   4726   N N    . LEU B 1 90  ? -15.281 8.417  -52.626 0.010 28.19  ? 90   LEU B N    1  
ATOM   4727   C CA   . LEU B 1 90  ? -14.525 8.567  -51.381 0.010 26.67  ? 90   LEU B CA   1  
ATOM   4728   C C    . LEU B 1 90  ? -13.335 7.633  -51.301 0.010 27.20  ? 90   LEU B C    1  
ATOM   4729   O O    . LEU B 1 90  ? -13.377 6.491  -51.793 0.010 29.00  ? 90   LEU B O    1  
ATOM   4730   C CB   . LEU B 1 90  ? -15.410 8.352  -50.160 0.010 26.48  ? 90   LEU B CB   1  
ATOM   4731   C CG   . LEU B 1 90  ? -16.543 9.359  -49.963 0.010 25.96  ? 90   LEU B CG   1  
ATOM   4732   C CD1  . LEU B 1 90  ? -17.345 8.997  -48.728 0.010 26.21  ? 90   LEU B CD1  1  
ATOM   4733   C CD2  . LEU B 1 90  ? -15.993 10.806 -49.870 0.010 24.19  ? 90   LEU B CD2  1  
ATOM   4734   H H    . LEU B 1 90  ? -15.673 7.657  -52.705 0.010 29.33  ? 90   LEU B H    1  
ATOM   4735   H HA   . LEU B 1 90  ? -14.167 9.465  -51.327 0.010 25.53  ? 90   LEU B HA   1  
ATOM   4736   H HB2  . LEU B 1 90  ? -15.806 7.469  -50.220 0.010 27.73  ? 90   LEU B HB2  1  
ATOM   4737   H HB3  . LEU B 1 90  ? -14.846 8.393  -49.373 0.010 25.66  ? 90   LEU B HB3  1  
ATOM   4738   H HG   . LEU B 1 90  ? -17.136 9.320  -50.729 0.010 26.86  ? 90   LEU B HG   1  
ATOM   4739   H HD11 . LEU B 1 90  ? -16.738 8.778  -48.005 0.010 25.66  ? 90   LEU B HD11 1  
ATOM   4740   H HD12 . LEU B 1 90  ? -17.897 9.754  -48.476 0.010 25.79  ? 90   LEU B HD12 1  
ATOM   4741   H HD13 . LEU B 1 90  ? -17.906 8.230  -48.926 0.010 27.53  ? 90   LEU B HD13 1  
ATOM   4742   H HD21 . LEU B 1 90  ? -15.458 11.003 -50.653 0.010 24.20  ? 90   LEU B HD21 1  
ATOM   4743   H HD22 . LEU B 1 90  ? -16.738 11.423 -49.828 0.010 24.09  ? 90   LEU B HD22 1  
ATOM   4744   H HD23 . LEU B 1 90  ? -15.454 10.886 -49.069 0.010 23.39  ? 90   LEU B HD23 1  
ATOM   4745   N N    . LEU B 1 91  ? -12.278 8.137  -50.665 0.010 25.83  ? 91   LEU B N    1  
ATOM   4746   C CA   . LEU B 1 91  ? -11.015 7.421  -50.515 0.010 26.28  ? 91   LEU B CA   1  
ATOM   4747   C C    . LEU B 1 91  ? -10.474 7.546  -49.099 0.010 25.11  ? 91   LEU B C    1  
ATOM   4748   O O    . LEU B 1 91  ? -10.338 8.654  -48.587 0.010 23.57  ? 91   LEU B O    1  
ATOM   4749   C CB   . LEU B 1 91  ? -9.996  7.966  -51.496 0.010 26.29  ? 91   LEU B CB   1  
ATOM   4750   C CG   . LEU B 1 91  ? -8.548  7.478  -51.431 0.010 26.78  ? 91   LEU B CG   1  
ATOM   4751   C CD1  . LEU B 1 91  ? -8.451  6.049  -51.895 0.010 28.96  ? 91   LEU B CD1  1  
ATOM   4752   C CD2  . LEU B 1 91  ? -7.641  8.375  -52.269 0.010 26.58  ? 91   LEU B CD2  1  
ATOM   4753   H H    . LEU B 1 91  ? -12.269 8.917  -50.309 0.010 24.73  ? 91   LEU B H    1  
ATOM   4754   H HA   . LEU B 1 91  ? -11.146 6.480  -50.709 0.010 27.59  ? 91   LEU B HA   1  
ATOM   4755   H HB2  . LEU B 1 91  ? -10.316 7.748  -52.377 0.010 27.33  ? 91   LEU B HB2  1  
ATOM   4756   H HB3  . LEU B 1 91  ? -9.976  8.930  -51.393 0.010 25.14  ? 91   LEU B HB3  1  
ATOM   4757   H HG   . LEU B 1 91  ? -8.233  7.514  -50.515 0.010 26.02  ? 91   LEU B HG   1  
ATOM   4758   H HD11 . LEU B 1 91  ? -8.979  5.940  -52.701 0.010 29.87  ? 91   LEU B HD11 1  
ATOM   4759   H HD12 . LEU B 1 91  ? -7.521  5.843  -52.080 0.010 29.42  ? 91   LEU B HD12 1  
ATOM   4760   H HD13 . LEU B 1 91  ? -8.791  5.466  -51.195 0.010 29.15  ? 91   LEU B HD13 1  
ATOM   4761   H HD21 . LEU B 1 91  ? -7.835  9.296  -52.046 0.010 25.37  ? 91   LEU B HD21 1  
ATOM   4762   H HD22 . LEU B 1 91  ? -6.715  8.174  -52.068 0.010 26.76  ? 91   LEU B HD22 1  
ATOM   4763   H HD23 . LEU B 1 91  ? -7.814  8.219  -53.210 0.010 27.65  ? 91   LEU B HD23 1  
ATOM   4764   N N    . LEU B 1 92  ? -10.176 6.410  -48.469 0.010 26.06  ? 92   LEU B N    1  
ATOM   4765   C CA   . LEU B 1 92  ? -9.593  6.417  -47.133 0.010 25.31  ? 92   LEU B CA   1  
ATOM   4766   C C    . LEU B 1 92  ? -8.146  5.959  -47.179 0.010 25.86  ? 92   LEU B C    1  
ATOM   4767   O O    . LEU B 1 92  ? -7.814  4.905  -47.722 0.010 27.53  ? 92   LEU B O    1  
ATOM   4768   C CB   . LEU B 1 92  ? -10.407 5.570  -46.161 0.010 26.09  ? 92   LEU B CB   1  
ATOM   4769   C CG   . LEU B 1 92  ? -11.648 6.254  -45.577 0.010 25.35  ? 92   LEU B CG   1  
ATOM   4770   C CD1  . LEU B 1 92  ? -12.552 5.230  -44.900 0.010 26.76  ? 92   LEU B CD1  1  
ATOM   4771   C CD2  . LEU B 1 92  ? -11.254 7.379  -44.613 0.010 23.69  ? 92   LEU B CD2  1  
ATOM   4772   H H    . LEU B 1 92  ? -10.290 5.626  -48.798 0.010 27.27  ? 92   LEU B H    1  
ATOM   4773   H HA   . LEU B 1 92  ? -9.589  7.321  -46.788 0.010 24.09  ? 92   LEU B HA   1  
ATOM   4774   H HB2  . LEU B 1 92  ? -10.704 4.769  -46.618 0.010 27.38  ? 92   LEU B HB2  1  
ATOM   4775   H HB3  . LEU B 1 92  ? -9.839  5.325  -45.417 0.010 26.05  ? 92   LEU B HB3  1  
ATOM   4776   H HG   . LEU B 1 92  ? -12.152 6.660  -46.299 0.010 25.25  ? 92   LEU B HG   1  
ATOM   4777   H HD11 . LEU B 1 92  ? -12.042 4.767  -44.218 0.010 26.96  ? 92   LEU B HD11 1  
ATOM   4778   H HD12 . LEU B 1 92  ? -13.306 5.688  -44.497 0.010 26.45  ? 92   LEU B HD12 1  
ATOM   4779   H HD13 . LEU B 1 92  ? -12.868 4.600  -45.564 0.010 27.92  ? 92   LEU B HD13 1  
ATOM   4780   H HD21 . LEU B 1 92  ? -10.350 7.232  -44.296 0.010 23.53  ? 92   LEU B HD21 1  
ATOM   4781   H HD22 . LEU B 1 92  ? -11.295 8.222  -45.089 0.010 22.90  ? 92   LEU B HD22 1  
ATOM   4782   H HD23 . LEU B 1 92  ? -11.866 7.393  -43.862 0.010 23.78  ? 92   LEU B HD23 1  
ATOM   4783   N N    . LEU B 1 93  ? -7.297  6.781  -46.576 0.010 24.62  ? 93   LEU B N    1  
ATOM   4784   C CA   . LEU B 1 93  ? -5.857  6.603  -46.597 0.010 25.05  ? 93   LEU B CA   1  
ATOM   4785   C C    . LEU B 1 93  ? -5.368  6.404  -45.166 0.010 24.84  ? 93   LEU B C    1  
ATOM   4786   O O    . LEU B 1 93  ? -5.574  7.261  -44.313 0.010 23.56  ? 93   LEU B O    1  
ATOM   4787   C CB   . LEU B 1 93  ? -5.174  7.838  -47.225 0.010 24.08  ? 93   LEU B CB   1  
ATOM   4788   C CG   . LEU B 1 93  ? -5.586  8.174  -48.656 0.010 24.35  ? 93   LEU B CG   1  
ATOM   4789   C CD1  . LEU B 1 93  ? -5.270  9.646  -48.983 0.010 23.15  ? 93   LEU B CD1  1  
ATOM   4790   C CD2  . LEU B 1 93  ? -4.858  7.259  -49.625 0.010 26.27  ? 93   LEU B CD2  1  
ATOM   4791   H H    . LEU B 1 93  ? -7.552  7.466  -46.127 0.010 23.61  ? 93   LEU B H    1  
ATOM   4792   H HA   . LEU B 1 93  ? -5.624  5.825  -47.121 0.010 26.31  ? 93   LEU B HA   1  
ATOM   4793   H HB2  . LEU B 1 93  ? -5.364  8.617  -46.679 0.010 22.94  ? 93   LEU B HB2  1  
ATOM   4794   H HB3  . LEU B 1 93  ? -4.218  7.681  -47.237 0.010 24.56  ? 93   LEU B HB3  1  
ATOM   4795   H HG   . LEU B 1 93  ? -6.541  8.033  -48.756 0.010 24.28  ? 93   LEU B HG   1  
ATOM   4796   H HD11 . LEU B 1 93  ? -5.610  10.208 -48.271 0.010 22.09  ? 93   LEU B HD11 1  
ATOM   4797   H HD12 . LEU B 1 93  ? -4.310  9.755  -49.059 0.010 23.39  ? 93   LEU B HD12 1  
ATOM   4798   H HD13 . LEU B 1 93  ? -5.695  9.879  -49.822 0.010 23.41  ? 93   LEU B HD13 1  
ATOM   4799   H HD21 . LEU B 1 93  ? -4.759  6.384  -49.219 0.010 27.04  ? 93   LEU B HD21 1  
ATOM   4800   H HD22 . LEU B 1 93  ? -5.373  7.191  -50.444 0.010 26.81  ? 93   LEU B HD22 1  
ATOM   4801   H HD23 . LEU B 1 93  ? -3.983  7.632  -49.816 0.010 26.34  ? 93   LEU B HD23 1  
ATOM   4802   N N    . GLN B 1 94  ? -4.742  5.260  -44.899 0.010 26.33  ? 94   GLN B N    1  
ATOM   4803   C CA   . GLN B 1 94  ? -4.186  5.002  -43.586 0.010 26.46  ? 94   GLN B CA   1  
ATOM   4804   C C    . GLN B 1 94  ? -2.736  5.425  -43.542 0.010 26.45  ? 94   GLN B C    1  
ATOM   4805   O O    . GLN B 1 94  ? -1.934  4.927  -44.303 0.010 27.62  ? 94   GLN B O    1  
ATOM   4806   C CB   . GLN B 1 94  ? -4.273  3.522  -43.200 0.010 28.35  ? 94   GLN B CB   1  
ATOM   4807   C CG   . GLN B 1 94  ? -4.183  3.355  -41.701 0.010 28.47  ? 94   GLN B CG   1  
ATOM   4808   C CD   . GLN B 1 94  ? -4.415  1.929  -41.245 0.010 30.44  ? 94   GLN B CD   1  
ATOM   4809   O OE1  . GLN B 1 94  ? -4.039  0.977  -41.934 0.010 32.09  ? 94   GLN B OE1  1  
ATOM   4810   N NE2  . GLN B 1 94  ? -5.029  1.776  -40.070 0.010 30.52  ? 94   GLN B NE2  1  
ATOM   4811   H H    . GLN B 1 94  ? -4.629  4.621  -45.461 0.010 27.40  ? 94   GLN B H    1  
ATOM   4812   H HA   . GLN B 1 94  ? -4.685  5.508  -42.929 0.010 25.55  ? 94   GLN B HA   1  
ATOM   4813   H HB2  . GLN B 1 94  ? -5.104  3.151  -43.514 0.010 28.71  ? 94   GLN B HB2  1  
ATOM   4814   H HB3  . GLN B 1 94  ? -3.528  3.046  -43.600 0.010 29.37  ? 94   GLN B HB3  1  
ATOM   4815   H HG2  . GLN B 1 94  ? -3.294  3.616  -41.417 0.010 28.46  ? 94   GLN B HG2  1  
ATOM   4816   H HG3  . GLN B 1 94  ? -4.836  3.928  -41.275 0.010 27.45  ? 94   GLN B HG3  1  
ATOM   4817   H HE21 . GLN B 1 94  ? -5.806  1.410  -40.036 0.010 31.12  ? 94   GLN B HE21 1  
ATOM   4818   H HE22 . GLN B 1 94  ? -4.653  2.055  -39.350 0.010 30.06  ? 94   GLN B HE22 1  
ATOM   4819   N N    . LEU B 1 95  ? -2.400  6.332  -42.631 0.010 25.37  ? 95   LEU B N    1  
ATOM   4820   C CA   . LEU B 1 95  ? -1.029  6.829  -42.534 0.010 25.41  ? 95   LEU B CA   1  
ATOM   4821   C C    . LEU B 1 95  ? -0.069  5.801  -41.943 0.010 27.06  ? 95   LEU B C    1  
ATOM   4822   O O    . LEU B 1 95  ? -0.491  4.890  -41.227 0.010 27.88  ? 95   LEU B O    1  
ATOM   4823   C CB   . LEU B 1 95  ? -0.977  8.104  -41.689 0.010 23.95  ? 95   LEU B CB   1  
ATOM   4824   C CG   . LEU B 1 95  ? -2.105  9.082  -41.946 0.010 22.47  ? 95   LEU B CG   1  
ATOM   4825   C CD1  . LEU B 1 95  ? -1.934  10.435 -41.183 0.010 21.29  ? 95   LEU B CD1  1  
ATOM   4826   C CD2  . LEU B 1 95  ? -2.198  9.305  -43.440 0.010 22.53  ? 95   LEU B CD2  1  
ATOM   4827   H H    . LEU B 1 95  ? -2.945  6.666  -42.060 0.010 24.76  ? 95   LEU B H    1  
ATOM   4828   H HA   . LEU B 1 95  ? -0.710  7.038  -43.424 0.010 25.51  ? 95   LEU B HA   1  
ATOM   4829   H HB2  . LEU B 1 95  ? -1.019  7.847  -40.757 0.010 24.13  ? 95   LEU B HB2  1  
ATOM   4830   H HB3  . LEU B 1 95  ? -0.141  8.564  -41.866 0.010 23.97  ? 95   LEU B HB3  1  
ATOM   4831   H HG   . LEU B 1 95  ? -2.937  8.684  -41.651 0.010 22.46  ? 95   LEU B HG   1  
ATOM   4832   H HD11 . LEU B 1 95  ? -1.090  10.839 -41.434 0.010 21.39  ? 95   LEU B HD11 1  
ATOM   4833   H HD12 . LEU B 1 95  ? -2.665  11.021 -41.422 0.010 20.51  ? 95   LEU B HD12 1  
ATOM   4834   H HD13 . LEU B 1 95  ? -1.947  10.269 -40.228 0.010 21.42  ? 95   LEU B HD13 1  
ATOM   4835   H HD21 . LEU B 1 95  ? -1.306  9.426  -43.796 0.010 23.06  ? 95   LEU B HD21 1  
ATOM   4836   H HD22 . LEU B 1 95  ? -2.622  8.537  -43.852 0.010 23.12  ? 95   LEU B HD22 1  
ATOM   4837   H HD23 . LEU B 1 95  ? -2.729  10.103 -43.601 0.010 21.60  ? 95   LEU B HD23 1  
ATOM   4838   N N    . SER B 1 96  ? 1.218   5.984  -42.248 0.010 27.75  ? 96   SER B N    1  
ATOM   4839   C CA   . SER B 1 96  ? 2.306   5.133  -41.765 0.010 29.50  ? 96   SER B CA   1  
ATOM   4840   C C    . SER B 1 96  ? 2.282   4.941  -40.259 0.010 29.68  ? 96   SER B C    1  
ATOM   4841   O O    . SER B 1 96  ? 2.670   3.907  -39.730 0.010 31.38  ? 96   SER B O    1  
ATOM   4842   C CB   . SER B 1 96  ? 3.670   5.753  -42.125 0.010 29.77  ? 96   SER B CB   1  
ATOM   4843   O OG   . SER B 1 96  ? 4.460   5.987  -40.949 0.010 30.11  ? 96   SER B OG   1  
ATOM   4844   H H    . SER B 1 96  ? 1.493   6.615  -42.759 0.010 27.33  ? 96   SER B H    1  
ATOM   4845   H HA   . SER B 1 96  ? 2.260   4.274  -42.190 0.010 30.69  ? 96   SER B HA   1  
ATOM   4846   H HB2  . SER B 1 96  ? 4.146   5.129  -42.694 0.010 31.00  ? 96   SER B HB2  1  
ATOM   4847   H HB3  . SER B 1 96  ? 3.541   6.591  -42.596 0.010 28.62  ? 96   SER B HB3  1  
ATOM   4848   H HG   . SER B 1 96  ? 5.253   6.206  -41.160 0.010 30.82  ? 96   SER B HG   1  
ATOM   4849   N N    . GLU B 1 97  ? 1.865   5.979  -39.560 0.010 28.12  ? 97   GLU B N    1  
ATOM   4850   C CA   . GLU B 1 97  ? 1.815   5.937  -38.107 0.010 28.38  ? 97   GLU B CA   1  
ATOM   4851   C C    . GLU B 1 97  ? 0.848   7.023  -37.665 0.010 26.62  ? 97   GLU B C    1  
ATOM   4852   O O    . GLU B 1 97  ? 0.369   7.794  -38.496 0.010 25.29  ? 97   GLU B O    1  
ATOM   4853   C CB   . GLU B 1 97  ? 3.224   6.077  -37.498 0.010 29.35  ? 97   GLU B CB   1  
ATOM   4854   C CG   . GLU B 1 97  ? 3.852   4.684  -37.053 0.010 31.72  ? 97   GLU B CG   1  
ATOM   4855   C CD   . GLU B 1 97  ? 5.357   4.705  -36.699 0.010 32.95  ? 97   GLU B CD   1  
ATOM   4856   O OE1  . GLU B 1 97  ? 5.797   3.830  -35.893 0.010 34.22  ? 97   GLU B OE1  1  
ATOM   4857   O OE2  . GLU B 1 97  ? 6.092   5.545  -37.259 0.010 32.92  ? 97   GLU B OE2  1  
ATOM   4858   H H    . GLU B 1 97  ? 1.605   6.722  -39.907 0.010 27.02  ? 97   GLU B H    1  
ATOM   4859   H HA   . GLU B 1 97  ? 1.449   5.077  -37.840 0.010 29.23  ? 97   GLU B HA   1  
ATOM   4860   H HB2  . GLU B 1 97  ? 3.811   6.480  -38.156 0.010 29.02  ? 97   GLU B HB2  1  
ATOM   4861   H HB3  . GLU B 1 97  ? 3.166   6.646  -36.715 0.010 29.01  ? 97   GLU B HB3  1  
ATOM   4862   H HG2  . GLU B 1 97  ? 3.381   4.374  -36.264 0.010 32.21  ? 97   GLU B HG2  1  
ATOM   4863   H HG3  . GLU B 1 97  ? 3.755   4.030  -37.756 0.010 32.21  ? 97   GLU B HG3  1  
ATOM   4864   N N    . LYS B 1 98  ? 0.476   7.012  -36.394 0.010 26.89  ? 98   LYS B N    1  
ATOM   4865   C CA   . LYS B 1 98  ? -0.518  7.929  -35.895 0.010 25.72  ? 98   LYS B CA   1  
ATOM   4866   C C    . LYS B 1 98  ? 0.050   9.312  -36.148 0.010 24.59  ? 98   LYS B C    1  
ATOM   4867   O O    . LYS B 1 98  ? 1.240   9.538  -35.935 0.010 25.19  ? 98   LYS B O    1  
ATOM   4868   C CB   . LYS B 1 98  ? -0.672  7.833  -34.388 0.010 26.82  ? 98   LYS B CB   1  
ATOM   4869   C CG   . LYS B 1 98  ? -1.184  6.509  -33.823 0.010 28.11  ? 98   LYS B CG   1  
ATOM   4870   C CD   . LYS B 1 98  ? -0.393  5.957  -32.692 0.010 29.93  ? 98   LYS B CD   1  
ATOM   4871   C CE   . LYS B 1 98  ? -0.272  4.424  -32.723 0.010 31.65  ? 98   LYS B CE   1  
ATOM   4872   N NZ   . LYS B 1 98  ? 0.293   3.806  -31.522 0.010 33.61  ? 98   LYS B NZ   1  
ATOM   4873   H H    . LYS B 1 98  ? 0.799   6.491  -35.797 0.010 27.94  ? 98   LYS B H    1  
ATOM   4874   H HA   . LYS B 1 98  ? -1.374  7.805  -36.333 0.010 25.17  ? 98   LYS B HA   1  
ATOM   4875   H HB2  . LYS B 1 98  ? 0.179   8.039  -33.964 0.010 27.56  ? 98   LYS B HB2  1  
ATOM   4876   H HB3  . LYS B 1 98  ? -1.324  8.507  -34.147 0.010 26.22  ? 98   LYS B HB3  1  
ATOM   4877   H HG2  . LYS B 1 98  ? -2.083  6.686  -33.486 0.010 27.79  ? 98   LYS B HG2  1  
ATOM   4878   H HG3  . LYS B 1 98  ? -1.217  5.853  -34.519 0.010 28.36  ? 98   LYS B HG3  1  
ATOM   4879   H HD2  . LYS B 1 98  ? 0.505   6.300  -32.793 0.010 30.14  ? 98   LYS B HD2  1  
ATOM   4880   H HD3  . LYS B 1 98  ? -0.763  6.257  -31.850 0.010 30.00  ? 98   LYS B HD3  1  
ATOM   4881   H HE2  . LYS B 1 98  ? -1.028  3.886  -33.056 0.010 31.76  ? 98   LYS B HE2  1  
ATOM   4882   H HE3  . LYS B 1 98  ? 0.427   4.267  -33.509 0.010 31.62  ? 98   LYS B HE3  1  
ATOM   4883   H HZ1  . LYS B 1 98  ? 0.314   4.384  -30.844 0.010 33.55  ? 98   LYS B HZ1  1  
ATOM   4884   H HZ2  . LYS B 1 98  ? -0.204  3.097  -31.322 0.010 34.80  ? 98   LYS B HZ2  1  
ATOM   4885   H HZ3  . LYS B 1 98  ? 1.136   3.553  -31.690 0.010 33.79  ? 98   LYS B HZ3  1  
ATOM   4886   N N    . ALA B 1 99  ? -0.808  10.240 -36.555 0.010 23.17  ? 99   ALA B N    1  
ATOM   4887   C CA   . ALA B 1 99  ? -0.356  11.619 -36.740 0.010 22.26  ? 99   ALA B CA   1  
ATOM   4888   C C    . ALA B 1 99  ? -0.095  12.268 -35.384 0.010 22.65  ? 99   ALA B C    1  
ATOM   4889   O O    . ALA B 1 99  ? -0.858  12.115 -34.457 0.010 22.95  ? 99   ALA B O    1  
ATOM   4890   C CB   . ALA B 1 99  ? -1.407  12.419 -37.490 0.010 20.89  ? 99   ALA B CB   1  
ATOM   4891   H H    . ALA B 1 99  ? -1.640  10.101 -36.722 0.010 22.84  ? 99   ALA B H    1  
ATOM   4892   H HA   . ALA B 1 99  ? 0.466   11.631 -37.257 0.010 22.50  ? 99   ALA B HA   1  
ATOM   4893   H HB1  . ALA B 1 99  ? -2.234  12.386 -36.987 0.010 20.75  ? 99   ALA B HB1  1  
ATOM   4894   H HB2  . ALA B 1 99  ? -1.104  13.336 -37.559 0.010 20.45  ? 99   ALA B HB2  1  
ATOM   4895   H HB3  . ALA B 1 99  ? -1.543  12.048 -38.375 0.010 20.79  ? 99   ALA B HB3  1  
ATOM   4896   N N    . THR B 1 100 ? 1.011   12.986 -35.282 0.010 22.88  ? 100  THR B N    1  
ATOM   4897   C CA   . THR B 1 100 ? 1.258   13.816 -34.118 0.010 23.31  ? 100  THR B CA   1  
ATOM   4898   C C    . THR B 1 100 ? 0.322   15.015 -34.168 0.010 22.20  ? 100  THR B C    1  
ATOM   4899   O O    . THR B 1 100 ? 0.364   15.806 -35.097 0.010 21.32  ? 100  THR B O    1  
ATOM   4900   C CB   . THR B 1 100 ? 2.716   14.322 -34.064 0.010 24.10  ? 100  THR B CB   1  
ATOM   4901   O OG1  . THR B 1 100 ? 3.593   13.205 -34.205 0.010 25.25  ? 100  THR B OG1  1  
ATOM   4902   C CG2  . THR B 1 100 ? 2.971   14.996 -32.739 0.010 24.98  ? 100  THR B CG2  1  
ATOM   4903   H H    . THR B 1 100 ? 1.636   12.997 -35.868 0.010 22.94  ? 100  THR B H    1  
ATOM   4904   H HA   . THR B 1 100 ? 1.076   13.314 -33.310 0.010 24.02  ? 100  THR B HA   1  
ATOM   4905   H HB   . THR B 1 100 ? 2.884   14.952 -34.780 0.010 23.49  ? 100  THR B HB   1  
ATOM   4906   H HG1  . THR B 1 100 ? 3.525   12.705 -33.524 0.010 25.91  ? 100  THR B HG1  1  
ATOM   4907   H HG21 . THR B 1 100 ? 2.660   14.435 -32.014 0.010 25.60  ? 100  THR B HG21 1  
ATOM   4908   H HG22 . THR B 1 100 ? 3.918   15.156 -32.622 0.010 25.73  ? 100  THR B HG22 1  
ATOM   4909   H HG23 . THR B 1 100 ? 2.503   15.842 -32.702 0.010 24.39  ? 100  THR B HG23 1  
ATOM   4910   N N    . LEU B 1 101 ? -0.512  15.144 -33.157 0.010 22.47  ? 101  LEU B N    1  
ATOM   4911   C CA   . LEU B 1 101 ? -1.442  16.254 -33.120 0.010 21.75  ? 101  LEU B CA   1  
ATOM   4912   C C    . LEU B 1 101 ? -0.834  17.483 -32.468 0.010 22.29  ? 101  LEU B C    1  
ATOM   4913   O O    . LEU B 1 101 ? 0.128   17.410 -31.707 0.010 23.45  ? 101  LEU B O    1  
ATOM   4914   C CB   . LEU B 1 101 ? -2.724  15.888 -32.378 0.010 22.05  ? 101  LEU B CB   1  
ATOM   4915   C CG   . LEU B 1 101 ? -3.451  14.641 -32.857 0.010 21.91  ? 101  LEU B CG   1  
ATOM   4916   C CD1  . LEU B 1 101 ? -4.788  14.493 -32.067 0.010 22.46  ? 101  LEU B CD1  1  
ATOM   4917   C CD2  . LEU B 1 101 ? -3.665  14.665 -34.386 0.010 20.64  ? 101  LEU B CD2  1  
ATOM   4918   H H    . LEU B 1 101 ? -0.559  14.609 -32.488 0.010 23.19  ? 101  LEU B H    1  
ATOM   4919   H HA   . LEU B 1 101 ? -1.686  16.488 -34.027 0.010 20.88  ? 101  LEU B HA   1  
ATOM   4920   H HB2  . LEU B 1 101 ? -2.510  15.766 -31.442 0.010 23.03  ? 101  LEU B HB2  1  
ATOM   4921   H HB3  . LEU B 1 101 ? -3.343  16.626 -32.468 0.010 21.60  ? 101  LEU B HB3  1  
ATOM   4922   H HG   . LEU B 1 101 ? -2.897  13.874 -32.647 0.010 22.56  ? 101  LEU B HG   1  
ATOM   4923   H HD11 . LEU B 1 101 ? -5.306  15.309 -32.149 0.010 22.02  ? 101  LEU B HD11 1  
ATOM   4924   H HD12 . LEU B 1 101 ? -5.287  13.744 -32.428 0.010 22.43  ? 101  LEU B HD12 1  
ATOM   4925   H HD13 . LEU B 1 101 ? -4.585  14.332 -31.133 0.010 23.47  ? 101  LEU B HD13 1  
ATOM   4926   H HD21 . LEU B 1 101 ? -2.807  14.672 -34.835 0.010 20.55  ? 101  LEU B HD21 1  
ATOM   4927   H HD22 . LEU B 1 101 ? -4.159  13.874 -34.643 0.010 20.73  ? 101  LEU B HD22 1  
ATOM   4928   H HD23 . LEU B 1 101 ? -4.162  15.459 -34.626 0.010 20.06  ? 101  LEU B HD23 1  
ATOM   4929   N N    . GLY B 1 102 ? -1.427  18.623 -32.792 0.010 21.63  ? 102  GLY B N    1  
ATOM   4930   C CA   . GLY B 1 102 ? -1.002  19.873 -32.217 0.010 22.28  ? 102  GLY B CA   1  
ATOM   4931   C C    . GLY B 1 102 ? -1.925  20.967 -32.692 0.010 21.55  ? 102  GLY B C    1  
ATOM   4932   O O    . GLY B 1 102 ? -2.947  20.696 -33.321 0.010 20.63  ? 102  GLY B O    1  
ATOM   4933   H H    . GLY B 1 102 ? -2.077  18.689 -33.345 0.010 20.92  ? 102  GLY B H    1  
ATOM   4934   H HA2  . GLY B 1 102 ? -1.029  19.828 -31.251 0.010 23.22  ? 102  GLY B HA2  1  
ATOM   4935   H HA3  . GLY B 1 102 ? -0.094  20.069 -32.491 0.010 22.44  ? 102  GLY B HA3  1  
ATOM   4936   N N    . PRO B 1 103 ? -1.566  22.221 -32.414 0.010 22.16  ? 103  PRO B N    1  
ATOM   4937   C CA   . PRO B 1 103 ? -2.463  23.282 -32.867 0.010 21.70  ? 103  PRO B CA   1  
ATOM   4938   C C    . PRO B 1 103 ? -2.637  23.337 -34.374 0.010 20.37  ? 103  PRO B C    1  
ATOM   4939   O O    . PRO B 1 103 ? -3.652  23.918 -34.796 0.010 19.95  ? 103  PRO B O    1  
ATOM   4940   C CB   . PRO B 1 103 ? -1.808  24.563 -32.334 0.010 22.89  ? 103  PRO B CB   1  
ATOM   4941   C CG   . PRO B 1 103 ? -0.367  24.199 -32.105 0.010 23.54  ? 103  PRO B CG   1  
ATOM   4942   C CD   . PRO B 1 103 ? -0.385  22.737 -31.718 0.010 23.43  ? 103  PRO B CD   1  
ATOM   4943   H HA   . PRO B 1 103 ? -3.335  23.182 -32.464 0.010 21.80  ? 103  PRO B HA   1  
ATOM   4944   H HB2  . PRO B 1 103 ? -1.876  25.265 -32.995 0.010 22.56  ? 103  PRO B HB2  1  
ATOM   4945   H HB3  . PRO B 1 103 ? -2.240  24.826 -31.508 0.010 23.72  ? 103  PRO B HB3  1  
ATOM   4946   H HG2  . PRO B 1 103 ? 0.134   24.328 -32.924 0.010 23.04  ? 103  PRO B HG2  1  
ATOM   4947   H HG3  . PRO B 1 103 ? -0.001  24.742 -31.390 0.010 24.66  ? 103  PRO B HG3  1  
ATOM   4948   H HD2  . PRO B 1 103 ? 0.414   22.286 -32.030 0.010 23.38  ? 103  PRO B HD2  1  
ATOM   4949   H HD3  . PRO B 1 103 ? -0.501  22.642 -30.761 0.010 24.37  ? 103  PRO B HD3  1  
ATOM   4950   N N    . ALA B 1 104 ? -1.733  22.742 -35.148 0.010 19.95  ? 104  ALA B N    1  
ATOM   4951   C CA   . ALA B 1 104 ? -1.804  22.760 -36.617 0.010 18.98  ? 104  ALA B CA   1  
ATOM   4952   C C    . ALA B 1 104 ? -2.265  21.454 -37.251 0.010 18.23  ? 104  ALA B C    1  
ATOM   4953   O O    . ALA B 1 104 ? -2.432  21.365 -38.474 0.010 17.60  ? 104  ALA B O    1  
ATOM   4954   C CB   . ALA B 1 104 ? -0.415  23.126 -37.220 0.010 19.38  ? 104  ALA B CB   1  
ATOM   4955   H H    . ALA B 1 104 ? -1.058  22.316 -34.843 0.010 20.35  ? 104  ALA B H    1  
ATOM   4956   H HA   . ALA B 1 104 ? -2.439  23.441 -36.884 0.010 18.75  ? 104  ALA B HA   1  
ATOM   4957   H HB1  . ALA B 1 104 ? 0.219   22.448 -36.953 0.010 19.71  ? 104  ALA B HB1  1  
ATOM   4958   H HB2  . ALA B 1 104 ? -0.475  23.150 -38.188 0.010 18.90  ? 104  ALA B HB2  1  
ATOM   4959   H HB3  . ALA B 1 104 ? -0.137  23.989 -36.881 0.010 19.95  ? 104  ALA B HB3  1  
ATOM   4960   N N    . VAL B 1 105 ? -2.406  20.434 -36.414 0.010 18.57  ? 105  VAL B N    1  
ATOM   4961   C CA   . VAL B 1 105 ? -2.797  19.100 -36.870 0.010 18.21  ? 105  VAL B CA   1  
ATOM   4962   C C    . VAL B 1 105 ? -3.796  18.469 -35.889 0.010 18.56  ? 105  VAL B C    1  
ATOM   4963   O O    . VAL B 1 105 ? -3.456  18.114 -34.759 0.010 19.45  ? 105  VAL B O    1  
ATOM   4964   C CB   . VAL B 1 105 ? -1.569  18.176 -37.020 0.010 18.71  ? 105  VAL B CB   1  
ATOM   4965   C CG1  . VAL B 1 105 ? -1.977  16.815 -37.545 0.010 18.60  ? 105  VAL B CG1  1  
ATOM   4966   C CG2  . VAL B 1 105 ? -0.514  18.818 -37.931 0.010 18.71  ? 105  VAL B CG2  1  
ATOM   4967   H H    . VAL B 1 105 ? -2.267  20.485 -35.568 0.010 19.14  ? 105  VAL B H    1  
ATOM   4968   H HA   . VAL B 1 105 ? -3.219  19.166 -37.736 0.010 17.64  ? 105  VAL B HA   1  
ATOM   4969   H HB   . VAL B 1 105 ? -1.181  18.044 -36.139 0.010 19.37  ? 105  VAL B HB   1  
ATOM   4970   H HG11 . VAL B 1 105 ? -2.605  16.931 -38.274 0.010 18.03  ? 105  VAL B HG11 1  
ATOM   4971   H HG12 . VAL B 1 105 ? -1.188  16.354 -37.866 0.010 18.93  ? 105  VAL B HG12 1  
ATOM   4972   H HG13 . VAL B 1 105 ? -2.400  16.308 -36.835 0.010 18.93  ? 105  VAL B HG13 1  
ATOM   4973   H HG21 . VAL B 1 105 ? -0.278  19.686 -37.580 0.010 18.90  ? 105  VAL B HG21 1  
ATOM   4974   H HG22 . VAL B 1 105 ? 0.271   18.254 -37.952 0.010 19.22  ? 105  VAL B HG22 1  
ATOM   4975   H HG23 . VAL B 1 105 ? -0.875  18.906 -38.824 0.010 18.19  ? 105  VAL B HG23 1  
ATOM   4976   N N    . ARG B 1 106 ? -5.047  18.388 -36.327 0.010 18.07  ? 106  ARG B N    1  
ATOM   4977   C CA   . ARG B 1 106 ? -6.138  17.878 -35.502 0.010 18.57  ? 106  ARG B CA   1  
ATOM   4978   C C    . ARG B 1 106 ? -7.222  17.309 -36.408 0.010 18.08  ? 106  ARG B C    1  
ATOM   4979   O O    . ARG B 1 106 ? -7.588  17.916 -37.405 0.010 17.40  ? 106  ARG B O    1  
ATOM   4980   C CB   . ARG B 1 106 ? -6.807  18.967 -34.641 0.010 19.07  ? 106  ARG B CB   1  
ATOM   4981   C CG   . ARG B 1 106 ? -6.030  19.416 -33.437 0.010 20.00  ? 106  ARG B CG   1  
ATOM   4982   C CD   . ARG B 1 106 ? -6.859  20.363 -32.519 0.010 20.88  ? 106  ARG B CD   1  
ATOM   4983   N NE   . ARG B 1 106 ? -6.624  21.780 -32.819 0.010 20.80  ? 106  ARG B NE   1  
ATOM   4984   C CZ   . ARG B 1 106 ? -7.388  22.776 -32.374 0.010 21.46  ? 106  ARG B CZ   1  
ATOM   4985   N NH1  . ARG B 1 106 ? -8.430  22.536 -31.574 0.010 22.30  ? 106  ARG B NH1  1  
ATOM   4986   N NH2  . ARG B 1 106 ? -7.079  24.021 -32.680 0.010 21.57  ? 106  ARG B NH2  1  
ATOM   4987   H H    . ARG B 1 106 ? -5.291  18.629 -37.114 0.010 17.56  ? 106  ARG B H    1  
ATOM   4988   H HA   . ARG B 1 106 ? -5.788  17.197 -34.913 0.010 19.12  ? 106  ARG B HA   1  
ATOM   4989   H HB2  . ARG B 1 106 ? -6.970  19.746 -35.196 0.010 18.62  ? 106  ARG B HB2  1  
ATOM   4990   H HB3  . ARG B 1 106 ? -7.652  18.617 -34.314 0.010 19.46  ? 106  ARG B HB3  1  
ATOM   4991   H HG2  . ARG B 1 106 ? -5.755  18.638 -32.931 0.010 20.51  ? 106  ARG B HG2  1  
ATOM   4992   H HG3  . ARG B 1 106 ? -5.253  19.904 -33.744 0.010 19.72  ? 106  ARG B HG3  1  
ATOM   4993   H HD2  . ARG B 1 106 ? -7.802  20.187 -32.648 0.010 20.80  ? 106  ARG B HD2  1  
ATOM   4994   H HD3  . ARG B 1 106 ? -6.617  20.203 -31.595 0.010 21.81  ? 106  ARG B HD3  1  
ATOM   4995   H HE   . ARG B 1 106 ? -5.841  21.987 -33.104 0.010 20.64  ? 106  ARG B HE   1  
ATOM   4996   H HH11 . ARG B 1 106 ? -8.629  21.730 -31.361 0.010 22.38  ? 106  ARG B HH11 1  
ATOM   4997   H HH12 . ARG B 1 106 ? -8.914  23.186 -31.284 0.010 22.87  ? 106  ARG B HH12 1  
ATOM   4998   H HH21 . ARG B 1 106 ? -6.404  24.179 -33.191 0.010 21.16  ? 106  ARG B HH21 1  
ATOM   4999   H HH22 . ARG B 1 106 ? -7.567  24.672 -32.391 0.010 22.13  ? 106  ARG B HH22 1  
ATOM   5000   N N    . PRO B 1 107 ? -7.736  16.129 -36.058 0.010 18.63  ? 107  PRO B N    1  
ATOM   5001   C CA   . PRO B 1 107 ? -8.781  15.555 -36.893 0.010 18.44  ? 107  PRO B CA   1  
ATOM   5002   C C    . PRO B 1 107 ? -10.049 16.361 -36.742 0.010 18.49  ? 107  PRO B C    1  
ATOM   5003   O O    . PRO B 1 107 ? -10.254 16.977 -35.695 0.010 19.06  ? 107  PRO B O    1  
ATOM   5004   C CB   . PRO B 1 107 ? -8.990  14.153 -36.300 0.010 19.41  ? 107  PRO B CB   1  
ATOM   5005   C CG   . PRO B 1 107 ? -8.524  14.250 -34.936 0.010 20.15  ? 107  PRO B CG   1  
ATOM   5006   C CD   . PRO B 1 107 ? -7.431  15.288 -34.900 0.010 19.62  ? 107  PRO B CD   1  
ATOM   5007   H HA   . PRO B 1 107 ? -8.489  15.504 -37.809 0.010 17.95  ? 107  PRO B HA   1  
ATOM   5008   H HB2  . PRO B 1 107 ? -9.934  13.941 -36.326 0.010 19.75  ? 107  PRO B HB2  1  
ATOM   5009   H HB3  . PRO B 1 107 ? -8.479  13.496 -36.794 0.010 19.36  ? 107  PRO B HB3  1  
ATOM   5010   H HG2  . PRO B 1 107 ? -9.262  14.509 -34.363 0.010 20.71  ? 107  PRO B HG2  1  
ATOM   5011   H HG3  . PRO B 1 107 ? -8.167  13.394 -34.660 0.010 20.61  ? 107  PRO B HG3  1  
ATOM   5012   H HD2  . PRO B 1 107 ? -7.479  15.810 -34.085 0.010 20.11  ? 107  PRO B HD2  1  
ATOM   5013   H HD3  . PRO B 1 107 ? -6.565  14.868 -35.008 0.010 19.60  ? 107  PRO B HD3  1  
ATOM   5014   N N    . LEU B 1 108 ? -10.882 16.344 -37.774 0.010 18.14  ? 108  LEU B N    1  
ATOM   5015   C CA   . LEU B 1 108 ? -12.150 17.044 -37.740 0.010 18.35  ? 108  LEU B CA   1  
ATOM   5016   C C    . LEU B 1 108 ? -13.298 16.046 -37.616 0.010 19.24  ? 108  LEU B C    1  
ATOM   5017   O O    . LEU B 1 108 ? -13.364 15.100 -38.372 0.010 19.25  ? 108  LEU B O    1  
ATOM   5018   C CB   . LEU B 1 108 ? -12.337 17.836 -39.031 0.010 17.61  ? 108  LEU B CB   1  
ATOM   5019   C CG   . LEU B 1 108 ? -13.682 18.536 -39.152 0.010 17.98  ? 108  LEU B CG   1  
ATOM   5020   C CD1  . LEU B 1 108 ? -13.995 19.339 -37.920 0.010 18.62  ? 108  LEU B CD1  1  
ATOM   5021   C CD2  . LEU B 1 108 ? -13.682 19.428 -40.377 0.010 17.40  ? 108  LEU B CD2  1  
ATOM   5022   H H    . LEU B 1 108 ? -10.736 15.928 -38.513 0.010 17.90  ? 108  LEU B H    1  
ATOM   5023   H HA   . LEU B 1 108 ? -12.153 17.654 -36.993 0.010 18.60  ? 108  LEU B HA   1  
ATOM   5024   H HB2  . LEU B 1 108 ? -11.644 18.513 -39.088 0.010 17.20  ? 108  LEU B HB2  1  
ATOM   5025   H HB3  . LEU B 1 108 ? -12.254 17.231 -39.783 0.010 17.45  ? 108  LEU B HB3  1  
ATOM   5026   H HG   . LEU B 1 108 ? -14.374 17.866 -39.260 0.010 18.43  ? 108  LEU B HG   1  
ATOM   5027   H HD11 . LEU B 1 108 ? -13.252 19.322 -37.305 0.010 18.51  ? 108  LEU B HD11 1  
ATOM   5028   H HD12 . LEU B 1 108 ? -14.163 20.259 -38.176 0.010 18.61  ? 108  LEU B HD12 1  
ATOM   5029   H HD13 . LEU B 1 108 ? -14.791 18.969 -37.511 0.010 19.32  ? 108  LEU B HD13 1  
ATOM   5030   H HD21 . LEU B 1 108 ? -12.784 19.764 -40.527 0.010 17.00  ? 108  LEU B HD21 1  
ATOM   5031   H HD22 . LEU B 1 108 ? -13.963 18.907 -41.144 0.010 17.28  ? 108  LEU B HD22 1  
ATOM   5032   H HD23 . LEU B 1 108 ? -14.295 20.165 -40.242 0.010 17.75  ? 108  LEU B HD23 1  
ATOM   5033   N N    . PRO B 1 109 ? -14.215 16.284 -36.675 0.010 20.21  ? 109  PRO B N    1  
ATOM   5034   C CA   . PRO B 1 109 ? -15.462 15.518 -36.628 0.010 21.32  ? 109  PRO B CA   1  
ATOM   5035   C C    . PRO B 1 109 ? -16.217 15.497 -37.969 0.010 21.07  ? 109  PRO B C    1  
ATOM   5036   O O    . PRO B 1 109 ? -16.429 16.550 -38.584 0.010 20.48  ? 109  PRO B O    1  
ATOM   5037   C CB   . PRO B 1 109 ? -16.261 16.268 -35.577 0.010 22.33  ? 109  PRO B CB   1  
ATOM   5038   C CG   . PRO B 1 109 ? -15.230 16.776 -34.647 0.010 22.09  ? 109  PRO B CG   1  
ATOM   5039   C CD   . PRO B 1 109 ? -14.083 17.170 -35.509 0.010 20.59  ? 109  PRO B CD   1  
ATOM   5040   H HA   . PRO B 1 109 ? -15.303 14.613 -36.321 0.010 21.81  ? 109  PRO B HA   1  
ATOM   5041   H HB2  . PRO B 1 109 ? -16.745 17.000 -35.988 0.010 22.22  ? 109  PRO B HB2  1  
ATOM   5042   H HB3  . PRO B 1 109 ? -16.863 15.660 -35.126 0.010 23.36  ? 109  PRO B HB3  1  
ATOM   5043   H HG2  . PRO B 1 109 ? -15.574 17.544 -34.165 0.010 22.52  ? 109  PRO B HG2  1  
ATOM   5044   H HG3  . PRO B 1 109 ? -14.966 16.072 -34.037 0.010 22.62  ? 109  PRO B HG3  1  
ATOM   5045   H HD2  . PRO B 1 109 ? -14.162 18.102 -35.740 0.010 20.28  ? 109  PRO B HD2  1  
ATOM   5046   H HD3  . PRO B 1 109 ? -13.244 16.991 -35.056 0.010 20.48  ? 109  PRO B HD3  1  
ATOM   5047   N N    . TRP B 1 110 ? -16.636 14.316 -38.406 0.010 21.73  ? 110  TRP B N    1  
ATOM   5048   C CA   . TRP B 1 110 ? -17.417 14.210 -39.625 0.010 21.82  ? 110  TRP B CA   1  
ATOM   5049   C C    . TRP B 1 110 ? -18.841 13.789 -39.308 0.010 23.39  ? 110  TRP B C    1  
ATOM   5050   O O    . TRP B 1 110 ? -19.108 13.199 -38.271 0.010 24.49  ? 110  TRP B O    1  
ATOM   5051   C CB   . TRP B 1 110 ? -16.751 13.307 -40.669 0.010 21.45  ? 110  TRP B CB   1  
ATOM   5052   C CG   . TRP B 1 110 ? -16.429 11.915 -40.247 0.010 22.28  ? 110  TRP B CG   1  
ATOM   5053   C CD1  . TRP B 1 110 ? -15.248 11.455 -39.760 0.010 22.01  ? 110  TRP B CD1  1  
ATOM   5054   C CD2  . TRP B 1 110 ? -17.304 10.778 -40.314 0.010 23.77  ? 110  TRP B CD2  1  
ATOM   5055   N NE1  . TRP B 1 110 ? -15.321 10.111 -39.511 0.010 23.23  ? 110  TRP B NE1  1  
ATOM   5056   C CE2  . TRP B 1 110 ? -16.578 9.666  -39.833 0.010 24.35  ? 110  TRP B CE2  1  
ATOM   5057   C CE3  . TRP B 1 110 ? -18.619 10.598 -40.732 0.010 24.86  ? 110  TRP B CE3  1  
ATOM   5058   C CZ2  . TRP B 1 110 ? -17.124 8.393  -39.762 0.010 25.99  ? 110  TRP B CZ2  1  
ATOM   5059   C CZ3  . TRP B 1 110 ? -19.167 9.333  -40.659 0.010 26.49  ? 110  TRP B CZ3  1  
ATOM   5060   C CH2  . TRP B 1 110 ? -18.419 8.240  -40.172 0.010 27.05  ? 110  TRP B CH2  1  
ATOM   5061   H H    . TRP B 1 110 ? -16.489 13.565 -38.015 0.010 22.27  ? 110  TRP B H    1  
ATOM   5062   H HA   . TRP B 1 110 ? -17.492 15.088 -40.025 0.010 21.29  ? 110  TRP B HA   1  
ATOM   5063   H HB2  . TRP B 1 110 ? -17.339 13.253 -41.438 0.010 21.70  ? 110  TRP B HB2  1  
ATOM   5064   H HB3  . TRP B 1 110 ? -15.915 13.721 -40.937 0.010 20.56  ? 110  TRP B HB3  1  
ATOM   5065   H HD1  . TRP B 1 110 ? -14.495 11.979 -39.614 0.010 21.24  ? 110  TRP B HD1  1  
ATOM   5066   H HE1  . TRP B 1 110 ? -14.688 9.626  -39.189 0.010 23.40  ? 110  TRP B HE1  1  
ATOM   5067   H HE3  . TRP B 1 110 ? -19.115 11.315 -41.051 0.010 24.63  ? 110  TRP B HE3  1  
ATOM   5068   H HZ2  . TRP B 1 110 ? -16.634 7.671  -39.443 0.010 26.48  ? 110  TRP B HZ2  1  
ATOM   5069   H HZ3  . TRP B 1 110 ? -20.046 9.206  -40.930 0.010 27.36  ? 110  TRP B HZ3  1  
ATOM   5070   H HH2  . TRP B 1 110 ? -18.809 7.399  -40.129 0.010 28.29  ? 110  TRP B HH2  1  
ATOM   5071   N N    . GLN B 1 111 ? -19.743 14.161 -40.203 0.010 23.64  ? 111  GLN B N    1  
ATOM   5072   C CA   . GLN B 1 111 ? -21.174 14.043 -39.957 0.010 25.28  ? 111  GLN B CA   1  
ATOM   5073   C C    . GLN B 1 111 ? -21.583 12.596 -40.063 0.010 26.52  ? 111  GLN B C    1  
ATOM   5074   O O    . GLN B 1 111 ? -21.409 11.974 -41.105 0.010 26.41  ? 111  GLN B O    1  
ATOM   5075   C CB   . GLN B 1 111 ? -21.981 14.861 -40.971 0.010 25.39  ? 111  GLN B CB   1  
ATOM   5076   C CG   . GLN B 1 111 ? -23.489 14.825 -40.722 0.010 27.31  ? 111  GLN B CG   1  
ATOM   5077   C CD   . GLN B 1 111 ? -23.819 15.231 -39.312 0.010 28.20  ? 111  GLN B CD   1  
ATOM   5078   O OE1  . GLN B 1 111 ? -24.057 14.381 -38.448 0.010 29.48  ? 111  GLN B OE1  1  
ATOM   5079   N NE2  . GLN B 1 111 ? -23.812 16.541 -39.054 0.010 27.76  ? 111  GLN B NE2  1  
ATOM   5080   H H    . GLN B 1 111 ? -19.546 14.479 -40.978 0.010 22.98  ? 111  GLN B H    1  
ATOM   5081   H HA   . GLN B 1 111 ? -21.369 14.359 -39.062 0.010 25.76  ? 111  GLN B HA   1  
ATOM   5082   H HB2  . GLN B 1 111 ? -21.697 15.787 -40.927 0.010 24.68  ? 111  GLN B HB2  1  
ATOM   5083   H HB3  . GLN B 1 111 ? -21.818 14.507 -41.859 0.010 25.12  ? 111  GLN B HB3  1  
ATOM   5084   H HG2  . GLN B 1 111 ? -23.929 15.438 -41.327 0.010 27.35  ? 111  GLN B HG2  1  
ATOM   5085   H HG3  . GLN B 1 111 ? -23.818 13.925 -40.858 0.010 28.13  ? 111  GLN B HG3  1  
ATOM   5086   H HE21 . GLN B 1 111 ? -23.973 17.101 -39.683 0.010 27.46  ? 111  GLN B HE21 1  
ATOM   5087   H HE22 . GLN B 1 111 ? -23.652 16.826 -38.259 0.010 27.90  ? 111  GLN B HE22 1  
ATOM   5088   N N    . ARG B 1 112 ? -22.114 12.077 -38.959 0.010 27.93  ? 112  ARG B N    1  
ATOM   5089   C CA   . ARG B 1 112 ? -22.646 10.722 -38.879 0.010 29.60  ? 112  ARG B CA   1  
ATOM   5090   C C    . ARG B 1 112 ? -24.183 10.679 -38.884 0.010 31.58  ? 112  ARG B C    1  
ATOM   5091   O O    . ARG B 1 112 ? -24.762 9.630  -39.124 0.010 33.11  ? 112  ARG B O    1  
ATOM   5092   C CB   . ARG B 1 112 ? -22.155 10.063 -37.596 0.010 30.23  ? 112  ARG B CB   1  
ATOM   5093   C CG   . ARG B 1 112 ? -20.672 9.846  -37.574 0.010 28.74  ? 112  ARG B CG   1  
ATOM   5094   C CD   . ARG B 1 112 ? -20.078 9.934  -36.176 0.010 28.82  ? 112  ARG B CD   1  
ATOM   5095   N NE   . ARG B 1 112 ? -18.659 9.618  -36.233 0.010 27.65  ? 112  ARG B NE   1  
ATOM   5096   C CZ   . ARG B 1 112 ? -18.188 8.391  -36.439 0.010 28.24  ? 112  ARG B CZ   1  
ATOM   5097   N NH1  . ARG B 1 112 ? -19.034 7.365  -36.587 0.010 30.01  ? 112  ARG B NH1  1  
ATOM   5098   N NH2  . ARG B 1 112 ? -16.876 8.197  -36.490 0.010 27.30  ? 112  ARG B NH2  1  
ATOM   5099   H H    . ARG B 1 112 ? -22.173 12.505 -38.216 0.010 28.10  ? 112  ARG B H    1  
ATOM   5100   H HA   . ARG B 1 112 ? -22.323 10.202 -39.630 0.010 29.29  ? 112  ARG B HA   1  
ATOM   5101   H HB2  . ARG B 1 112 ? -22.380 10.630 -36.844 0.010 30.51  ? 112  ARG B HB2  1  
ATOM   5102   H HB3  . ARG B 1 112 ? -22.591 9.202  -37.501 0.010 31.55  ? 112  ARG B HB3  1  
ATOM   5103   H HG2  . ARG B 1 112 ? -20.481 8.966  -37.931 0.010 29.16  ? 112  ARG B HG2  1  
ATOM   5104   H HG3  . ARG B 1 112 ? -20.245 10.521 -38.123 0.010 27.45  ? 112  ARG B HG3  1  
ATOM   5105   H HD2  . ARG B 1 112 ? -20.183 10.836 -35.833 0.010 28.41  ? 112  ARG B HD2  1  
ATOM   5106   H HD3  . ARG B 1 112 ? -20.512 9.292  -35.592 0.010 30.23  ? 112  ARG B HD3  1  
ATOM   5107   H HE   . ARG B 1 112 ? -18.124 10.186 -35.879 0.010 27.02  ? 112  ARG B HE   1  
ATOM   5108   H HH11 . ARG B 1 112 ? -19.883 7.495  -36.557 0.010 30.74  ? 112  ARG B HH11 1  
ATOM   5109   H HH12 . ARG B 1 112 ? -18.729 6.571  -36.717 0.010 30.53  ? 112  ARG B HH12 1  
ATOM   5110   H HH21 . ARG B 1 112 ? -16.337 8.860  -36.387 0.010 26.29  ? 112  ARG B HH21 1  
ATOM   5111   H HH22 . ARG B 1 112 ? -16.564 7.405  -36.614 0.010 27.80  ? 112  ARG B HH22 1  
ATOM   5112   N N    . VAL B 1 113 ? -24.826 11.809 -38.598 0.010 31.80  ? 113  VAL B N    1  
ATOM   5113   C CA   . VAL B 1 113 ? -26.288 11.873 -38.623 0.010 33.86  ? 113  VAL B CA   1  
ATOM   5114   C C    . VAL B 1 113 ? -26.695 12.292 -40.026 0.010 33.49  ? 113  VAL B C    1  
ATOM   5115   O O    . VAL B 1 113 ? -26.255 13.328 -40.547 0.010 31.95  ? 113  VAL B O    1  
ATOM   5116   C CB   . VAL B 1 113 ? -26.880 12.840 -37.558 0.010 34.82  ? 113  VAL B CB   1  
ATOM   5117   C CG1  . VAL B 1 113 ? -28.399 12.905 -37.661 0.010 37.19  ? 113  VAL B CG1  1  
ATOM   5118   C CG2  . VAL B 1 113 ? -26.484 12.398 -36.153 0.010 35.46  ? 113  VAL B CG2  1  
ATOM   5119   H H    . VAL B 1 113 ? -24.441 12.549 -38.393 0.010 30.92  ? 113  VAL B H    1  
ATOM   5120   H HA   . VAL B 1 113 ? -26.658 10.994 -38.457 0.010 35.15  ? 113  VAL B HA   1  
ATOM   5121   H HB   . VAL B 1 113 ? -26.532 13.733 -37.707 0.010 33.70  ? 113  VAL B HB   1  
ATOM   5122   H HG11 . VAL B 1 113 ? -28.759 12.012 -37.559 0.010 38.26  ? 113  VAL B HG11 1  
ATOM   5123   H HG12 . VAL B 1 113 ? -28.733 13.478 -36.953 0.010 38.15  ? 113  VAL B HG12 1  
ATOM   5124   H HG13 . VAL B 1 113 ? -28.653 13.270 -38.522 0.010 36.82  ? 113  VAL B HG13 1  
ATOM   5125   H HG21 . VAL B 1 113 ? -25.520 12.275 -36.122 0.010 34.14  ? 113  VAL B HG21 1  
ATOM   5126   H HG22 . VAL B 1 113 ? -26.752 13.083 -35.521 0.010 35.86  ? 113  VAL B HG22 1  
ATOM   5127   H HG23 . VAL B 1 113 ? -26.933 11.565 -35.946 0.010 36.95  ? 113  VAL B HG23 1  
ATOM   5128   N N    . ASP B 1 114 ? -27.514 11.451 -40.642 0.010 35.09  ? 114  ASP B N    1  
ATOM   5129   C CA   . ASP B 1 114 ? -27.824 11.584 -42.051 0.010 35.03  ? 114  ASP B CA   1  
ATOM   5130   C C    . ASP B 1 114 ? -29.065 12.448 -42.251 0.010 36.35  ? 114  ASP B C    1  
ATOM   5131   O O    . ASP B 1 114 ? -30.135 11.946 -42.577 0.010 38.47  ? 114  ASP B O    1  
ATOM   5132   C CB   . ASP B 1 114 ? -28.006 10.199 -42.664 0.010 36.33  ? 114  ASP B CB   1  
ATOM   5133   C CG   . ASP B 1 114 ? -28.152 10.237 -44.163 0.010 36.38  ? 114  ASP B CG   1  
ATOM   5134   O OD1  . ASP B 1 114 ? -28.163 11.341 -44.740 0.010 35.44  ? 114  ASP B OD1  1  
ATOM   5135   O OD2  . ASP B 1 114 ? -28.265 9.155  -44.773 0.010 37.58  ? 114  ASP B OD2  1  
ATOM   5136   H H    . ASP B 1 114 ? -27.901 10.789 -40.260 0.010 36.37  ? 114  ASP B H    1  
ATOM   5137   H HA   . ASP B 1 114 ? -27.083 12.015 -42.505 0.010 33.45  ? 114  ASP B HA   1  
ATOM   5138   H HB2  . ASP B 1 114 ? -27.227 9.661  -42.457 0.010 35.64  ? 114  ASP B HB2  1  
ATOM   5139   H HB3  . ASP B 1 114 ? -28.801 9.785  -42.293 0.010 38.07  ? 114  ASP B HB3  1  
ATOM   5140   N N    . ARG B 1 115 ? -28.902 13.745 -41.997 0.010 35.28  ? 115  ARG B N    1  
ATOM   5141   C CA   . ARG B 1 115 ? -29.826 14.773 -42.467 0.010 36.21  ? 115  ARG B CA   1  
ATOM   5142   C C    . ARG B 1 115 ? -29.046 15.661 -43.463 0.010 34.25  ? 115  ARG B C    1  
ATOM   5143   O O    . ARG B 1 115 ? -27.860 15.927 -43.268 0.010 32.28  ? 115  ARG B O    1  
ATOM   5144   C CB   . ARG B 1 115 ? -30.372 15.630 -41.309 0.010 37.36  ? 115  ARG B CB   1  
ATOM   5145   C CG   . ARG B 1 115 ? -31.448 14.982 -40.427 0.010 39.77  ? 115  ARG B CG   1  
ATOM   5146   C CD   . ARG B 1 115 ? -31.649 15.774 -39.128 0.010 40.71  ? 115  ARG B CD   1  
ATOM   5147   N NE   . ARG B 1 115 ? -33.030 16.229 -38.921 0.010 43.36  ? 115  ARG B NE   1  
ATOM   5148   C CZ   . ARG B 1 115 ? -33.569 17.277 -39.535 0.010 43.63  ? 115  ARG B CZ   1  
ATOM   5149   N NH1  . ARG B 1 115 ? -32.858 17.965 -40.428 0.010 41.40  ? 115  ARG B NH1  1  
ATOM   5150   N NH2  . ARG B 1 115 ? -34.827 17.628 -39.275 0.010 46.34  ? 115  ARG B NH2  1  
ATOM   5151   H H    . ARG B 1 115 ? -28.250 14.058 -41.535 0.010 34.12  ? 115  ARG B H    1  
ATOM   5152   H HA   . ARG B 1 115 ? -30.574 14.368 -42.932 0.010 37.56  ? 115  ARG B HA   1  
ATOM   5153   H HB2  . ARG B 1 115 ? -29.628 15.863 -40.731 0.010 36.15  ? 115  ARG B HB2  1  
ATOM   5154   H HB3  . ARG B 1 115 ? -30.758 16.439 -41.678 0.010 37.95  ? 115  ARG B HB3  1  
ATOM   5155   H HG2  . ARG B 1 115 ? -32.289 14.962 -40.906 0.010 41.28  ? 115  ARG B HG2  1  
ATOM   5156   H HG3  . ARG B 1 115 ? -31.173 14.082 -40.192 0.010 39.44  ? 115  ARG B HG3  1  
ATOM   5157   H HD2  . ARG B 1 115 ? -31.399 15.213 -38.378 0.010 41.07  ? 115  ARG B HD2  1  
ATOM   5158   H HD3  . ARG B 1 115 ? -31.085 16.562 -39.147 0.010 39.38  ? 115  ARG B HD3  1  
ATOM   5159   H HE   . ARG B 1 115 ? -33.566 15.691 -38.515 0.010 44.97  ? 115  ARG B HE   1  
ATOM   5160   H HH11 . ARG B 1 115 ? -32.045 17.744 -40.597 0.010 39.77  ? 115  ARG B HH11 1  
ATOM   5161   H HH12 . ARG B 1 115 ? -33.208 18.639 -40.830 0.010 41.69  ? 115  ARG B HH12 1  
ATOM   5162   H HH21 . ARG B 1 115 ? -35.288 17.182 -38.704 0.010 47.91  ? 115  ARG B HH21 1  
ATOM   5163   H HH22 . ARG B 1 115 ? -35.179 18.299 -39.681 0.010 46.62  ? 115  ARG B HH22 1  
ATOM   5164   N N    . ASP B 1 116 ? -29.698 16.090 -44.538 0.010 35.00  ? 116  ASP B N    1  
ATOM   5165   C CA   . ASP B 1 116 ? -29.064 16.993 -45.490 0.010 33.54  ? 116  ASP B CA   1  
ATOM   5166   C C    . ASP B 1 116 ? -28.597 18.243 -44.775 0.010 32.45  ? 116  ASP B C    1  
ATOM   5167   O O    . ASP B 1 116 ? -29.140 18.626 -43.760 0.010 33.39  ? 116  ASP B O    1  
ATOM   5168   C CB   . ASP B 1 116 ? -30.060 17.432 -46.561 0.010 35.09  ? 116  ASP B CB   1  
ATOM   5169   C CG   . ASP B 1 116 ? -30.357 16.354 -47.592 0.010 36.04  ? 116  ASP B CG   1  
ATOM   5170   O OD1  . ASP B 1 116 ? -29.427 15.775 -48.204 0.010 34.80  ? 116  ASP B OD1  1  
ATOM   5171   O OD2  . ASP B 1 116 ? -31.545 16.106 -47.812 0.010 38.28  ? 116  ASP B OD2  1  
ATOM   5172   H H    . ASP B 1 116 ? -30.506 15.877 -44.739 0.010 36.46  ? 116  ASP B H    1  
ATOM   5173   H HA   . ASP B 1 116 ? -28.307 16.560 -45.914 0.010 32.47  ? 116  ASP B HA   1  
ATOM   5174   H HB2  . ASP B 1 116 ? -30.898 17.663 -46.130 0.010 36.49  ? 116  ASP B HB2  1  
ATOM   5175   H HB3  . ASP B 1 116 ? -29.696 18.202 -47.024 0.010 34.31  ? 116  ASP B HB3  1  
ATOM   5176   N N    . VAL B 1 117 ? -27.572 18.889 -45.306 0.010 30.66  ? 117  VAL B N    1  
ATOM   5177   C CA   . VAL B 1 117 ? -27.249 20.213 -44.835 0.010 30.01  ? 117  VAL B CA   1  
ATOM   5178   C C    . VAL B 1 117 ? -28.319 21.175 -45.348 0.010 31.59  ? 117  VAL B C    1  
ATOM   5179   O O    . VAL B 1 117 ? -28.720 21.112 -46.498 0.010 32.20  ? 117  VAL B O    1  
ATOM   5180   C CB   . VAL B 1 117 ? -25.884 20.656 -45.334 0.010 27.98  ? 117  VAL B CB   1  
ATOM   5181   C CG1  . VAL B 1 117 ? -25.620 22.062 -44.867 0.010 27.67  ? 117  VAL B CG1  1  
ATOM   5182   C CG2  . VAL B 1 117 ? -24.799 19.647 -44.856 0.010 26.60  ? 117  VAL B CG2  1  
ATOM   5183   H H    . VAL B 1 117 ? -27.053 18.588 -45.922 0.010 29.94  ? 117  VAL B H    1  
ATOM   5184   H HA   . VAL B 1 117 ? -27.248 20.232 -43.864 0.010 30.13  ? 117  VAL B HA   1  
ATOM   5185   H HB   . VAL B 1 117 ? -25.889 20.654 -46.303 0.010 28.00  ? 117  VAL B HB   1  
ATOM   5186   H HG11 . VAL B 1 117 ? -25.795 22.116 -43.916 0.010 28.07  ? 117  VAL B HG11 1  
ATOM   5187   H HG12 . VAL B 1 117 ? -24.693 22.285 -45.046 0.010 26.42  ? 117  VAL B HG12 1  
ATOM   5188   H HG13 . VAL B 1 117 ? -26.194 22.676 -45.349 0.010 28.48  ? 117  VAL B HG13 1  
ATOM   5189   H HG21 . VAL B 1 117 ? -24.871 19.539 -43.896 0.010 26.85  ? 117  VAL B HG21 1  
ATOM   5190   H HG22 . VAL B 1 117 ? -24.949 18.793 -45.287 0.010 26.87  ? 117  VAL B HG22 1  
ATOM   5191   H HG23 . VAL B 1 117 ? -23.920 19.979 -45.091 0.010 25.43  ? 117  VAL B HG23 1  
ATOM   5192   N N    . ALA B 1 118 ? -28.760 22.063 -44.476 0.010 32.44  ? 118  ALA B N    1  
ATOM   5193   C CA   . ALA B 1 118 ? -29.779 23.050 -44.821 0.010 34.20  ? 118  ALA B CA   1  
ATOM   5194   C C    . ALA B 1 118 ? -29.333 23.912 -46.014 0.010 33.49  ? 118  ALA B C    1  
ATOM   5195   O O    . ALA B 1 118 ? -28.232 24.466 -46.003 0.010 31.83  ? 118  ALA B O    1  
ATOM   5196   C CB   . ALA B 1 118 ? -30.052 23.925 -43.632 0.010 35.12  ? 118  ALA B CB   1  
ATOM   5197   H H    . ALA B 1 118 ? -28.478 22.119 -43.665 0.010 32.15  ? 118  ALA B H    1  
ATOM   5198   H HA   . ALA B 1 118 ? -30.600 22.587 -45.041 0.010 35.53  ? 118  ALA B HA   1  
ATOM   5199   H HB1  . ALA B 1 118 ? -29.232 24.354 -43.351 0.010 33.91  ? 118  ALA B HB1  1  
ATOM   5200   H HB2  . ALA B 1 118 ? -30.701 24.595 -43.887 0.010 36.39  ? 118  ALA B HB2  1  
ATOM   5201   H HB3  . ALA B 1 118 ? -30.401 23.378 -42.912 0.010 35.81  ? 118  ALA B HB3  1  
ATOM   5202   N N    . PRO B 1 119 ? -30.171 24.006 -47.055 0.010 34.91  ? 119  PRO B N    1  
ATOM   5203   C CA   . PRO B 1 119 ? -29.857 24.939 -48.145 0.010 34.68  ? 119  PRO B CA   1  
ATOM   5204   C C    . PRO B 1 119 ? -29.719 26.381 -47.636 0.010 34.87  ? 119  PRO B C    1  
ATOM   5205   O O    . PRO B 1 119 ? -30.495 26.830 -46.785 0.010 36.36  ? 119  PRO B O    1  
ATOM   5206   C CB   . PRO B 1 119 ? -31.036 24.758 -49.096 0.010 36.79  ? 119  PRO B CB   1  
ATOM   5207   C CG   . PRO B 1 119 ? -31.430 23.319 -48.885 0.010 37.15  ? 119  PRO B CG   1  
ATOM   5208   C CD   . PRO B 1 119 ? -31.262 23.084 -47.423 0.010 36.67  ? 119  PRO B CD   1  
ATOM   5209   H HA   . PRO B 1 119 ? -29.043 24.674 -48.599 0.010 33.33  ? 119  PRO B HA   1  
ATOM   5210   H HB2  . PRO B 1 119 ? -31.759 25.355 -48.851 0.010 38.21  ? 119  PRO B HB2  1  
ATOM   5211   H HB3  . PRO B 1 119 ? -30.754 24.906 -50.012 0.010 36.55  ? 119  PRO B HB3  1  
ATOM   5212   H HG2  . PRO B 1 119 ? -32.355 23.187 -49.146 0.010 38.86  ? 119  PRO B HG2  1  
ATOM   5213   H HG3  . PRO B 1 119 ? -30.839 22.743 -49.393 0.010 36.12  ? 119  PRO B HG3  1  
ATOM   5214   H HD2  . PRO B 1 119 ? -32.075 23.317 -46.952 0.010 38.19  ? 119  PRO B HD2  1  
ATOM   5215   H HD3  . PRO B 1 119 ? -31.001 22.166 -47.255 0.010 36.10  ? 119  PRO B HD3  1  
ATOM   5216   N N    . GLY B 1 120 ? -28.706 27.079 -48.140 0.010 33.56  ? 120  GLY B N    1  
ATOM   5217   C CA   . GLY B 1 120 ? -28.368 28.423 -47.683 0.010 33.66  ? 120  GLY B CA   1  
ATOM   5218   C C    . GLY B 1 120 ? -27.316 28.470 -46.582 0.010 32.05  ? 120  GLY B C    1  
ATOM   5219   O O    . GLY B 1 120 ? -26.807 29.535 -46.235 0.010 31.95  ? 120  GLY B O    1  
ATOM   5220   H H    . GLY B 1 120 ? -28.197 26.790 -48.768 0.010 32.74  ? 120  GLY B H    1  
ATOM   5221   H HA2  . GLY B 1 120 ? -28.031 28.933 -48.436 0.010 33.51  ? 120  GLY B HA2  1  
ATOM   5222   H HA3  . GLY B 1 120 ? -29.166 28.866 -47.357 0.010 35.17  ? 120  GLY B HA3  1  
ATOM   5223   N N    . THR B 1 121 ? -26.995 27.317 -46.014 0.010 31.00  ? 121  THR B N    1  
ATOM   5224   C CA   . THR B 1 121 ? -25.957 27.248 -45.004 0.010 29.58  ? 121  THR B CA   1  
ATOM   5225   C C    . THR B 1 121 ? -24.601 27.588 -45.614 0.010 27.86  ? 121  THR B C    1  
ATOM   5226   O O    . THR B 1 121 ? -24.225 27.069 -46.654 0.010 27.10  ? 121  THR B O    1  
ATOM   5227   C CB   . THR B 1 121 ? -25.845 25.838 -44.379 0.010 28.90  ? 121  THR B CB   1  
ATOM   5228   O OG1  . THR B 1 121 ? -27.097 25.454 -43.812 0.010 30.70  ? 121  THR B OG1  1  
ATOM   5229   C CG2  . THR B 1 121 ? -24.788 25.825 -43.282 0.010 27.72  ? 121  THR B CG2  1  
ATOM   5230   H H    . THR B 1 121 ? -27.368 26.564 -46.194 0.010 31.22  ? 121  THR B H    1  
ATOM   5231   H HA   . THR B 1 121 ? -26.154 27.883 -44.298 0.010 30.31  ? 121  THR B HA   1  
ATOM   5232   H HB   . THR B 1 121 ? -25.596 25.202 -45.067 0.010 28.22  ? 121  THR B HB   1  
ATOM   5233   H HG1  . THR B 1 121 ? -27.686 25.387 -44.423 0.010 31.44  ? 121  THR B HG1  1  
ATOM   5234   H HG21 . THR B 1 121 ? -25.010 26.472 -42.596 0.010 28.52  ? 121  THR B HG21 1  
ATOM   5235   H HG22 . THR B 1 121 ? -24.752 24.947 -42.879 0.010 27.45  ? 121  THR B HG22 1  
ATOM   5236   H HG23 . THR B 1 121 ? -23.917 26.040 -43.645 0.010 26.59  ? 121  THR B HG23 1  
ATOM   5237   N N    . LEU B 1 122 ? -23.868 28.463 -44.951 0.010 27.49  ? 122  LEU B N    1  
ATOM   5238   C CA   . LEU B 1 122 ? -22.514 28.776 -45.404 0.010 26.03  ? 122  LEU B CA   1  
ATOM   5239   C C    . LEU B 1 122 ? -21.547 27.722 -44.912 0.010 24.42  ? 122  LEU B C    1  
ATOM   5240   O O    . LEU B 1 122 ? -21.414 27.515 -43.709 0.010 24.35  ? 122  LEU B O    1  
ATOM   5241   C CB   . LEU B 1 122 ? -22.079 30.140 -44.913 0.010 26.51  ? 122  LEU B CB   1  
ATOM   5242   C CG   . LEU B 1 122 ? -22.810 31.298 -45.603 0.010 28.14  ? 122  LEU B CG   1  
ATOM   5243   C CD1  . LEU B 1 122 ? -22.519 32.601 -44.885 0.010 29.08  ? 122  LEU B CD1  1  
ATOM   5244   C CD2  . LEU B 1 122 ? -22.421 31.356 -47.074 0.010 27.70  ? 122  LEU B CD2  1  
ATOM   5245   H H    . LEU B 1 122 ? -24.124 28.883 -44.248 0.010 28.20  ? 122  LEU B H    1  
ATOM   5246   H HA   . LEU B 1 122 ? -22.482 28.776 -46.371 0.010 25.95  ? 122  LEU B HA   1  
ATOM   5247   H HB2  . LEU B 1 122 ? -22.239 30.201 -43.959 0.010 26.92  ? 122  LEU B HB2  1  
ATOM   5248   H HB3  . LEU B 1 122 ? -21.133 30.239 -45.093 0.010 25.56  ? 122  LEU B HB3  1  
ATOM   5249   H HG   . LEU B 1 122 ? -23.763 31.135 -45.557 0.010 29.13  ? 122  LEU B HG   1  
ATOM   5250   H HD11 . LEU B 1 122 ? -21.559 32.709 -44.796 0.010 28.15  ? 122  LEU B HD11 1  
ATOM   5251   H HD12 . LEU B 1 122 ? -22.888 33.336 -45.401 0.010 30.08  ? 122  LEU B HD12 1  
ATOM   5252   H HD13 . LEU B 1 122 ? -22.932 32.573 -44.008 0.010 29.78  ? 122  LEU B HD13 1  
ATOM   5253   H HD21 . LEU B 1 122 ? -21.455 31.343 -47.144 0.010 26.68  ? 122  LEU B HD21 1  
ATOM   5254   H HD22 . LEU B 1 122 ? -22.792 30.590 -47.537 0.010 27.52  ? 122  LEU B HD22 1  
ATOM   5255   H HD23 . LEU B 1 122 ? -22.769 32.171 -47.463 0.010 28.79  ? 122  LEU B HD23 1  
ATOM   5256   N N    . CYS B 1 123 ? -20.885 27.075 -45.860 0.010 23.37  ? 123  CYS B N    1  
ATOM   5257   C CA   . CYS B 1 123 ? -19.890 26.052 -45.561 0.010 21.98  ? 123  CYS B CA   1  
ATOM   5258   C C    . CYS B 1 123 ? -18.529 26.463 -46.106 0.010 20.99  ? 123  CYS B C    1  
ATOM   5259   O O    . CYS B 1 123 ? -18.436 27.140 -47.120 0.010 21.34  ? 123  CYS B O    1  
ATOM   5260   C CB   . CYS B 1 123 ? -20.295 24.716 -46.151 0.010 21.91  ? 123  CYS B CB   1  
ATOM   5261   S SG   . CYS B 1 123 ? -21.915 24.194 -45.516 0.010 23.41  ? 123  CYS B SG   1  
ATOM   5262   H H    . CYS B 1 123 ? -20.997 27.215 -46.699 0.010 23.58  ? 123  CYS B H    1  
ATOM   5263   H HA   . CYS B 1 123 ? -19.812 25.938 -44.601 0.010 21.90  ? 123  CYS B HA   1  
ATOM   5264   H HB2  . CYS B 1 123 ? -20.345 24.791 -47.115 0.010 22.07  ? 123  CYS B HB2  1  
ATOM   5265   H HB3  . CYS B 1 123 ? -19.636 24.050 -45.908 0.010 21.13  ? 123  CYS B HB3  1  
ATOM   5266   N N    . ASP B 1 124 ? -17.497 26.053 -45.392 0.010 19.99  ? 124  ASP B N    1  
ATOM   5267   C CA   . ASP B 1 124 ? -16.116 26.355 -45.743 0.010 19.21  ? 124  ASP B CA   1  
ATOM   5268   C C    . ASP B 1 124 ? -15.542 25.259 -46.610 0.010 18.54  ? 124  ASP B C    1  
ATOM   5269   O O    . ASP B 1 124 ? -15.545 24.106 -46.203 0.010 18.17  ? 124  ASP B O    1  
ATOM   5270   C CB   . ASP B 1 124 ? -15.285 26.434 -44.468 0.010 18.80  ? 124  ASP B CB   1  
ATOM   5271   C CG   . ASP B 1 124 ? -13.919 27.063 -44.701 0.010 18.35  ? 124  ASP B CG   1  
ATOM   5272   O OD1  . ASP B 1 124 ? -12.892 26.530 -44.216 0.010 17.61  ? 124  ASP B OD1  1  
ATOM   5273   O OD2  . ASP B 1 124 ? -13.885 28.066 -45.413 0.010 18.92  ? 124  ASP B OD2  1  
ATOM   5274   H H    . ASP B 1 124 ? -17.573 25.595 -44.671 0.010 19.86  ? 124  ASP B H    1  
ATOM   5275   H HA   . ASP B 1 124 ? -16.062 27.198 -46.217 0.010 19.60  ? 124  ASP B HA   1  
ATOM   5276   H HB2  . ASP B 1 124 ? -15.760 26.971 -43.814 0.010 19.42  ? 124  ASP B HB2  1  
ATOM   5277   H HB3  . ASP B 1 124 ? -15.149 25.539 -44.120 0.010 18.42  ? 124  ASP B HB3  1  
ATOM   5278   N N    . VAL B 1 125 ? -15.034 25.620 -47.788 0.010 18.61  ? 125  VAL B N    1  
ATOM   5279   C CA   . VAL B 1 125 ? -14.197 24.706 -48.575 0.010 18.19  ? 125  VAL B CA   1  
ATOM   5280   C C    . VAL B 1 125 ? -12.807 25.302 -48.709 0.010 17.87  ? 125  VAL B C    1  
ATOM   5281   O O    . VAL B 1 125 ? -12.644 26.504 -48.949 0.010 18.32  ? 125  VAL B O    1  
ATOM   5282   C CB   . VAL B 1 125 ? -14.779 24.352 -49.980 0.010 18.94  ? 125  VAL B CB   1  
ATOM   5283   C CG1  . VAL B 1 125 ? -14.782 25.509 -50.907 0.010 19.71  ? 125  VAL B CG1  1  
ATOM   5284   C CG2  . VAL B 1 125 ? -13.952 23.223 -50.639 0.010 18.76  ? 125  VAL B CG2  1  
ATOM   5285   H H    . VAL B 1 125 ? -15.157 26.384 -48.155 0.010 19.05  ? 125  VAL B H    1  
ATOM   5286   H HA   . VAL B 1 125 ? -14.103 23.875 -48.089 0.010 17.81  ? 125  VAL B HA   1  
ATOM   5287   H HB   . VAL B 1 125 ? -15.697 24.062 -49.873 0.010 19.29  ? 125  VAL B HB   1  
ATOM   5288   H HG11 . VAL B 1 125 ? -13.884 25.861 -50.998 0.010 19.51  ? 125  VAL B HG11 1  
ATOM   5289   H HG12 . VAL B 1 125 ? -15.094 25.200 -51.773 0.010 20.29  ? 125  VAL B HG12 1  
ATOM   5290   H HG13 . VAL B 1 125 ? -15.380 26.194 -50.566 0.010 20.02  ? 125  VAL B HG13 1  
ATOM   5291   H HG21 . VAL B 1 125 ? -13.633 22.613 -49.955 0.010 18.20  ? 125  VAL B HG21 1  
ATOM   5292   H HG22 . VAL B 1 125 ? -14.511 22.741 -51.266 0.010 19.28  ? 125  VAL B HG22 1  
ATOM   5293   H HG23 . VAL B 1 125 ? -13.202 23.615 -51.107 0.010 18.87  ? 125  VAL B HG23 1  
ATOM   5294   N N    . ALA B 1 126 ? -11.807 24.460 -48.512 0.010 17.29  ? 126  ALA B N    1  
ATOM   5295   C CA   . ALA B 1 126 ? -10.402 24.872 -48.611 0.010 17.15  ? 126  ALA B CA   1  
ATOM   5296   C C    . ALA B 1 126 ? -9.618  23.929 -49.496 0.010 17.26  ? 126  ALA B C    1  
ATOM   5297   O O    . ALA B 1 126 ? -9.994  22.784 -49.683 0.010 17.24  ? 126  ALA B O    1  
ATOM   5298   C CB   . ALA B 1 126 ? -9.765  24.926 -47.217 0.010 16.63  ? 126  ALA B CB   1  
ATOM   5299   H H    . ALA B 1 126 ? -11.914 23.634 -48.304 0.010 17.08  ? 126  ALA B H    1  
ATOM   5300   H HA   . ALA B 1 126 ? -10.355 25.754 -49.003 0.010 17.56  ? 126  ALA B HA   1  
ATOM   5301   H HB1  . ALA B 1 126 ? -9.814  24.045 -46.814 0.010 16.32  ? 126  ALA B HB1  1  
ATOM   5302   H HB2  . ALA B 1 126 ? -8.838  25.196 -47.299 0.010 16.67  ? 126  ALA B HB2  1  
ATOM   5303   H HB3  . ALA B 1 126 ? -10.241 25.568 -46.668 0.010 16.76  ? 126  ALA B HB3  1  
ATOM   5304   N N    . GLY B 1 127 ? -8.511  24.416 -50.046 0.010 17.63  ? 127  GLY B N    1  
ATOM   5305   C CA   . GLY B 1 127 ? -7.656  23.572 -50.844 0.010 18.04  ? 127  GLY B CA   1  
ATOM   5306   C C    . GLY B 1 127 ? -6.550  24.344 -51.524 0.010 18.77  ? 127  GLY B C    1  
ATOM   5307   O O    . GLY B 1 127 ? -6.519  25.587 -51.480 0.010 19.05  ? 127  GLY B O    1  
ATOM   5308   H H    . GLY B 1 127 ? -8.240  25.222 -49.970 0.010 17.79  ? 127  GLY B H    1  
ATOM   5309   H HA2  . GLY B 1 127 ? -7.240  22.909 -50.277 0.010 17.67  ? 127  GLY B HA2  1  
ATOM   5310   H HA3  . GLY B 1 127 ? -8.181  23.122 -51.520 0.010 18.41  ? 127  GLY B HA3  1  
ATOM   5311   N N    . TRP B 1 128 ? -5.640  23.586 -52.126 0.010 19.30  ? 128  TRP B N    1  
ATOM   5312   C CA   . TRP B 1 128 ? -4.556  24.142 -52.906 0.010 20.38  ? 128  TRP B CA   1  
ATOM   5313   C C    . TRP B 1 128 ? -4.823  23.995 -54.414 0.010 21.64  ? 128  TRP B C    1  
ATOM   5314   O O    . TRP B 1 128 ? -3.903  23.969 -55.216 0.010 22.84  ? 128  TRP B O    1  
ATOM   5315   C CB   . TRP B 1 128 ? -3.253  23.445 -52.533 0.010 20.53  ? 128  TRP B CB   1  
ATOM   5316   C CG   . TRP B 1 128 ? -2.720  23.756 -51.184 0.010 19.77  ? 128  TRP B CG   1  
ATOM   5317   C CD1  . TRP B 1 128 ? -1.879  24.782 -50.852 0.010 20.18  ? 128  TRP B CD1  1  
ATOM   5318   C CD2  . TRP B 1 128 ? -2.952  23.027 -49.976 0.010 18.75  ? 128  TRP B CD2  1  
ATOM   5319   N NE1  . TRP B 1 128 ? -1.574  24.732 -49.513 0.010 19.49  ? 128  TRP B NE1  1  
ATOM   5320   C CE2  . TRP B 1 128 ? -2.223  23.667 -48.951 0.010 18.61  ? 128  TRP B CE2  1  
ATOM   5321   C CE3  . TRP B 1 128 ? -3.705  21.888 -49.657 0.010 18.17  ? 128  TRP B CE3  1  
ATOM   5322   C CZ2  . TRP B 1 128 ? -2.220  23.203 -47.641 0.010 17.92  ? 128  TRP B CZ2  1  
ATOM   5323   C CZ3  . TRP B 1 128 ? -3.700  21.437 -48.373 0.010 17.48  ? 128  TRP B CZ3  1  
ATOM   5324   C CH2  . TRP B 1 128 ? -2.964  22.092 -47.367 0.010 17.35  ? 128  TRP B CH2  1  
ATOM   5325   H H    . TRP B 1 128 ? -5.629  22.733 -52.088 0.010 19.18  ? 128  TRP B H    1  
ATOM   5326   H HA   . TRP B 1 128 ? -4.464  25.086 -52.710 0.010 20.44  ? 128  TRP B HA   1  
ATOM   5327   H HB2  . TRP B 1 128 ? -3.388  22.488 -52.577 0.010 20.44  ? 128  TRP B HB2  1  
ATOM   5328   H HB3  . TRP B 1 128 ? -2.573  23.703 -53.172 0.010 21.46  ? 128  TRP B HB3  1  
ATOM   5329   H HD1  . TRP B 1 128 ? -1.557  25.418 -51.448 0.010 20.96  ? 128  TRP B HD1  1  
ATOM   5330   H HE1  . TRP B 1 128 ? -1.066  25.282 -49.097 0.010 19.70  ? 128  TRP B HE1  1  
ATOM   5331   H HE3  . TRP B 1 128 ? -4.186  21.443 -50.312 0.010 18.39  ? 128  TRP B HE3  1  
ATOM   5332   H HZ2  . TRP B 1 128 ? -1.740  23.641 -46.978 0.010 17.98  ? 128  TRP B HZ2  1  
ATOM   5333   H HZ3  . TRP B 1 128 ? -4.198  20.688 -48.153 0.010 17.22  ? 128  TRP B HZ3  1  
ATOM   5334   H HH2  . TRP B 1 128 ? -2.991  21.765 -46.499 0.010 17.02  ? 128  TRP B HH2  1  
ATOM   5335   N N    . GLY B 1 129 ? -6.091  23.931 -54.800 0.010 21.60  ? 129  GLY B N    1  
ATOM   5336   C CA   . GLY B 1 129 ? -6.414  23.734 -56.190 0.010 22.98  ? 129  GLY B CA   1  
ATOM   5337   C C    . GLY B 1 129 ? -6.242  25.053 -56.944 0.010 24.09  ? 129  GLY B C    1  
ATOM   5338   O O    . GLY B 1 129 ? -5.846  26.055 -56.365 0.010 23.76  ? 129  GLY B O    1  
ATOM   5339   H H    . GLY B 1 129 ? -6.771  24.012 -54.287 0.010 20.94  ? 129  GLY B H    1  
ATOM   5340   H HA2  . GLY B 1 129 ? -5.822  23.069 -56.569 0.010 23.55  ? 129  GLY B HA2  1  
ATOM   5341   H HA3  . GLY B 1 129 ? -7.328  23.424 -56.281 0.010 22.84  ? 129  GLY B HA3  1  
ATOM   5342   N N    . ILE B 1 130 ? -6.546  25.046 -58.230 0.010 25.61  ? 130  ILE B N    1  
ATOM   5343   C CA   . ILE B 1 130 ? -6.359  26.241 -59.054 0.010 27.04  ? 130  ILE B CA   1  
ATOM   5344   C C    . ILE B 1 130 ? -7.260  27.389 -58.596 0.010 26.55  ? 130  ILE B C    1  
ATOM   5345   O O    . ILE B 1 130 ? -8.350  27.170 -58.071 0.010 25.56  ? 130  ILE B O    1  
ATOM   5346   C CB   . ILE B 1 130 ? -6.573  25.988 -60.574 0.010 29.10  ? 130  ILE B CB   1  
ATOM   5347   C CG1  . ILE B 1 130 ? -8.044  25.720 -60.905 0.010 29.19  ? 130  ILE B CG1  1  
ATOM   5348   C CG2  . ILE B 1 130 ? -5.664  24.873 -61.077 0.010 29.97  ? 130  ILE B CG2  1  
ATOM   5349   C CD1  . ILE B 1 130 ? -8.308  25.744 -62.415 0.010 31.55  ? 130  ILE B CD1  1  
ATOM   5350   H H    . ILE B 1 130 ? -6.857  24.364 -58.652 0.010 25.99  ? 130  ILE B H    1  
ATOM   5351   H HA   . ILE B 1 130 ? -5.443  26.533 -58.949 0.010 27.28  ? 130  ILE B HA   1  
ATOM   5352   H HB   . ILE B 1 130 ? -6.313  26.799 -61.039 0.010 30.11  ? 130  ILE B HB   1  
ATOM   5353   H HG12 . ILE B 1 130 ? -8.296  24.849 -60.565 0.010 28.60  ? 130  ILE B HG12 1  
ATOM   5354   H HG13 . ILE B 1 130 ? -8.607  26.401 -60.511 0.010 28.56  ? 130  ILE B HG13 1  
ATOM   5355   H HG21 . ILE B 1 130 ? -5.740  24.105 -60.489 0.010 28.95  ? 130  ILE B HG21 1  
ATOM   5356   H HG22 . ILE B 1 130 ? -5.928  24.624 -61.976 0.010 31.30  ? 130  ILE B HG22 1  
ATOM   5357   H HG23 . ILE B 1 130 ? -4.751  25.196 -61.087 0.010 30.39  ? 130  ILE B HG23 1  
ATOM   5358   H HD11 . ILE B 1 130 ? -7.780  26.455 -62.813 0.010 32.47  ? 130  ILE B HD11 1  
ATOM   5359   H HD12 . ILE B 1 130 ? -8.054  24.889 -62.798 0.010 32.12  ? 130  ILE B HD12 1  
ATOM   5360   H HD13 . ILE B 1 130 ? -9.251  25.913 -62.573 0.010 31.71  ? 130  ILE B HD13 1  
ATOM   5361   N N    . VAL B 1 131 ? -6.782  28.609 -58.831 0.010 27.52  ? 131  VAL B N    1  
ATOM   5362   C CA   . VAL B 1 131 ? -7.421  29.822 -58.319 0.010 27.27  ? 131  VAL B CA   1  
ATOM   5363   C C    . VAL B 1 131 ? -7.926  30.733 -59.441 0.010 29.12  ? 131  VAL B C    1  
ATOM   5364   O O    . VAL B 1 131 ? -8.793  31.570 -59.227 0.010 29.20  ? 131  VAL B O    1  
ATOM   5365   C CB   . VAL B 1 131 ? -6.456  30.604 -57.400 0.010 26.91  ? 131  VAL B CB   1  
ATOM   5366   C CG1  . VAL B 1 131 ? -6.032  29.735 -56.208 0.010 25.16  ? 131  VAL B CG1  1  
ATOM   5367   C CG2  . VAL B 1 131 ? -5.221  31.075 -58.182 0.010 28.61  ? 131  VAL B CG2  1  
ATOM   5368   H H    . VAL B 1 131 ? -6.073  28.757 -59.289 0.010 28.48  ? 131  VAL B H    1  
ATOM   5369   H HA   . VAL B 1 131 ? -8.190  29.573 -57.790 0.010 26.33  ? 131  VAL B HA   1  
ATOM   5370   H HB   . VAL B 1 131 ? -6.915  31.380 -57.052 0.010 26.93  ? 131  VAL B HB   1  
ATOM   5371   H HG11 . VAL B 1 131 ? -6.821  29.315 -55.832 0.010 24.30  ? 131  VAL B HG11 1  
ATOM   5372   H HG12 . VAL B 1 131 ? -5.415  29.057 -56.522 0.010 25.30  ? 131  VAL B HG12 1  
ATOM   5373   H HG13 . VAL B 1 131 ? -5.599  30.285 -55.538 0.010 24.96  ? 131  VAL B HG13 1  
ATOM   5374   H HG21 . VAL B 1 131 ? -5.254  30.719 -59.084 0.010 29.49  ? 131  VAL B HG21 1  
ATOM   5375   H HG22 . VAL B 1 131 ? -5.216  32.045 -58.213 0.010 29.39  ? 131  VAL B HG22 1  
ATOM   5376   H HG23 . VAL B 1 131 ? -4.422  30.758 -57.734 0.010 28.20  ? 131  VAL B HG23 1  
ATOM   5377   N N    . ASN B 1 132 ? -7.421  30.530 -60.645 0.010 30.83  ? 132  ASN B N    1  
ATOM   5378   C CA   . ASN B 1 132 ? -7.907  31.291 -61.793 0.010 32.90  ? 132  ASN B CA   1  
ATOM   5379   C C    . ASN B 1 132 ? -8.297  30.338 -62.895 0.010 33.96  ? 132  ASN B C    1  
ATOM   5380   O O    . ASN B 1 132 ? -8.292  29.126 -62.703 0.010 33.12  ? 132  ASN B O    1  
ATOM   5381   C CB   . ASN B 1 132 ? -6.891  32.338 -62.267 0.010 34.66  ? 132  ASN B CB   1  
ATOM   5382   C CG   . ASN B 1 132 ? -5.623  31.733 -62.811 0.010 35.51  ? 132  ASN B CG   1  
ATOM   5383   O OD1  . ASN B 1 132 ? -5.611  30.631 -63.349 0.010 35.79  ? 132  ASN B OD1  1  
ATOM   5384   N ND2  . ASN B 1 132 ? -4.530  32.458 -62.660 0.010 36.15  ? 132  ASN B ND2  1  
ATOM   5385   H H    . ASN B 1 132 ? -6.810  29.955 -60.830 0.010 30.97  ? 132  ASN B H    1  
ATOM   5386   H HA   . ASN B 1 132 ? -8.710  31.776 -61.550 0.010 32.72  ? 132  ASN B HA   1  
ATOM   5387   H HB2  . ASN B 1 132 ? -7.294  32.875 -62.966 0.010 36.09  ? 132  ASN B HB2  1  
ATOM   5388   H HB3  . ASN B 1 132 ? -6.649  32.899 -61.515 0.010 34.05  ? 132  ASN B HB3  1  
ATOM   5389   H HD21 . ASN B 1 132 ? -4.585  33.257 -62.351 0.010 36.26  ? 132  ASN B HD21 1  
ATOM   5390   H HD22 . ASN B 1 132 ? -3.764  32.127 -62.866 0.010 36.56  ? 132  ASN B HD22 1  
ATOM   5391   N N    . HIS B 1 133 ? -8.615  30.891 -64.056 0.010 36.07  ? 133  HIS B N    1  
ATOM   5392   C CA   . HIS B 1 133 ? -9.195  30.100 -65.115 0.010 37.47  ? 133  HIS B CA   1  
ATOM   5393   C C    . HIS B 1 133 ? -8.074  29.557 -65.997 0.010 38.91  ? 133  HIS B C    1  
ATOM   5394   O O    . HIS B 1 133 ? -8.275  28.644 -66.804 0.010 39.79  ? 133  HIS B O    1  
ATOM   5395   C CB   . HIS B 1 133 ? -10.189 30.960 -65.880 0.010 39.54  ? 133  HIS B CB   1  
ATOM   5396   C CG   . HIS B 1 133 ? -11.401 30.219 -66.343 0.010 40.15  ? 133  HIS B CG   1  
ATOM   5397   N ND1  . HIS B 1 133 ? -12.497 29.994 -65.537 0.010 39.15  ? 133  HIS B ND1  1  
ATOM   5398   C CD2  . HIS B 1 133 ? -11.696 29.668 -67.543 0.010 41.95  ? 133  HIS B CD2  1  
ATOM   5399   C CE1  . HIS B 1 133 ? -13.411 29.328 -66.220 0.010 40.27  ? 133  HIS B CE1  1  
ATOM   5400   N NE2  . HIS B 1 133 ? -12.953 29.127 -67.444 0.010 41.99  ? 133  HIS B NE2  1  
ATOM   5401   H H    . HIS B 1 133 ? -8.496  31.720 -64.258 0.010 36.87  ? 133  HIS B H    1  
ATOM   5402   H HA   . HIS B 1 133 ? -9.676  29.346 -64.738 0.010 36.42  ? 133  HIS B HA   1  
ATOM   5403   H HB2  . HIS B 1 133 ? -10.488 31.674 -65.293 0.010 39.06  ? 133  HIS B HB2  1  
ATOM   5404   H HB3  . HIS B 1 133 ? -9.752  31.336 -66.659 0.010 41.22  ? 133  HIS B HB3  1  
ATOM   5405   H HD1  . HIS B 1 133 ? -12.573 30.242 -64.718 0.010 38.12  ? 133  HIS B HD1  1  
ATOM   5406   H HD2  . HIS B 1 133 ? -11.152 29.663 -68.296 0.010 43.12  ? 133  HIS B HD2  1  
ATOM   5407   H HE1  . HIS B 1 133 ? -14.238 29.055 -65.897 0.010 40.04  ? 133  HIS B HE1  1  
ATOM   5408   H HE2  . HIS B 1 133 ? -13.366 28.710 -68.073 0.010 43.07  ? 133  HIS B HE2  1  
ATOM   5409   N N    . ALA B 1 134 ? -6.881  30.101 -65.777 0.010 39.37  ? 134  ALA B N    1  
ATOM   5410   C CA   . ALA B 1 134 ? -5.700  29.743 -66.534 0.010 41.16  ? 134  ALA B CA   1  
ATOM   5411   C C    . ALA B 1 134 ? -4.688  29.072 -65.621 0.010 39.53  ? 134  ALA B C    1  
ATOM   5412   O O    . ALA B 1 134 ? -3.480  29.299 -65.739 0.010 40.42  ? 134  ALA B O    1  
ATOM   5413   C CB   . ALA B 1 134 ? -5.106  30.981 -67.180 0.010 43.51  ? 134  ALA B CB   1  
ATOM   5414   H H    . ALA B 1 134 ? -6.722  30.698 -65.181 0.010 38.81  ? 134  ALA B H    1  
ATOM   5415   H HA   . ALA B 1 134 ? -5.931  29.116 -67.236 0.010 42.13  ? 134  ALA B HA   1  
ATOM   5416   H HB1  . ALA B 1 134 ? -4.878  31.617 -66.484 0.010 42.69  ? 134  ALA B HB1  1  
ATOM   5417   H HB2  . ALA B 1 134 ? -4.312  30.732 -67.677 0.010 44.74  ? 134  ALA B HB2  1  
ATOM   5418   H HB3  . ALA B 1 134 ? -5.764  31.370 -67.778 0.010 44.74  ? 134  ALA B HB3  1  
ATOM   5419   N N    . GLY B 1 135 ? -5.205  28.306 -64.663 0.010 37.25  ? 135  GLY B N    1  
ATOM   5420   C CA   . GLY B 1 135 ? -4.477  27.203 -64.079 0.010 35.98  ? 135  GLY B CA   1  
ATOM   5421   C C    . GLY B 1 135 ? -3.417  27.479 -63.035 0.010 35.27  ? 135  GLY B C    1  
ATOM   5422   O O    . GLY B 1 135 ? -2.757  26.528 -62.591 0.010 35.29  ? 135  GLY B O    1  
ATOM   5423   H H    . GLY B 1 135 ? -5.987  28.416 -64.327 0.010 36.49  ? 135  GLY B H    1  
ATOM   5424   H HA2  . GLY B 1 135 ? -5.118  26.595 -63.681 0.010 34.49  ? 135  GLY B HA2  1  
ATOM   5425   H HA3  . GLY B 1 135 ? -4.041  26.723 -64.797 0.010 37.17  ? 135  GLY B HA3  1  
ATOM   5426   N N    . ARG B 1 136 ? -3.234  28.738 -62.627 0.010 34.82  ? 136  ARG B N    1  
ATOM   5427   C CA   . ARG B 1 136 ? -2.261  29.003 -61.572 0.010 33.89  ? 136  ARG B CA   1  
ATOM   5428   C C    . ARG B 1 136 ? -2.546  28.130 -60.374 0.010 31.36  ? 136  ARG B C    1  
ATOM   5429   O O    . ARG B 1 136 ? -3.706  28.001 -59.946 0.010 30.06  ? 136  ARG B O    1  
ATOM   5430   C CB   . ARG B 1 136 ? -2.262  30.446 -61.080 0.010 34.31  ? 136  ARG B CB   1  
ATOM   5431   C CG   . ARG B 1 136 ? -1.603  30.520 -59.707 0.010 32.41  ? 136  ARG B CG   1  
ATOM   5432   C CD   . ARG B 1 136 ? -1.131  31.837 -59.284 0.010 33.32  ? 136  ARG B CD   1  
ATOM   5433   N NE   . ARG B 1 136 ? -1.422  32.845 -60.275 0.010 35.06  ? 136  ARG B NE   1  
ATOM   5434   C CZ   . ARG B 1 136 ? -2.357  33.784 -60.163 0.010 34.74  ? 136  ARG B CZ   1  
ATOM   5435   N NH1  . ARG B 1 136 ? -3.127  33.863 -59.076 0.010 32.70  ? 136  ARG B NH1  1  
ATOM   5436   N NH2  . ARG B 1 136 ? -2.515  34.659 -61.159 0.010 36.76  ? 136  ARG B NH2  1  
ATOM   5437   H H    . ARG B 1 136 ? -3.647  29.429 -62.930 0.010 35.14  ? 136  ARG B H    1  
ATOM   5438   H HA   . ARG B 1 136 ? -1.371  28.793 -61.900 0.010 34.88  ? 136  ARG B HA   1  
ATOM   5439   H HB2  . ARG B 1 136 ? -1.766  30.987 -61.704 0.010 35.80  ? 136  ARG B HB2  1  
ATOM   5440   H HB3  . ARG B 1 136 ? -3.176  30.766 -61.008 0.010 34.65  ? 136  ARG B HB3  1  
ATOM   5441   H HG2  . ARG B 1 136 ? -2.229  30.219 -59.023 0.010 31.15  ? 136  ARG B HG2  1  
ATOM   5442   H HG3  . ARG B 1 136 ? -0.811  29.957 -59.719 0.010 31.95  ? 136  ARG B HG3  1  
ATOM   5443   H HD2  . ARG B 1 136 ? -1.531  32.075 -58.432 0.010 32.11  ? 136  ARG B HD2  1  
ATOM   5444   H HD3  . ARG B 1 136 ? -0.174  31.766 -59.192 0.010 34.16  ? 136  ARG B HD3  1  
ATOM   5445   H HE   . ARG B 1 136 ? -0.905  32.883 -60.961 0.010 36.37  ? 136  ARG B HE   1  
ATOM   5446   H HH11 . ARG B 1 136 ? -3.033  33.305 -58.429 0.010 31.52  ? 136  ARG B HH11 1  
ATOM   5447   H HH12 . ARG B 1 136 ? -3.726  34.476 -59.020 0.010 32.69  ? 136  ARG B HH12 1  
ATOM   5448   H HH21 . ARG B 1 136 ? -2.018  34.603 -61.857 0.010 38.20  ? 136  ARG B HH21 1  
ATOM   5449   H HH22 . ARG B 1 136 ? -3.114  35.272 -61.106 0.010 36.73  ? 136  ARG B HH22 1  
ATOM   5450   N N    . ARG B 1 137 ? -1.489  27.555 -59.811 0.010 30.91  ? 137  ARG B N    1  
ATOM   5451   C CA   . ARG B 1 137 ? -1.623  26.823 -58.554 0.010 28.75  ? 137  ARG B CA   1  
ATOM   5452   C C    . ARG B 1 137 ? -1.088  27.685 -57.408 0.010 27.95  ? 137  ARG B C    1  
ATOM   5453   O O    . ARG B 1 137 ? 0.060   28.151 -57.454 0.010 29.13  ? 137  ARG B O    1  
ATOM   5454   C CB   . ARG B 1 137 ? -0.850  25.493 -58.538 0.010 28.84  ? 137  ARG B CB   1  
ATOM   5455   C CG   . ARG B 1 137 ? -0.798  24.675 -59.829 0.010 30.68  ? 137  ARG B CG   1  
ATOM   5456   C CD   . ARG B 1 137 ? 0.315   23.591 -59.719 0.010 31.28  ? 137  ARG B CD   1  
ATOM   5457   N NE   . ARG B 1 137 ? 1.146   23.443 -60.916 0.010 33.88  ? 137  ARG B NE   1  
ATOM   5458   C CZ   . ARG B 1 137 ? 2.442   23.124 -60.907 0.010 35.23  ? 137  ARG B CZ   1  
ATOM   5459   N NH1  . ARG B 1 137 ? 3.089   22.921 -59.769 0.010 34.20  ? 137  ARG B NH1  1  
ATOM   5460   N NH2  . ARG B 1 137 ? 3.101   23.005 -62.046 0.010 37.86  ? 137  ARG B NH2  1  
ATOM   5461   H H    . ARG B 1 137 ? -0.693  27.574 -60.127 0.010 31.93  ? 137  ARG B H    1  
ATOM   5462   H HA   . ARG B 1 137 ? -2.556  26.617 -58.410 0.010 27.94  ? 137  ARG B HA   1  
ATOM   5463   H HB2  . ARG B 1 137 ? 0.061   25.678 -58.266 0.010 29.08  ? 137  ARG B HB2  1  
ATOM   5464   H HB3  . ARG B 1 137 ? -1.270  24.926 -57.877 0.010 27.57  ? 137  ARG B HB3  1  
ATOM   5465   H HG2  . ARG B 1 137 ? -1.650  24.224 -59.949 0.010 30.29  ? 137  ARG B HG2  1  
ATOM   5466   H HG3  . ARG B 1 137 ? -0.607  25.250 -60.586 0.010 32.06  ? 137  ARG B HG3  1  
ATOM   5467   H HD2  . ARG B 1 137 ? 0.895   23.824 -58.980 0.010 30.83  ? 137  ARG B HD2  1  
ATOM   5468   H HD3  . ARG B 1 137 ? -0.103  22.732 -59.547 0.010 30.57  ? 137  ARG B HD3  1  
ATOM   5469   H HE   . ARG B 1 137 ? 0.800   23.661 -61.673 0.010 34.72  ? 137  ARG B HE   1  
ATOM   5470   H HH11 . ARG B 1 137 ? 2.680   22.989 -59.016 0.010 32.63  ? 137  ARG B HH11 1  
ATOM   5471   H HH12 . ARG B 1 137 ? 3.924   22.718 -59.784 0.010 35.21  ? 137  ARG B HH12 1  
ATOM   5472   H HH21 . ARG B 1 137 ? 2.696   23.135 -62.792 0.010 38.67  ? 137  ARG B HH21 1  
ATOM   5473   H HH22 . ARG B 1 137 ? 3.938   22.804 -62.039 0.010 38.88  ? 137  ARG B HH22 1  
ATOM   5474   N N    . PRO B 1 138 ? -1.887  27.867 -56.360 0.010 26.21  ? 138  PRO B N    1  
ATOM   5475   C CA   . PRO B 1 138 ? -1.374  28.621 -55.215 0.010 25.62  ? 138  PRO B CA   1  
ATOM   5476   C C    . PRO B 1 138 ? -0.362  27.830 -54.405 0.010 25.13  ? 138  PRO B C    1  
ATOM   5477   O O    . PRO B 1 138 ? -0.394  26.595 -54.402 0.010 24.59  ? 138  PRO B O    1  
ATOM   5478   C CB   . PRO B 1 138 ? -2.621  28.831 -54.359 0.010 24.13  ? 138  PRO B CB   1  
ATOM   5479   C CG   . PRO B 1 138 ? -3.462  27.553 -54.614 0.010 23.36  ? 138  PRO B CG   1  
ATOM   5480   C CD   . PRO B 1 138 ? -3.148  27.166 -56.055 0.010 24.89  ? 138  PRO B CD   1  
ATOM   5481   H HA   . PRO B 1 138 ? -0.994  29.469 -55.491 0.010 26.62  ? 138  PRO B HA   1  
ATOM   5482   H HB2  . PRO B 1 138 ? -2.373  28.897 -53.424 0.010 23.44  ? 138  PRO B HB2  1  
ATOM   5483   H HB3  . PRO B 1 138 ? -3.088  29.627 -54.656 0.010 24.61  ? 138  PRO B HB3  1  
ATOM   5484   H HG2  . PRO B 1 138 ? -3.185  26.847 -54.011 0.010 22.66  ? 138  PRO B HG2  1  
ATOM   5485   H HG3  . PRO B 1 138 ? -4.405  27.749 -54.503 0.010 22.90  ? 138  PRO B HG3  1  
ATOM   5486   H HD2  . PRO B 1 138 ? -3.019  26.206 -56.116 0.010 24.73  ? 138  PRO B HD2  1  
ATOM   5487   H HD3  . PRO B 1 138 ? -3.844  27.470 -56.658 0.010 25.37  ? 138  PRO B HD3  1  
ATOM   5488   N N    . ASP B 1 139 ? 0.488   28.540 -53.684 0.010 25.45  ? 139  ASP B N    1  
ATOM   5489   C CA   . ASP B 1 139 ? 1.406   27.912 -52.764 0.010 25.06  ? 139  ASP B CA   1  
ATOM   5490   C C    . ASP B 1 139 ? 0.794   27.786 -51.386 0.010 23.40  ? 139  ASP B C    1  
ATOM   5491   O O    . ASP B 1 139 ? 1.087   26.863 -50.639 0.010 22.69  ? 139  ASP B O    1  
ATOM   5492   C CB   . ASP B 1 139 ? 2.699   28.721 -52.662 0.010 26.53  ? 139  ASP B CB   1  
ATOM   5493   C CG   . ASP B 1 139 ? 3.591   28.232 -51.552 0.010 26.26  ? 139  ASP B CG   1  
ATOM   5494   O OD1  . ASP B 1 139 ? 4.278   27.214 -51.777 0.010 26.74  ? 139  ASP B OD1  1  
ATOM   5495   O OD2  . ASP B 1 139 ? 3.585   28.837 -50.455 0.010 25.75  ? 139  ASP B OD2  1  
ATOM   5496   H H    . ASP B 1 139 ? 0.551   29.393 -53.717 0.010 26.02  ? 139  ASP B H    1  
ATOM   5497   H HA   . ASP B 1 139 ? 1.630   27.022 -53.081 0.010 25.17  ? 139  ASP B HA   1  
ATOM   5498   H HB2  . ASP B 1 139 ? 3.181   28.644 -53.497 0.010 27.72  ? 139  ASP B HB2  1  
ATOM   5499   H HB3  . ASP B 1 139 ? 2.479   29.646 -52.483 0.010 26.66  ? 139  ASP B HB3  1  
ATOM   5500   N N    . SER B 1 140 ? -0.072  28.725 -51.055 0.010 23.00  ? 140  SER B N    1  
ATOM   5501   C CA   . SER B 1 140 ? -0.716  28.752 -49.757 0.010 21.76  ? 140  SER B CA   1  
ATOM   5502   C C    . SER B 1 140 ? -2.186  28.308 -49.827 0.010 20.71  ? 140  SER B C    1  
ATOM   5503   O O    . SER B 1 140 ? -2.893  28.609 -50.775 0.010 21.08  ? 140  SER B O    1  
ATOM   5504   C CB   . SER B 1 140 ? -0.697  30.181 -49.217 0.010 22.37  ? 140  SER B CB   1  
ATOM   5505   O OG   . SER B 1 140 ? -1.389  31.014 -50.117 0.010 23.09  ? 140  SER B OG   1  
ATOM   5506   H H    . SER B 1 140 ? -0.306  29.367 -51.572 0.010 23.57  ? 140  SER B H    1  
ATOM   5507   H HA   . SER B 1 140 ? -0.236  28.188 -49.136 0.010 21.43  ? 140  SER B HA   1  
ATOM   5508   H HB2  . SER B 1 140 ? -1.154  30.197 -48.360 0.010 21.70  ? 140  SER B HB2  1  
ATOM   5509   H HB3  . SER B 1 140 ? 0.219   30.494 -49.123 0.010 23.13  ? 140  SER B HB3  1  
ATOM   5510   H HG   . SER B 1 140 ? -1.352  31.823 -49.851 0.010 23.57  ? 140  SER B HG   1  
ATOM   5511   N N    . LEU B 1 141 ? -2.618  27.635 -48.775 0.010 19.60  ? 141  LEU B N    1  
ATOM   5512   C CA   . LEU B 1 141 ? -3.994  27.160 -48.646 0.010 18.74  ? 141  LEU B CA   1  
ATOM   5513   C C    . LEU B 1 141 ? -4.987  28.286 -48.890 0.010 19.08  ? 141  LEU B C    1  
ATOM   5514   O O    . LEU B 1 141 ? -4.879  29.359 -48.315 0.010 19.52  ? 141  LEU B O    1  
ATOM   5515   C CB   . LEU B 1 141 ? -4.217  26.596 -47.237 0.010 17.89  ? 141  LEU B CB   1  
ATOM   5516   C CG   . LEU B 1 141 ? -5.564  25.919 -46.995 0.010 17.17  ? 141  LEU B CG   1  
ATOM   5517   C CD1  . LEU B 1 141 ? -5.685  24.701 -47.933 0.010 17.09  ? 141  LEU B CD1  1  
ATOM   5518   C CD2  . LEU B 1 141 ? -5.693  25.532 -45.540 0.010 16.68  ? 141  LEU B CD2  1  
ATOM   5519   H H    . LEU B 1 141 ? -2.121  27.437 -48.105 0.010 19.46  ? 141  LEU B H    1  
ATOM   5520   H HA   . LEU B 1 141 ? -4.162  26.464 -49.297 0.010 18.70  ? 141  LEU B HA   1  
ATOM   5521   H HB2  . LEU B 1 141 ? -3.526  25.942 -47.057 0.010 17.82  ? 141  LEU B HB2  1  
ATOM   5522   H HB3  . LEU B 1 141 ? -4.147  27.314 -46.592 0.010 18.05  ? 141  LEU B HB3  1  
ATOM   5523   H HG   . LEU B 1 141 ? -6.273  26.543 -47.213 0.010 17.34  ? 141  LEU B HG   1  
ATOM   5524   H HD11 . LEU B 1 141 ? -4.870  24.180 -47.873 0.010 17.16  ? 141  LEU B HD11 1  
ATOM   5525   H HD12 . LEU B 1 141 ? -6.441  24.161 -47.661 0.010 16.71  ? 141  LEU B HD12 1  
ATOM   5526   H HD13 . LEU B 1 141 ? -5.814  25.016 -48.841 0.010 17.53  ? 141  LEU B HD13 1  
ATOM   5527   H HD21 . LEU B 1 141 ? -4.905  25.042 -45.272 0.010 16.65  ? 141  LEU B HD21 1  
ATOM   5528   H HD22 . LEU B 1 141 ? -5.767  26.334 -45.004 0.010 16.90  ? 141  LEU B HD22 1  
ATOM   5529   H HD23 . LEU B 1 141 ? -6.481  24.983 -45.421 0.010 16.35  ? 141  LEU B HD23 1  
ATOM   5530   N N    . GLN B 1 142 ? -5.946  28.010 -49.756 0.010 19.09  ? 142  GLN B N    1  
ATOM   5531   C CA   . GLN B 1 142 ? -7.010  28.947 -50.049 0.010 19.56  ? 142  GLN B CA   1  
ATOM   5532   C C    . GLN B 1 142 ? -8.287  28.403 -49.433 0.010 18.83  ? 142  GLN B C    1  
ATOM   5533   O O    . GLN B 1 142 ? -8.445  27.193 -49.237 0.010 18.14  ? 142  GLN B O    1  
ATOM   5534   C CB   . GLN B 1 142 ? -7.176  29.119 -51.553 0.010 20.50  ? 142  GLN B CB   1  
ATOM   5535   C CG   . GLN B 1 142 ? -5.903  29.509 -52.269 0.010 21.49  ? 142  GLN B CG   1  
ATOM   5536   C CD   . GLN B 1 142 ? -5.419  30.901 -51.915 0.010 22.30  ? 142  GLN B CD   1  
ATOM   5537   O OE1  . GLN B 1 142 ? -6.134  31.877 -52.095 0.010 22.96  ? 142  GLN B OE1  1  
ATOM   5538   N NE2  . GLN B 1 142 ? -4.203  30.993 -51.413 0.010 22.45  ? 142  GLN B NE2  1  
ATOM   5539   H H    . GLN B 1 142 ? -5.997  27.277 -50.195 0.010 18.95  ? 142  GLN B H    1  
ATOM   5540   H HA   . GLN B 1 142 ? -6.819  29.813 -49.664 0.010 19.94  ? 142  GLN B HA   1  
ATOM   5541   H HB2  . GLN B 1 142 ? -7.495  28.293 -51.943 0.010 20.26  ? 142  GLN B HB2  1  
ATOM   5542   H HB3  . GLN B 1 142 ? -7.824  29.820 -51.710 0.010 20.94  ? 142  GLN B HB3  1  
ATOM   5543   H HG2  . GLN B 1 142 ? -5.206  28.878 -52.037 0.010 21.16  ? 142  GLN B HG2  1  
ATOM   5544   H HG3  . GLN B 1 142 ? -6.067  29.492 -53.224 0.010 22.17  ? 142  GLN B HG3  1  
ATOM   5545   H HE21 . GLN B 1 142 ? -3.630  30.376 -51.571 0.010 22.35  ? 142  GLN B HE21 1  
ATOM   5546   H HE22 . GLN B 1 142 ? -3.991  31.661 -50.919 0.010 22.74  ? 142  GLN B HE22 1  
ATOM   5547   N N    . HIS B 1 143 ? -9.210  29.296 -49.155 0.010 19.23  ? 143  HIS B N    1  
ATOM   5548   C CA   . HIS B 1 143 ? -10.529 28.856 -48.716 0.010 18.92  ? 143  HIS B CA   1  
ATOM   5549   C C    . HIS B 1 143 ? -11.592 29.782 -49.256 0.010 19.89  ? 143  HIS B C    1  
ATOM   5550   O O    . HIS B 1 143 ? -11.306 30.896 -49.712 0.010 20.78  ? 143  HIS B O    1  
ATOM   5551   C CB   . HIS B 1 143 ? -10.624 28.822 -47.196 0.010 18.43  ? 143  HIS B CB   1  
ATOM   5552   C CG   . HIS B 1 143 ? -10.878 30.169 -46.588 0.010 19.21  ? 143  HIS B CG   1  
ATOM   5553   N ND1  . HIS B 1 143 ? -12.126 30.579 -46.168 0.010 19.70  ? 143  HIS B ND1  1  
ATOM   5554   C CD2  . HIS B 1 143 ? -10.045 31.214 -46.362 0.010 19.88  ? 143  HIS B CD2  1  
ATOM   5555   C CE1  . HIS B 1 143 ? -12.048 31.813 -45.699 0.010 20.63  ? 143  HIS B CE1  1  
ATOM   5556   N NE2  . HIS B 1 143 ? -10.795 32.223 -45.804 0.010 20.75  ? 143  HIS B NE2  1  
ATOM   5557   H H    . HIS B 1 143 ? -9.105  30.145 -49.212 0.010 19.81  ? 143  HIS B H    1  
ATOM   5558   H HA   . HIS B 1 143 ? -10.702 27.968 -49.053 0.010 18.62  ? 143  HIS B HA   1  
ATOM   5559   H HB2  . HIS B 1 143 ? -11.365 28.248 -46.955 0.010 18.21  ? 143  HIS B HB2  1  
ATOM   5560   H HB3  . HIS B 1 143 ? -9.799  28.475 -46.829 0.010 18.03  ? 143  HIS B HB3  1  
ATOM   5561   H HD1  . HIS B 1 143 ? -12.842 30.104 -46.203 0.010 19.56  ? 143  HIS B HD1  1  
ATOM   5562   H HD2  . HIS B 1 143 ? -9.133  31.235 -46.544 0.010 19.89  ? 143  HIS B HD2  1  
ATOM   5563   H HE1  . HIS B 1 143 ? -12.751 32.309 -45.350 0.010 21.25  ? 143  HIS B HE1  1  
ATOM   5564   H HE2  . HIS B 1 143 ? -10.502 32.992 -45.559 0.010 21.40  ? 143  HIS B HE2  1  
ATOM   5565   N N    . VAL B 1 144 ? -12.826 29.301 -49.206 0.010 19.90  ? 144  VAL B N    1  
ATOM   5566   C CA   . VAL B 1 144 ? -13.960 30.116 -49.550 0.010 20.98  ? 144  VAL B CA   1  
ATOM   5567   C C    . VAL B 1 144 ? -15.196 29.586 -48.851 0.010 20.94  ? 144  VAL B C    1  
ATOM   5568   O O    . VAL B 1 144 ? -15.309 28.374 -48.627 0.010 20.20  ? 144  VAL B O    1  
ATOM   5569   C CB   . VAL B 1 144 ? -14.153 30.189 -51.082 0.010 21.79  ? 144  VAL B CB   1  
ATOM   5570   C CG1  . VAL B 1 144 ? -14.562 28.839 -51.677 0.010 21.44  ? 144  VAL B CG1  1  
ATOM   5571   C CG2  . VAL B 1 144 ? -15.139 31.281 -51.453 0.010 23.19  ? 144  VAL B CG2  1  
ATOM   5572   H H    . VAL B 1 144 ? -13.024 28.499 -48.973 0.010 19.42  ? 144  VAL B H    1  
ATOM   5573   H HA   . VAL B 1 144 ? -13.811 31.014 -49.225 0.010 21.45  ? 144  VAL B HA   1  
ATOM   5574   H HB   . VAL B 1 144 ? -13.302 30.434 -51.478 0.010 21.88  ? 144  VAL B HB   1  
ATOM   5575   H HG11 . VAL B 1 144 ? -13.998 28.143 -51.308 0.010 20.63  ? 144  VAL B HG11 1  
ATOM   5576   H HG12 . VAL B 1 144 ? -15.488 28.659 -51.461 0.010 21.61  ? 144  VAL B HG12 1  
ATOM   5577   H HG13 . VAL B 1 144 ? -14.445 28.877 -52.639 0.010 22.02  ? 144  VAL B HG13 1  
ATOM   5578   H HG21 . VAL B 1 144 ? -15.392 31.763 -50.655 0.010 23.31  ? 144  VAL B HG21 1  
ATOM   5579   H HG22 . VAL B 1 144 ? -14.711 31.882 -52.083 0.010 23.83  ? 144  VAL B HG22 1  
ATOM   5580   H HG23 . VAL B 1 144 ? -15.921 30.877 -51.861 0.010 23.47  ? 144  VAL B HG23 1  
ATOM   5581   N N    . LEU B 1 145 ? -16.059 30.518 -48.442 0.010 21.95  ? 145  LEU B N    1  
ATOM   5582   C CA   . LEU B 1 145 ? -17.414 30.216 -47.956 0.010 22.46  ? 145  LEU B CA   1  
ATOM   5583   C C    . LEU B 1 145 ? -18.411 30.200 -49.089 0.010 23.45  ? 145  LEU B C    1  
ATOM   5584   O O    . LEU B 1 145 ? -18.510 31.153 -49.879 0.010 24.45  ? 145  LEU B O    1  
ATOM   5585   C CB   . LEU B 1 145 ? -17.886 31.258 -46.963 0.010 23.44  ? 145  LEU B CB   1  
ATOM   5586   C CG   . LEU B 1 145 ? -17.465 31.177 -45.510 0.010 23.02  ? 145  LEU B CG   1  
ATOM   5587   C CD1  . LEU B 1 145 ? -18.207 32.302 -44.770 0.010 24.59  ? 145  LEU B CD1  1  
ATOM   5588   C CD2  . LEU B 1 145 ? -17.786 29.810 -44.899 0.010 22.27  ? 145  LEU B CD2  1  
ATOM   5589   H H    . LEU B 1 145 ? -15.874 31.355 -48.432 0.010 22.50  ? 145  LEU B H    1  
ATOM   5590   H HA   . LEU B 1 145 ? -17.430 29.353 -47.527 0.010 21.81  ? 145  LEU B HA   1  
ATOM   5591   H HB2  . LEU B 1 145 ? -17.585 32.122 -47.284 0.010 23.97  ? 145  LEU B HB2  1  
ATOM   5592   H HB3  . LEU B 1 145 ? -18.855 31.243 -46.970 0.010 24.19  ? 145  LEU B HB3  1  
ATOM   5593   H HG   . LEU B 1 145 ? -16.511 31.335 -45.445 0.010 22.47  ? 145  LEU B HG   1  
ATOM   5594   H HD11 . LEU B 1 145 ? -18.255 33.081 -45.343 0.010 25.24  ? 145  LEU B HD11 1  
ATOM   5595   H HD12 . LEU B 1 145 ? -19.099 31.993 -44.559 0.010 25.17  ? 145  LEU B HD12 1  
ATOM   5596   H HD13 . LEU B 1 145 ? -17.728 32.517 -43.956 0.010 24.51  ? 145  LEU B HD13 1  
ATOM   5597   H HD21 . LEU B 1 145 ? -18.722 29.600 -45.048 0.010 22.93  ? 145  LEU B HD21 1  
ATOM   5598   H HD22 . LEU B 1 145 ? -17.224 29.138 -45.313 0.010 21.44  ? 145  LEU B HD22 1  
ATOM   5599   H HD23 . LEU B 1 145 ? -17.605 29.842 -43.946 0.010 22.16  ? 145  LEU B HD23 1  
ATOM   5600   N N    . LEU B 1 146 ? -19.190 29.123 -49.117 0.010 23.40  ? 146  LEU B N    1  
ATOM   5601   C CA   . LEU B 1 146 ? -20.131 28.866 -50.172 0.010 24.40  ? 146  LEU B CA   1  
ATOM   5602   C C    . LEU B 1 146 ? -21.455 28.488 -49.532 0.010 25.21  ? 146  LEU B C    1  
ATOM   5603   O O    . LEU B 1 146 ? -21.479 27.694 -48.593 0.010 24.55  ? 146  LEU B O    1  
ATOM   5604   C CB   . LEU B 1 146 ? -19.672 27.707 -51.050 0.010 23.78  ? 146  LEU B CB   1  
ATOM   5605   C CG   . LEU B 1 146 ? -18.330 27.777 -51.782 0.010 23.13  ? 146  LEU B CG   1  
ATOM   5606   C CD1  . LEU B 1 146 ? -18.022 26.483 -52.491 0.010 22.90  ? 146  LEU B CD1  1  
ATOM   5607   C CD2  . LEU B 1 146 ? -18.392 28.920 -52.739 0.010 24.28  ? 146  LEU B CD2  1  
ATOM   5608   H H    . LEU B 1 146 ? -19.189 28.522 -48.504 0.010 22.90  ? 146  LEU B H    1  
ATOM   5609   H HA   . LEU B 1 146 ? -20.235 29.654 -50.722 0.010 25.19  ? 146  LEU B HA   1  
ATOM   5610   H HB2  . LEU B 1 146 ? -19.640 26.916 -50.492 0.010 23.17  ? 146  LEU B HB2  1  
ATOM   5611   H HB3  . LEU B 1 146 ? -20.349 27.579 -51.729 0.010 24.66  ? 146  LEU B HB3  1  
ATOM   5612   H HG   . LEU B 1 146 ? -17.623 27.953 -51.144 0.010 22.34  ? 146  LEU B HG   1  
ATOM   5613   H HD11 . LEU B 1 146 ? -18.838 26.149 -52.891 0.010 23.76  ? 146  LEU B HD11 1  
ATOM   5614   H HD12 . LEU B 1 146 ? -17.358 26.632 -53.179 0.010 22.81  ? 146  LEU B HD12 1  
ATOM   5615   H HD13 . LEU B 1 146 ? -17.686 25.845 -51.845 0.010 22.17  ? 146  LEU B HD13 1  
ATOM   5616   H HD21 . LEU B 1 146 ? -19.321 29.159 -52.869 0.010 25.20  ? 146  LEU B HD21 1  
ATOM   5617   H HD22 . LEU B 1 146 ? -17.910 29.668 -52.354 0.010 24.14  ? 146  LEU B HD22 1  
ATOM   5618   H HD23 . LEU B 1 146 ? -17.994 28.655 -53.583 0.010 24.39  ? 146  LEU B HD23 1  
ATOM   5619   N N    . PRO B 1 147 ? -22.554 29.078 -50.021 0.010 26.84  ? 147  PRO B N    1  
ATOM   5620   C CA   . PRO B 1 147 ? -23.859 28.600 -49.560 0.010 27.91  ? 147  PRO B CA   1  
ATOM   5621   C C    . PRO B 1 147 ? -24.267 27.304 -50.273 0.010 27.95  ? 147  PRO B C    1  
ATOM   5622   O O    . PRO B 1 147 ? -24.149 27.144 -51.490 0.010 28.24  ? 147  PRO B O    1  
ATOM   5623   C CB   . PRO B 1 147 ? -24.804 29.755 -49.901 0.010 29.86  ? 147  PRO B CB   1  
ATOM   5624   C CG   . PRO B 1 147 ? -24.190 30.422 -51.059 0.010 29.92  ? 147  PRO B CG   1  
ATOM   5625   C CD   . PRO B 1 147 ? -22.678 30.257 -50.897 0.010 28.03  ? 147  PRO B CD   1  
ATOM   5626   H HA   . PRO B 1 147 ? -23.856 28.471 -48.601 0.010 27.63  ? 147  PRO B HA   1  
ATOM   5627   H HB2  . PRO B 1 147 ? -25.678 29.406 -50.132 0.010 30.82  ? 147  PRO B HB2  1  
ATOM   5628   H HB3  . PRO B 1 147 ? -24.864 30.365 -49.150 0.010 30.19  ? 147  PRO B HB3  1  
ATOM   5629   H HG2  . PRO B 1 147 ? -24.494 29.993 -51.874 0.010 30.31  ? 147  PRO B HG2  1  
ATOM   5630   H HG3  . PRO B 1 147 ? -24.436 31.360 -51.055 0.010 30.91  ? 147  PRO B HG3  1  
ATOM   5631   H HD2  . PRO B 1 147 ? -22.260 30.086 -51.754 0.010 27.83  ? 147  PRO B HD2  1  
ATOM   5632   H HD3  . PRO B 1 147 ? -22.298 31.037 -50.466 0.010 28.03  ? 147  PRO B HD3  1  
ATOM   5633   N N    . VAL B 1 148 ? -24.715 26.356 -49.466 0.010 27.85  ? 148  VAL B N    1  
ATOM   5634   C CA   . VAL B 1 148 ? -25.267 25.104 -49.966 0.010 28.33  ? 148  VAL B CA   1  
ATOM   5635   C C    . VAL B 1 148 ? -26.470 25.424 -50.816 0.010 30.34  ? 148  VAL B C    1  
ATOM   5636   O O    . VAL B 1 148 ? -27.300 26.239 -50.427 0.010 31.64  ? 148  VAL B O    1  
ATOM   5637   C CB   . VAL B 1 148 ? -25.722 24.208 -48.799 0.010 28.37  ? 148  VAL B CB   1  
ATOM   5638   C CG1  . VAL B 1 148 ? -26.416 22.949 -49.308 0.010 29.36  ? 148  VAL B CG1  1  
ATOM   5639   C CG2  . VAL B 1 148 ? -24.533 23.876 -47.910 0.010 26.54  ? 148  VAL B CG2  1  
ATOM   5640   H H    . VAL B 1 148 ? -24.701 26.414 -48.608 0.010 27.63  ? 148  VAL B H    1  
ATOM   5641   H HA   . VAL B 1 148 ? -24.609 24.633 -50.502 0.010 27.59  ? 148  VAL B HA   1  
ATOM   5642   H HB   . VAL B 1 148 ? -26.364 24.695 -48.261 0.010 29.18  ? 148  VAL B HB   1  
ATOM   5643   H HG11 . VAL B 1 148 ? -25.863 22.543 -49.994 0.010 28.90  ? 148  VAL B HG11 1  
ATOM   5644   H HG12 . VAL B 1 148 ? -26.527 22.334 -48.567 0.010 29.22  ? 148  VAL B HG12 1  
ATOM   5645   H HG13 . VAL B 1 148 ? -27.286 23.177 -49.670 0.010 30.74  ? 148  VAL B HG13 1  
ATOM   5646   H HG21 . VAL B 1 148 ? -23.823 23.502 -48.454 0.010 25.88  ? 148  VAL B HG21 1  
ATOM   5647   H HG22 . VAL B 1 148 ? -24.228 24.691 -47.486 0.010 26.05  ? 148  VAL B HG22 1  
ATOM   5648   H HG23 . VAL B 1 148 ? -24.806 23.236 -47.235 0.010 26.72  ? 148  VAL B HG23 1  
ATOM   5649   N N    . LEU B 1 149 ? -26.567 24.796 -51.978 0.010 30.82  ? 149  LEU B N    1  
ATOM   5650   C CA   . LEU B 1 149 ? -27.744 24.987 -52.816 0.010 32.96  ? 149  LEU B CA   1  
ATOM   5651   C C    . LEU B 1 149 ? -28.668 23.772 -52.734 0.010 34.12  ? 149  LEU B C    1  
ATOM   5652   O O    . LEU B 1 149 ? -28.213 22.633 -52.784 0.010 33.37  ? 149  LEU B O    1  
ATOM   5653   C CB   . LEU B 1 149 ? -27.341 25.318 -54.258 0.010 33.28  ? 149  LEU B CB   1  
ATOM   5654   C CG   . LEU B 1 149 ? -28.455 25.843 -55.168 0.010 35.67  ? 149  LEU B CG   1  
ATOM   5655   C CD1  . LEU B 1 149 ? -29.327 26.822 -54.409 0.010 36.69  ? 149  LEU B CD1  1  
ATOM   5656   C CD2  . LEU B 1 149 ? -27.892 26.524 -56.436 0.010 36.05  ? 149  LEU B CD2  1  
ATOM   5657   H H    . LEU B 1 149 ? -25.971 24.271 -52.304 0.010 30.07  ? 149  LEU B H    1  
ATOM   5658   H HA   . LEU B 1 149 ? -28.240 25.739 -52.470 0.010 33.71  ? 149  LEU B HA   1  
ATOM   5659   H HB2  . LEU B 1 149 ? -26.656 26.005 -54.228 0.010 32.46  ? 149  LEU B HB2  1  
ATOM   5660   H HB3  . LEU B 1 149 ? -26.973 24.520 -54.664 0.010 32.92  ? 149  LEU B HB3  1  
ATOM   5661   H HG   . LEU B 1 149 ? -29.011 25.098 -55.447 0.010 36.57  ? 149  LEU B HG   1  
ATOM   5662   H HD11 . LEU B 1 149 ? -28.749 27.462 -53.964 0.010 35.61  ? 149  LEU B HD11 1  
ATOM   5663   H HD12 . LEU B 1 149 ? -29.906 27.281 -55.038 0.010 38.05  ? 149  LEU B HD12 1  
ATOM   5664   H HD13 . LEU B 1 149 ? -29.866 26.348 -53.758 0.010 37.24  ? 149  LEU B HD13 1  
ATOM   5665   H HD21 . LEU B 1 149 ? -26.924 26.552 -56.377 0.010 34.69  ? 149  LEU B HD21 1  
ATOM   5666   H HD22 . LEU B 1 149 ? -28.162 26.018 -57.219 0.010 36.69  ? 149  LEU B HD22 1  
ATOM   5667   H HD23 . LEU B 1 149 ? -28.243 27.426 -56.494 0.010 37.20  ? 149  LEU B HD23 1  
ATOM   5668   N N    . ASP B 1 150 ? -29.959 24.034 -52.555 0.010 36.16  ? 150  ASP B N    1  
ATOM   5669   C CA   . ASP B 1 150 ? -30.936 22.962 -52.392 0.010 37.61  ? 150  ASP B CA   1  
ATOM   5670   C C    . ASP B 1 150 ? -30.869 22.008 -53.564 0.010 38.19  ? 150  ASP B C    1  
ATOM   5671   O O    . ASP B 1 150 ? -30.698 22.425 -54.706 0.010 38.67  ? 150  ASP B O    1  
ATOM   5672   C CB   . ASP B 1 150 ? -32.358 23.507 -52.245 0.010 40.08  ? 150  ASP B CB   1  
ATOM   5673   C CG   . ASP B 1 150 ? -33.312 22.917 -53.265 0.010 42.34  ? 150  ASP B CG   1  
ATOM   5674   O OD1  . ASP B 1 150 ? -33.996 21.920 -52.935 0.010 43.25  ? 150  ASP B OD1  1  
ATOM   5675   O OD2  . ASP B 1 150 ? -33.357 23.434 -54.397 0.010 43.35  ? 150  ASP B OD2  1  
ATOM   5676   H H    . ASP B 1 150 ? -30.292 24.823 -52.516 0.010 36.87  ? 150  ASP B H    1  
ATOM   5677   H HA   . ASP B 1 150 ? -30.719 22.462 -51.592 0.010 36.82  ? 150  ASP B HA   1  
ATOM   5678   H HB2  . ASP B 1 150 ? -32.693 23.285 -51.362 0.010 40.16  ? 150  ASP B HB2  1  
ATOM   5679   H HB3  . ASP B 1 150 ? -32.349 24.469 -52.365 0.010 40.37  ? 150  ASP B HB3  1  
ATOM   5680   N N    . ARG B 1 151 ? -31.008 20.723 -53.259 0.010 38.38  ? 151  ARG B N    1  
ATOM   5681   C CA   . ARG B 1 151 ? -30.820 19.661 -54.236 0.010 38.82  ? 151  ARG B CA   1  
ATOM   5682   C C    . ARG B 1 151 ? -31.734 19.763 -55.451 0.010 41.30  ? 151  ARG B C    1  
ATOM   5683   O O    . ARG B 1 151 ? -31.304 19.521 -56.577 0.010 41.57  ? 151  ARG B O    1  
ATOM   5684   C CB   . ARG B 1 151 ? -31.027 18.305 -53.559 0.010 39.01  ? 151  ARG B CB   1  
ATOM   5685   C CG   . ARG B 1 151 ? -30.810 17.130 -54.474 0.010 39.61  ? 151  ARG B CG   1  
ATOM   5686   C CD   . ARG B 1 151 ? -30.932 15.817 -53.711 0.010 39.91  ? 151  ARG B CD   1  
ATOM   5687   N NE   . ARG B 1 151 ? -29.822 15.595 -52.786 0.010 37.58  ? 151  ARG B NE   1  
ATOM   5688   C CZ   . ARG B 1 151 ? -29.873 15.786 -51.471 0.010 36.83  ? 151  ARG B CZ   1  
ATOM   5689   N NH1  . ARG B 1 151 ? -30.974 16.234 -50.893 0.010 38.20  ? 151  ARG B NH1  1  
ATOM   5690   N NH2  . ARG B 1 151 ? -28.802 15.542 -50.726 0.010 34.89  ? 151  ARG B NH2  1  
ATOM   5691   H H    . ARG B 1 151 ? -31.215 20.438 -52.475 0.010 38.40  ? 151  ARG B H    1  
ATOM   5692   H HA   . ARG B 1 151 ? -29.906 19.697 -54.555 0.010 37.53  ? 151  ARG B HA   1  
ATOM   5693   H HB2  . ARG B 1 151 ? -30.406 18.225 -52.817 0.010 37.52  ? 151  ARG B HB2  1  
ATOM   5694   H HB3  . ARG B 1 151 ? -31.938 18.256 -53.230 0.010 40.44  ? 151  ARG B HB3  1  
ATOM   5695   H HG2  . ARG B 1 151 ? -31.473 17.138 -55.180 0.010 41.26  ? 151  ARG B HG2  1  
ATOM   5696   H HG3  . ARG B 1 151 ? -29.918 17.179 -54.850 0.010 38.35  ? 151  ARG B HG3  1  
ATOM   5697   H HD2  . ARG B 1 151 ? -31.768 15.812 -53.219 0.010 41.02  ? 151  ARG B HD2  1  
ATOM   5698   H HD3  . ARG B 1 151 ? -30.930 15.086 -54.347 0.010 40.80  ? 151  ARG B HD3  1  
ATOM   5699   H HE   . ARG B 1 151 ? -29.044 15.473 -53.132 0.010 36.66  ? 151  ARG B HE   1  
ATOM   5700   H HH11 . ARG B 1 151 ? -31.674 16.399 -51.358 0.010 39.57  ? 151  ARG B HH11 1  
ATOM   5701   H HH12 . ARG B 1 151 ? -30.989 16.359 -50.044 0.010 37.84  ? 151  ARG B HH12 1  
ATOM   5702   H HH21 . ARG B 1 151 ? -28.084 15.251 -51.094 0.010 34.12  ? 151  ARG B HH21 1  
ATOM   5703   H HH22 . ARG B 1 151 ? -28.828 15.669 -49.877 0.010 34.53  ? 151  ARG B HH22 1  
ATOM   5704   N N    . ALA B 1 152 ? -32.997 20.092 -55.223 0.010 43.34  ? 152  ALA B N    1  
ATOM   5705   C CA   . ALA B 1 152 ? -33.968 20.119 -56.312 0.010 46.06  ? 152  ALA B CA   1  
ATOM   5706   C C    . ALA B 1 152 ? -33.527 21.145 -57.347 0.010 45.98  ? 152  ALA B C    1  
ATOM   5707   O O    . ALA B 1 152 ? -33.674 20.931 -58.546 0.010 47.34  ? 152  ALA B O    1  
ATOM   5708   C CB   . ALA B 1 152 ? -35.357 20.424 -55.783 0.010 48.30  ? 152  ALA B CB   1  
ATOM   5709   H H    . ALA B 1 152 ? -33.318 20.303 -54.454 0.010 43.34  ? 152  ALA B H    1  
ATOM   5710   H HA   . ALA B 1 152 ? -33.996 19.251 -56.744 0.010 46.70  ? 152  ALA B HA   1  
ATOM   5711   H HB1  . ALA B 1 152 ? -35.344 21.287 -55.341 0.010 47.78  ? 152  ALA B HB1  1  
ATOM   5712   H HB2  . ALA B 1 152 ? -35.983 20.440 -56.524 0.010 50.18  ? 152  ALA B HB2  1  
ATOM   5713   H HB3  . ALA B 1 152 ? -35.613 19.732 -55.153 0.010 48.52  ? 152  ALA B HB3  1  
ATOM   5714   N N    . THR B 1 153 ? -32.928 22.234 -56.868 0.010 44.50  ? 153  THR B N    1  
ATOM   5715   C CA   . THR B 1 153 ? -32.477 23.315 -57.739 0.010 44.41  ? 153  THR B CA   1  
ATOM   5716   C C    . THR B 1 153 ? -31.290 22.872 -58.584 0.010 43.20  ? 153  THR B C    1  
ATOM   5717   O O    . THR B 1 153 ? -31.301 23.043 -59.785 0.010 44.47  ? 153  THR B O    1  
ATOM   5718   C CB   . THR B 1 153 ? -32.111 24.567 -56.920 0.010 43.04  ? 153  THR B CB   1  
ATOM   5719   O OG1  . THR B 1 153 ? -33.297 25.118 -56.336 0.010 44.74  ? 153  THR B OG1  1  
ATOM   5720   C CG2  . THR B 1 153 ? -31.439 25.611 -57.788 0.010 42.83  ? 153  THR B CG2  1  
ATOM   5721   H H    . THR B 1 153 ? -32.762 22.371 -56.034 0.010 43.64  ? 153  THR B H    1  
ATOM   5722   H HA   . THR B 1 153 ? -33.197 23.555 -58.341 0.010 46.30  ? 153  THR B HA   1  
ATOM   5723   H HB   . THR B 1 153 ? -31.494 24.323 -56.214 0.010 41.33  ? 153  THR B HB   1  
ATOM   5724   H HG1  . THR B 1 153 ? -33.128 25.871 -55.982 0.010 44.25  ? 153  THR B HG1  1  
ATOM   5725   H HG21 . THR B 1 153 ? -31.899 25.683 -58.638 0.010 44.49  ? 153  THR B HG21 1  
ATOM   5726   H HG22 . THR B 1 153 ? -31.464 26.472 -57.340 0.010 42.61  ? 153  THR B HG22 1  
ATOM   5727   H HG23 . THR B 1 153 ? -30.513 25.371 -57.947 0.010 41.41  ? 153  THR B HG23 1  
ATOM   5728   N N    . CYS B 1 154 ? -30.272 22.274 -57.967 0.010 40.99  ? 154  CYS B N    1  
ATOM   5729   C CA   . CYS B 1 154 ? -29.110 21.823 -58.727 0.010 39.98  ? 154  CYS B CA   1  
ATOM   5730   C C    . CYS B 1 154 ? -29.461 20.604 -59.596 0.010 41.80  ? 154  CYS B C    1  
ATOM   5731   O O    . CYS B 1 154 ? -28.627 20.119 -60.356 0.010 41.73  ? 154  CYS B O    1  
ATOM   5732   C CB   . CYS B 1 154 ? -27.942 21.499 -57.792 0.010 37.33  ? 154  CYS B CB   1  
ATOM   5733   S SG   . CYS B 1 154 ? -27.819 22.597 -56.324 0.010 35.25  ? 154  CYS B SG   1  
ATOM   5734   H H    . CYS B 1 154 ? -30.228 22.122 -57.122 0.010 40.17  ? 154  CYS B H    1  
ATOM   5735   H HA   . CYS B 1 154 ? -28.825 22.536 -59.319 0.010 40.06  ? 154  CYS B HA   1  
ATOM   5736   H HB2  . CYS B 1 154 ? -28.037 20.588 -57.477 0.010 37.28  ? 154  CYS B HB2  1  
ATOM   5737   H HB3  . CYS B 1 154 ? -27.114 21.583 -58.291 0.010 36.94  ? 154  CYS B HB3  1  
ATOM   5738   N N    . ASN B 1 155 ? -30.690 20.108 -59.475 0.010 43.67  ? 155  ASN B N    1  
ATOM   5739   C CA   . ASN B 1 155 ? -31.143 18.976 -60.290 0.010 45.73  ? 155  ASN B CA   1  
ATOM   5740   C C    . ASN B 1 155 ? -31.905 19.383 -61.553 0.010 48.53  ? 155  ASN B C    1  
ATOM   5741   O O    . ASN B 1 155 ? -32.194 18.537 -62.401 0.010 50.55  ? 155  ASN B O    1  
ATOM   5742   C CB   . ASN B 1 155 ? -32.023 18.025 -59.470 0.010 46.51  ? 155  ASN B CB   1  
ATOM   5743   C CG   . ASN B 1 155 ? -31.242 16.856 -58.871 0.010 44.73  ? 155  ASN B CG   1  
ATOM   5744   O OD1  . ASN B 1 155 ? -30.221 16.427 -59.408 0.010 43.71  ? 155  ASN B OD1  1  
ATOM   5745   N ND2  . ASN B 1 155 ? -31.742 16.324 -57.759 0.010 44.63  ? 155  ASN B ND2  1  
ATOM   5746   H H    . ASN B 1 155 ? -31.283 20.400 -58.926 0.010 43.94  ? 155  ASN B H    1  
ATOM   5747   H HA   . ASN B 1 155 ? -30.366 18.478 -60.583 0.010 45.02  ? 155  ASN B HA   1  
ATOM   5748   H HB2  . ASN B 1 155 ? -32.435 18.520 -58.746 0.010 46.39  ? 155  ASN B HB2  1  
ATOM   5749   H HB3  . ASN B 1 155 ? -32.710 17.658 -60.048 0.010 48.51  ? 155  ASN B HB3  1  
ATOM   5750   H HD21 . ASN B 1 155 ? -32.564 16.460 -57.550 0.010 45.82  ? 155  ASN B HD21 1  
ATOM   5751   H HD22 . ASN B 1 155 ? -31.242 15.843 -57.252 0.010 43.49  ? 155  ASN B HD22 1  
ATOM   5752   N N    . ARG B 1 156 ? -32.250 20.661 -61.675 0.010 48.89  ? 156  ARG B N    1  
ATOM   5753   C CA   . ARG B 1 156 ? -32.899 21.145 -62.893 0.010 51.61  ? 156  ARG B CA   1  
ATOM   5754   C C    . ARG B 1 156 ? -32.042 20.813 -64.115 0.010 52.06  ? 156  ARG B C    1  
ATOM   5755   O O    . ARG B 1 156 ? -30.816 20.746 -64.016 0.010 49.92  ? 156  ARG B O    1  
ATOM   5756   C CB   . ARG B 1 156 ? -33.107 22.657 -62.837 0.010 51.65  ? 156  ARG B CB   1  
ATOM   5757   C CG   . ARG B 1 156 ? -34.019 23.167 -61.734 0.010 51.55  ? 156  ARG B CG   1  
ATOM   5758   C CD   . ARG B 1 156 ? -33.950 24.680 -61.731 0.010 51.53  ? 156  ARG B CD   1  
ATOM   5759   N NE   . ARG B 1 156 ? -34.830 25.333 -60.768 0.010 51.99  ? 156  ARG B NE   1  
ATOM   5760   C CZ   . ARG B 1 156 ? -34.660 26.587 -60.355 0.010 51.48  ? 156  ARG B CZ   1  
ATOM   5761   N NH1  . ARG B 1 156 ? -33.637 27.310 -60.802 0.010 50.40  ? 156  ARG B NH1  1  
ATOM   5762   N NH2  . ARG B 1 156 ? -35.502 27.121 -59.487 0.010 52.26  ? 156  ARG B NH2  1  
ATOM   5763   H H    . ARG B 1 156 ? -32.124 21.263 -61.074 0.010 47.72  ? 156  ARG B H    1  
ATOM   5764   H HA   . ARG B 1 156 ? -33.762 20.715 -62.991 0.010 53.40  ? 156  ARG B HA   1  
ATOM   5765   H HB2  . ARG B 1 156 ? -32.244 23.081 -62.716 0.010 50.03  ? 156  ARG B HB2  1  
ATOM   5766   H HB3  . ARG B 1 156 ? -33.490 22.943 -63.682 0.010 53.62  ? 156  ARG B HB3  1  
ATOM   5767   H HG2  . ARG B 1 156 ? -34.934 22.895 -61.909 0.010 53.43  ? 156  ARG B HG2  1  
ATOM   5768   H HG3  . ARG B 1 156 ? -33.719 22.836 -60.873 0.010 49.81  ? 156  ARG B HG3  1  
ATOM   5769   H HD2  . ARG B 1 156 ? -33.038 24.943 -61.527 0.010 49.69  ? 156  ARG B HD2  1  
ATOM   5770   H HD3  . ARG B 1 156 ? -34.193 25.001 -62.613 0.010 53.25  ? 156  ARG B HD3  1  
ATOM   5771   H HE   . ARG B 1 156 ? -35.367 24.835 -60.318 0.010 52.61  ? 156  ARG B HE   1  
ATOM   5772   H HH11 . ARG B 1 156 ? -33.081 26.979 -61.369 0.010 50.03  ? 156  ARG B HH11 1  
ATOM   5773   H HH12 . ARG B 1 156 ? -33.533 28.119 -60.528 0.010 50.19  ? 156  ARG B HH12 1  
ATOM   5774   H HH21 . ARG B 1 156 ? -36.162 26.659 -59.188 0.010 53.09  ? 156  ARG B HH21 1  
ATOM   5775   H HH22 . ARG B 1 156 ? -35.384 27.929 -59.217 0.010 52.05  ? 156  ARG B HH22 1  
ATOM   5776   N N    . ARG B 1 157 ? -32.691 20.628 -65.264 0.010 55.07  ? 157  ARG B N    1  
ATOM   5777   C CA   . ARG B 1 157 ? -32.009 20.170 -66.479 0.010 56.11  ? 157  ARG B CA   1  
ATOM   5778   C C    . ARG B 1 157 ? -30.847 21.070 -66.849 0.010 54.65  ? 157  ARG B C    1  
ATOM   5779   O O    . ARG B 1 157 ? -29.861 20.621 -67.434 0.010 54.25  ? 157  ARG B O    1  
ATOM   5780   C CB   . ARG B 1 157 ? -32.979 20.100 -67.660 0.010 59.93  ? 157  ARG B CB   1  
ATOM   5781   C CG   . ARG B 1 157 ? -33.567 21.440 -68.049 0.010 61.37  ? 157  ARG B CG   1  
ATOM   5782   C CD   . ARG B 1 157 ? -33.997 21.512 -69.520 0.010 64.87  ? 157  ARG B CD   1  
ATOM   5783   N NE   . ARG B 1 157 ? -33.953 22.889 -70.010 0.010 65.53  ? 157  ARG B NE   1  
ATOM   5784   C CZ   . ARG B 1 157 ? -32.863 23.478 -70.494 0.010 64.58  ? 157  ARG B CZ   1  
ATOM   5785   N NH1  . ARG B 1 157 ? -31.723 22.812 -70.561 0.010 62.90  ? 157  ARG B NH1  1  
ATOM   5786   N NH2  . ARG B 1 157 ? -32.909 24.736 -70.918 0.010 65.53  ? 157  ARG B NH2  1  
ATOM   5787   H H    . ARG B 1 157 ? -33.533 20.763 -65.370 0.010 56.70  ? 157  ARG B H    1  
ATOM   5788   H HA   . ARG B 1 157 ? -31.656 19.284 -66.328 0.010 55.51  ? 157  ARG B HA   1  
ATOM   5789   H HB2  . ARG B 1 157 ? -32.505 19.745 -68.429 0.010 60.70  ? 157  ARG B HB2  1  
ATOM   5790   H HB3  . ARG B 1 157 ? -33.712 19.512 -67.425 0.010 60.96  ? 157  ARG B HB3  1  
ATOM   5791   H HG2  . ARG B 1 157 ? -34.355 21.588 -67.506 0.010 61.91  ? 157  ARG B HG2  1  
ATOM   5792   H HG3  . ARG B 1 157 ? -32.925 22.147 -67.897 0.010 59.76  ? 157  ARG B HG3  1  
ATOM   5793   H HD2  . ARG B 1 157 ? -33.406 20.969 -70.065 0.010 64.96  ? 157  ARG B HD2  1  
ATOM   5794   H HD3  . ARG B 1 157 ? -34.908 21.193 -69.600 0.010 66.87  ? 157  ARG B HD3  1  
ATOM   5795   H HE   . ARG B 1 157 ? -34.641 23.383 -69.865 0.010 66.38  ? 157  ARG B HE   1  
ATOM   5796   H HH11 . ARG B 1 157 ? -31.673 21.998 -70.294 0.010 62.38  ? 157  ARG B HH11 1  
ATOM   5797   H HH12 . ARG B 1 157 ? -31.030 23.201 -70.881 0.010 62.46  ? 157  ARG B HH12 1  
ATOM   5798   H HH21 . ARG B 1 157 ? -33.645 25.176 -70.880 0.010 66.73  ? 157  ARG B HH21 1  
ATOM   5799   H HH22 . ARG B 1 157 ? -32.201 25.109 -71.233 0.010 65.03  ? 157  ARG B HH22 1  
ATOM   5800   N N    . THR B 1 158 ? -30.972 22.347 -66.506 0.010 54.07  ? 158  THR B N    1  
ATOM   5801   C CA   . THR B 1 158 ? -29.978 23.319 -66.910 0.010 53.14  ? 158  THR B CA   1  
ATOM   5802   C C    . THR B 1 158 ? -28.798 23.368 -65.954 0.010 49.71  ? 158  THR B C    1  
ATOM   5803   O O    . THR B 1 158 ? -27.879 24.156 -66.143 0.010 48.76  ? 158  THR B O    1  
ATOM   5804   C CB   . THR B 1 158 ? -30.572 24.736 -67.083 0.010 54.37  ? 158  THR B CB   1  
ATOM   5805   O OG1  . THR B 1 158 ? -29.791 25.460 -68.039 0.010 54.61  ? 158  THR B OG1  1  
ATOM   5806   C CG2  . THR B 1 158 ? -30.599 25.492 -65.763 0.010 52.36  ? 158  THR B CG2  1  
ATOM   5807   H H    . THR B 1 158 ? -31.621 22.670 -66.045 0.010 54.36  ? 158  THR B H    1  
ATOM   5808   H HA   . THR B 1 158 ? -29.657 23.034 -67.765 0.010 54.22  ? 158  THR B HA   1  
ATOM   5809   H HB   . THR B 1 158 ? -31.483 24.666 -67.411 0.010 56.52  ? 158  THR B HB   1  
ATOM   5810   H HG1  . THR B 1 158 ? -30.278 25.702 -68.692 0.010 56.38  ? 158  THR B HG1  1  
ATOM   5811   H HG21 . THR B 1 158 ? -30.881 24.890 -65.061 0.010 51.63  ? 158  THR B HG21 1  
ATOM   5812   H HG22 . THR B 1 158 ? -29.720 25.846 -65.556 0.010 50.67  ? 158  THR B HG22 1  
ATOM   5813   H HG23 . THR B 1 158 ? -31.231 26.225 -65.812 0.010 53.67  ? 158  THR B HG23 1  
ATOM   5814   N N    . HIS B 1 159 ? -28.824 22.530 -64.926 0.010 48.06  ? 159  HIS B N    1  
ATOM   5815   C CA   . HIS B 1 159 ? -27.659 22.375 -64.065 0.010 45.06  ? 159  HIS B CA   1  
ATOM   5816   C C    . HIS B 1 159 ? -27.089 20.969 -64.178 0.010 44.71  ? 159  HIS B C    1  
ATOM   5817   O O    . HIS B 1 159 ? -26.405 20.661 -65.148 0.010 45.58  ? 159  HIS B O    1  
ATOM   5818   C CB   . HIS B 1 159 ? -27.997 22.730 -62.615 0.010 43.22  ? 159  HIS B CB   1  
ATOM   5819   C CG   . HIS B 1 159 ? -28.493 24.128 -62.449 0.010 43.64  ? 159  HIS B CG   1  
ATOM   5820   N ND1  . HIS B 1 159 ? -27.725 25.128 -61.895 0.010 42.19  ? 159  HIS B ND1  1  
ATOM   5821   C CD2  . HIS B 1 159 ? -29.670 24.700 -62.788 0.010 45.58  ? 159  HIS B CD2  1  
ATOM   5822   C CE1  . HIS B 1 159 ? -28.414 26.254 -61.889 0.010 43.22  ? 159  HIS B CE1  1  
ATOM   5823   N NE2  . HIS B 1 159 ? -29.597 26.022 -62.426 0.010 45.27  ? 159  HIS B NE2  1  
ATOM   5824   H H    . HIS B 1 159 ? -29.498 22.047 -64.701 0.010 48.73  ? 159  HIS B H    1  
ATOM   5825   H HA   . HIS B 1 159 ? -26.965 22.972 -64.363 0.010 44.63  ? 159  HIS B HA   1  
ATOM   5826   H HB2  . HIS B 1 159 ? -28.694 22.137 -62.295 0.010 43.78  ? 159  HIS B HB2  1  
ATOM   5827   H HB3  . HIS B 1 159 ? -27.200 22.632 -62.072 0.010 41.38  ? 159  HIS B HB3  1  
ATOM   5828   H HD1  . HIS B 1 159 ? -26.928 25.030 -61.596 0.010 40.93  ? 159  HIS B HD1  1  
ATOM   5829   H HD2  . HIS B 1 159 ? -30.395 24.277 -63.187 0.010 47.00  ? 159  HIS B HD2  1  
ATOM   5830   H HE1  . HIS B 1 159 ? -28.116 27.072 -61.562 0.010 42.72  ? 159  HIS B HE1  1  
ATOM   5831   H HE2  . HIS B 1 159 ? -30.222 26.605 -62.531 0.010 46.37  ? 159  HIS B HE2  1  
ATOM   5832   N N    . HIS B 1 160 ? -27.359 20.132 -63.183 0.010 43.67  ? 160  HIS B N    1  
ATOM   5833   C CA   . HIS B 1 160 ? -26.855 18.764 -63.172 0.010 43.47  ? 160  HIS B CA   1  
ATOM   5834   C C    . HIS B 1 160 ? -27.975 17.778 -63.489 0.010 45.81  ? 160  HIS B C    1  
ATOM   5835   O O    . HIS B 1 160 ? -27.806 16.568 -63.326 0.010 45.98  ? 160  HIS B O    1  
ATOM   5836   C CB   . HIS B 1 160 ? -26.196 18.447 -61.827 0.010 40.72  ? 160  HIS B CB   1  
ATOM   5837   C CG   . HIS B 1 160 ? -24.968 19.257 -61.558 0.010 38.58  ? 160  HIS B CG   1  
ATOM   5838   N ND1  . HIS B 1 160 ? -23.905 19.304 -62.434 0.010 38.49  ? 160  HIS B ND1  1  
ATOM   5839   C CD2  . HIS B 1 160 ? -24.625 20.038 -60.505 0.010 36.67  ? 160  HIS B CD2  1  
ATOM   5840   C CE1  . HIS B 1 160 ? -22.964 20.090 -61.937 0.010 36.59  ? 160  HIS B CE1  1  
ATOM   5841   N NE2  . HIS B 1 160 ? -23.375 20.546 -60.767 0.010 35.45  ? 160  HIS B NE2  1  
ATOM   5842   H H    . HIS B 1 160 ? -27.840 20.323 -62.499 0.010 43.21  ? 160  HIS B H    1  
ATOM   5843   H HA   . HIS B 1 160 ? -26.177 18.664 -63.856 0.010 43.80  ? 160  HIS B HA   1  
ATOM   5844   H HB2  . HIS B 1 160 ? -26.829 18.614 -61.113 0.010 40.43  ? 160  HIS B HB2  1  
ATOM   5845   H HB3  . HIS B 1 160 ? -25.931 17.516 -61.821 0.010 40.80  ? 160  HIS B HB3  1  
ATOM   5846   H HD1  . HIS B 1 160 ? -23.864 18.892 -63.185 0.010 39.63  ? 160  HIS B HD1  1  
ATOM   5847   H HD2  . HIS B 1 160 ? -25.140 20.203 -59.748 0.010 36.40  ? 160  HIS B HD2  1  
ATOM   5848   H HE1  . HIS B 1 160 ? -22.149 20.285 -62.342 0.010 36.27  ? 160  HIS B HE1  1  
ATOM   5849   H HE2  . HIS B 1 160 ? -22.937 21.074 -60.255 0.010 34.28  ? 160  HIS B HE2  1  
ATOM   5850   N N    . ASP B 1 161 ? -29.116 18.320 -63.910 0.010 47.74  ? 161  ASP B N    1  
ATOM   5851   C CA   . ASP B 1 161 ? -30.198 17.552 -64.544 0.010 50.73  ? 161  ASP B CA   1  
ATOM   5852   C C    . ASP B 1 161 ? -30.564 16.239 -63.847 0.010 50.88  ? 161  ASP B C    1  
ATOM   5853   O O    . ASP B 1 161 ? -30.690 15.202 -64.505 0.010 53.10  ? 161  ASP B O    1  
ATOM   5854   C CB   . ASP B 1 161 ? -29.813 17.279 -66.006 0.010 52.83  ? 161  ASP B CB   1  
ATOM   5855   C CG   . ASP B 1 161 ? -30.988 16.795 -66.870 0.010 56.49  ? 161  ASP B CG   1  
ATOM   5856   O OD1  . ASP B 1 161 ? -32.163 16.872 -66.441 0.010 57.53  ? 161  ASP B OD1  1  
ATOM   5857   O OD2  . ASP B 1 161 ? -30.720 16.354 -68.005 0.010 58.54  ? 161  ASP B OD2  1  
ATOM   5858   H H    . ASP B 1 161 ? -29.303 19.155 -63.841 0.010 47.49  ? 161  ASP B H    1  
ATOM   5859   H HA   . ASP B 1 161 ? -30.992 18.105 -64.549 0.010 51.71  ? 161  ASP B HA   1  
ATOM   5860   H HB2  . ASP B 1 161 ? -29.475 18.099 -66.396 0.010 52.61  ? 161  ASP B HB2  1  
ATOM   5861   H HB3  . ASP B 1 161 ? -29.123 16.598 -66.024 0.010 52.27  ? 161  ASP B HB3  1  
ATOM   5862   N N    . GLY B 1 162 ? -30.737 16.277 -62.527 0.010 48.79  ? 162  GLY B N    1  
ATOM   5863   C CA   . GLY B 1 162 ? -31.267 15.128 -61.797 0.010 49.25  ? 162  GLY B CA   1  
ATOM   5864   C C    . GLY B 1 162 ? -30.275 14.184 -61.110 0.010 47.33  ? 162  GLY B C    1  
ATOM   5865   O O    . GLY B 1 162 ? -30.677 13.304 -60.356 0.010 47.40  ? 162  GLY B O    1  
ATOM   5866   H H    . GLY B 1 162 ? -30.559 16.958 -62.034 0.010 47.23  ? 162  GLY B H    1  
ATOM   5867   H HA2  . GLY B 1 162 ? -31.875 15.456 -61.117 0.010 49.09  ? 162  GLY B HA2  1  
ATOM   5868   H HA3  . GLY B 1 162 ? -31.792 14.591 -62.409 0.010 51.37  ? 162  GLY B HA3  1  
ATOM   5869   N N    . ALA B 1 163 ? -28.984 14.374 -61.351 0.010 45.82  ? 163  ALA B N    1  
ATOM   5870   C CA   . ALA B 1 163 ? -27.979 13.407 -60.918 0.010 44.39  ? 163  ALA B CA   1  
ATOM   5871   C C    . ALA B 1 163 ? -27.347 13.718 -59.552 0.010 41.58  ? 163  ALA B C    1  
ATOM   5872   O O    . ALA B 1 163 ? -26.423 13.035 -59.120 0.010 40.46  ? 163  ALA B O    1  
ATOM   5873   C CB   . ALA B 1 163 ? -26.911 13.281 -61.973 0.010 44.22  ? 163  ALA B CB   1  
ATOM   5874   H H    . ALA B 1 163 ? -28.662 15.054 -61.768 0.010 45.73  ? 163  ALA B H    1  
ATOM   5875   H HA   . ALA B 1 163 ? -28.403 12.539 -60.846 0.010 45.67  ? 163  ALA B HA   1  
ATOM   5876   H HB1  . ALA B 1 163 ? -27.336 13.192 -62.840 0.010 46.19  ? 163  ALA B HB1  1  
ATOM   5877   H HB2  . ALA B 1 163 ? -26.358 14.076 -61.958 0.010 43.05  ? 163  ALA B HB2  1  
ATOM   5878   H HB3  . ALA B 1 163 ? -26.370 12.500 -61.781 0.010 43.51  ? 163  ALA B HB3  1  
ATOM   5879   N N    . ILE B 1 164 ? -27.836 14.743 -58.870 0.010 40.67  ? 164  ILE B N    1  
ATOM   5880   C CA   . ILE B 1 164 ? -27.449 14.958 -57.478 0.010 38.44  ? 164  ILE B CA   1  
ATOM   5881   C C    . ILE B 1 164 ? -28.184 13.959 -56.586 0.010 39.25  ? 164  ILE B C    1  
ATOM   5882   O O    . ILE B 1 164 ? -29.151 14.302 -55.911 0.010 39.82  ? 164  ILE B O    1  
ATOM   5883   C CB   . ILE B 1 164 ? -27.743 16.391 -57.007 0.010 37.57  ? 164  ILE B CB   1  
ATOM   5884   C CG1  . ILE B 1 164 ? -27.177 17.400 -58.005 0.010 37.26  ? 164  ILE B CG1  1  
ATOM   5885   C CG2  . ILE B 1 164 ? -27.127 16.652 -55.646 0.010 35.34  ? 164  ILE B CG2  1  
ATOM   5886   C CD1  . ILE B 1 164 ? -25.769 17.089 -58.469 0.010 36.22  ? 164  ILE B CD1  1  
ATOM   5887   H H    . ILE B 1 164 ? -28.383 15.326 -59.187 0.010 41.41  ? 164  ILE B H    1  
ATOM   5888   H HA   . ILE B 1 164 ? -26.498 14.799 -57.374 0.010 37.12  ? 164  ILE B HA   1  
ATOM   5889   H HB   . ILE B 1 164 ? -28.701 16.518 -56.944 0.010 38.89  ? 164  ILE B HB   1  
ATOM   5890   H HG12 . ILE B 1 164 ? -27.754 17.429 -58.783 0.010 38.90  ? 164  ILE B HG12 1  
ATOM   5891   H HG13 . ILE B 1 164 ? -27.157 18.271 -57.581 0.010 36.31  ? 164  ILE B HG13 1  
ATOM   5892   H HG21 . ILE B 1 164 ? -26.172 16.501 -55.700 0.010 34.08  ? 164  ILE B HG21 1  
ATOM   5893   H HG22 . ILE B 1 164 ? -27.308 17.570 -55.393 0.010 35.08  ? 164  ILE B HG22 1  
ATOM   5894   H HG23 . ILE B 1 164 ? -27.518 16.048 -54.996 0.010 35.65  ? 164  ILE B HG23 1  
ATOM   5895   H HD11 . ILE B 1 164 ? -25.227 16.851 -57.701 0.010 35.00  ? 164  ILE B HD11 1  
ATOM   5896   H HD12 . ILE B 1 164 ? -25.795 16.351 -59.096 0.010 37.54  ? 164  ILE B HD12 1  
ATOM   5897   H HD13 . ILE B 1 164 ? -25.399 17.871 -58.903 0.010 35.64  ? 164  ILE B HD13 1  
ATOM   5898   N N    . THR B 1 165 ? -27.734 12.714 -56.604 0.010 39.58  ? 165  THR B N    1  
ATOM   5899   C CA   . THR B 1 165 ? -28.290 11.694 -55.704 0.010 40.33  ? 165  THR B CA   1  
ATOM   5900   C C    . THR B 1 165 ? -28.403 12.201 -54.271 0.010 38.88  ? 165  THR B C    1  
ATOM   5901   O O    . THR B 1 165 ? -27.765 13.191 -53.891 0.010 36.95  ? 165  THR B O    1  
ATOM   5902   C CB   . THR B 1 165 ? -27.444 10.430 -55.672 0.010 40.20  ? 165  THR B CB   1  
ATOM   5903   O OG1  . THR B 1 165 ? -26.183 10.709 -55.054 0.010 37.64  ? 165  THR B OG1  1  
ATOM   5904   C CG2  . THR B 1 165 ? -27.240 9.875  -57.082 0.010 42.09  ? 165  THR B CG2  1  
ATOM   5905   H H    . THR B 1 165 ? -27.112 12.434 -57.127 0.010 39.54  ? 165  THR B H    1  
ATOM   5906   H HA   . THR B 1 165 ? -29.177 11.449 -56.007 0.010 42.20  ? 165  THR B HA   1  
ATOM   5907   H HB   . THR B 1 165 ? -27.907 9.759  -55.151 0.010 40.90  ? 165  THR B HB   1  
ATOM   5908   H HG1  . THR B 1 165 ? -25.849 11.417 -55.386 0.010 37.34  ? 165  THR B HG1  1  
ATOM   5909   H HG21 . THR B 1 165 ? -26.783 10.521 -57.642 0.010 41.53  ? 165  THR B HG21 1  
ATOM   5910   H HG22 . THR B 1 165 ? -26.711 9.063  -57.047 0.010 42.23  ? 165  THR B HG22 1  
ATOM   5911   H HG23 . THR B 1 165 ? -28.100 9.670  -57.480 0.010 43.93  ? 165  THR B HG23 1  
ATOM   5912   N N    . GLU B 1 166 ? -29.208 11.501 -53.478 0.010 40.06  ? 166  GLU B N    1  
ATOM   5913   C CA   . GLU B 1 166 ? -29.445 11.865 -52.089 0.010 39.22  ? 166  GLU B CA   1  
ATOM   5914   C C    . GLU B 1 166 ? -28.142 11.860 -51.266 0.010 36.68  ? 166  GLU B C    1  
ATOM   5915   O O    . GLU B 1 166 ? -28.110 12.367 -50.151 0.010 35.68  ? 166  GLU B O    1  
ATOM   5916   C CB   . GLU B 1 166 ? -30.447 10.888 -51.456 0.010 41.33  ? 166  GLU B CB   1  
ATOM   5917   C CG   . GLU B 1 166 ? -29.782 9.777  -50.646 0.010 40.76  ? 166  GLU B CG   1  
ATOM   5918   C CD   . GLU B 1 166 ? -30.762 8.736  -50.131 0.010 43.15  ? 166  GLU B CD   1  
ATOM   5919   O OE1  . GLU B 1 166 ? -31.804 8.493  -50.790 0.010 45.60  ? 166  GLU B OE1  1  
ATOM   5920   O OE2  . GLU B 1 166 ? -30.473 8.139  -49.069 0.010 42.76  ? 166  GLU B OE2  1  
ATOM   5921   H H    . GLU B 1 166 ? -29.635 10.801 -53.728 0.010 41.50  ? 166  GLU B H    1  
ATOM   5922   H HA   . GLU B 1 166 ? -29.826 12.757 -52.054 0.010 39.15  ? 166  GLU B HA   1  
ATOM   5923   H HB2  . GLU B 1 166 ? -31.045 11.376 -50.867 0.010 41.70  ? 166  GLU B HB2  1  
ATOM   5924   H HB3  . GLU B 1 166 ? -30.963 10.470 -52.163 0.010 43.00  ? 166  GLU B HB3  1  
ATOM   5925   H HG2  . GLU B 1 166 ? -29.139 9.323  -51.210 0.010 40.51  ? 166  GLU B HG2  1  
ATOM   5926   H HG3  . GLU B 1 166 ? -29.341 10.151 -49.868 0.010 39.27  ? 166  GLU B HG3  1  
ATOM   5927   N N    . ARG B 1 167 ? -27.096 11.248 -51.807 0.010 35.94  ? 167  ARG B N    1  
ATOM   5928   C CA   . ARG B 1 167 ? -25.850 11.087 -51.072 0.010 33.92  ? 167  ARG B CA   1  
ATOM   5929   C C    . ARG B 1 167 ? -24.820 12.115 -51.543 0.010 32.03  ? 167  ARG B C    1  
ATOM   5930   O O    . ARG B 1 167 ? -23.666 12.085 -51.113 0.010 30.53  ? 167  ARG B O    1  
ATOM   5931   C CB   . ARG B 1 167 ? -25.333 9.654  -51.225 0.010 34.70  ? 167  ARG B CB   1  
ATOM   5932   C CG   . ARG B 1 167 ? -26.453 8.639  -51.058 0.010 37.16  ? 167  ARG B CG   1  
ATOM   5933   C CD   . ARG B 1 167 ? -25.987 7.231  -51.258 0.010 38.20  ? 167  ARG B CD   1  
ATOM   5934   N NE   . ARG B 1 167 ? -27.121 6.340  -51.562 0.010 41.06  ? 167  ARG B NE   1  
ATOM   5935   C CZ   . ARG B 1 167 ? -26.993 5.050  -51.833 0.010 42.77  ? 167  ARG B CZ   1  
ATOM   5936   N NH1  . ARG B 1 167 ? -25.780 4.513  -51.837 0.010 41.89  ? 167  ARG B NH1  1  
ATOM   5937   N NH2  . ARG B 1 167 ? -28.072 4.301  -52.102 0.010 45.57  ? 167  ARG B NH2  1  
ATOM   5938   H H    . ARG B 1 167 ? -27.078 10.913 -52.597 0.010 36.72  ? 167  ARG B H    1  
ATOM   5939   H HA   . ARG B 1 167 ? -26.008 11.239 -50.129 0.010 33.46  ? 167  ARG B HA   1  
ATOM   5940   H HB2  . ARG B 1 167 ? -24.944 9.540  -52.106 0.010 34.89  ? 167  ARG B HB2  1  
ATOM   5941   H HB3  . ARG B 1 167 ? -24.668 9.482  -50.543 0.010 33.64  ? 167  ARG B HB3  1  
ATOM   5942   H HG2  . ARG B 1 167 ? -26.825 8.716  -50.165 0.010 37.14  ? 167  ARG B HG2  1  
ATOM   5943   H HG3  . ARG B 1 167 ? -27.136 8.808  -51.723 0.010 38.36  ? 167  ARG B HG3  1  
ATOM   5944   H HD2  . ARG B 1 167 ? -25.361 7.201  -51.999 0.010 37.89  ? 167  ARG B HD2  1  
ATOM   5945   H HD3  . ARG B 1 167 ? -25.558 6.921  -50.444 0.010 37.49  ? 167  ARG B HD3  1  
ATOM   5946   H HE   . ARG B 1 167 ? -27.915 6.674  -51.559 0.010 41.81  ? 167  ARG B HE   1  
ATOM   5947   H HH11 . ARG B 1 167 ? -25.086 4.992  -51.664 0.010 40.20  ? 167  ARG B HH11 1  
ATOM   5948   H HH12 . ARG B 1 167 ? -25.686 3.676  -52.011 0.010 43.12  ? 167  ARG B HH12 1  
ATOM   5949   H HH21 . ARG B 1 167 ? -28.852 4.660  -52.096 0.010 46.22  ? 167  ARG B HH21 1  
ATOM   5950   H HH22 . ARG B 1 167 ? -27.989 3.461  -52.277 0.010 46.83  ? 167  ARG B HH22 1  
ATOM   5951   N N    . LEU B 1 168 ? -25.257 12.999 -52.446 0.010 32.39  ? 168  LEU B N    1  
ATOM   5952   C CA   . LEU B 1 168 ? -24.451 14.112 -52.921 0.010 30.93  ? 168  LEU B CA   1  
ATOM   5953   C C    . LEU B 1 168 ? -25.150 15.411 -52.558 0.010 30.80  ? 168  LEU B C    1  
ATOM   5954   O O    . LEU B 1 168 ? -26.374 15.472 -52.439 0.010 32.30  ? 168  LEU B O    1  
ATOM   5955   C CB   . LEU B 1 168 ? -24.269 14.053 -54.436 0.010 31.92  ? 168  LEU B CB   1  
ATOM   5956   C CG   . LEU B 1 168 ? -23.494 12.889 -55.061 0.010 32.50  ? 168  LEU B CG   1  
ATOM   5957   C CD1  . LEU B 1 168 ? -23.781 12.915 -56.550 0.010 34.38  ? 168  LEU B CD1  1  
ATOM   5958   C CD2  . LEU B 1 168 ? -21.959 12.931 -54.784 0.010 30.67  ? 168  LEU B CD2  1  
ATOM   5959   H H    . LEU B 1 168 ? -26.037 12.981 -52.805 0.010 33.60  ? 168  LEU B H    1  
ATOM   5960   H HA   . LEU B 1 168 ? -23.578 14.103 -52.505 0.010 29.62  ? 168  LEU B HA   1  
ATOM   5961   H HB2  . LEU B 1 168 ? -25.151 14.055 -54.840 0.010 33.31  ? 168  LEU B HB2  1  
ATOM   5962   H HB3  . LEU B 1 168 ? -23.806 14.863 -54.703 0.010 31.07  ? 168  LEU B HB3  1  
ATOM   5963   H HG   . LEU B 1 168 ? -23.839 12.055 -54.706 0.010 33.17  ? 168  LEU B HG   1  
ATOM   5964   H HD11 . LEU B 1 168 ? -24.741 12.902 -56.689 0.010 35.65  ? 168  LEU B HD11 1  
ATOM   5965   H HD12 . LEU B 1 168 ? -23.410 13.727 -56.922 0.010 33.86  ? 168  LEU B HD12 1  
ATOM   5966   H HD13 . LEU B 1 168 ? -23.380 12.136 -56.962 0.010 35.00  ? 168  LEU B HD13 1  
ATOM   5967   H HD21 . LEU B 1 168 ? -21.625 13.822 -54.970 0.010 29.87  ? 168  LEU B HD21 1  
ATOM   5968   H HD22 . LEU B 1 168 ? -21.789 12.708 -53.855 0.010 29.82  ? 168  LEU B HD22 1  
ATOM   5969   H HD23 . LEU B 1 168 ? -21.516 12.292 -55.362 0.010 31.35  ? 168  LEU B HD23 1  
ATOM   5970   N N    . MET B 1 169 ? -24.357 16.457 -52.399 0.010 29.22  ? 169  MET B N    1  
ATOM   5971   C CA   . MET B 1 169 ? -24.880 17.792 -52.177 0.010 29.23  ? 169  MET B CA   1  
ATOM   5972   C C    . MET B 1 169 ? -24.134 18.736 -53.090 0.010 28.67  ? 169  MET B C    1  
ATOM   5973   O O    . MET B 1 169 ? -23.141 18.356 -53.707 0.010 28.08  ? 169  MET B O    1  
ATOM   5974   C CB   . MET B 1 169 ? -24.702 18.210 -50.725 0.010 28.05  ? 169  MET B CB   1  
ATOM   5975   C CG   . MET B 1 169 ? -23.249 18.298 -50.275 0.010 26.10  ? 169  MET B CG   1  
ATOM   5976   S SD   . MET B 1 169 ? -23.112 18.638 -48.519 0.010 25.17  ? 169  MET B SD   1  
ATOM   5977   C CE   . MET B 1 169 ? -23.629 20.361 -48.465 0.010 25.42  ? 169  MET B CE   1  
ATOM   5978   H H    . MET B 1 169 ? -23.500 16.416 -52.417 0.010 28.25  ? 169  MET B H    1  
ATOM   5979   H HA   . MET B 1 169 ? -25.823 17.831 -52.392 0.010 30.55  ? 169  MET B HA   1  
ATOM   5980   H HB2  . MET B 1 169 ? -25.113 19.076 -50.592 0.010 28.23  ? 169  MET B HB2  1  
ATOM   5981   H HB3  . MET B 1 169 ? -25.139 17.557 -50.158 0.010 28.57  ? 169  MET B HB3  1  
ATOM   5982   H HG2  . MET B 1 169 ? -22.805 17.456 -50.456 0.010 26.01  ? 169  MET B HG2  1  
ATOM   5983   H HG3  . MET B 1 169 ? -22.817 19.020 -50.755 0.010 25.65  ? 169  MET B HG3  1  
ATOM   5984   H HE1  . MET B 1 169 ? -24.461 20.453 -48.953 0.010 26.59  ? 169  MET B HE1  1  
ATOM   5985   H HE2  . MET B 1 169 ? -23.755 20.625 -47.540 0.010 25.18  ? 169  MET B HE2  1  
ATOM   5986   H HE3  . MET B 1 169 ? -22.945 20.911 -48.875 0.010 24.81  ? 169  MET B HE3  1  
ATOM   5987   N N    . CYS B 1 170 ? -24.640 19.954 -53.196 0.010 29.13  ? 170  CYS B N    1  
ATOM   5988   C CA   . CYS B 1 170 ? -23.980 20.961 -54.022 0.010 28.85  ? 170  CYS B CA   1  
ATOM   5989   C C    . CYS B 1 170 ? -23.979 22.290 -53.310 0.010 28.17  ? 170  CYS B C    1  
ATOM   5990   O O    . CYS B 1 170 ? -24.700 22.513 -52.337 0.010 28.35  ? 170  CYS B O    1  
ATOM   5991   C CB   . CYS B 1 170 ? -24.659 21.091 -55.388 0.010 30.81  ? 170  CYS B CB   1  
ATOM   5992   S SG   . CYS B 1 170 ? -26.362 21.616 -55.268 0.010 32.79  ? 170  CYS B SG   1  
ATOM   5993   H H    . CYS B 1 170 ? -25.353 20.223 -52.799 0.010 29.71  ? 170  CYS B H    1  
ATOM   5994   H HA   . CYS B 1 170 ? -23.058 20.709 -54.160 0.010 28.02  ? 170  CYS B HA   1  
ATOM   5995   H HB2  . CYS B 1 170 ? -24.185 21.748 -55.922 0.010 30.71  ? 170  CYS B HB2  1  
ATOM   5996   H HB3  . CYS B 1 170 ? -24.646 20.231 -55.840 0.010 31.35  ? 170  CYS B HB3  1  
ATOM   5997   N N    . ALA B 1 171 ? -23.166 23.186 -53.840 0.010 27.66  ? 171  ALA B N    1  
ATOM   5998   C CA   . ALA B 1 171 ? -22.958 24.471 -53.226 0.010 27.17  ? 171  ALA B CA   1  
ATOM   5999   C C    . ALA B 1 171 ? -22.947 25.444 -54.373 0.010 28.14  ? 171  ALA B C    1  
ATOM   6000   O O    . ALA B 1 171 ? -22.595 25.070 -55.497 0.010 28.58  ? 171  ALA B O    1  
ATOM   6001   C CB   . ALA B 1 171 ? -21.648 24.474 -52.491 0.010 25.35  ? 171  ALA B CB   1  
ATOM   6002   H H    . ALA B 1 171 ? -22.726 23.071 -54.569 0.010 27.73  ? 171  ALA B H    1  
ATOM   6003   H HA   . ALA B 1 171 ? -23.678 24.697 -52.618 0.010 27.66  ? 171  ALA B HA   1  
ATOM   6004   H HB1  . ALA B 1 171 ? -20.949 24.193 -53.101 0.010 24.99  ? 171  ALA B HB1  1  
ATOM   6005   H HB2  . ALA B 1 171 ? -21.467 25.369 -52.167 0.010 25.18  ? 171  ALA B HB2  1  
ATOM   6006   H HB3  . ALA B 1 171 ? -21.704 23.855 -51.748 0.010 24.89  ? 171  ALA B HB3  1  
ATOM   6007   N N    . GLU B 1 172 ? -23.376 26.677 -54.115 0.010 28.77  ? 172  GLU B N    1  
ATOM   6008   C CA   . GLU B 1 172 ? -23.470 27.624 -55.195 0.010 29.98  ? 172  GLU B CA   1  
ATOM   6009   C C    . GLU B 1 172 ? -22.076 27.829 -55.769 0.010 29.10  ? 172  GLU B C    1  
ATOM   6010   O O    . GLU B 1 172 ? -21.067 27.548 -55.119 0.010 27.49  ? 172  GLU B O    1  
ATOM   6011   C CB   . GLU B 1 172 ? -24.126 28.930 -54.756 0.010 30.87  ? 172  GLU B CB   1  
ATOM   6012   C CG   . GLU B 1 172 ? -25.658 28.876 -54.692 0.010 32.69  ? 172  GLU B CG   1  
ATOM   6013   C CD   . GLU B 1 172 ? -26.280 30.177 -54.201 0.010 33.78  ? 172  GLU B CD   1  
ATOM   6014   O OE1  . GLU B 1 172 ? -25.709 31.258 -54.467 0.010 34.10  ? 172  GLU B OE1  1  
ATOM   6015   O OE2  . GLU B 1 172 ? -27.337 30.114 -53.539 0.010 34.53  ? 172  GLU B OE2  1  
ATOM   6016   H H    . GLU B 1 172 ? -23.606 26.975 -53.343 0.010 28.64  ? 172  GLU B H    1  
ATOM   6017   H HA   . GLU B 1 172 ? -24.026 27.244 -55.894 0.010 31.09  ? 172  GLU B HA   1  
ATOM   6018   H HB2  . GLU B 1 172 ? -23.784 29.199 -53.889 0.010 29.98  ? 172  GLU B HB2  1  
ATOM   6019   H HB3  . GLU B 1 172 ? -23.908 29.578 -55.428 0.010 31.41  ? 172  GLU B HB3  1  
ATOM   6020   H HG2  . GLU B 1 172 ? -25.998 28.704 -55.584 0.010 33.75  ? 172  GLU B HG2  1  
ATOM   6021   H HG3  . GLU B 1 172 ? -25.927 28.166 -54.089 0.010 32.35  ? 172  GLU B HG3  1  
ATOM   6022   N N    . SER B 1 173 ? -22.025 28.270 -57.017 0.010 30.39  ? 173  SER B N    1  
ATOM   6023   C CA   . SER B 1 173 ? -20.755 28.373 -57.701 0.010 30.00  ? 173  SER B CA   1  
ATOM   6024   C C    . SER B 1 173 ? -20.671 29.535 -58.696 0.010 31.61  ? 173  SER B C    1  
ATOM   6025   O O    . SER B 1 173 ? -19.914 29.462 -59.655 0.010 32.10  ? 173  SER B O    1  
ATOM   6026   C CB   . SER B 1 173 ? -20.449 27.077 -58.446 0.010 30.07  ? 173  SER B CB   1  
ATOM   6027   O OG   . SER B 1 173 ? -21.256 26.995 -59.604 0.010 32.09  ? 173  SER B OG   1  
ATOM   6028   H H    . SER B 1 173 ? -22.707 28.510 -57.482 0.010 31.63  ? 173  SER B H    1  
ATOM   6029   H HA   . SER B 1 173 ? -20.079 28.493 -57.036 0.010 28.82  ? 173  SER B HA   1  
ATOM   6030   H HB2  . SER B 1 173 ? -19.519 27.085 -58.713 0.010 29.68  ? 173  SER B HB2  1  
ATOM   6031   H HB3  . SER B 1 173 ? -20.626 26.315 -57.871 0.010 29.32  ? 173  SER B HB3  1  
ATOM   6032   H HG   . SER B 1 173 ? -22.073 27.113 -59.399 0.010 32.60  ? 173  SER B HG   1  
ATOM   6033   N N    . ASN B 1 174 ? -21.429 30.600 -58.481 0.010 32.65  ? 174  ASN B N    1  
ATOM   6034   C CA   . ASN B 1 174 ? -21.225 31.793 -59.290 0.010 34.18  ? 174  ASN B CA   1  
ATOM   6035   C C    . ASN B 1 174 ? -19.897 32.434 -58.876 0.010 33.13  ? 174  ASN B C    1  
ATOM   6036   O O    . ASN B 1 174 ? -19.829 33.126 -57.876 0.010 32.65  ? 174  ASN B O    1  
ATOM   6037   C CB   . ASN B 1 174 ? -22.392 32.784 -59.148 0.010 35.87  ? 174  ASN B CB   1  
ATOM   6038   C CG   . ASN B 1 174 ? -22.403 33.840 -60.238 0.010 38.00  ? 174  ASN B CG   1  
ATOM   6039   O OD1  . ASN B 1 174 ? -23.333 34.642 -60.334 0.010 39.66  ? 174  ASN B OD1  1  
ATOM   6040   N ND2  . ASN B 1 174 ? -21.377 33.842 -61.075 0.010 38.20  ? 174  ASN B ND2  1  
ATOM   6041   H H    . ASN B 1 174 ? -22.056 30.660 -57.901 0.010 32.66  ? 174  ASN B H    1  
ATOM   6042   H HA   . ASN B 1 174 ? -21.162 31.522 -60.218 0.010 35.02  ? 174  ASN B HA   1  
ATOM   6043   H HB2  . ASN B 1 174 ? -23.226 32.292 -59.205 0.010 36.41  ? 174  ASN B HB2  1  
ATOM   6044   H HB3  . ASN B 1 174 ? -22.331 33.238 -58.294 0.010 35.28  ? 174  ASN B HB3  1  
ATOM   6045   H HD21 . ASN B 1 174 ? -21.075 33.105 -61.398 0.010 37.74  ? 174  ASN B HD21 1  
ATOM   6046   H HD22 . ASN B 1 174 ? -21.011 34.588 -61.300 0.010 38.94  ? 174  ASN B HD22 1  
ATOM   6047   N N    . ARG B 1 175 ? -18.851 32.165 -59.652 0.010 33.04  ? 175  ARG B N    1  
ATOM   6048   C CA   . ARG B 1 175 ? -17.480 32.652 -59.413 0.010 32.32  ? 175  ARG B CA   1  
ATOM   6049   C C    . ARG B 1 175 ? -16.953 32.604 -57.962 0.010 30.35  ? 175  ARG B C    1  
ATOM   6050   O O    . ARG B 1 175 ? -16.079 33.380 -57.564 0.010 30.16  ? 175  ARG B O    1  
ATOM   6051   C CB   . ARG B 1 175 ? -17.272 34.022 -60.058 0.010 34.14  ? 175  ARG B CB   1  
ATOM   6052   C CG   . ARG B 1 175 ? -17.149 33.936 -61.588 0.010 35.91  ? 175  ARG B CG   1  
ATOM   6053   C CD   . ARG B 1 175 ? -15.759 33.491 -62.044 0.010 35.36  ? 175  ARG B CD   1  
ATOM   6054   N NE   . ARG B 1 175 ? -14.773 34.532 -61.807 0.010 36.04  ? 175  ARG B NE   1  
ATOM   6055   C CZ   . ARG B 1 175 ? -14.591 35.583 -62.604 0.010 38.29  ? 175  ARG B CZ   1  
ATOM   6056   N NH1  . ARG B 1 175 ? -15.318 35.729 -63.706 0.010 40.07  ? 175  ARG B NH1  1  
ATOM   6057   N NH2  . ARG B 1 175 ? -13.679 36.487 -62.296 0.010 38.97  ? 175  ARG B NH2  1  
ATOM   6058   H H    . ARG B 1 175 ? -18.908 31.684 -60.363 0.010 33.55  ? 175  ARG B H    1  
ATOM   6059   H HA   . ARG B 1 175 ? -16.898 32.050 -59.903 0.010 32.18  ? 175  ARG B HA   1  
ATOM   6060   H HB2  . ARG B 1 175 ? -18.026 34.592 -59.840 0.010 34.89  ? 175  ARG B HB2  1  
ATOM   6061   H HB3  . ARG B 1 175 ? -16.453 34.418 -59.725 0.010 33.65  ? 175  ARG B HB3  1  
ATOM   6062   H HG2  . ARG B 1 175 ? -17.792 33.293 -61.923 0.010 36.24  ? 175  ARG B HG2  1  
ATOM   6063   H HG3  . ARG B 1 175 ? -17.324 34.810 -61.972 0.010 37.31  ? 175  ARG B HG3  1  
ATOM   6064   H HD2  . ARG B 1 175 ? -15.494 32.706 -61.542 0.010 33.78  ? 175  ARG B HD2  1  
ATOM   6065   H HD3  . ARG B 1 175 ? -15.775 33.294 -62.993 0.010 36.29  ? 175  ARG B HD3  1  
ATOM   6066   H HE   . ARG B 1 175 ? -14.339 34.509 -61.066 0.010 35.04  ? 175  ARG B HE   1  
ATOM   6067   H HH11 . ARG B 1 175 ? -15.917 35.149 -63.913 0.010 39.78  ? 175  ARG B HH11 1  
ATOM   6068   H HH12 . ARG B 1 175 ? -15.190 36.411 -64.215 0.010 41.62  ? 175  ARG B HH12 1  
ATOM   6069   H HH21 . ARG B 1 175 ? -13.206 36.391 -61.583 0.010 37.93  ? 175  ARG B HH21 1  
ATOM   6070   H HH22 . ARG B 1 175 ? -13.552 37.165 -62.809 0.010 40.54  ? 175  ARG B HH22 1  
ATOM   6071   N N    . ARG B 1 176 ? -17.509 31.681 -57.196 0.010 29.11  ? 176  ARG B N    1  
ATOM   6072   C CA   . ARG B 1 176 ? -16.869 31.123 -56.024 0.010 27.23  ? 176  ARG B CA   1  
ATOM   6073   C C    . ARG B 1 176 ? -16.965 29.632 -56.290 0.010 26.62  ? 176  ARG B C    1  
ATOM   6074   O O    . ARG B 1 176 ? -18.025 29.182 -56.694 0.010 27.45  ? 176  ARG B O    1  
ATOM   6075   C CB   . ARG B 1 176 ? -17.619 31.468 -54.736 0.010 26.74  ? 176  ARG B CB   1  
ATOM   6076   C CG   . ARG B 1 176 ? -19.117 31.935 -54.883 0.010 28.14  ? 176  ARG B CG   1  
ATOM   6077   C CD   . ARG B 1 176 ? -20.161 30.796 -54.707 0.010 28.05  ? 176  ARG B CD   1  
ATOM   6078   N NE   . ARG B 1 176 ? -21.338 30.959 -55.541 0.010 29.87  ? 176  ARG B NE   1  
ATOM   6079   C CZ   . ARG B 1 176 ? -22.445 31.623 -55.188 0.010 31.11  ? 176  ARG B CZ   1  
ATOM   6080   N NH1  . ARG B 1 176 ? -22.571 32.194 -53.987 0.010 30.78  ? 176  ARG B NH1  1  
ATOM   6081   N NH2  . ARG B 1 176 ? -23.446 31.709 -56.044 0.010 32.92  ? 176  ARG B NH2  1  
ATOM   6082   H H    . ARG B 1 176 ? -18.284 31.346 -57.341 0.010 29.46  ? 176  ARG B H    1  
ATOM   6083   H HA   . ARG B 1 176 ? -15.945 31.404 -55.962 0.010 26.95  ? 176  ARG B HA   1  
ATOM   6084   H HB2  . ARG B 1 176 ? -17.600 30.702 -54.168 0.010 25.69  ? 176  ARG B HB2  1  
ATOM   6085   H HB3  . ARG B 1 176 ? -17.109 32.167 -54.317 0.010 26.75  ? 176  ARG B HB3  1  
ATOM   6086   H HG2  . ARG B 1 176 ? -19.314 32.589 -54.203 0.010 28.16  ? 176  ARG B HG2  1  
ATOM   6087   H HG3  . ARG B 1 176 ? -19.249 32.333 -55.749 0.010 29.32  ? 176  ARG B HG3  1  
ATOM   6088   H HD2  . ARG B 1 176 ? -19.754 29.950 -54.945 0.010 27.37  ? 176  ARG B HD2  1  
ATOM   6089   H HD3  . ARG B 1 176 ? -20.453 30.779 -53.784 0.010 27.64  ? 176  ARG B HD3  1  
ATOM   6090   H HE   . ARG B 1 176 ? -21.374 30.478 -56.248 0.010 30.08  ? 176  ARG B HE   1  
ATOM   6091   H HH11 . ARG B 1 176 ? -21.930 32.152 -53.416 0.010 29.72  ? 176  ARG B HH11 1  
ATOM   6092   H HH12 . ARG B 1 176 ? -23.295 32.610 -53.784 0.010 31.74  ? 176  ARG B HH12 1  
ATOM   6093   H HH21 . ARG B 1 176 ? -23.386 31.344 -56.821 0.010 33.30  ? 176  ARG B HH21 1  
ATOM   6094   H HH22 . ARG B 1 176 ? -24.163 32.128 -55.822 0.010 33.83  ? 176  ARG B HH22 1  
ATOM   6095   N N    . ASP B 1 177 ? -15.896 28.869 -56.088 0.010 25.43  ? 177  ASP B N    1  
ATOM   6096   C CA   . ASP B 1 177 ? -15.984 27.427 -56.324 0.010 25.09  ? 177  ASP B CA   1  
ATOM   6097   C C    . ASP B 1 177 ? -14.744 26.680 -55.884 0.010 23.83  ? 177  ASP B C    1  
ATOM   6098   O O    . ASP B 1 177 ? -13.706 27.275 -55.586 0.010 23.41  ? 177  ASP B O    1  
ATOM   6099   C CB   . ASP B 1 177 ? -16.206 27.145 -57.821 0.010 26.66  ? 177  ASP B CB   1  
ATOM   6100   C CG   . ASP B 1 177 ? -17.058 25.894 -58.077 0.010 26.98  ? 177  ASP B CG   1  
ATOM   6101   O OD1  . ASP B 1 177 ? -17.234 25.064 -57.174 0.010 25.90  ? 177  ASP B OD1  1  
ATOM   6102   O OD2  . ASP B 1 177 ? -17.537 25.737 -59.212 0.010 28.54  ? 177  ASP B OD2  1  
ATOM   6103   H H    . ASP B 1 177 ? -15.129 29.146 -55.821 0.010 24.95  ? 177  ASP B H    1  
ATOM   6104   H HA   . ASP B 1 177 ? -16.734 27.072 -55.826 0.010 24.89  ? 177  ASP B HA   1  
ATOM   6105   H HB2  . ASP B 1 177 ? -16.651 27.891 -58.245 0.010 27.67  ? 177  ASP B HB2  1  
ATOM   6106   H HB3  . ASP B 1 177 ? -15.338 27.008 -58.227 0.010 26.66  ? 177  ASP B HB3  1  
ATOM   6107   N N    . SER B 1 178 ? -14.864 25.358 -55.871 0.010 23.50  ? 178  SER B N    1  
ATOM   6108   C CA   . SER B 1 178 ? -13.721 24.499 -55.723 0.010 22.77  ? 178  SER B CA   1  
ATOM   6109   C C    . SER B 1 178 ? -13.349 24.092 -57.129 0.010 24.10  ? 178  SER B C    1  
ATOM   6110   O O    . SER B 1 178 ? -14.207 24.057 -58.012 0.010 25.43  ? 178  SER B O    1  
ATOM   6111   C CB   . SER B 1 178 ? -14.061 23.271 -54.878 0.010 21.87  ? 178  SER B CB   1  
ATOM   6112   O OG   . SER B 1 178 ? -15.259 22.683 -55.320 0.010 22.72  ? 178  SER B OG   1  
ATOM   6113   H H    . SER B 1 178 ? -15.610 24.941 -55.948 0.010 23.81  ? 178  SER B H    1  
ATOM   6114   H HA   . SER B 1 178 ? -12.979 24.966 -55.314 0.010 22.24  ? 178  SER B HA   1  
ATOM   6115   H HB2  . SER B 1 178 ? -13.344 22.624 -54.965 0.010 21.60  ? 178  SER B HB2  1  
ATOM   6116   H HB3  . SER B 1 178 ? -14.164 23.533 -53.951 0.010 21.17  ? 178  SER B HB3  1  
ATOM   6117   H HG   . SER B 1 178 ? -15.610 22.243 -54.683 0.010 22.28  ? 178  SER B HG   1  
ATOM   6118   N N    . CYS B 1 179 ? -12.067 23.800 -57.333 0.010 23.98  ? 179  CYS B N    1  
ATOM   6119   C CA   . CYS B 1 179 ? -11.546 23.547 -58.642 0.010 25.50  ? 179  CYS B CA   1  
ATOM   6120   C C    . CYS B 1 179 ? -10.504 22.454 -58.662 0.010 25.45  ? 179  CYS B C    1  
ATOM   6121   O O    . CYS B 1 179 ? -10.117 21.912 -57.634 0.010 24.14  ? 179  CYS B O    1  
ATOM   6122   C CB   . CYS B 1 179 ? -10.921 24.822 -59.185 0.010 26.20  ? 179  CYS B CB   1  
ATOM   6123   S SG   . CYS B 1 179 ? -11.999 26.237 -58.973 0.010 26.24  ? 179  CYS B SG   1  
ATOM   6124   H H    . CYS B 1 179 ? -11.479 23.751 -56.709 0.010 23.16  ? 179  CYS B H    1  
ATOM   6125   H HA   . CYS B 1 179 ? -12.263 23.279 -59.232 0.010 26.39  ? 179  CYS B HA   1  
ATOM   6126   H HB2  . CYS B 1 179 ? -10.093 24.995 -58.709 0.010 25.55  ? 179  CYS B HB2  1  
ATOM   6127   H HB3  . CYS B 1 179 ? -10.744 24.716 -60.134 0.010 27.49  ? 179  CYS B HB3  1  
ATOM   6128   N N    . LYS B 1 180 ? -10.039 22.176 -59.873 0.010 27.14  ? 180  LYS B N    1  
ATOM   6129   C CA   . LYS B 1 180 ? -8.998  21.192 -60.122 0.010 27.67  ? 180  LYS B CA   1  
ATOM   6130   C C    . LYS B 1 180 ? -7.880  21.307 -59.088 0.010 26.35  ? 180  LYS B C    1  
ATOM   6131   O O    . LYS B 1 180 ? -7.291  22.375 -58.898 0.010 26.18  ? 180  LYS B O    1  
ATOM   6132   C CB   . LYS B 1 180 ? -8.450  21.399 -61.529 0.010 29.93  ? 180  LYS B CB   1  
ATOM   6133   C CG   . LYS B 1 180 ? -7.949  20.160 -62.210 0.010 31.40  ? 180  LYS B CG   1  
ATOM   6134   C CD   . LYS B 1 180 ? -8.431  20.120 -63.679 0.010 33.97  ? 180  LYS B CD   1  
ATOM   6135   C CE   . LYS B 1 180 ? -7.953  21.309 -64.490 0.010 35.30  ? 180  LYS B CE   1  
ATOM   6136   N NZ   . LYS B 1 180 ? -8.369  21.243 -65.941 0.010 38.10  ? 180  LYS B NZ   1  
ATOM   6137   H H    . LYS B 1 180 ? -10.325 22.561 -60.584 0.010 28.17  ? 180  LYS B H    1  
ATOM   6138   H HA   . LYS B 1 180 ? -9.379  20.303 -60.064 0.010 27.71  ? 180  LYS B HA   1  
ATOM   6139   H HB2  . LYS B 1 180 ? -9.160  21.762 -62.078 0.010 30.67  ? 180  LYS B HB2  1  
ATOM   6140   H HB3  . LYS B 1 180 ? -7.715  22.028 -61.488 0.010 29.95  ? 180  LYS B HB3  1  
ATOM   6141   H HG2  . LYS B 1 180 ? -6.979  20.162 -62.202 0.010 31.55  ? 180  LYS B HG2  1  
ATOM   6142   H HG3  . LYS B 1 180 ? -8.285  19.373 -61.752 0.010 30.79  ? 180  LYS B HG3  1  
ATOM   6143   H HD2  . LYS B 1 180 ? -8.069  19.328 -64.099 0.010 35.04  ? 180  LYS B HD2  1  
ATOM   6144   H HD3  . LYS B 1 180 ? -9.401  20.105 -63.703 0.010 33.97  ? 180  LYS B HD3  1  
ATOM   6145   H HE2  . LYS B 1 180 ? -8.308  22.126 -64.110 0.010 34.40  ? 180  LYS B HE2  1  
ATOM   6146   H HE3  . LYS B 1 180 ? -6.984  21.329 -64.461 0.010 35.46  ? 180  LYS B HE3  1  
ATOM   6147   H HZ1  . LYS B 1 180 ? -8.560  20.404 -66.171 0.010 38.57  ? 180  LYS B HZ1  1  
ATOM   6148   H HZ2  . LYS B 1 180 ? -9.086  21.752 -66.076 0.010 38.28  ? 180  LYS B HZ2  1  
ATOM   6149   H HZ3  . LYS B 1 180 ? -7.707  21.539 -66.459 0.010 39.30  ? 180  LYS B HZ3  1  
ATOM   6150   N N    . GLY B 1 181 ? -7.630  20.201 -58.391 0.010 25.57  ? 181  GLY B N    1  
ATOM   6151   C CA   . GLY B 1 181 ? -6.682  20.184 -57.293 0.010 24.38  ? 181  GLY B CA   1  
ATOM   6152   C C    . GLY B 1 181 ? -7.321  20.399 -55.933 0.010 22.56  ? 181  GLY B C    1  
ATOM   6153   O O    . GLY B 1 181 ? -6.673  20.176 -54.914 0.010 21.64  ? 181  GLY B O    1  
ATOM   6154   H H    . GLY B 1 181 ? -8.010  19.445 -58.535 0.010 25.83  ? 181  GLY B H    1  
ATOM   6155   H HA2  . GLY B 1 181 ? -6.246  19.319 -57.274 0.010 24.69  ? 181  GLY B HA2  1  
ATOM   6156   H HA3  . GLY B 1 181 ? -6.000  20.857 -57.428 0.010 24.63  ? 181  GLY B HA3  1  
ATOM   6157   N N    . ASP B 1 182 ? -8.592  20.789 -55.901 0.010 22.28  ? 182  ASP B N    1  
ATOM   6158   C CA   . ASP B 1 182 ? -9.314  20.856 -54.640 0.010 20.92  ? 182  ASP B CA   1  
ATOM   6159   C C    . ASP B 1 182 ? -9.989  19.520 -54.355 0.010 20.89  ? 182  ASP B C    1  
ATOM   6160   O O    . ASP B 1 182 ? -10.531 19.327 -53.268 0.010 19.98  ? 182  ASP B O    1  
ATOM   6161   C CB   . ASP B 1 182 ? -10.348 21.969 -54.645 0.010 20.88  ? 182  ASP B CB   1  
ATOM   6162   C CG   . ASP B 1 182 ? -9.702  23.338 -54.728 0.010 21.00  ? 182  ASP B CG   1  
ATOM   6163   O OD1  . ASP B 1 182 ? -8.646  23.493 -54.095 0.010 20.44  ? 182  ASP B OD1  1  
ATOM   6164   O OD2  . ASP B 1 182 ? -10.239 24.218 -55.423 0.010 21.83  ? 182  ASP B OD2  1  
ATOM   6165   H H    . ASP B 1 182 ? -9.055  21.008 -56.588 0.010 22.99  ? 182  ASP B H    1  
ATOM   6166   H HA   . ASP B 1 182 ? -8.695  21.035 -53.918 0.010 20.23  ? 182  ASP B HA   1  
ATOM   6167   H HB2  . ASP B 1 182 ? -10.952 21.857 -55.393 0.010 21.68  ? 182  ASP B HB2  1  
ATOM   6168   H HB3  . ASP B 1 182 ? -10.845 21.927 -53.815 0.010 20.16  ? 182  ASP B HB3  1  
ATOM   6169   N N    . SER B 1 183 ? -9.943  18.648 -55.361 0.010 22.16  ? 183  SER B N    1  
ATOM   6170   C CA   . SER B 1 183 ? -10.439 17.285 -55.269 0.010 22.59  ? 183  SER B CA   1  
ATOM   6171   C C    . SER B 1 183 ? -10.093 16.669 -53.938 0.010 21.52  ? 183  SER B C    1  
ATOM   6172   O O    . SER B 1 183 ? -8.941  16.654 -53.532 0.010 21.13  ? 183  SER B O    1  
ATOM   6173   C CB   . SER B 1 183 ? -9.826  16.428 -56.389 0.010 24.24  ? 183  SER B CB   1  
ATOM   6174   O OG   . SER B 1 183 ? -10.311 16.809 -57.663 0.010 25.57  ? 183  SER B OG   1  
ATOM   6175   H H    . SER B 1 183 ? -9.617  18.820 -56.134 0.010 22.95  ? 183  SER B H    1  
ATOM   6176   H HA   . SER B 1 183 ? -11.404 17.278 -55.367 0.010 22.77  ? 183  SER B HA   1  
ATOM   6177   H HB2  . SER B 1 183 ? -8.864  16.544 -56.380 0.010 24.16  ? 183  SER B HB2  1  
ATOM   6178   H HB3  . SER B 1 183 ? -10.045 15.499 -56.228 0.010 24.65  ? 183  SER B HB3  1  
ATOM   6179   H HG   . SER B 1 183 ? -11.156 16.729 -57.687 0.010 26.01  ? 183  SER B HG   1  
ATOM   6180   N N    . GLY B 1 184 ? -11.116 16.145 -53.272 0.010 21.28  ? 184  GLY B N    1  
ATOM   6181   C CA   . GLY B 1 184 ? -10.924 15.333 -52.092 0.010 20.63  ? 184  GLY B CA   1  
ATOM   6182   C C    . GLY B 1 184 ? -10.819 16.165 -50.833 0.010 19.28  ? 184  GLY B C    1  
ATOM   6183   O O    . GLY B 1 184 ? -10.645 15.639 -49.756 0.010 18.78  ? 184  GLY B O    1  
ATOM   6184   H H    . GLY B 1 184 ? -11.937 16.253 -53.493 0.010 21.61  ? 184  GLY B H    1  
ATOM   6185   H HA2  . GLY B 1 184 ? -11.663 14.715 -51.997 0.010 21.05  ? 184  GLY B HA2  1  
ATOM   6186   H HA3  . GLY B 1 184 ? -10.108 14.820 -52.179 0.010 20.83  ? 184  GLY B HA3  1  
ATOM   6187   N N    . GLY B 1 185 ? -10.929 17.472 -50.983 0.010 18.93  ? 185  GLY B N    1  
ATOM   6188   C CA   . GLY B 1 185 ? -10.903 18.350 -49.836 0.010 17.94  ? 185  GLY B CA   1  
ATOM   6189   C C    . GLY B 1 185 ? -12.213 18.425 -49.093 0.010 17.78  ? 185  GLY B C    1  
ATOM   6190   O O    . GLY B 1 185 ? -13.222 17.857 -49.519 0.010 18.46  ? 185  GLY B O    1  
ATOM   6191   H H    . GLY B 1 185 ? -11.018 17.874 -51.736 0.010 19.38  ? 185  GLY B H    1  
ATOM   6192   H HA2  . GLY B 1 185 ? -10.233 18.041 -49.210 0.010 17.57  ? 185  GLY B HA2  1  
ATOM   6193   H HA3  . GLY B 1 185 ? -10.678 19.242 -50.123 0.010 17.92  ? 185  GLY B HA3  1  
ATOM   6194   N N    . PRO B 1 186 ? -12.196 19.180 -47.992 0.010 17.13  ? 186  PRO B N    1  
ATOM   6195   C CA   . PRO B 1 186 ? -13.206 19.170 -46.946 0.010 17.13  ? 186  PRO B CA   1  
ATOM   6196   C C    . PRO B 1 186 ? -14.193 20.327 -47.118 0.010 17.44  ? 186  PRO B C    1  
ATOM   6197   O O    . PRO B 1 186 ? -13.783 21.493 -47.142 0.010 17.24  ? 186  PRO B O    1  
ATOM   6198   C CB   . PRO B 1 186 ? -12.358 19.394 -45.677 0.010 16.53  ? 186  PRO B CB   1  
ATOM   6199   C CG   . PRO B 1 186 ? -10.923 19.874 -46.208 0.010 16.18  ? 186  PRO B CG   1  
ATOM   6200   C CD   . PRO B 1 186 ? -11.121 20.131 -47.657 0.010 16.62  ? 186  PRO B CD   1  
ATOM   6201   H HA   . PRO B 1 186 ? -13.678 18.322 -46.910 0.010 17.49  ? 186  PRO B HA   1  
ATOM   6202   H HB2  . PRO B 1 186 ? -12.763 20.095 -45.146 0.010 16.56  ? 186  PRO B HB2  1  
ATOM   6203   H HB3  . PRO B 1 186 ? -12.291 18.576 -45.162 0.010 16.54  ? 186  PRO B HB3  1  
ATOM   6204   H HG2  . PRO B 1 186 ? -10.654 20.683 -45.745 0.010 16.08  ? 186  PRO B HG2  1  
ATOM   6205   H HG3  . PRO B 1 186 ? -10.264 19.174 -46.081 0.010 16.00  ? 186  PRO B HG3  1  
ATOM   6206   H HD2  . PRO B 1 186 ? -11.418 21.042 -47.804 0.010 16.74  ? 186  PRO B HD2  1  
ATOM   6207   H HD3  . PRO B 1 186 ? -10.290 19.957 -48.119 0.010 16.62  ? 186  PRO B HD3  1  
ATOM   6208   N N    . LEU B 1 187 ? -15.466 19.999 -47.252 0.010 18.12  ? 187  LEU B N    1  
ATOM   6209   C CA   . LEU B 1 187 ? -16.539 20.983 -47.152 0.010 18.67  ? 187  LEU B CA   1  
ATOM   6210   C C    . LEU B 1 187 ? -17.103 20.906 -45.733 0.010 18.81  ? 187  LEU B C    1  
ATOM   6211   O O    . LEU B 1 187 ? -17.661 19.884 -45.338 0.010 19.25  ? 187  LEU B O    1  
ATOM   6212   C CB   . LEU B 1 187 ? -17.636 20.718 -48.181 0.010 19.70  ? 187  LEU B CB   1  
ATOM   6213   C CG   . LEU B 1 187 ? -18.804 21.703 -48.163 0.010 20.56  ? 187  LEU B CG   1  
ATOM   6214   C CD1  . LEU B 1 187 ? -18.320 23.077 -48.538 0.010 20.37  ? 187  LEU B CD1  1  
ATOM   6215   C CD2  . LEU B 1 187 ? -19.940 21.306 -49.092 0.010 21.82  ? 187  LEU B CD2  1  
ATOM   6216   H H    . LEU B 1 187 ? -15.736 19.199 -47.408 0.010 18.42  ? 187  LEU B H    1  
ATOM   6217   H HA   . LEU B 1 187 ? -16.188 21.874 -47.296 0.010 18.48  ? 187  LEU B HA   1  
ATOM   6218   H HB2  . LEU B 1 187 ? -17.246 20.744 -49.067 0.010 19.73  ? 187  LEU B HB2  1  
ATOM   6219   H HB3  . LEU B 1 187 ? -18.003 19.834 -48.019 0.010 20.01  ? 187  LEU B HB3  1  
ATOM   6220   H HG   . LEU B 1 187 ? -19.163 21.749 -47.263 0.010 20.67  ? 187  LEU B HG   1  
ATOM   6221   H HD11 . LEU B 1 187 ? -17.575 22.987 -49.150 0.010 20.04  ? 187  LEU B HD11 1  
ATOM   6222   H HD12 . LEU B 1 187 ? -19.047 23.556 -48.962 0.010 21.14  ? 187  LEU B HD12 1  
ATOM   6223   H HD13 . LEU B 1 187 ? -18.035 23.544 -47.736 0.010 19.99  ? 187  LEU B HD13 1  
ATOM   6224   H HD21 . LEU B 1 187 ? -20.180 20.380 -48.925 0.010 22.00  ? 187  LEU B HD21 1  
ATOM   6225   H HD22 . LEU B 1 187 ? -20.699 21.881 -48.915 0.010 22.47  ? 187  LEU B HD22 1  
ATOM   6226   H HD23 . LEU B 1 187 ? -19.653 21.418 -50.011 0.010 21.95  ? 187  LEU B HD23 1  
ATOM   6227   N N    . VAL B 1 188 ? -16.935 21.994 -44.986 0.010 18.68  ? 188  VAL B N    1  
ATOM   6228   C CA   . VAL B 1 188 ? -17.213 22.017 -43.557 0.010 18.95  ? 188  VAL B CA   1  
ATOM   6229   C C    . VAL B 1 188 ? -18.373 22.971 -43.271 0.010 20.01  ? 188  VAL B C    1  
ATOM   6230   O O    . VAL B 1 188 ? -18.385 24.088 -43.760 0.010 20.17  ? 188  VAL B O    1  
ATOM   6231   C CB   . VAL B 1 188 ? -15.959 22.443 -42.742 0.010 18.23  ? 188  VAL B CB   1  
ATOM   6232   C CG1  . VAL B 1 188 ? -16.213 22.366 -41.235 0.010 18.76  ? 188  VAL B CG1  1  
ATOM   6233   C CG2  . VAL B 1 188 ? -14.803 21.558 -43.094 0.010 17.42  ? 188  VAL B CG2  1  
ATOM   6234   H H    . VAL B 1 188 ? -16.674 22.747 -45.300 0.010 18.58  ? 188  VAL B H    1  
ATOM   6235   H HA   . VAL B 1 188 ? -17.463 21.126 -43.259 0.010 19.13  ? 188  VAL B HA   1  
ATOM   6236   H HB   . VAL B 1 188 ? -15.730 23.358 -42.967 0.010 18.19  ? 188  VAL B HB   1  
ATOM   6237   H HG11 . VAL B 1 188 ? -16.555 21.483 -41.020 0.010 18.98  ? 188  VAL B HG11 1  
ATOM   6238   H HG12 . VAL B 1 188 ? -15.376 22.510 -40.774 0.010 18.39  ? 188  VAL B HG12 1  
ATOM   6239   H HG13 . VAL B 1 188 ? -16.847 23.053 -40.978 0.010 19.41  ? 188  VAL B HG13 1  
ATOM   6240   H HG21 . VAL B 1 188 ? -15.058 20.632 -42.985 0.010 17.58  ? 188  VAL B HG21 1  
ATOM   6241   H HG22 . VAL B 1 188 ? -14.552 21.720 -44.016 0.010 17.18  ? 188  VAL B HG22 1  
ATOM   6242   H HG23 . VAL B 1 188 ? -14.066 21.764 -42.502 0.010 17.17  ? 188  VAL B HG23 1  
ATOM   6243   N N    . CYS B 1 189 ? -19.342 22.515 -42.487 0.010 20.96  ? 189  CYS B N    1  
ATOM   6244   C CA   . CYS B 1 189 ? -20.450 23.364 -42.061 0.010 22.30  ? 189  CYS B CA   1  
ATOM   6245   C C    . CYS B 1 189 ? -20.639 23.254 -40.555 0.010 23.10  ? 189  CYS B C    1  
ATOM   6246   O O    . CYS B 1 189 ? -20.686 22.152 -40.001 0.010 23.20  ? 189  CYS B O    1  
ATOM   6247   C CB   . CYS B 1 189 ? -21.744 22.989 -42.789 0.010 23.35  ? 189  CYS B CB   1  
ATOM   6248   S SG   . CYS B 1 189 ? -21.544 22.453 -44.465 0.010 22.73  ? 189  CYS B SG   1  
ATOM   6249   H H    . CYS B 1 189 ? -19.384 21.712 -42.193 0.010 20.99  ? 189  CYS B H    1  
ATOM   6250   H HA   . CYS B 1 189 ? -20.257 24.291 -42.262 0.010 22.29  ? 189  CYS B HA   1  
ATOM   6251   H HB2  . CYS B 1 189 ? -22.170 22.269 -42.298 0.010 23.88  ? 189  CYS B HB2  1  
ATOM   6252   H HB3  . CYS B 1 189 ? -22.327 23.764 -42.806 0.010 24.14  ? 189  CYS B HB3  1  
ATOM   6253   N N    . GLY B 1 190 ? -20.725 24.407 -39.897 0.010 23.88  ? 190  GLY B N    1  
ATOM   6254   C CA   . GLY B 1 190 ? -20.876 24.450 -38.457 0.010 24.89  ? 190  GLY B CA   1  
ATOM   6255   C C    . GLY B 1 190 ? -19.775 23.711 -37.714 0.010 23.95  ? 190  GLY B C    1  
ATOM   6256   O O    . GLY B 1 190 ? -19.989 23.275 -36.593 0.010 24.83  ? 190  GLY B O    1  
ATOM   6257   H H    . GLY B 1 190 ? -20.703 25.180 -40.268 0.010 23.99  ? 190  GLY B H    1  
ATOM   6258   H HA2  . GLY B 1 190 ? -20.875 25.371 -38.159 0.010 25.51  ? 190  GLY B HA2  1  
ATOM   6259   H HA3  . GLY B 1 190 ? -21.724 24.048 -38.217 0.010 25.81  ? 190  GLY B HA3  1  
ATOM   6260   N N    . GLY B 1 191 ? -18.606 23.578 -38.343 0.010 22.37  ? 191  GLY B N    1  
ATOM   6261   C CA   . GLY B 1 191 ? -17.438 22.986 -37.704 0.010 21.56  ? 191  GLY B CA   1  
ATOM   6262   C C    . GLY B 1 191 ? -17.397 21.470 -37.834 0.010 21.29  ? 191  GLY B C    1  
ATOM   6263   O O    . GLY B 1 191 ? -16.525 20.793 -37.276 0.010 21.19  ? 191  GLY B O    1  
ATOM   6264   H H    . GLY B 1 191 ? -18.465 23.823 -39.155 0.010 21.86  ? 191  GLY B H    1  
ATOM   6265   H HA2  . GLY B 1 191 ? -16.637 23.349 -38.104 0.010 20.72  ? 191  GLY B HA2  1  
ATOM   6266   H HA3  . GLY B 1 191 ? -17.430 23.218 -36.764 0.010 22.20  ? 191  GLY B HA3  1  
ATOM   6267   N N    . VAL B 1 192 ? -18.345 20.922 -38.579 0.010 21.37  ? 192  VAL B N    1  
ATOM   6268   C CA   . VAL B 1 192 ? -18.359 19.495 -38.881 0.010 21.34  ? 192  VAL B CA   1  
ATOM   6269   C C    . VAL B 1 192 ? -18.155 19.210 -40.368 0.010 20.51  ? 192  VAL B C    1  
ATOM   6270   O O    . VAL B 1 192 ? -18.709 19.884 -41.221 0.010 20.63  ? 192  VAL B O    1  
ATOM   6271   C CB   . VAL B 1 192 ? -19.671 18.894 -38.435 0.010 22.90  ? 192  VAL B CB   1  
ATOM   6272   C CG1  . VAL B 1 192 ? -19.701 17.391 -38.653 0.010 23.13  ? 192  VAL B CG1  1  
ATOM   6273   C CG2  . VAL B 1 192 ? -19.897 19.226 -36.955 0.010 24.10  ? 192  VAL B CG2  1  
ATOM   6274   H H    . VAL B 1 192 ? -19.001 21.354 -38.926 0.010 21.56  ? 192  VAL B H    1  
ATOM   6275   H HA   . VAL B 1 192 ? -17.652 19.043 -38.398 0.010 21.05  ? 192  VAL B HA   1  
ATOM   6276   H HB   . VAL B 1 192 ? -20.386 19.291 -38.956 0.010 23.28  ? 192  VAL B HB   1  
ATOM   6277   H HG11 . VAL B 1 192 ? -19.498 17.180 -39.576 0.010 22.65  ? 192  VAL B HG11 1  
ATOM   6278   H HG12 . VAL B 1 192 ? -19.050 16.976 -38.068 0.010 22.78  ? 192  VAL B HG12 1  
ATOM   6279   H HG13 . VAL B 1 192 ? -20.593 17.070 -38.435 0.010 24.28  ? 192  VAL B HG13 1  
ATOM   6280   H HG21 . VAL B 1 192 ? -19.050 19.161 -36.489 0.010 23.71  ? 192  VAL B HG21 1  
ATOM   6281   H HG22 . VAL B 1 192 ? -20.239 20.132 -36.883 0.010 24.31  ? 192  VAL B HG22 1  
ATOM   6282   H HG23 . VAL B 1 192 ? -20.534 18.598 -36.578 0.010 25.18  ? 192  VAL B HG23 1  
ATOM   6283   N N    . LEU B 1 193 ? -17.350 18.206 -40.667 0.010 19.89  ? 193  LEU B N    1  
ATOM   6284   C CA   . LEU B 1 193 ? -17.213 17.738 -42.042 0.010 19.50  ? 193  LEU B CA   1  
ATOM   6285   C C    . LEU B 1 193 ? -18.557 17.225 -42.562 0.010 20.59  ? 193  LEU B C    1  
ATOM   6286   O O    . LEU B 1 193 ? -19.018 16.181 -42.130 0.010 21.39  ? 193  LEU B O    1  
ATOM   6287   C CB   . LEU B 1 193 ? -16.186 16.603 -42.148 0.010 19.11  ? 193  LEU B CB   1  
ATOM   6288   C CG   . LEU B 1 193 ? -15.798 16.206 -43.584 0.010 18.83  ? 193  LEU B CG   1  
ATOM   6289   C CD1  . LEU B 1 193 ? -14.967 17.337 -44.233 0.010 17.94  ? 193  LEU B CD1  1  
ATOM   6290   C CD2  . LEU B 1 193 ? -15.053 14.884 -43.644 0.010 18.97  ? 193  LEU B CD2  1  
ATOM   6291   H H    . LEU B 1 193 ? -16.864 17.789 -40.097 0.010 19.81  ? 193  LEU B H    1  
ATOM   6292   H HA   . LEU B 1 193 ? -16.928 18.473 -42.606 0.010 19.01  ? 193  LEU B HA   1  
ATOM   6293   H HB2  . LEU B 1 193 ? -15.378 16.873 -41.688 0.010 18.61  ? 193  LEU B HB2  1  
ATOM   6294   H HB3  . LEU B 1 193 ? -16.552 15.818 -41.727 0.010 19.75  ? 193  LEU B HB3  1  
ATOM   6295   H HG   . LEU B 1 193 ? -16.607 16.104 -44.107 0.010 19.37  ? 193  LEU B HG   1  
ATOM   6296   H HD11 . LEU B 1 193 ? -14.159 17.459 -43.715 0.010 17.50  ? 193  LEU B HD11 1  
ATOM   6297   H HD12 . LEU B 1 193 ? -14.738 17.094 -45.143 0.010 17.94  ? 193  LEU B HD12 1  
ATOM   6298   H HD13 . LEU B 1 193 ? -15.484 18.156 -44.232 0.010 18.02  ? 193  LEU B HD13 1  
ATOM   6299   H HD21 . LEU B 1 193 ? -15.626 14.182 -43.303 0.010 19.68  ? 193  LEU B HD21 1  
ATOM   6300   H HD22 . LEU B 1 193 ? -14.815 14.690 -44.562 0.010 18.98  ? 193  LEU B HD22 1  
ATOM   6301   H HD23 . LEU B 1 193 ? -14.254 14.951 -43.102 0.010 18.53  ? 193  LEU B HD23 1  
ATOM   6302   N N    . GLU B 1 194 ? -19.165 17.961 -43.486 0.010 20.81  ? 194  GLU B N    1  
ATOM   6303   C CA   . GLU B 1 194 ? -20.385 17.531 -44.149 0.010 21.99  ? 194  GLU B CA   1  
ATOM   6304   C C    . GLU B 1 194 ? -20.099 16.954 -45.517 0.010 21.92  ? 194  GLU B C    1  
ATOM   6305   O O    . GLU B 1 194 ? -20.778 16.038 -45.941 0.010 22.98  ? 194  GLU B O    1  
ATOM   6306   C CB   . GLU B 1 194 ? -21.381 18.695 -44.286 0.010 22.61  ? 194  GLU B CB   1  
ATOM   6307   C CG   . GLU B 1 194 ? -21.965 19.233 -42.982 0.010 23.41  ? 194  GLU B CG   1  
ATOM   6308   C CD   . GLU B 1 194 ? -22.963 18.292 -42.300 0.010 24.78  ? 194  GLU B CD   1  
ATOM   6309   O OE1  . GLU B 1 194 ? -23.306 17.231 -42.887 0.010 25.29  ? 194  GLU B OE1  1  
ATOM   6310   O OE2  . GLU B 1 194 ? -23.367 18.620 -41.155 0.010 25.53  ? 194  GLU B OE2  1  
ATOM   6311   H H    . GLU B 1 194 ? -18.884 18.731 -43.748 0.010 20.40  ? 194  GLU B H    1  
ATOM   6312   H HA   . GLU B 1 194 ? -20.819 16.841 -43.629 0.010 22.70  ? 194  GLU B HA   1  
ATOM   6313   H HB2  . GLU B 1 194 ? -20.933 19.431 -44.731 0.010 21.94  ? 194  GLU B HB2  1  
ATOM   6314   H HB3  . GLU B 1 194 ? -22.125 18.398 -44.833 0.010 23.38  ? 194  GLU B HB3  1  
ATOM   6315   H HG2  . GLU B 1 194 ? -21.237 19.400 -42.361 0.010 22.77  ? 194  GLU B HG2  1  
ATOM   6316   H HG3  . GLU B 1 194 ? -22.435 20.061 -43.175 0.010 23.92  ? 194  GLU B HG3  1  
ATOM   6317   N N    . GLY B 1 195 ? -19.109 17.498 -46.233 0.010 20.93  ? 195  GLY B N    1  
ATOM   6318   C CA   . GLY B 1 195 ? -18.868 17.086 -47.612 0.010 21.17  ? 195  GLY B CA   1  
ATOM   6319   C C    . GLY B 1 195 ? -17.419 16.947 -48.076 0.010 20.26  ? 195  GLY B C    1  
ATOM   6320   O O    . GLY B 1 195 ? -16.496 17.462 -47.447 0.010 19.28  ? 195  GLY B O    1  
ATOM   6321   H H    . GLY B 1 195 ? -18.570 18.099 -45.939 0.010 20.25  ? 195  GLY B H    1  
ATOM   6322   H HA2  . GLY B 1 195 ? -19.269 16.220 -47.720 0.010 21.86  ? 195  GLY B HA2  1  
ATOM   6323   H HA3  . GLY B 1 195 ? -19.324 17.693 -48.213 0.010 21.54  ? 195  GLY B HA3  1  
ATOM   6324   N N    . VAL B 1 196 ? -17.220 16.213 -49.165 0.010 20.86  ? 196  VAL B N    1  
ATOM   6325   C CA   . VAL B 1 196 ? -15.897 16.061 -49.779 0.010 20.46  ? 196  VAL B CA   1  
ATOM   6326   C C    . VAL B 1 196 ? -15.924 16.507 -51.243 0.010 21.17  ? 196  VAL B C    1  
ATOM   6327   O O    . VAL B 1 196 ? -16.785 16.064 -52.018 0.010 22.38  ? 196  VAL B O    1  
ATOM   6328   C CB   . VAL B 1 196 ? -15.383 14.626 -49.725 0.010 20.90  ? 196  VAL B CB   1  
ATOM   6329   C CG1  . VAL B 1 196 ? -14.081 14.472 -50.515 0.010 20.86  ? 196  VAL B CG1  1  
ATOM   6330   C CG2  . VAL B 1 196 ? -15.166 14.177 -48.273 0.010 20.36  ? 196  VAL B CG2  1  
ATOM   6331   H H    . VAL B 1 196 ? -17.842 15.790 -49.579 0.010 21.68  ? 196  VAL B H    1  
ATOM   6332   H HA   . VAL B 1 196 ? -15.263 16.617 -49.310 0.010 19.65  ? 196  VAL B HA   1  
ATOM   6333   H HB   . VAL B 1 196 ? -16.042 14.042 -50.128 0.010 21.83  ? 196  VAL B HB   1  
ATOM   6334   H HG11 . VAL B 1 196 ? -13.456 15.158 -50.234 0.010 20.07  ? 196  VAL B HG11 1  
ATOM   6335   H HG12 . VAL B 1 196 ? -13.706 13.599 -50.332 0.010 21.14  ? 196  VAL B HG12 1  
ATOM   6336   H HG13 . VAL B 1 196 ? -14.259 14.555 -51.463 0.010 21.53  ? 196  VAL B HG13 1  
ATOM   6337   H HG21 . VAL B 1 196 ? -16.012 14.211 -47.801 0.010 20.63  ? 196  VAL B HG21 1  
ATOM   6338   H HG22 . VAL B 1 196 ? -14.827 13.269 -48.275 0.010 20.77  ? 196  VAL B HG22 1  
ATOM   6339   H HG23 . VAL B 1 196 ? -14.529 14.768 -47.844 0.010 19.54  ? 196  VAL B HG23 1  
ATOM   6340   N N    . VAL B 1 197 ? -14.986 17.367 -51.623 0.010 20.66  ? 197  VAL B N    1  
ATOM   6341   C CA   . VAL B 1 197 ? -14.924 17.826 -52.998 0.010 21.50  ? 197  VAL B CA   1  
ATOM   6342   C C    . VAL B 1 197 ? -14.778 16.612 -53.892 0.010 22.72  ? 197  VAL B C    1  
ATOM   6343   O O    . VAL B 1 197 ? -13.908 15.759 -53.708 0.010 22.67  ? 197  VAL B O    1  
ATOM   6344   C CB   . VAL B 1 197 ? -13.781 18.844 -53.236 0.010 20.93  ? 197  VAL B CB   1  
ATOM   6345   C CG1  . VAL B 1 197 ? -13.782 19.342 -54.674 0.010 22.10  ? 197  VAL B CG1  1  
ATOM   6346   C CG2  . VAL B 1 197 ? -13.902 20.031 -52.269 0.010 19.92  ? 197  VAL B CG2  1  
ATOM   6347   H H    . VAL B 1 197 ? -14.381 17.692 -51.111 0.010 19.95  ? 197  VAL B H    1  
ATOM   6348   H HA   . VAL B 1 197 ? -15.761 18.257 -53.222 0.010 21.89  ? 197  VAL B HA   1  
ATOM   6349   H HB   . VAL B 1 197 ? -12.934 18.399 -53.069 0.010 20.67  ? 197  VAL B HB   1  
ATOM   6350   H HG11 . VAL B 1 197 ? -14.670 19.654 -54.908 0.010 22.59  ? 197  VAL B HG11 1  
ATOM   6351   H HG12 . VAL B 1 197 ? -13.147 20.070 -54.752 0.010 21.81  ? 197  VAL B HG12 1  
ATOM   6352   H HG13 . VAL B 1 197 ? -13.520 18.617 -55.262 0.010 22.80  ? 197  VAL B HG13 1  
ATOM   6353   H HG21 . VAL B 1 197 ? -14.473 19.797 -51.523 0.010 19.59  ? 197  VAL B HG21 1  
ATOM   6354   H HG22 . VAL B 1 197 ? -13.018 20.253 -51.943 0.010 19.41  ? 197  VAL B HG22 1  
ATOM   6355   H HG23 . VAL B 1 197 ? -14.275 20.789 -52.742 0.010 20.30  ? 197  VAL B HG23 1  
ATOM   6356   N N    . THR B 1 198 ? -15.720 16.507 -54.814 0.010 24.08  ? 198  THR B N    1  
ATOM   6357   C CA   . THR B 1 198 ? -15.668 15.508 -55.850 0.010 25.59  ? 198  THR B CA   1  
ATOM   6358   C C    . THR B 1 198 ? -15.967 16.090 -57.178 0.010 26.95  ? 198  THR B C    1  
ATOM   6359   O O    . THR B 1 198 ? -17.102 16.499 -57.411 0.010 27.52  ? 198  THR B O    1  
ATOM   6360   C CB   . THR B 1 198 ? -16.809 14.526 -55.787 0.010 26.58  ? 198  THR B CB   1  
ATOM   6361   O OG1  . THR B 1 198 ? -17.256 14.352 -57.130 0.010 28.53  ? 198  THR B OG1  1  
ATOM   6362   C CG2  . THR B 1 198 ? -17.972 15.049 -54.968 0.010 26.03  ? 198  THR B CG2  1  
ATOM   6363   H H    . THR B 1 198 ? -16.412 17.015 -54.854 0.010 24.28  ? 198  THR B H    1  
ATOM   6364   H HA   . THR B 1 198 ? -14.816 15.049 -55.875 0.010 25.46  ? 198  THR B HA   1  
ATOM   6365   H HB   . THR B 1 198 ? -16.513 13.674 -55.437 0.010 26.56  ? 198  THR B HB   1  
ATOM   6366   H HG1  . THR B 1 198 ? -16.693 13.884 -57.568 0.010 29.23  ? 198  THR B HG1  1  
ATOM   6367   H HG21 . THR B 1 198 ? -17.680 15.408 -54.119 0.010 24.91  ? 198  THR B HG21 1  
ATOM   6368   H HG22 . THR B 1 198 ? -18.426 15.739 -55.465 0.010 26.10  ? 198  THR B HG22 1  
ATOM   6369   H HG23 . THR B 1 198 ? -18.601 14.333 -54.801 0.010 26.93  ? 198  THR B HG23 1  
ATOM   6370   N N    . SER B 1 199 ? -14.983 16.021 -58.061 0.010 27.71  ? 199  SER B N    1  
ATOM   6371   C CA   . SER B 1 199 ? -15.178 16.203 -59.491 0.010 29.59  ? 199  SER B CA   1  
ATOM   6372   C C    . SER B 1 199 ? -15.089 17.661 -59.898 0.010 29.45  ? 199  SER B C    1  
ATOM   6373   O O    . SER B 1 199 ? -14.860 17.949 -61.061 0.010 30.97  ? 199  SER B O    1  
ATOM   6374   C CB   . SER B 1 199 ? -16.485 15.546 -59.999 0.010 31.25  ? 199  SER B CB   1  
ATOM   6375   O OG   . SER B 1 199 ? -17.612 16.413 -59.906 0.010 31.90  ? 199  SER B OG   1  
ATOM   6376   H H    . SER B 1 199 ? -14.166 15.870 -57.844 0.010 27.28  ? 199  SER B H    1  
ATOM   6377   H HA   . SER B 1 199 ? -14.443 15.755 -59.938 0.010 30.22  ? 199  SER B HA   1  
ATOM   6378   H HB2  . SER B 1 199 ? -16.355 15.302 -60.930 0.010 32.60  ? 199  SER B HB2  1  
ATOM   6379   H HB3  . SER B 1 199 ? -16.659 14.746 -59.483 0.010 30.76  ? 199  SER B HB3  1  
ATOM   6380   H HG   . SER B 1 199 ? -18.320 15.999 -60.130 0.010 32.90  ? 199  SER B HG   1  
ATOM   6381   N N    . GLY B 1 200 ? -15.279 18.583 -58.957 0.010 27.92  ? 200  GLY B N    1  
ATOM   6382   C CA   . GLY B 1 200 ? -14.780 19.927 -59.184 0.010 27.85  ? 200  GLY B CA   1  
ATOM   6383   C C    . GLY B 1 200 ? -13.325 19.700 -59.561 0.010 27.80  ? 200  GLY B C    1  
ATOM   6384   O O    . GLY B 1 200 ? -12.667 18.963 -58.855 0.010 27.03  ? 200  GLY B O    1  
ATOM   6385   H H    . GLY B 1 200 ? -15.687 18.467 -58.207 0.010 27.08  ? 200  GLY B H    1  
ATOM   6386   H HA2  . GLY B 1 200 ? -15.277 20.349 -59.899 0.010 29.07  ? 200  GLY B HA2  1  
ATOM   6387   H HA3  . GLY B 1 200 ? -14.834 20.460 -58.375 0.010 26.80  ? 200  GLY B HA3  1  
ATOM   6388   N N    . SER B 1 201 ? -12.815 20.209 -60.686 0.010 28.93  ? 201  SER B N    1  
ATOM   6389   C CA   . SER B 1 201 ? -13.558 20.872 -61.741 0.010 30.70  ? 201  SER B CA   1  
ATOM   6390   C C    . SER B 1 201 ? -12.568 20.869 -62.923 0.010 32.38  ? 201  SER B C    1  
ATOM   6391   O O    . SER B 1 201 ? -12.270 19.796 -63.443 0.010 33.54  ? 201  SER B O    1  
ATOM   6392   C CB   . SER B 1 201 ? -14.053 22.280 -61.322 0.010 30.39  ? 201  SER B CB   1  
ATOM   6393   O OG   . SER B 1 201 ? -14.880 22.898 -62.313 0.010 32.42  ? 201  SER B OG   1  
ATOM   6394   H H    . SER B 1 201 ? -11.975 20.171 -60.868 0.010 28.79  ? 201  SER B H    1  
ATOM   6395   H HA   . SER B 1 201 ? -14.326 20.331 -61.980 0.010 31.30  ? 201  SER B HA   1  
ATOM   6396   H HB2  . SER B 1 201 ? -14.567 22.214 -60.503 0.010 29.38  ? 201  SER B HB2  1  
ATOM   6397   H HB3  . SER B 1 201 ? -13.287 22.848 -61.162 0.010 30.00  ? 201  SER B HB3  1  
ATOM   6398   H HG   . SER B 1 201 ? -15.419 22.330 -62.643 0.010 32.72  ? 201  SER B HG   1  
ATOM   6399   N N    . ALA B 1 202 ? -11.979 22.028 -63.233 0.010 32.52  ? 202  ALA B N    1  
ATOM   6400   C CA   . ALA B 1 202 ? -11.329 22.341 -64.526 0.010 34.60  ? 202  ALA B CA   1  
ATOM   6401   C C    . ALA B 1 202 ? -11.956 23.628 -65.017 0.010 35.61  ? 202  ALA B C    1  
ATOM   6402   O O    . ALA B 1 202 ? -11.262 24.558 -65.439 0.010 36.58  ? 202  ALA B O    1  
ATOM   6403   C CB   . ALA B 1 202 ? -11.501 21.210 -65.607 0.010 36.72  ? 202  ALA B CB   1  
ATOM   6404   H H    . ALA B 1 202 ? -11.921 22.684 -62.676 0.010 31.47  ? 202  ALA B H    1  
ATOM   6405   H HA   . ALA B 1 202 ? -10.384 22.501 -64.394 0.010 34.18  ? 202  ALA B HA   1  
ATOM   6406   H HB1  . ALA B 1 202 ? -12.443 20.998 -65.707 0.010 37.23  ? 202  ALA B HB1  1  
ATOM   6407   H HB2  . ALA B 1 202 ? -11.153 21.537 -66.452 0.010 38.26  ? 202  ALA B HB2  1  
ATOM   6408   H HB3  . ALA B 1 202 ? -11.004 20.418 -65.344 0.010 36.21  ? 202  ALA B HB3  1  
ATOM   6409   N N    . VAL B 1 203 ? -13.285 23.678 -64.961 0.010 35.55  ? 203  VAL B N    1  
ATOM   6410   C CA   . VAL B 1 203 ? -14.007 24.866 -65.392 0.010 36.73  ? 203  VAL B CA   1  
ATOM   6411   C C    . VAL B 1 203 ? -14.995 25.368 -64.322 0.010 35.27  ? 203  VAL B C    1  
ATOM   6412   O O    . VAL B 1 203 ? -15.990 26.003 -64.656 0.010 36.43  ? 203  VAL B O    1  
ATOM   6413   C CB   . VAL B 1 203 ? -14.759 24.614 -66.731 0.010 39.32  ? 203  VAL B CB   1  
ATOM   6414   C CG1  . VAL B 1 203 ? -15.981 23.729 -66.510 0.010 38.98  ? 203  VAL B CG1  1  
ATOM   6415   C CG2  . VAL B 1 203 ? -15.149 25.942 -67.402 0.010 41.15  ? 203  VAL B CG2  1  
ATOM   6416   H H    . VAL B 1 203 ? -13.791 23.038 -64.683 0.010 34.97  ? 203  VAL B H    1  
ATOM   6417   H HA   . VAL B 1 203 ? -13.372 25.581 -65.550 0.010 37.17  ? 203  VAL B HA   1  
ATOM   6418   H HB   . VAL B 1 203 ? -14.165 24.144 -67.337 0.010 40.28  ? 203  VAL B HB   1  
ATOM   6419   H HG11 . VAL B 1 203 ? -15.783 23.092 -65.805 0.010 37.53  ? 203  VAL B HG11 1  
ATOM   6420   H HG12 . VAL B 1 203 ? -16.737 24.278 -66.252 0.010 38.75  ? 203  VAL B HG12 1  
ATOM   6421   H HG13 . VAL B 1 203 ? -16.180 23.258 -67.334 0.010 40.64  ? 203  VAL B HG13 1  
ATOM   6422   H HG21 . VAL B 1 203 ? -14.607 26.657 -67.033 0.010 40.60  ? 203  VAL B HG21 1  
ATOM   6423   H HG22 . VAL B 1 203 ? -14.990 25.867 -68.356 0.010 43.05  ? 203  VAL B HG22 1  
ATOM   6424   H HG23 . VAL B 1 203 ? -16.086 26.125 -67.237 0.010 41.12  ? 203  VAL B HG23 1  
ATOM   6425   N N    . CYS B 1 204 ? -14.735 25.122 -63.041 0.010 32.97  ? 204  CYS B N    1  
ATOM   6426   C CA   . CYS B 1 204 ? -15.495 25.845 -62.034 0.010 31.74  ? 204  CYS B CA   1  
ATOM   6427   C C    . CYS B 1 204 ? -15.060 27.279 -62.228 0.010 32.62  ? 204  CYS B C    1  
ATOM   6428   O O    . CYS B 1 204 ? -13.986 27.485 -62.772 0.010 33.58  ? 204  CYS B O    1  
ATOM   6429   C CB   . CYS B 1 204 ? -15.147 25.404 -60.620 0.010 29.40  ? 204  CYS B CB   1  
ATOM   6430   S SG   . CYS B 1 204 ? -13.450 25.528 -60.203 0.010 28.59  ? 204  CYS B SG   1  
ATOM   6431   H H    . CYS B 1 204 ? -14.147 24.573 -62.739 0.010 32.22  ? 204  CYS B H    1  
ATOM   6432   H HA   . CYS B 1 204 ? -16.446 25.752 -62.186 0.010 32.20  ? 204  CYS B HA   1  
ATOM   6433   H HB2  . CYS B 1 204 ? -15.555 26.047 -60.049 0.010 28.82  ? 204  CYS B HB2  1  
ATOM   6434   H HB3  . CYS B 1 204 ? -15.474 24.511 -60.437 0.010 29.05  ? 204  CYS B HB3  1  
ATOM   6435   N N    . GLY B 1 205 ? -15.817 28.289 -61.810 0.010 32.68  ? 205  GLY B N    1  
ATOM   6436   C CA   . GLY B 1 205 ? -17.093 28.204 -61.145 0.010 32.01  ? 205  GLY B CA   1  
ATOM   6437   C C    . GLY B 1 205 ? -18.166 28.673 -62.105 0.010 34.14  ? 205  GLY B C    1  
ATOM   6438   O O    . GLY B 1 205 ? -18.220 29.835 -62.565 0.010 35.48  ? 205  GLY B O    1  
ATOM   6439   H H    . GLY B 1 205 ? -15.580 29.109 -61.924 0.010 33.28  ? 205  GLY B H    1  
ATOM   6440   H HA2  . GLY B 1 205 ? -17.284 27.299 -60.881 0.010 31.21  ? 205  GLY B HA2  1  
ATOM   6441   H HA3  . GLY B 1 205 ? -17.098 28.777 -60.364 0.010 31.29  ? 205  GLY B HA3  1  
ATOM   6442   N N    . ASN B 1 206 ? -19.028 27.729 -62.430 0.010 34.68  ? 206  ASN B N    1  
ATOM   6443   C CA   . ASN B 1 206 ? -20.076 27.937 -63.391 0.010 36.91  ? 206  ASN B CA   1  
ATOM   6444   C C    . ASN B 1 206 ? -21.338 28.134 -62.586 0.010 36.68  ? 206  ASN B C    1  
ATOM   6445   O O    . ASN B 1 206 ? -21.751 27.235 -61.871 0.010 35.69  ? 206  ASN B O    1  
ATOM   6446   C CB   . ASN B 1 206 ? -20.179 26.693 -64.265 0.010 38.16  ? 206  ASN B CB   1  
ATOM   6447   C CG   . ASN B 1 206 ? -20.981 26.921 -65.519 0.010 40.93  ? 206  ASN B CG   1  
ATOM   6448   O OD1  . ASN B 1 206 ? -20.786 26.232 -66.530 0.010 42.67  ? 206  ASN B OD1  1  
ATOM   6449   N ND2  . ASN B 1 206 ? -21.898 27.876 -65.463 0.010 41.59  ? 206  ASN B ND2  1  
ATOM   6450   H H    . ASN B 1 206 ? -19.027 26.945 -62.093 0.010 33.90  ? 206  ASN B H    1  
ATOM   6451   H HA   . ASN B 1 206 ? -19.908 28.718 -63.942 0.010 37.99  ? 206  ASN B HA   1  
ATOM   6452   H HB2  . ASN B 1 206 ? -19.290 26.402 -64.519 0.010 38.09  ? 206  ASN B HB2  1  
ATOM   6453   H HB3  . ASN B 1 206 ? -20.613 26.014 -63.744 0.010 37.44  ? 206  ASN B HB3  1  
ATOM   6454   H HD21 . ASN B 1 206 ? -22.708 27.670 -65.281 0.010 41.22  ? 206  ASN B HD21 1  
ATOM   6455   H HD22 . ASN B 1 206 ? -21.682 28.697 -65.600 0.010 42.48  ? 206  ASN B HD22 1  
ATOM   6456   N N    . ARG B 1 207 ? -21.908 29.335 -62.662 0.010 37.77  ? 207  ARG B N    1  
ATOM   6457   C CA   . ARG B 1 207 ? -23.193 29.603 -62.027 0.010 38.17  ? 207  ARG B CA   1  
ATOM   6458   C C    . ARG B 1 207 ? -24.154 28.443 -62.319 0.010 39.07  ? 207  ARG B C    1  
ATOM   6459   O O    . ARG B 1 207 ? -24.741 27.868 -61.415 0.010 38.17  ? 207  ARG B O    1  
ATOM   6460   C CB   . ARG B 1 207 ? -23.785 30.937 -62.518 0.010 40.15  ? 207  ARG B CB   1  
ATOM   6461   C CG   . ARG B 1 207 ? -23.642 31.208 -64.018 0.010 42.44  ? 207  ARG B CG   1  
ATOM   6462   C CD   . ARG B 1 207 ? -24.111 32.645 -64.426 0.010 44.34  ? 207  ARG B CD   1  
ATOM   6463   N NE   . ARG B 1 207 ? -24.045 32.871 -65.871 0.010 46.89  ? 207  ARG B NE   1  
ATOM   6464   C CZ   . ARG B 1 207 ? -25.089 32.864 -66.710 0.010 49.21  ? 207  ARG B CZ   1  
ATOM   6465   N NH1  . ARG B 1 207 ? -26.328 32.635 -66.287 0.010 49.32  ? 207  ARG B NH1  1  
ATOM   6466   N NH2  . ARG B 1 207 ? -24.894 33.079 -68.002 0.010 51.66  ? 207  ARG B NH2  1  
ATOM   6467   H H    . ARG B 1 207 ? -21.565 30.007 -63.070 0.010 38.43  ? 207  ARG B H    1  
ATOM   6468   H HA   . ARG B 1 207 ? -23.069 29.661 -61.066 0.010 36.75  ? 207  ARG B HA   1  
ATOM   6469   H HB2  . ARG B 1 207 ? -24.732 30.946 -62.310 0.010 40.85  ? 207  ARG B HB2  1  
ATOM   6470   H HB3  . ARG B 1 207 ? -23.343 31.661 -62.049 0.010 39.48  ? 207  ARG B HB3  1  
ATOM   6471   H HG2  . ARG B 1 207 ? -22.711 31.116 -64.269 0.010 41.93  ? 207  ARG B HG2  1  
ATOM   6472   H HG3  . ARG B 1 207 ? -24.182 30.569 -64.509 0.010 43.49  ? 207  ARG B HG3  1  
ATOM   6473   H HD2  . ARG B 1 207 ? -25.021 32.789 -64.126 0.010 44.87  ? 207  ARG B HD2  1  
ATOM   6474   H HD3  . ARG B 1 207 ? -23.524 33.295 -64.008 0.010 43.52  ? 207  ARG B HD3  1  
ATOM   6475   H HE   . ARG B 1 207 ? -23.261 32.881 -66.224 0.010 46.90  ? 207  ARG B HE   1  
ATOM   6476   H HH11 . ARG B 1 207 ? -26.487 32.490 -65.454 0.010 47.89  ? 207  ARG B HH11 1  
ATOM   6477   H HH12 . ARG B 1 207 ? -26.977 32.635 -66.849 0.010 50.94  ? 207  ARG B HH12 1  
ATOM   6478   H HH21 . ARG B 1 207 ? -24.103 33.231 -68.300 0.010 51.77  ? 207  ARG B HH21 1  
ATOM   6479   H HH22 . ARG B 1 207 ? -25.564 33.075 -68.542 0.010 53.26  ? 207  ARG B HH22 1  
ATOM   6480   N N    . LYS B 1 208 ? -24.285 28.119 -63.599 0.010 41.08  ? 208  LYS B N    1  
ATOM   6481   C CA   . LYS B 1 208 ? -25.193 27.075 -64.071 0.010 42.44  ? 208  LYS B CA   1  
ATOM   6482   C C    . LYS B 1 208 ? -24.790 25.642 -63.676 0.010 41.01  ? 208  LYS B C    1  
ATOM   6483   O O    . LYS B 1 208 ? -25.590 24.724 -63.807 0.010 42.01  ? 208  LYS B O    1  
ATOM   6484   C CB   . LYS B 1 208 ? -25.350 27.193 -65.601 0.010 45.17  ? 208  LYS B CB   1  
ATOM   6485   C CG   . LYS B 1 208 ? -26.257 28.342 -66.043 0.010 47.41  ? 208  LYS B CG   1  
ATOM   6486   C CD   . LYS B 1 208 ? -25.574 29.360 -66.984 0.010 48.71  ? 208  LYS B CD   1  
ATOM   6487   C CE   . LYS B 1 208 ? -25.291 28.815 -68.383 0.010 50.62  ? 208  LYS B CE   1  
ATOM   6488   N NZ   . LYS B 1 208 ? -25.399 29.902 -69.445 0.010 53.23  ? 208  LYS B NZ   1  
ATOM   6489   H H    . LYS B 1 208 ? -23.863 28.515 -64.232 0.010 41.87  ? 208  LYS B H    1  
ATOM   6490   H HA   . LYS B 1 208 ? -26.066 27.238 -63.680 0.010 42.92  ? 208  LYS B HA   1  
ATOM   6491   H HB2  . LYS B 1 208 ? -24.482 27.339 -66.003 0.010 44.94  ? 208  LYS B HB2  1  
ATOM   6492   H HB3  . LYS B 1 208 ? -25.732 26.367 -65.940 0.010 45.98  ? 208  LYS B HB3  1  
ATOM   6493   H HG2  . LYS B 1 208 ? -27.019 27.973 -66.515 0.010 49.04  ? 208  LYS B HG2  1  
ATOM   6494   H HG3  . LYS B 1 208 ? -26.560 28.820 -65.256 0.010 46.66  ? 208  LYS B HG3  1  
ATOM   6495   H HD2  . LYS B 1 208 ? -26.152 30.132 -67.079 0.010 50.06  ? 208  LYS B HD2  1  
ATOM   6496   H HD3  . LYS B 1 208 ? -24.727 29.631 -66.595 0.010 47.21  ? 208  LYS B HD3  1  
ATOM   6497   H HE2  . LYS B 1 208 ? -24.389 28.459 -68.407 0.010 49.42  ? 208  LYS B HE2  1  
ATOM   6498   H HE3  . LYS B 1 208 ? -25.932 28.117 -68.590 0.010 51.57  ? 208  LYS B HE3  1  
ATOM   6499   H HZ1  . LYS B 1 208 ? -24.806 30.547 -69.285 0.010 52.51  ? 208  LYS B HZ1  1  
ATOM   6500   H HZ2  . LYS B 1 208 ? -25.240 29.560 -70.251 0.010 54.46  ? 208  LYS B HZ2  1  
ATOM   6501   H HZ3  . LYS B 1 208 ? -26.215 30.257 -69.437 0.010 54.46  ? 208  LYS B HZ3  1  
ATOM   6502   N N    . LYS B 1 209 ? -23.566 25.454 -63.186 0.010 38.89  ? 209  LYS B N    1  
ATOM   6503   C CA   . LYS B 1 209 ? -23.087 24.129 -62.800 0.010 37.66  ? 209  LYS B CA   1  
ATOM   6504   C C    . LYS B 1 209 ? -22.490 24.151 -61.397 0.010 35.03  ? 209  LYS B C    1  
ATOM   6505   O O    . LYS B 1 209 ? -21.279 24.192 -61.251 0.010 33.73  ? 209  LYS B O    1  
ATOM   6506   C CB   . LYS B 1 209 ? -22.042 23.631 -63.802 0.010 38.25  ? 209  LYS B CB   1  
ATOM   6507   C CG   . LYS B 1 209 ? -22.531 23.562 -65.244 0.010 41.14  ? 209  LYS B CG   1  
ATOM   6508   C CD   . LYS B 1 209 ? -23.469 22.388 -65.434 0.010 42.29  ? 209  LYS B CD   1  
ATOM   6509   C CE   . LYS B 1 209 ? -22.759 21.047 -65.261 0.010 41.45  ? 209  LYS B CE   1  
ATOM   6510   N NZ   . LYS B 1 209 ? -23.718 19.914 -65.222 0.010 42.55  ? 209  LYS B NZ   1  
ATOM   6511   H H    . LYS B 1 209 ? -22.990 26.079 -63.067 0.010 38.24  ? 209  LYS B H    1  
ATOM   6512   H HA   . LYS B 1 209 ? -23.819 23.495 -62.800 0.010 38.37  ? 209  LYS B HA   1  
ATOM   6513   H HB2  . LYS B 1 209 ? -21.275 24.209 -63.786 0.010 37.75  ? 209  LYS B HB2  1  
ATOM   6514   H HB3  . LYS B 1 209 ? -21.760 22.752 -63.524 0.010 37.45  ? 209  LYS B HB3  1  
ATOM   6515   H HG2  . LYS B 1 209 ? -23.011 24.376 -65.465 0.010 42.09  ? 209  LYS B HG2  1  
ATOM   6516   H HG3  . LYS B 1 209 ? -21.773 23.449 -65.839 0.010 41.56  ? 209  LYS B HG3  1  
ATOM   6517   H HD2  . LYS B 1 209 ? -24.182 22.445 -64.779 0.010 41.81  ? 209  LYS B HD2  1  
ATOM   6518   H HD3  . LYS B 1 209 ? -23.836 22.422 -66.332 0.010 44.29  ? 209  LYS B HD3  1  
ATOM   6519   H HE2  . LYS B 1 209 ? -22.157 20.911 -66.008 0.010 42.27  ? 209  LYS B HE2  1  
ATOM   6520   H HE3  . LYS B 1 209 ? -22.265 21.028 -64.431 0.010 39.55  ? 209  LYS B HE3  1  
ATOM   6521   H HZ1  . LYS B 1 209 ? -24.366 20.089 -64.638 0.010 42.19  ? 209  LYS B HZ1  1  
ATOM   6522   H HZ2  . LYS B 1 209 ? -24.089 19.811 -66.023 0.010 44.40  ? 209  LYS B HZ2  1  
ATOM   6523   H HZ3  . LYS B 1 209 ? -23.312 19.151 -64.987 0.010 41.89  ? 209  LYS B HZ3  1  
ATOM   6524   N N    . PRO B 1 210 ? -23.348 24.144 -60.365 0.010 34.50  ? 210  PRO B N    1  
ATOM   6525   C CA   . PRO B 1 210 ? -22.927 24.098 -58.960 0.010 32.32  ? 210  PRO B CA   1  
ATOM   6526   C C    . PRO B 1 210 ? -21.876 23.036 -58.680 0.010 30.90  ? 210  PRO B C    1  
ATOM   6527   O O    . PRO B 1 210 ? -21.884 21.997 -59.325 0.010 31.74  ? 210  PRO B O    1  
ATOM   6528   C CB   . PRO B 1 210 ? -24.228 23.774 -58.229 0.010 32.84  ? 210  PRO B CB   1  
ATOM   6529   C CG   . PRO B 1 210 ? -25.282 24.396 -59.080 0.010 35.08  ? 210  PRO B CG   1  
ATOM   6530   C CD   . PRO B 1 210 ? -24.814 24.236 -60.494 0.010 36.26  ? 210  PRO B CD   1  
ATOM   6531   H HA   . PRO B 1 210 ? -22.600 24.963 -58.669 0.010 31.77  ? 210  PRO B HA   1  
ATOM   6532   H HB2  . PRO B 1 210 ? -24.352 22.813 -58.178 0.010 32.93  ? 210  PRO B HB2  1  
ATOM   6533   H HB3  . PRO B 1 210 ? -24.216 24.171 -57.344 0.010 31.91  ? 210  PRO B HB3  1  
ATOM   6534   H HG2  . PRO B 1 210 ? -26.124 23.936 -58.948 0.010 35.92  ? 210  PRO B HG2  1  
ATOM   6535   H HG3  . PRO B 1 210 ? -25.368 25.335 -58.852 0.010 35.03  ? 210  PRO B HG3  1  
ATOM   6536   H HD2  . PRO B 1 210 ? -25.178 23.427 -60.887 0.010 37.08  ? 210  PRO B HD2  1  
ATOM   6537   H HD3  . PRO B 1 210 ? -25.051 25.018 -61.014 0.010 37.38  ? 210  PRO B HD3  1  
ATOM   6538   N N    . GLY B 1 211 ? -20.981 23.302 -57.726 0.010 29.00  ? 211  GLY B N    1  
ATOM   6539   C CA   . GLY B 1 211 ? -20.005 22.322 -57.308 0.010 27.73  ? 211  GLY B CA   1  
ATOM   6540   C C    . GLY B 1 211 ? -20.693 21.157 -56.631 0.010 27.71  ? 211  GLY B C    1  
ATOM   6541   O O    . GLY B 1 211 ? -21.695 21.337 -55.945 0.010 27.97  ? 211  GLY B O    1  
ATOM   6542   H H    . GLY B 1 211 ? -20.926 24.050 -57.305 0.010 28.54  ? 211  GLY B H    1  
ATOM   6543   H HA2  . GLY B 1 211 ? -19.520 21.997 -58.081 0.010 28.24  ? 211  GLY B HA2  1  
ATOM   6544   H HA3  . GLY B 1 211 ? -19.379 22.719 -56.681 0.010 26.57  ? 211  GLY B HA3  1  
ATOM   6545   N N    . ILE B 1 212 ? -20.147 19.967 -56.822 0.010 27.63  ? 212  ILE B N    1  
ATOM   6546   C CA   . ILE B 1 212 ? -20.739 18.752 -56.259 0.010 27.88  ? 212  ILE B CA   1  
ATOM   6547   C C    . ILE B 1 212 ? -19.865 18.217 -55.152 0.010 26.25  ? 212  ILE B C    1  
ATOM   6548   O O    . ILE B 1 212 ? -18.644 18.112 -55.293 0.010 25.52  ? 212  ILE B O    1  
ATOM   6549   C CB   . ILE B 1 212 ? -20.919 17.657 -57.319 0.010 29.58  ? 212  ILE B CB   1  
ATOM   6550   C CG1  . ILE B 1 212 ? -22.064 18.018 -58.273 0.010 31.56  ? 212  ILE B CG1  1  
ATOM   6551   C CG2  . ILE B 1 212 ? -21.177 16.295 -56.639 0.010 29.76  ? 212  ILE B CG2  1  
ATOM   6552   C CD1  . ILE B 1 212 ? -22.019 17.278 -59.594 0.010 33.50  ? 212  ILE B CD1  1  
ATOM   6553   H H    . ILE B 1 212 ? -19.423 19.832 -57.266 0.010 27.56  ? 212  ILE B H    1  
ATOM   6554   H HA   . ILE B 1 212 ? -21.609 18.948 -55.881 0.010 28.22  ? 212  ILE B HA   1  
ATOM   6555   H HB   . ILE B 1 212 ? -20.098 17.600 -57.833 0.010 29.49  ? 212  ILE B HB   1  
ATOM   6556   H HG12 . ILE B 1 212 ? -22.908 17.808 -57.844 0.010 31.95  ? 212  ILE B HG12 1  
ATOM   6557   H HG13 . ILE B 1 212 ? -22.027 18.967 -58.472 0.010 31.42  ? 212  ILE B HG13 1  
ATOM   6558   H HG21 . ILE B 1 212 ? -21.820 16.410 -55.921 0.010 29.24  ? 212  ILE B HG21 1  
ATOM   6559   H HG22 . ILE B 1 212 ? -21.529 15.680 -57.299 0.010 31.22  ? 212  ILE B HG22 1  
ATOM   6560   H HG23 . ILE B 1 212 ? -20.348 15.943 -56.284 0.010 29.12  ? 212  ILE B HG23 1  
ATOM   6561   H HD11 . ILE B 1 212 ? -21.123 17.336 -59.962 0.010 33.16  ? 212  ILE B HD11 1  
ATOM   6562   H HD12 . ILE B 1 212 ? -22.254 16.349 -59.444 0.010 34.03  ? 212  ILE B HD12 1  
ATOM   6563   H HD13 . ILE B 1 212 ? -22.653 17.689 -60.202 0.010 34.70  ? 212  ILE B HD13 1  
ATOM   6564   N N    . TYR B 1 213 ? -20.507 17.883 -54.041 0.010 25.93  ? 213  TYR B N    1  
ATOM   6565   C CA   . TYR B 1 213 ? -19.805 17.385 -52.904 0.010 24.60  ? 213  TYR B CA   1  
ATOM   6566   C C    . TYR B 1 213 ? -20.448 16.099 -52.411 0.010 25.33  ? 213  TYR B C    1  
ATOM   6567   O O    . TYR B 1 213 ? -21.682 15.943 -52.370 0.010 26.44  ? 213  TYR B O    1  
ATOM   6568   C CB   . TYR B 1 213 ? -19.765 18.438 -51.800 0.010 23.53  ? 213  TYR B CB   1  
ATOM   6569   C CG   . TYR B 1 213 ? -19.231 19.764 -52.296 0.010 23.07  ? 213  TYR B CG   1  
ATOM   6570   C CD1  . TYR B 1 213 ? -20.018 20.610 -53.073 0.010 24.12  ? 213  TYR B CD1  1  
ATOM   6571   C CD2  . TYR B 1 213 ? -17.945 20.158 -52.011 0.010 21.83  ? 213  TYR B CD2  1  
ATOM   6572   C CE1  . TYR B 1 213 ? -19.534 21.802 -53.536 0.010 23.92  ? 213  TYR B CE1  1  
ATOM   6573   C CE2  . TYR B 1 213 ? -17.452 21.363 -52.470 0.010 21.63  ? 213  TYR B CE2  1  
ATOM   6574   C CZ   . TYR B 1 213 ? -18.243 22.177 -53.231 0.010 22.68  ? 213  TYR B CZ   1  
ATOM   6575   O OH   . TYR B 1 213 ? -17.758 23.386 -53.694 0.010 22.71  ? 213  TYR B OH   1  
ATOM   6576   H H    . TYR B 1 213 ? -21.356 17.940 -53.929 0.010 26.61  ? 213  TYR B H    1  
ATOM   6577   H HA   . TYR B 1 213 ? -18.888 17.183 -53.148 0.010 24.10  ? 213  TYR B HA   1  
ATOM   6578   H HB2  . TYR B 1 213 ? -20.659 18.574 -51.451 0.010 24.14  ? 213  TYR B HB2  1  
ATOM   6579   H HB3  . TYR B 1 213 ? -19.175 18.126 -51.097 0.010 22.73  ? 213  TYR B HB3  1  
ATOM   6580   H HD1  . TYR B 1 213 ? -20.887 20.362 -53.286 0.010 25.09  ? 213  TYR B HD1  1  
ATOM   6581   H HD2  . TYR B 1 213 ? -17.400 19.611 -51.495 0.010 21.23  ? 213  TYR B HD2  1  
ATOM   6582   H HE1  . TYR B 1 213 ? -20.070 22.360 -54.052 0.010 24.75  ? 213  TYR B HE1  1  
ATOM   6583   H HE2  . TYR B 1 213 ? -16.583 21.615 -52.264 0.010 20.92  ? 213  TYR B HE2  1  
ATOM   6584   H HH   . TYR B 1 213 ? -16.929 23.451 -53.524 0.010 22.03  ? 213  TYR B HH   1  
ATOM   6585   N N    . THR B 1 214 ? -19.589 15.176 -52.030 0.010 24.90  ? 214  THR B N    1  
ATOM   6586   C CA   . THR B 1 214 ? -20.066 13.925 -51.470 0.010 25.66  ? 214  THR B CA   1  
ATOM   6587   C C    . THR B 1 214 ? -20.449 14.077 -50.006 0.010 25.03  ? 214  THR B C    1  
ATOM   6588   O O    . THR B 1 214 ? -19.664 14.546 -49.183 0.010 23.66  ? 214  THR B O    1  
ATOM   6589   C CB   . THR B 1 214 ? -19.016 12.848 -51.593 0.010 25.64  ? 214  THR B CB   1  
ATOM   6590   O OG1  . THR B 1 214 ? -18.535 12.805 -52.930 0.010 26.31  ? 214  THR B OG1  1  
ATOM   6591   C CG2  . THR B 1 214 ? -19.608 11.517 -51.235 0.010 26.96  ? 214  THR B CG2  1  
ATOM   6592   H H    . THR B 1 214 ? -18.734 15.243 -52.090 0.010 24.31  ? 214  THR B H    1  
ATOM   6593   H HA   . THR B 1 214 ? -20.851 13.637 -51.961 0.010 26.88  ? 214  THR B HA   1  
ATOM   6594   H HB   . THR B 1 214 ? -18.284 13.037 -50.986 0.010 24.55  ? 214  THR B HB   1  
ATOM   6595   H HG1  . THR B 1 214 ? -19.152 12.549 -53.451 0.010 27.43  ? 214  THR B HG1  1  
ATOM   6596   H HG21 . THR B 1 214 ? -20.462 11.414 -51.681 0.010 28.12  ? 214  THR B HG21 1  
ATOM   6597   H HG22 . THR B 1 214 ? -19.011 10.809 -51.519 0.010 27.23  ? 214  THR B HG22 1  
ATOM   6598   H HG23 . THR B 1 214 ? -19.744 11.460 -50.277 0.010 26.58  ? 214  THR B HG23 1  
ATOM   6599   N N    . ARG B 1 215 ? -21.667 13.676 -49.683 0.010 26.30  ? 215  ARG B N    1  
ATOM   6600   C CA   . ARG B 1 215 ? -22.155 13.740 -48.314 0.010 26.22  ? 215  ARG B CA   1  
ATOM   6601   C C    . ARG B 1 215 ? -21.541 12.614 -47.491 0.010 26.08  ? 215  ARG B C    1  
ATOM   6602   O O    . ARG B 1 215 ? -21.925 11.436 -47.651 0.010 27.43  ? 215  ARG B O    1  
ATOM   6603   C CB   . ARG B 1 215 ? -23.692 13.659 -48.277 0.010 28.01  ? 215  ARG B CB   1  
ATOM   6604   C CG   . ARG B 1 215 ? -24.403 14.797 -48.965 0.010 28.36  ? 215  ARG B CG   1  
ATOM   6605   C CD   . ARG B 1 215 ? -25.959 14.781 -48.758 0.010 30.33  ? 215  ARG B CD   1  
ATOM   6606   N NE   . ARG B 1 215 ? -26.360 14.962 -47.358 0.010 30.43  ? 215  ARG B NE   1  
ATOM   6607   C CZ   . ARG B 1 215 ? -26.737 13.967 -46.548 0.010 31.40  ? 215  ARG B CZ   1  
ATOM   6608   N NH1  . ARG B 1 215 ? -26.794 12.731 -47.002 0.010 32.34  ? 215  ARG B NH1  1  
ATOM   6609   N NH2  . ARG B 1 215 ? -27.061 14.206 -45.283 0.010 31.67  ? 215  ARG B NH2  1  
ATOM   6610   H H    . ARG B 1 215 ? -22.237 13.363 -50.245 0.010 27.37  ? 215  ARG B H    1  
ATOM   6611   H HA   . ARG B 1 215 ? -21.891 14.582 -47.916 0.010 25.31  ? 215  ARG B HA   1  
ATOM   6612   H HB2  . ARG B 1 215 ? -23.963 12.837 -48.710 0.010 29.03  ? 215  ARG B HB2  1  
ATOM   6613   H HB3  . ARG B 1 215 ? -23.982 13.655 -47.352 0.010 28.16  ? 215  ARG B HB3  1  
ATOM   6614   H HG2  . ARG B 1 215 ? -24.061 15.636 -48.615 0.010 27.38  ? 215  ARG B HG2  1  
ATOM   6615   H HG3  . ARG B 1 215 ? -24.222 14.745 -49.917 0.010 28.50  ? 215  ARG B HG3  1  
ATOM   6616   H HD2  . ARG B 1 215 ? -26.350 15.506 -49.272 0.010 30.70  ? 215  ARG B HD2  1  
ATOM   6617   H HD3  . ARG B 1 215 ? -26.308 13.941 -49.088 0.010 31.40  ? 215  ARG B HD3  1  
ATOM   6618   H HE   . ARG B 1 215 ? -26.638 15.748 -47.144 0.010 30.43  ? 215  ARG B HE   1  
ATOM   6619   H HH11 . ARG B 1 215 ? -26.583 12.546 -47.813 0.010 32.33  ? 215  ARG B HH11 1  
ATOM   6620   H HH12 . ARG B 1 215 ? -27.043 12.098 -46.475 0.010 33.08  ? 215  ARG B HH12 1  
ATOM   6621   H HH21 . ARG B 1 215 ? -27.035 15.007 -44.973 0.010 31.21  ? 215  ARG B HH21 1  
ATOM   6622   H HH22 . ARG B 1 215 ? -27.312 13.561 -44.776 0.010 32.43  ? 215  ARG B HH22 1  
ATOM   6623   N N    . VAL B 1 216 ? -20.617 12.973 -46.591 0.010 24.68  ? 216  VAL B N    1  
ATOM   6624   C CA   . VAL B 1 216 ? -19.918 11.978 -45.783 0.010 24.61  ? 216  VAL B CA   1  
ATOM   6625   C C    . VAL B 1 216 ? -20.921 11.146 -44.958 0.010 26.15  ? 216  VAL B C    1  
ATOM   6626   O O    . VAL B 1 216 ? -20.724 9.952  -44.780 0.010 27.02  ? 216  VAL B O    1  
ATOM   6627   C CB   . VAL B 1 216 ? -18.857 12.595 -44.848 0.010 23.13  ? 216  VAL B CB   1  
ATOM   6628   C CG1  . VAL B 1 216 ? -17.739 13.330 -45.658 0.010 21.84  ? 216  VAL B CG1  1  
ATOM   6629   C CG2  . VAL B 1 216 ? -19.510 13.524 -43.875 0.010 23.01  ? 216  VAL B CG2  1  
ATOM   6630   H H    . VAL B 1 216 ? -20.390 13.784 -46.420 0.010 23.90  ? 216  VAL B H    1  
ATOM   6631   H HA   . VAL B 1 216 ? -19.456 11.369 -46.378 0.010 24.77  ? 216  VAL B HA   1  
ATOM   6632   H HB   . VAL B 1 216 ? -18.437 11.881 -44.346 0.010 23.30  ? 216  VAL B HB   1  
ATOM   6633   H HG11 . VAL B 1 216 ? -18.154 13.912 -46.315 0.010 21.73  ? 216  VAL B HG11 1  
ATOM   6634   H HG12 . VAL B 1 216 ? -17.198 13.862 -45.053 0.010 21.07  ? 216  VAL B HG12 1  
ATOM   6635   H HG13 . VAL B 1 216 ? -17.182 12.670 -46.100 0.010 22.12  ? 216  VAL B HG13 1  
ATOM   6636   H HG21 . VAL B 1 216 ? -20.387 13.767 -44.207 0.010 23.67  ? 216  VAL B HG21 1  
ATOM   6637   H HG22 . VAL B 1 216 ? -19.592 13.077 -43.018 0.010 23.41  ? 216  VAL B HG22 1  
ATOM   6638   H HG23 . VAL B 1 216 ? -18.969 14.321 -43.785 0.010 22.06  ? 216  VAL B HG23 1  
ATOM   6639   N N    . ALA B 1 217 ? -21.995 11.768 -44.477 0.010 26.71  ? 217  ALA B N    1  
ATOM   6640   C CA   . ALA B 1 217 ? -22.949 11.058 -43.600 0.010 28.41  ? 217  ALA B CA   1  
ATOM   6641   C C    . ALA B 1 217 ? -23.720 9.979  -44.323 0.010 30.24  ? 217  ALA B C    1  
ATOM   6642   O O    . ALA B 1 217 ? -24.264 9.064  -43.692 0.010 31.88  ? 217  ALA B O    1  
ATOM   6643   C CB   . ALA B 1 217 ? -23.908 12.012 -42.943 0.010 28.86  ? 217  ALA B CB   1  
ATOM   6644   H H    . ALA B 1 217 ? -22.205 12.586 -44.641 0.010 26.29  ? 217  ALA B H    1  
ATOM   6645   H HA   . ALA B 1 217 ? -22.448 10.623 -42.897 0.010 28.31  ? 217  ALA B HA   1  
ATOM   6646   H HB1  . ALA B 1 217 ? -23.402 12.755 -42.581 0.010 27.72  ? 217  ALA B HB1  1  
ATOM   6647   H HB2  . ALA B 1 217 ? -24.546 12.332 -43.601 0.010 29.54  ? 217  ALA B HB2  1  
ATOM   6648   H HB3  . ALA B 1 217 ? -24.370 11.547 -42.229 0.010 29.78  ? 217  ALA B HB3  1  
ATOM   6649   N N    . SER B 1 218 ? -23.794 10.070 -45.643 0.010 30.24  ? 218  SER B N    1  
ATOM   6650   C CA   . SER B 1 218 ? -24.394 8.977  -46.399 0.010 32.14  ? 218  SER B CA   1  
ATOM   6651   C C    . SER B 1 218 ? -23.511 7.733  -46.410 0.010 32.40  ? 218  SER B C    1  
ATOM   6652   O O    . SER B 1 218 ? -23.966 6.670  -46.807 0.010 34.29  ? 218  SER B O    1  
ATOM   6653   C CB   . SER B 1 218 ? -24.676 9.386  -47.839 0.010 32.38  ? 218  SER B CB   1  
ATOM   6654   O OG   . SER B 1 218 ? -25.527 10.504 -47.866 0.010 32.40  ? 218  SER B OG   1  
ATOM   6655   H H    . SER B 1 218 ? -23.519 10.732 -46.114 0.010 29.33  ? 218  SER B H    1  
ATOM   6656   H HA   . SER B 1 218 ? -25.238 8.737  -45.987 0.010 33.42  ? 218  SER B HA   1  
ATOM   6657   H HB2  . SER B 1 218 ? -23.843 9.598  -48.287 0.010 31.30  ? 218  SER B HB2  1  
ATOM   6658   H HB3  . SER B 1 218 ? -25.116 8.652  -48.294 0.010 33.84  ? 218  SER B HB3  1  
ATOM   6659   H HG   . SER B 1 218 ? -26.175 10.379 -47.331 0.010 33.33  ? 218  SER B HG   1  
ATOM   6660   N N    . TYR B 1 219 ? -22.248 7.875  -46.005 0.010 30.71  ? 219  TYR B N    1  
ATOM   6661   C CA   . TYR B 1 219 ? -21.279 6.778  -46.118 0.010 30.95  ? 219  TYR B CA   1  
ATOM   6662   C C    . TYR B 1 219 ? -20.670 6.357  -44.773 0.010 30.59  ? 219  TYR B C    1  
ATOM   6663   O O    . TYR B 1 219 ? -19.629 5.710  -44.731 0.010 30.25  ? 219  TYR B O    1  
ATOM   6664   C CB   . TYR B 1 219 ? -20.176 7.179  -47.103 0.010 29.69  ? 219  TYR B CB   1  
ATOM   6665   C CG   . TYR B 1 219 ? -20.688 7.375  -48.519 0.010 30.50  ? 219  TYR B CG   1  
ATOM   6666   C CD1  . TYR B 1 219 ? -20.687 6.323  -49.430 0.010 32.35  ? 219  TYR B CD1  1  
ATOM   6667   C CD2  . TYR B 1 219 ? -21.217 8.597  -48.932 0.010 29.70  ? 219  TYR B CD2  1  
ATOM   6668   C CE1  . TYR B 1 219 ? -21.181 6.486  -50.724 0.010 33.40  ? 219  TYR B CE1  1  
ATOM   6669   C CE2  . TYR B 1 219 ? -21.706 8.774  -50.223 0.010 30.69  ? 219  TYR B CE2  1  
ATOM   6670   C CZ   . TYR B 1 219 ? -21.693 7.704  -51.115 0.010 32.56  ? 219  TYR B CZ   1  
ATOM   6671   O OH   . TYR B 1 219 ? -22.169 7.854  -52.401 0.010 33.82  ? 219  TYR B OH   1  
ATOM   6672   H H    . TYR B 1 219 ? -21.923 8.598  -45.668 0.010 29.52  ? 219  TYR B H    1  
ATOM   6673   H HA   . TYR B 1 219 ? -21.718 5.998  -46.488 0.010 32.44  ? 219  TYR B HA   1  
ATOM   6674   H HB2  . TYR B 1 219 ? -19.782 8.012  -46.802 0.010 28.30  ? 219  TYR B HB2  1  
ATOM   6675   H HB3  . TYR B 1 219 ? -19.500 6.485  -47.124 0.010 29.92  ? 219  TYR B HB3  1  
ATOM   6676   H HD1  . TYR B 1 219 ? -20.349 5.498  -49.171 0.010 33.05  ? 219  TYR B HD1  1  
ATOM   6677   H HD2  . TYR B 1 219 ? -21.234 9.311  -48.339 0.010 28.62  ? 219  TYR B HD2  1  
ATOM   6678   H HE1  . TYR B 1 219 ? -21.168 5.775  -51.324 0.010 34.80  ? 219  TYR B HE1  1  
ATOM   6679   H HE2  . TYR B 1 219 ? -22.049 9.597  -50.484 0.010 30.26  ? 219  TYR B HE2  1  
ATOM   6680   H HH   . TYR B 1 219 ? -22.787 8.437  -52.420 0.010 33.86  ? 219  TYR B HH   1  
ATOM   6681   N N    . ALA B 1 220 ? -21.334 6.716  -43.682 0.010 30.90  ? 220  ALA B N    1  
ATOM   6682   C CA   . ALA B 1 220 ? -20.780 6.554  -42.341 0.010 30.53  ? 220  ALA B CA   1  
ATOM   6683   C C    . ALA B 1 220 ? -20.485 5.113  -42.000 0.010 32.00  ? 220  ALA B C    1  
ATOM   6684   O O    . ALA B 1 220 ? -19.463 4.795  -41.385 0.010 31.49  ? 220  ALA B O    1  
ATOM   6685   C CB   . ALA B 1 220 ? -21.726 7.137  -41.312 0.010 31.09  ? 220  ALA B CB   1  
ATOM   6686   H H    . ALA B 1 220 ? -22.121 7.061  -43.690 0.010 31.46  ? 220  ALA B H    1  
ATOM   6687   H HA   . ALA B 1 220 ? -19.946 7.046  -42.294 0.010 29.14  ? 220  ALA B HA   1  
ATOM   6688   H HB1  . ALA B 1 220 ? -21.942 8.049  -41.564 0.010 30.36  ? 220  ALA B HB1  1  
ATOM   6689   H HB2  . ALA B 1 220 ? -22.535 6.602  -41.292 0.010 32.64  ? 220  ALA B HB2  1  
ATOM   6690   H HB3  . ALA B 1 220 ? -21.293 7.131  -40.444 0.010 30.79  ? 220  ALA B HB3  1  
ATOM   6691   N N    . ALA B 1 221 ? -21.396 4.227  -42.389 0.010 34.06  ? 221  ALA B N    1  
ATOM   6692   C CA   . ALA B 1 221 ? -21.189 2.810  -42.166 0.010 35.88  ? 221  ALA B CA   1  
ATOM   6693   C C    . ALA B 1 221 ? -19.911 2.324  -42.832 0.010 35.32  ? 221  ALA B C    1  
ATOM   6694   O O    . ALA B 1 221 ? -19.155 1.562  -42.239 0.010 35.88  ? 221  ALA B O    1  
ATOM   6695   C CB   . ALA B 1 221 ? -22.388 2.016  -42.664 0.010 38.35  ? 221  ALA B CB   1  
ATOM   6696   H H    . ALA B 1 221 ? -22.132 4.424  -42.783 0.010 34.57  ? 221  ALA B H    1  
ATOM   6697   H HA   . ALA B 1 221 ? -21.101 2.652  -41.213 0.010 36.15  ? 221  ALA B HA   1  
ATOM   6698   H HB1  . ALA B 1 221 ? -22.525 2.209  -43.604 0.010 38.18  ? 221  ALA B HB1  1  
ATOM   6699   H HB2  . ALA B 1 221 ? -22.209 1.072  -42.541 0.010 39.65  ? 221  ALA B HB2  1  
ATOM   6700   H HB3  . ALA B 1 221 ? -23.172 2.275  -42.157 0.010 38.91  ? 221  ALA B HB3  1  
ATOM   6701   N N    . TRP B 1 222 ? -19.665 2.760  -44.062 0.010 34.45  ? 222  TRP B N    1  
ATOM   6702   C CA   . TRP B 1 222 ? -18.425 2.390  -44.736 0.010 34.13  ? 222  TRP B CA   1  
ATOM   6703   C C    . TRP B 1 222 ? -17.172 2.951  -44.051 0.010 32.22  ? 222  TRP B C    1  
ATOM   6704   O O    . TRP B 1 222 ? -16.194 2.232  -43.853 0.010 32.65  ? 222  TRP B O    1  
ATOM   6705   C CB   . TRP B 1 222 ? -18.440 2.815  -46.207 0.010 33.93  ? 222  TRP B CB   1  
ATOM   6706   C CG   . TRP B 1 222 ? -17.194 2.404  -46.937 0.010 33.85  ? 222  TRP B CG   1  
ATOM   6707   C CD1  . TRP B 1 222 ? -16.853 1.137  -47.335 0.010 35.81  ? 222  TRP B CD1  1  
ATOM   6708   C CD2  . TRP B 1 222 ? -16.113 3.249  -47.335 0.010 32.01  ? 222  TRP B CD2  1  
ATOM   6709   N NE1  . TRP B 1 222 ? -15.638 1.156  -47.967 0.010 35.30  ? 222  TRP B NE1  1  
ATOM   6710   C CE2  . TRP B 1 222 ? -15.162 2.440  -47.974 0.010 32.97  ? 222  TRP B CE2  1  
ATOM   6711   C CE3  . TRP B 1 222 ? -15.863 4.619  -47.220 0.010 29.85  ? 222  TRP B CE3  1  
ATOM   6712   C CZ2  . TRP B 1 222 ? -13.985 2.953  -48.498 0.010 31.87  ? 222  TRP B CZ2  1  
ATOM   6713   C CZ3  . TRP B 1 222 ? -14.693 5.123  -47.736 0.010 28.74  ? 222  TRP B CZ3  1  
ATOM   6714   C CH2  . TRP B 1 222 ? -13.769 4.298  -48.363 0.010 29.73  ? 222  TRP B CH2  1  
ATOM   6715   H H    . TRP B 1 222 ? -20.193 3.257  -44.522 0.010 34.19  ? 222  TRP B H    1  
ATOM   6716   H HA   . TRP B 1 222 ? -18.353 1.423  -44.719 0.010 35.60  ? 222  TRP B HA   1  
ATOM   6717   H HB2  . TRP B 1 222 ? -19.197 2.399  -46.647 0.010 35.37  ? 222  TRP B HB2  1  
ATOM   6718   H HB3  . TRP B 1 222 ? -18.515 3.780  -46.260 0.010 32.62  ? 222  TRP B HB3  1  
ATOM   6719   H HD1  . TRP B 1 222 ? -17.373 0.377  -47.203 0.010 37.40  ? 222  TRP B HD1  1  
ATOM   6720   H HE1  . TRP B 1 222 ? -15.235 0.472  -48.297 0.010 36.40  ? 222  TRP B HE1  1  
ATOM   6721   H HE3  . TRP B 1 222 ? -16.476 5.181  -46.803 0.010 29.33  ? 222  TRP B HE3  1  
ATOM   6722   H HZ2  . TRP B 1 222 ? -13.364 2.404  -48.919 0.010 32.70  ? 222  TRP B HZ2  1  
ATOM   6723   H HZ3  . TRP B 1 222 ? -14.519 6.033  -47.661 0.010 27.44  ? 222  TRP B HZ3  1  
ATOM   6724   H HH2  . TRP B 1 222 ? -12.989 4.673  -48.702 0.010 29.08  ? 222  TRP B HH2  1  
ATOM   6725   N N    . ILE B 1 223 ? -17.199 4.239  -43.713 0.010 30.33  ? 223  ILE B N    1  
ATOM   6726   C CA   . ILE B 1 223 ? -16.033 4.894  -43.112 0.010 28.66  ? 223  ILE B CA   1  
ATOM   6727   C C    . ILE B 1 223 ? -15.630 4.166  -41.834 0.010 29.49  ? 223  ILE B C    1  
ATOM   6728   O O    . ILE B 1 223 ? -14.455 3.917  -41.601 0.010 29.16  ? 223  ILE B O    1  
ATOM   6729   C CB   . ILE B 1 223 ? -16.330 6.361  -42.768 0.010 26.99  ? 223  ILE B CB   1  
ATOM   6730   C CG1  . ILE B 1 223 ? -16.631 7.159  -44.042 0.010 26.30  ? 223  ILE B CG1  1  
ATOM   6731   C CG2  . ILE B 1 223 ? -15.163 6.959  -42.013 0.010 25.60  ? 223  ILE B CG2  1  
ATOM   6732   C CD1  . ILE B 1 223 ? -17.420 8.451  -43.797 0.010 25.64  ? 223  ILE B CD1  1  
ATOM   6733   H H    . ILE B 1 223 ? -17.880 4.753  -43.821 0.010 30.10  ? 223  ILE B H    1  
ATOM   6734   H HA   . ILE B 1 223 ? -15.289 4.863  -43.733 0.010 28.30  ? 223  ILE B HA   1  
ATOM   6735   H HB   . ILE B 1 223 ? -17.115 6.396  -42.200 0.010 27.50  ? 223  ILE B HB   1  
ATOM   6736   H HG12 . ILE B 1 223 ? -15.790 7.417  -44.451 0.010 25.41  ? 223  ILE B HG12 1  
ATOM   6737   H HG13 . ILE B 1 223 ? -17.139 6.606  -44.657 0.010 27.34  ? 223  ILE B HG13 1  
ATOM   6738   H HG21 . ILE B 1 223 ? -14.331 6.677  -42.429 0.010 25.42  ? 223  ILE B HG21 1  
ATOM   6739   H HG22 . ILE B 1 223 ? -15.241 7.924  -42.050 0.010 24.60  ? 223  ILE B HG22 1  
ATOM   6740   H HG23 . ILE B 1 223 ? -15.195 6.663  -41.090 0.010 26.10  ? 223  ILE B HG23 1  
ATOM   6741   H HD11 . ILE B 1 223 ? -17.934 8.366  -42.978 0.010 26.24  ? 223  ILE B HD11 1  
ATOM   6742   H HD12 . ILE B 1 223 ? -16.792 9.186  -43.719 0.010 24.45  ? 223  ILE B HD12 1  
ATOM   6743   H HD13 . ILE B 1 223 ? -18.017 8.600  -44.547 0.010 26.00  ? 223  ILE B HD13 1  
ATOM   6744   N N    . ASP B 1 224 ? -16.636 3.789  -41.043 0.010 30.83  ? 224  ASP B N    1  
ATOM   6745   C CA   . ASP B 1 224 ? -16.442 3.090  -39.763 0.010 31.92  ? 224  ASP B CA   1  
ATOM   6746   C C    . ASP B 1 224 ? -15.811 1.717  -39.874 0.010 33.52  ? 224  ASP B C    1  
ATOM   6747   O O    . ASP B 1 224 ? -14.939 1.368  -39.081 0.010 33.73  ? 224  ASP B O    1  
ATOM   6748   C CB   . ASP B 1 224 ? -17.781 2.913  -39.067 0.010 33.35  ? 224  ASP B CB   1  
ATOM   6749   C CG   . ASP B 1 224 ? -18.152 4.081  -38.204 0.010 32.39  ? 224  ASP B CG   1  
ATOM   6750   O OD1  . ASP B 1 224 ? -19.255 4.027  -37.624 0.010 33.72  ? 224  ASP B OD1  1  
ATOM   6751   O OD2  . ASP B 1 224 ? -17.356 5.035  -38.094 0.010 30.57  ? 224  ASP B OD2  1  
ATOM   6752   H H    . ASP B 1 224 ? -17.462 3.933  -41.229 0.010 31.28  ? 224  ASP B H    1  
ATOM   6753   H HA   . ASP B 1 224 ? -15.860 3.617  -39.198 0.010 30.91  ? 224  ASP B HA   1  
ATOM   6754   H HB2  . ASP B 1 224 ? -18.474 2.799  -39.736 0.010 33.76  ? 224  ASP B HB2  1  
ATOM   6755   H HB3  . ASP B 1 224 ? -17.740 2.126  -38.501 0.010 34.76  ? 224  ASP B HB3  1  
ATOM   6756   N N    . SER B 1 225 ? -16.268 0.922  -40.836 0.010 34.84  ? 225  SER B N    1  
ATOM   6757   C CA   . SER B 1 225 ? -15.661 -0.371 -41.071 0.010 36.60  ? 225  SER B CA   1  
ATOM   6758   C C    . SER B 1 225 ? -14.135 -0.319 -41.328 0.010 35.67  ? 225  SER B C    1  
ATOM   6759   O O    . SER B 1 225 ? -13.537 -1.329 -41.679 0.010 37.12  ? 225  SER B O    1  
ATOM   6760   C CB   . SER B 1 225 ? -16.424 -1.182 -42.152 0.010 37.96  ? 225  SER B CB   1  
ATOM   6761   O OG   . SER B 1 225 ? -16.909 -0.393 -43.225 0.010 36.75  ? 225  SER B OG   1  
ATOM   6762   H H    . SER B 1 225 ? -16.933 1.101  -41.349 0.010 34.89  ? 225  SER B H    1  
ATOM   6763   H HA   . SER B 1 225 ? -15.773 -0.858 -40.244 0.010 37.90  ? 225  SER B HA   1  
ATOM   6764   H HB2  . SER B 1 225 ? -15.833 -1.864 -42.507 0.010 38.18  ? 225  SER B HB2  1  
ATOM   6765   H HB3  . SER B 1 225 ? -17.184 -1.609 -41.728 0.010 39.69  ? 225  SER B HB3  1  
ATOM   6766   H HG   . SER B 1 225 ? -17.674 -0.085 -43.025 0.010 36.95  ? 225  SER B HG   1  
ATOM   6767   N N    . VAL B 1 226 ? -13.509 0.855  -41.180 0.010 33.42  ? 226  VAL B N    1  
ATOM   6768   C CA   . VAL B 1 226 ? -12.078 0.915  -40.860 0.010 32.73  ? 226  VAL B CA   1  
ATOM   6769   C C    . VAL B 1 226 ? -11.935 0.404  -39.440 0.010 33.73  ? 226  VAL B C    1  
ATOM   6770   O O    . VAL B 1 226 ? -12.438 1.003  -38.483 0.010 33.24  ? 226  VAL B O    1  
ATOM   6771   C CB   . VAL B 1 226 ? -11.511 2.280  -40.865 0.010 30.40  ? 226  VAL B CB   1  
ATOM   6772   C CG1  . VAL B 1 226 ? -12.203 3.196  -39.920 0.010 29.41  ? 226  VAL B CG1  1  
ATOM   6773   C CG2  . VAL B 1 226 ? -10.085 2.204  -40.445 0.010 30.15  ? 226  VAL B CG2  1  
ATOM   6774   H H    . VAL B 1 226 ? -13.875 1.627  -41.285 0.010 32.36  ? 226  VAL B H    1  
ATOM   6775   H HA   . VAL B 1 226 ? -11.563 0.361  -41.465 0.010 33.44  ? 226  VAL B HA   1  
ATOM   6776   H HB   . VAL B 1 226 ? -11.563 2.655  -41.759 0.010 29.85  ? 226  VAL B HB   1  
ATOM   6777   H HG11 . VAL B 1 226 ? -13.108 2.897  -39.773 0.010 30.29  ? 226  VAL B HG11 1  
ATOM   6778   H HG12 . VAL B 1 226 ? -11.719 3.230  -39.084 0.010 29.32  ? 226  VAL B HG12 1  
ATOM   6779   H HG13 . VAL B 1 226 ? -12.211 4.077  -40.319 0.010 28.15  ? 226  VAL B HG13 1  
ATOM   6780   H HG21 . VAL B 1 226 ? -9.647  1.473  -40.907 0.010 30.61  ? 226  VAL B HG21 1  
ATOM   6781   H HG22 . VAL B 1 226 ? -9.706  3.050  -40.679 0.010 28.79  ? 226  VAL B HG22 1  
ATOM   6782   H HG23 . VAL B 1 226 ? -10.019 2.086  -39.486 0.010 31.07  ? 226  VAL B HG23 1  
ATOM   6783   N N    . LEU B 1 227 ? -11.198 -0.682 -39.307 0.010 35.31  ? 227  LEU B N    1  
ATOM   6784   C CA   . LEU B 1 227 ? -11.554 -1.688 -38.348 0.010 37.57  ? 227  LEU B CA   1  
ATOM   6785   C C    . LEU B 1 227 ? -10.768 -2.947 -38.777 0.010 39.46  ? 227  LEU B C    1  
ATOM   6786   O O    . LEU B 1 227 ? -9.574  -2.835 -39.092 0.010 38.94  ? 227  LEU B O    1  
ATOM   6787   C CB   . LEU B 1 227 ? -13.095 -1.807 -38.415 0.010 38.51  ? 227  LEU B CB   1  
ATOM   6788   C CG   . LEU B 1 227 ? -14.041 -2.982 -38.106 0.010 41.01  ? 227  LEU B CG   1  
ATOM   6789   C CD1  . LEU B 1 227 ? -14.952 -2.617 -36.944 0.010 40.56  ? 227  LEU B CD1  1  
ATOM   6790   C CD2  . LEU B 1 227 ? -14.874 -3.382 -39.354 0.010 42.40  ? 227  LEU B CD2  1  
ATOM   6791   H H    . LEU B 1 227 ? -10.485 -0.850 -39.755 0.010 35.22  ? 227  LEU B H    1  
ATOM   6792   H HA   . LEU B 1 227 ? -11.287 -1.418 -37.456 0.010 37.44  ? 227  LEU B HA   1  
ATOM   6793   H HB2  . LEU B 1 227 ? -13.435 -1.088 -37.860 0.010 37.25  ? 227  LEU B HB2  1  
ATOM   6794   H HB3  . LEU B 1 227 ? -13.304 -1.601 -39.328 0.010 38.76  ? 227  LEU B HB3  1  
ATOM   6795   H HG   . LEU B 1 227 ? -13.539 -3.750 -37.806 0.010 42.24  ? 227  LEU B HG   1  
ATOM   6796   H HD11 . LEU B 1 227 ? -15.530 -1.884 -37.210 0.010 39.69  ? 227  LEU B HD11 1  
ATOM   6797   H HD12 . LEU B 1 227 ? -15.490 -3.392 -36.713 0.010 42.33  ? 227  LEU B HD12 1  
ATOM   6798   H HD13 . LEU B 1 227 ? -14.411 -2.357 -36.182 0.010 39.54  ? 227  LEU B HD13 1  
ATOM   6799   H HD21 . LEU B 1 227 ? -14.884 -2.671 -40.001 0.010 41.20  ? 227  LEU B HD21 1  
ATOM   6800   H HD22 . LEU B 1 227 ? -14.459 -4.159 -39.756 0.010 43.02  ? 227  LEU B HD22 1  
ATOM   6801   H HD23 . LEU B 1 227 ? -15.788 -3.611 -39.095 0.010 44.05  ? 227  LEU B HD23 1  
ATOM   6802   N N    . ALA B 1 228 ? -11.477 -4.072 -38.925 0.010 41.75  ? 228  ALA B N    1  
ATOM   6803   C CA   . ALA B 1 228 ? -11.000 -5.471 -38.928 0.010 44.42  ? 228  ALA B CA   1  
ATOM   6804   C C    . ALA B 1 228 ? -9.705  -5.832 -39.654 0.010 44.58  ? 228  ALA B C    1  
ATOM   6805   O O    . ALA B 1 228 ? -8.604  -5.828 -39.098 0.010 43.80  ? 228  ALA B O    1  
ATOM   6806   C CB   . ALA B 1 228 ? -12.133 -6.356 -39.501 0.010 46.83  ? 228  ALA B CB   1  
ATOM   6807   O OXT  . ALA B 1 228 ? -9.776  -6.227 -40.823 0.010 45.81  ? 228  ALA B OXT  1  
ATOM   6808   H H    . ALA B 1 228 ? -12.308 -4.058 -39.108 0.010 41.94  ? 228  ALA B H    1  
ATOM   6809   H HA   . ALA B 1 228 ? -10.876 -5.740 -38.006 0.010 45.01  ? 228  ALA B HA   1  
ATOM   6810   H HB1  . ALA B 1 228 ? -12.341 -6.060 -40.401 0.010 46.33  ? 228  ALA B HB1  1  
ATOM   6811   H HB2  . ALA B 1 228 ? -11.838 -7.280 -39.523 0.010 48.74  ? 228  ALA B HB2  1  
ATOM   6812   H HB3  . ALA B 1 228 ? -12.918 -6.272 -38.939 0.010 47.07  ? 228  ALA B HB3  1  
HETATM 6813   C C1   . GOL C 2 .   ? 7.269   18.059 -18.697 0.010 19.56  ? 1000 GOL A C1   1  
HETATM 6814   O O1   . GOL C 2 .   ? 6.180   18.831 -18.188 0.010 19.70  ? 1000 GOL A O1   1  
HETATM 6815   C C2   . GOL C 2 .   ? 7.518   18.466 -20.157 0.010 19.52  ? 1000 GOL A C2   1  
HETATM 6816   O O2   . GOL C 2 .   ? 7.688   19.895 -20.156 0.010 20.60  ? 1000 GOL A O2   1  
HETATM 6817   C C3   . GOL C 2 .   ? 8.793   17.840 -20.741 0.010 19.71  ? 1000 GOL A C3   1  
HETATM 6818   O O3   . GOL C 2 .   ? 9.950   18.256 -20.045 0.010 20.82  ? 1000 GOL A O3   1  
HETATM 6819   H H11  . GOL C 2 .   ? 8.168   18.232 -18.111 0.010 20.36  ? 1000 GOL A H11  1  
HETATM 6820   H H12  . GOL C 2 .   ? 7.031   17.002 -18.636 0.010 18.84  ? 1000 GOL A H12  1  
HETATM 6821   H HO1  . GOL C 2 .   ? 6.444   19.243 -17.342 0.010 20.49  ? 1000 GOL A HO1  1  
HETATM 6822   H H2   . GOL C 2 .   ? 6.651   18.182 -20.766 0.010 18.79  ? 1000 GOL A H2   1  
HETATM 6823   H HO2  . GOL C 2 .   ? 8.612   20.136 -19.917 0.010 21.31  ? 1000 GOL A HO2  1  
HETATM 6824   H H31  . GOL C 2 .   ? 8.722   16.753 -20.682 0.010 19.10  ? 1000 GOL A H31  1  
HETATM 6825   H H32  . GOL C 2 .   ? 8.878   18.107 -21.793 0.010 19.71  ? 1000 GOL A H32  1  
HETATM 6826   H HO3  . GOL C 2 .   ? 10.735  17.844 -20.452 0.010 20.97  ? 1000 GOL A HO3  1  
HETATM 6827   C C1   . GOL D 2 .   ? -30.196 19.754 -49.489 0.010 35.23  ? 1000 GOL B C1   1  
HETATM 6828   O O1   . GOL D 2 .   ? -31.112 20.405 -50.358 0.010 36.98  ? 1000 GOL B O1   1  
HETATM 6829   C C2   . GOL D 2 .   ? -28.779 20.252 -49.735 0.010 32.93  ? 1000 GOL B C2   1  
HETATM 6830   O O2   . GOL D 2 .   ? -27.924 19.909 -48.655 0.010 31.33  ? 1000 GOL B O2   1  
HETATM 6831   C C3   . GOL D 2 .   ? -28.227 19.679 -51.030 0.010 32.75  ? 1000 GOL B C3   1  
HETATM 6832   O O3   . GOL D 2 .   ? -27.070 20.372 -51.430 0.010 31.19  ? 1000 GOL B O3   1  
HETATM 6833   H H11  . GOL D 2 .   ? -30.476 19.938 -48.451 0.010 35.42  ? 1000 GOL B H11  1  
HETATM 6834   H H12  . GOL D 2 .   ? -30.233 18.677 -49.657 0.010 35.58  ? 1000 GOL B H12  1  
HETATM 6835   H HO1  . GOL D 2 .   ? -32.027 20.126 -50.148 0.010 38.59  ? 1000 GOL B HO1  1  
HETATM 6836   H H2   . GOL D 2 .   ? -28.826 21.337 -49.831 0.010 32.91  ? 1000 GOL B H2   1  
HETATM 6837   H HO2  . GOL D 2 .   ? -27.748 18.947 -48.666 0.010 31.33  ? 1000 GOL B HO2  1  
HETATM 6838   H H31  . GOL D 2 .   ? -27.995 18.624 -50.897 0.010 32.56  ? 1000 GOL B H31  1  
HETATM 6839   H H32  . GOL D 2 .   ? -28.981 19.762 -51.810 0.010 34.31  ? 1000 GOL B H32  1  
HETATM 6840   H HO3  . GOL D 2 .   ? -27.111 21.295 -51.106 0.010 30.89  ? 1000 GOL B HO3  1  
HETATM 6841   O O    . HOH E 3 .   ? -25.494 29.576 -16.266 0.010 29.04  ? 1101 HOH A O    1  
HETATM 6842   O O    . HOH E 3 .   ? 4.751   7.527  -29.815 0.010 18.41  ? 1102 HOH A O    1  
HETATM 6843   O O    . HOH E 3 .   ? -17.932 6.398  -28.080 0.010 20.60  ? 1103 HOH A O    1  
HETATM 6844   O O    . HOH E 3 .   ? -23.875 11.926 -8.761  0.010 24.55  ? 1104 HOH A O    1  
HETATM 6845   O O    . HOH E 3 .   ? 1.666   8.233  -14.295 0.010 17.53  ? 1105 HOH A O    1  
HETATM 6846   O O    . HOH E 3 .   ? -30.103 19.596 -22.076 0.010 24.34  ? 1106 HOH A O    1  
HETATM 6847   O O    . HOH E 3 .   ? -13.278 20.649 -12.278 0.010 20.35  ? 1107 HOH A O    1  
HETATM 6848   O O    . HOH E 3 .   ? -20.612 23.270 -22.500 0.010 20.60  ? 1108 HOH A O    1  
HETATM 6849   O O    . HOH E 3 .   ? -18.788 22.492 -20.580 0.010 19.28  ? 1109 HOH A O    1  
HETATM 6850   O O    . HOH E 3 .   ? -5.293  25.033 -26.301 0.010 20.55  ? 1110 HOH A O    1  
HETATM 6851   O O    . HOH E 3 .   ? -20.130 20.007 -18.394 0.010 18.74  ? 1111 HOH A O    1  
HETATM 6852   O O    . HOH E 3 .   ? -24.572 6.217  -12.828 0.010 24.04  ? 1112 HOH A O    1  
HETATM 6853   O O    . HOH E 3 .   ? -0.591  9.365  -13.161 0.010 17.60  ? 1113 HOH A O    1  
HETATM 6854   O O    . HOH E 3 .   ? 0.155   13.563 -23.677 0.010 14.67  ? 1114 HOH A O    1  
HETATM 6855   O O    . HOH E 3 .   ? -26.695 25.957 -23.057 0.010 25.46  ? 1115 HOH A O    1  
HETATM 6856   O O    . HOH E 3 .   ? 5.772   8.964  -9.060  0.010 23.54  ? 1116 HOH A O    1  
HETATM 6857   O O    . HOH E 3 .   ? -30.775 17.745 -18.847 0.010 24.29  ? 1117 HOH A O    1  
HETATM 6858   O O    . HOH E 3 .   ? 13.260  14.780 -14.972 0.010 23.52  ? 1118 HOH A O    1  
HETATM 6859   O O    . HOH E 3 .   ? -11.478 12.216 -29.567 0.010 17.30  ? 1119 HOH A O    1  
HETATM 6860   O O    . HOH E 3 .   ? 4.579   16.227 -21.647 0.010 16.72  ? 1120 HOH A O    1  
HETATM 6861   O O    . HOH E 3 .   ? -24.670 21.503 -27.510 0.010 23.43  ? 1121 HOH A O    1  
HETATM 6862   O O    . HOH E 3 .   ? -12.862 31.094 -22.049 0.010 26.41  ? 1122 HOH A O    1  
HETATM 6863   O O    . HOH E 3 .   ? 4.209   7.682  -13.244 0.010 19.17  ? 1123 HOH A O    1  
HETATM 6864   O O    . HOH E 3 .   ? -29.979 15.289 -17.781 0.010 23.57  ? 1124 HOH A O    1  
HETATM 6865   O O    . HOH E 3 .   ? -2.789  6.205  -9.020  0.010 21.83  ? 1125 HOH A O    1  
HETATM 6866   O O    . HOH E 3 .   ? -4.569  -0.160 -27.528 0.010 21.27  ? 1126 HOH A O    1  
HETATM 6867   O O    . HOH E 3 .   ? 4.839   5.081  -13.664 0.010 19.55  ? 1127 HOH A O    1  
HETATM 6868   O O    . HOH E 3 .   ? 6.949   4.804  -15.652 0.010 19.68  ? 1128 HOH A O    1  
HETATM 6869   O O    . HOH E 3 .   ? -1.501  11.516 -31.696 0.010 25.09  ? 1129 HOH A O    1  
HETATM 6870   O O    . HOH E 3 .   ? -17.009 24.976 -21.731 0.010 20.54  ? 1130 HOH A O    1  
HETATM 6871   O O    . HOH E 3 .   ? 5.297   2.415  -15.932 0.010 19.76  ? 1131 HOH A O    1  
HETATM 6872   O O    . HOH E 3 .   ? -25.028 13.625 -31.459 0.010 25.59  ? 1132 HOH A O    1  
HETATM 6873   O O    . HOH E 3 .   ? -20.040 33.368 -21.449 0.010 30.46  ? 1133 HOH A O    1  
HETATM 6874   O O    . HOH E 3 .   ? -28.493 8.864  -18.628 0.010 23.77  ? 1134 HOH A O    1  
HETATM 6875   O O    . HOH E 3 .   ? -5.021  32.531 -17.845 0.010 30.22  ? 1135 HOH A O    1  
HETATM 6876   O O    . HOH E 3 .   ? -18.902 26.102 -19.861 0.010 22.18  ? 1136 HOH A O    1  
HETATM 6877   O O    . HOH E 3 .   ? 2.847   14.521 -22.980 0.010 15.55  ? 1137 HOH A O    1  
HETATM 6878   O O    . HOH E 3 .   ? -9.547  24.811 -3.093  0.010 34.75  ? 1138 HOH A O    1  
HETATM 6879   O O    . HOH E 3 .   ? -17.666 -1.319 -22.430 0.010 24.74  ? 1139 HOH A O    1  
HETATM 6880   O O    . HOH E 3 .   ? 2.828   15.866 -27.252 0.010 16.83  ? 1140 HOH A O    1  
HETATM 6881   O O    . HOH E 3 .   ? 8.679   26.276 -17.736 0.010 28.66  ? 1141 HOH A O    1  
HETATM 6882   O O    . HOH E 3 .   ? -0.253  19.562 -27.897 0.010 17.97  ? 1142 HOH A O    1  
HETATM 6883   O O    . HOH E 3 .   ? -19.335 19.888 -21.870 0.010 18.19  ? 1143 HOH A O    1  
HETATM 6884   O O    . HOH E 3 .   ? -23.389 30.963 -15.288 0.010 30.31  ? 1144 HOH A O    1  
HETATM 6885   O O    . HOH E 3 .   ? -2.732  25.764 -25.639 0.010 21.65  ? 1145 HOH A O    1  
HETATM 6886   O O    . HOH E 3 .   ? -7.733  3.091  -8.622  0.010 23.19  ? 1146 HOH A O    1  
HETATM 6887   O O    . HOH E 3 .   ? -18.332 32.875 -6.374  0.010 40.21  ? 1147 HOH A O    1  
HETATM 6888   O O    . HOH E 3 .   ? -9.955  -1.201 -13.432 0.010 22.88  ? 1148 HOH A O    1  
HETATM 6889   O O    . HOH E 3 .   ? -8.018  8.161  -30.290 0.010 18.07  ? 1149 HOH A O    1  
HETATM 6890   O O    . HOH E 3 .   ? 5.304   7.383  -22.318 0.010 16.43  ? 1150 HOH A O    1  
HETATM 6891   O O    . HOH E 3 .   ? -24.747 15.910 -24.138 0.010 20.49  ? 1151 HOH A O    1  
HETATM 6892   O O    . HOH E 3 .   ? -11.278 20.172 -14.002 0.010 18.73  ? 1152 HOH A O    1  
HETATM 6893   O O    . HOH E 3 .   ? 12.363  13.878 -19.045 0.010 20.63  ? 1153 HOH A O    1  
HETATM 6894   O O    . HOH E 3 .   ? -4.328  12.200 -13.646 0.010 16.35  ? 1154 HOH A O    1  
HETATM 6895   O O    . HOH E 3 .   ? 12.147  19.833 -26.365 0.010 23.30  ? 1155 HOH A O    1  
HETATM 6896   O O    . HOH E 3 .   ? -28.737 12.438 -8.684  0.010 27.36  ? 1156 HOH A O    1  
HETATM 6897   O O    . HOH E 3 .   ? -19.826 4.480  -27.896 0.010 23.12  ? 1157 HOH A O    1  
HETATM 6898   O O    . HOH E 3 .   ? -15.846 9.041  -1.469  0.010 31.42  ? 1158 HOH A O    1  
HETATM 6899   O O    . HOH E 3 .   ? -4.844  6.942  -8.578  0.010 21.70  ? 1159 HOH A O    1  
HETATM 6900   O O    . HOH E 3 .   ? -25.626 18.893 -26.798 0.010 22.69  ? 1160 HOH A O    1  
HETATM 6901   O O    . HOH E 3 .   ? -28.229 29.794 -16.543 0.010 30.69  ? 1161 HOH A O    1  
HETATM 6902   O O    . HOH E 3 .   ? -4.889  30.110 -0.920  0.010 46.78  ? 1162 HOH A O    1  
HETATM 6903   O O    . HOH E 3 .   ? -15.167 27.265 -21.719 0.010 22.28  ? 1163 HOH A O    1  
HETATM 6904   O O    . HOH E 3 .   ? -11.076 8.867  -28.455 0.010 17.21  ? 1164 HOH A O    1  
HETATM 6905   O O    . HOH E 3 .   ? -19.996 3.706  -6.917  0.010 27.67  ? 1165 HOH A O    1  
HETATM 6906   O O    . HOH E 3 .   ? -9.006  11.725 -30.472 0.010 17.41  ? 1166 HOH A O    1  
HETATM 6907   O O    . HOH E 3 .   ? 9.604   12.548 -4.924  0.010 33.40  ? 1167 HOH A O    1  
HETATM 6908   O O    . HOH E 3 .   ? -30.085 11.520 -11.560 0.010 26.74  ? 1168 HOH A O    1  
HETATM 6909   O O    . HOH E 3 .   ? 16.965  18.907 -12.237 0.010 31.82  ? 1169 HOH A O    1  
HETATM 6910   O O    . HOH E 3 .   ? 10.884  24.316 -25.826 0.010 26.03  ? 1170 HOH A O    1  
HETATM 6911   O O    . HOH E 3 .   ? -9.371  26.012 -9.575  0.010 27.36  ? 1171 HOH A O    1  
HETATM 6912   O O    . HOH E 3 .   ? 10.220  27.309 -19.885 0.010 29.90  ? 1172 HOH A O    1  
HETATM 6913   O O    . HOH E 3 .   ? -28.603 2.616  -20.936 0.010 28.04  ? 1173 HOH A O    1  
HETATM 6914   O O    . HOH E 3 .   ? -12.901 29.470 -7.057  0.010 34.08  ? 1174 HOH A O    1  
HETATM 6915   O O    . HOH E 3 .   ? -18.995 19.023 -1.865  0.010 32.74  ? 1175 HOH A O    1  
HETATM 6916   O O    . HOH E 3 .   ? 6.534   20.919 -3.614  0.010 36.78  ? 1176 HOH A O    1  
HETATM 6917   O O    . HOH E 3 .   ? -9.841  26.499 -6.663  0.010 31.38  ? 1177 HOH A O    1  
HETATM 6918   O O    . HOH E 3 .   ? -14.456 9.495  -3.091  0.010 28.59  ? 1178 HOH A O    1  
HETATM 6919   O O    . HOH E 3 .   ? 12.170  17.722 -21.599 0.010 21.62  ? 1179 HOH A O    1  
HETATM 6920   O O    . HOH E 3 .   ? -25.724 28.640 -20.785 0.010 27.35  ? 1180 HOH A O    1  
HETATM 6921   O O    . HOH E 3 .   ? 11.034  16.327 -23.345 0.010 19.88  ? 1181 HOH A O    1  
HETATM 6922   O O    . HOH E 3 .   ? 0.238   23.855 -12.589 0.010 24.63  ? 1182 HOH A O    1  
HETATM 6923   O O    . HOH E 3 .   ? -20.546 2.480  -12.066 0.010 24.57  ? 1183 HOH A O    1  
HETATM 6924   O O    . HOH E 3 .   ? -6.085  13.429 -8.920  0.010 20.81  ? 1184 HOH A O    1  
HETATM 6925   O O    . HOH E 3 .   ? -26.488 5.890  -27.029 0.010 26.31  ? 1185 HOH A O    1  
HETATM 6926   O O    . HOH E 3 .   ? -31.717 33.582 -10.363 0.010 41.03  ? 1186 HOH A O    1  
HETATM 6927   O O    . HOH E 3 .   ? -18.487 30.852 -10.162 0.010 32.69  ? 1187 HOH A O    1  
HETATM 6928   O O    . HOH E 3 .   ? -5.512  -4.063 -11.024 0.010 26.97  ? 1188 HOH A O    1  
HETATM 6929   O O    . HOH E 3 .   ? -27.416 11.249 -25.715 0.010 23.58  ? 1189 HOH A O    1  
HETATM 6930   O O    . HOH E 3 .   ? -7.290  29.875 -1.176  0.010 44.34  ? 1190 HOH A O    1  
HETATM 6931   O O    . HOH E 3 .   ? -28.920 11.360 -19.877 0.010 23.11  ? 1191 HOH A O    1  
HETATM 6932   O O    . HOH E 3 .   ? -4.590  27.088 -25.534 0.010 23.00  ? 1192 HOH A O    1  
HETATM 6933   O O    . HOH E 3 .   ? -9.896  4.401  -30.840 0.010 20.55  ? 1193 HOH A O    1  
HETATM 6934   O O    . HOH E 3 .   ? -22.151 4.781  -9.655  0.010 25.84  ? 1194 HOH A O    1  
HETATM 6935   O O    . HOH E 3 .   ? -11.747 34.202 -10.536 0.010 37.17  ? 1195 HOH A O    1  
HETATM 6936   O O    . HOH E 3 .   ? -5.588  23.068 -3.591  0.010 33.22  ? 1196 HOH A O    1  
HETATM 6937   O O    . HOH E 3 .   ? -13.884 39.716 -16.226 0.010 42.03  ? 1197 HOH A O    1  
HETATM 6938   O O    . HOH E 3 .   ? -9.238  25.311 -12.977 0.010 23.59  ? 1198 HOH A O    1  
HETATM 6939   O O    . HOH E 3 .   ? -31.675 22.286 -25.305 0.010 27.76  ? 1199 HOH A O    1  
HETATM 6940   O O    . HOH E 3 .   ? 10.307  18.248 -24.851 0.010 20.69  ? 1200 HOH A O    1  
HETATM 6941   O O    . HOH E 3 .   ? 7.025   19.650 -29.975 0.010 21.93  ? 1201 HOH A O    1  
HETATM 6942   O O    . HOH E 3 .   ? 4.065   30.617 -9.653  0.010 38.33  ? 1202 HOH A O    1  
HETATM 6943   O O    . HOH E 3 .   ? -7.916  28.281 -9.494  0.010 30.03  ? 1203 HOH A O    1  
HETATM 6944   O O    . HOH E 3 .   ? -15.849 -0.328 -25.023 0.010 23.43  ? 1204 HOH A O    1  
HETATM 6945   O O    . HOH E 3 .   ? -11.698 19.752 -6.938  0.010 25.10  ? 1205 HOH A O    1  
HETATM 6946   O O    . HOH E 3 .   ? -9.921  11.329 -33.296 0.010 23.53  ? 1206 HOH A O    1  
HETATM 6947   O O    . HOH E 3 .   ? 15.492  13.722 -5.811  0.010 35.31  ? 1207 HOH A O    1  
HETATM 6948   O O    . HOH E 3 .   ? -5.597  -1.020 -8.934  0.010 25.91  ? 1208 HOH A O    1  
HETATM 6949   O O    . HOH E 3 .   ? 4.459   4.840  -25.252 0.010 17.25  ? 1209 HOH A O    1  
HETATM 6950   O O    . HOH E 3 .   ? 2.290   1.828  -25.983 0.010 19.00  ? 1210 HOH A O    1  
HETATM 6951   O O    . HOH E 3 .   ? 9.054   12.873 -25.517 0.010 17.95  ? 1211 HOH A O    1  
HETATM 6952   O O    . HOH E 3 .   ? -26.088 16.781 -10.435 0.010 24.70  ? 1212 HOH A O    1  
HETATM 6953   O O    . HOH E 3 .   ? 4.564   22.518 -5.125  0.010 33.85  ? 1213 HOH A O    1  
HETATM 6954   O O    . HOH E 3 .   ? 13.373  9.577  -10.883 0.010 26.10  ? 1214 HOH A O    1  
HETATM 6955   O O    . HOH E 3 .   ? -6.843  -1.018 -28.991 0.010 23.17  ? 1215 HOH A O    1  
HETATM 6956   O O    . HOH E 3 .   ? -27.172 2.833  -24.309 0.010 27.88  ? 1216 HOH A O    1  
HETATM 6957   O O    . HOH E 3 .   ? -0.394  35.419 -0.683  0.010 57.54  ? 1217 HOH A O    1  
HETATM 6958   O O    . HOH E 3 .   ? -13.749 35.607 -17.273 0.010 34.65  ? 1218 HOH A O    1  
HETATM 6959   O O    . HOH E 3 .   ? 12.814  15.959 -28.731 0.010 22.22  ? 1219 HOH A O    1  
HETATM 6960   O O    . HOH E 3 .   ? -8.526  21.162 -5.141  0.010 28.48  ? 1220 HOH A O    1  
HETATM 6961   O O    . HOH E 3 .   ? 3.532   22.171 -7.019  0.010 31.07  ? 1221 HOH A O    1  
HETATM 6962   O O    . HOH E 3 .   ? -22.933 24.624 -8.169  0.010 30.99  ? 1222 HOH A O    1  
HETATM 6963   O O    . HOH E 3 .   ? 7.499   22.987 -5.133  0.010 36.63  ? 1223 HOH A O    1  
HETATM 6964   O O    . HOH E 3 .   ? -19.195 35.256 -21.662 0.010 56.42  ? 1224 HOH A O    1  
HETATM 6965   O O    . HOH E 3 .   ? -0.645  27.323 -6.260  0.010 35.87  ? 1225 HOH A O    1  
HETATM 6966   O O    . HOH E 3 .   ? 11.106  24.572 -18.703 0.010 27.91  ? 1226 HOH A O    1  
HETATM 6967   O O    . HOH E 3 .   ? -24.318 1.745  -24.476 0.010 27.06  ? 1227 HOH A O    1  
HETATM 6968   O O    . HOH E 3 .   ? -22.379 20.371 -7.627  0.010 27.00  ? 1228 HOH A O    1  
HETATM 6969   O O    . HOH E 3 .   ? -9.667  23.212 -10.470 0.010 23.33  ? 1229 HOH A O    1  
HETATM 6970   O O    . HOH E 3 .   ? -10.513 22.051 -6.521  0.010 27.55  ? 1230 HOH A O    1  
HETATM 6971   O O    . HOH E 3 .   ? -13.853 35.616 -14.097 0.010 35.70  ? 1231 HOH A O    1  
HETATM 6972   O O    . HOH E 3 .   ? -22.257 21.236 -33.662 0.010 26.92  ? 1232 HOH A O    1  
HETATM 6973   O O    . HOH E 3 .   ? -8.840  8.712  -3.063  0.010 28.14  ? 1233 HOH A O    1  
HETATM 6974   O O    . HOH E 3 .   ? 0.406   3.249  -8.730  0.010 23.68  ? 1234 HOH A O    1  
HETATM 6975   O O    . HOH E 3 .   ? 12.207  35.395 -5.936  0.010 57.69  ? 1235 HOH A O    1  
HETATM 6976   O O    . HOH E 3 .   ? -13.904 16.029 -5.286  0.010 25.78  ? 1236 HOH A O    1  
HETATM 6977   O O    . HOH E 3 .   ? -10.125 36.788 -19.435 0.010 34.99  ? 1237 HOH A O    1  
HETATM 6978   O O    . HOH E 3 .   ? 9.860   21.810 -0.743  0.010 44.82  ? 1238 HOH A O    1  
HETATM 6979   O O    . HOH E 3 .   ? -26.296 18.959 -7.223  0.010 28.52  ? 1239 HOH A O    1  
HETATM 6980   O O    . HOH E 3 .   ? -28.877 12.410 -22.092 0.010 23.24  ? 1240 HOH A O    1  
HETATM 6981   O O    . HOH E 3 .   ? -8.289  19.772 -3.598  0.010 29.45  ? 1241 HOH A O    1  
HETATM 6982   O O    . HOH E 3 .   ? -0.168  26.896 -26.960 0.010 23.80  ? 1242 HOH A O    1  
HETATM 6983   O O    . HOH E 3 .   ? 17.119  21.252 -12.113 0.010 34.03  ? 1243 HOH A O    1  
HETATM 6984   O O    . HOH E 3 .   ? 12.479  13.242 -21.692 0.010 19.80  ? 1244 HOH A O    1  
HETATM 6985   O O    . HOH E 3 .   ? -18.993 -3.639 -23.357 0.010 60.51  ? 1245 HOH A O    1  
HETATM 6986   O O    . HOH E 3 .   ? -12.453 33.561 -19.999 0.010 30.33  ? 1246 HOH A O    1  
HETATM 6987   O O    . HOH E 3 .   ? -3.185  29.641 -6.737  0.010 37.57  ? 1247 HOH A O    1  
HETATM 6988   O O    . HOH E 3 .   ? -14.775 17.035 -31.700 0.010 20.03  ? 1248 HOH A O    1  
HETATM 6989   O O    . HOH F 3 .   ? -26.350 17.841 -47.701 0.010 29.26  ? 1101 HOH B O    1  
HETATM 6990   O O    . HOH F 3 .   ? -22.395 9.851  -54.107 0.010 33.28  ? 1102 HOH B O    1  
HETATM 6991   O O    . HOH F 3 .   ? -33.838 19.868 -49.876 0.010 42.03  ? 1103 HOH B O    1  
HETATM 6992   O O    . HOH F 3 .   ? -1.621  19.987 -44.424 0.010 17.23  ? 1104 HOH B O    1  
HETATM 6993   O O    . HOH F 3 .   ? -9.665  21.053 -30.417 0.010 23.87  ? 1105 HOH B O    1  
HETATM 6994   O O    . HOH F 3 .   ? -6.711  27.498 -42.483 0.010 17.42  ? 1106 HOH B O    1  
HETATM 6995   O O    . HOH F 3 .   ? 3.992   11.936 -52.681 0.010 30.32  ? 1107 HOH B O    1  
HETATM 6996   O O    . HOH F 3 .   ? -22.755 14.897 -44.720 0.010 25.64  ? 1108 HOH B O    1  
HETATM 6997   O O    . HOH F 3 .   ? -25.561 16.301 -44.803 0.010 28.54  ? 1109 HOH B O    1  
HETATM 6998   O O    . HOH F 3 .   ? 0.107   33.725 -44.330 0.010 24.83  ? 1110 HOH B O    1  
HETATM 6999   O O    . HOH F 3 .   ? -19.521 10.807 -54.756 0.010 30.42  ? 1111 HOH B O    1  
HETATM 7000   O O    . HOH F 3 .   ? -23.156 20.602 -40.154 0.010 25.81  ? 1112 HOH B O    1  
HETATM 7001   O O    . HOH F 3 .   ? -6.532  20.876 -52.218 0.010 19.11  ? 1113 HOH B O    1  
HETATM 7002   O O    . HOH F 3 .   ? 3.536   5.896  -49.142 0.010 32.21  ? 1114 HOH B O    1  
HETATM 7003   O O    . HOH F 3 .   ? -2.242  23.372 -40.308 0.010 17.40  ? 1115 HOH B O    1  
HETATM 7004   O O    . HOH F 3 .   ? -7.006  26.914 -54.090 0.010 21.47  ? 1116 HOH B O    1  
HETATM 7005   O O    . HOH F 3 .   ? -3.449  22.559 -42.756 0.010 16.40  ? 1117 HOH B O    1  
HETATM 7006   O O    . HOH F 3 .   ? 0.609   21.089 -34.678 0.010 21.13  ? 1118 HOH B O    1  
HETATM 7007   O O    . HOH F 3 .   ? -5.139  25.219 -42.120 0.010 16.66  ? 1119 HOH B O    1  
HETATM 7008   O O    . HOH F 3 .   ? -9.158  20.588 -51.370 0.010 18.32  ? 1120 HOH B O    1  
HETATM 7009   O O    . HOH F 3 .   ? 1.599   15.734 -37.420 0.010 20.92  ? 1121 HOH B O    1  
HETATM 7010   O O    . HOH F 3 .   ? -21.872 3.326  -45.756 0.010 35.46  ? 1122 HOH B O    1  
HETATM 7011   O O    . HOH F 3 .   ? 4.645   20.137 -50.731 0.010 24.64  ? 1123 HOH B O    1  
HETATM 7012   O O    . HOH F 3 .   ? -25.186 11.019 -59.881 0.010 41.77  ? 1124 HOH B O    1  
HETATM 7013   O O    . HOH F 3 .   ? 7.967   31.749 -48.483 0.010 32.04  ? 1125 HOH B O    1  
HETATM 7014   O O    . HOH F 3 .   ? -2.881  26.041 -43.336 0.010 17.55  ? 1126 HOH B O    1  
HETATM 7015   O O    . HOH F 3 .   ? -29.933 12.338 -48.777 0.010 38.06  ? 1127 HOH B O    1  
HETATM 7016   O O    . HOH F 3 .   ? 0.645   35.393 -47.316 0.010 27.32  ? 1128 HOH B O    1  
HETATM 7017   O O    . HOH F 3 .   ? -4.702  -1.739 -42.505 0.010 36.71  ? 1129 HOH B O    1  
HETATM 7018   O O    . HOH F 3 .   ? -28.310 28.862 -51.787 0.010 34.68  ? 1130 HOH B O    1  
HETATM 7019   O O    . HOH F 3 .   ? 3.034   18.050 -37.238 0.010 21.53  ? 1131 HOH B O    1  
HETATM 7020   O O    . HOH F 3 .   ? -17.060 7.199  -58.758 0.010 37.60  ? 1132 HOH B O    1  
HETATM 7021   O O    . HOH F 3 .   ? -27.299 22.552 -41.486 0.010 30.88  ? 1133 HOH B O    1  
HETATM 7022   O O    . HOH F 3 .   ? -1.196  24.291 -55.540 0.010 24.79  ? 1134 HOH B O    1  
HETATM 7023   O O    . HOH F 3 .   ? -28.601 8.794  -39.733 0.010 39.55  ? 1135 HOH B O    1  
HETATM 7024   O O    . HOH F 3 .   ? 2.764   25.388 -55.800 0.010 28.38  ? 1136 HOH B O    1  
HETATM 7025   O O    . HOH F 3 .   ? -13.985 -2.147 -48.854 0.010 41.43  ? 1137 HOH B O    1  
HETATM 7026   O O    . HOH F 3 .   ? 3.841   27.944 -40.174 0.010 23.57  ? 1138 HOH B O    1  
HETATM 7027   O O    . HOH F 3 .   ? 8.962   6.826  -47.354 0.010 36.40  ? 1139 HOH B O    1  
HETATM 7028   O O    . HOH F 3 .   ? -25.134 6.740  -43.288 0.010 35.53  ? 1140 HOH B O    1  
HETATM 7029   O O    . HOH F 3 .   ? -2.776  18.801 -41.150 0.010 16.75  ? 1141 HOH B O    1  
HETATM 7030   O O    . HOH F 3 .   ? -34.010 16.569 -56.510 0.010 47.52  ? 1142 HOH B O    1  
HETATM 7031   O O    . HOH F 3 .   ? 6.055   28.732 -40.691 0.010 25.76  ? 1143 HOH B O    1  
HETATM 7032   O O    . HOH F 3 .   ? 2.696   20.792 -55.881 0.010 28.15  ? 1144 HOH B O    1  
HETATM 7033   O O    . HOH F 3 .   ? -11.272 1.371  -43.983 0.010 31.64  ? 1145 HOH B O    1  
HETATM 7034   O O    . HOH F 3 .   ? -22.531 13.320 -35.891 0.010 29.61  ? 1146 HOH B O    1  
HETATM 7035   O O    . HOH F 3 .   ? -12.852 24.070 -44.684 0.010 16.64  ? 1147 HOH B O    1  
HETATM 7036   O O    . HOH F 3 .   ? -24.495 9.277  -55.781 0.010 37.83  ? 1148 HOH B O    1  
HETATM 7037   O O    . HOH F 3 .   ? -10.117 -2.138 -43.778 0.010 37.83  ? 1149 HOH B O    1  
HETATM 7038   O O    . HOH F 3 .   ? -33.273 14.584 -46.689 0.010 43.01  ? 1150 HOH B O    1  
HETATM 7039   O O    . HOH F 3 .   ? -27.611 9.095  -47.589 0.010 36.82  ? 1151 HOH B O    1  
HETATM 7040   O O    . HOH F 3 .   ? -18.913 25.439 -61.772 0.010 32.95  ? 1152 HOH B O    1  
HETATM 7041   O O    . HOH F 3 .   ? -26.984 3.747  -48.407 0.010 42.95  ? 1153 HOH B O    1  
HETATM 7042   O O    . HOH F 3 .   ? 9.098   19.985 -41.603 0.010 26.29  ? 1154 HOH B O    1  
HETATM 7043   O O    . HOH F 3 .   ? 1.471   32.790 -47.366 0.010 25.10  ? 1155 HOH B O    1  
HETATM 7044   O O    . HOH F 3 .   ? -7.982  -3.639 -47.217 0.010 41.27  ? 1156 HOH B O    1  
HETATM 7045   O O    . HOH F 3 .   ? -9.480  -1.015 -42.285 0.010 34.47  ? 1157 HOH B O    1  
HETATM 7046   O O    . HOH F 3 .   ? -8.994  34.054 -66.939 0.010 43.93  ? 1158 HOH B O    1  
HETATM 7047   O O    . HOH F 3 .   ? 1.569   20.042 -64.789 0.010 41.96  ? 1159 HOH B O    1  
HETATM 7048   O O    . HOH F 3 .   ? 5.274   20.778 -55.587 0.010 30.37  ? 1160 HOH B O    1  
HETATM 7049   O O    . HOH F 3 .   ? -5.400  -0.825 -44.212 0.010 35.26  ? 1161 HOH B O    1  
HETATM 7050   O O    . HOH F 3 .   ? 9.373   22.234 -49.809 0.010 30.07  ? 1162 HOH B O    1  
HETATM 7051   O O    . HOH F 3 .   ? -14.646 38.382 -65.632 0.010 45.98  ? 1163 HOH B O    1  
HETATM 7052   O O    . HOH F 3 .   ? -15.702 33.412 -48.705 0.010 24.16  ? 1164 HOH B O    1  
HETATM 7053   O O    . HOH F 3 .   ? -29.629 30.453 -55.394 0.010 39.89  ? 1165 HOH B O    1  
HETATM 7054   O O    . HOH F 3 .   ? -14.560 7.813  -58.084 0.010 34.61  ? 1166 HOH B O    1  
HETATM 7055   O O    . HOH F 3 .   ? -24.789 22.319 -41.111 0.010 27.42  ? 1167 HOH B O    1  
HETATM 7056   O O    . HOH F 3 .   ? 0.811   26.946 -61.521 0.010 35.20  ? 1168 HOH B O    1  
HETATM 7057   O O    . HOH F 3 .   ? -6.387  23.605 -65.295 0.010 36.78  ? 1169 HOH B O    1  
HETATM 7058   O O    . HOH F 3 .   ? -35.191 19.460 -60.050 0.010 52.22  ? 1170 HOH B O    1  
HETATM 7059   O O    . HOH F 3 .   ? -2.026  33.330 -42.377 0.010 23.18  ? 1171 HOH B O    1  
HETATM 7060   O O    . HOH F 3 .   ? -8.804  31.472 -54.121 0.010 23.68  ? 1172 HOH B O    1  
HETATM 7061   O O    . HOH F 3 .   ? -5.936  36.230 -46.424 0.010 24.95  ? 1173 HOH B O    1  
HETATM 7062   O O    . HOH F 3 .   ? -16.786 10.906 -36.182 0.010 25.09  ? 1174 HOH B O    1  
HETATM 7063   O O    . HOH F 3 .   ? -7.023  32.790 -38.175 0.010 23.07  ? 1175 HOH B O    1  
HETATM 7064   O O    . HOH F 3 .   ? -3.169  9.706  -60.757 0.010 38.01  ? 1176 HOH B O    1  
HETATM 7065   O O    . HOH F 3 .   ? -15.680 13.163 -53.271 0.010 24.51  ? 1177 HOH B O    1  
HETATM 7066   O O    . HOH F 3 .   ? -11.165 5.603  -38.791 0.010 26.10  ? 1178 HOH B O    1  
HETATM 7067   O O    . HOH F 3 .   ? -30.179 29.293 -57.184 0.010 41.28  ? 1179 HOH B O    1  
HETATM 7068   O O    . HOH F 3 .   ? -5.839  0.320  -52.929 0.010 39.45  ? 1180 HOH B O    1  
HETATM 7069   O O    . HOH F 3 .   ? -21.987 2.942  -48.625 0.010 37.87  ? 1181 HOH B O    1  
HETATM 7070   O O    . HOH F 3 .   ? -13.168 12.804 -36.761 0.010 21.25  ? 1182 HOH B O    1  
HETATM 7071   O O    . HOH F 3 .   ? -26.576 29.088 -40.648 0.010 33.30  ? 1183 HOH B O    1  
HETATM 7072   O O    . HOH F 3 .   ? -34.105 23.700 -66.316 0.010 58.65  ? 1184 HOH B O    1  
HETATM 7073   O O    . HOH F 3 .   ? -13.847 34.862 -59.360 0.010 32.34  ? 1185 HOH B O    1  
HETATM 7074   O O    . HOH F 3 .   ? -34.988 19.528 -71.990 0.010 72.61  ? 1186 HOH B O    1  
HETATM 7075   O O    . HOH F 3 .   ? 6.960   7.796  -51.969 0.010 37.30  ? 1187 HOH B O    1  
HETATM 7076   O O    . HOH F 3 .   ? -7.504  33.980 -65.424 0.010 41.15  ? 1188 HOH B O    1  
HETATM 7077   O O    . HOH F 3 .   ? -17.685 34.050 -53.367 0.010 28.36  ? 1189 HOH B O    1  
HETATM 7078   O O    . HOH F 3 .   ? -7.207  34.240 -68.231 0.010 47.07  ? 1190 HOH B O    1  
HETATM 7079   O O    . HOH F 3 .   ? -30.449 28.274 -45.069 0.010 37.20  ? 1191 HOH B O    1  
HETATM 7080   O O    . HOH F 3 .   ? -18.182 22.866 -60.631 0.010 30.63  ? 1192 HOH B O    1  
HETATM 7081   O O    . HOH F 3 .   ? -24.215 28.220 -58.399 0.010 34.25  ? 1193 HOH B O    1  
HETATM 7082   O O    . HOH F 3 .   ? 8.062   15.504 -42.510 0.010 26.49  ? 1194 HOH B O    1  
HETATM 7083   O O    . HOH F 3 .   ? -0.754  -1.625 -48.909 0.010 41.27  ? 1195 HOH B O    1  
HETATM 7084   O O    . HOH F 3 .   ? -8.577  40.248 -48.998 0.010 30.80  ? 1196 HOH B O    1  
HETATM 7085   O O    . HOH F 3 .   ? -19.159 35.860 -53.155 0.010 75.40  ? 1197 HOH B O    1  
HETATM 7086   O O    . HOH F 3 .   ? -13.181 35.395 -50.821 0.010 26.18  ? 1198 HOH B O    1  
HETATM 7087   O O    . HOH F 3 .   ? -24.045 17.534 -64.605 0.010 42.64  ? 1199 HOH B O    1  
HETATM 7088   O O    . HOH F 3 .   ? -1.386  34.270 -50.632 0.010 26.07  ? 1200 HOH B O    1  
HETATM 7089   O O    . HOH F 3 .   ? -30.125 33.119 -56.253 0.010 87.98  ? 1201 HOH B O    1  
HETATM 7090   O O    . HOH F 3 .   ? 1.274   18.404 -34.829 0.010 21.63  ? 1202 HOH B O    1  
HETATM 7091   O O    . HOH F 3 .   ? -0.422  20.581 -57.854 0.010 28.02  ? 1203 HOH B O    1  
HETATM 7092   O O    . HOH F 3 .   ? 5.463   11.335 -37.425 0.010 26.06  ? 1204 HOH B O    1  
HETATM 7093   O O    . HOH F 3 .   ? -22.015 10.147 -62.744 0.010 44.12  ? 1205 HOH B O    1  
HETATM 7094   O O    . HOH F 3 .   ? -26.432 7.028  -59.848 0.010 47.82  ? 1206 HOH B O    1  
HETATM 7095   O O    . HOH F 3 .   ? 5.468   23.209 -54.023 0.010 29.19  ? 1207 HOH B O    1  
HETATM 7096   O O    . HOH F 3 .   ? -16.078 -6.468 -39.450 0.010 48.66  ? 1208 HOH B O    1  
HETATM 7097   O O    . HOH F 3 .   ? 4.189   25.813 -53.960 0.010 28.19  ? 1209 HOH B O    1  
HETATM 7098   O O    . HOH F 3 .   ? -0.674  2.400  -35.699 0.010 32.07  ? 1210 HOH B O    1  
HETATM 7099   O O    . HOH F 3 .   ? -19.094 25.076 -55.407 0.010 25.25  ? 1211 HOH B O    1  
HETATM 7100   O O    . HOH F 3 .   ? -8.580  17.710 -59.040 0.010 26.77  ? 1212 HOH B O    1  
HETATM 7101   O O    . HOH F 3 .   ? -7.875  -7.561 -37.944 0.010 48.60  ? 1213 HOH B O    1  
ATOM   7102   N N    . ILE A 1 1   ? -11.282 27.664 -7.991  0.010 32.02  ? 1    ILE A N    2  
ATOM   7103   C CA   . ILE A 1 1   ? -11.072 29.121 -8.152  0.010 33.23  ? 1    ILE A CA   2  
ATOM   7104   C C    . ILE A 1 1   ? -10.236 29.614 -6.981  0.010 35.68  ? 1    ILE A C    2  
ATOM   7105   O O    . ILE A 1 1   ? -10.249 28.996 -5.920  0.010 36.87  ? 1    ILE A O    2  
ATOM   7106   C CB   . ILE A 1 1   ? -12.410 29.902 -8.169  0.010 33.94  ? 1    ILE A CB   2  
ATOM   7107   C CG1  . ILE A 1 1   ? -12.408 30.988 -9.259  0.010 35.02  ? 1    ILE A CG1  2  
ATOM   7108   C CG2  . ILE A 1 1   ? -12.740 30.502 -6.766  0.010 35.89  ? 1    ILE A CG2  2  
ATOM   7109   C CD1  . ILE A 1 1   ? -12.196 32.454 -8.777  0.010 37.97  ? 1    ILE A CD1  2  
ATOM   7110   H H1   . ILE A 1 1   ? -11.287 27.460 -7.124  0.010 33.13  ? 1    ILE A H1   2  
ATOM   7111   H H2   . ILE A 1 1   ? -12.060 27.432 -8.353  0.010 31.35  ? 1    ILE A H2   2  
ATOM   7112   H H3   . ILE A 1 1   ? -10.621 27.226 -8.397  0.010 30.99  ? 1    ILE A H3   2  
ATOM   7113   H HA   . ILE A 1 1   ? -10.585 29.282 -8.976  0.010 32.25  ? 1    ILE A HA   2  
ATOM   7114   H HB   . ILE A 1 1   ? -13.108 29.274 -8.396  0.010 32.55  ? 1    ILE A HB   2  
ATOM   7115   H HG12 . ILE A 1 1   ? -11.712 30.789 -9.903  0.010 34.39  ? 1    ILE A HG12 2  
ATOM   7116   H HG13 . ILE A 1 1   ? -13.268 30.959 -9.701  0.010 34.61  ? 1    ILE A HG13 2  
ATOM   7117   H HG21 . ILE A 1 1   ? -12.088 31.172 -6.507  0.010 37.48  ? 1    ILE A HG21 2  
ATOM   7118   H HG22 . ILE A 1 1   ? -13.615 30.919 -6.807  0.010 36.24  ? 1    ILE A HG22 2  
ATOM   7119   H HG23 . ILE A 1 1   ? -12.759 29.786 -6.111  0.010 35.29  ? 1    ILE A HG23 2  
ATOM   7120   H HD11 . ILE A 1 1   ? -11.386 32.503 -8.246  0.010 38.62  ? 1    ILE A HD11 2  
ATOM   7121   H HD12 . ILE A 1 1   ? -12.115 33.032 -9.553  0.010 38.55  ? 1    ILE A HD12 2  
ATOM   7122   H HD13 . ILE A 1 1   ? -12.960 32.731 -8.246  0.010 38.73  ? 1    ILE A HD13 2  
ATOM   7123   N N    . LEU A 1 2   ? -9.575  30.751 -7.219  0.010 36.63  ? 2    LEU A N    2  
ATOM   7124   C CA   . LEU A 1 2   ? -8.489  31.376 -6.428  0.010 38.39  ? 2    LEU A CA   2  
ATOM   7125   C C    . LEU A 1 2   ? -7.098  31.108 -7.111  0.010 37.59  ? 2    LEU A C    2  
ATOM   7126   O O    . LEU A 1 2   ? -6.044  31.043 -6.441  0.010 39.07  ? 2    LEU A O    2  
ATOM   7127   C CB   . LEU A 1 2   ? -8.510  31.056 -4.904  0.010 39.00  ? 2    LEU A CB   2  
ATOM   7128   C CG   . LEU A 1 2   ? -9.294  31.952 -3.908  0.010 41.72  ? 2    LEU A CG   2  
ATOM   7129   C CD1  . LEU A 1 2   ? -9.332  31.312 -2.548  0.010 42.19  ? 2    LEU A CD1  2  
ATOM   7130   C CD2  . LEU A 1 2   ? -8.687  33.313 -3.796  0.010 44.48  ? 2    LEU A CD2  2  
ATOM   7131   H H    . LEU A 1 2   ? -9.753  31.224 -7.915  0.010 36.39  ? 2    LEU A H    2  
ATOM   7132   H HA   . LEU A 1 2   ? -8.625  32.333 -6.497  0.010 40.17  ? 2    LEU A HA   2  
ATOM   7133   H HB2  . LEU A 1 2   ? -8.798  30.149 -4.756  0.010 37.46  ? 2    LEU A HB2  2  
ATOM   7134   H HB3  . LEU A 1 2   ? -7.593  31.124 -4.599  0.010 39.32  ? 2    LEU A HB3  2  
ATOM   7135   H HG   . LEU A 1 2   ? -10.209 32.058 -4.212  0.010 41.63  ? 2    LEU A HG   2  
ATOM   7136   H HD11 . LEU A 1 2   ? -9.681  30.418 -2.657  0.010 41.14  ? 2    LEU A HD11 2  
ATOM   7137   H HD12 . LEU A 1 2   ? -8.435  31.269 -2.189  0.010 41.53  ? 2    LEU A HD12 2  
ATOM   7138   H HD13 . LEU A 1 2   ? -9.905  31.832 -1.966  0.010 44.34  ? 2    LEU A HD13 2  
ATOM   7139   H HD21 . LEU A 1 2   ? -8.655  33.720 -4.676  0.010 44.13  ? 2    LEU A HD21 2  
ATOM   7140   H HD22 . LEU A 1 2   ? -9.232  33.852 -3.201  0.010 46.12  ? 2    LEU A HD22 2  
ATOM   7141   H HD23 . LEU A 1 2   ? -7.790  33.230 -3.434  0.010 45.12  ? 2    LEU A HD23 2  
ATOM   7142   N N    . GLY A 1 3   ? -7.125  30.954 -8.448  0.010 35.45  ? 3    GLY A N    2  
ATOM   7143   C CA   . GLY A 1 3   ? -5.947  31.093 -9.300  0.010 35.15  ? 3    GLY A CA   2  
ATOM   7144   C C    . GLY A 1 3   ? -6.250  31.035 -10.799 0.010 33.01  ? 3    GLY A C    2  
ATOM   7145   O O    . GLY A 1 3   ? -5.963  30.003 -11.421 0.010 31.13  ? 3    GLY A O    2  
ATOM   7146   H H    . GLY A 1 3   ? -7.837  30.755 -8.891  0.010 34.26  ? 3    GLY A H    2  
ATOM   7147   H HA2  . GLY A 1 3   ? -5.506  31.935 -9.117  0.010 36.70  ? 3    GLY A HA2  2  
ATOM   7148   H HA3  . GLY A 1 3   ? -5.328  30.372 -9.098  0.010 35.02  ? 3    GLY A HA3  2  
ATOM   7149   N N    . GLY A 1 4   ? -6.783  32.120 -11.382 0.010 33.52  ? 4    GLY A N    2  
ATOM   7150   C CA   . GLY A 1 4   ? -7.284  32.115 -12.766 0.010 31.83  ? 4    GLY A CA   2  
ATOM   7151   C C    . GLY A 1 4   ? -8.533  32.983 -13.018 0.010 32.71  ? 4    GLY A C    2  
ATOM   7152   O O    . GLY A 1 4   ? -8.664  34.053 -12.410 0.010 34.77  ? 4    GLY A O    2  
ATOM   7153   H H    . GLY A 1 4   ? -6.862  32.882 -10.990 0.010 35.00  ? 4    GLY A H    2  
ATOM   7154   H HA2  . GLY A 1 4   ? -6.579  32.447 -13.344 0.010 31.64  ? 4    GLY A HA2  2  
ATOM   7155   H HA3  . GLY A 1 4   ? -7.486  31.205 -13.031 0.010 30.41  ? 4    GLY A HA3  2  
ATOM   7156   N N    . ARG A 1 5   ? -9.444  32.560 -13.908 0.010 31.38  ? 5    ARG A N    2  
ATOM   7157   C CA   . ARG A 1 5   ? -10.719 33.301 -14.071 0.010 32.24  ? 5    ARG A CA   2  
ATOM   7158   C C    . ARG A 1 5   ? -11.839 32.580 -14.841 0.010 30.62  ? 5    ARG A C    2  
ATOM   7159   O O    . ARG A 1 5   ? -11.671 31.437 -15.291 0.010 28.75  ? 5    ARG A O    2  
ATOM   7160   C CB   . ARG A 1 5   ? -10.460 34.685 -14.694 0.010 33.77  ? 5    ARG A CB   2  
ATOM   7161   C CG   . ARG A 1 5   ? -10.532 35.842 -13.688 0.010 36.46  ? 5    ARG A CG   2  
ATOM   7162   C CD   . ARG A 1 5   ? -9.303  36.771 -13.696 0.010 37.82  ? 5    ARG A CD   2  
ATOM   7163   N NE   . ARG A 1 5   ? -9.466  37.900 -14.614 0.010 40.22  ? 5    ARG A NE   2  
ATOM   7164   C CZ   . ARG A 1 5   ? -8.782  38.089 -15.745 0.010 40.49  ? 5    ARG A CZ   2  
ATOM   7165   N NH1  . ARG A 1 5   ? -7.831  37.249 -16.144 0.010 38.51  ? 5    ARG A NH1  2  
ATOM   7166   N NH2  . ARG A 1 5   ? -9.055  39.136 -16.496 0.010 42.99  ? 5    ARG A NH2  2  
ATOM   7167   H H    . ARG A 1 5   ? -9.359  31.879 -14.421 0.010 30.11  ? 5    ARG A H    2  
ATOM   7168   H HA   . ARG A 1 5   ? -11.073 33.455 -13.182 0.010 33.25  ? 5    ARG A HA   2  
ATOM   7169   H HB2  . ARG A 1 5   ? -9.573  34.683 -15.082 0.010 33.42  ? 5    ARG A HB2  2  
ATOM   7170   H HB3  . ARG A 1 5   ? -11.113 34.849 -15.389 0.010 33.50  ? 5    ARG A HB3  2  
ATOM   7171   H HG2  . ARG A 1 5   ? -11.299 36.393 -13.908 0.010 37.29  ? 5    ARG A HG2  2  
ATOM   7172   H HG3  . ARG A 1 5   ? -10.634 35.488 -12.789 0.010 36.74  ? 5    ARG A HG3  2  
ATOM   7173   H HD2  . ARG A 1 5   ? -9.179  37.129 -12.802 0.010 38.42  ? 5    ARG A HD2  2  
ATOM   7174   H HD3  . ARG A 1 5   ? -8.521  36.261 -13.953 0.010 36.67  ? 5    ARG A HD3  2  
ATOM   7175   H HE   . ARG A 1 5   ? -9.918  38.572 -14.321 0.010 41.68  ? 5    ARG A HE   2  
ATOM   7176   H HH11 . ARG A 1 5   ? -7.637  36.550 -15.684 0.010 36.99  ? 5    ARG A HH11 2  
ATOM   7177   H HH12 . ARG A 1 5   ? -7.412  37.404 -16.880 0.010 38.84  ? 5    ARG A HH12 2  
ATOM   7178   H HH21 . ARG A 1 5   ? -9.660  39.696 -16.251 0.010 44.41  ? 5    ARG A HH21 2  
ATOM   7179   H HH22 . ARG A 1 5   ? -8.610  39.269 -17.219 0.010 43.27  ? 5    ARG A HH22 2  
ATOM   7180   N N    . GLU A 1 6   ? -12.990 33.257 -14.965 0.010 31.55  ? 6    GLU A N    2  
ATOM   7181   C CA   . GLU A 1 6   ? -14.192 32.639 -15.549 0.010 30.31  ? 6    GLU A CA   2  
ATOM   7182   C C    . GLU A 1 6   ? -14.039 32.352 -17.036 0.010 29.17  ? 6    GLU A C    2  
ATOM   7183   O O    . GLU A 1 6   ? -13.774 33.231 -17.841 0.010 30.12  ? 6    GLU A O    2  
ATOM   7184   C CB   . GLU A 1 6   ? -15.469 33.472 -15.332 0.010 31.70  ? 6    GLU A CB   2  
ATOM   7185   C CG   . GLU A 1 6   ? -16.759 32.615 -15.542 0.010 30.41  ? 6    GLU A CG   2  
ATOM   7186   C CD   . GLU A 1 6   ? -18.045 33.416 -15.605 0.010 31.65  ? 6    GLU A CD   2  
ATOM   7187   O OE1  . GLU A 1 6   ? -18.004 34.661 -15.501 0.010 33.65  ? 6    GLU A OE1  2  
ATOM   7188   O OE2  . GLU A 1 6   ? -19.104 32.779 -15.773 0.010 30.76  ? 6    GLU A OE2  2  
ATOM   7189   H H    . GLU A 1 6   ? -13.101 34.072 -14.720 0.010 32.95  ? 6    GLU A H    2  
ATOM   7190   H HA   . GLU A 1 6   ? -14.330 31.788 -15.108 0.010 29.37  ? 6    GLU A HA   2  
ATOM   7191   H HB2  . GLU A 1 6   ? -15.476 33.822 -14.427 0.010 32.81  ? 6    GLU A HB2  2  
ATOM   7192   H HB3  . GLU A 1 6   ? -15.484 34.200 -15.972 0.010 32.40  ? 6    GLU A HB3  2  
ATOM   7193   H HG2  . GLU A 1 6   ? -16.683 32.127 -16.376 0.010 29.33  ? 6    GLU A HG2  2  
ATOM   7194   H HG3  . GLU A 1 6   ? -16.844 31.988 -14.806 0.010 29.94  ? 6    GLU A HG3  2  
ATOM   7195   N N    . ALA A 1 7   ? -14.218 31.083 -17.372 0.010 27.31  ? 7    ALA A N    2  
ATOM   7196   C CA   . ALA A 1 7   ? -14.219 30.613 -18.746 0.010 26.34  ? 7    ALA A CA   2  
ATOM   7197   C C    . ALA A 1 7   ? -15.415 31.152 -19.499 0.010 27.05  ? 7    ALA A C    2  
ATOM   7198   O O    . ALA A 1 7   ? -16.467 31.345 -18.904 0.010 27.59  ? 7    ALA A O    2  
ATOM   7199   C CB   . ALA A 1 7   ? -14.275 29.089 -18.759 0.010 24.46  ? 7    ALA A CB   2  
ATOM   7200   H H    . ALA A 1 7   ? -14.333 30.455 -16.798 0.010 26.70  ? 7    ALA A H    2  
ATOM   7201   H HA   . ALA A 1 7   ? -13.406 30.901 -19.191 0.010 26.59  ? 7    ALA A HA   2  
ATOM   7202   H HB1  . ALA A 1 7   ? -15.026 28.797 -18.222 0.010 24.29  ? 7    ALA A HB1  2  
ATOM   7203   H HB2  . ALA A 1 7   ? -14.393 28.791 -19.673 0.010 24.02  ? 7    ALA A HB2  2  
ATOM   7204   H HB3  . ALA A 1 7   ? -13.449 28.737 -18.393 0.010 24.04  ? 7    ALA A HB3  2  
ATOM   7205   N N    . GLU A 1 8   ? -15.255 31.353 -20.803 0.010 27.17  ? 8    GLU A N    2  
ATOM   7206   C CA   . GLU A 1 8   ? -16.382 31.611 -21.677 0.010 27.62  ? 8    GLU A CA   2  
ATOM   7207   C C    . GLU A 1 8   ? -17.348 30.443 -21.574 0.010 26.26  ? 8    GLU A C    2  
ATOM   7208   O O    . GLU A 1 8   ? -16.936 29.283 -21.639 0.010 24.81  ? 8    GLU A O    2  
ATOM   7209   C CB   . GLU A 1 8   ? -15.945 31.747 -23.130 0.010 27.85  ? 8    GLU A CB   2  
ATOM   7210   C CG   . GLU A 1 8   ? -17.143 31.911 -24.103 0.010 27.97  ? 8    GLU A CG   2  
ATOM   7211   C CD   . GLU A 1 8   ? -17.322 33.313 -24.593 0.010 29.72  ? 8    GLU A CD   2  
ATOM   7212   O OE1  . GLU A 1 8   ? -18.123 34.048 -23.966 0.010 30.98  ? 8    GLU A OE1  2  
ATOM   7213   O OE2  . GLU A 1 8   ? -16.684 33.662 -25.622 0.010 29.98  ? 8    GLU A OE2  2  
ATOM   7214   H H    . GLU A 1 8   ? -14.497 31.343 -21.207 0.010 27.09  ? 8    GLU A H    2  
ATOM   7215   H HA   . GLU A 1 8   ? -16.838 32.422 -21.406 0.010 28.77  ? 8    GLU A HA   2  
ATOM   7216   H HB2  . GLU A 1 8   ? -15.374 32.527 -23.219 0.010 29.01  ? 8    GLU A HB2  2  
ATOM   7217   H HB3  . GLU A 1 8   ? -15.454 30.955 -23.387 0.010 26.91  ? 8    GLU A HB3  2  
ATOM   7218   H HG2  . GLU A 1 8   ? -17.001 31.358 -24.884 0.010 27.01  ? 8    GLU A HG2  2  
ATOM   7219   H HG3  . GLU A 1 8   ? -17.971 31.653 -23.674 0.010 28.03  ? 8    GLU A HG3  2  
ATOM   7220   N N    . ALA A 1 9   ? -18.641 30.741 -21.445 0.010 26.88  ? 9    ALA A N    2  
ATOM   7221   C CA   . ALA A 1 9   ? -19.606 29.661 -21.260 0.010 25.87  ? 9    ALA A CA   2  
ATOM   7222   C C    . ALA A 1 9   ? -19.693 28.775 -22.507 0.010 24.96  ? 9    ALA A C    2  
ATOM   7223   O O    . ALA A 1 9   ? -19.860 29.239 -23.628 0.010 25.68  ? 9    ALA A O    2  
ATOM   7224   C CB   . ALA A 1 9   ? -20.975 30.172 -20.852 0.010 26.93  ? 9    ALA A CB   2  
ATOM   7225   H H    . ALA A 1 9   ? -18.974 31.530 -21.468 0.010 27.95  ? 9    ALA A H    2  
ATOM   7226   H HA   . ALA A 1 9   ? -19.286 29.104 -20.534 0.010 25.20  ? 9    ALA A HA   2  
ATOM   7227   H HB1  . ALA A 1 9   ? -21.228 30.906 -21.431 0.010 27.78  ? 9    ALA A HB1  2  
ATOM   7228   H HB2  . ALA A 1 9   ? -21.613 29.451 -20.946 0.010 26.32  ? 9    ALA A HB2  2  
ATOM   7229   H HB3  . ALA A 1 9   ? -20.945 30.462 -19.928 0.010 27.47  ? 9    ALA A HB3  2  
ATOM   7230   N N    . HIS A 1 10  ? -19.512 27.482 -22.272 0.010 23.56  ? 10   HIS A N    2  
ATOM   7231   C CA   . HIS A 1 10  ? -19.631 26.449 -23.294 0.010 22.78  ? 10   HIS A CA   2  
ATOM   7232   C C    . HIS A 1 10  ? -18.551 26.479 -24.374 0.010 22.77  ? 10   HIS A C    2  
ATOM   7233   O O    . HIS A 1 10  ? -18.685 25.785 -25.378 0.010 22.66  ? 10   HIS A O    2  
ATOM   7234   C CB   . HIS A 1 10  ? -21.008 26.467 -23.956 0.010 23.40  ? 10   HIS A CB   2  
ATOM   7235   C CG   . HIS A 1 10  ? -22.139 26.585 -22.988 0.010 23.68  ? 10   HIS A CG   2  
ATOM   7236   N ND1  . HIS A 1 10  ? -22.364 25.656 -21.994 0.010 22.81  ? 10   HIS A ND1  2  
ATOM   7237   C CD2  . HIS A 1 10  ? -23.122 27.510 -22.870 0.010 24.90  ? 10   HIS A CD2  2  
ATOM   7238   C CE1  . HIS A 1 10  ? -23.426 26.015 -21.296 0.010 23.47  ? 10   HIS A CE1  2  
ATOM   7239   N NE2  . HIS A 1 10  ? -23.906 27.132 -21.811 0.010 24.71  ? 10   HIS A NE2  2  
ATOM   7240   H H    . HIS A 1 10  ? -19.305 27.174 -21.499 0.010 23.15  ? 10   HIS A H    2  
ATOM   7241   H HA   . HIS A 1 10  ? -19.562 25.594 -22.845 0.010 21.93  ? 10   HIS A HA   2  
ATOM   7242   H HB2  . HIS A 1 10  ? -21.052 27.219 -24.565 0.010 24.28  ? 10   HIS A HB2  2  
ATOM   7243   H HB3  . HIS A 1 10  ? -21.128 25.639 -24.448 0.010 22.88  ? 10   HIS A HB3  2  
ATOM   7244   H HD1  . HIS A 1 10  ? -21.886 24.960 -21.843 0.010 22.04  ? 10   HIS A HD1  2  
ATOM   7245   H HD2  . HIS A 1 10  ? -23.238 28.262 -23.401 0.010 25.79  ? 10   HIS A HD2  2  
ATOM   7246   H HE1  . HIS A 1 10  ? -23.782 25.550 -20.574 0.010 23.20  ? 10   HIS A HE1  2  
ATOM   7247   H HE2  . HIS A 1 10  ? -24.598 27.552 -21.525 0.010 25.39  ? 10   HIS A HE2  2  
ATOM   7248   N N    . ALA A 1 11  ? -17.475 27.239 -24.142 0.010 23.02  ? 11   ALA A N    2  
ATOM   7249   C CA   . ALA A 1 11  ? -16.351 27.371 -25.096 0.010 23.08  ? 11   ALA A CA   2  
ATOM   7250   C C    . ALA A 1 11  ? -15.381 26.188 -25.059 0.010 21.72  ? 11   ALA A C    2  
ATOM   7251   O O    . ALA A 1 11  ? -14.485 26.090 -25.897 0.010 21.68  ? 11   ALA A O    2  
ATOM   7252   C CB   . ALA A 1 11  ? -15.583 28.652 -24.816 0.010 24.17  ? 11   ALA A CB   2  
ATOM   7253   H H    . ALA A 1 11  ? -17.365 27.694 -23.422 0.010 23.24  ? 11   ALA A H    2  
ATOM   7254   H HA   . ALA A 1 11  ? -16.706 27.422 -25.996 0.010 23.50  ? 11   ALA A HA   2  
ATOM   7255   H HB1  . ALA A 1 11  ? -15.399 28.703 -23.865 0.010 24.04  ? 11   ALA A HB1  2  
ATOM   7256   H HB2  . ALA A 1 11  ? -14.749 28.634 -25.310 0.010 24.07  ? 11   ALA A HB2  2  
ATOM   7257   H HB3  . ALA A 1 11  ? -16.109 29.412 -25.101 0.010 25.20  ? 11   ALA A HB3  2  
ATOM   7258   N N    . ARG A 1 12  ? -15.571 25.317 -24.083 0.010 20.79  ? 12   ARG A N    2  
ATOM   7259   C CA   . ARG A 1 12  ? -14.832 24.062 -23.990 0.010 19.58  ? 12   ARG A CA   2  
ATOM   7260   C C    . ARG A 1 12  ? -15.840 22.939 -23.838 0.010 18.98  ? 12   ARG A C    2  
ATOM   7261   O O    . ARG A 1 12  ? -16.084 22.484 -22.725 0.010 18.53  ? 12   ARG A O    2  
ATOM   7262   C CB   . ARG A 1 12  ? -13.897 24.099 -22.800 0.010 19.29  ? 12   ARG A CB   2  
ATOM   7263   C CG   . ARG A 1 12  ? -12.771 25.112 -22.964 0.010 19.99  ? 12   ARG A CG   2  
ATOM   7264   C CD   . ARG A 1 12  ? -12.148 25.449 -21.639 0.010 20.33  ? 12   ARG A CD   2  
ATOM   7265   N NE   . ARG A 1 12  ? -11.116 26.461 -21.777 0.010 21.13  ? 12   ARG A NE   2  
ATOM   7266   C CZ   . ARG A 1 12  ? -11.359 27.765 -21.847 0.010 22.45  ? 12   ARG A CZ   2  
ATOM   7267   N NH1  . ARG A 1 12  ? -12.604 28.232 -21.800 0.010 23.07  ? 12   ARG A NH1  2  
ATOM   7268   N NH2  . ARG A 1 12  ? -10.349 28.604 -21.979 0.010 23.28  ? 12   ARG A NH2  2  
ATOM   7269   H H    . ARG A 1 12  ? -16.128 25.429 -23.442 0.010 20.92  ? 12   ARG A H    2  
ATOM   7270   H HA   . ARG A 1 12  ? -14.305 23.906 -24.785 0.010 19.51  ? 12   ARG A HA   2  
ATOM   7271   H HB2  . ARG A 1 12  ? -14.404 24.339 -22.010 0.010 19.53  ? 12   ARG A HB2  2  
ATOM   7272   H HB3  . ARG A 1 12  ? -13.498 23.221 -22.687 0.010 18.55  ? 12   ARG A HB3  2  
ATOM   7273   H HG2  . ARG A 1 12  ? -12.093 24.764 -23.559 0.010 19.60  ? 12   ARG A HG2  2  
ATOM   7274   H HG3  . ARG A 1 12  ? -13.140 25.930 -23.327 0.010 20.77  ? 12   ARG A HG3  2  
ATOM   7275   H HD2  . ARG A 1 12  ? -12.824 25.776 -21.028 0.010 20.85  ? 12   ARG A HD2  2  
ATOM   7276   H HD3  . ARG A 1 12  ? -11.725 24.652 -21.283 0.010 19.65  ? 12   ARG A HD3  2  
ATOM   7277   H HE   . ARG A 1 12  ? -10.315 26.194 -21.933 0.010 20.75  ? 12   ARG A HE   2  
ATOM   7278   H HH11 . ARG A 1 12  ? -13.271 27.697 -21.715 0.010 22.61  ? 12   ARG A HH11 2  
ATOM   7279   H HH12 . ARG A 1 12  ? -12.740 29.079 -21.846 0.010 24.02  ? 12   ARG A HH12 2  
ATOM   7280   H HH21 . ARG A 1 12  ? -9.547  28.304 -22.013 0.010 22.93  ? 12   ARG A HH21 2  
ATOM   7281   H HH22 . ARG A 1 12  ? -10.493 29.448 -22.028 0.010 24.24  ? 12   ARG A HH22 2  
ATOM   7282   N N    . PRO A 1 13  ? -16.416 22.499 -24.964 0.010 19.20  ? 13   PRO A N    2  
ATOM   7283   C CA   . PRO A 1 13  ? -17.602 21.649 -24.882 0.010 19.02  ? 13   PRO A CA   2  
ATOM   7284   C C    . PRO A 1 13  ? -17.193 20.209 -24.566 0.010 18.03  ? 13   PRO A C    2  
ATOM   7285   O O    . PRO A 1 13  ? -18.065 19.365 -24.408 0.010 17.93  ? 13   PRO A O    2  
ATOM   7286   C CB   . PRO A 1 13  ? -18.221 21.782 -26.284 0.010 19.74  ? 13   PRO A CB   2  
ATOM   7287   C CG   . PRO A 1 13  ? -17.416 22.891 -27.003 0.010 19.96  ? 13   PRO A CG   2  
ATOM   7288   C CD   . PRO A 1 13  ? -16.067 22.744 -26.371 0.010 19.97  ? 13   PRO A CD   2  
ATOM   7289   H HA   . PRO A 1 13  ? -18.228 21.976 -24.218 0.010 19.32  ? 13   PRO A HA   2  
ATOM   7290   H HB2  . PRO A 1 13  ? -18.178 20.940 -26.763 0.010 19.51  ? 13   PRO A HB2  2  
ATOM   7291   H HB3  . PRO A 1 13  ? -19.121 22.085 -26.205 0.010 20.43  ? 13   PRO A HB3  2  
ATOM   7292   H HG2  . PRO A 1 13  ? -17.382 22.723 -27.956 0.010 19.43  ? 13   PRO A HG2  2  
ATOM   7293   H HG3  . PRO A 1 13  ? -17.797 23.763 -26.813 0.010 20.75  ? 13   PRO A HG3  2  
ATOM   7294   H HD2  . PRO A 1 13  ? -15.618 21.968 -26.745 0.010 19.85  ? 13   PRO A HD2  2  
ATOM   7295   H HD3  . PRO A 1 13  ? -15.546 23.551 -26.482 0.010 20.74  ? 13   PRO A HD3  2  
ATOM   7296   N N    . TYR A 1 14  ? -15.886 19.964 -24.475 0.010 17.45  ? 14   TYR A N    2  
ATOM   7297   C CA   . TYR A 1 14  ? -15.364 18.687 -24.039 0.010 16.66  ? 14   TYR A CA   2  
ATOM   7298   C C    . TYR A 1 14  ? -15.357 18.543 -22.535 0.010 16.36  ? 14   TYR A C    2  
ATOM   7299   O O    . TYR A 1 14  ? -15.004 17.501 -21.963 0.010 15.87  ? 14   TYR A O    2  
ATOM   7300   C CB   . TYR A 1 14  ? -13.911 18.561 -24.528 0.010 16.35  ? 14   TYR A CB   2  
ATOM   7301   C CG   . TYR A 1 14  ? -13.016 19.728 -24.160 0.010 16.53  ? 14   TYR A CG   2  
ATOM   7302   C CD1  . TYR A 1 14  ? -12.400 19.810 -22.923 0.010 16.25  ? 14   TYR A CD1  2  
ATOM   7303   C CD2  . TYR A 1 14  ? -12.770 20.734 -25.083 0.010 17.22  ? 14   TYR A CD2  2  
ATOM   7304   C CE1  . TYR A 1 14  ? -11.538 20.873 -22.614 0.010 16.64  ? 14   TYR A CE1  2  
ATOM   7305   C CE2  . TYR A 1 14  ? -11.940 21.793 -24.791 0.010 17.60  ? 14   TYR A CE2  2  
ATOM   7306   C CZ   . TYR A 1 14  ? -11.320 21.859 -23.552 0.010 17.31  ? 14   TYR A CZ   2  
ATOM   7307   O OH   . TYR A 1 14  ? -10.504 22.923 -23.282 0.010 17.91  ? 14   TYR A OH   2  
ATOM   7308   H H    . TYR A 1 14  ? -15.278 20.534 -24.671 0.010 17.60  ? 14   TYR A H    2  
ATOM   7309   H HA   . TYR A 1 14  ? -15.899 17.969 -24.406 0.010 16.66  ? 14   TYR A HA   2  
ATOM   7310   H HB2  . TYR A 1 14  ? -13.518 17.768 -24.141 0.010 15.89  ? 14   TYR A HB2  2  
ATOM   7311   H HB3  . TYR A 1 14  ? -13.912 18.487 -25.495 0.010 16.63  ? 14   TYR A HB3  2  
ATOM   7312   H HD1  . TYR A 1 14  ? -12.543 19.137 -22.295 0.010 15.91  ? 14   TYR A HD1  2  
ATOM   7313   H HD2  . TYR A 1 14  ? -13.172 20.687 -25.921 0.010 17.55  ? 14   TYR A HD2  2  
ATOM   7314   H HE1  . TYR A 1 14  ? -11.133 20.926 -21.781 0.010 16.59  ? 14   TYR A HE1  2  
ATOM   7315   H HE2  . TYR A 1 14  ? -11.792 22.453 -25.424 0.010 18.18  ? 14   TYR A HE2  2  
ATOM   7316   H HH   . TYR A 1 14  ? -10.379 22.996 -22.445 0.010 17.95  ? 14   TYR A HH   2  
ATOM   7317   N N    . MET A 1 15  ? -15.656 19.632 -21.867 0.010 16.82  ? 15   MET A N    2  
ATOM   7318   C CA   . MET A 1 15  ? -15.501 19.659 -20.439 0.010 16.80  ? 15   MET A CA   2  
ATOM   7319   C C    . MET A 1 15  ? -16.640 18.927 -19.701 0.010 16.83  ? 15   MET A C    2  
ATOM   7320   O O    . MET A 1 15  ? -17.835 19.143 -19.978 0.010 17.23  ? 15   MET A O    2  
ATOM   7321   C CB   . MET A 1 15  ? -15.410 21.100 -20.038 0.010 17.59  ? 15   MET A CB   2  
ATOM   7322   C CG   . MET A 1 15  ? -14.704 21.274 -18.847 0.010 17.88  ? 15   MET A CG   2  
ATOM   7323   S SD   . MET A 1 15  ? -12.918 20.847 -19.055 0.010 17.55  ? 15   MET A SD   2  
ATOM   7324   C CE   . MET A 1 15  ? -12.656 20.975 -17.322 0.010 18.10  ? 15   MET A CE   2  
ATOM   7325   H H    . MET A 1 15  ? -15.951 20.360 -22.207 0.010 17.25  ? 15   MET A H    2  
ATOM   7326   H HA   . MET A 1 15  ? -14.670 19.230 -20.197 0.010 16.44  ? 15   MET A HA   2  
ATOM   7327   H HB2  . MET A 1 15  ? -14.934 21.589 -20.722 0.010 17.69  ? 15   MET A HB2  2  
ATOM   7328   H HB3  . MET A 1 15  ? -16.300 21.463 -19.919 0.010 18.01  ? 15   MET A HB3  2  
ATOM   7329   H HG2  . MET A 1 15  ? -14.782 22.193 -18.550 0.010 18.57  ? 15   MET A HG2  2  
ATOM   7330   H HG3  . MET A 1 15  ? -15.105 20.680 -18.194 0.010 17.74  ? 15   MET A HG3  2  
ATOM   7331   H HE1  . MET A 1 15  ? -13.469 20.721 -16.867 0.010 17.73  ? 15   MET A HE1  2  
ATOM   7332   H HE2  . MET A 1 15  ? -11.942 20.401 -17.039 0.010 18.28  ? 15   MET A HE2  2  
ATOM   7333   H HE3  . MET A 1 15  ? -12.445 21.895 -17.120 0.010 18.75  ? 15   MET A HE3  2  
ATOM   7334   N N    . ALA A 1 16  ? -16.254 18.087 -18.752 0.010 16.58  ? 16   ALA A N    2  
ATOM   7335   C CA   . ALA A 1 16  ? -17.215 17.318 -17.958 0.010 16.82  ? 16   ALA A CA   2  
ATOM   7336   C C    . ALA A 1 16  ? -17.028 17.497 -16.457 0.010 17.32  ? 16   ALA A C    2  
ATOM   7337   O O    . ALA A 1 16  ? -15.903 17.638 -15.952 0.010 17.29  ? 16   ALA A O    2  
ATOM   7338   C CB   . ALA A 1 16  ? -17.120 15.867 -18.322 0.010 16.37  ? 16   ALA A CB   2  
ATOM   7339   H H    . ALA A 1 16  ? -15.439 17.938 -18.547 0.010 16.35  ? 16   ALA A H    2  
ATOM   7340   H HA   . ALA A 1 16  ? -18.119 17.603 -18.169 0.010 17.12  ? 16   ALA A HA   2  
ATOM   7341   H HB1  . ALA A 1 16  ? -16.214 15.560 -18.146 0.010 16.07  ? 16   ALA A HB1  2  
ATOM   7342   H HB2  . ALA A 1 16  ? -17.751 15.364 -17.785 0.010 16.64  ? 16   ALA A HB2  2  
ATOM   7343   H HB3  . ALA A 1 16  ? -17.328 15.763 -19.262 0.010 16.24  ? 16   ALA A HB3  2  
ATOM   7344   N N    . SER A 1 17  ? -18.140 17.495 -15.741 0.010 17.98  ? 17   SER A N    2  
ATOM   7345   C CA   . SER A 1 17  ? -18.131 17.461 -14.287 0.010 18.69  ? 17   SER A CA   2  
ATOM   7346   C C    . SER A 1 17  ? -18.458 16.049 -13.839 0.010 18.68  ? 17   SER A C    2  
ATOM   7347   O O    . SER A 1 17  ? -19.523 15.564 -14.106 0.010 18.84  ? 17   SER A O    2  
ATOM   7348   C CB   . SER A 1 17  ? -19.178 18.401 -13.696 0.010 19.71  ? 17   SER A CB   2  
ATOM   7349   O OG   . SER A 1 17  ? -19.319 18.159 -12.311 0.010 20.59  ? 17   SER A OG   2  
ATOM   7350   H H    . SER A 1 17  ? -18.923 17.501 -16.086 0.010 18.11  ? 17   SER A H    2  
ATOM   7351   H HA   . SER A 1 17  ? -17.267 17.714 -13.938 0.010 18.72  ? 17   SER A HA   2  
ATOM   7352   H HB2  . SER A 1 17  ? -18.905 19.321 -13.835 0.010 19.92  ? 17   SER A HB2  2  
ATOM   7353   H HB3  . SER A 1 17  ? -20.024 18.241 -14.132 0.010 19.70  ? 17   SER A HB3  2  
ATOM   7354   H HG   . SER A 1 17  ? -19.937 18.647 -12.002 0.010 21.25  ? 17   SER A HG   2  
ATOM   7355   N N    . VAL A 1 18  ? -17.508 15.398 -13.175 0.010 18.62  ? 18   VAL A N    2  
ATOM   7356   C CA   . VAL A 1 18  ? -17.752 14.057 -12.636 0.010 18.94  ? 18   VAL A CA   2  
ATOM   7357   C C    . VAL A 1 18  ? -18.338 14.209 -11.253 0.010 20.18  ? 18   VAL A C    2  
ATOM   7358   O O    . VAL A 1 18  ? -17.747 14.865 -10.413 0.010 20.77  ? 18   VAL A O    2  
ATOM   7359   C CB   . VAL A 1 18  ? -16.436 13.234 -12.591 0.010 18.64  ? 18   VAL A CB   2  
ATOM   7360   C CG1  . VAL A 1 18  ? -16.710 11.814 -12.163 0.010 19.37  ? 18   VAL A CG1  2  
ATOM   7361   C CG2  . VAL A 1 18  ? -15.796 13.268 -13.940 0.010 17.61  ? 18   VAL A CG2  2  
ATOM   7362   H H    . VAL A 1 18  ? -16.729 15.717 -13.011 0.010 18.51  ? 18   VAL A H    2  
ATOM   7363   H HA   . VAL A 1 18  ? -18.398 13.583 -13.184 0.010 18.76  ? 18   VAL A HA   2  
ATOM   7364   H HB   . VAL A 1 18  ? -15.830 13.633 -11.950 0.010 18.83  ? 18   VAL A HB   2  
ATOM   7365   H HG11 . VAL A 1 18  ? -17.478 11.483 -12.656 0.010 19.62  ? 18   VAL A HG11 2  
ATOM   7366   H HG12 . VAL A 1 18  ? -15.935 11.264 -12.354 0.010 19.03  ? 18   VAL A HG12 2  
ATOM   7367   H HG13 . VAL A 1 18  ? -16.895 11.806 -11.211 0.010 20.06  ? 18   VAL A HG13 2  
ATOM   7368   H HG21 . VAL A 1 18  ? -16.458 13.081 -14.622 0.010 17.55  ? 18   VAL A HG21 2  
ATOM   7369   H HG22 . VAL A 1 18  ? -15.419 14.149 -14.085 0.010 17.29  ? 18   VAL A HG22 2  
ATOM   7370   H HG23 . VAL A 1 18  ? -15.093 12.598 -13.969 0.010 17.45  ? 18   VAL A HG23 2  
ATOM   7371   N N    . GLN A 1 19  ? -19.503 13.608 -11.027 0.010 20.74  ? 19   GLN A N    2  
ATOM   7372   C CA   . GLN A 1 19  ? -20.286 13.869 -9.833  0.010 22.08  ? 19   GLN A CA   2  
ATOM   7373   C C    . GLN A 1 19  ? -20.527 12.603 -9.027  0.010 22.94  ? 19   GLN A C    2  
ATOM   7374   O O    . GLN A 1 19  ? -20.688 11.530 -9.591  0.010 22.56  ? 19   GLN A O    2  
ATOM   7375   C CB   . GLN A 1 19  ? -21.617 14.510 -10.208 0.010 22.33  ? 19   GLN A CB   2  
ATOM   7376   C CG   . GLN A 1 19  ? -21.476 15.672 -11.187 0.010 21.59  ? 19   GLN A CG   2  
ATOM   7377   C CD   . GLN A 1 19  ? -22.489 16.788 -10.933 0.010 22.46  ? 19   GLN A CD   2  
ATOM   7378   O OE1  . GLN A 1 19  ? -23.591 16.538 -10.454 0.010 23.39  ? 19   GLN A OE1  2  
ATOM   7379   N NE2  . GLN A 1 19  ? -22.109 18.014 -11.238 0.010 22.30  ? 19   GLN A NE2  2  
ATOM   7380   H H    . GLN A 1 19  ? -19.869 13.042 -11.556 0.010 20.46  ? 19   GLN A H    2  
ATOM   7381   H HA   . GLN A 1 19  ? -19.805 14.492 -9.274  0.010 22.47  ? 19   GLN A HA   2  
ATOM   7382   H HB2  . GLN A 1 19  ? -22.196 13.846 -10.609 0.010 22.24  ? 19   GLN A HB2  2  
ATOM   7383   H HB3  . GLN A 1 19  ? -22.029 14.846 -9.400  0.010 23.27  ? 19   GLN A HB3  2  
ATOM   7384   H HG2  . GLN A 1 19  ? -20.587 16.044 -11.099 0.010 21.33  ? 19   GLN A HG2  2  
ATOM   7385   H HG3  . GLN A 1 19  ? -21.610 15.345 -12.089 0.010 20.94  ? 19   GLN A HG3  2  
ATOM   7386   H HE21 . GLN A 1 19  ? -21.711 18.499 -10.653 0.010 22.83  ? 19   GLN A HE21 2  
ATOM   7387   H HE22 . GLN A 1 19  ? -22.260 18.325 -12.023 0.010 21.77  ? 19   GLN A HE22 2  
ATOM   7388   N N    . LEU A 1 20  ? -20.550 12.761 -7.710  0.010 24.30  ? 20   LEU A N    2  
ATOM   7389   C CA   . LEU A 1 20  ? -20.717 11.629 -6.805  0.010 25.54  ? 20   LEU A CA   2  
ATOM   7390   C C    . LEU A 1 20  ? -21.796 11.909 -5.799  0.010 26.90  ? 20   LEU A C    2  
ATOM   7391   O O    . LEU A 1 20  ? -21.744 12.910 -5.083  0.010 27.30  ? 20   LEU A O    2  
ATOM   7392   C CB   . LEU A 1 20  ? -19.421 11.322 -6.074  0.010 26.35  ? 20   LEU A CB   2  
ATOM   7393   C CG   . LEU A 1 20  ? -19.497 9.975  -5.336  0.010 27.16  ? 20   LEU A CG   2  
ATOM   7394   C CD1  . LEU A 1 20  ? -19.369 8.830  -6.320  0.010 25.89  ? 20   LEU A CD1  2  
ATOM   7395   C CD2  . LEU A 1 20  ? -18.467 9.856  -4.246  0.010 28.33  ? 20   LEU A CD2  2  
ATOM   7396   H H    . LEU A 1 20  ? -20.470 13.516 -7.315  0.010 24.66  ? 20   LEU A H    2  
ATOM   7397   H HA   . LEU A 1 20  ? -20.979 10.841 -7.302  0.010 25.15  ? 20   LEU A HA   2  
ATOM   7398   H HB2  . LEU A 1 20  ? -18.709 11.277 -6.727  0.010 25.54  ? 20   LEU A HB2  2  
ATOM   7399   H HB3  . LEU A 1 20  ? -19.248 12.018 -5.424  0.010 27.37  ? 20   LEU A HB3  2  
ATOM   7400   H HG   . LEU A 1 20  ? -20.368 9.901  -4.915  0.010 28.01  ? 20   LEU A HG   2  
ATOM   7401   H HD11 . LEU A 1 20  ? -20.028 8.933  -7.023  0.010 24.97  ? 20   LEU A HD11 2  
ATOM   7402   H HD12 . LEU A 1 20  ? -18.476 8.835  -6.699  0.010 25.51  ? 20   LEU A HD12 2  
ATOM   7403   H HD13 . LEU A 1 20  ? -19.522 7.999  -5.853  0.010 26.56  ? 20   LEU A HD13 2  
ATOM   7404   H HD21 . LEU A 1 20  ? -17.589 10.022 -4.622  0.010 27.58  ? 20   LEU A HD21 2  
ATOM   7405   H HD22 . LEU A 1 20  ? -18.665 10.503 -3.551  0.010 29.44  ? 20   LEU A HD22 2  
ATOM   7406   H HD23 . LEU A 1 20  ? -18.514 8.959  -3.882  0.010 28.82  ? 20   LEU A HD23 2  
ATOM   7407   N N    . ASN A 1 21  ? -22.764 10.996 -5.749  0.010 27.72  ? 21   ASN A N    2  
ATOM   7408   C CA   . ASN A 1 21  ? -23.967 11.158 -4.942  0.010 29.31  ? 21   ASN A CA   2  
ATOM   7409   C C    . ASN A 1 21  ? -24.599 12.490 -5.295  0.010 29.17  ? 21   ASN A C    2  
ATOM   7410   O O    . ASN A 1 21  ? -25.250 13.089 -4.470  0.010 30.40  ? 21   ASN A O    2  
ATOM   7411   C CB   . ASN A 1 21  ? -23.665 11.103 -3.427  0.010 31.14  ? 21   ASN A CB   2  
ATOM   7412   C CG   . ASN A 1 21  ? -23.597 9.675  -2.874  0.010 32.11  ? 21   ASN A CG   2  
ATOM   7413   O OD1  . ASN A 1 21  ? -24.449 9.260  -2.082  0.010 33.97  ? 21   ASN A OD1  2  
ATOM   7414   N ND2  . ASN A 1 21  ? -22.582 8.932  -3.280  0.010 31.04  ? 21   ASN A ND2  2  
ATOM   7415   H H    . ASN A 1 21  ? -22.747 10.258 -6.191  0.010 27.46  ? 21   ASN A H    2  
ATOM   7416   H HA   . ASN A 1 21  ? -24.595 10.450 -5.153  0.010 29.59  ? 21   ASN A HA   2  
ATOM   7417   H HB2  . ASN A 1 21  ? -22.812 11.533 -3.254  0.010 30.87  ? 21   ASN A HB2  2  
ATOM   7418   H HB3  . ASN A 1 21  ? -24.366 11.559 -2.937  0.010 32.16  ? 21   ASN A HB3  2  
ATOM   7419   H HD21 . ASN A 1 21  ? -22.369 8.911  -4.113  0.010 29.97  ? 21   ASN A HD21 2  
ATOM   7420   H HD22 . ASN A 1 21  ? -22.131 8.479  -2.706  0.010 31.49  ? 21   ASN A HD22 2  
ATOM   7421   N N    . GLY A 1 22  ? -24.362 12.984 -6.511  0.010 27.82  ? 22   GLY A N    2  
ATOM   7422   C CA   . GLY A 1 22  ? -25.018 14.196 -6.966  0.010 27.85  ? 22   GLY A CA   2  
ATOM   7423   C C    . GLY A 1 22  ? -24.440 15.498 -6.441  0.010 27.75  ? 22   GLY A C    2  
ATOM   7424   O O    . GLY A 1 22  ? -25.166 16.335 -5.868  0.010 28.45  ? 22   GLY A O    2  
ATOM   7425   H H    . GLY A 1 22  ? -23.824 12.638 -7.087  0.010 26.92  ? 22   GLY A H    2  
ATOM   7426   H HA2  . GLY A 1 22  ? -24.989 14.229 -7.933  0.010 26.99  ? 22   GLY A HA2  2  
ATOM   7427   H HA3  . GLY A 1 22  ? -25.947 14.160 -6.697  0.010 28.96  ? 22   GLY A HA3  2  
ATOM   7428   N N    . ALA A 1 23  ? -23.133 15.662 -6.608  0.010 27.03  ? 23   ALA A N    2  
ATOM   7429   C CA   . ALA A 1 23  ? -22.461 16.933 -6.382  0.010 27.22  ? 23   ALA A CA   2  
ATOM   7430   C C    . ALA A 1 23  ? -21.088 16.859 -7.064  0.010 25.65  ? 23   ALA A C    2  
ATOM   7431   O O    . ALA A 1 23  ? -20.672 15.795 -7.511  0.010 24.96  ? 23   ALA A O    2  
ATOM   7432   C CB   . ALA A 1 23  ? -22.316 17.198 -4.908  0.010 28.96  ? 23   ALA A CB   2  
ATOM   7433   H H    . ALA A 1 23  ? -22.602 15.032 -6.850  0.010 26.53  ? 23   ALA A H    2  
ATOM   7434   H HA   . ALA A 1 23  ? -22.977 17.650 -6.783  0.010 27.39  ? 23   ALA A HA   2  
ATOM   7435   H HB1  . ALA A 1 23  ? -21.834 16.463 -4.499  0.010 28.77  ? 23   ALA A HB1  2  
ATOM   7436   H HB2  . ALA A 1 23  ? -21.825 18.026 -4.788  0.010 29.34  ? 23   ALA A HB2  2  
ATOM   7437   H HB3  . ALA A 1 23  ? -23.198 17.276 -4.512  0.010 29.98  ? 23   ALA A HB3  2  
ATOM   7438   N N    . HIS A 1 24  ? -20.382 17.970 -7.130  0.010 25.24  ? 24   HIS A N    2  
ATOM   7439   C CA   . HIS A 1 24  ? -19.139 18.004 -7.881  0.010 24.00  ? 24   HIS A CA   2  
ATOM   7440   C C    . HIS A 1 24  ? -17.994 17.319 -7.141  0.010 24.46  ? 24   HIS A C    2  
ATOM   7441   O O    . HIS A 1 24  ? -17.724 17.643 -5.995  0.010 25.94  ? 24   HIS A O    2  
ATOM   7442   C CB   . HIS A 1 24  ? -18.703 19.434 -8.196  0.010 23.89  ? 24   HIS A CB   2  
ATOM   7443   C CG   . HIS A 1 24  ? -17.614 19.481 -9.221  0.010 22.99  ? 24   HIS A CG   2  
ATOM   7444   N ND1  . HIS A 1 24  ? -17.849 19.181 -10.538 0.010 21.57  ? 24   HIS A ND1  2  
ATOM   7445   C CD2  . HIS A 1 24  ? -16.287 19.717 -9.122  0.010 23.47  ? 24   HIS A CD2  2  
ATOM   7446   C CE1  . HIS A 1 24  ? -16.725 19.258 -11.220 0.010 21.16  ? 24   HIS A CE1  2  
ATOM   7447   N NE2  . HIS A 1 24  ? -15.758 19.587 -10.385 0.010 22.27  ? 24   HIS A NE2  2  
ATOM   7448   H H    . HIS A 1 24  ? -20.595 18.709 -6.748  0.010 25.73  ? 24   HIS A H    2  
ATOM   7449   H HA   . HIS A 1 24  ? -19.274 17.539 -8.721  0.010 23.06  ? 24   HIS A HA   2  
ATOM   7450   H HB2  . HIS A 1 24  ? -19.464 19.931 -8.533  0.010 23.46  ? 24   HIS A HB2  2  
ATOM   7451   H HB3  . HIS A 1 24  ? -18.371 19.847 -7.384  0.010 24.98  ? 24   HIS A HB3  2  
ATOM   7452   H HD1  . HIS A 1 24  ? -18.617 18.982 -10.863 0.010 21.12  ? 24   HIS A HD1  2  
ATOM   7453   H HD2  . HIS A 1 24  ? -15.823 19.945 -8.349  0.010 24.53  ? 24   HIS A HD2  2  
ATOM   7454   H HE1  . HIS A 1 24  ? -16.637 19.112 -12.134 0.010 20.34  ? 24   HIS A HE1  2  
ATOM   7455   H HE2  . HIS A 1 24  ? -14.935 19.701 -10.597 0.010 22.33  ? 24   HIS A HE2  2  
ATOM   7456   N N    . LEU A 1 25  ? -17.335 16.380 -7.810  0.010 23.35  ? 25   LEU A N    2  
ATOM   7457   C CA   . LEU A 1 25  ? -16.172 15.717 -7.248  0.010 23.76  ? 25   LEU A CA   2  
ATOM   7458   C C    . LEU A 1 25  ? -14.909 16.051 -8.035  0.010 22.67  ? 25   LEU A C    2  
ATOM   7459   O O    . LEU A 1 25  ? -13.927 16.485 -7.454  0.010 23.30  ? 25   LEU A O    2  
ATOM   7460   C CB   . LEU A 1 25  ? -16.368 14.204 -7.228  0.010 23.90  ? 25   LEU A CB   2  
ATOM   7461   C CG   . LEU A 1 25  ? -15.597 13.383 -6.166  0.010 24.87  ? 25   LEU A CG   2  
ATOM   7462   C CD1  . LEU A 1 25  ? -15.005 14.203 -5.035  0.010 26.66  ? 25   LEU A CD1  2  
ATOM   7463   C CD2  . LEU A 1 25  ? -16.511 12.352 -5.565  0.010 25.30  ? 25   LEU A CD2  2  
ATOM   7464   H H    . LEU A 1 25  ? -17.549 16.106 -8.595  0.010 22.46  ? 25   LEU A H    2  
ATOM   7465   H HA   . LEU A 1 25  ? -16.049 16.027 -6.342  0.010 24.87  ? 25   LEU A HA   2  
ATOM   7466   H HB2  . LEU A 1 25  ? -17.314 14.018 -7.120  0.010 24.53  ? 25   LEU A HB2  2  
ATOM   7467   H HB3  . LEU A 1 25  ? -16.084 13.866 -8.092  0.010 22.87  ? 25   LEU A HB3  2  
ATOM   7468   H HG   . LEU A 1 25  ? -14.872 12.908 -6.599  0.010 24.19  ? 25   LEU A HG   2  
ATOM   7469   H HD11 . LEU A 1 25  ? -15.712 14.705 -4.601  0.010 27.30  ? 25   LEU A HD11 2  
ATOM   7470   H HD12 . LEU A 1 25  ? -14.587 13.605 -4.394  0.010 27.46  ? 25   LEU A HD12 2  
ATOM   7471   H HD13 . LEU A 1 25  ? -14.340 14.808 -5.398  0.010 26.50  ? 25   LEU A HD13 2  
ATOM   7472   H HD21 . LEU A 1 25  ? -16.767 11.733 -6.262  0.010 24.35  ? 25   LEU A HD21 2  
ATOM   7473   H HD22 . LEU A 1 25  ? -16.030 11.884 -4.866  0.010 25.64  ? 25   LEU A HD22 2  
ATOM   7474   H HD23 . LEU A 1 25  ? -17.285 12.796 -5.187  0.010 26.32  ? 25   LEU A HD23 2  
ATOM   7475   N N    . CYS A 1 26  ? -14.949 15.852 -9.350  0.010 21.24  ? 26   CYS A N    2  
ATOM   7476   C CA   . CYS A 1 26  ? -13.768 15.979 -10.202 0.010 20.25  ? 26   CYS A CA   2  
ATOM   7477   C C    . CYS A 1 26  ? -14.090 16.520 -11.547 0.010 19.25  ? 26   CYS A C    2  
ATOM   7478   O O    . CYS A 1 26  ? -15.193 16.394 -12.026 0.010 19.02  ? 26   CYS A O    2  
ATOM   7479   C CB   . CYS A 1 26  ? -13.128 14.599 -10.427 0.010 19.70  ? 26   CYS A CB   2  
ATOM   7480   S SG   . CYS A 1 26  ? -11.985 14.209 -9.161  0.010 20.90  ? 26   CYS A SG   2  
ATOM   7481   H H    . CYS A 1 26  ? -15.657 15.633 -9.780  0.010 20.92  ? 26   CYS A H    2  
ATOM   7482   H HA   . CYS A 1 26  ? -13.118 16.565 -9.788  0.010 20.72  ? 26   CYS A HA   2  
ATOM   7483   H HB2  . CYS A 1 26  ? -13.817 13.920 -10.435 0.010 19.62  ? 26   CYS A HB2  2  
ATOM   7484   H HB3  . CYS A 1 26  ? -12.658 14.592 -11.273 0.010 18.93  ? 26   CYS A HB3  2  
ATOM   7485   N N    . GLY A 1 27  ? -13.089 17.104 -12.181 0.010 18.80  ? 27   GLY A N    2  
ATOM   7486   C CA   . GLY A 1 27  ? -13.165 17.393 -13.590 0.010 17.89  ? 27   GLY A CA   2  
ATOM   7487   C C    . GLY A 1 27  ? -13.028 16.115 -14.399 0.010 16.98  ? 27   GLY A C    2  
ATOM   7488   O O    . GLY A 1 27  ? -12.610 15.054 -13.880 0.010 16.99  ? 27   GLY A O    2  
ATOM   7489   H H    . GLY A 1 27  ? -12.355 17.350 -11.807 0.010 19.12  ? 27   GLY A H    2  
ATOM   7490   H HA2  . GLY A 1 27  ? -14.009 17.813 -13.798 0.010 18.03  ? 27   GLY A HA2  2  
ATOM   7491   H HA3  . GLY A 1 27  ? -12.456 17.996 -13.847 0.010 17.85  ? 27   GLY A HA3  2  
ATOM   7492   N N    . GLY A 1 28  ? -13.381 16.243 -15.675 0.010 16.40  ? 28   GLY A N    2  
ATOM   7493   C CA   . GLY A 1 28  ? -13.180 15.214 -16.683 0.010 15.69  ? 28   GLY A CA   2  
ATOM   7494   C C    . GLY A 1 28  ? -13.218 15.792 -18.096 0.010 15.37  ? 28   GLY A C    2  
ATOM   7495   O O    . GLY A 1 28  ? -13.551 16.972 -18.303 0.010 15.68  ? 28   GLY A O    2  
ATOM   7496   H H    . GLY A 1 28  ? -13.738 16.953 -15.994 0.010 16.52  ? 28   GLY A H    2  
ATOM   7497   H HA2  . GLY A 1 28  ? -12.326 14.784 -16.551 0.010 15.54  ? 28   GLY A HA2  2  
ATOM   7498   H HA3  . GLY A 1 28  ? -13.872 14.537 -16.601 0.010 15.73  ? 28   GLY A HA3  2  
ATOM   7499   N N    . VAL A 1 29  ? -12.920 14.952 -19.078 0.010 14.95  ? 29   VAL A N    2  
ATOM   7500   C CA   . VAL A 1 29  ? -12.912 15.385 -20.473 0.010 14.85  ? 29   VAL A CA   2  
ATOM   7501   C C    . VAL A 1 29  ? -13.540 14.323 -21.413 0.010 14.84  ? 29   VAL A C    2  
ATOM   7502   O O    . VAL A 1 29  ? -13.192 13.124 -21.358 0.010 14.71  ? 29   VAL A O    2  
ATOM   7503   C CB   . VAL A 1 29  ? -11.465 15.741 -20.916 0.010 14.62  ? 29   VAL A CB   2  
ATOM   7504   C CG1  . VAL A 1 29  ? -10.537 14.632 -20.570 0.010 14.30  ? 29   VAL A CG1  2  
ATOM   7505   C CG2  . VAL A 1 29  ? -11.418 16.054 -22.377 0.010 14.75  ? 29   VAL A CG2  2  
ATOM   7506   H H    . VAL A 1 29  ? -12.721 14.130 -18.962 0.010 14.84  ? 29   VAL A H    2  
ATOM   7507   H HA   . VAL A 1 29  ? -13.430 16.196 -20.563 0.010 15.11  ? 29   VAL A HA   2  
ATOM   7508   H HB   . VAL A 1 29  ? -11.166 16.525 -20.429 0.010 14.77  ? 29   VAL A HB   2  
ATOM   7509   H HG11 . VAL A 1 29  ? -10.835 13.806 -20.984 0.010 14.26  ? 29   VAL A HG11 2  
ATOM   7510   H HG12 . VAL A 1 29  ? -9.650  14.864 -20.894 0.010 14.22  ? 29   VAL A HG12 2  
ATOM   7511   H HG13 . VAL A 1 29  ? -10.513 14.537 -19.607 0.010 14.35  ? 29   VAL A HG13 2  
ATOM   7512   H HG21 . VAL A 1 29  ? -12.040 16.768 -22.574 0.010 15.05  ? 29   VAL A HG21 2  
ATOM   7513   H HG22 . VAL A 1 29  ? -10.522 16.336 -22.608 0.010 14.72  ? 29   VAL A HG22 2  
ATOM   7514   H HG23 . VAL A 1 29  ? -11.648 15.262 -22.883 0.010 14.71  ? 29   VAL A HG23 2  
ATOM   7515   N N    . LEU A 1 30  ? -14.484 14.766 -22.242 0.010 15.18  ? 30   LEU A N    2  
ATOM   7516   C CA   . LEU A 1 30  ? -15.149 13.892 -23.213 0.010 15.47  ? 30   LEU A CA   2  
ATOM   7517   C C    . LEU A 1 30  ? -14.117 13.548 -24.288 0.010 15.42  ? 30   LEU A C    2  
ATOM   7518   O O    . LEU A 1 30  ? -13.686 14.422 -25.039 0.010 15.56  ? 30   LEU A O    2  
ATOM   7519   C CB   . LEU A 1 30  ? -16.346 14.598 -23.868 0.010 16.05  ? 30   LEU A CB   2  
ATOM   7520   C CG   . LEU A 1 30  ? -17.647 13.879 -24.327 0.010 16.66  ? 30   LEU A CG   2  
ATOM   7521   C CD1  . LEU A 1 30  ? -17.818 13.878 -25.802 0.010 17.04  ? 30   LEU A CD1  2  
ATOM   7522   C CD2  . LEU A 1 30  ? -17.779 12.503 -23.745 0.010 16.66  ? 30   LEU A CD2  2  
ATOM   7523   H H    . LEU A 1 30  ? -14.759 15.576 -22.269 0.010 15.36  ? 30   LEU A H    2  
ATOM   7524   H HA   . LEU A 1 30  ? -15.447 13.087 -22.764 0.010 15.49  ? 30   LEU A HA   2  
ATOM   7525   H HB2  . LEU A 1 30  ? -16.632 15.279 -23.242 0.010 16.09  ? 30   LEU A HB2  2  
ATOM   7526   H HB3  . LEU A 1 30  ? -16.019 15.035 -24.662 0.010 16.17  ? 30   LEU A HB3  2  
ATOM   7527   H HG   . LEU A 1 30  ? -18.400 14.393 -23.986 0.010 17.02  ? 30   LEU A HG   2  
ATOM   7528   H HD11 . LEU A 1 30  ? -16.976 13.616 -26.210 0.010 16.71  ? 30   LEU A HD11 2  
ATOM   7529   H HD12 . LEU A 1 30  ? -18.511 13.246 -26.052 0.010 17.50  ? 30   LEU A HD12 2  
ATOM   7530   H HD13 . LEU A 1 30  ? -18.069 14.774 -26.079 0.010 17.33  ? 30   LEU A HD13 2  
ATOM   7531   H HD21 . LEU A 1 30  ? -16.958 12.019 -23.890 0.010 16.42  ? 30   LEU A HD21 2  
ATOM   7532   H HD22 . LEU A 1 30  ? -17.950 12.593 -22.796 0.010 16.52  ? 30   LEU A HD22 2  
ATOM   7533   H HD23 . LEU A 1 30  ? -18.516 12.041 -24.170 0.010 17.17  ? 30   LEU A HD23 2  
ATOM   7534   N N    . VAL A 1 31  ? -13.743 12.272 -24.364 0.010 15.39  ? 31   VAL A N    2  
ATOM   7535   C CA   . VAL A 1 31  ? -12.725 11.834 -25.308 0.010 15.48  ? 31   VAL A CA   2  
ATOM   7536   C C    . VAL A 1 31  ? -13.303 10.960 -26.432 0.010 16.27  ? 31   VAL A C    2  
ATOM   7537   O O    . VAL A 1 31  ? -12.703 10.789 -27.486 0.010 16.66  ? 31   VAL A O    2  
ATOM   7538   C CB   . VAL A 1 31  ? -11.562 11.119 -24.568 0.010 15.05  ? 31   VAL A CB   2  
ATOM   7539   C CG1  . VAL A 1 31  ? -10.868 12.072 -23.585 0.010 14.52  ? 31   VAL A CG1  2  
ATOM   7540   C CG2  . VAL A 1 31  ? -12.082 9.897  -23.830 0.010 15.22  ? 31   VAL A CG2  2  
ATOM   7541   H H    . VAL A 1 31  ? -14.069 11.648 -23.879 0.010 15.41  ? 31   VAL A H    2  
ATOM   7542   H HA   . VAL A 1 31  ? -12.349 12.610 -25.744 0.010 15.47  ? 31   VAL A HA   2  
ATOM   7543   H HB   . VAL A 1 31  ? -10.900 10.838 -25.217 0.010 15.17  ? 31   VAL A HB   2  
ATOM   7544   H HG11 . VAL A 1 31  ? -11.025 12.982 -23.879 0.010 14.56  ? 31   VAL A HG11 2  
ATOM   7545   H HG12 . VAL A 1 31  ? -11.239 11.945 -22.701 0.010 14.45  ? 31   VAL A HG12 2  
ATOM   7546   H HG13 . VAL A 1 31  ? -9.917  11.893 -23.567 0.010 14.37  ? 31   VAL A HG13 2  
ATOM   7547   H HG21 . VAL A 1 31  ? -12.890 10.128 -23.351 0.010 15.15  ? 31   VAL A HG21 2  
ATOM   7548   H HG22 . VAL A 1 31  ? -12.270 9.196  -24.473 0.010 15.69  ? 31   VAL A HG22 2  
ATOM   7549   H HG23 . VAL A 1 31  ? -11.407 9.592  -23.203 0.010 15.09  ? 31   VAL A HG23 2  
ATOM   7550   N N    . ALA A 1 32  ? -14.510 10.465 -26.222 0.010 16.69  ? 32   ALA A N    2  
ATOM   7551   C CA   . ALA A 1 32  ? -15.266 9.808  -27.273 0.010 17.70  ? 32   ALA A CA   2  
ATOM   7552   C C    . ALA A 1 32  ? -16.717 10.125 -26.958 0.010 18.13  ? 32   ALA A C    2  
ATOM   7553   O O    . ALA A 1 32  ? -16.978 10.783 -25.952 0.010 17.61  ? 32   ALA A O    2  
ATOM   7554   C CB   . ALA A 1 32  ? -15.017 8.305  -27.272 0.010 18.10  ? 32   ALA A CB   2  
ATOM   7555   H H    . ALA A 1 32  ? -14.918 10.488 -25.470 0.010 16.50  ? 32   ALA A H    2  
ATOM   7556   H HA   . ALA A 1 32  ? -15.040 10.175 -28.138 0.010 18.03  ? 32   ALA A HA   2  
ATOM   7557   H HB1  . ALA A 1 32  ? -14.060 8.149  -27.265 0.010 17.72  ? 32   ALA A HB1  2  
ATOM   7558   H HB2  . ALA A 1 32  ? -15.417 7.915  -26.482 0.010 18.04  ? 32   ALA A HB2  2  
ATOM   7559   H HB3  . ALA A 1 32  ? -15.411 7.915  -28.069 0.010 18.90  ? 32   ALA A HB3  2  
ATOM   7560   N N    . GLU A 1 33  ? -17.658 9.680  -27.786 0.010 19.23  ? 33   GLU A N    2  
ATOM   7561   C CA   . GLU A 1 33  ? -19.060 10.058 -27.573 0.010 19.79  ? 33   GLU A CA   2  
ATOM   7562   C C    . GLU A 1 33  ? -19.555 9.470  -26.256 0.010 19.49  ? 33   GLU A C    2  
ATOM   7563   O O    . GLU A 1 33  ? -20.223 10.175 -25.476 0.010 19.40  ? 33   GLU A O    2  
ATOM   7564   C CB   . GLU A 1 33  ? -19.971 9.672  -28.766 0.010 21.29  ? 33   GLU A CB   2  
ATOM   7565   C CG   . GLU A 1 33  ? -19.321 10.012 -30.092 0.010 21.82  ? 33   GLU A CG   2  
ATOM   7566   C CD   . GLU A 1 33  ? -20.184 9.746  -31.310 0.010 23.55  ? 33   GLU A CD   2  
ATOM   7567   O OE1  . GLU A 1 33  ? -21.380 10.120 -31.330 0.010 24.34  ? 33   GLU A OE1  2  
ATOM   7568   O OE2  . GLU A 1 33  ? -19.614 9.185  -32.273 0.010 24.29  ? 33   GLU A OE2  2  
ATOM   7569   H H    . GLU A 1 33  ? -17.515 9.166  -28.458 0.010 19.76  ? 33   GLU A H    2  
ATOM   7570   H HA   . GLU A 1 33  ? -19.102 11.023 -27.488 0.010 19.53  ? 33   GLU A HA   2  
ATOM   7571   H HB2  . GLU A 1 33  ? -20.153 8.718  -28.756 0.010 21.71  ? 33   GLU A HB2  2  
ATOM   7572   H HB3  . GLU A 1 33  ? -20.798 10.173 -28.707 0.010 21.68  ? 33   GLU A HB3  2  
ATOM   7573   H HG2  . GLU A 1 33  ? -19.093 10.955 -30.090 0.010 21.41  ? 33   GLU A HG2  2  
ATOM   7574   H HG3  . GLU A 1 33  ? -18.518 9.478  -30.186 0.010 21.58  ? 33   GLU A HG3  2  
ATOM   7575   N N    . GLN A 1 34  ? -19.197 8.218  -25.972 0.010 19.41  ? 34   GLN A N    2  
ATOM   7576   C CA   . GLN A 1 34  ? -19.731 7.554  -24.784 0.010 19.44  ? 34   GLN A CA   2  
ATOM   7577   C C    . GLN A 1 34  ? -18.686 7.448  -23.664 0.010 18.53  ? 34   GLN A C    2  
ATOM   7578   O O    . GLN A 1 34  ? -18.870 6.714  -22.721 0.010 18.77  ? 34   GLN A O    2  
ATOM   7579   C CB   . GLN A 1 34  ? -20.379 6.192  -25.156 0.010 20.65  ? 34   GLN A CB   2  
ATOM   7580   C CG   . GLN A 1 34  ? -21.606 5.706  -24.260 0.010 21.38  ? 34   GLN A CG   2  
ATOM   7581   C CD   . GLN A 1 34  ? -22.407 4.552  -24.891 0.010 22.53  ? 34   GLN A CD   2  
ATOM   7582   O OE1  . GLN A 1 34  ? -23.396 4.010  -24.310 0.010 22.75  ? 34   GLN A OE1  2  
ATOM   7583   N NE2  . GLN A 1 34  ? -21.996 4.176  -26.098 0.010 23.52  ? 34   GLN A NE2  2  
ATOM   7584   H H    . GLN A 1 34  ? -18.659 7.743  -26.438 0.010 19.44  ? 34   GLN A H    2  
ATOM   7585   H HA   . GLN A 1 34  ? -20.444 8.101  -24.426 0.010 19.48  ? 34   GLN A HA   2  
ATOM   7586   H HB2  . GLN A 1 34  ? -20.702 6.266  -26.069 0.010 21.26  ? 34   GLN A HB2  2  
ATOM   7587   H HB3  . GLN A 1 34  ? -19.690 5.510  -25.113 0.010 20.56  ? 34   GLN A HB3  2  
ATOM   7588   H HG2  . GLN A 1 34  ? -21.263 5.398  -23.408 0.010 20.82  ? 34   GLN A HG2  2  
ATOM   7589   H HG3  . GLN A 1 34  ? -22.201 6.451  -24.122 0.010 21.83  ? 34   GLN A HG3  2  
ATOM   7590   H HE21 . GLN A 1 34  ? -21.190 3.906  -26.210 0.010 24.35  ? 34   GLN A HE21 2  
ATOM   7591   H HE22 . GLN A 1 34  ? -22.532 4.213  -26.767 0.010 23.43  ? 34   GLN A HE22 2  
ATOM   7592   N N    . TRP A 1 35  ? -17.616 8.245  -23.741 0.010 17.66  ? 35   TRP A N    2  
ATOM   7593   C CA   . TRP A 1 35  ? -16.520 8.093  -22.783 0.010 17.02  ? 35   TRP A CA   2  
ATOM   7594   C C    . TRP A 1 35  ? -15.846 9.384  -22.265 0.010 16.19  ? 35   TRP A C    2  
ATOM   7595   O O    . TRP A 1 35  ? -15.470 10.245 -23.042 0.010 15.95  ? 35   TRP A O    2  
ATOM   7596   C CB   . TRP A 1 35  ? -15.427 7.276  -23.397 0.010 17.09  ? 35   TRP A CB   2  
ATOM   7597   C CG   . TRP A 1 35  ? -15.766 5.856  -23.670 0.010 18.03  ? 35   TRP A CG   2  
ATOM   7598   C CD1  . TRP A 1 35  ? -16.218 5.321  -24.844 0.010 18.98  ? 35   TRP A CD1  2  
ATOM   7599   C CD2  . TRP A 1 35  ? -15.599 4.770  -22.767 0.010 18.34  ? 35   TRP A CD2  2  
ATOM   7600   N NE1  . TRP A 1 35  ? -16.350 3.952  -24.716 0.010 19.88  ? 35   TRP A NE1  2  
ATOM   7601   C CE2  . TRP A 1 35  ? -15.979 3.592  -23.448 0.010 19.49  ? 35   TRP A CE2  2  
ATOM   7602   C CE3  . TRP A 1 35  ? -15.180 4.673  -21.445 0.010 17.97  ? 35   TRP A CE3  2  
ATOM   7603   C CZ2  . TRP A 1 35  ? -15.933 2.351  -22.851 0.010 20.24  ? 35   TRP A CZ2  2  
ATOM   7604   C CZ3  . TRP A 1 35  ? -15.165 3.435  -20.847 0.010 18.71  ? 35   TRP A CZ3  2  
ATOM   7605   C CH2  . TRP A 1 35  ? -15.543 2.289  -21.552 0.010 19.83  ? 35   TRP A CH2  2  
ATOM   7606   H H    . TRP A 1 35  ? -17.508 8.866  -24.321 0.010 17.54  ? 35   TRP A H    2  
ATOM   7607   H HA   . TRP A 1 35  ? -16.839 7.609  -22.009 0.010 17.23  ? 35   TRP A HA   2  
ATOM   7608   H HB2  . TRP A 1 35  ? -15.162 7.683  -24.233 0.010 17.08  ? 35   TRP A HB2  2  
ATOM   7609   H HB3  . TRP A 1 35  ? -14.675 7.284  -22.789 0.010 16.64  ? 35   TRP A HB3  2  
ATOM   7610   H HD1  . TRP A 1 35  ? -16.386 5.804  -25.619 0.010 19.13  ? 35   TRP A HD1  2  
ATOM   7611   H HE1  . TRP A 1 35  ? -16.618 3.417  -25.327 0.010 20.67  ? 35   TRP A HE1  2  
ATOM   7612   H HE3  . TRP A 1 35  ? -14.926 5.427  -20.968 0.010 17.37  ? 35   TRP A HE3  2  
ATOM   7613   H HZ2  . TRP A 1 35  ? -16.205 1.591  -23.307 0.010 21.14  ? 35   TRP A HZ2  2  
ATOM   7614   H HZ3  . TRP A 1 35  ? -14.880 3.359  -19.966 0.010 18.60  ? 35   TRP A HZ3  2  
ATOM   7615   H HH2  . TRP A 1 35  ? -15.514 1.467  -21.123 0.010 20.44  ? 35   TRP A HH2  2  
ATOM   7616   N N    . VAL A 1 36  ? -15.685 9.445  -20.957 0.010 16.00  ? 36   VAL A N    2  
ATOM   7617   C CA   . VAL A 1 36  ? -15.080 10.588 -20.272 0.010 15.51  ? 36   VAL A CA   2  
ATOM   7618   C C    . VAL A 1 36  ? -13.833 10.097 -19.530 0.010 15.27  ? 36   VAL A C    2  
ATOM   7619   O O    . VAL A 1 36  ? -13.880 9.115  -18.831 0.010 15.62  ? 36   VAL A O    2  
ATOM   7620   C CB   . VAL A 1 36  ? -16.067 11.216 -19.256 0.010 15.80  ? 36   VAL A CB   2  
ATOM   7621   C CG1  . VAL A 1 36  ? -15.375 12.225 -18.322 0.010 15.61  ? 36   VAL A CG1  2  
ATOM   7622   C CG2  . VAL A 1 36  ? -17.196 11.892 -20.000 0.010 16.07  ? 36   VAL A CG2  2  
ATOM   7623   H H    . VAL A 1 36  ? -15.928 8.823  -20.422 0.010 16.28  ? 36   VAL A H    2  
ATOM   7624   H HA   . VAL A 1 36  ? -14.824 11.267 -20.913 0.010 15.30  ? 36   VAL A HA   2  
ATOM   7625   H HB   . VAL A 1 36  ? -16.452 10.516 -18.708 0.010 16.14  ? 36   VAL A HB   2  
ATOM   7626   H HG11 . VAL A 1 36  ? -14.910 12.878 -18.865 0.010 15.32  ? 36   VAL A HG11 2  
ATOM   7627   H HG12 . VAL A 1 36  ? -16.054 12.660 -17.788 0.010 15.91  ? 36   VAL A HG12 2  
ATOM   7628   H HG13 . VAL A 1 36  ? -14.749 11.767 -17.742 0.010 15.61  ? 36   VAL A HG13 2  
ATOM   7629   H HG21 . VAL A 1 36  ? -17.528 11.291 -20.684 0.010 16.24  ? 36   VAL A HG21 2  
ATOM   7630   H HG22 . VAL A 1 36  ? -17.896 12.112 -19.367 0.010 16.39  ? 36   VAL A HG22 2  
ATOM   7631   H HG23 . VAL A 1 36  ? -16.862 12.703 -20.407 0.010 15.86  ? 36   VAL A HG23 2  
ATOM   7632   N N    . LEU A 1 37  ? -12.724 10.786 -19.737 0.010 14.83  ? 37   LEU A N    2  
ATOM   7633   C CA   . LEU A 1 37  ? -11.481 10.526 -19.014 0.010 14.69  ? 37   LEU A CA   2  
ATOM   7634   C C    . LEU A 1 37  ? -11.317 11.466 -17.816 0.010 14.81  ? 37   LEU A C    2  
ATOM   7635   O O    . LEU A 1 37  ? -11.578 12.674 -17.919 0.010 14.79  ? 37   LEU A O    2  
ATOM   7636   C CB   . LEU A 1 37  ? -10.323 10.686 -19.987 0.010 14.33  ? 37   LEU A CB   2  
ATOM   7637   C CG   . LEU A 1 37  ? -8.921  10.478 -19.401 0.010 14.25  ? 37   LEU A CG   2  
ATOM   7638   C CD1  . LEU A 1 37  ? -8.775  9.079  -18.745 0.010 14.57  ? 37   LEU A CD1  2  
ATOM   7639   C CD2  . LEU A 1 37  ? -7.895  10.725 -20.515 0.010 13.99  ? 37   LEU A CD2  2  
ATOM   7640   H H    . LEU A 1 37  ? -12.656 11.414 -20.315 0.010 14.70  ? 37   LEU A H    2  
ATOM   7641   H HA   . LEU A 1 37  ? -11.473 9.618  -18.683 0.010 14.90  ? 37   LEU A HA   2  
ATOM   7642   H HB2  . LEU A 1 37  ? -10.445 10.039 -20.698 0.010 14.39  ? 37   LEU A HB2  2  
ATOM   7643   H HB3  . LEU A 1 37  ? -10.360 11.572 -20.369 0.010 14.21  ? 37   LEU A HB3  2  
ATOM   7644   H HG   . LEU A 1 37  ? -8.772  11.140 -18.710 0.010 14.33  ? 37   LEU A HG   2  
ATOM   7645   H HD11 . LEU A 1 37  ? -9.215  8.428  -19.311 0.010 14.65  ? 37   LEU A HD11 2  
ATOM   7646   H HD12 . LEU A 1 37  ? -7.835  8.852  -18.667 0.010 14.56  ? 37   LEU A HD12 2  
ATOM   7647   H HD13 . LEU A 1 37  ? -9.183  9.087  -17.867 0.010 14.85  ? 37   LEU A HD13 2  
ATOM   7648   H HD21 . LEU A 1 37  ? -8.325  10.644 -21.379 0.010 14.02  ? 37   LEU A HD21 2  
ATOM   7649   H HD22 . LEU A 1 37  ? -7.521  11.611 -20.417 0.010 13.92  ? 37   LEU A HD22 2  
ATOM   7650   H HD23 . LEU A 1 37  ? -7.183  10.073 -20.438 0.010 14.00  ? 37   LEU A HD23 2  
ATOM   7651   N N    . SER A 1 38  ? -10.926 10.892 -16.681 0.010 15.17  ? 38   SER A N    2  
ATOM   7652   C CA   . SER A 1 38  ? -10.768 11.623 -15.426 0.010 15.62  ? 38   SER A CA   2  
ATOM   7653   C C    . SER A 1 38  ? -9.630  10.957 -14.672 0.010 15.94  ? 38   SER A C    2  
ATOM   7654   O O    . SER A 1 38  ? -8.836  10.228 -15.280 0.010 15.64  ? 38   SER A O    2  
ATOM   7655   C CB   . SER A 1 38  ? -12.097 11.637 -14.633 0.010 16.23  ? 38   SER A CB   2  
ATOM   7656   O OG   . SER A 1 38  ? -12.000 12.371 -13.439 0.010 16.90  ? 38   SER A OG   2  
ATOM   7657   H H    . SER A 1 38  ? -10.739 10.061 -16.609 0.010 15.29  ? 38   SER A H    2  
ATOM   7658   H HA   . SER A 1 38  ? -10.504 12.540 -15.595 0.010 15.49  ? 38   SER A HA   2  
ATOM   7659   H HB2  . SER A 1 38  ? -12.780 12.032 -15.190 0.010 16.05  ? 38   SER A HB2  2  
ATOM   7660   H HB3  . SER A 1 38  ? -12.344 10.728 -14.414 0.010 16.48  ? 38   SER A HB3  2  
ATOM   7661   H HG   . SER A 1 38  ? -11.730 13.157 -13.605 0.010 16.78  ? 38   SER A HG   2  
ATOM   7662   N N    . ALA A 1 39  ? -9.537  11.206 -13.382 0.010 16.70  ? 39   ALA A N    2  
ATOM   7663   C CA   . ALA A 1 39  ? -8.449  10.625 -12.599 0.010 17.26  ? 39   ALA A CA   2  
ATOM   7664   C C    . ALA A 1 39  ? -8.963  9.531  -11.686 0.010 18.11  ? 39   ALA A C    2  
ATOM   7665   O O    . ALA A 1 39  ? -10.025 9.645  -11.092 0.010 18.64  ? 39   ALA A O    2  
ATOM   7666   C CB   . ALA A 1 39  ? -7.746  11.679 -11.789 0.010 17.88  ? 39   ALA A CB   2  
ATOM   7667   H H    . ALA A 1 39  ? -10.077 11.695 -12.935 0.010 17.01  ? 39   ALA A H    2  
ATOM   7668   H HA   . ALA A 1 39  ? -7.791  10.230 -13.187 0.010 16.87  ? 39   ALA A HA   2  
ATOM   7669   H HB1  . ALA A 1 39  ? -8.397  12.160 -11.254 0.010 18.30  ? 39   ALA A HB1  2  
ATOM   7670   H HB2  . ALA A 1 39  ? -7.108  11.239 -11.206 0.010 18.43  ? 39   ALA A HB2  2  
ATOM   7671   H HB3  . ALA A 1 39  ? -7.289  12.288 -12.393 0.010 17.45  ? 39   ALA A HB3  2  
ATOM   7672   N N    . ALA A 1 40  ? -8.178  8.467  -11.569 0.010 18.39  ? 40   ALA A N    2  
ATOM   7673   C CA   . ALA A 1 40  ? -8.565  7.325  -10.734 0.010 19.41  ? 40   ALA A CA   2  
ATOM   7674   C C    . ALA A 1 40  ? -8.835  7.702  -9.265  0.010 20.73  ? 40   ALA A C    2  
ATOM   7675   O O    . ALA A 1 40  ? -9.736  7.157  -8.629  0.010 21.59  ? 40   ALA A O    2  
ATOM   7676   C CB   . ALA A 1 40  ? -7.485  6.243  -10.796 0.010 19.65  ? 40   ALA A CB   2  
ATOM   7677   H H    . ALA A 1 40  ? -7.424  8.380  -11.967 0.010 18.09  ? 40   ALA A H    2  
ATOM   7678   H HA   . ALA A 1 40  ? -9.382  6.947  -11.092 0.010 19.28  ? 40   ALA A HA   2  
ATOM   7679   H HB1  . ALA A 1 40  ? -7.308  6.023  -11.721 0.010 19.04  ? 40   ALA A HB1  2  
ATOM   7680   H HB2  . ALA A 1 40  ? -6.680  6.582  -10.385 0.010 19.68  ? 40   ALA A HB2  2  
ATOM   7681   H HB3  . ALA A 1 40  ? -7.796  5.459  -10.316 0.010 20.52  ? 40   ALA A HB3  2  
ATOM   7682   N N    . HIS A 1 41  ? -8.035  8.616  -8.737  0.010 21.07  ? 41   HIS A N    2  
ATOM   7683   C CA   . HIS A 1 41  ? -8.244  9.068  -7.379  0.010 22.58  ? 41   HIS A CA   2  
ATOM   7684   C C    . HIS A 1 41  ? -9.592  9.734  -7.240  0.010 22.92  ? 41   HIS A C    2  
ATOM   7685   O O    . HIS A 1 41  ? -10.073 9.792  -6.110  0.010 24.38  ? 41   HIS A O    2  
ATOM   7686   C CB   . HIS A 1 41  ? -7.241  10.125 -6.970  0.010 22.94  ? 41   HIS A CB   2  
ATOM   7687   C CG   . HIS A 1 41  ? -5.824  9.654  -6.955  0.010 23.39  ? 41   HIS A CG   2  
ATOM   7688   N ND1  . HIS A 1 41  ? -4.811  10.324 -7.607  0.010 22.61  ? 41   HIS A ND1  2  
ATOM   7689   C CD2  . HIS A 1 41  ? -5.238  8.616  -6.308  0.010 24.72  ? 41   HIS A CD2  2  
ATOM   7690   C CE1  . HIS A 1 41  ? -3.670  9.712  -7.394  0.010 23.37  ? 41   HIS A CE1  2  
ATOM   7691   N NE2  . HIS A 1 41  ? -3.895  8.679  -6.591  0.010 24.66  ? 41   HIS A NE2  2  
ATOM   7692   H H    . HIS A 1 41  ? -7.378  8.990  -9.141  0.010 20.56  ? 41   HIS A H    2  
ATOM   7693   H HA   . HIS A 1 41  ? -8.191  8.332  -6.752  0.010 23.40  ? 41   HIS A HA   2  
ATOM   7694   H HB2  . HIS A 1 41  ? -7.324  10.858 -7.584  0.010 22.05  ? 41   HIS A HB2  2  
ATOM   7695   H HB3  . HIS A 1 41  ? -7.475  10.439 -6.079  0.010 23.93  ? 41   HIS A HB3  2  
ATOM   7696   H HD1  . HIS A 1 41  ? -4.926  11.019 -8.094  0.010 21.84  ? 41   HIS A HD1  2  
ATOM   7697   H HD2  . HIS A 1 41  ? -5.640  7.970  -5.785  0.010 25.60  ? 41   HIS A HD2  2  
ATOM   7698   H HE1  . HIS A 1 41  ? -2.873  9.973  -7.742  0.010 23.13  ? 41   HIS A HE1  2  
ATOM   7699   H HE2  . HIS A 1 41  ? -3.317  8.110  -6.303  0.010 25.43  ? 41   HIS A HE2  2  
ATOM   7700   N N    . CYS A 1 42  ? -10.113 10.306 -8.344  0.010 21.73  ? 42   CYS A N    2  
ATOM   7701   C CA   . CYS A 1 42  ? -11.445 10.930 -8.384  0.010 21.97  ? 42   CYS A CA   2  
ATOM   7702   C C    . CYS A 1 42  ? -12.379 9.811  -8.005  0.010 22.66  ? 42   CYS A C    2  
ATOM   7703   O O    . CYS A 1 42  ? -12.266 9.239  -6.943  0.010 23.62  ? 42   CYS A O    2  
ATOM   7704   C CB   . CYS A 1 42  ? -11.874 11.492 -9.769  0.010 20.55  ? 42   CYS A CB   2  
ATOM   7705   S SG   . CYS A 1 42  ? -11.078 12.930 -10.526 0.010 19.87  ? 42   CYS A SG   2  
ATOM   7706   H H    . CYS A 1 42  ? -9.697  10.353 -9.094  0.010 20.85  ? 42   CYS A H    2  
ATOM   7707   H HA   . CYS A 1 42  ? -11.510 11.634 -7.721  0.010 22.65  ? 42   CYS A HA   2  
ATOM   7708   H HB2  . CYS A 1 42  ? -11.835 10.783 -10.421 0.010 19.96  ? 42   CYS A HB2  2  
ATOM   7709   H HB3  . CYS A 1 42  ? -12.804 11.756 -9.689  0.010 20.74  ? 42   CYS A HB3  2  
ATOM   7710   N N    . LEU A 1 43  ? -13.287 9.462  -8.904  0.010 22.17  ? 43   LEU A N    2  
ATOM   7711   C CA   . LEU A 1 43  ? -14.180 8.345  -8.651  0.010 22.51  ? 43   LEU A CA   2  
ATOM   7712   C C    . LEU A 1 43  ? -13.441 7.246  -7.883  0.010 23.62  ? 43   LEU A C    2  
ATOM   7713   O O    . LEU A 1 43  ? -12.932 6.268  -8.428  0.010 23.33  ? 43   LEU A O    2  
ATOM   7714   C CB   . LEU A 1 43  ? -14.652 7.830  -9.969  0.010 21.32  ? 43   LEU A CB   2  
ATOM   7715   C CG   . LEU A 1 43  ? -15.770 6.811  -10.037 0.010 21.86  ? 43   LEU A CG   2  
ATOM   7716   C CD1  . LEU A 1 43  ? -16.232 6.867  -11.457 0.010 20.84  ? 43   LEU A CD1  2  
ATOM   7717   C CD2  . LEU A 1 43  ? -15.311 5.405  -9.695  0.010 23.13  ? 43   LEU A CD2  2  
ATOM   7718   H H    . LEU A 1 43  ? -13.416 9.828  -9.668  0.010 21.76  ? 43   LEU A H    2  
ATOM   7719   H HA   . LEU A 1 43  ? -14.944 8.639  -8.128  0.010 23.03  ? 43   LEU A HA   2  
ATOM   7720   H HB2  . LEU A 1 43  ? -14.918 8.592  -10.506 0.010 20.62  ? 43   LEU A HB2  2  
ATOM   7721   H HB3  . LEU A 1 43  ? -13.890 7.405  -10.378 0.010 20.96  ? 43   LEU A HB3  2  
ATOM   7722   H HG   . LEU A 1 43  ? -16.494 7.070  -9.447  0.010 22.22  ? 43   LEU A HG   2  
ATOM   7723   H HD11 . LEU A 1 43  ? -15.465 6.660  -12.006 0.010 20.16  ? 43   LEU A HD11 2  
ATOM   7724   H HD12 . LEU A 1 43  ? -16.934 6.212  -11.600 0.010 21.34  ? 43   LEU A HD12 2  
ATOM   7725   H HD13 . LEU A 1 43  ? -16.558 7.758  -11.656 0.010 20.53  ? 43   LEU A HD13 2  
ATOM   7726   H HD21 . LEU A 1 43  ? -14.462 5.232  -10.131 0.010 22.90  ? 43   LEU A HD21 2  
ATOM   7727   H HD22 . LEU A 1 43  ? -15.214 5.324  -8.735  0.010 24.04  ? 43   LEU A HD22 2  
ATOM   7728   H HD23 . LEU A 1 43  ? -15.978 4.778  -10.013 0.010 23.40  ? 43   LEU A HD23 2  
ATOM   7729   N N    . GLU A 1 44  ? -13.365 7.515  -6.601  0.010 25.03  ? 44   GLU A N    2  
ATOM   7730   C CA   . GLU A 1 44  ? -12.666 6.733  -5.617  0.010 26.29  ? 44   GLU A CA   2  
ATOM   7731   C C    . GLU A 1 44  ? -12.741 7.655  -4.402  0.010 27.88  ? 44   GLU A C    2  
ATOM   7732   O O    . GLU A 1 44  ? -12.965 8.872  -4.499  0.010 27.65  ? 44   GLU A O    2  
ATOM   7733   C CB   . GLU A 1 44  ? -11.218 6.404  -6.009  0.010 25.37  ? 44   GLU A CB   2  
ATOM   7734   C CG   . GLU A 1 44  ? -10.650 5.169  -5.301  0.010 26.30  ? 44   GLU A CG   2  
ATOM   7735   C CD   . GLU A 1 44  ? -9.553  5.530  -4.315  0.010 27.64  ? 44   GLU A CD   2  
ATOM   7736   O OE1  . GLU A 1 44  ? -9.712  5.325  -3.084  0.010 29.47  ? 44   GLU A OE1  2  
ATOM   7737   O OE2  . GLU A 1 44  ? -8.533  6.040  -4.786  0.010 27.10  ? 44   GLU A OE2  2  
ATOM   7738   H H    . GLU A 1 44  ? -13.751 8.205  -6.256  0.010 25.37  ? 44   GLU A H    2  
ATOM   7739   H HA   . GLU A 1 44  ? -13.159 5.917  -5.440  0.010 26.88  ? 44   GLU A HA   2  
ATOM   7740   H HB2  . GLU A 1 44  ? -11.162 6.220  -6.951  0.010 24.16  ? 44   GLU A HB2  2  
ATOM   7741   H HB3  . GLU A 1 44  ? -10.655 7.161  -5.792  0.010 25.54  ? 44   GLU A HB3  2  
ATOM   7742   H HG2  . GLU A 1 44  ? -11.357 4.720  -4.809  0.010 27.12  ? 44   GLU A HG2  2  
ATOM   7743   H HG3  . GLU A 1 44  ? -10.276 4.570  -5.966  0.010 25.41  ? 44   GLU A HG3  2  
ATOM   7744   N N    . ASP A 1 45  ? -12.531 7.054  -3.254  0.010 29.70  ? 45   ASP A N    2  
ATOM   7745   C CA   . ASP A 1 45  ? -13.086 7.530  -2.011  0.010 31.67  ? 45   ASP A CA   2  
ATOM   7746   C C    . ASP A 1 45  ? -13.071 6.304  -1.131  0.010 33.21  ? 45   ASP A C    2  
ATOM   7747   O O    . ASP A 1 45  ? -13.008 6.406  0.088   0.010 34.71  ? 45   ASP A O    2  
ATOM   7748   C CB   . ASP A 1 45  ? -14.514 8.086  -2.183  0.010 32.02  ? 45   ASP A CB   2  
ATOM   7749   C CG   . ASP A 1 45  ? -15.435 7.171  -3.006  0.010 31.31  ? 45   ASP A CG   2  
ATOM   7750   O OD1  . ASP A 1 45  ? -16.429 7.686  -3.562  0.010 29.53  ? 45   ASP A OD1  2  
ATOM   7751   O OD2  . ASP A 1 45  ? -15.178 5.957  -3.096  0.010 32.74  ? 45   ASP A OD2  2  
ATOM   7752   H H    . ASP A 1 45  ? -12.019 6.370  -3.177  0.010 29.93  ? 45   ASP A H    2  
ATOM   7753   H HA   . ASP A 1 45  ? -12.516 8.211  -1.623  0.010 31.80  ? 45   ASP A HA   2  
ATOM   7754   H HB2  . ASP A 1 45  ? -14.913 8.186  -1.304  0.010 33.66  ? 45   ASP A HB2  2  
ATOM   7755   H HB3  . ASP A 1 45  ? -14.473 8.950  -2.619  0.010 31.22  ? 45   ASP A HB3  2  
ATOM   7756   N N    . ALA A 1 46  ? -13.138 5.164  -1.820  0.010 32.92  ? 46   ALA A N    2  
ATOM   7757   C CA   . ALA A 1 46  ? -12.912 3.789  -1.357  0.010 32.93  ? 46   ALA A CA   2  
ATOM   7758   C C    . ALA A 1 46  ? -14.157 3.125  -1.925  0.010 33.19  ? 46   ALA A C    2  
ATOM   7759   O O    . ALA A 1 46  ? -14.367 3.157  -3.138  0.010 31.68  ? 46   ALA A O    2  
ATOM   7760   C CB   . ALA A 1 46  ? -12.800 3.626  0.146   0.010 34.95  ? 46   ALA A CB   2  
ATOM   7761   H H    . ALA A 1 46  ? -13.364 5.152  -2.648  0.010 32.85  ? 46   ALA A H    2  
ATOM   7762   H HA   . ALA A 1 46  ? -12.122 3.420  -1.782  0.010 31.55  ? 46   ALA A HA   2  
ATOM   7763   H HB1  . ALA A 1 46  ? -12.120 4.236  0.488   0.010 34.66  ? 46   ALA A HB1  2  
ATOM   7764   H HB2  . ALA A 1 46  ? -13.661 3.796  0.558   0.010 36.46  ? 46   ALA A HB2  2  
ATOM   7765   H HB3  . ALA A 1 46  ? -12.529 2.717  0.326   0.010 35.06  ? 46   ALA A HB3  2  
ATOM   7766   N N    . ALA A 1 47  ? -15.026 2.587  -1.081  0.010 35.27  ? 47   ALA A N    2  
ATOM   7767   C CA   . ALA A 1 47  ? -16.298 2.095  -1.591  0.010 36.07  ? 47   ALA A CA   2  
ATOM   7768   C C    . ALA A 1 47  ? -17.307 3.246  -1.750  0.010 34.81  ? 47   ALA A C    2  
ATOM   7769   O O    . ALA A 1 47  ? -17.168 4.297  -1.117  0.010 34.78  ? 47   ALA A O    2  
ATOM   7770   C CB   . ALA A 1 47  ? -16.852 1.013  -0.664  0.010 38.90  ? 47   ALA A CB   2  
ATOM   7771   H H    . ALA A 1 47  ? -14.918 2.494  -0.234  0.010 36.39  ? 47   ALA A H    2  
ATOM   7772   H HA   . ALA A 1 47  ? -16.163 1.696  -2.465  0.010 35.87  ? 47   ALA A HA   2  
ATOM   7773   H HB1  . ALA A 1 47  ? -17.004 1.396  0.213   0.010 39.19  ? 47   ALA A HB1  2  
ATOM   7774   H HB2  . ALA A 1 47  ? -17.684 0.680  -1.034  0.010 39.66  ? 47   ALA A HB2  2  
ATOM   7775   H HB3  . ALA A 1 47  ? -16.215 0.291  -0.602  0.010 39.75  ? 47   ALA A HB3  2  
ATOM   7776   N N    . ASP A 1 48  ? -18.275 3.056  -2.643  0.010 33.92  ? 48   ASP A N    2  
ATOM   7777   C CA   . ASP A 1 48  ? -19.402 3.960  -2.808  0.010 33.37  ? 48   ASP A CA   2  
ATOM   7778   C C    . ASP A 1 48  ? -18.995 5.238  -3.560  0.010 31.41  ? 48   ASP A C    2  
ATOM   7779   O O    . ASP A 1 48  ? -17.838 5.616  -3.553  0.010 30.61  ? 48   ASP A O    2  
ATOM   7780   C CB   . ASP A 1 48  ? -20.047 4.349  -1.453  0.010 35.46  ? 48   ASP A CB   2  
ATOM   7781   C CG   . ASP A 1 48  ? -20.923 3.253  -0.863  0.010 37.77  ? 48   ASP A CG   2  
ATOM   7782   O OD1  . ASP A 1 48  ? -20.366 2.245  -0.370  0.010 38.99  ? 48   ASP A OD1  2  
ATOM   7783   O OD2  . ASP A 1 48  ? -22.173 3.418  -0.849  0.010 38.57  ? 48   ASP A OD2  2  
ATOM   7784   H H    . ASP A 1 48  ? -18.295 2.396  -3.191  0.010 33.71  ? 48   ASP A H    2  
ATOM   7785   H HA   . ASP A 1 48  ? -20.058 3.470  -3.325  0.010 33.03  ? 48   ASP A HA   2  
ATOM   7786   H HB2  . ASP A 1 48  ? -19.379 4.567  -0.792  0.010 35.87  ? 48   ASP A HB2  2  
ATOM   7787   H HB3  . ASP A 1 48  ? -20.611 5.125  -1.595  0.010 35.18  ? 48   ASP A HB3  2  
ATOM   7788   N N    . GLY A 1 49  ? -19.960 5.880  -4.217  0.010 30.69  ? 49   GLY A N    2  
ATOM   7789   C CA   . GLY A 1 49  ? -21.293 5.320  -4.347  0.010 31.29  ? 49   GLY A CA   2  
ATOM   7790   C C    . GLY A 1 49  ? -22.289 6.189  -5.072  0.010 29.84  ? 49   GLY A C    2  
ATOM   7791   O O    . GLY A 1 49  ? -23.062 6.854  -4.406  0.010 30.21  ? 49   GLY A O    2  
ATOM   7792   H H    . GLY A 1 49  ? -19.865 6.648  -4.584  0.010 29.91  ? 49   GLY A H    2  
ATOM   7793   H HA2  . GLY A 1 49  ? -21.237 4.480  -4.829  0.010 31.35  ? 49   GLY A HA2  2  
ATOM   7794   H HA3  . GLY A 1 49  ? -21.659 5.137  -3.469  0.010 32.64  ? 49   GLY A HA3  2  
ATOM   7795   N N    . LYS A 1 50  ? -22.287 6.135  -6.404  0.010 28.37  ? 50   LYS A N    2  
ATOM   7796   C CA   . LYS A 1 50  ? -23.271 6.844  -7.311  0.010 27.34  ? 50   LYS A CA   2  
ATOM   7797   C C    . LYS A 1 50  ? -22.687 7.947  -8.191  0.010 25.68  ? 50   LYS A C    2  
ATOM   7798   O O    . LYS A 1 50  ? -22.797 9.150  -7.900  0.010 25.64  ? 50   LYS A O    2  
ATOM   7799   C CB   . LYS A 1 50  ? -24.524 7.388  -6.633  0.010 28.39  ? 50   LYS A CB   2  
ATOM   7800   C CG   . LYS A 1 50  ? -25.473 6.303  -6.118  0.010 29.85  ? 50   LYS A CG   2  
ATOM   7801   C CD   . LYS A 1 50  ? -26.796 6.238  -6.929  0.010 29.32  ? 50   LYS A CD   2  
ATOM   7802   C CE   . LYS A 1 50  ? -27.764 5.230  -6.315  0.010 31.01  ? 50   LYS A CE   2  
ATOM   7803   N NZ   . LYS A 1 50  ? -28.681 5.815  -5.254  0.010 32.83  ? 50   LYS A NZ   2  
ATOM   7804   H H    . LYS A 1 50  ? -21.713 5.670  -6.842  0.010 28.02  ? 50   LYS A H    2  
ATOM   7805   H HA   . LYS A 1 50  ? -23.598 6.174  -7.934  0.010 27.18  ? 50   LYS A HA   2  
ATOM   7806   H HB2  . LYS A 1 50  ? -24.285 7.991  -5.918  0.010 28.93  ? 50   LYS A HB2  2  
ATOM   7807   H HB3  . LYS A 1 50  ? -25.020 7.880  -7.307  0.010 27.64  ? 50   LYS A HB3  2  
ATOM   7808   H HG2  . LYS A 1 50  ? -25.028 5.442  -6.203  0.010 30.26  ? 50   LYS A HG2  2  
ATOM   7809   H HG3  . LYS A 1 50  ? -25.693 6.476  -5.188  0.010 30.88  ? 50   LYS A HG3  2  
ATOM   7810   H HD2  . LYS A 1 50  ? -27.222 7.110  -6.932  0.010 28.56  ? 50   LYS A HD2  2  
ATOM   7811   H HD3  . LYS A 1 50  ? -26.605 5.955  -7.838  0.010 28.81  ? 50   LYS A HD3  2  
ATOM   7812   H HE2  . LYS A 1 50  ? -28.321 4.866  -7.021  0.010 30.85  ? 50   LYS A HE2  2  
ATOM   7813   H HE3  . LYS A 1 50  ? -27.245 4.519  -5.906  0.010 31.26  ? 50   LYS A HE3  2  
ATOM   7814   H HZ1  . LYS A 1 50  ? -28.588 6.698  -5.217  0.010 32.78  ? 50   LYS A HZ1  2  
ATOM   7815   H HZ2  . LYS A 1 50  ? -29.528 5.622  -5.447  0.010 33.83  ? 50   LYS A HZ2  2  
ATOM   7816   H HZ3  . LYS A 1 50  ? -28.486 5.473  -4.455  0.010 33.11  ? 50   LYS A HZ3  2  
ATOM   7817   N N    . VAL A 1 51  ? -22.200 7.512  -9.331  0.010 24.50  ? 51   VAL A N    2  
ATOM   7818   C CA   . VAL A 1 51  ? -21.353 8.344  -10.160 0.010 23.04  ? 51   VAL A CA   2  
ATOM   7819   C C    . VAL A 1 51  ? -22.092 8.730  -11.403 0.010 22.34  ? 51   VAL A C    2  
ATOM   7820   O O    . VAL A 1 51  ? -22.669 7.896  -12.081 0.010 22.57  ? 51   VAL A O    2  
ATOM   7821   C CB   . VAL A 1 51  ? -20.086 7.586  -10.550 0.010 22.26  ? 51   VAL A CB   2  
ATOM   7822   C CG1  . VAL A 1 51  ? -19.116 8.490  -11.272 0.010 21.54  ? 51   VAL A CG1  2  
ATOM   7823   C CG2  . VAL A 1 51  ? -19.427 7.021  -9.313  0.010 23.32  ? 51   VAL A CG2  2  
ATOM   7824   H H    . VAL A 1 51  ? -22.359 6.735  -9.657  0.010 24.63  ? 51   VAL A H    2  
ATOM   7825   H HA   . VAL A 1 51  ? -21.099 9.146  -9.685  0.010 23.12  ? 51   VAL A HA   2  
ATOM   7826   H HB   . VAL A 1 51  ? -20.316 6.848  -11.137 0.010 21.69  ? 51   VAL A HB   2  
ATOM   7827   H HG11 . VAL A 1 51  ? -19.549 9.320  -11.515 0.010 21.30  ? 51   VAL A HG11 2  
ATOM   7828   H HG12 . VAL A 1 51  ? -18.375 8.681  -10.679 0.010 22.19  ? 51   VAL A HG12 2  
ATOM   7829   H HG13 . VAL A 1 51  ? -18.799 8.029  -12.066 0.010 20.81  ? 51   VAL A HG13 2  
ATOM   7830   H HG21 . VAL A 1 51  ? -20.039 6.424  -8.861  0.010 23.81  ? 51   VAL A HG21 2  
ATOM   7831   H HG22 . VAL A 1 51  ? -18.631 6.531  -9.574  0.010 22.87  ? 51   VAL A HG22 2  
ATOM   7832   H HG23 . VAL A 1 51  ? -19.188 7.755  -8.728  0.010 24.07  ? 51   VAL A HG23 2  
ATOM   7833   N N    . GLN A 1 52  ? -22.043 10.016 -11.698 0.010 21.66  ? 52   GLN A N    2  
ATOM   7834   C CA   . GLN A 1 52  ? -22.662 10.537 -12.878 0.010 21.12  ? 52   GLN A CA   2  
ATOM   7835   C C    . GLN A 1 52  ? -21.754 11.567 -13.474 0.010 20.09  ? 52   GLN A C    2  
ATOM   7836   O O    . GLN A 1 52  ? -20.822 12.002 -12.855 0.010 19.97  ? 52   GLN A O    2  
ATOM   7837   C CB   . GLN A 1 52  ? -24.003 11.179 -12.536 0.010 21.94  ? 52   GLN A CB   2  
ATOM   7838   C CG   . GLN A 1 52  ? -25.052 10.201 -12.035 0.010 23.16  ? 52   GLN A CG   2  
ATOM   7839   C CD   . GLN A 1 52  ? -26.309 10.927 -11.561 0.010 24.09  ? 52   GLN A CD   2  
ATOM   7840   O OE1  . GLN A 1 52  ? -26.233 11.822 -10.721 0.010 24.42  ? 52   GLN A OE1  2  
ATOM   7841   N NE2  . GLN A 1 52  ? -27.456 10.571 -12.134 0.010 24.63  ? 52   GLN A NE2  2  
ATOM   7842   H H    . GLN A 1 52  ? -21.655 10.610 -11.216 0.010 21.61  ? 52   GLN A H    2  
ATOM   7843   H HA   . GLN A 1 52  ? -22.800 9.834  -13.532 0.010 21.02  ? 52   GLN A HA   2  
ATOM   7844   H HB2  . GLN A 1 52  ? -23.857 11.842 -11.846 0.010 22.16  ? 52   GLN A HB2  2  
ATOM   7845   H HB3  . GLN A 1 52  ? -24.353 11.606 -13.332 0.010 21.63  ? 52   GLN A HB3  2  
ATOM   7846   H HG2  . GLN A 1 52  ? -25.293 9.590  -12.749 0.010 23.09  ? 52   GLN A HG2  2  
ATOM   7847   H HG3  . GLN A 1 52  ? -24.688 9.709  -11.283 0.010 23.58  ? 52   GLN A HG3  2  
ATOM   7848   H HE21 . GLN A 1 52  ? -27.470 10.346 -12.964 0.010 24.26  ? 52   GLN A HE21 2  
ATOM   7849   H HE22 . GLN A 1 52  ? -28.180 10.575 -11.676 0.010 25.44  ? 52   GLN A HE22 2  
ATOM   7850   N N    . VAL A 1 53  ? -22.090 11.957 -14.685 0.010 19.56  ? 53   VAL A N    2  
ATOM   7851   C CA   . VAL A 1 53  ? -21.302 12.870 -15.461 0.010 18.75  ? 53   VAL A CA   2  
ATOM   7852   C C    . VAL A 1 53  ? -22.186 13.981 -16.034 0.010 18.93  ? 53   VAL A C    2  
ATOM   7853   O O    . VAL A 1 53  ? -23.153 13.738 -16.747 0.010 19.20  ? 53   VAL A O    2  
ATOM   7854   C CB   . VAL A 1 53  ? -20.623 12.124 -16.575 0.010 18.04  ? 53   VAL A CB   2  
ATOM   7855   C CG1  . VAL A 1 53  ? -19.507 11.236 -16.002 0.010 17.95  ? 53   VAL A CG1  2  
ATOM   7856   C CG2  . VAL A 1 53  ? -21.638 11.274 -17.265 0.010 18.36  ? 53   VAL A CG2  2  
ATOM   7857   H H    . VAL A 1 53  ? -22.805 11.699 -15.074 0.010 19.77  ? 53   VAL A H    2  
ATOM   7858   H HA   . VAL A 1 53  ? -20.626 13.281 -14.906 0.010 18.70  ? 53   VAL A HA   2  
ATOM   7859   H HB   . VAL A 1 53  ? -20.231 12.745 -17.211 0.010 17.60  ? 53   VAL A HB   2  
ATOM   7860   H HG11 . VAL A 1 53  ? -19.889 10.604 -15.377 0.010 18.43  ? 53   VAL A HG11 2  
ATOM   7861   H HG12 . VAL A 1 53  ? -19.085 10.767 -16.735 0.010 17.46  ? 53   VAL A HG12 2  
ATOM   7862   H HG13 . VAL A 1 53  ? -18.855 11.787 -15.547 0.010 18.03  ? 53   VAL A HG13 2  
ATOM   7863   H HG21 . VAL A 1 53  ? -22.519 11.453 -16.926 0.010 18.90  ? 53   VAL A HG21 2  
ATOM   7864   H HG22 . VAL A 1 53  ? -21.612 11.496 -18.207 0.010 18.10  ? 53   VAL A HG22 2  
ATOM   7865   H HG23 . VAL A 1 53  ? -21.430 10.337 -17.119 0.010 18.41  ? 53   VAL A HG23 2  
ATOM   7866   N N    . LEU A 1 54  ? -21.838 15.211 -15.691 0.010 18.97  ? 54   LEU A N    2  
ATOM   7867   C CA   . LEU A 1 54  ? -22.564 16.354 -16.191 0.010 19.30  ? 54   LEU A CA   2  
ATOM   7868   C C    . LEU A 1 54  ? -21.832 16.954 -17.392 0.010 18.70  ? 54   LEU A C    2  
ATOM   7869   O O    . LEU A 1 54  ? -20.710 17.442 -17.265 0.010 18.35  ? 54   LEU A O    2  
ATOM   7870   C CB   . LEU A 1 54  ? -22.746 17.388 -15.078 0.010 20.06  ? 54   LEU A CB   2  
ATOM   7871   C CG   . LEU A 1 54  ? -23.374 18.709 -15.540 0.010 20.54  ? 54   LEU A CG   2  
ATOM   7872   C CD1  . LEU A 1 54  ? -24.786 18.468 -16.017 0.010 21.00  ? 54   LEU A CD1  2  
ATOM   7873   C CD2  . LEU A 1 54  ? -23.351 19.726 -14.423 0.010 21.45  ? 54   LEU A CD2  2  
ATOM   7874   H H    . LEU A 1 54  ? -21.191 15.403 -15.165 0.010 18.92  ? 54   LEU A H    2  
ATOM   7875   H HA   . LEU A 1 54  ? -23.443 16.083 -16.485 0.010 19.62  ? 54   LEU A HA   2  
ATOM   7876   H HB2  . LEU A 1 54  ? -23.311 17.009 -14.391 0.010 20.58  ? 54   LEU A HB2  2  
ATOM   7877   H HB3  . LEU A 1 54  ? -21.882 17.593 -14.706 0.010 19.89  ? 54   LEU A HB3  2  
ATOM   7878   H HG   . LEU A 1 54  ? -22.865 19.060 -16.287 0.010 20.12  ? 54   LEU A HG   2  
ATOM   7879   H HD11 . LEU A 1 54  ? -24.790 17.753 -16.664 0.010 20.59  ? 54   LEU A HD11 2  
ATOM   7880   H HD12 . LEU A 1 54  ? -25.333 18.231 -15.254 0.010 21.55  ? 54   LEU A HD12 2  
ATOM   7881   H HD13 . LEU A 1 54  ? -25.119 19.273 -16.436 0.010 21.29  ? 54   LEU A HD13 2  
ATOM   7882   H HD21 . LEU A 1 54  ? -22.500 19.678 -13.966 0.010 21.28  ? 54   LEU A HD21 2  
ATOM   7883   H HD22 . LEU A 1 54  ? -23.473 20.608 -14.803 0.010 21.73  ? 54   LEU A HD22 2  
ATOM   7884   H HD23 . LEU A 1 54  ? -24.065 19.524 -13.804 0.010 22.03  ? 54   LEU A HD23 2  
ATOM   7885   N N    . LEU A 1 55  ? -22.489 16.923 -18.543 0.010 18.76  ? 55   LEU A N    2  
ATOM   7886   C CA   . LEU A 1 55  ? -21.976 17.510 -19.767 0.010 18.50  ? 55   LEU A CA   2  
ATOM   7887   C C    . LEU A 1 55  ? -22.715 18.774 -20.177 0.010 19.22  ? 55   LEU A C    2  
ATOM   7888   O O    . LEU A 1 55  ? -23.851 18.979 -19.806 0.010 19.90  ? 55   LEU A O    2  
ATOM   7889   C CB   . LEU A 1 55  ? -22.079 16.501 -20.910 0.010 18.33  ? 55   LEU A CB   2  
ATOM   7890   C CG   . LEU A 1 55  ? -21.207 15.248 -20.788 0.010 17.76  ? 55   LEU A CG   2  
ATOM   7891   C CD1  . LEU A 1 55  ? -21.293 14.441 -22.078 0.010 17.88  ? 55   LEU A CD1  2  
ATOM   7892   C CD2  . LEU A 1 55  ? -19.780 15.607 -20.445 0.010 17.11  ? 55   LEU A CD2  2  
ATOM   7893   H H    . LEU A 1 55  ? -23.252 16.546 -18.639 0.010 19.07  ? 55   LEU A H    2  
ATOM   7894   H HA   . LEU A 1 55  ? -21.048 17.754 -19.649 0.010 18.14  ? 55   LEU A HA   2  
ATOM   7895   H HB2  . LEU A 1 55  ? -22.998 16.203 -20.970 0.010 18.79  ? 55   LEU A HB2  2  
ATOM   7896   H HB3  . LEU A 1 55  ? -21.832 16.946 -21.734 0.010 18.31  ? 55   LEU A HB3  2  
ATOM   7897   H HG   . LEU A 1 55  ? -21.546 14.695 -20.068 0.010 17.91  ? 55   LEU A HG   2  
ATOM   7898   H HD11 . LEU A 1 55  ? -22.224 14.283 -22.286 0.010 18.41  ? 55   LEU A HD11 2  
ATOM   7899   H HD12 . LEU A 1 55  ? -20.887 14.949 -22.797 0.010 17.81  ? 55   LEU A HD12 2  
ATOM   7900   H HD13 . LEU A 1 55  ? -20.833 13.596 -21.967 0.010 17.63  ? 55   LEU A HD13 2  
ATOM   7901   H HD21 . LEU A 1 55  ? -19.485 16.317 -21.030 0.010 17.07  ? 55   LEU A HD21 2  
ATOM   7902   H HD22 . LEU A 1 55  ? -19.745 15.901 -19.523 0.010 17.18  ? 55   LEU A HD22 2  
ATOM   7903   H HD23 . LEU A 1 55  ? -19.220 14.826 -20.565 0.010 16.80  ? 55   LEU A HD23 2  
ATOM   7904   N N    . GLY A 1 56  ? -22.046 19.589 -20.981 0.010 19.19  ? 56   GLY A N    2  
ATOM   7905   C CA   . GLY A 1 56  ? -22.634 20.780 -21.546 0.010 20.02  ? 56   GLY A CA   2  
ATOM   7906   C C    . GLY A 1 56  ? -22.882 21.897 -20.552 0.010 20.68  ? 56   GLY A C    2  
ATOM   7907   O O    . GLY A 1 56  ? -23.704 22.766 -20.821 0.010 21.58  ? 56   GLY A O    2  
ATOM   7908   H H    . GLY A 1 56  ? -21.235 19.467 -21.208 0.010 18.77  ? 56   GLY A H    2  
ATOM   7909   H HA2  . GLY A 1 56  ? -22.047 21.114 -22.237 0.010 19.97  ? 56   GLY A HA2  2  
ATOM   7910   H HA3  . GLY A 1 56  ? -23.476 20.554 -21.964 0.010 20.39  ? 56   GLY A HA3  2  
ATOM   7911   N N    . ALA A 1 57  ? -22.166 21.891 -19.429 0.010 20.40  ? 57   ALA A N    2  
ATOM   7912   C CA   . ALA A 1 57  ? -22.437 22.815 -18.324 0.010 21.25  ? 57   ALA A CA   2  
ATOM   7913   C C    . ALA A 1 57  ? -21.469 23.977 -18.295 0.010 21.62  ? 57   ALA A C    2  
ATOM   7914   O O    . ALA A 1 57  ? -20.326 23.867 -18.732 0.010 21.01  ? 57   ALA A O    2  
ATOM   7915   C CB   . ALA A 1 57  ? -22.362 22.107 -17.021 0.010 21.10  ? 57   ALA A CB   2  
ATOM   7916   H H    . ALA A 1 57  ? -21.511 21.361 -19.283 0.010 19.84  ? 57   ALA A H    2  
ATOM   7917   H HA   . ALA A 1 57  ? -23.331 23.177 -18.409 0.010 21.88  ? 57   ALA A HA   2  
ATOM   7918   H HB1  . ALA A 1 57  ? -21.528 21.622 -16.973 0.010 20.47  ? 57   ALA A HB1  2  
ATOM   7919   H HB2  . ALA A 1 57  ? -22.390 22.766 -16.312 0.010 21.76  ? 57   ALA A HB2  2  
ATOM   7920   H HB3  . ALA A 1 57  ? -23.113 21.500 -16.935 0.010 21.13  ? 57   ALA A HB3  2  
ATOM   7921   N N    . HIS A 1 58  ? -21.946 25.080 -17.738 0.010 22.80  ? 58   HIS A N    2  
ATOM   7922   C CA   . HIS A 1 58  ? -21.075 26.164 -17.339 0.010 23.50  ? 58   HIS A CA   2  
ATOM   7923   C C    . HIS A 1 58  ? -21.247 26.319 -15.852 0.010 24.28  ? 58   HIS A C    2  
ATOM   7924   O O    . HIS A 1 58  ? -20.321 26.107 -15.103 0.010 24.16  ? 58   HIS A O    2  
ATOM   7925   C CB   . HIS A 1 58  ? -21.394 27.447 -18.080 0.010 24.58  ? 58   HIS A CB   2  
ATOM   7926   C CG   . HIS A 1 58  ? -20.415 28.526 -17.799 0.010 25.50  ? 58   HIS A CG   2  
ATOM   7927   N ND1  . HIS A 1 58  ? -19.072 28.384 -18.078 0.010 24.92  ? 58   HIS A ND1  2  
ATOM   7928   C CD2  . HIS A 1 58  ? -20.554 29.735 -17.216 0.010 27.12  ? 58   HIS A CD2  2  
ATOM   7929   C CE1  . HIS A 1 58  ? -18.431 29.468 -17.696 0.010 26.15  ? 58   HIS A CE1  2  
ATOM   7930   N NE2  . HIS A 1 58  ? -19.306 30.309 -17.178 0.010 27.53  ? 58   HIS A NE2  2  
ATOM   7931   H H    . HIS A 1 58  ? -22.776 25.220 -17.574 0.010 23.31  ? 58   HIS A H    2  
ATOM   7932   H HA   . HIS A 1 58  ? -20.151 25.936 -17.507 0.010 22.91  ? 58   HIS A HA   2  
ATOM   7933   H HB2  . HIS A 1 58  ? -21.377 27.277 -19.033 0.010 24.18  ? 58   HIS A HB2  2  
ATOM   7934   H HB3  . HIS A 1 58  ? -22.275 27.752 -17.814 0.010 25.26  ? 58   HIS A HB3  2  
ATOM   7935   H HD1  . HIS A 1 58  ? -18.710 27.696 -18.445 0.010 23.98  ? 58   HIS A HD1  2  
ATOM   7936   H HD2  . HIS A 1 58  ? -21.346 30.117 -16.913 0.010 27.90  ? 58   HIS A HD2  2  
ATOM   7937   H HE1  . HIS A 1 58  ? -17.517 29.616 -17.789 0.010 26.14  ? 58   HIS A HE1  2  
ATOM   7938   H HE2  . HIS A 1 58  ? -19.125 31.088 -16.860 0.010 28.61  ? 58   HIS A HE2  2  
ATOM   7939   N N    . SER A 1 59  ? -22.467 26.641 -15.419 0.010 25.22  ? 59   SER A N    2  
ATOM   7940   C CA   . SER A 1 59  ? -22.793 26.638 -14.007 0.010 26.11  ? 59   SER A CA   2  
ATOM   7941   C C    . SER A 1 59  ? -23.156 25.251 -13.531 0.010 25.33  ? 59   SER A C    2  
ATOM   7942   O O    . SER A 1 59  ? -23.921 24.565 -14.184 0.010 24.71  ? 59   SER A O    2  
ATOM   7943   C CB   . SER A 1 59  ? -24.012 27.524 -13.739 0.010 27.61  ? 59   SER A CB   2  
ATOM   7944   O OG   . SER A 1 59  ? -24.538 27.253 -12.456 0.010 28.44  ? 59   SER A OG   2  
ATOM   7945   H H    . SER A 1 59  ? -23.115 26.864 -15.930 0.010 25.45  ? 59   SER A H    2  
ATOM   7946   H HA   . SER A 1 59  ? -22.051 26.972 -13.484 0.010 26.48  ? 59   SER A HA   2  
ATOM   7947   H HB2  . SER A 1 59  ? -23.746 28.454 -13.791 0.010 28.41  ? 59   SER A HB2  2  
ATOM   7948   H HB3  . SER A 1 59  ? -24.689 27.331 -14.404 0.010 27.33  ? 59   SER A HB3  2  
ATOM   7949   H HG   . SER A 1 59  ? -23.949 27.396 -11.865 0.010 28.55  ? 59   SER A HG   2  
ATOM   7950   N N    . LEU A 1 60  ? -22.671 24.887 -12.350 0.010 25.63  ? 60   LEU A N    2  
ATOM   7951   C CA   . LEU A 1 60  ? -23.007 23.605 -11.736 0.010 25.23  ? 60   LEU A CA   2  
ATOM   7952   C C    . LEU A 1 60  ? -24.449 23.581 -11.240 0.010 26.26  ? 60   LEU A C    2  
ATOM   7953   O O    . LEU A 1 60  ? -25.005 22.511 -11.054 0.010 25.97  ? 60   LEU A O    2  
ATOM   7954   C CB   . LEU A 1 60  ? -22.106 23.320 -10.538 0.010 25.57  ? 60   LEU A CB   2  
ATOM   7955   C CG   . LEU A 1 60  ? -20.632 23.008 -10.835 0.010 24.51  ? 60   LEU A CG   2  
ATOM   7956   C CD1  . LEU A 1 60  ? -19.850 23.029 -9.554  0.010 25.27  ? 60   LEU A CD1  2  
ATOM   7957   C CD2  . LEU A 1 60  ? -20.521 21.679 -11.533 0.010 22.96  ? 60   LEU A CD2  2  
ATOM   7958   H H    . LEU A 1 60  ? -22.148 25.373 -11.875 0.010 26.20  ? 60   LEU A H    2  
ATOM   7959   H HA   . LEU A 1 60  ? -22.901 22.894 -12.383 0.010 24.23  ? 60   LEU A HA   2  
ATOM   7960   H HB2  . LEU A 1 60  ? -22.121 24.098 -9.961  0.010 26.67  ? 60   LEU A HB2  2  
ATOM   7961   H HB3  . LEU A 1 60  ? -22.473 22.562 -10.059 0.010 25.57  ? 60   LEU A HB3  2  
ATOM   7962   H HG   . LEU A 1 60  ? -20.272 23.685 -11.426 0.010 24.54  ? 60   LEU A HG   2  
ATOM   7963   H HD11 . LEU A 1 60  ? -20.309 22.489 -8.893  0.010 25.51  ? 60   LEU A HD11 2  
ATOM   7964   H HD12 . LEU A 1 60  ? -18.965 22.672 -9.721  0.010 24.59  ? 60   LEU A HD12 2  
ATOM   7965   H HD13 . LEU A 1 60  ? -19.784 23.945 -9.243  0.010 26.34  ? 60   LEU A HD13 2  
ATOM   7966   H HD21 . LEU A 1 60  ? -21.113 21.665 -12.300 0.010 22.62  ? 60   LEU A HD21 2  
ATOM   7967   H HD22 . LEU A 1 60  ? -19.606 21.556 -11.828 0.010 22.39  ? 60   LEU A HD22 2  
ATOM   7968   H HD23 . LEU A 1 60  ? -20.764 20.980 -10.905 0.010 23.03  ? 60   LEU A HD23 2  
ATOM   7969   N N    . SER A 1 61  ? -25.023 24.760 -11.000 0.010 27.60  ? 61   SER A N    2  
ATOM   7970   C CA   . SER A 1 61  ? -26.312 24.859 -10.283 0.010 28.93  ? 61   SER A CA   2  
ATOM   7971   C C    . SER A 1 61  ? -27.454 25.471 -11.088 0.010 29.33  ? 61   SER A C    2  
ATOM   7972   O O    . SER A 1 61  ? -28.640 25.192 -10.811 0.010 29.96  ? 61   SER A O    2  
ATOM   7973   C CB   . SER A 1 61  ? -26.141 25.657 -8.982  0.010 30.72  ? 61   SER A CB   2  
ATOM   7974   O OG   . SER A 1 61  ? -25.732 26.975 -9.264  0.010 31.42  ? 61   SER A OG   2  
ATOM   7975   H H    . SER A 1 61  ? -24.694 25.514 -11.240 0.010 27.86  ? 61   SER A H    2  
ATOM   7976   H HA   . SER A 1 61  ? -26.598 23.971 -10.027 0.010 28.65  ? 61   SER A HA   2  
ATOM   7977   H HB2  . SER A 1 61  ? -26.988 25.686 -8.513  0.010 31.64  ? 61   SER A HB2  2  
ATOM   7978   H HB3  . SER A 1 61  ? -25.475 25.228 -8.424  0.010 30.63  ? 61   SER A HB3  2  
ATOM   7979   H HG   . SER A 1 61  ? -25.094 26.972 -9.823  0.010 30.59  ? 61   SER A HG   2  
ATOM   7980   N N    . GLN A 1 62  ? -27.117 26.307 -12.061 0.010 29.14  ? 62   GLN A N    2  
ATOM   7981   C CA   . GLN A 1 62  ? -28.130 27.110 -12.729 0.010 29.95  ? 62   GLN A CA   2  
ATOM   7982   C C    . GLN A 1 62  ? -28.638 26.479 -14.029 0.010 28.88  ? 62   GLN A C    2  
ATOM   7983   O O    . GLN A 1 62  ? -27.918 25.769 -14.708 0.010 27.49  ? 62   GLN A O    2  
ATOM   7984   C CB   . GLN A 1 62  ? -27.619 28.532 -12.945 0.010 30.92  ? 62   GLN A CB   2  
ATOM   7985   C CG   . GLN A 1 62  ? -27.466 29.287 -11.630 0.010 32.44  ? 62   GLN A CG   2  
ATOM   7986   C CD   . GLN A 1 62  ? -28.793 29.399 -10.873 0.010 33.89  ? 62   GLN A CD   2  
ATOM   7987   O OE1  . GLN A 1 62  ? -28.845 29.298 -9.656  0.010 34.64  ? 62   GLN A OE1  2  
ATOM   7988   N NE2  . GLN A 1 62  ? -29.863 29.583 -11.610 0.010 34.39  ? 62   GLN A NE2  2  
ATOM   7989   H H    . GLN A 1 62  ? -26.322 26.421 -12.356 0.010 28.63  ? 62   GLN A H    2  
ATOM   7990   H HA   . GLN A 1 62  ? -28.877 27.170 -12.122 0.010 30.86  ? 62   GLN A HA   2  
ATOM   7991   H HB2  . GLN A 1 62  ? -26.751 28.496 -13.372 0.010 30.13  ? 62   GLN A HB2  2  
ATOM   7992   H HB3  . GLN A 1 62  ? -28.238 29.014 -13.512 0.010 31.55  ? 62   GLN A HB3  2  
ATOM   7993   H HG2  . GLN A 1 62  ? -26.838 28.815 -11.063 0.010 31.92  ? 62   GLN A HG2  2  
ATOM   7994   H HG3  . GLN A 1 62  ? -27.141 30.182 -11.811 0.010 33.17  ? 62   GLN A HG3  2  
ATOM   7995   H HE21 . GLN A 1 62  ? -29.793 29.692 -12.458 0.010 33.75  ? 62   GLN A HE21 2  
ATOM   7996   H HE22 . GLN A 1 62  ? -30.636 29.596 -11.238 0.010 35.42  ? 62   GLN A HE22 2  
ATOM   7997   N N    . PRO A 1 63  ? -29.916 26.719 -14.362 0.010 29.70  ? 63   PRO A N    2  
ATOM   7998   C CA   . PRO A 1 63  ? -30.485 26.104 -15.560 0.010 28.97  ? 63   PRO A CA   2  
ATOM   7999   C C    . PRO A 1 63  ? -29.750 26.486 -16.824 0.010 28.32  ? 63   PRO A C    2  
ATOM   8000   O O    . PRO A 1 63  ? -29.421 27.640 -17.017 0.010 29.03  ? 63   PRO A O    2  
ATOM   8001   C CB   . PRO A 1 63  ? -31.935 26.653 -15.587 0.010 30.40  ? 63   PRO A CB   2  
ATOM   8002   C CG   . PRO A 1 63  ? -32.201 27.046 -14.177 0.010 31.58  ? 63   PRO A CG   2  
ATOM   8003   C CD   . PRO A 1 63  ? -30.907 27.545 -13.642 0.010 31.45  ? 63   PRO A CD   2  
ATOM   8004   H HA   . PRO A 1 63  ? -30.501 25.142 -15.472 0.010 28.29  ? 63   PRO A HA   2  
ATOM   8005   H HB2  . PRO A 1 63  ? -31.992 27.418 -16.178 0.010 30.87  ? 63   PRO A HB2  2  
ATOM   8006   H HB3  . PRO A 1 63  ? -32.541 25.954 -15.873 0.010 30.17  ? 63   PRO A HB3  2  
ATOM   8007   H HG2  . PRO A 1 63  ? -32.870 27.747 -14.158 0.010 32.69  ? 63   PRO A HG2  2  
ATOM   8008   H HG3  . PRO A 1 63  ? -32.495 26.277 -13.669 0.010 31.43  ? 63   PRO A HG3  2  
ATOM   8009   H HD2  . PRO A 1 63  ? -30.786 28.481 -13.857 0.010 32.17  ? 63   PRO A HD2  2  
ATOM   8010   H HD3  . PRO A 1 63  ? -30.866 27.390 -12.689 0.010 31.85  ? 63   PRO A HD3  2  
ATOM   8011   N N    . GLU A 1 64  ? -29.463 25.499 -17.667 0.010 27.14  ? 64   GLU A N    2  
ATOM   8012   C CA   . GLU A 1 64  ? -28.901 25.766 -18.972 0.010 26.73  ? 64   GLU A CA   2  
ATOM   8013   C C    . GLU A 1 64  ? -29.402 24.732 -19.969 0.010 26.22  ? 64   GLU A C    2  
ATOM   8014   O O    . GLU A 1 64  ? -29.487 23.533 -19.637 0.010 25.52  ? 64   GLU A O    2  
ATOM   8015   C CB   . GLU A 1 64  ? -27.359 25.752 -18.915 0.010 25.76  ? 64   GLU A CB   2  
ATOM   8016   C CG   . GLU A 1 64  ? -26.757 26.663 -17.839 0.010 26.39  ? 64   GLU A CG   2  
ATOM   8017   C CD   . GLU A 1 64  ? -25.227 26.484 -17.680 0.010 25.47  ? 64   GLU A CD   2  
ATOM   8018   O OE1  . GLU A 1 64  ? -24.674 25.587 -18.342 0.010 24.30  ? 64   GLU A OE1  2  
ATOM   8019   O OE2  . GLU A 1 64  ? -24.622 27.223 -16.880 0.010 26.06  ? 64   GLU A OE2  2  
ATOM   8020   H H    . GLU A 1 64  ? -29.585 24.669 -17.500 0.010 26.67  ? 64   GLU A H    2  
ATOM   8021   H HA   . GLU A 1 64  ? -29.179 26.648 -19.241 0.010 27.58  ? 64   GLU A HA   2  
ATOM   8022   H HB2  . GLU A 1 64  ? -27.071 24.848 -18.733 0.010 24.95  ? 64   GLU A HB2  2  
ATOM   8023   H HB3  . GLU A 1 64  ? -27.016 26.030 -19.775 0.010 25.66  ? 64   GLU A HB3  2  
ATOM   8024   H HG2  . GLU A 1 64  ? -26.923 27.587 -18.074 0.010 27.25  ? 64   GLU A HG2  2  
ATOM   8025   H HG3  . GLU A 1 64  ? -27.155 26.458 -16.984 0.010 26.69  ? 64   GLU A HG3  2  
ATOM   8026   N N    . PRO A 1 65  ? -29.725 25.181 -21.190 0.010 26.77  ? 65   PRO A N    2  
ATOM   8027   C CA   . PRO A 1 65  ? -30.311 24.294 -22.195 0.010 26.72  ? 65   PRO A CA   2  
ATOM   8028   C C    . PRO A 1 65  ? -29.481 23.066 -22.517 0.010 25.46  ? 65   PRO A C    2  
ATOM   8029   O O    . PRO A 1 65  ? -30.032 22.003 -22.767 0.010 25.36  ? 65   PRO A O    2  
ATOM   8030   C CB   . PRO A 1 65  ? -30.384 25.172 -23.438 0.010 27.81  ? 65   PRO A CB   2  
ATOM   8031   C CG   . PRO A 1 65  ? -30.502 26.547 -22.926 0.010 28.58  ? 65   PRO A CG   2  
ATOM   8032   C CD   . PRO A 1 65  ? -29.755 26.594 -21.636 0.010 27.69  ? 65   PRO A CD   2  
ATOM   8033   H HA   . PRO A 1 65  ? -31.207 24.034 -21.933 0.010 27.07  ? 65   PRO A HA   2  
ATOM   8034   H HB2  . PRO A 1 65  ? -29.581 25.068 -23.973 0.010 27.44  ? 65   PRO A HB2  2  
ATOM   8035   H HB3  . PRO A 1 65  ? -31.177 24.933 -23.946 0.010 28.50  ? 65   PRO A HB3  2  
ATOM   8036   H HG2  . PRO A 1 65  ? -30.114 27.163 -23.565 0.010 28.89  ? 65   PRO A HG2  2  
ATOM   8037   H HG3  . PRO A 1 65  ? -31.440 26.748 -22.785 0.010 29.46  ? 65   PRO A HG3  2  
ATOM   8038   H HD2  . PRO A 1 65  ? -28.865 26.936 -21.781 0.010 27.22  ? 65   PRO A HD2  2  
ATOM   8039   H HD3  . PRO A 1 65  ? -30.242 27.140 -21.003 0.010 28.37  ? 65   PRO A HD3  2  
ATOM   8040   N N    . SER A 1 66  ? -28.169 23.211 -22.536 0.010 24.65  ? 66   SER A N    2  
ATOM   8041   C CA   . SER A 1 66  ? -27.327 22.117 -23.004 0.010 23.58  ? 66   SER A CA   2  
ATOM   8042   C C    . SER A 1 66  ? -26.880 21.183 -21.883 0.010 22.66  ? 66   SER A C    2  
ATOM   8043   O O    . SER A 1 66  ? -26.120 20.256 -22.147 0.010 21.89  ? 66   SER A O    2  
ATOM   8044   C CB   . SER A 1 66  ? -26.092 22.659 -23.748 0.010 23.22  ? 66   SER A CB   2  
ATOM   8045   O OG   . SER A 1 66  ? -25.400 23.578 -22.943 0.010 23.30  ? 66   SER A OG   2  
ATOM   8046   H H    . SER A 1 66  ? -27.750 23.919 -22.295 0.010 24.77  ? 66   SER A H    2  
ATOM   8047   H HA   . SER A 1 66  ? -27.825 21.585 -23.640 0.010 23.82  ? 66   SER A HA   2  
ATOM   8048   H HB2  . SER A 1 66  ? -25.500 21.925 -23.965 0.010 22.48  ? 66   SER A HB2  2  
ATOM   8049   H HB3  . SER A 1 66  ? -26.366 23.099 -24.565 0.010 23.83  ? 66   SER A HB3  2  
ATOM   8050   H HG   . SER A 1 66  ? -25.773 23.644 -22.183 0.010 23.29  ? 66   SER A HG   2  
ATOM   8051   N N    . LYS A 1 67  ? -27.282 21.456 -20.644 0.010 22.90  ? 67   LYS A N    2  
ATOM   8052   C CA   . LYS A 1 67  ? -26.909 20.615 -19.509 0.010 22.31  ? 67   LYS A CA   2  
ATOM   8053   C C    . LYS A 1 67  ? -27.546 19.250 -19.616 0.010 22.23  ? 67   LYS A C    2  
ATOM   8054   O O    . LYS A 1 67  ? -28.734 19.106 -19.855 0.010 23.01  ? 67   LYS A O    2  
ATOM   8055   C CB   . LYS A 1 67  ? -27.269 21.263 -18.171 0.010 22.98  ? 67   LYS A CB   2  
ATOM   8056   C CG   . LYS A 1 67  ? -26.252 22.332 -17.717 0.010 23.01  ? 67   LYS A CG   2  
ATOM   8057   C CD   . LYS A 1 67  ? -26.795 23.208 -16.556 0.010 24.16  ? 67   LYS A CD   2  
ATOM   8058   C CE   . LYS A 1 67  ? -26.225 22.734 -15.235 0.010 24.07  ? 67   LYS A CE   2  
ATOM   8059   N NZ   . LYS A 1 67  ? -26.624 23.507 -14.036 0.010 25.39  ? 67   LYS A NZ   2  
ATOM   8060   H H    . LYS A 1 67  ? -27.757 22.135 -20.429 0.010 23.52  ? 67   LYS A H    2  
ATOM   8061   H HA   . LYS A 1 67  ? -25.950 20.482 -19.522 0.010 21.66  ? 67   LYS A HA   2  
ATOM   8062   H HB2  . LYS A 1 67  ? -28.137 21.683 -18.250 0.010 23.72  ? 67   LYS A HB2  2  
ATOM   8063   H HB3  . LYS A 1 67  ? -27.297 20.572 -17.493 0.010 22.82  ? 67   LYS A HB3  2  
ATOM   8064   H HG2  . LYS A 1 67  ? -25.452 21.892 -17.405 0.010 22.40  ? 67   LYS A HG2  2  
ATOM   8065   H HG3  . LYS A 1 67  ? -26.048 22.905 -18.468 0.010 23.10  ? 67   LYS A HG3  2  
ATOM   8066   H HD2  . LYS A 1 67  ? -26.536 24.133 -16.693 0.010 24.59  ? 67   LYS A HD2  2  
ATOM   8067   H HD3  . LYS A 1 67  ? -27.762 23.122 -16.516 0.010 24.69  ? 67   LYS A HD3  2  
ATOM   8068   H HE2  . LYS A 1 67  ? -26.501 21.814 -15.097 0.010 23.85  ? 67   LYS A HE2  2  
ATOM   8069   H HE3  . LYS A 1 67  ? -25.259 22.766 -15.299 0.010 23.50  ? 67   LYS A HE3  2  
ATOM   8070   H HZ1  . LYS A 1 67  ? -27.473 23.747 -14.101 0.010 25.99  ? 67   LYS A HZ1  2  
ATOM   8071   H HZ2  . LYS A 1 67  ? -26.522 23.015 -13.303 0.010 25.48  ? 67   LYS A HZ2  2  
ATOM   8072   H HZ3  . LYS A 1 67  ? -26.118 24.233 -13.964 0.010 25.62  ? 67   LYS A HZ3  2  
ATOM   8073   N N    . ARG A 1 68  ? -26.716 18.234 -19.480 0.010 21.40  ? 68   ARG A N    2  
ATOM   8074   C CA   . ARG A 1 68  ? -27.185 16.900 -19.724 0.010 21.47  ? 68   ARG A CA   2  
ATOM   8075   C C    . ARG A 1 68  ? -26.437 16.010 -18.711 0.010 20.93  ? 68   ARG A C    2  
ATOM   8076   O O    . ARG A 1 68  ? -25.212 16.031 -18.668 0.010 20.16  ? 68   ARG A O    2  
ATOM   8077   C CB   . ARG A 1 68  ? -26.918 16.575 -21.209 0.010 21.29  ? 68   ARG A CB   2  
ATOM   8078   C CG   . ARG A 1 68  ? -27.417 17.683 -22.328 0.010 21.95  ? 68   ARG A CG   2  
ATOM   8079   C CD   . ARG A 1 68  ? -26.444 17.864 -23.649 0.010 21.59  ? 68   ARG A CD   2  
ATOM   8080   N NE   . ARG A 1 68  ? -26.870 18.622 -24.821 0.010 22.20  ? 68   ARG A NE   2  
ATOM   8081   C CZ   . ARG A 1 68  ? -28.079 18.521 -25.421 0.010 23.32  ? 68   ARG A CZ   2  
ATOM   8082   N NH1  . ARG A 1 68  ? -28.996 17.688 -24.957 0.010 23.90  ? 68   ARG A NH1  2  
ATOM   8083   N NH2  . ARG A 1 68  ? -28.385 19.274 -26.495 0.010 24.03  ? 68   ARG A NH2  2  
ATOM   8084   H H    . ARG A 1 68  ? -25.894 18.294 -19.252 0.010 20.90  ? 68   ARG A H    2  
ATOM   8085   H HA   . ARG A 1 68  ? -28.133 16.826 -19.545 0.010 22.13  ? 68   ARG A HA   2  
ATOM   8086   H HB2  . ARG A 1 68  ? -25.964 16.452 -21.328 0.010 20.65  ? 68   ARG A HB2  2  
ATOM   8087   H HB3  . ARG A 1 68  ? -27.381 15.746 -21.404 0.010 21.55  ? 68   ARG A HB3  2  
ATOM   8088   H HG2  . ARG A 1 68  ? -28.281 17.376 -22.624 0.010 22.57  ? 68   ARG A HG2  2  
ATOM   8089   H HG3  . ARG A 1 68  ? -27.541 18.543 -21.926 0.010 22.17  ? 68   ARG A HG3  2  
ATOM   8090   H HD2  . ARG A 1 68  ? -25.569 18.180 -23.388 0.010 20.91  ? 68   ARG A HD2  2  
ATOM   8091   H HD3  . ARG A 1 68  ? -26.392 16.989 -24.024 0.010 21.76  ? 68   ARG A HD3  2  
ATOM   8092   H HE   . ARG A 1 68  ? -26.233 18.829 -25.351 0.010 21.93  ? 68   ARG A HE   2  
ATOM   8093   H HH11 . ARG A 1 68  ? -28.836 17.190 -24.289 0.010 23.57  ? 68   ARG A HH11 2  
ATOM   8094   H HH12 . ARG A 1 68  ? -29.756 17.631 -25.354 0.010 24.68  ? 68   ARG A HH12 2  
ATOM   8095   H HH21 . ARG A 1 68  ? -27.814 19.828 -26.819 0.010 23.78  ? 68   ARG A HH21 2  
ATOM   8096   H HH22 . ARG A 1 68  ? -29.157 19.194 -26.864 0.010 24.83  ? 68   ARG A HH22 2  
ATOM   8097   N N    . LEU A 1 69  ? -27.178 15.302 -17.853 0.010 21.50  ? 69   LEU A N    2  
ATOM   8098   C CA   . LEU A 1 69  ? -26.560 14.512 -16.780 0.010 21.29  ? 69   LEU A CA   2  
ATOM   8099   C C    . LEU A 1 69  ? -26.652 13.034 -17.148 0.010 21.37  ? 69   LEU A C    2  
ATOM   8100   O O    . LEU A 1 69  ? -27.736 12.545 -17.394 0.010 22.14  ? 69   LEU A O    2  
ATOM   8101   C CB   . LEU A 1 69  ? -27.222 14.785 -15.421 0.010 22.17  ? 69   LEU A CB   2  
ATOM   8102   C CG   . LEU A 1 69  ? -26.670 14.146 -14.136 0.010 22.39  ? 69   LEU A CG   2  
ATOM   8103   C CD1  . LEU A 1 69  ? -25.280 14.659 -13.778 0.010 21.69  ? 69   LEU A CD1  2  
ATOM   8104   C CD2  . LEU A 1 69  ? -27.638 14.399 -12.940 0.010 23.66  ? 69   LEU A CD2  2  
ATOM   8105   H H    . LEU A 1 69  ? -28.032 15.249 -17.880 0.010 22.09  ? 69   LEU A H    2  
ATOM   8106   H HA   . LEU A 1 69  ? -25.622 14.742 -16.699 0.010 20.71  ? 69   LEU A HA   2  
ATOM   8107   H HB2  . LEU A 1 69  ? -27.195 15.743 -15.277 0.010 22.24  ? 69   LEU A HB2  2  
ATOM   8108   H HB3  . LEU A 1 69  ? -28.150 14.513 -15.487 0.010 22.79  ? 69   LEU A HB3  2  
ATOM   8109   H HG   . LEU A 1 69  ? -26.604 13.190 -14.268 0.010 22.37  ? 69   LEU A HG   2  
ATOM   8110   H HD11 . LEU A 1 69  ? -24.782 14.841 -14.589 0.010 21.01  ? 69   LEU A HD11 2  
ATOM   8111   H HD12 . LEU A 1 69  ? -25.368 15.472 -13.259 0.010 22.09  ? 69   LEU A HD12 2  
ATOM   8112   H HD13 . LEU A 1 69  ? -24.828 13.983 -13.253 0.010 21.68  ? 69   LEU A HD13 2  
ATOM   8113   H HD21 . LEU A 1 69  ? -28.079 15.250 -13.075 0.010 23.85  ? 69   LEU A HD21 2  
ATOM   8114   H HD22 . LEU A 1 69  ? -28.294 13.688 -12.905 0.010 24.18  ? 69   LEU A HD22 2  
ATOM   8115   H HD23 . LEU A 1 69  ? -27.137 14.418 -12.112 0.010 23.87  ? 69   LEU A HD23 2  
ATOM   8116   N N    . TYR A 1 70  ? -25.511 12.351 -17.205 0.010 20.71  ? 70   TYR A N    2  
ATOM   8117   C CA   . TYR A 1 70  ? -25.478 10.953 -17.637 0.010 20.90  ? 70   TYR A CA   2  
ATOM   8118   C C    . TYR A 1 70  ? -25.138 10.016 -16.480 0.010 21.22  ? 70   TYR A C    2  
ATOM   8119   O O    . TYR A 1 70  ? -24.260 10.271 -15.679 0.010 20.85  ? 70   TYR A O    2  
ATOM   8120   C CB   . TYR A 1 70  ? -24.490 10.728 -18.802 0.010 20.16  ? 70   TYR A CB   2  
ATOM   8121   C CG   . TYR A 1 70  ? -24.792 11.515 -20.063 0.010 20.07  ? 70   TYR A CG   2  
ATOM   8122   C CD1  . TYR A 1 70  ? -24.432 12.853 -20.184 0.010 19.60  ? 70   TYR A CD1  2  
ATOM   8123   C CD2  . TYR A 1 70  ? -25.427 10.913 -21.137 0.010 20.69  ? 70   TYR A CD2  2  
ATOM   8124   C CE1  . TYR A 1 70  ? -24.717 13.557 -21.333 0.010 19.75  ? 70   TYR A CE1  2  
ATOM   8125   C CE2  . TYR A 1 70  ? -25.713 11.607 -22.265 0.010 20.86  ? 70   TYR A CE2  2  
ATOM   8126   C CZ   . TYR A 1 70  ? -25.362 12.932 -22.361 0.010 20.37  ? 70   TYR A CZ   2  
ATOM   8127   O OH   . TYR A 1 70  ? -25.662 13.609 -23.506 0.010 20.75  ? 70   TYR A OH   2  
ATOM   8128   H H    . TYR A 1 70  ? -24.747 12.666 -16.988 0.010 20.26  ? 70   TYR A H    2  
ATOM   8129   H HA   . TYR A 1 70  ? -26.356 10.697 -17.961 0.010 21.52  ? 70   TYR A HA   2  
ATOM   8130   H HB2  . TYR A 1 70  ? -23.621 10.999 -18.538 0.010 19.59  ? 70   TYR A HB2  2  
ATOM   8131   H HB3  . TYR A 1 70  ? -24.477 9.787  -19.030 0.010 20.47  ? 70   TYR A HB3  2  
ATOM   8132   H HD1  . TYR A 1 70  ? -24.004 13.277 -19.479 0.010 19.33  ? 70   TYR A HD1  2  
ATOM   8133   H HD2  . TYR A 1 70  ? -25.678 10.021 -21.074 0.010 21.15  ? 70   TYR A HD2  2  
ATOM   8134   H HE1  . TYR A 1 70  ? -24.485 14.452 -21.405 0.010 19.56  ? 70   TYR A HE1  2  
ATOM   8135   H HE2  . TYR A 1 70  ? -26.149 11.185 -22.970 0.010 21.43  ? 70   TYR A HE2  2  
ATOM   8136   H HH   . TYR A 1 70  ? -26.240 13.179 -23.958 0.010 21.29  ? 70   TYR A HH   2  
ATOM   8137   N N    . ASP A 1 71  ? -25.861 8.914  -16.403 0.010 22.10  ? 71   ASP A N    2  
ATOM   8138   C CA   . ASP A 1 71  ? -25.417 7.796  -15.590 0.010 22.56  ? 71   ASP A CA   2  
ATOM   8139   C C    . ASP A 1 71  ? -24.172 7.168  -16.246 0.010 21.83  ? 71   ASP A C    2  
ATOM   8140   O O    . ASP A 1 71  ? -23.898 7.385  -17.426 0.010 21.27  ? 71   ASP A O    2  
ATOM   8141   C CB   . ASP A 1 71  ? -26.528 6.747  -15.469 0.010 23.92  ? 71   ASP A CB   2  
ATOM   8142   C CG   . ASP A 1 71  ? -27.581 7.105  -14.399 0.010 24.75  ? 71   ASP A CG   2  
ATOM   8143   O OD1  . ASP A 1 71  ? -27.224 7.655  -13.325 0.010 24.23  ? 71   ASP A OD1  2  
ATOM   8144   O OD2  . ASP A 1 71  ? -28.772 6.782  -14.631 0.010 26.05  ? 71   ASP A OD2  2  
ATOM   8145   H H    . ASP A 1 71  ? -26.605 8.788  -16.812 0.010 22.56  ? 71   ASP A H    2  
ATOM   8146   H HA   . ASP A 1 71  ? -25.186 8.107  -14.702 0.010 22.63  ? 71   ASP A HA   2  
ATOM   8147   H HB2  . ASP A 1 71  ? -26.971 6.671  -16.327 0.010 23.97  ? 71   ASP A HB2  2  
ATOM   8148   H HB3  . ASP A 1 71  ? -26.133 5.898  -15.227 0.010 24.34  ? 71   ASP A HB3  2  
ATOM   8149   N N    . VAL A 1 72  ? -23.430 6.411  -15.452 0.010 22.00  ? 72   VAL A N    2  
ATOM   8150   C CA   . VAL A 1 72  ? -22.234 5.716  -15.900 0.010 21.50  ? 72   VAL A CA   2  
ATOM   8151   C C    . VAL A 1 72  ? -22.417 4.204  -15.808 0.010 22.63  ? 72   VAL A C    2  
ATOM   8152   O O    . VAL A 1 72  ? -22.755 3.705  -14.758 0.010 23.60  ? 72   VAL A O    2  
ATOM   8153   C CB   . VAL A 1 72  ? -21.109 6.093  -14.989 0.010 20.97  ? 72   VAL A CB   2  
ATOM   8154   C CG1  . VAL A 1 72  ? -19.863 5.272  -15.258 0.010 20.62  ? 72   VAL A CG1  2  
ATOM   8155   C CG2  . VAL A 1 72  ? -20.844 7.593  -15.119 0.010 20.06  ? 72   VAL A CG2  2  
ATOM   8156   H H    . VAL A 1 72  ? -23.597 6.296  -14.618 0.010 22.49  ? 72   VAL A H    2  
ATOM   8157   H HA   . VAL A 1 72  ? -22.003 5.966  -16.806 0.010 20.96  ? 72   VAL A HA   2  
ATOM   8158   H HB   . VAL A 1 72  ? -21.388 5.905  -14.078 0.010 21.64  ? 72   VAL A HB   2  
ATOM   8159   H HG11 . VAL A 1 72  ? -19.961 4.776  -16.085 0.010 20.84  ? 72   VAL A HG11 2  
ATOM   8160   H HG12 . VAL A 1 72  ? -19.110 5.875  -15.332 0.010 19.81  ? 72   VAL A HG12 2  
ATOM   8161   H HG13 . VAL A 1 72  ? -19.724 4.659  -14.521 0.010 21.10  ? 72   VAL A HG13 2  
ATOM   8162   H HG21 . VAL A 1 72  ? -20.860 7.827  -16.058 0.010 19.57  ? 72   VAL A HG21 2  
ATOM   8163   H HG22 . VAL A 1 72  ? -21.538 8.080  -14.652 0.010 20.42  ? 72   VAL A HG22 2  
ATOM   8164   H HG23 . VAL A 1 72  ? -19.980 7.802  -14.732 0.010 19.75  ? 72   VAL A HG23 2  
ATOM   8165   N N    . LEU A 1 73  ? -22.156 3.480  -16.890 0.010 22.71  ? 73   LEU A N    2  
ATOM   8166   C CA   . LEU A 1 73  ? -22.349 2.012  -16.907 0.010 24.01  ? 73   LEU A CA   2  
ATOM   8167   C C    . LEU A 1 73  ? -21.099 1.249  -16.531 0.010 23.96  ? 73   LEU A C    2  
ATOM   8168   O O    . LEU A 1 73  ? -21.184 0.099  -16.123 0.010 25.19  ? 73   LEU A O    2  
ATOM   8169   C CB   . LEU A 1 73  ? -22.765 1.498  -18.279 0.010 24.47  ? 73   LEU A CB   2  
ATOM   8170   C CG   . LEU A 1 73  ? -24.026 2.075  -18.894 0.010 25.04  ? 73   LEU A CG   2  
ATOM   8171   C CD1  . LEU A 1 73  ? -25.233 1.864  -17.980 0.010 24.75  ? 73   LEU A CD1  2  
ATOM   8172   C CD2  . LEU A 1 73  ? -23.760 3.497  -19.198 0.010 24.41  ? 73   LEU A CD2  2  
ATOM   8173   H H    . LEU A 1 73  ? -21.833 3.801  -17.613 0.010 22.15  ? 73   LEU A H    2  
ATOM   8174   H HA   . LEU A 1 73  ? -23.043 1.765  -16.277 0.010 24.85  ? 73   LEU A HA   2  
ATOM   8175   H HB2  . LEU A 1 73  ? -22.039 1.655  -18.901 0.010 23.68  ? 73   LEU A HB2  2  
ATOM   8176   H HB3  . LEU A 1 73  ? -22.914 0.541  -18.202 0.010 25.37  ? 73   LEU A HB3  2  
ATOM   8177   H HG   . LEU A 1 73  ? -24.205 1.626  -19.733 0.010 26.19  ? 73   LEU A HG   2  
ATOM   8178   H HD11 . LEU A 1 73  ? -25.103 2.354  -17.152 0.010 23.72  ? 73   LEU A HD11 2  
ATOM   8179   H HD12 . LEU A 1 73  ? -26.030 2.178  -18.433 0.010 25.20  ? 73   LEU A HD12 2  
ATOM   8180   H HD13 . LEU A 1 73  ? -25.318 0.918  -17.793 0.010 25.28  ? 73   LEU A HD13 2  
ATOM   8181   H HD21 . LEU A 1 73  ? -22.809 3.663  -19.204 0.010 24.65  ? 73   LEU A HD21 2  
ATOM   8182   H HD22 . LEU A 1 73  ? -24.098 3.649  -20.087 0.010 24.94  ? 73   LEU A HD22 2  
ATOM   8183   H HD23 . LEU A 1 73  ? -24.195 4.063  -18.543 0.010 23.36  ? 73   LEU A HD23 2  
ATOM   8184   N N    . ARG A 1 74  ? -19.940 1.864  -16.732 0.010 22.67  ? 74   ARG A N    2  
ATOM   8185   C CA   . ARG A 1 74  ? -18.666 1.177  -16.542 0.010 22.57  ? 74   ARG A CA   2  
ATOM   8186   C C    . ARG A 1 74  ? -17.693 2.284  -16.052 0.010 21.37  ? 74   ARG A C    2  
ATOM   8187   O O    . ARG A 1 74  ? -17.521 3.298  -16.708 0.010 20.31  ? 74   ARG A O    2  
ATOM   8188   C CB   . ARG A 1 74  ? -18.296 0.416  -17.887 0.010 22.53  ? 74   ARG A CB   2  
ATOM   8189   C CG   . ARG A 1 74  ? -16.895 -0.313 -18.058 0.010 23.70  ? 74   ARG A CG   2  
ATOM   8190   C CD   . ARG A 1 74  ? -16.950 -1.455 -19.100 0.010 24.36  ? 74   ARG A CD   2  
ATOM   8191   N NE   . ARG A 1 74  ? -15.903 -1.519 -20.158 0.010 23.45  ? 74   ARG A NE   2  
ATOM   8192   C CZ   . ARG A 1 74  ? -14.614 -1.784 -19.958 0.010 23.42  ? 74   ARG A CZ   2  
ATOM   8193   N NH1  . ARG A 1 74  ? -14.148 -2.001 -18.731 0.010 24.22  ? 74   ARG A NH1  2  
ATOM   8194   N NH2  . ARG A 1 74  ? -13.785 -1.840 -20.999 0.010 22.69  ? 74   ARG A NH2  2  
ATOM   8195   H H    . ARG A 1 74  ? -19.862 2.679  -16.986 0.010 21.91  ? 74   ARG A H    2  
ATOM   8196   H HA   . ARG A 1 74  ? -18.748 0.519  -15.835 0.010 23.45  ? 74   ARG A HA   2  
ATOM   8197   H HB2  . ARG A 1 74  ? -18.970 -0.267 -18.021 0.010 22.80  ? 74   ARG A HB2  2  
ATOM   8198   H HB3  . ARG A 1 74  ? -18.357 1.047  -18.620 0.010 21.62  ? 74   ARG A HB3  2  
ATOM   8199   H HG2  . ARG A 1 74  ? -16.237 0.332  -18.360 0.010 23.32  ? 74   ARG A HG2  2  
ATOM   8200   H HG3  . ARG A 1 74  ? -16.630 -0.694 -17.207 0.010 24.60  ? 74   ARG A HG3  2  
ATOM   8201   H HD2  . ARG A 1 74  ? -16.909 -2.296 -18.620 0.010 25.41  ? 74   ARG A HD2  2  
ATOM   8202   H HD3  . ARG A 1 74  ? -17.802 -1.384 -19.555 0.010 24.57  ? 74   ARG A HD3  2  
ATOM   8203   H HE   . ARG A 1 74  ? -16.194 -1.736 -20.940 0.010 22.93  ? 74   ARG A HE   2  
ATOM   8204   H HH11 . ARG A 1 74  ? -14.680 -1.975 -18.057 0.010 24.80  ? 74   ARG A HH11 2  
ATOM   8205   H HH12 . ARG A 1 74  ? -13.316 -2.169 -18.610 0.010 24.25  ? 74   ARG A HH12 2  
ATOM   8206   H HH21 . ARG A 1 74  ? -14.077 -1.697 -21.795 0.010 22.28  ? 74   ARG A HH21 2  
ATOM   8207   H HH22 . ARG A 1 74  ? -12.954 -2.003 -20.875 0.010 22.71  ? 74   ARG A HH22 2  
ATOM   8208   N N    . ALA A 1 75  ? -17.142 2.116  -14.855 0.010 21.78  ? 75   ALA A N    2  
ATOM   8209   C CA   . ALA A 1 75  ? -16.028 2.958  -14.384 0.010 20.94  ? 75   ALA A CA   2  
ATOM   8210   C C    . ALA A 1 75  ? -14.780 2.099  -14.396 0.010 21.10  ? 75   ALA A C    2  
ATOM   8211   O O    . ALA A 1 75  ? -14.760 1.008  -13.829 0.010 22.27  ? 75   ALA A O    2  
ATOM   8212   C CB   . ALA A 1 75  ? -16.279 3.491  -13.010 0.010 21.48  ? 75   ALA A CB   2  
ATOM   8213   H H    . ALA A 1 75  ? -17.389 1.522  -14.290 0.010 22.64  ? 75   ALA A H    2  
ATOM   8214   H HA   . ALA A 1 75  ? -15.890 3.710  -14.979 0.010 20.07  ? 75   ALA A HA   2  
ATOM   8215   H HB1  . ALA A 1 75  ? -16.645 2.788  -12.454 0.010 22.47  ? 75   ALA A HB1  2  
ATOM   8216   H HB2  . ALA A 1 75  ? -15.438 3.793  -12.638 0.010 21.21  ? 75   ALA A HB2  2  
ATOM   8217   H HB3  . ALA A 1 75  ? -16.896 4.234  -13.073 0.010 21.22  ? 75   ALA A HB3  2  
ATOM   8218   N N    . VAL A 1 76  ? -13.755 2.597  -15.072 0.010 20.05  ? 76   VAL A N    2  
ATOM   8219   C CA   . VAL A 1 76  ? -12.580 1.812  -15.394 0.010 20.13  ? 76   VAL A CA   2  
ATOM   8220   C C    . VAL A 1 76  ? -11.306 2.579  -14.986 0.010 19.38  ? 76   VAL A C    2  
ATOM   8221   O O    . VAL A 1 76  ? -10.729 3.326  -15.779 0.010 18.39  ? 76   VAL A O    2  
ATOM   8222   C CB   . VAL A 1 76  ? -12.525 1.471  -16.888 0.010 19.88  ? 76   VAL A CB   2  
ATOM   8223   C CG1  . VAL A 1 76  ? -11.345 0.515  -17.167 0.010 20.10  ? 76   VAL A CG1  2  
ATOM   8224   C CG2  . VAL A 1 76  ? -13.823 0.885  -17.346 0.010 20.84  ? 76   VAL A CG2  2  
ATOM   8225   H H    . VAL A 1 76  ? -13.719 3.407  -15.355 0.010 19.35  ? 76   VAL A H    2  
ATOM   8226   H HA   . VAL A 1 76  ? -12.602 0.968  -14.921 0.010 21.02  ? 76   VAL A HA   2  
ATOM   8227   H HB   . VAL A 1 76  ? -12.384 2.286  -17.390 0.010 19.09  ? 76   VAL A HB   2  
ATOM   8228   H HG11 . VAL A 1 76  ? -11.183 -0.019 -16.374 0.010 20.71  ? 76   VAL A HG11 2  
ATOM   8229   H HG12 . VAL A 1 76  ? -11.563 -0.067 -17.914 0.010 20.53  ? 76   VAL A HG12 2  
ATOM   8230   H HG13 . VAL A 1 76  ? -10.557 1.046  -17.376 0.010 19.34  ? 76   VAL A HG13 2  
ATOM   8231   H HG21 . VAL A 1 76  ? -14.520 1.552  -17.247 0.010 20.56  ? 76   VAL A HG21 2  
ATOM   8232   H HG22 . VAL A 1 76  ? -13.744 0.630  -18.277 0.010 20.99  ? 76   VAL A HG22 2  
ATOM   8233   H HG23 . VAL A 1 76  ? -14.029 0.104  -16.810 0.010 21.71  ? 76   VAL A HG23 2  
ATOM   8234   N N    . PRO A 1 77  ? -10.889 2.404  -13.730 0.010 20.06  ? 77   PRO A N    2  
ATOM   8235   C CA   . PRO A 1 77  ? -9.649  3.005  -13.248 0.010 19.75  ? 77   PRO A CA   2  
ATOM   8236   C C    . PRO A 1 77  ? -8.501  2.229  -13.860 0.010 19.72  ? 77   PRO A C    2  
ATOM   8237   O O    . PRO A 1 77  ? -8.650  1.035  -14.118 0.010 20.49  ? 77   PRO A O    2  
ATOM   8238   C CB   . PRO A 1 77  ? -9.704  2.771  -11.731 0.010 21.00  ? 77   PRO A CB   2  
ATOM   8239   C CG   . PRO A 1 77  ? -10.655 1.697  -11.536 0.010 22.02  ? 77   PRO A CG   2  
ATOM   8240   C CD   . PRO A 1 77  ? -11.534 1.563  -12.711 0.010 21.42  ? 77   PRO A CD   2  
ATOM   8241   H HA   . PRO A 1 77  ? -9.591  3.947  -13.462 0.010 19.04  ? 77   PRO A HA   2  
ATOM   8242   H HB2  . PRO A 1 77  ? -8.830  2.503  -11.410 0.010 21.35  ? 77   PRO A HB2  2  
ATOM   8243   H HB3  . PRO A 1 77  ? -9.999  3.575  -11.277 0.010 20.90  ? 77   PRO A HB3  2  
ATOM   8244   H HG2  . PRO A 1 77  ? -10.170 0.870  -11.389 0.010 22.71  ? 77   PRO A HG2  2  
ATOM   8245   H HG3  . PRO A 1 77  ? -11.197 1.904  -10.759 0.010 22.57  ? 77   PRO A HG3  2  
ATOM   8246   H HD2  . PRO A 1 77  ? -11.562 0.644  -13.009 0.010 22.00  ? 77   PRO A HD2  2  
ATOM   8247   H HD3  . PRO A 1 77  ? -12.420 1.894  -12.504 0.010 21.45  ? 77   PRO A HD3  2  
ATOM   8248   N N    . HIS A 1 78  ? -7.391  2.886  -14.118 0.010 18.99  ? 78   HIS A N    2  
ATOM   8249   C CA   . HIS A 1 78  ? -6.237  2.161  -14.624 0.010 19.03  ? 78   HIS A CA   2  
ATOM   8250   C C    . HIS A 1 78  ? -5.935  1.049  -13.603 0.010 20.39  ? 78   HIS A C    2  
ATOM   8251   O O    . HIS A 1 78  ? -5.815  1.312  -12.428 0.010 21.03  ? 78   HIS A O    2  
ATOM   8252   C CB   . HIS A 1 78  ? -5.045  3.076  -14.745 0.010 18.31  ? 78   HIS A CB   2  
ATOM   8253   C CG   . HIS A 1 78  ? -3.966  2.516  -15.609 0.010 18.22  ? 78   HIS A CG   2  
ATOM   8254   N ND1  . HIS A 1 78  ? -3.227  1.415  -15.256 0.010 19.16  ? 78   HIS A ND1  2  
ATOM   8255   C CD2  . HIS A 1 78  ? -3.502  2.910  -16.812 0.010 17.50  ? 78   HIS A CD2  2  
ATOM   8256   C CE1  . HIS A 1 78  ? -2.349  1.150  -16.200 0.010 18.97  ? 78   HIS A CE1  2  
ATOM   8257   N NE2  . HIS A 1 78  ? -2.492  2.049  -17.156 0.010 17.98  ? 78   HIS A NE2  2  
ATOM   8258   H H    . HIS A 1 78  ? -7.272  3.724  -14.002 0.010 18.55  ? 78   HIS A H    2  
ATOM   8259   H HA   . HIS A 1 78  ? -6.429  1.795  -15.499 0.010 18.83  ? 78   HIS A HA   2  
ATOM   8260   H HB2  . HIS A 1 78  ? -5.326  3.925  -15.121 0.010 17.63  ? 78   HIS A HB2  2  
ATOM   8261   H HB3  . HIS A 1 78  ? -4.673  3.220  -13.861 0.010 18.72  ? 78   HIS A HB3  2  
ATOM   8262   H HD1  . HIS A 1 78  ? -3.316  0.974  -14.554 0.010 19.82  ? 78   HIS A HD1  2  
ATOM   8263   H HD2  . HIS A 1 78  ? -3.809  3.636  -17.304 0.010 16.90  ? 78   HIS A HD2  2  
ATOM   8264   H HE1  . HIS A 1 78  ? -1.737  0.454  -16.189 0.010 19.54  ? 78   HIS A HE1  2  
ATOM   8265   H HE2  . HIS A 1 78  ? -2.034  2.086  -17.879 0.010 17.76  ? 78   HIS A HE2  2  
ATOM   8266   N N    . PRO A 1 79  ? -5.821  -0.200 -14.049 0.010 21.02  ? 79   PRO A N    2  
ATOM   8267   C CA   . PRO A 1 79  ? -5.578  -1.230 -13.017 0.010 22.50  ? 79   PRO A CA   2  
ATOM   8268   C C    . PRO A 1 79  ? -4.191  -1.173 -12.336 0.010 22.89  ? 79   PRO A C    2  
ATOM   8269   O O    . PRO A 1 79  ? -3.894  -2.004 -11.474 0.010 24.21  ? 79   PRO A O    2  
ATOM   8270   C CB   . PRO A 1 79  ? -5.817  -2.567 -13.763 0.010 22.84  ? 79   PRO A CB   2  
ATOM   8271   C CG   . PRO A 1 79  ? -6.444  -2.216 -15.068 0.010 21.96  ? 79   PRO A CG   2  
ATOM   8272   C CD   . PRO A 1 79  ? -5.985  -0.773 -15.385 0.010 20.58  ? 79   PRO A CD   2  
ATOM   8273   H HA   . PRO A 1 79  ? -6.245  -1.158 -12.320 0.010 23.20  ? 79   PRO A HA   2  
ATOM   8274   H HB2  . PRO A 1 79  ? -4.975  -3.026 -13.903 0.010 22.64  ? 79   PRO A HB2  2  
ATOM   8275   H HB3  . PRO A 1 79  ? -6.422  -3.115 -13.242 0.010 23.93  ? 79   PRO A HB3  2  
ATOM   8276   H HG2  . PRO A 1 79  ? -6.136  -2.835 -15.746 0.010 21.88  ? 79   PRO A HG2  2  
ATOM   8277   H HG3  . PRO A 1 79  ? -7.408  -2.263 -14.984 0.010 22.51  ? 79   PRO A HG3  2  
ATOM   8278   H HD2  . PRO A 1 79  ? -5.137  -0.770 -15.853 0.010 19.99  ? 79   PRO A HD2  2  
ATOM   8279   H HD3  . PRO A 1 79  ? -6.661  -0.300 -15.888 0.010 20.27  ? 79   PRO A HD3  2  
ATOM   8280   N N    . ASP A 1 80  ? -3.362  -0.201 -12.703 0.010 21.97  ? 80   ASP A N    2  
ATOM   8281   C CA   . ASP A 1 80  ? -2.015  -0.048 -12.103 0.010 22.45  ? 80   ASP A CA   2  
ATOM   8282   C C    . ASP A 1 80  ? -2.074  1.140  -11.135 0.010 22.30  ? 80   ASP A C    2  
ATOM   8283   O O    . ASP A 1 80  ? -1.109  1.426  -10.439 0.010 22.81  ? 80   ASP A O    2  
ATOM   8284   C CB   . ASP A 1 80  ? -0.881  0.136  -13.159 0.010 21.82  ? 80   ASP A CB   2  
ATOM   8285   C CG   . ASP A 1 80  ? -0.507  -1.175 -13.879 0.010 22.42  ? 80   ASP A CG   2  
ATOM   8286   O OD1  . ASP A 1 80  ? -0.178  -2.144 -13.175 0.010 23.84  ? 80   ASP A OD1  2  
ATOM   8287   O OD2  . ASP A 1 80  ? -0.552  -1.246 -15.133 0.010 21.67  ? 80   ASP A OD2  2  
ATOM   8288   H H    . ASP A 1 80  ? -3.574  0.407  -13.237 0.010 21.21  ? 80   ASP A H    2  
ATOM   8289   H HA   . ASP A 1 80  ? -1.796  -0.835 -11.581 0.010 23.54  ? 80   ASP A HA   2  
ATOM   8290   H HB2  . ASP A 1 80  ? -1.147  0.791  -13.822 0.010 20.84  ? 80   ASP A HB2  2  
ATOM   8291   H HB3  . ASP A 1 80  ? -0.084  0.439  -12.701 0.010 22.17  ? 80   ASP A HB3  2  
ATOM   8292   N N    . SER A 1 81  ? -3.229  1.824  -11.097 0.010 21.78  ? 81   SER A N    2  
ATOM   8293   C CA   . SER A 1 81  ? -3.479  2.885  -10.139 0.010 21.90  ? 81   SER A CA   2  
ATOM   8294   C C    . SER A 1 81  ? -3.627  2.344  -8.736  0.010 23.60  ? 81   SER A C    2  
ATOM   8295   O O    . SER A 1 81  ? -4.088  1.221  -8.536  0.010 24.59  ? 81   SER A O    2  
ATOM   8296   C CB   . SER A 1 81  ? -4.755  3.668  -10.511 0.010 21.07  ? 81   SER A CB   2  
ATOM   8297   O OG   . SER A 1 81  ? -5.898  2.860  -10.418 0.010 21.73  ? 81   SER A OG   2  
ATOM   8298   H H    . SER A 1 81  ? -3.888  1.697  -11.631 0.010 21.43  ? 81   SER A H    2  
ATOM   8299   H HA   . SER A 1 81  ? -2.734  3.504  -10.149 0.010 21.58  ? 81   SER A HA   2  
ATOM   8300   H HB2  . SER A 1 81  ? -4.849  4.421  -9.909  0.010 21.13  ? 81   SER A HB2  2  
ATOM   8301   H HB3  . SER A 1 81  ? -4.683  3.987  -11.421 0.010 20.14  ? 81   SER A HB3  2  
ATOM   8302   H HG   . SER A 1 81  ? -6.533  3.201  -10.866 0.010 21.18  ? 81   SER A HG   2  
ATOM   8303   N N    . GLN A 1 82  ? -3.260  3.169  -7.764  0.010 24.15  ? 82   GLN A N    2  
ATOM   8304   C CA   . GLN A 1 82  ? -3.236  2.766  -6.353  0.010 26.05  ? 82   GLN A CA   2  
ATOM   8305   C C    . GLN A 1 82  ? -3.406  4.017  -5.517  0.010 26.47  ? 82   GLN A C    2  
ATOM   8306   O O    . GLN A 1 82  ? -2.896  5.075  -5.864  0.010 25.79  ? 82   GLN A O    2  
ATOM   8307   C CB   . GLN A 1 82  ? -1.921  2.020  -6.002  0.010 26.88  ? 82   GLN A CB   2  
ATOM   8308   C CG   . GLN A 1 82  ? -1.471  2.094  -4.554  0.010 29.07  ? 82   GLN A CG   2  
ATOM   8309   C CD   . GLN A 1 82  ? -0.614  0.886  -4.101  0.010 30.04  ? 82   GLN A CD   2  
ATOM   8310   O OE1  . GLN A 1 82  ? 0.572   0.778  -4.440  0.010 30.69  ? 82   GLN A OE1  2  
ATOM   8311   N NE2  . GLN A 1 82  ? -1.225  -0.022 -3.328  0.010 30.32  ? 82   GLN A NE2  2  
ATOM   8312   H H    . GLN A 1 82  ? -3.005  3.978  -7.895  0.010 23.57  ? 82   GLN A H    2  
ATOM   8313   H HA   . GLN A 1 82  ? -3.979  2.170  -6.182  0.010 26.67  ? 82   GLN A HA   2  
ATOM   8314   H HB2  . GLN A 1 82  ? -2.031  1.081  -6.216  0.010 26.51  ? 82   GLN A HB2  2  
ATOM   8315   H HB3  . GLN A 1 82  ? -1.205  2.390  -6.540  0.010 26.48  ? 82   GLN A HB3  2  
ATOM   8316   H HG2  . GLN A 1 82  ? -0.928  2.890  -4.457  0.010 29.58  ? 82   GLN A HG2  2  
ATOM   8317   H HG3  . GLN A 1 82  ? -2.245  2.147  -3.975  0.010 29.60  ? 82   GLN A HG3  2  
ATOM   8318   H HE21 . GLN A 1 82  ? -1.907  0.204  -2.853  0.010 29.67  ? 82   GLN A HE21 2  
ATOM   8319   H HE22 . GLN A 1 82  ? -0.940  -0.834 -3.310  0.010 31.24  ? 82   GLN A HE22 2  
ATOM   8320   N N    . PRO A 1 83  ? -4.142  3.907  -4.409  0.010 27.76  ? 83   PRO A N    2  
ATOM   8321   C CA   . PRO A 1 83  ? -4.386  5.091  -3.579  0.010 28.15  ? 83   PRO A CA   2  
ATOM   8322   C C    . PRO A 1 83  ? -3.128  5.691  -2.969  0.010 29.17  ? 83   PRO A C    2  
ATOM   8323   O O    . PRO A 1 83  ? -3.147  6.841  -2.529  0.010 29.44  ? 83   PRO A O    2  
ATOM   8324   C CB   . PRO A 1 83  ? -5.286  4.547  -2.477  0.010 29.70  ? 83   PRO A CB   2  
ATOM   8325   C CG   . PRO A 1 83  ? -5.031  3.099  -2.463  0.010 30.42  ? 83   PRO A CG   2  
ATOM   8326   C CD   . PRO A 1 83  ? -4.878  2.743  -3.891  0.010 28.96  ? 83   PRO A CD   2  
ATOM   8327   H HA   . PRO A 1 83  ? -4.859  5.773  -4.091  0.010 26.95  ? 83   PRO A HA   2  
ATOM   8328   H HB2  . PRO A 1 83  ? -5.044  4.953  -1.633  0.010 30.97  ? 83   PRO A HB2  2  
ATOM   8329   H HB3  . PRO A 1 83  ? -6.212  4.727  -2.701  0.010 29.05  ? 83   PRO A HB3  2  
ATOM   8330   H HG2  . PRO A 1 83  ? -4.209  2.920  -1.980  0.010 31.86  ? 83   PRO A HG2  2  
ATOM   8331   H HG3  . PRO A 1 83  ? -5.779  2.632  -2.058  0.010 30.56  ? 83   PRO A HG3  2  
ATOM   8332   H HD2  . PRO A 1 83  ? -4.365  1.928  -3.988  0.010 29.77  ? 83   PRO A HD2  2  
ATOM   8333   H HD3  . PRO A 1 83  ? -5.748  2.672  -4.313  0.010 28.14  ? 83   PRO A HD3  2  
ATOM   8334   N N    . ASP A 1 84  ? -2.053  4.910  -2.943  0.010 29.83  ? 84   ASP A N    2  
ATOM   8335   C CA   . ASP A 1 84  ? -0.798  5.321  -2.323  0.010 30.95  ? 84   ASP A CA   2  
ATOM   8336   C C    . ASP A 1 84  ? 0.079   6.242  -3.192  0.010 29.54  ? 84   ASP A C    2  
ATOM   8337   O O    . ASP A 1 84  ? 1.074   6.786  -2.715  0.010 30.32  ? 84   ASP A O    2  
ATOM   8338   C CB   . ASP A 1 84  ? 0.000   4.075  -1.921  0.010 32.87  ? 84   ASP A CB   2  
ATOM   8339   C CG   . ASP A 1 84  ? -0.250  3.663  -0.474  0.010 35.42  ? 84   ASP A CG   2  
ATOM   8340   O OD1  . ASP A 1 84  ? -1.432  3.573  -0.046  0.010 35.64  ? 84   ASP A OD1  2  
ATOM   8341   O OD2  . ASP A 1 84  ? 0.743   3.444  0.246   0.010 37.37  ? 84   ASP A OD2  2  
ATOM   8342   H H    . ASP A 1 84  ? -2.031  4.122  -3.275  0.010 29.76  ? 84   ASP A H    2  
ATOM   8343   H HA   . ASP A 1 84  ? -1.002  5.803  -1.508  0.010 31.68  ? 84   ASP A HA   2  
ATOM   8344   H HB2  . ASP A 1 84  ? -0.256  3.333  -2.486  0.010 32.69  ? 84   ASP A HB2  2  
ATOM   8345   H HB3  . ASP A 1 84  ? 0.946   4.250  -2.027  0.010 32.83  ? 84   ASP A HB3  2  
ATOM   8346   N N    . THR A 1 85  ? -0.301  6.456  -4.443  0.010 27.70  ? 85   THR A N    2  
ATOM   8347   C CA   . THR A 1 85  ? 0.641   6.974  -5.432  0.010 26.45  ? 85   THR A CA   2  
ATOM   8348   C C    . THR A 1 85  ? 0.003   7.939  -6.435  0.010 24.86  ? 85   THR A C    2  
ATOM   8349   O O    . THR A 1 85  ? -1.208  7.950  -6.595  0.010 24.46  ? 85   THR A O    2  
ATOM   8350   C CB   . THR A 1 85  ? 1.210   5.803  -6.245  0.010 25.63  ? 85   THR A CB   2  
ATOM   8351   O OG1  . THR A 1 85  ? 0.132   5.206  -6.954  0.010 24.60  ? 85   THR A OG1  2  
ATOM   8352   C CG2  . THR A 1 85  ? 1.879   4.744  -5.315  0.010 27.29  ? 85   THR A CG2  2  
ATOM   8353   H H    . THR A 1 85  ? -1.095  6.316  -4.744  0.010 27.24  ? 85   THR A H    2  
ATOM   8354   H HA   . THR A 1 85  ? 1.374   7.430  -4.993  0.010 27.24  ? 85   THR A HA   2  
ATOM   8355   H HB   . THR A 1 85  ? 1.873   6.126  -6.876  0.010 24.91  ? 85   THR A HB   2  
ATOM   8356   H HG1  . THR A 1 85  ? -0.497  5.027  -6.414  0.010 25.24  ? 85   THR A HG1  2  
ATOM   8357   H HG21 . THR A 1 85  ? 2.541   5.166  -4.747  0.010 28.04  ? 85   THR A HG21 2  
ATOM   8358   H HG22 . THR A 1 85  ? 1.207   4.321  -4.758  0.010 28.18  ? 85   THR A HG22 2  
ATOM   8359   H HG23 . THR A 1 85  ? 2.316   4.059  -5.846  0.010 26.85  ? 85   THR A HG23 2  
ATOM   8360   N N    . ILE A 1 86  ? 0.843   8.725  -7.107  0.010 24.12  ? 86   ILE A N    2  
ATOM   8361   C CA   . ILE A 1 86  ? 0.429   9.611  -8.191  0.010 22.65  ? 86   ILE A CA   2  
ATOM   8362   C C    . ILE A 1 86  ? 0.475   8.923  -9.577  0.010 21.16  ? 86   ILE A C    2  
ATOM   8363   O O    . ILE A 1 86  ? 0.221   9.543  -10.596 0.010 20.02  ? 86   ILE A O    2  
ATOM   8364   C CB   . ILE A 1 86  ? 1.350   10.862 -8.270  0.010 22.74  ? 86   ILE A CB   2  
ATOM   8365   C CG1  . ILE A 1 86  ? 2.823   10.447 -8.415  0.010 22.94  ? 86   ILE A CG1  2  
ATOM   8366   C CG2  . ILE A 1 86  ? 1.177   11.730 -7.052  0.010 24.31  ? 86   ILE A CG2  2  
ATOM   8367   C CD1  . ILE A 1 86  ? 3.814   11.630 -8.374  0.010 23.06  ? 86   ILE A CD1  2  
ATOM   8368   H H    . ILE A 1 86  ? 1.680   8.759  -6.941  0.010 24.54  ? 86   ILE A H    2  
ATOM   8369   H HA   . ILE A 1 86  ? -0.476  9.917  -8.027  0.010 22.69  ? 86   ILE A HA   2  
ATOM   8370   H HB   . ILE A 1 86  ? 1.098   11.379 -9.051  0.010 21.80  ? 86   ILE A HB   2  
ATOM   8371   H HG12 . ILE A 1 86  ? 3.059   9.864  -7.682  0.010 24.00  ? 86   ILE A HG12 2  
ATOM   8372   H HG13 . ILE A 1 86  ? 2.943   9.982  -9.255  0.010 22.09  ? 86   ILE A HG13 2  
ATOM   8373   H HG21 . ILE A 1 86  ? 0.240   11.727 -6.798  0.010 24.42  ? 86   ILE A HG21 2  
ATOM   8374   H HG22 . ILE A 1 86  ? 1.718   11.373 -6.329  0.010 25.38  ? 86   ILE A HG22 2  
ATOM   8375   H HG23 . ILE A 1 86  ? 1.460   12.633 -7.264  0.010 24.27  ? 86   ILE A HG23 2  
ATOM   8376   H HD11 . ILE A 1 86  ? 3.472   12.353 -8.927  0.010 22.68  ? 86   ILE A HD11 2  
ATOM   8377   H HD12 . ILE A 1 86  ? 3.911   11.932 -7.457  0.010 24.26  ? 86   ILE A HD12 2  
ATOM   8378   H HD13 . ILE A 1 86  ? 4.676   11.333 -8.708  0.010 22.47  ? 86   ILE A HD13 2  
ATOM   8379   N N    . ASP A 1 87  ? 0.828   7.645  -9.616  0.010 21.39  ? 87   ASP A N    2  
ATOM   8380   C CA   . ASP A 1 87  ? 1.103   6.987  -10.887 0.010 20.33  ? 87   ASP A CA   2  
ATOM   8381   C C    . ASP A 1 87  ? -0.149  6.336  -11.519 0.010 19.64  ? 87   ASP A C    2  
ATOM   8382   O O    . ASP A 1 87  ? -0.979  5.803  -10.811 0.010 20.27  ? 87   ASP A O    2  
ATOM   8383   C CB   . ASP A 1 87  ? 2.203   5.931  -10.644 0.010 21.15  ? 87   ASP A CB   2  
ATOM   8384   C CG   . ASP A 1 87  ? 3.434   6.526  -9.959  0.010 22.07  ? 87   ASP A CG   2  
ATOM   8385   O OD1  . ASP A 1 87  ? 3.966   7.539  -10.467 0.010 21.58  ? 87   ASP A OD1  2  
ATOM   8386   O OD2  . ASP A 1 87  ? 3.863   5.993  -8.910  0.010 23.43  ? 87   ASP A OD2  2  
ATOM   8387   H H    . ASP A 1 87  ? 0.917   7.139  -8.929  0.010 22.29  ? 87   ASP A H    2  
ATOM   8388   H HA   . ASP A 1 87  ? 1.449   7.635  -11.517 0.010 19.71  ? 87   ASP A HA   2  
ATOM   8389   H HB2  . ASP A 1 87  ? 1.849   5.231  -10.078 0.010 21.84  ? 87   ASP A HB2  2  
ATOM   8390   H HB3  . ASP A 1 87  ? 2.480   5.561  -11.494 0.010 20.57  ? 87   ASP A HB3  2  
ATOM   8391   N N    . HIS A 1 88  ? -0.251  6.374  -12.846 0.010 18.54  ? 88   HIS A N    2  
ATOM   8392   C CA   . HIS A 1 88  ? -1.287  5.656  -13.580 0.010 18.09  ? 88   HIS A CA   2  
ATOM   8393   C C    . HIS A 1 88  ? -2.695  6.130  -13.159 0.010 18.03  ? 88   HIS A C    2  
ATOM   8394   O O    . HIS A 1 88  ? -3.622  5.347  -13.082 0.010 18.30  ? 88   HIS A O    2  
ATOM   8395   C CB   . HIS A 1 88  ? -1.142  4.144  -13.358 0.010 18.94  ? 88   HIS A CB   2  
ATOM   8396   C CG   . HIS A 1 88  ? 0.278   3.684  -13.353 0.010 19.39  ? 88   HIS A CG   2  
ATOM   8397   N ND1  . HIS A 1 88  ? 1.163   3.992  -14.367 0.010 18.73  ? 88   HIS A ND1  2  
ATOM   8398   C CD2  . HIS A 1 88  ? 0.985   2.981  -12.438 0.010 20.57  ? 88   HIS A CD2  2  
ATOM   8399   C CE1  . HIS A 1 88  ? 2.348   3.473  -14.086 0.010 19.43  ? 88   HIS A CE1  2  
ATOM   8400   N NE2  . HIS A 1 88  ? 2.266   2.856  -12.918 0.010 20.55  ? 88   HIS A NE2  2  
ATOM   8401   H H    . HIS A 1 88  ? 0.276   6.814  -13.354 0.010 18.14  ? 88   HIS A H    2  
ATOM   8402   H HA   . HIS A 1 88  ? -1.179  5.831  -14.526 0.010 17.44  ? 88   HIS A HA   2  
ATOM   8403   H HB2  . HIS A 1 88  ? -1.530  3.906  -12.503 0.010 19.63  ? 88   HIS A HB2  2  
ATOM   8404   H HB3  . HIS A 1 88  ? -1.607  3.679  -14.068 0.010 18.66  ? 88   HIS A HB3  2  
ATOM   8405   H HD1  . HIS A 1 88  ? 0.973   4.433  -15.076 0.010 18.06  ? 88   HIS A HD1  2  
ATOM   8406   H HD2  . HIS A 1 88  ? 0.665   2.636  -11.636 0.010 21.35  ? 88   HIS A HD2  2  
ATOM   8407   H HE1  . HIS A 1 88  ? 3.106   3.533  -14.618 0.010 19.25  ? 88   HIS A HE1  2  
ATOM   8408   H HE2  . HIS A 1 88  ? 2.905   2.444  -12.523 0.010 21.24  ? 88   HIS A HE2  2  
ATOM   8409   N N    . ASP A 1 89  ? -2.810  7.423  -12.867 0.010 17.81  ? 89   ASP A N    2  
ATOM   8410   C CA   . ASP A 1 89  ? -3.998  7.956  -12.174 0.010 18.10  ? 89   ASP A CA   2  
ATOM   8411   C C    . ASP A 1 89  ? -5.043  8.380  -13.182 0.010 17.19  ? 89   ASP A C    2  
ATOM   8412   O O    . ASP A 1 89  ? -5.406  9.569  -13.275 0.010 16.92  ? 89   ASP A O    2  
ATOM   8413   C CB   . ASP A 1 89  ? -3.594  9.137  -11.276 0.010 18.68  ? 89   ASP A CB   2  
ATOM   8414   C CG   . ASP A 1 89  ? -4.758  9.689  -10.458 0.010 19.25  ? 89   ASP A CG   2  
ATOM   8415   O OD1  . ASP A 1 89  ? -5.675  8.899  -10.102 0.010 19.60  ? 89   ASP A OD1  2  
ATOM   8416   O OD2  . ASP A 1 89  ? -4.728  10.910 -10.138 0.010 19.51  ? 89   ASP A OD2  2  
ATOM   8417   H H    . ASP A 1 89  ? -2.222  8.013  -13.059 0.010 17.60  ? 89   ASP A H    2  
ATOM   8418   H HA   . ASP A 1 89  ? -4.384  7.266  -11.612 0.010 18.71  ? 89   ASP A HA   2  
ATOM   8419   H HB2  . ASP A 1 89  ? -2.914  8.844  -10.657 0.010 19.37  ? 89   ASP A HB2  2  
ATOM   8420   H HB3  . ASP A 1 89  ? -3.245  9.844  -11.838 0.010 18.17  ? 89   ASP A HB3  2  
ATOM   8421   N N    . LEU A 1 90  ? -5.501  7.407  -13.961 0.010 16.89  ? 90   LEU A N    2  
ATOM   8422   C CA   . LEU A 1 90  ? -6.488  7.645  -14.986 0.010 16.22  ? 90   LEU A CA   2  
ATOM   8423   C C    . LEU A 1 90  ? -7.734  6.826  -14.736 0.010 16.67  ? 90   LEU A C    2  
ATOM   8424   O O    . LEU A 1 90  ? -7.691  5.773  -14.117 0.010 17.43  ? 90   LEU A O    2  
ATOM   8425   C CB   . LEU A 1 90  ? -5.959  7.336  -16.381 0.010 15.64  ? 90   LEU A CB   2  
ATOM   8426   C CG   . LEU A 1 90  ? -4.798  8.216  -16.873 0.010 15.20  ? 90   LEU A CG   2  
ATOM   8427   C CD1  . LEU A 1 90  ? -4.372  7.844  -18.261 0.010 14.87  ? 90   LEU A CD1  2  
ATOM   8428   C CD2  . LEU A 1 90  ? -5.186  9.698  -16.829 0.010 14.90  ? 90   LEU A CD2  2  
ATOM   8429   H H    . LEU A 1 90  ? -5.247  6.592  -13.909 0.010 17.18  ? 90   LEU A H    2  
ATOM   8430   H HA   . LEU A 1 90  ? -6.751  8.577  -14.969 0.010 16.00  ? 90   LEU A HA   2  
ATOM   8431   H HB2  . LEU A 1 90  ? -5.664  6.415  -16.405 0.010 15.94  ? 90   LEU A HB2  2  
ATOM   8432   H HB3  . LEU A 1 90  ? -6.684  7.448  -17.010 0.010 15.38  ? 90   LEU A HB3  2  
ATOM   8433   H HG   . LEU A 1 90  ? -4.042  8.081  -16.288 0.010 15.51  ? 90   LEU A HG   2  
ATOM   8434   H HD11 . LEU A 1 90  ? -4.423  6.882  -18.359 0.010 15.06  ? 90   LEU A HD11 2  
ATOM   8435   H HD12 . LEU A 1 90  ? -4.961  8.269  -18.902 0.010 14.53  ? 90   LEU A HD12 2  
ATOM   8436   H HD13 . LEU A 1 90  ? -3.461  8.134  -18.402 0.010 14.94  ? 90   LEU A HD13 2  
ATOM   8437   H HD21 . LEU A 1 90  ? -6.058  9.819  -17.232 0.010 14.67  ? 90   LEU A HD21 2  
ATOM   8438   H HD22 . LEU A 1 90  ? -5.204  9.980  -15.905 0.010 15.25  ? 90   LEU A HD22 2  
ATOM   8439   H HD23 . LEU A 1 90  ? -4.528  10.212 -17.314 0.010 14.74  ? 90   LEU A HD23 2  
ATOM   8440   N N    . LEU A 1 91  ? -8.834  7.337  -15.266 0.010 16.32  ? 91   LEU A N    2  
ATOM   8441   C CA   . LEU A 1 91  ? -10.145 6.769  -15.034 0.010 16.82  ? 91   LEU A CA   2  
ATOM   8442   C C    . LEU A 1 91  ? -11.003 7.009  -16.263 0.010 16.32  ? 91   LEU A C    2  
ATOM   8443   O O    . LEU A 1 91  ? -11.161 8.143  -16.706 0.010 15.79  ? 91   LEU A O    2  
ATOM   8444   C CB   . LEU A 1 91  ? -10.778 7.435  -13.817 0.010 17.35  ? 91   LEU A CB   2  
ATOM   8445   C CG   . LEU A 1 91  ? -12.240 7.064  -13.551 0.010 17.83  ? 91   LEU A CG   2  
ATOM   8446   C CD1  . LEU A 1 91  ? -12.345 5.674  -12.998 0.010 18.66  ? 91   LEU A CD1  2  
ATOM   8447   C CD2  . LEU A 1 91  ? -12.838 8.074  -12.592 0.010 18.41  ? 91   LEU A CD2  2  
ATOM   8448   H H    . LEU A 1 91  ? -8.839  8.021  -15.778 0.010 15.87  ? 91   LEU A H    2  
ATOM   8449   H HA   . LEU A 1 91  ? -10.080 5.818  -14.870 0.010 17.29  ? 91   LEU A HA   2  
ATOM   8450   H HB2  . LEU A 1 91  ? -10.266 7.190  -13.034 0.010 17.90  ? 91   LEU A HB2  2  
ATOM   8451   H HB3  . LEU A 1 91  ? -10.735 8.396  -13.934 0.010 17.00  ? 91   LEU A HB3  2  
ATOM   8452   H HG   . LEU A 1 91  ? -12.752 7.104  -14.373 0.010 17.38  ? 91   LEU A HG   2  
ATOM   8453   H HD11 . LEU A 1 91  ? -11.868 5.059  -13.577 0.010 18.42  ? 91   LEU A HD11 2  
ATOM   8454   H HD12 . LEU A 1 91  ? -11.958 5.655  -12.111 0.010 19.25  ? 91   LEU A HD12 2  
ATOM   8455   H HD13 . LEU A 1 91  ? -13.281 5.425  -12.958 0.010 18.97  ? 91   LEU A HD13 2  
ATOM   8456   H HD21 . LEU A 1 91  ? -12.708 8.967  -12.946 0.010 17.99  ? 91   LEU A HD21 2  
ATOM   8457   H HD22 . LEU A 1 91  ? -13.782 7.888  -12.507 0.010 18.70  ? 91   LEU A HD22 2  
ATOM   8458   H HD23 . LEU A 1 91  ? -12.401 7.986  -11.733 0.010 19.03  ? 91   LEU A HD23 2  
ATOM   8459   N N    . LEU A 1 92  ? -11.513 5.942  -16.840 0.010 16.69  ? 92   LEU A N    2  
ATOM   8460   C CA   . LEU A 1 92  ? -12.419 6.077  -17.957 0.010 16.54  ? 92   LEU A CA   2  
ATOM   8461   C C    . LEU A 1 92  ? -13.823 5.758  -17.459 0.010 17.23  ? 92   LEU A C    2  
ATOM   8462   O O    . LEU A 1 92  ? -14.012 4.827  -16.695 0.010 18.03  ? 92   LEU A O    2  
ATOM   8463   C CB   . LEU A 1 92  ? -12.003 5.176  -19.112 0.010 16.68  ? 92   LEU A CB   2  
ATOM   8464   C CG   . LEU A 1 92  ? -10.918 5.727  -20.023 0.010 16.02  ? 92   LEU A CG   2  
ATOM   8465   C CD1  . LEU A 1 92  ? -10.445 4.603  -20.912 0.010 16.49  ? 92   LEU A CD1  2  
ATOM   8466   C CD2  . LEU A 1 92  ? -11.395 6.883  -20.871 0.010 15.63  ? 92   LEU A CD2  2  
ATOM   8467   H H    . LEU A 1 92  ? -11.356 5.136  -16.606 0.010 17.14  ? 92   LEU A H    2  
ATOM   8468   H HA   . LEU A 1 92  ? -12.422 6.985  -18.287 0.010 16.06  ? 92   LEU A HA   2  
ATOM   8469   H HB2  . LEU A 1 92  ? -11.673 4.340  -18.747 0.010 17.11  ? 92   LEU A HB2  2  
ATOM   8470   H HB3  . LEU A 1 92  ? -12.785 5.003  -19.658 0.010 16.96  ? 92   LEU A HB3  2  
ATOM   8471   H HG   . LEU A 1 92  ? -10.170 6.027  -19.487 0.010 15.73  ? 92   LEU A HG   2  
ATOM   8472   H HD11 . LEU A 1 92  ? -11.212 4.179  -21.323 0.010 17.06  ? 92   LEU A HD11 2  
ATOM   8473   H HD12 . LEU A 1 92  ? -9.863  4.965  -21.596 0.010 16.26  ? 92   LEU A HD12 2  
ATOM   8474   H HD13 . LEU A 1 92  ? -9.964  3.958  -20.372 0.010 16.57  ? 92   LEU A HD13 2  
ATOM   8475   H HD21 . LEU A 1 92  ? -11.798 7.549  -20.295 0.010 15.38  ? 92   LEU A HD21 2  
ATOM   8476   H HD22 . LEU A 1 92  ? -10.634 7.258  -21.334 0.010 15.40  ? 92   LEU A HD22 2  
ATOM   8477   H HD23 . LEU A 1 92  ? -12.040 6.571  -21.520 0.010 16.01  ? 92   LEU A HD23 2  
ATOM   8478   N N    . LEU A 1 93  ? -14.775 6.587  -17.876 0.010 17.04  ? 93   LEU A N    2  
ATOM   8479   C CA   . LEU A 1 93  ? -16.178 6.465  -17.496 0.010 17.70  ? 93   LEU A CA   2  
ATOM   8480   C C    . LEU A 1 93  ? -16.999 6.307  -18.759 0.010 17.88  ? 93   LEU A C    2  
ATOM   8481   O O    . LEU A 1 93  ? -16.961 7.173  -19.632 0.010 17.36  ? 93   LEU A O    2  
ATOM   8482   C CB   . LEU A 1 93  ? -16.628 7.744  -16.763 0.010 17.52  ? 93   LEU A CB   2  
ATOM   8483   C CG   . LEU A 1 93  ? -15.896 8.036  -15.459 0.010 17.63  ? 93   LEU A CG   2  
ATOM   8484   C CD1  . LEU A 1 93  ? -16.225 9.410  -14.914 0.010 17.60  ? 93   LEU A CD1  2  
ATOM   8485   C CD2  . LEU A 1 93  ? -16.206 6.959  -14.443 0.010 18.64  ? 93   LEU A CD2  2  
ATOM   8486   H H    . LEU A 1 93  ? -14.626 7.244  -18.403 0.010 16.59  ? 93   LEU A H    2  
ATOM   8487   H HA   . LEU A 1 93  ? -16.321 5.695  -16.930 0.010 18.30  ? 93   LEU A HA   2  
ATOM   8488   H HB2  . LEU A 1 93  ? -16.484 8.498  -17.351 0.010 17.01  ? 93   LEU A HB2  2  
ATOM   8489   H HB3  . LEU A 1 93  ? -17.571 7.671  -16.561 0.010 17.99  ? 93   LEU A HB3  2  
ATOM   8490   H HG   . LEU A 1 93  ? -14.941 8.012  -15.626 0.010 17.23  ? 93   LEU A HG   2  
ATOM   8491   H HD11 . LEU A 1 93  ? -17.185 9.547  -14.937 0.010 17.95  ? 93   LEU A HD11 2  
ATOM   8492   H HD12 . LEU A 1 93  ? -15.905 9.463  -13.999 0.010 17.91  ? 93   LEU A HD12 2  
ATOM   8493   H HD13 . LEU A 1 93  ? -15.782 10.080 -15.458 0.010 17.05  ? 93   LEU A HD13 2  
ATOM   8494   H HD21 . LEU A 1 93  ? -16.616 6.204  -14.885 0.010 18.75  ? 93   LEU A HD21 2  
ATOM   8495   H HD22 . LEU A 1 93  ? -15.388 6.681  -14.013 0.010 18.81  ? 93   LEU A HD22 2  
ATOM   8496   H HD23 . LEU A 1 93  ? -16.826 7.327  -13.805 0.010 19.11  ? 93   LEU A HD23 2  
ATOM   8497   N N    . GLN A 1 94  ? -17.722 5.188  -18.873 0.010 18.82  ? 94   GLN A N    2  
ATOM   8498   C CA   . GLN A 1 94  ? -18.612 4.979  -19.983 0.010 19.34  ? 94   GLN A CA   2  
ATOM   8499   C C    . GLN A 1 94  ? -20.019 5.535  -19.667 0.010 19.73  ? 94   GLN A C    2  
ATOM   8500   O O    . GLN A 1 94  ? -20.643 5.133  -18.696 0.010 20.40  ? 94   GLN A O    2  
ATOM   8501   C CB   . GLN A 1 94  ? -18.727 3.489  -20.326 0.010 20.46  ? 94   GLN A CB   2  
ATOM   8502   C CG   . GLN A 1 94  ? -19.177 3.330  -21.749 0.010 21.05  ? 94   GLN A CG   2  
ATOM   8503   C CD   . GLN A 1 94  ? -19.272 1.902  -22.175 0.010 22.47  ? 94   GLN A CD   2  
ATOM   8504   O OE1  . GLN A 1 94  ? -19.081 0.998  -21.365 0.010 22.83  ? 94   GLN A OE1  2  
ATOM   8505   N NE2  . GLN A 1 94  ? -19.555 1.679  -23.460 0.010 23.47  ? 94   GLN A NE2  2  
ATOM   8506   H H    . GLN A 1 94  ? -17.707 4.539  -18.316 0.010 19.29  ? 94   GLN A H    2  
ATOM   8507   H HA   . GLN A 1 94  ? -18.262 5.422  -20.767 0.010 18.93  ? 94   GLN A HA   2  
ATOM   8508   H HB2  . GLN A 1 94  ? -17.869 3.056  -20.227 0.010 20.33  ? 94   GLN A HB2  2  
ATOM   8509   H HB3  . GLN A 1 94  ? -19.373 3.073  -19.740 0.010 21.10  ? 94   GLN A HB3  2  
ATOM   8510   H HG2  . GLN A 1 94  ? -20.049 3.743  -21.857 0.010 21.17  ? 94   GLN A HG2  2  
ATOM   8511   H HG3  . GLN A 1 94  ? -18.535 3.769  -22.327 0.010 20.55  ? 94   GLN A HG3  2  
ATOM   8512   H HE21 . GLN A 1 94  ? -19.308 2.241  -24.062 0.010 23.22  ? 94   GLN A HE21 2  
ATOM   8513   H HE22 . GLN A 1 94  ? -19.988 0.971  -23.689 0.010 24.46  ? 94   GLN A HE22 2  
ATOM   8514   N N    . LEU A 1 95  ? -20.494 6.455  -20.498 0.010 19.43  ? 95   LEU A N    2  
ATOM   8515   C CA   . LEU A 1 95  ? -21.817 7.061  -20.305 0.010 19.86  ? 95   LEU A CA   2  
ATOM   8516   C C    . LEU A 1 95  ? -22.981 6.114  -20.644 0.010 21.14  ? 95   LEU A C    2  
ATOM   8517   O O    . LEU A 1 95  ? -22.803 5.160  -21.394 0.010 21.70  ? 95   LEU A O    2  
ATOM   8518   C CB   . LEU A 1 95  ? -21.934 8.292  -21.190 0.010 19.45  ? 95   LEU A CB   2  
ATOM   8519   C CG   . LEU A 1 95  ? -20.812 9.308  -21.001 0.010 18.39  ? 95   LEU A CG   2  
ATOM   8520   C CD1  . LEU A 1 95  ? -21.137 10.566 -21.756 0.010 18.29  ? 95   LEU A CD1  2  
ATOM   8521   C CD2  . LEU A 1 95  ? -20.601 9.557  -19.533 0.010 18.07  ? 95   LEU A CD2  2  
ATOM   8522   H H    . LEU A 1 95  ? -20.072 6.752  -21.183 0.010 19.06  ? 95   LEU A H    2  
ATOM   8523   H HA   . LEU A 1 95  ? -21.914 7.337  -19.382 0.010 19.77  ? 95   LEU A HA   2  
ATOM   8524   H HB2  . LEU A 1 95  ? -21.915 8.006  -22.118 0.010 19.77  ? 95   LEU A HB2  2  
ATOM   8525   H HB3  . LEU A 1 95  ? -22.779 8.733  -21.003 0.010 19.73  ? 95   LEU A HB3  2  
ATOM   8526   H HG   . LEU A 1 95  ? -19.990 8.947  -21.366 0.010 18.15  ? 95   LEU A HG   2  
ATOM   8527   H HD11 . LEU A 1 95  ? -21.359 10.349 -22.672 0.010 18.68  ? 95   LEU A HD11 2  
ATOM   8528   H HD12 . LEU A 1 95  ? -21.881 11.007 -21.323 0.010 18.51  ? 95   LEU A HD12 2  
ATOM   8529   H HD13 . LEU A 1 95  ? -20.355 11.138 -21.736 0.010 17.73  ? 95   LEU A HD13 2  
ATOM   8530   H HD21 . LEU A 1 95  ? -21.466 9.548  -19.103 0.010 18.52  ? 95   LEU A HD21 2  
ATOM   8531   H HD22 . LEU A 1 95  ? -20.046 8.848  -19.171 0.010 18.05  ? 95   LEU A HD22 2  
ATOM   8532   H HD23 . LEU A 1 95  ? -20.160 10.412 -19.411 0.010 17.58  ? 95   LEU A HD23 2  
ATOM   8533   N N    . SER A 1 96  ? -24.158 6.431  -20.070 0.010 21.75  ? 96   SER A N    2  
ATOM   8534   C CA   . SER A 1 96  ? -25.470 5.818  -20.358 0.010 23.12  ? 96   SER A CA   2  
ATOM   8535   C C    . SER A 1 96  ? -25.842 5.527  -21.821 0.010 23.70  ? 96   SER A C    2  
ATOM   8536   O O    . SER A 1 96  ? -26.183 4.406  -22.177 0.010 24.97  ? 96   SER A O    2  
ATOM   8537   C CB   . SER A 1 96  ? -26.574 6.671  -19.719 0.010 23.68  ? 96   SER A CB   2  
ATOM   8538   O OG   . SER A 1 96  ? -26.313 8.070  -19.787 0.010 22.94  ? 96   SER A OG   2  
ATOM   8539   H H    . SER A 1 96  ? -24.217 7.027  -19.457 0.010 21.48  ? 96   SER A H    2  
ATOM   8540   H HA   . SER A 1 96  ? -25.544 4.982  -19.897 0.010 23.55  ? 96   SER A HA   2  
ATOM   8541   H HB2  . SER A 1 96  ? -27.405 6.487  -20.181 0.010 24.59  ? 96   SER A HB2  2  
ATOM   8542   H HB3  . SER A 1 96  ? -26.649 6.417  -18.786 0.010 23.79  ? 96   SER A HB3  2  
ATOM   8543   H HG   . SER A 1 96  ? -26.847 8.492  -19.282 0.010 22.99  ? 96   SER A HG   2  
ATOM   8544   N N    . GLU A 1 97  ? -25.824 6.557  -22.647 0.010 22.99  ? 97   GLU A N    2  
ATOM   8545   C CA   . GLU A 1 97  ? -25.851 6.366  -24.093 0.010 23.53  ? 97   GLU A CA   2  
ATOM   8546   C C    . GLU A 1 97  ? -24.727 7.232  -24.587 0.010 22.54  ? 97   GLU A C    2  
ATOM   8547   O O    . GLU A 1 97  ? -24.048 7.873  -23.793 0.010 21.44  ? 97   GLU A O    2  
ATOM   8548   C CB   . GLU A 1 97  ? -27.193 6.788  -24.746 0.010 24.88  ? 97   GLU A CB   2  
ATOM   8549   C CG   . GLU A 1 97  ? -27.345 8.248  -25.295 0.010 24.69  ? 97   GLU A CG   2  
ATOM   8550   C CD   . GLU A 1 97  ? -27.853 8.330  -26.781 0.010 25.98  ? 97   GLU A CD   2  
ATOM   8551   O OE1  . GLU A 1 97  ? -27.353 9.192  -27.547 0.010 26.11  ? 97   GLU A OE1  2  
ATOM   8552   O OE2  . GLU A 1 97  ? -28.788 7.566  -27.184 0.010 27.05  ? 97   GLU A OE2  2  
ATOM   8553   H H    . GLU A 1 97  ? -25.785 7.378  -22.398 0.010 22.34  ? 97   GLU A H    2  
ATOM   8554   H HA   . GLU A 1 97  ? -25.664 5.443  -24.325 0.010 23.86  ? 97   GLU A HA   2  
ATOM   8555   H HB2  . GLU A 1 97  ? -27.351 6.193  -25.493 0.010 25.59  ? 97   GLU A HB2  2  
ATOM   8556   H HB3  . GLU A 1 97  ? -27.895 6.659  -24.087 0.010 25.41  ? 97   GLU A HB3  2  
ATOM   8557   H HG2  . GLU A 1 97  ? -28.008 8.698  -24.748 0.010 24.84  ? 97   GLU A HG2  2  
ATOM   8558   H HG3  . GLU A 1 97  ? -26.520 8.728  -25.216 0.010 23.79  ? 97   GLU A HG3  2  
ATOM   8559   N N    . LYS A 1 98  ? -24.579 7.318  -25.893 0.010 23.12  ? 98   LYS A N    2  
ATOM   8560   C CA   . LYS A 1 98  ? -23.527 8.148  -26.448 0.010 22.35  ? 98   LYS A CA   2  
ATOM   8561   C C    . LYS A 1 98  ? -23.991 9.629  -26.312 0.010 21.92  ? 98   LYS A C    2  
ATOM   8562   O O    . LYS A 1 98  ? -25.156 9.929  -26.508 0.010 22.67  ? 98   LYS A O    2  
ATOM   8563   C CB   . LYS A 1 98  ? -23.190 7.670  -27.873 0.010 23.32  ? 98   LYS A CB   2  
ATOM   8564   C CG   . LYS A 1 98  ? -23.592 8.598  -29.045 0.010 24.72  ? 98   LYS A CG   2  
ATOM   8565   C CD   . LYS A 1 98  ? -23.302 7.923  -30.406 0.010 25.83  ? 98   LYS A CD   2  
ATOM   8566   C CE   . LYS A 1 98  ? -24.007 8.630  -31.589 0.010 26.82  ? 98   LYS A CE   2  
ATOM   8567   N NZ   . LYS A 1 98  ? -23.222 8.652  -32.869 0.010 28.73  ? 98   LYS A NZ   2  
ATOM   8568   H H    . LYS A 1 98  ? -25.075 6.932  -26.477 0.010 24.04  ? 98   LYS A H    2  
ATOM   8569   H HA   . LYS A 1 98  ? -22.724 8.025  -25.920 0.010 21.57  ? 98   LYS A HA   2  
ATOM   8570   H HB2  . LYS A 1 98  ? -22.233 7.534  -27.908 0.010 22.79  ? 98   LYS A HB2  2  
ATOM   8571   H HB3  . LYS A 1 98  ? -23.628 6.816  -28.010 0.010 23.70  ? 98   LYS A HB3  2  
ATOM   8572   H HG2  . LYS A 1 98  ? -24.534 8.763  -28.989 0.010 25.40  ? 98   LYS A HG2  2  
ATOM   8573   H HG3  . LYS A 1 98  ? -23.130 9.455  -28.983 0.010 24.42  ? 98   LYS A HG3  2  
ATOM   8574   H HD2  . LYS A 1 98  ? -22.346 7.928  -30.568 0.010 25.19  ? 98   LYS A HD2  2  
ATOM   8575   H HD3  . LYS A 1 98  ? -23.615 7.007  -30.360 0.010 26.74  ? 98   LYS A HD3  2  
ATOM   8576   H HE2  . LYS A 1 98  ? -24.841 8.167  -31.769 0.010 27.01  ? 98   LYS A HE2  2  
ATOM   8577   H HE3  . LYS A 1 98  ? -24.196 9.547  -31.334 0.010 26.21  ? 98   LYS A HE3  2  
ATOM   8578   H HZ1  . LYS A 1 98  ? -22.360 8.787  -32.699 0.010 28.65  ? 98   LYS A HZ1  2  
ATOM   8579   H HZ2  . LYS A 1 98  ? -23.317 7.876  -33.293 0.010 29.44  ? 98   LYS A HZ2  2  
ATOM   8580   H HZ3  . LYS A 1 98  ? -23.519 9.307  -33.394 0.010 29.37  ? 98   LYS A HZ3  2  
ATOM   8581   N N    . ALA A 1 99  ? -23.111 10.543 -25.909 0.010 20.83  ? 99   ALA A N    2  
ATOM   8582   C CA   . ALA A 1 99  ? -23.543 11.901 -25.536 0.010 20.55  ? 99   ALA A CA   2  
ATOM   8583   C C    . ALA A 1 99  ? -24.214 12.630 -26.704 0.010 21.51  ? 99   ALA A C    2  
ATOM   8584   O O    . ALA A 1 99  ? -23.891 12.384 -27.858 0.010 21.96  ? 99   ALA A O    2  
ATOM   8585   C CB   . ALA A 1 99  ? -22.389 12.710 -25.004 0.010 19.48  ? 99   ALA A CB   2  
ATOM   8586   H H    . ALA A 1 99  ? -22.266 10.412 -25.854 0.010 20.33  ? 99   ALA A H    2  
ATOM   8587   H HA   . ALA A 1 99  ? -24.190 11.841 -24.818 0.010 20.62  ? 99   ALA A HA   2  
ATOM   8588   H HB1  . ALA A 1 99  ? -21.932 12.195 -24.321 0.010 19.00  ? 99   ALA A HB1  2  
ATOM   8589   H HB2  . ALA A 1 99  ? -21.786 12.922 -25.732 0.010 19.49  ? 99   ALA A HB2  2  
ATOM   8590   H HB3  . ALA A 1 99  ? -22.738 13.524 -24.613 0.010 19.42  ? 99   ALA A HB3  2  
ATOM   8591   N N    . THR A 1 100 ? -25.150 13.523 -26.397 0.010 22.00  ? 100  THR A N    2  
ATOM   8592   C CA   . THR A 1 100 ? -25.769 14.345 -27.428 0.010 22.95  ? 100  THR A CA   2  
ATOM   8593   C C    . THR A 1 100 ? -24.825 15.456 -27.782 0.010 22.36  ? 100  THR A C    2  
ATOM   8594   O O    . THR A 1 100 ? -24.454 16.238 -26.910 0.010 21.59  ? 100  THR A O    2  
ATOM   8595   C CB   . THR A 1 100 ? -27.096 14.981 -26.968 0.010 23.67  ? 100  THR A CB   2  
ATOM   8596   O OG1  . THR A 1 100 ? -27.995 13.967 -26.517 0.010 24.24  ? 100  THR A OG1  2  
ATOM   8597   C CG2  . THR A 1 100 ? -27.753 15.750 -28.113 0.010 24.89  ? 100  THR A CG2  2  
ATOM   8598   H H    . THR A 1 100 ? -25.436 13.676 -25.601 0.010 21.88  ? 100  THR A H    2  
ATOM   8599   H HA   . THR A 1 100 ? -25.929 13.815 -28.223 0.010 23.64  ? 100  THR A HA   2  
ATOM   8600   H HB   . THR A 1 100 ? -26.920 15.601 -26.244 0.010 23.12  ? 100  THR A HB   2  
ATOM   8601   H HG1  . THR A 1 100 ? -28.204 13.449 -27.158 0.010 24.98  ? 100  THR A HG1  2  
ATOM   8602   H HG21 . THR A 1 100 ? -27.862 15.166 -28.878 0.010 25.67  ? 100  THR A HG21 2  
ATOM   8603   H HG22 . THR A 1 100 ? -28.626 16.065 -27.834 0.010 25.27  ? 100  THR A HG22 2  
ATOM   8604   H HG23 . THR A 1 100 ? -27.211 16.512 -28.368 0.010 24.67  ? 100  THR A HG23 2  
ATOM   8605   N N    . LEU A 1 101 ? -24.460 15.519 -29.061 0.010 22.89  ? 101  LEU A N    2  
ATOM   8606   C CA   . LEU A 1 101 ? -23.498 16.484 -29.589 0.010 22.56  ? 101  LEU A CA   2  
ATOM   8607   C C    . LEU A 1 101 ? -24.121 17.763 -30.122 0.010 23.58  ? 101  LEU A C    2  
ATOM   8608   O O    . LEU A 1 101 ? -25.246 17.760 -30.607 0.010 24.78  ? 101  LEU A O    2  
ATOM   8609   C CB   . LEU A 1 101 ? -22.723 15.838 -30.726 0.010 22.70  ? 101  LEU A CB   2  
ATOM   8610   C CG   . LEU A 1 101 ? -22.218 14.444 -30.379 0.010 21.90  ? 101  LEU A CG   2  
ATOM   8611   C CD1  . LEU A 1 101 ? -21.424 13.862 -31.529 0.010 21.83  ? 101  LEU A CD1  2  
ATOM   8612   C CD2  . LEU A 1 101 ? -21.390 14.540 -29.122 0.010 20.63  ? 101  LEU A CD2  2  
ATOM   8613   H H    . LEU A 1 101 ? -24.758 14.985 -29.661 0.010 23.56  ? 101  LEU A H    2  
ATOM   8614   H HA   . LEU A 1 101 ? -22.879 16.731 -28.889 0.010 21.71  ? 101  LEU A HA   2  
ATOM   8615   H HB2  . LEU A 1 101 ? -23.299 15.760 -31.501 0.010 23.71  ? 101  LEU A HB2  2  
ATOM   8616   H HB3  . LEU A 1 101 ? -21.954 16.393 -30.933 0.010 22.50  ? 101  LEU A HB3  2  
ATOM   8617   H HG   . LEU A 1 101 ? -22.974 13.860 -30.205 0.010 22.48  ? 101  LEU A HG   2  
ATOM   8618   H HD11 . LEU A 1 101 ? -21.619 14.363 -32.336 0.010 22.74  ? 101  LEU A HD11 2  
ATOM   8619   H HD12 . LEU A 1 101 ? -20.478 13.922 -31.323 0.010 21.72  ? 101  LEU A HD12 2  
ATOM   8620   H HD13 . LEU A 1 101 ? -21.682 12.933 -31.643 0.010 21.10  ? 101  LEU A HD13 2  
ATOM   8621   H HD21 . LEU A 1 101 ? -20.808 15.312 -29.191 0.010 20.12  ? 101  LEU A HD21 2  
ATOM   8622   H HD22 . LEU A 1 101 ? -21.984 14.639 -28.363 0.010 20.79  ? 101  LEU A HD22 2  
ATOM   8623   H HD23 . LEU A 1 101 ? -20.866 13.731 -29.025 0.010 20.33  ? 101  LEU A HD23 2  
ATOM   8624   N N    . GLY A 1 102 ? -23.348 18.843 -30.064 0.010 23.25  ? 102  GLY A N    2  
ATOM   8625   C CA   . GLY A 1 102 ? -23.828 20.169 -30.433 0.010 24.34  ? 102  GLY A CA   2  
ATOM   8626   C C    . GLY A 1 102 ? -22.789 21.221 -30.105 0.010 23.85  ? 102  GLY A C    2  
ATOM   8627   O O    . GLY A 1 102 ? -21.643 20.858 -29.790 0.010 22.76  ? 102  GLY A O    2  
ATOM   8628   H H    . GLY A 1 102 ? -22.529 18.829 -29.808 0.010 22.49  ? 102  GLY A H    2  
ATOM   8629   H HA2  . GLY A 1 102 ? -24.012 20.197 -31.384 0.010 25.21  ? 102  GLY A HA2  2  
ATOM   8630   H HA3  . GLY A 1 102 ? -24.643 20.359 -29.945 0.010 24.67  ? 102  GLY A HA3  2  
ATOM   8631   N N    . PRO A 1 103 ? -23.184 22.518 -30.141 0.010 24.80  ? 103  PRO A N    2  
ATOM   8632   C CA   . PRO A 1 103 ? -22.245 23.622 -29.870 0.010 24.62  ? 103  PRO A CA   2  
ATOM   8633   C C    . PRO A 1 103 ? -21.515 23.429 -28.545 0.010 23.38  ? 103  PRO A C    2  
ATOM   8634   O O    . PRO A 1 103 ? -20.319 23.737 -28.426 0.010 23.12  ? 103  PRO A O    2  
ATOM   8635   C CB   . PRO A 1 103 ? -23.140 24.863 -29.762 0.010 26.11  ? 103  PRO A CB   2  
ATOM   8636   C CG   . PRO A 1 103 ? -24.562 24.417 -30.044 0.010 27.26  ? 103  PRO A CG   2  
ATOM   8637   C CD   . PRO A 1 103 ? -24.593 22.951 -30.210 0.010 26.35  ? 103  PRO A CD   2  
ATOM   8638   H HA   . PRO A 1 103 ? -21.609 23.728 -30.590 0.010 24.62  ? 103  PRO A HA   2  
ATOM   8639   H HB2  . PRO A 1 103 ? -23.071 25.221 -28.863 0.010 26.00  ? 103  PRO A HB2  2  
ATOM   8640   H HB3  . PRO A 1 103 ? -22.862 25.529 -30.410 0.010 26.51  ? 103  PRO A HB3  2  
ATOM   8641   H HG2  . PRO A 1 103 ? -25.123 24.683 -29.298 0.010 28.18  ? 103  PRO A HG2  2  
ATOM   8642   H HG3  . PRO A 1 103 ? -24.868 24.842 -30.860 0.010 27.72  ? 103  PRO A HG3  2  
ATOM   8643   H HD2  . PRO A 1 103 ? -25.097 22.549 -29.488 0.010 26.32  ? 103  PRO A HD2  2  
ATOM   8644   H HD3  . PRO A 1 103 ? -24.970 22.724 -31.074 0.010 26.92  ? 103  PRO A HD3  2  
ATOM   8645   N N    . ALA A 1 104 ? -22.243 22.882 -27.575 0.010 22.79  ? 104  ALA A N    2  
ATOM   8646   C CA   . ALA A 1 104 ? -21.827 22.854 -26.176 0.010 21.88  ? 104  ALA A CA   2  
ATOM   8647   C C    . ALA A 1 104 ? -21.303 21.490 -25.692 0.010 20.67  ? 104  ALA A C    2  
ATOM   8648   O O    . ALA A 1 104 ? -20.877 21.373 -24.568 0.010 20.01  ? 104  ALA A O    2  
ATOM   8649   C CB   . ALA A 1 104 ? -22.987 23.260 -25.298 0.010 22.33  ? 104  ALA A CB   2  
ATOM   8650   H H    . ALA A 1 104 ? -23.008 22.518 -27.707 0.010 23.02  ? 104  ALA A H    2  
ATOM   8651   H HA   . ALA A 1 104 ? -21.124 23.504 -26.046 0.010 21.92  ? 104  ALA A HA   2  
ATOM   8652   H HB1  . ALA A 1 104 ? -23.408 24.042 -25.686 0.010 23.20  ? 104  ALA A HB1  2  
ATOM   8653   H HB2  . ALA A 1 104 ? -23.623 22.531 -25.266 0.010 22.22  ? 104  ALA A HB2  2  
ATOM   8654   H HB3  . ALA A 1 104 ? -22.663 23.461 -24.408 0.010 22.00  ? 104  ALA A HB3  2  
ATOM   8655   N N    . VAL A 1 105 ? -21.350 20.484 -26.541 0.010 20.62  ? 105  VAL A N    2  
ATOM   8656   C CA   . VAL A 1 105 ? -20.901 19.142 -26.157 0.010 19.73  ? 105  VAL A CA   2  
ATOM   8657   C C    . VAL A 1 105 ? -20.195 18.517 -27.340 0.010 19.83  ? 105  VAL A C    2  
ATOM   8658   O O    . VAL A 1 105 ? -20.808 18.235 -28.371 0.010 20.71  ? 105  VAL A O    2  
ATOM   8659   C CB   . VAL A 1 105 ? -22.053 18.220 -25.697 0.010 19.86  ? 105  VAL A CB   2  
ATOM   8660   C CG1  . VAL A 1 105 ? -21.494 16.839 -25.336 0.010 19.12  ? 105  VAL A CG1  2  
ATOM   8661   C CG2  . VAL A 1 105 ? -22.763 18.806 -24.511 0.010 19.99  ? 105  VAL A CG2  2  
ATOM   8662   H H    . VAL A 1 105 ? -21.627 20.546 -27.353 0.010 21.22  ? 105  VAL A H    2  
ATOM   8663   H HA   . VAL A 1 105 ? -20.274 19.195 -25.426 0.010 19.13  ? 105  VAL A HA   2  
ATOM   8664   H HB   . VAL A 1 105 ? -22.693 18.123 -26.421 0.010 20.53  ? 105  VAL A HB   2  
ATOM   8665   H HG11 . VAL A 1 105 ? -20.720 16.954 -24.766 0.010 18.53  ? 105  VAL A HG11 2  
ATOM   8666   H HG12 . VAL A 1 105 ? -22.176 16.337 -24.865 0.010 19.20  ? 105  VAL A HG12 2  
ATOM   8667   H HG13 . VAL A 1 105 ? -21.245 16.373 -26.146 0.010 19.32  ? 105  VAL A HG13 2  
ATOM   8668   H HG21 . VAL A 1 105 ? -23.152 19.658 -24.760 0.010 20.55  ? 105  VAL A HG21 2  
ATOM   8669   H HG22 . VAL A 1 105 ? -23.461 18.199 -24.231 0.010 20.17  ? 105  VAL A HG22 2  
ATOM   8670   H HG23 . VAL A 1 105 ? -22.127 18.919 -23.791 0.010 19.46  ? 105  VAL A HG23 2  
ATOM   8671   N N    . ARG A 1 106 ? -18.891 18.284 -27.166 0.010 19.08  ? 106  ARG A N    2  
ATOM   8672   C CA   . ARG A 1 106 ? -18.068 17.791 -28.238 0.010 19.22  ? 106  ARG A CA   2  
ATOM   8673   C C    . ARG A 1 106 ? -16.787 17.140 -27.691 0.010 18.23  ? 106  ARG A C    2  
ATOM   8674   O O    . ARG A 1 106 ? -16.095 17.736 -26.845 0.010 17.72  ? 106  ARG A O    2  
ATOM   8675   C CB   . ARG A 1 106 ? -17.627 18.924 -29.160 0.010 20.13  ? 106  ARG A CB   2  
ATOM   8676   C CG   . ARG A 1 106 ? -17.350 18.449 -30.563 0.010 20.67  ? 106  ARG A CG   2  
ATOM   8677   C CD   . ARG A 1 106 ? -18.616 18.651 -31.388 0.010 22.17  ? 106  ARG A CD   2  
ATOM   8678   N NE   . ARG A 1 106 ? -18.904 17.559 -32.310 0.010 23.21  ? 106  ARG A NE   2  
ATOM   8679   C CZ   . ARG A 1 106 ? -19.895 17.616 -33.191 0.010 23.93  ? 106  ARG A CZ   2  
ATOM   8680   N NH1  . ARG A 1 106 ? -20.631 18.702 -33.259 0.010 23.74  ? 106  ARG A NH1  2  
ATOM   8681   N NH2  . ARG A 1 106 ? -20.152 16.604 -33.993 0.010 24.99  ? 106  ARG A NH2  2  
ATOM   8682   H H    . ARG A 1 106 ? -18.469 18.408 -26.427 0.010 18.56  ? 106  ARG A H    2  
ATOM   8683   H HA   . ARG A 1 106 ? -18.593 17.170 -28.754 0.010 19.55  ? 106  ARG A HA   2  
ATOM   8684   H HB2  . ARG A 1 106 ? -18.321 19.598 -29.196 0.010 20.82  ? 106  ARG A HB2  2  
ATOM   8685   H HB3  . ARG A 1 106 ? -16.810 19.313 -28.812 0.010 19.86  ? 106  ARG A HB3  2  
ATOM   8686   H HG2  . ARG A 1 106 ? -16.637 18.981 -30.948 0.010 20.23  ? 106  ARG A HG2  2  
ATOM   8687   H HG3  . ARG A 1 106 ? -17.118 17.512 -30.571 0.010 20.69  ? 106  ARG A HG3  2  
ATOM   8688   H HD2  . ARG A 1 106 ? -19.372 18.714 -30.787 0.010 22.37  ? 106  ARG A HD2  2  
ATOM   8689   H HD3  . ARG A 1 106 ? -18.528 19.468 -31.900 0.010 22.43  ? 106  ARG A HD3  2  
ATOM   8690   H HE   . ARG A 1 106 ? -18.278 16.985 -32.452 0.010 23.36  ? 106  ARG A HE   2  
ATOM   8691   H HH11 . ARG A 1 106 ? -20.479 19.366 -32.738 0.010 23.17  ? 106  ARG A HH11 2  
ATOM   8692   H HH12 . ARG A 1 106 ? -21.270 18.747 -33.833 0.010 24.27  ? 106  ARG A HH12 2  
ATOM   8693   H HH21 . ARG A 1 106 ? -19.670 15.892 -33.954 0.010 25.24  ? 106  ARG A HH21 2  
ATOM   8694   H HH22 . ARG A 1 106 ? -20.789 16.660 -34.568 0.010 25.52  ? 106  ARG A HH22 2  
ATOM   8695   N N    . PRO A 1 107 ? -16.477 15.934 -28.177 0.010 18.13  ? 107  PRO A N    2  
ATOM   8696   C CA   . PRO A 1 107 ? -15.259 15.230 -27.743 0.010 17.35  ? 107  PRO A CA   2  
ATOM   8697   C C    . PRO A 1 107 ? -13.965 15.941 -28.214 0.010 17.39  ? 107  PRO A C    2  
ATOM   8698   O O    . PRO A 1 107 ? -13.918 16.407 -29.325 0.010 18.16  ? 107  PRO A O    2  
ATOM   8699   C CB   . PRO A 1 107 ? -15.382 13.870 -28.447 0.010 17.69  ? 107  PRO A CB   2  
ATOM   8700   C CG   . PRO A 1 107 ? -16.812 13.831 -29.056 0.010 18.55  ? 107  PRO A CG   2  
ATOM   8701   C CD   . PRO A 1 107 ? -17.143 15.231 -29.291 0.010 18.90  ? 107  PRO A CD   2  
ATOM   8702   H HA   . PRO A 1 107 ? -15.254 15.119 -26.784 0.010 16.81  ? 107  PRO A HA   2  
ATOM   8703   H HB2  . PRO A 1 107 ? -14.727 13.813 -29.155 0.010 17.98  ? 107  PRO A HB2  2  
ATOM   8704   H HB3  . PRO A 1 107 ? -15.266 13.154 -27.805 0.010 17.23  ? 107  PRO A HB3  2  
ATOM   8705   H HG2  . PRO A 1 107 ? -16.799 13.348 -29.896 0.010 19.20  ? 107  PRO A HG2  2  
ATOM   8706   H HG3  . PRO A 1 107 ? -17.436 13.432 -28.435 0.010 18.40  ? 107  PRO A HG3  2  
ATOM   8707   H HD2  . PRO A 1 107 ? -16.775 15.506 -30.142 0.010 19.63  ? 107  PRO A HD2  2  
ATOM   8708   H HD3  . PRO A 1 107 ? -18.106 15.330 -29.273 0.010 18.98  ? 107  PRO A HD3  2  
ATOM   8709   N N    . LEU A 1 108 ? -12.950 15.982 -27.364 0.010 16.71  ? 108  LEU A N    2  
ATOM   8710   C CA   . LEU A 1 108 ? -11.698 16.675 -27.659 0.010 16.82  ? 108  LEU A CA   2  
ATOM   8711   C C    . LEU A 1 108 ? -10.693 15.703 -28.219 0.010 16.62  ? 108  LEU A C    2  
ATOM   8712   O O    . LEU A 1 108 ? -10.516 14.658 -27.640 0.010 16.05  ? 108  LEU A O    2  
ATOM   8713   C CB   . LEU A 1 108 ? -11.113 17.225 -26.368 0.010 16.37  ? 108  LEU A CB   2  
ATOM   8714   C CG   . LEU A 1 108 ? -9.817  18.008 -26.501 0.010 16.83  ? 108  LEU A CG   2  
ATOM   8715   C CD1  . LEU A 1 108 ? -10.021 19.326 -27.247 0.010 17.78  ? 108  LEU A CD1  2  
ATOM   8716   C CD2  . LEU A 1 108 ? -9.320  18.244 -25.139 0.010 16.34  ? 108  LEU A CD2  2  
ATOM   8717   H H    . LEU A 1 108 ? -12.962 15.612 -26.592 0.010 16.25  ? 108  LEU A H    2  
ATOM   8718   H HA   . LEU A 1 108 ? -11.850 17.409 -28.268 0.010 17.47  ? 108  LEU A HA   2  
ATOM   8719   H HB2  . LEU A 1 108 ? -11.763 17.816 -25.962 0.010 16.45  ? 108  LEU A HB2  2  
ATOM   8720   H HB3  . LEU A 1 108 ? -10.934 16.485 -25.768 0.010 15.85  ? 108  LEU A HB3  2  
ATOM   8721   H HG   . LEU A 1 108 ? -9.165  17.485 -26.984 0.010 16.96  ? 108  LEU A HG   2  
ATOM   8722   H HD11 . LEU A 1 108 ? -10.971 19.498 -27.341 0.010 17.89  ? 108  LEU A HD11 2  
ATOM   8723   H HD12 . LEU A 1 108 ? -9.604  20.047 -26.749 0.010 17.85  ? 108  LEU A HD12 2  
ATOM   8724   H HD13 . LEU A 1 108 ? -9.611  19.270 -28.117 0.010 18.32  ? 108  LEU A HD13 2  
ATOM   8725   H HD21 . LEU A 1 108 ? -10.060 18.508 -24.573 0.010 16.27  ? 108  LEU A HD21 2  
ATOM   8726   H HD22 . LEU A 1 108 ? -8.948  17.420 -24.809 0.010 15.88  ? 108  LEU A HD22 2  
ATOM   8727   H HD23 . LEU A 1 108 ? -8.646  18.937 -25.150 0.010 16.72  ? 108  LEU A HD23 2  
ATOM   8728   N N    . PRO A 1 109 ? -10.031 16.052 -29.325 0.010 17.24  ? 109  PRO A N    2  
ATOM   8729   C CA   . PRO A 1 109 ? -8.907  15.219 -29.786 0.010 17.15  ? 109  PRO A CA   2  
ATOM   8730   C C    . PRO A 1 109 ? -7.830  15.070 -28.703 0.010 16.27  ? 109  PRO A C    2  
ATOM   8731   O O    . PRO A 1 109 ? -7.602  15.991 -27.931 0.010 16.00  ? 109  PRO A O    2  
ATOM   8732   C CB   . PRO A 1 109 ? -8.359  15.980 -31.024 0.010 18.11  ? 109  PRO A CB   2  
ATOM   8733   C CG   . PRO A 1 109 ? -9.442  17.037 -31.362 0.010 18.58  ? 109  PRO A CG   2  
ATOM   8734   C CD   . PRO A 1 109 ? -10.195 17.289 -30.114 0.010 18.23  ? 109  PRO A CD   2  
ATOM   8735   H HA   . PRO A 1 109 ? -9.225  14.343 -30.045 0.010 17.26  ? 109  PRO A HA   2  
ATOM   8736   H HB2  . PRO A 1 109 ? -7.521  16.410 -30.804 0.010 17.92  ? 109  PRO A HB2  2  
ATOM   8737   H HB3  . PRO A 1 109 ? -8.239  15.362 -31.761 0.010 18.72  ? 109  PRO A HB3  2  
ATOM   8738   H HG2  . PRO A 1 109 ? -9.012  17.855 -31.652 0.010 18.36  ? 109  PRO A HG2  2  
ATOM   8739   H HG3  . PRO A 1 109 ? -10.033 16.702 -32.052 0.010 19.45  ? 109  PRO A HG3  2  
ATOM   8740   H HD2  . PRO A 1 109 ? -9.811  18.045 -29.659 0.010 18.19  ? 109  PRO A HD2  2  
ATOM   8741   H HD3  . PRO A 1 109 ? -11.133 17.432 -30.308 0.010 18.82  ? 109  PRO A HD3  2  
ATOM   8742   N N    . TRP A 1 110 ? -7.196  13.891 -28.629 0.010 16.00  ? 110  TRP A N    2  
ATOM   8743   C CA   . TRP A 1 110 ? -6.226  13.633 -27.582 0.010 15.34  ? 110  TRP A CA   2  
ATOM   8744   C C    . TRP A 1 110 ? -5.004  12.958 -28.161 0.010 15.62  ? 110  TRP A C    2  
ATOM   8745   O O    . TRP A 1 110 ? -5.091  12.266 -29.171 0.010 16.24  ? 110  TRP A O    2  
ATOM   8746   C CB   . TRP A 1 110 ? -6.812  12.870 -26.401 0.010 14.84  ? 110  TRP A CB   2  
ATOM   8747   C CG   . TRP A 1 110 ? -7.257  11.507 -26.687 0.010 15.15  ? 110  TRP A CG   2  
ATOM   8748   C CD1  . TRP A 1 110 ? -8.450  11.119 -27.203 0.010 15.62  ? 110  TRP A CD1  2  
ATOM   8749   C CD2  . TRP A 1 110 ? -6.515  10.318 -26.437 0.010 15.20  ? 110  TRP A CD2  2  
ATOM   8750   N NE1  . TRP A 1 110 ? -8.494  9.738  -27.300 0.010 16.04  ? 110  TRP A NE1  2  
ATOM   8751   C CE2  . TRP A 1 110 ? -7.310  9.233  -26.828 0.010 15.78  ? 110  TRP A CE2  2  
ATOM   8752   C CE3  . TRP A 1 110 ? -5.253  10.069 -25.914 0.010 14.96  ? 110  TRP A CE3  2  
ATOM   8753   C CZ2  . TRP A 1 110 ? -6.878  7.919  -26.707 0.010 16.18  ? 110  TRP A CZ2  2  
ATOM   8754   C CZ3  . TRP A 1 110 ? -4.824  8.762  -25.808 0.010 15.29  ? 110  TRP A CZ3  2  
ATOM   8755   C CH2  . TRP A 1 110 ? -5.641  7.706  -26.189 0.010 15.90  ? 110  TRP A CH2  2  
ATOM   8756   H H    . TRP A 1 110 ? -7.303  13.248 -29.183 0.010 16.32  ? 110  TRP A H    2  
ATOM   8757   H HA   . TRP A 1 110 ? -5.920  14.479 -27.223 0.010 15.22  ? 110  TRP A HA   2  
ATOM   8758   H HB2  . TRP A 1 110 ? -6.154  12.811 -25.696 0.010 14.54  ? 110  TRP A HB2  2  
ATOM   8759   H HB3  . TRP A 1 110 ? -7.579  13.360 -26.073 0.010 14.74  ? 110  TRP A HB3  2  
ATOM   8760   H HD1  . TRP A 1 110 ? -9.128  11.698 -27.457 0.010 15.76  ? 110  TRP A HD1  2  
ATOM   8761   H HE1  . TRP A 1 110 ? -9.147  9.276  -27.602 0.010 16.48  ? 110  TRP A HE1  2  
ATOM   8762   H HE3  . TRP A 1 110 ? -4.716  10.768 -25.654 0.010 14.70  ? 110  TRP A HE3  2  
ATOM   8763   H HZ2  . TRP A 1 110 ? -7.418  7.209  -26.979 0.010 16.71  ? 110  TRP A HZ2  2  
ATOM   8764   H HZ3  . TRP A 1 110 ? -3.983  8.582  -25.458 0.010 15.20  ? 110  TRP A HZ3  2  
ATOM   8765   H HH2  . TRP A 1 110 ? -5.324  6.836  -26.117 0.010 16.24  ? 110  TRP A HH2  2  
ATOM   8766   N N    . GLN A 1 111 ? -3.863  13.263 -27.552 0.010 15.33  ? 111  GLN A N    2  
ATOM   8767   C CA   . GLN A 1 111 ? -2.568  12.929 -28.135 0.010 15.68  ? 111  GLN A CA   2  
ATOM   8768   C C    . GLN A 1 111 ? -2.247  11.443 -28.015 0.010 15.60  ? 111  GLN A C    2  
ATOM   8769   O O    . GLN A 1 111 ? -2.203  10.906 -26.926 0.010 15.11  ? 111  GLN A O    2  
ATOM   8770   C CB   . GLN A 1 111 ? -1.446  13.697 -27.459 0.010 15.54  ? 111  GLN A CB   2  
ATOM   8771   C CG   . GLN A 1 111 ? -0.090  13.557 -28.175 0.010 16.06  ? 111  GLN A CG   2  
ATOM   8772   C CD   . GLN A 1 111 ? -0.041  14.328 -29.499 0.010 16.93  ? 111  GLN A CD   2  
ATOM   8773   O OE1  . GLN A 1 111 ? -0.015  13.745 -30.586 0.010 17.58  ? 111  GLN A OE1  2  
ATOM   8774   N NE2  . GLN A 1 111 ? -0.040  15.640 -29.406 0.010 17.15  ? 111  GLN A NE2  2  
ATOM   8775   H H    . GLN A 1 111 ? -3.815  13.663 -26.798 0.010 15.03  ? 111  GLN A H    2  
ATOM   8776   H HA   . GLN A 1 111 ? -2.579  13.171 -29.073 0.010 16.23  ? 111  GLN A HA   2  
ATOM   8777   H HB2  . GLN A 1 111 ? -1.686  14.637 -27.444 0.010 15.68  ? 111  GLN A HB2  2  
ATOM   8778   H HB3  . GLN A 1 111 ? -1.344  13.371 -26.554 0.010 15.13  ? 111  GLN A HB3  2  
ATOM   8779   H HG2  . GLN A 1 111 ? 0.597   13.920 -27.602 0.010 15.95  ? 111  GLN A HG2  2  
ATOM   8780   H HG3  . GLN A 1 111 ? 0.095   12.624 -28.356 0.010 16.11  ? 111  GLN A HG3  2  
ATOM   8781   H HE21 . GLN A 1 111 ? -0.145  16.016 -28.646 0.010 16.81  ? 111  GLN A HE21 2  
ATOM   8782   H HE22 . GLN A 1 111 ? 0.064   16.114 -30.110 0.010 17.75  ? 111  GLN A HE22 2  
ATOM   8783   N N    . ARG A 1 112 ? -2.003  10.834 -29.162 0.010 16.30  ? 112  ARG A N    2  
ATOM   8784   C CA   . ARG A 1 112 ? -1.735  9.418  -29.254 0.010 16.51  ? 112  ARG A CA   2  
ATOM   8785   C C    . ARG A 1 112 ? -0.248  9.136  -29.418 0.010 16.72  ? 112  ARG A C    2  
ATOM   8786   O O    . ARG A 1 112 ? 0.185   8.002  -29.248 0.010 16.56  ? 112  ARG A O    2  
ATOM   8787   C CB   . ARG A 1 112 ? -2.517  8.825  -30.432 0.010 17.44  ? 112  ARG A CB   2  
ATOM   8788   C CG   . ARG A 1 112 ? -3.969  8.526  -30.028 0.010 17.34  ? 112  ARG A CG   2  
ATOM   8789   C CD   . ARG A 1 112 ? -3.997  7.353  -29.070 0.010 18.15  ? 112  ARG A CD   2  
ATOM   8790   N NE   . ARG A 1 112 ? -2.717  6.611  -29.094 0.010 18.07  ? 112  ARG A NE   2  
ATOM   8791   C CZ   . ARG A 1 112 ? -2.401  5.639  -29.971 0.010 19.00  ? 112  ARG A CZ   2  
ATOM   8792   N NH1  . ARG A 1 112 ? -3.249  5.292  -30.926 0.010 20.16  ? 112  ARG A NH1  2  
ATOM   8793   N NH2  . ARG A 1 112 ? -1.217  5.029  -29.919 0.010 18.95  ? 112  ARG A NH2  2  
ATOM   8794   H H    . ARG A 1 112 ? -1.985  11.232 -29.919 0.010 16.77  ? 112  ARG A H    2  
ATOM   8795   H HA   . ARG A 1 112 ? -2.034  8.980  -28.446 0.010 16.11  ? 112  ARG A HA   2  
ATOM   8796   H HB2  . ARG A 1 112 ? -2.552  9.477  -31.145 0.010 17.86  ? 112  ARG A HB2  2  
ATOM   8797   H HB3  . ARG A 1 112 ? -2.080  8.033  -30.765 0.010 17.86  ? 112  ARG A HB3  2  
ATOM   8798   H HG2  . ARG A 1 112 ? -4.300  9.292  -29.541 0.010 16.68  ? 112  ARG A HG2  2  
ATOM   8799   H HG3  . ARG A 1 112 ? -4.517  8.332  -30.805 0.010 17.64  ? 112  ARG A HG3  2  
ATOM   8800   H HD2  . ARG A 1 112 ? -4.123  7.698  -28.182 0.010 18.09  ? 112  ARG A HD2  2  
ATOM   8801   H HD3  . ARG A 1 112 ? -4.725  6.760  -29.310 0.010 18.95  ? 112  ARG A HD3  2  
ATOM   8802   H HE   . ARG A 1 112 ? -2.057  6.995  -28.706 0.010 17.50  ? 112  ARG A HE   2  
ATOM   8803   H HH11 . ARG A 1 112 ? -4.017  5.673  -30.984 0.010 20.27  ? 112  ARG A HH11 2  
ATOM   8804   H HH12 . ARG A 1 112 ? -3.035  4.674  -31.487 0.010 20.89  ? 112  ARG A HH12 2  
ATOM   8805   H HH21 . ARG A 1 112 ? -0.644  5.240  -29.313 0.010 18.32  ? 112  ARG A HH21 2  
ATOM   8806   H HH22 . ARG A 1 112 ? -1.029  4.416  -30.491 0.010 19.64  ? 112  ARG A HH22 2  
ATOM   8807   N N    . VAL A 1 113 ? 0.532   10.148 -29.753 0.010 17.20  ? 113  VAL A N    2  
ATOM   8808   C CA   . VAL A 1 113 ? 1.958   9.911  -29.973 0.010 17.57  ? 113  VAL A CA   2  
ATOM   8809   C C    . VAL A 1 113 ? 2.710   10.250 -28.689 0.010 16.86  ? 113  VAL A C    2  
ATOM   8810   O O    . VAL A 1 113 ? 2.506   11.296 -28.129 0.010 16.44  ? 113  VAL A O    2  
ATOM   8811   C CB   . VAL A 1 113 ? 2.471   10.721 -31.173 0.010 18.39  ? 113  VAL A CB   2  
ATOM   8812   C CG1  . VAL A 1 113 ? 3.984   10.738 -31.212 0.010 18.72  ? 113  VAL A CG1  2  
ATOM   8813   C CG2  . VAL A 1 113 ? 1.903   10.164 -32.464 0.010 19.46  ? 113  VAL A CG2  2  
ATOM   8814   H H    . VAL A 1 113 ? 0.280   10.963 -29.856 0.010 17.41  ? 113  VAL A H    2  
ATOM   8815   H HA   . VAL A 1 113 ? 2.122   8.977  -30.168 0.010 17.93  ? 113  VAL A HA   2  
ATOM   8816   H HB   . VAL A 1 113 ? 2.171   11.638 -31.091 0.010 18.18  ? 113  VAL A HB   2  
ATOM   8817   H HG11 . VAL A 1 113 ? 4.319   9.838  -31.089 0.010 18.74  ? 113  VAL A HG11 2  
ATOM   8818   H HG12 . VAL A 1 113 ? 4.271   11.081 -32.073 0.010 19.48  ? 113  VAL A HG12 2  
ATOM   8819   H HG13 . VAL A 1 113 ? 4.306   11.315 -30.504 0.010 18.29  ? 113  VAL A HG13 2  
ATOM   8820   H HG21 . VAL A 1 113 ? 0.939   10.254 -32.455 0.010 19.33  ? 113  VAL A HG21 2  
ATOM   8821   H HG22 . VAL A 1 113 ? 2.266   10.663 -33.209 0.010 20.13  ? 113  VAL A HG22 2  
ATOM   8822   H HG23 . VAL A 1 113 ? 2.145   9.228  -32.540 0.010 19.72  ? 113  VAL A HG23 2  
ATOM   8823   N N    . ASP A 1 114 ? 3.551   9.336  -28.217 0.010 16.90  ? 114  ASP A N    2  
ATOM   8824   C CA   . ASP A 1 114 ? 4.383   9.647  -27.075 0.010 16.41  ? 114  ASP A CA   2  
ATOM   8825   C C    . ASP A 1 114 ? 5.427   10.643 -27.532 0.010 16.70  ? 114  ASP A C    2  
ATOM   8826   O O    . ASP A 1 114 ? 6.450   10.281 -28.130 0.010 17.08  ? 114  ASP A O    2  
ATOM   8827   C CB   . ASP A 1 114 ? 5.053   8.405  -26.495 0.010 16.51  ? 114  ASP A CB   2  
ATOM   8828   C CG   . ASP A 1 114 ? 4.985   8.357  -24.980 0.010 16.23  ? 114  ASP A CG   2  
ATOM   8829   O OD1  . ASP A 1 114 ? 4.901   7.231  -24.453 0.010 16.51  ? 114  ASP A OD1  2  
ATOM   8830   O OD2  . ASP A 1 114 ? 5.052   9.430  -24.327 0.010 15.91  ? 114  ASP A OD2  2  
ATOM   8831   H H    . ASP A 1 114 ? 3.645   8.545  -28.531 0.010 17.31  ? 114  ASP A H    2  
ATOM   8832   H HA   . ASP A 1 114 ? 3.847   10.062 -26.386 0.010 15.97  ? 114  ASP A HA   2  
ATOM   8833   H HB2  . ASP A 1 114 ? 4.634   7.606  -26.852 0.010 16.43  ? 114  ASP A HB2  2  
ATOM   8834   H HB3  . ASP A 1 114 ? 5.993   8.411  -26.733 0.010 17.02  ? 114  ASP A HB3  2  
ATOM   8835   N N    . ARG A 1 115 ? 5.126   11.901 -27.279 0.010 16.67  ? 115  ARG A N    2  
ATOM   8836   C CA   . ARG A 1 115 ? 6.033   13.029 -27.492 0.010 17.12  ? 115  ARG A CA   2  
ATOM   8837   C C    . ARG A 1 115 ? 5.740   13.911 -26.284 0.010 16.87  ? 115  ARG A C    2  
ATOM   8838   O O    . ARG A 1 115 ? 4.572   14.197 -26.012 0.010 16.51  ? 115  ARG A O    2  
ATOM   8839   C CB   . ARG A 1 115 ? 5.730   13.783 -28.802 0.010 17.91  ? 115  ARG A CB   2  
ATOM   8840   C CG   . ARG A 1 115 ? 6.305   13.123 -30.068 0.010 18.51  ? 115  ARG A CG   2  
ATOM   8841   C CD   . ARG A 1 115 ? 7.522   13.852 -30.827 0.010 19.29  ? 115  ARG A CD   2  
ATOM   8842   N NE   . ARG A 1 115 ? 8.829   13.722 -30.146 0.010 19.31  ? 115  ARG A NE   2  
ATOM   8843   C CZ   . ARG A 1 115 ? 9.560   14.735 -29.681 0.010 20.15  ? 115  ARG A CZ   2  
ATOM   8844   N NH1  . ARG A 1 115 ? 9.192   16.004 -29.869 0.010 21.03  ? 115  ARG A NH1  2  
ATOM   8845   N NH2  . ARG A 1 115 ? 10.695  14.489 -29.054 0.010 20.25  ? 115  ARG A NH2  2  
ATOM   8846   H H    . ARG A 1 115 ? 4.367   12.138 -26.963 0.010 16.49  ? 115  ARG A H    2  
ATOM   8847   H HA   . ARG A 1 115 ? 6.957   12.744 -27.479 0.010 17.25  ? 115  ARG A HA   2  
ATOM   8848   H HB2  . ARG A 1 115 ? 4.769   13.842 -28.919 0.010 17.86  ? 115  ARG A HB2  2  
ATOM   8849   H HB3  . ARG A 1 115 ? 6.087   14.682 -28.738 0.010 18.24  ? 115  ARG A HB3  2  
ATOM   8850   H HG2  . ARG A 1 115 ? 6.602   12.232 -29.827 0.010 18.18  ? 115  ARG A HG2  2  
ATOM   8851   H HG3  . ARG A 1 115 ? 5.584   13.061 -30.715 0.010 18.88  ? 115  ARG A HG3  2  
ATOM   8852   H HD2  . ARG A 1 115 ? 7.622   13.437 -31.701 0.010 19.25  ? 115  ARG A HD2  2  
ATOM   8853   H HD3  . ARG A 1 115 ? 7.309   14.792 -30.936 0.010 19.96  ? 115  ARG A HD3  2  
ATOM   8854   H HE   . ARG A 1 115 ? 9.205   12.946 -30.173 0.010 18.81  ? 115  ARG A HE   2  
ATOM   8855   H HH11 . ARG A 1 115 ? 8.461   16.196 -30.273 0.010 21.09  ? 115  ARG A HH11 2  
ATOM   8856   H HH12 . ARG A 1 115 ? 9.696   16.638 -29.574 0.010 21.62  ? 115  ARG A HH12 2  
ATOM   8857   H HH21 . ARG A 1 115 ? 10.952  13.678 -28.935 0.010 19.78  ? 115  ARG A HH21 2  
ATOM   8858   H HH22 . ARG A 1 115 ? 11.184  15.138 -28.775 0.010 20.88  ? 115  ARG A HH22 2  
ATOM   8859   N N    . ASP A 1 116 ? 6.762   14.304 -25.546 0.010 17.22  ? 116  ASP A N    2  
ATOM   8860   C CA   . ASP A 1 116 ? 6.562   15.266 -24.467 0.010 17.24  ? 116  ASP A CA   2  
ATOM   8861   C C    . ASP A 1 116 ? 6.065   16.586 -25.065 0.010 17.63  ? 116  ASP A C    2  
ATOM   8862   O O    . ASP A 1 116 ? 6.512   16.998 -26.139 0.010 18.24  ? 116  ASP A O    2  
ATOM   8863   C CB   . ASP A 1 116 ? 7.860   15.580 -23.723 0.010 17.89  ? 116  ASP A CB   2  
ATOM   8864   C CG   . ASP A 1 116 ? 8.263   14.518 -22.715 0.010 17.71  ? 116  ASP A CG   2  
ATOM   8865   O OD1  . ASP A 1 116 ? 7.411   13.690 -22.308 0.010 17.07  ? 116  ASP A OD1  2  
ATOM   8866   O OD2  . ASP A 1 116 ? 9.461   14.533 -22.326 0.010 18.36  ? 116  ASP A OD2  2  
ATOM   8867   H H    . ASP A 1 116 ? 7.570   14.044 -25.649 0.010 17.56  ? 116  ASP A H    2  
ATOM   8868   H HA   . ASP A 1 116 ? 5.894   14.937 -23.841 0.010 16.78  ? 116  ASP A HA   2  
ATOM   8869   H HB2  . ASP A 1 116 ? 8.577   15.652 -24.373 0.010 18.35  ? 116  ASP A HB2  2  
ATOM   8870   H HB3  . ASP A 1 116 ? 7.758   16.419 -23.245 0.010 18.14  ? 116  ASP A HB3  2  
ATOM   8871   N N    . VAL A 1 117 ? 5.151   17.252 -24.366 0.010 17.45  ? 117  VAL A N    2  
ATOM   8872   C CA   . VAL A 1 117 ? 4.849   18.628 -24.719 0.010 18.09  ? 117  VAL A CA   2  
ATOM   8873   C C    . VAL A 1 117 ? 6.086   19.484 -24.439 0.010 19.11  ? 117  VAL A C    2  
ATOM   8874   O O    . VAL A 1 117 ? 6.744   19.324 -23.412 0.010 19.25  ? 117  VAL A O    2  
ATOM   8875   C CB   . VAL A 1 117 ? 3.668   19.191 -23.924 0.010 17.84  ? 117  VAL A CB   2  
ATOM   8876   C CG1  . VAL A 1 117 ? 3.417   20.647 -24.323 0.010 18.73  ? 117  VAL A CG1  2  
ATOM   8877   C CG2  . VAL A 1 117 ? 2.444   18.316 -24.131 0.010 16.94  ? 117  VAL A CG2  2  
ATOM   8878   H H    . VAL A 1 117 ? 4.719   16.941 -23.696 0.010 17.07  ? 117  VAL A H    2  
ATOM   8879   H HA   . VAL A 1 117 ? 4.639   18.676 -25.664 0.010 18.21  ? 117  VAL A HA   2  
ATOM   8880   H HB   . VAL A 1 117 ? 3.901   19.171 -22.981 0.010 17.87  ? 117  VAL A HB   2  
ATOM   8881   H HG11 . VAL A 1 117 ? 3.513   20.734 -25.282 0.010 18.98  ? 117  VAL A HG11 2  
ATOM   8882   H HG12 . VAL A 1 117 ? 2.517   20.891 -24.060 0.010 18.53  ? 117  VAL A HG12 2  
ATOM   8883   H HG13 . VAL A 1 117 ? 4.053   21.222 -23.873 0.010 19.35  ? 117  VAL A HG13 2  
ATOM   8884   H HG21 . VAL A 1 117 ? 2.265   18.241 -25.080 0.010 16.99  ? 117  VAL A HG21 2  
ATOM   8885   H HG22 . VAL A 1 117 ? 2.613   17.443 -23.754 0.010 16.53  ? 117  VAL A HG22 2  
ATOM   8886   H HG23 . VAL A 1 117 ? 1.687   18.722 -23.686 0.010 16.87  ? 117  VAL A HG23 2  
ATOM   8887   N N    . ALA A 1 118 ? 6.421   20.379 -25.353 0.010 20.01  ? 118  ALA A N    2  
ATOM   8888   C CA   . ALA A 1 118 ? 7.700   21.082 -25.214 0.010 21.15  ? 118  ALA A CA   2  
ATOM   8889   C C    . ALA A 1 118 ? 7.593   22.053 -24.032 0.010 21.77  ? 118  ALA A C    2  
ATOM   8890   O O    . ALA A 1 118 ? 6.562   22.685 -23.867 0.010 21.78  ? 118  ALA A O    2  
ATOM   8891   C CB   . ALA A 1 118 ? 8.050   21.811 -26.505 0.010 22.18  ? 118  ALA A CB   2  
ATOM   8892   H H    . ALA A 1 118 ? 5.948   20.610 -26.030 0.010 20.09  ? 118  ALA A H    2  
ATOM   8893   H HA   . ALA A 1 118 ? 8.398   20.435 -25.038 0.010 21.02  ? 118  ALA A HA   2  
ATOM   8894   H HB1  . ALA A 1 118 ? 7.382   22.490 -26.682 0.010 22.44  ? 118  ALA A HB1  2  
ATOM   8895   H HB2  . ALA A 1 118 ? 8.921   22.217 -26.399 0.010 22.99  ? 118  ALA A HB2  2  
ATOM   8896   H HB3  . ALA A 1 118 ? 8.067   21.175 -27.236 0.010 21.90  ? 118  ALA A HB3  2  
ATOM   8897   N N    . PRO A 1 119 ? 8.627   22.109 -23.172 0.010 22.40  ? 119  PRO A N    2  
ATOM   8898   C CA   . PRO A 1 119 ? 8.643   23.079 -22.076 0.010 23.37  ? 119  PRO A CA   2  
ATOM   8899   C C    . PRO A 1 119 ? 8.371   24.489 -22.601 0.010 24.56  ? 119  PRO A C    2  
ATOM   8900   O O    . PRO A 1 119 ? 8.845   24.845 -23.668 0.010 25.17  ? 119  PRO A O    2  
ATOM   8901   C CB   . PRO A 1 119 ? 10.088  22.978 -21.541 0.010 24.26  ? 119  PRO A CB   2  
ATOM   8902   C CG   . PRO A 1 119 ? 10.480  21.615 -21.880 0.010 23.22  ? 119  PRO A CG   2  
ATOM   8903   C CD   . PRO A 1 119 ? 9.865   21.307 -23.191 0.010 22.49  ? 119  PRO A CD   2  
ATOM   8904   H HA   . PRO A 1 119 ? 8.012   22.835 -21.382 0.010 22.86  ? 119  PRO A HA   2  
ATOM   8905   H HB2  . PRO A 1 119 ? 10.650  23.627 -21.992 0.010 25.20  ? 119  PRO A HB2  2  
ATOM   8906   H HB3  . PRO A 1 119 ? 10.104  23.112 -20.581 0.010 24.62  ? 119  PRO A HB3  2  
ATOM   8907   H HG2  . PRO A 1 119 ? 11.446  21.558 -21.934 0.010 23.80  ? 119  PRO A HG2  2  
ATOM   8908   H HG3  . PRO A 1 119 ? 10.142  21.005 -21.204 0.010 22.59  ? 119  PRO A HG3  2  
ATOM   8909   H HD2  . PRO A 1 119 ? 10.444  21.573 -23.920 0.010 23.10  ? 119  PRO A HD2  2  
ATOM   8910   H HD3  . PRO A 1 119 ? 9.652   20.366 -23.237 0.010 21.62  ? 119  PRO A HD3  2  
ATOM   8911   N N    . GLY A 1 120 ? 7.592   25.259 -21.859 0.010 25.01  ? 120  GLY A N    2  
ATOM   8912   C CA   . GLY A 1 120 ? 7.274   26.611 -22.259 0.010 26.29  ? 120  GLY A CA   2  
ATOM   8913   C C    . GLY A 1 120 ? 5.941   26.728 -22.982 0.010 25.61  ? 120  GLY A C    2  
ATOM   8914   O O    . GLY A 1 120 ? 5.393   27.819 -23.072 0.010 26.64  ? 120  GLY A O    2  
ATOM   8915   H H    . GLY A 1 120 ? 7.235   25.020 -21.114 0.010 24.69  ? 120  GLY A H    2  
ATOM   8916   H HA2  . GLY A 1 120 ? 7.248   27.166 -21.466 0.010 27.05  ? 120  GLY A HA2  2  
ATOM   8917   H HA3  . GLY A 1 120 ? 7.959   26.962 -22.846 0.010 27.09  ? 120  GLY A HA3  2  
ATOM   8918   N N    . THR A 1 121 ? 5.454   25.620 -23.537 0.010 24.09  ? 121  THR A N    2  
ATOM   8919   C CA   . THR A 1 121 ? 4.187   25.617 -24.239 0.010 23.50  ? 121  THR A CA   2  
ATOM   8920   C C    . THR A 1 121 ? 3.090   26.097 -23.272 0.010 23.50  ? 121  THR A C    2  
ATOM   8921   O O    . THR A 1 121 ? 3.048   25.692 -22.132 0.010 23.14  ? 121  THR A O    2  
ATOM   8922   C CB   . THR A 1 121 ? 3.804   24.203 -24.775 0.010 21.94  ? 121  THR A CB   2  
ATOM   8923   O OG1  . THR A 1 121 ? 4.824   23.693 -25.643 0.010 22.04  ? 121  THR A OG1  2  
ATOM   8924   C CG2  . THR A 1 121 ? 2.449   24.263 -25.529 0.010 21.56  ? 121  THR A CG2  2  
ATOM   8925   H H    . THR A 1 121 ? 5.846   24.858 -23.516 0.010 23.48  ? 121  THR A H    2  
ATOM   8926   H HA   . THR A 1 121 ? 4.240   26.220 -24.994 0.010 24.26  ? 121  THR A HA   2  
ATOM   8927   H HB   . THR A 1 121 ? 3.715   23.597 -24.024 0.010 21.27  ? 121  THR A HB   2  
ATOM   8928   H HG1  . THR A 1 121 ? 4.874   24.168 -26.342 0.010 22.67  ? 121  THR A HG1  2  
ATOM   8929   H HG21 . THR A 1 121 ? 1.814   24.821 -25.056 0.010 22.33  ? 121  THR A HG21 2  
ATOM   8930   H HG22 . THR A 1 121 ? 2.569   24.628 -26.418 0.010 21.49  ? 121  THR A HG22 2  
ATOM   8931   H HG23 . THR A 1 121 ? 2.079   23.370 -25.605 0.010 20.72  ? 121  THR A HG23 2  
ATOM   8932   N N    . LEU A 1 122 ? 2.225   26.983 -23.740 0.010 24.09  ? 122  LEU A N    2  
ATOM   8933   C CA   . LEU A 1 122 ? 1.109   27.468 -22.940 0.010 24.21  ? 122  LEU A CA   2  
ATOM   8934   C C    . LEU A 1 122 ? -0.081  26.544 -23.115 0.010 22.74  ? 122  LEU A C    2  
ATOM   8935   O O    . LEU A 1 122 ? -0.551  26.378 -24.224 0.010 22.47  ? 122  LEU A O    2  
ATOM   8936   C CB   . LEU A 1 122 ? 0.715   28.871 -23.402 0.010 25.83  ? 122  LEU A CB   2  
ATOM   8937   C CG   . LEU A 1 122 ? 1.646   29.966 -22.908 0.010 27.58  ? 122  LEU A CG   2  
ATOM   8938   C CD1  . LEU A 1 122 ? 1.209   31.266 -23.540 0.010 29.34  ? 122  LEU A CD1  2  
ATOM   8939   C CD2  . LEU A 1 122 ? 1.607   30.038 -21.401 0.010 27.91  ? 122  LEU A CD2  2  
ATOM   8940   H H    . LEU A 1 122 ? 2.264   27.323 -24.529 0.010 24.51  ? 122  LEU A H    2  
ATOM   8941   H HA   . LEU A 1 122 ? 1.348   27.493 -22.002 0.010 24.39  ? 122  LEU A HA   2  
ATOM   8942   H HB2  . LEU A 1 122 ? 0.722   28.889 -24.369 0.010 25.93  ? 122  LEU A HB2  2  
ATOM   8943   H HB3  . LEU A 1 122 ? -0.175  29.081 -23.079 0.010 25.83  ? 122  LEU A HB3  2  
ATOM   8944   H HG   . LEU A 1 122 ? 2.555   29.775 -23.187 0.010 27.50  ? 122  LEU A HG   2  
ATOM   8945   H HD11 . LEU A 1 122 ? 0.969   31.100 -24.465 0.010 29.34  ? 122  LEU A HD11 2  
ATOM   8946   H HD12 . LEU A 1 122 ? 0.439   31.604 -23.057 0.010 29.29  ? 122  LEU A HD12 2  
ATOM   8947   H HD13 . LEU A 1 122 ? 1.945   31.898 -23.495 0.010 30.59  ? 122  LEU A HD13 2  
ATOM   8948   H HD21 . LEU A 1 122 ? 0.768   29.669 -21.088 0.010 26.82  ? 122  LEU A HD21 2  
ATOM   8949   H HD22 . LEU A 1 122 ? 2.346   29.526 -21.040 0.010 28.16  ? 122  LEU A HD22 2  
ATOM   8950   H HD23 . LEU A 1 122 ? 1.673   30.964 -21.127 0.010 29.08  ? 122  LEU A HD23 2  
ATOM   8951   N N    . CYS A 1 123 ? -0.549  25.952 -22.017 0.010 21.97  ? 123  CYS A N    2  
ATOM   8952   C CA   . CYS A 1 123 ? -1.660  25.030 -22.061 0.010 20.67  ? 123  CYS A CA   2  
ATOM   8953   C C    . CYS A 1 123 ? -2.777  25.522 -21.152 0.010 20.90  ? 123  CYS A C    2  
ATOM   8954   O O    . CYS A 1 123 ? -2.535  26.258 -20.194 0.010 21.80  ? 123  CYS A O    2  
ATOM   8955   C CB   . CYS A 1 123 ? -1.250  23.645 -21.611 0.010 19.55  ? 123  CYS A CB   2  
ATOM   8956   S SG   . CYS A 1 123 ? 0.124   22.931 -22.605 0.010 19.28  ? 123  CYS A SG   2  
ATOM   8957   H H    . CYS A 1 123 ? -0.239  26.078 -21.228 0.010 22.31  ? 123  CYS A H    2  
ATOM   8958   H HA   . CYS A 1 123 ? -1.994  24.964 -22.966 0.010 20.50  ? 123  CYS A HA   2  
ATOM   8959   H HB2  . CYS A 1 123 ? -0.982  23.681 -20.681 0.010 19.83  ? 123  CYS A HB2  2  
ATOM   8960   H HB3  . CYS A 1 123 ? -2.018  23.075 -21.710 0.010 18.84  ? 123  CYS A HB3  2  
ATOM   8961   N N    . ASP A 1 124 ? -3.991  25.119 -21.492 0.010 20.27  ? 124  ASP A N    2  
ATOM   8962   C CA   . ASP A 1 124 ? -5.178  25.540 -20.773 0.010 20.52  ? 124  ASP A CA   2  
ATOM   8963   C C    . ASP A 1 124 ? -5.672  24.428 -19.859 0.010 19.57  ? 124  ASP A C    2  
ATOM   8964   O O    . ASP A 1 124 ? -5.833  23.296 -20.297 0.010 18.48  ? 124  ASP A O    2  
ATOM   8965   C CB   . ASP A 1 124 ? -6.265  25.903 -21.776 0.010 20.49  ? 124  ASP A CB   2  
ATOM   8966   C CG   . ASP A 1 124 ? -7.578  26.299 -21.106 0.010 21.08  ? 124  ASP A CG   2  
ATOM   8967   O OD1  . ASP A 1 124 ? -7.586  27.344 -20.459 0.010 22.37  ? 124  ASP A OD1  2  
ATOM   8968   O OD2  . ASP A 1 124 ? -8.600  25.569 -21.230 0.010 20.40  ? 124  ASP A OD2  2  
ATOM   8969   H H    . ASP A 1 124 ? -4.155  24.604 -22.157 0.010 19.78  ? 124  ASP A H    2  
ATOM   8970   H HA   . ASP A 1 124 ? -4.991  26.322 -20.235 0.010 21.45  ? 124  ASP A HA   2  
ATOM   8971   H HB2  . ASP A 1 124 ? -5.957  26.650 -22.310 0.010 21.10  ? 124  ASP A HB2  2  
ATOM   8972   H HB3  . ASP A 1 124 ? -6.428  25.135 -22.344 0.010 19.63  ? 124  ASP A HB3  2  
ATOM   8973   N N    . VAL A 1 125 ? -5.877  24.769 -18.592 0.010 20.20  ? 125  VAL A N    2  
ATOM   8974   C CA   . VAL A 1 125 ? -6.515  23.888 -17.628 0.010 19.67  ? 125  VAL A CA   2  
ATOM   8975   C C    . VAL A 1 125 ? -7.813  24.517 -17.200 0.010 20.30  ? 125  VAL A C    2  
ATOM   8976   O O    . VAL A 1 125 ? -7.865  25.716 -16.905 0.010 21.59  ? 125  VAL A O    2  
ATOM   8977   C CB   . VAL A 1 125 ? -5.760  23.774 -16.297 0.010 20.14  ? 125  VAL A CB   2  
ATOM   8978   C CG1  . VAL A 1 125 ? -6.024  22.396 -15.672 0.010 19.40  ? 125  VAL A CG1  2  
ATOM   8979   C CG2  . VAL A 1 125 ? -4.305  24.050 -16.459 0.010 20.11  ? 125  VAL A CG2  2  
ATOM   8980   H H    . VAL A 1 125 ? -5.654  25.528 -18.264 0.010 21.07  ? 125  VAL A H    2  
ATOM   8981   H HA   . VAL A 1 125 ? -6.688  23.015 -18.001 0.010 18.78  ? 125  VAL A HA   2  
ATOM   8982   H HB   . VAL A 1 125 ? -6.098  24.443 -15.681 0.010 21.12  ? 125  VAL A HB   2  
ATOM   8983   H HG11 . VAL A 1 125 ? -6.746  21.954 -16.142 0.010 18.73  ? 125  VAL A HG11 2  
ATOM   8984   H HG12 . VAL A 1 125 ? -5.221  21.858 -15.736 0.010 19.08  ? 125  VAL A HG12 2  
ATOM   8985   H HG13 . VAL A 1 125 ? -6.260  22.515 -14.740 0.010 20.06  ? 125  VAL A HG13 2  
ATOM   8986   H HG21 . VAL A 1 125 ? -4.041  23.920 -17.383 0.010 19.42  ? 125  VAL A HG21 2  
ATOM   8987   H HG22 . VAL A 1 125 ? -4.133  24.966 -16.189 0.010 21.02  ? 125  VAL A HG22 2  
ATOM   8988   H HG23 . VAL A 1 125 ? -3.810  23.437 -15.893 0.010 19.99  ? 125  VAL A HG23 2  
ATOM   8989   N N    . ALA A 1 126 ? -8.813  23.689 -17.050 0.010 19.54  ? 126  ALA A N    2  
ATOM   8990   C CA   . ALA A 1 126 ? -10.133 24.157 -16.691 0.010 20.04  ? 126  ALA A CA   2  
ATOM   8991   C C    . ALA A 1 126 ? -10.838 23.240 -15.687 0.010 19.93  ? 126  ALA A C    2  
ATOM   8992   O O    . ALA A 1 126 ? -10.464 22.082 -15.507 0.010 19.11  ? 126  ALA A O    2  
ATOM   8993   C CB   . ALA A 1 126 ? -10.947 24.319 -17.937 0.010 19.53  ? 126  ALA A CB   2  
ATOM   8994   H H    . ALA A 1 126 ? -8.755  22.838 -17.150 0.010 18.78  ? 126  ALA A H    2  
ATOM   8995   H HA   . ALA A 1 126 ? -10.058 25.026 -16.273 0.010 21.00  ? 126  ALA A HA   2  
ATOM   8996   H HB1  . ALA A 1 126 ? -10.921 23.493 -18.444 0.010 18.69  ? 126  ALA A HB1  2  
ATOM   8997   H HB2  . ALA A 1 126 ? -11.862 24.514 -17.682 0.010 19.83  ? 126  ALA A HB2  2  
ATOM   8998   H HB3  . ALA A 1 126 ? -10.588 25.049 -18.465 0.010 19.89  ? 126  ALA A HB3  2  
ATOM   8999   N N    . GLY A 1 127 ? -11.861 23.774 -15.025 0.010 20.97  ? 127  GLY A N    2  
ATOM   9000   C CA   . GLY A 1 127 ? -12.603 23.007 -14.037 0.010 21.20  ? 127  GLY A CA   2  
ATOM   9001   C C    . GLY A 1 127 ? -13.329 23.876 -13.021 0.010 22.45  ? 127  GLY A C    2  
ATOM   9002   O O    . GLY A 1 127 ? -13.241 25.093 -13.114 0.010 23.41  ? 127  GLY A O    2  
ATOM   9003   H H    . GLY A 1 127 ? -12.141 24.577 -15.133 0.010 21.63  ? 127  GLY A H    2  
ATOM   9004   H HA2  . GLY A 1 127 ? -13.245 22.432 -14.482 0.010 20.40  ? 127  GLY A HA2  2  
ATOM   9005   H HA3  . GLY A 1 127 ? -11.977 22.457 -13.548 0.010 21.49  ? 127  GLY A HA3  2  
ATOM   9006   N N    . TRP A 1 128 ? -13.955 23.264 -12.021 0.010 22.57  ? 128  TRP A N    2  
ATOM   9007   C CA   . TRP A 1 128 ? -14.821 24.006 -11.069 0.010 23.96  ? 128  TRP A CA   2  
ATOM   9008   C C    . TRP A 1 128 ? -14.326 24.244 -9.629  0.010 25.48  ? 128  TRP A C    2  
ATOM   9009   O O    . TRP A 1 128 ? -13.600 25.205 -9.391  0.010 26.71  ? 128  TRP A O    2  
ATOM   9010   C CB   . TRP A 1 128 ? -16.177 23.332 -11.019 0.010 23.45  ? 128  TRP A CB   2  
ATOM   9011   C CG   . TRP A 1 128 ? -16.984 23.549 -12.219 0.010 22.86  ? 128  TRP A CG   2  
ATOM   9012   C CD1  . TRP A 1 128 ? -17.894 24.554 -12.420 0.010 23.76  ? 128  TRP A CD1  2  
ATOM   9013   C CD2  . TRP A 1 128 ? -17.038 22.720 -13.389 0.010 21.45  ? 128  TRP A CD2  2  
ATOM   9014   N NE1  . TRP A 1 128 ? -18.484 24.416 -13.649 0.010 22.99  ? 128  TRP A NE1  2  
ATOM   9015   C CE2  . TRP A 1 128 ? -17.981 23.297 -14.263 0.010 21.60  ? 128  TRP A CE2  2  
ATOM   9016   C CE3  . TRP A 1 128 ? -16.379 21.549 -13.781 0.010 20.26  ? 128  TRP A CE3  2  
ATOM   9017   C CZ2  . TRP A 1 128 ? -18.282 22.751 -15.496 0.010 20.68  ? 128  TRP A CZ2  2  
ATOM   9018   C CZ3  . TRP A 1 128 ? -16.673 21.009 -15.011 0.010 19.35  ? 128  TRP A CZ3  2  
ATOM   9019   C CH2  . TRP A 1 128 ? -17.633 21.607 -15.853 0.010 19.59  ? 128  TRP A CH2  2  
ATOM   9020   H H    . TRP A 1 128 ? -13.894 22.425 -11.860 0.010 21.95  ? 128  TRP A H    2  
ATOM   9021   H HA   . TRP A 1 128 ? -14.977 24.888 -11.439 0.010 24.49  ? 128  TRP A HA   2  
ATOM   9022   H HB2  . TRP A 1 128 ? -16.053 22.376 -10.915 0.010 22.72  ? 128  TRP A HB2  2  
ATOM   9023   H HB3  . TRP A 1 128 ? -16.680 23.683 -10.266 0.010 24.41  ? 128  TRP A HB3  2  
ATOM   9024   H HD1  . TRP A 1 128 ? -18.073 25.240 -11.819 0.010 24.86  ? 128  TRP A HD1  2  
ATOM   9025   H HE1  . TRP A 1 128 ? -19.075 24.941 -13.980 0.010 23.41  ? 128  TRP A HE1  2  
ATOM   9026   H HE3  . TRP A 1 128 ? -15.754 21.148 -13.222 0.010 20.21  ? 128  TRP A HE3  2  
ATOM   9027   H HZ2  . TRP A 1 128 ? -18.903 23.149 -16.057 0.010 20.92  ? 128  TRP A HZ2  2  
ATOM   9028   H HZ3  . TRP A 1 128 ? -16.243 20.235 -15.285 0.010 18.67  ? 128  TRP A HZ3  2  
ATOM   9029   H HH2  . TRP A 1 128 ? -17.807 21.230 -16.685 0.010 19.10  ? 128  TRP A HH2  2  
ATOM   9030   N N    . GLY A 1 129 ? -14.743 23.406 -8.667  0.010 25.69  ? 129  GLY A N    2  
ATOM   9031   C CA   . GLY A 1 129 ? -14.373 23.555 -7.260  0.010 27.50  ? 129  GLY A CA   2  
ATOM   9032   C C    . GLY A 1 129 ? -14.673 22.382 -6.319  0.010 27.92  ? 129  GLY A C    2  
ATOM   9033   O O    . GLY A 1 129 ? -14.535 21.237 -6.707  0.010 26.70  ? 129  GLY A O    2  
ATOM   9034   H H    . GLY A 1 129 ? -15.246 22.726 -8.811  0.010 24.92  ? 129  GLY A H    2  
ATOM   9035   H HA2  . GLY A 1 129 ? -13.417 23.680 -7.241  0.010 27.81  ? 129  GLY A HA2  2  
ATOM   9036   H HA3  . GLY A 1 129 ? -14.777 24.348 -6.888  0.010 28.53  ? 129  GLY A HA3  2  
ATOM   9037   N N    . ILE A 1 130 ? -15.028 22.655 -5.064  0.010 29.83  ? 130  ILE A N    2  
ATOM   9038   C CA   . ILE A 1 130 ? -15.290 21.572 -4.096  0.010 30.68  ? 130  ILE A CA   2  
ATOM   9039   C C    . ILE A 1 130 ? -15.903 21.984 -2.727  0.010 33.28  ? 130  ILE A C    2  
ATOM   9040   O O    . ILE A 1 130 ? -15.928 23.166 -2.343  0.010 34.80  ? 130  ILE A O    2  
ATOM   9041   C CB   . ILE A 1 130 ? -13.982 20.719 -3.839  0.010 30.33  ? 130  ILE A CB   2  
ATOM   9042   C CG1  . ILE A 1 130 ? -14.302 19.360 -3.218  0.010 30.77  ? 130  ILE A CG1  2  
ATOM   9043   C CG2  . ILE A 1 130 ? -12.981 21.468 -2.950  0.010 31.91  ? 130  ILE A CG2  2  
ATOM   9044   C CD1  . ILE A 1 130 ? -15.239 18.483 -4.045  0.010 29.17  ? 130  ILE A CD1  2  
ATOM   9045   H H    . ILE A 1 130 ? -15.106 23.448 -4.746  0.010 30.74  ? 130  ILE A H    2  
ATOM   9046   H HA   . ILE A 1 130 ? -15.933 20.978 -4.514  0.010 29.93  ? 130  ILE A HA   2  
ATOM   9047   H HB   . ILE A 1 130 ? -13.550 20.554 -4.689  0.010 28.88  ? 130  ILE A HB   2  
ATOM   9048   H HG12 . ILE A 1 130 ? -13.471 18.872 -3.113  0.010 30.71  ? 130  ILE A HG12 2  
ATOM   9049   H HG13 . ILE A 1 130 ? -14.692 19.489 -2.348  0.010 32.29  ? 130  ILE A HG13 2  
ATOM   9050   H HG21 . ILE A 1 130 ? -13.385 22.284 -2.611  0.010 32.50  ? 130  ILE A HG21 2  
ATOM   9051   H HG22 . ILE A 1 130 ? -12.734 20.900 -2.200  0.010 33.26  ? 130  ILE A HG22 2  
ATOM   9052   H HG23 . ILE A 1 130 ? -12.197 21.686 -3.473  0.010 31.12  ? 130  ILE A HG23 2  
ATOM   9053   H HD11 . ILE A 1 130 ? -15.125 18.689 -4.987  0.010 28.22  ? 130  ILE A HD11 2  
ATOM   9054   H HD12 . ILE A 1 130 ? -15.017 17.552 -3.875  0.010 30.05  ? 130  ILE A HD12 2  
ATOM   9055   H HD13 . ILE A 1 130 ? -16.159 18.657 -3.776  0.010 28.38  ? 130  ILE A HD13 2  
ATOM   9056   N N    . VAL A 1 131 ? -16.445 20.990 -2.018  0.010 33.94  ? 131  VAL A N    2  
ATOM   9057   C CA   . VAL A 1 131 ? -16.762 21.074 -0.565  0.010 36.57  ? 131  VAL A CA   2  
ATOM   9058   C C    . VAL A 1 131 ? -17.472 22.320 0.031   0.010 38.06  ? 131  VAL A C    2  
ATOM   9059   O O    . VAL A 1 131 ? -18.701 22.396 -0.042  0.010 37.22  ? 131  VAL A O    2  
ATOM   9060   C CB   . VAL A 1 131 ? -15.525 20.698 0.349   0.010 38.11  ? 131  VAL A CB   2  
ATOM   9061   C CG1  . VAL A 1 131 ? -15.234 19.213 0.217   0.010 37.42  ? 131  VAL A CG1  2  
ATOM   9062   C CG2  . VAL A 1 131 ? -14.252 21.594 0.110   0.010 37.81  ? 131  VAL A CG2  2  
ATOM   9063   H H    . VAL A 1 131 ? -16.653 20.225 -2.359  0.010 32.95  ? 131  VAL A H    2  
ATOM   9064   H HA   . VAL A 1 131 ? -17.395 20.355 -0.419  0.010 36.62  ? 131  VAL A HA   2  
ATOM   9065   H HB   . VAL A 1 131 ? -15.790 20.845 1.269   0.010 40.06  ? 131  VAL A HB   2  
ATOM   9066   H HG11 . VAL A 1 131 ? -15.696 18.872 -0.564  0.010 35.56  ? 131  VAL A HG11 2  
ATOM   9067   H HG12 . VAL A 1 131 ? -14.278 19.058 0.130   0.010 38.07  ? 131  VAL A HG12 2  
ATOM   9068   H HG13 . VAL A 1 131 ? -15.567 18.767 1.009   0.010 38.36  ? 131  VAL A HG13 2  
ATOM   9069   H HG21 . VAL A 1 131 ? -14.407 22.196 -0.629  0.010 38.85  ? 131  VAL A HG21 2  
ATOM   9070   H HG22 . VAL A 1 131 ? -14.078 22.110 0.915   0.010 38.50  ? 131  VAL A HG22 2  
ATOM   9071   H HG23 . VAL A 1 131 ? -13.486 21.035 -0.079  0.010 35.98  ? 131  VAL A HG23 2  
ATOM   9072   N N    . ASN A 1 132 ? -16.726 23.241 0.662   0.010 40.41  ? 132  ASN A N    2  
ATOM   9073   C CA   . ASN A 1 132 ? -17.309 24.361 1.446   0.010 42.13  ? 132  ASN A CA   2  
ATOM   9074   C C    . ASN A 1 132 ? -16.295 25.487 1.838   0.010 44.00  ? 132  ASN A C    2  
ATOM   9075   O O    . ASN A 1 132 ? -15.808 25.536 2.970   0.010 46.74  ? 132  ASN A O    2  
ATOM   9076   C CB   . ASN A 1 132 ? -17.986 23.840 2.736   0.010 43.90  ? 132  ASN A CB   2  
ATOM   9077   C CG   . ASN A 1 132 ? -19.265 23.013 2.478   0.010 42.07  ? 132  ASN A CG   2  
ATOM   9078   O OD1  . ASN A 1 132 ? -19.527 22.033 3.181   0.010 41.39  ? 132  ASN A OD1  2  
ATOM   9079   N ND2  . ASN A 1 132 ? -20.054 23.400 1.459   0.010 41.29  ? 132  ASN A ND2  2  
ATOM   9080   H H    . ASN A 1 132 ? -15.868 23.253 0.652   0.010 41.19  ? 132  ASN A H    2  
ATOM   9081   H HA   . ASN A 1 132 ? -17.995 24.780 0.904   0.010 40.88  ? 132  ASN A HA   2  
ATOM   9082   H HB2  . ASN A 1 132 ? -17.358 23.275 3.213   0.010 45.29  ? 132  ASN A HB2  2  
ATOM   9083   H HB3  . ASN A 1 132 ? -18.233 24.600 3.288   0.010 45.01  ? 132  ASN A HB3  2  
ATOM   9084   H HD21 . ASN A 1 132 ? -19.962 24.182 1.112   0.010 41.29  ? 132  ASN A HD21 2  
ATOM   9085   H HD22 . ASN A 1 132 ? -20.658 22.866 1.154   0.010 40.84  ? 132  ASN A HD22 2  
ATOM   9086   N N    . HIS A 1 133 ? -16.026 26.401 0.898   0.010 42.55  ? 133  HIS A N    2  
ATOM   9087   C CA   . HIS A 1 133 ? -15.023 27.478 1.026   0.010 43.97  ? 133  HIS A CA   2  
ATOM   9088   C C    . HIS A 1 133 ? -15.671 28.793 0.630   0.010 44.73  ? 133  HIS A C    2  
ATOM   9089   O O    . HIS A 1 133 ? -15.823 29.052 -0.580  0.010 42.82  ? 133  HIS A O    2  
ATOM   9090   C CB   . HIS A 1 133 ? -13.879 27.206 0.038   0.010 41.84  ? 133  HIS A CB   2  
ATOM   9091   C CG   . HIS A 1 133 ? -12.917 28.348 -0.130  0.010 43.32  ? 133  HIS A CG   2  
ATOM   9092   N ND1  . HIS A 1 133 ? -12.835 29.401 0.758   0.010 45.80  ? 133  HIS A ND1  2  
ATOM   9093   C CD2  . HIS A 1 133 ? -11.981 28.589 -1.082  0.010 42.80  ? 133  HIS A CD2  2  
ATOM   9094   C CE1  . HIS A 1 133 ? -11.902 30.245 0.356   0.010 46.78  ? 133  HIS A CE1  2  
ATOM   9095   N NE2  . HIS A 1 133 ? -11.359 29.770 -0.749  0.010 44.97  ? 133  HIS A NE2  2  
ATOM   9096   H H    . HIS A 1 133 ? -16.430 26.418 0.137   0.010 40.74  ? 133  HIS A H    2  
ATOM   9097   H HA   . HIS A 1 133 ? -14.682 27.541 1.931   0.010 45.84  ? 133  HIS A HA   2  
ATOM   9098   H HB2  . HIS A 1 133 ? -13.375 26.432 0.336   0.010 40.89  ? 133  HIS A HB2  2  
ATOM   9099   H HB3  . HIS A 1 133 ? -14.262 27.018 -0.833  0.010 40.45  ? 133  HIS A HB3  2  
ATOM   9100   H HD1  . HIS A 1 133 ? -13.323 29.502 1.460   0.010 46.66  ? 133  HIS A HD1  2  
ATOM   9101   H HD2  . HIS A 1 133 ? -11.789 28.053 -1.815  0.010 41.35  ? 133  HIS A HD2  2  
ATOM   9102   H HE1  . HIS A 1 133 ? -11.658 31.033 0.787   0.010 48.55  ? 133  HIS A HE1  2  
ATOM   9103   H HE2  . HIS A 1 133 ? -10.739 30.146 -1.185  0.010 45.19  ? 133  HIS A HE2  2  
ATOM   9104   N N    . ALA A 1 134 ? -16.002 29.639 1.611   0.010 47.68  ? 134  ALA A N    2  
ATOM   9105   C CA   . ALA A 1 134 ? -17.068 30.616 1.420   0.010 48.64  ? 134  ALA A CA   2  
ATOM   9106   C C    . ALA A 1 134 ? -18.153 29.809 0.739   0.010 46.24  ? 134  ALA A C    2  
ATOM   9107   O O    . ALA A 1 134 ? -18.682 30.178 -0.308  0.010 45.04  ? 134  ALA A O    2  
ATOM   9108   C CB   . ALA A 1 134 ? -16.621 31.798 0.569   0.010 49.07  ? 134  ALA A CB   2  
ATOM   9109   H H    . ALA A 1 134 ? -15.626 29.667 2.384   0.010 49.25  ? 134  ALA A H    2  
ATOM   9110   H HA   . ALA A 1 134 ? -17.397 30.937 2.275   0.010 50.70  ? 134  ALA A HA   2  
ATOM   9111   H HB1  . ALA A 1 134 ? -16.199 31.479 -0.243  0.010 47.05  ? 134  ALA A HB1  2  
ATOM   9112   H HB2  . ALA A 1 134 ? -17.398 32.339 0.350   0.010 50.17  ? 134  ALA A HB2  2  
ATOM   9113   H HB3  . ALA A 1 134 ? -15.996 32.324 1.085   0.010 50.38  ? 134  ALA A HB3  2  
ATOM   9114   N N    . GLY A 1 135 ? -18.432 28.669 1.360   0.010 45.67  ? 135  GLY A N    2  
ATOM   9115   C CA   . GLY A 1 135 ? -19.244 27.614 0.785   0.010 43.56  ? 135  GLY A CA   2  
ATOM   9116   C C    . GLY A 1 135 ? -19.058 27.319 -0.673  0.010 40.62  ? 135  GLY A C    2  
ATOM   9117   O O    . GLY A 1 135 ? -18.241 26.500 -1.083  0.010 39.00  ? 135  GLY A O    2  
ATOM   9118   H H    . GLY A 1 135 ? -18.153 28.485 2.152   0.010 46.64  ? 135  GLY A H    2  
ATOM   9119   H HA2  . GLY A 1 135 ? -19.087 26.788 1.269   0.010 43.45  ? 135  GLY A HA2  2  
ATOM   9120   H HA3  . GLY A 1 135 ? -20.171 27.870 0.874   0.010 44.28  ? 135  GLY A HA3  2  
ATOM   9121   N N    . ARG A 1 136 ? -19.872 28.014 -1.448  0.010 40.16  ? 136  ARG A N    2  
ATOM   9122   C CA   . ARG A 1 136 ? -20.021 27.768 -2.859  0.010 37.64  ? 136  ARG A CA   2  
ATOM   9123   C C    . ARG A 1 136 ? -18.773 28.366 -3.534  0.010 37.08  ? 136  ARG A C    2  
ATOM   9124   O O    . ARG A 1 136 ? -18.430 29.511 -3.280  0.010 36.96  ? 136  ARG A O    2  
ATOM   9125   C CB   . ARG A 1 136 ? -21.358 28.408 -3.264  0.010 37.79  ? 136  ARG A CB   2  
ATOM   9126   C CG   . ARG A 1 136 ? -22.663 27.683 -2.742  0.010 35.99  ? 136  ARG A CG   2  
ATOM   9127   C CD   . ARG A 1 136 ? -22.530 26.767 -1.482  0.010 36.60  ? 136  ARG A CD   2  
ATOM   9128   N NE   . ARG A 1 136 ? -23.437 25.610 -1.502  0.010 36.82  ? 136  ARG A NE   2  
ATOM   9129   C CZ   . ARG A 1 136 ? -24.722 25.622 -1.148  0.010 38.88  ? 136  ARG A CZ   2  
ATOM   9130   N NH1  . ARG A 1 136 ? -25.314 26.738 -0.742  0.010 41.05  ? 136  ARG A NH1  2  
ATOM   9131   N NH2  . ARG A 1 136 ? -25.426 24.494 -1.211  0.010 38.92  ? 136  ARG A NH2  2  
ATOM   9132   H H    . ARG A 1 136 ? -20.371 28.654 -1.162  0.010 41.42  ? 136  ARG A H    2  
ATOM   9133   H HA   . ARG A 1 136 ? -20.053 26.814 -3.038  0.010 36.38  ? 136  ARG A HA   2  
ATOM   9134   H HB2  . ARG A 1 136 ? -21.375 29.305 -2.900  0.010 39.49  ? 136  ARG A HB2  2  
ATOM   9135   H HB3  . ARG A 1 136 ? -21.410 28.455 -4.230  0.010 37.59  ? 136  ARG A HB3  2  
ATOM   9136   H HG2  . ARG A 1 136 ? -23.308 28.374 -2.514  0.010 36.12  ? 136  ARG A HG2  2  
ATOM   9137   H HG3  . ARG A 1 136 ? -23.026 27.139 -3.458  0.010 34.43  ? 136  ARG A HG3  2  
ATOM   9138   H HD2  . ARG A 1 136 ? -21.639 26.401 -1.424  0.010 35.39  ? 136  ARG A HD2  2  
ATOM   9139   H HD3  . ARG A 1 136 ? -22.725 27.291 -0.689  0.010 38.16  ? 136  ARG A HD3  2  
ATOM   9140   H HE   . ARG A 1 136 ? -23.159 24.907 -1.909  0.010 35.58  ? 136  ARG A HE   2  
ATOM   9141   H HH11 . ARG A 1 136 ? -24.870 27.472 -0.698  0.010 41.14  ? 136  ARG A HH11 2  
ATOM   9142   H HH12 . ARG A 1 136 ? -26.147 26.726 -0.521  0.010 42.45  ? 136  ARG A HH12 2  
ATOM   9143   H HH21 . ARG A 1 136 ? -25.046 23.767 -1.476  0.010 37.65  ? 136  ARG A HH21 2  
ATOM   9144   H HH22 . ARG A 1 136 ? -26.258 24.489 -0.989  0.010 40.29  ? 136  ARG A HH22 2  
ATOM   9145   N N    . ARG A 1 137 ? -18.083 27.577 -4.368  0.010 37.08  ? 137  ARG A N    2  
ATOM   9146   C CA   . ARG A 1 137 ? -16.683 27.843 -4.722  0.010 36.11  ? 137  ARG A CA   2  
ATOM   9147   C C    . ARG A 1 137 ? -16.566 28.683 -5.992  0.010 35.25  ? 137  ARG A C    2  
ATOM   9148   O O    . ARG A 1 137 ? -16.743 29.896 -5.946  0.010 36.74  ? 137  ARG A O    2  
ATOM   9149   C CB   . ARG A 1 137 ? -15.955 26.514 -4.874  0.010 34.20  ? 137  ARG A CB   2  
ATOM   9150   C CG   . ARG A 1 137 ? -16.330 25.496 -3.826  0.010 34.57  ? 137  ARG A CG   2  
ATOM   9151   C CD   . ARG A 1 137 ? -17.402 24.524 -4.369  0.010 33.41  ? 137  ARG A CD   2  
ATOM   9152   N NE   . ARG A 1 137 ? -18.157 23.808 -3.331  0.010 34.68  ? 137  ARG A NE   2  
ATOM   9153   C CZ   . ARG A 1 137 ? -19.486 23.764 -3.261  0.010 34.21  ? 137  ARG A CZ   2  
ATOM   9154   N NH1  . ARG A 1 137 ? -20.237 24.395 -4.153  0.010 32.57  ? 137  ARG A NH1  2  
ATOM   9155   N NH2  . ARG A 1 137 ? -20.074 23.092 -2.282  0.010 35.56  ? 137  ARG A NH2  2  
ATOM   9156   H H    . ARG A 1 137 ? -18.409 26.886 -4.751  0.010 37.80  ? 137  ARG A H    2  
ATOM   9157   H HA   . ARG A 1 137 ? -16.254 28.328 -3.999  0.010 37.52  ? 137  ARG A HA   2  
ATOM   9158   H HB2  . ARG A 1 137 ? -16.217 26.112 -5.711  0.010 32.67  ? 137  ARG A HB2  2  
ATOM   9159   H HB3  . ARG A 1 137 ? -14.995 26.657 -4.844  0.010 34.26  ? 137  ARG A HB3  2  
ATOM   9160   H HG2  . ARG A 1 137 ? -15.528 25.011 -3.592  0.010 33.86  ? 137  ARG A HG2  2  
ATOM   9161   H HG3  . ARG A 1 137 ? -16.691 25.948 -3.048  0.010 36.32  ? 137  ARG A HG3  2  
ATOM   9162   H HD2  . ARG A 1 137 ? -18.023 25.037 -4.899  0.010 33.32  ? 137  ARG A HD2  2  
ATOM   9163   H HD3  . ARG A 1 137 ? -16.991 23.869 -4.944  0.010 31.90  ? 137  ARG A HD3  2  
ATOM   9164   H HE   . ARG A 1 137 ? -17.720 23.429 -2.698  0.010 35.79  ? 137  ARG A HE   2  
ATOM   9165   H HH11 . ARG A 1 137 ? -19.883 24.839 -4.795  0.010 31.80  ? 137  ARG A HH11 2  
ATOM   9166   H HH12 . ARG A 1 137 ? -21.095 24.356 -4.089  0.010 32.35  ? 137  ARG A HH12 2  
ATOM   9167   H HH21 . ARG A 1 137 ? -19.600 22.677 -1.698  0.010 36.76  ? 137  ARG A HH21 2  
ATOM   9168   H HH22 . ARG A 1 137 ? -20.934 23.065 -2.238  0.010 35.31  ? 137  ARG A HH22 2  
ATOM   9169   N N    . PRO A 1 138 ? -16.181 28.061 -7.120  0.010 33.15  ? 138  PRO A N    2  
ATOM   9170   C CA   . PRO A 1 138 ? -16.862 28.687 -8.250  0.010 32.31  ? 138  PRO A CA   2  
ATOM   9171   C C    . PRO A 1 138 ? -18.094 27.867 -8.563  0.010 30.80  ? 138  PRO A C    2  
ATOM   9172   O O    . PRO A 1 138 ? -18.061 26.628 -8.534  0.010 29.44  ? 138  PRO A O    2  
ATOM   9173   C CB   . PRO A 1 138 ? -15.843 28.597 -9.369  0.010 31.11  ? 138  PRO A CB   2  
ATOM   9174   C CG   . PRO A 1 138 ? -15.087 27.432 -9.065  0.010 30.25  ? 138  PRO A CG   2  
ATOM   9175   C CD   . PRO A 1 138 ? -14.961 27.369 -7.570  0.010 32.04  ? 138  PRO A CD   2  
ATOM   9176   H HA   . PRO A 1 138 ? -17.102 29.617 -8.117  0.010 33.57  ? 138  PRO A HA   2  
ATOM   9177   H HB2  . PRO A 1 138 ? -16.292 28.502 -10.219 0.010 30.03  ? 138  PRO A HB2  2  
ATOM   9178   H HB3  . PRO A 1 138 ? -15.278 29.386 -9.359  0.010 32.19  ? 138  PRO A HB3  2  
ATOM   9179   H HG2  . PRO A 1 138 ? -15.558 26.655 -9.404  0.010 28.99  ? 138  PRO A HG2  2  
ATOM   9180   H HG3  . PRO A 1 138 ? -14.215 27.514 -9.476  0.010 30.01  ? 138  PRO A HG3  2  
ATOM   9181   H HD2  . PRO A 1 138 ? -14.947 26.443 -7.291  0.010 31.40  ? 138  PRO A HD2  2  
ATOM   9182   H HD3  . PRO A 1 138 ? -14.170 27.837 -7.264  0.010 33.13  ? 138  PRO A HD3  2  
ATOM   9183   N N    . ASP A 1 139 ? -19.183 28.550 -8.854  0.010 31.18  ? 139  ASP A N    2  
ATOM   9184   C CA   . ASP A 1 139 ? -20.349 27.857 -9.351  0.010 29.98  ? 139  ASP A CA   2  
ATOM   9185   C C    . ASP A 1 139 ? -20.110 27.535 -10.830 0.010 28.34  ? 139  ASP A C    2  
ATOM   9186   O O    . ASP A 1 139 ? -20.507 26.487 -11.310 0.010 26.95  ? 139  ASP A O    2  
ATOM   9187   C CB   . ASP A 1 139 ? -21.573 28.737 -9.145  0.010 31.43  ? 139  ASP A CB   2  
ATOM   9188   C CG   . ASP A 1 139 ? -22.871 28.022 -9.439  0.010 30.48  ? 139  ASP A CG   2  
ATOM   9189   O OD1  . ASP A 1 139 ? -23.038 26.827 -9.057  0.010 29.90  ? 139  ASP A OD1  2  
ATOM   9190   O OD2  . ASP A 1 139 ? -23.727 28.683 -10.050 0.010 30.51  ? 139  ASP A OD2  2  
ATOM   9191   H H    . ASP A 1 139 ? -19.269 29.401 -8.775  0.010 32.22  ? 139  ASP A H    2  
ATOM   9192   H HA   . ASP A 1 139 ? -20.481 27.026 -8.867  0.010 29.49  ? 139  ASP A HA   2  
ATOM   9193   H HB2  . ASP A 1 139 ? -21.596 29.031 -8.221  0.010 32.45  ? 139  ASP A HB2  2  
ATOM   9194   H HB3  . ASP A 1 139 ? -21.508 29.505 -9.733  0.010 32.17  ? 139  ASP A HB3  2  
ATOM   9195   N N    . SER A 1 140 ? -19.434 28.439 -11.534 0.010 28.71  ? 140  SER A N    2  
ATOM   9196   C CA   . SER A 1 140 ? -19.200 28.328 -12.969 0.010 27.55  ? 140  SER A CA   2  
ATOM   9197   C C    . SER A 1 140 ? -17.755 27.898 -13.295 0.010 26.47  ? 140  SER A C    2  
ATOM   9198   O O    . SER A 1 140 ? -16.853 28.077 -12.494 0.010 27.06  ? 140  SER A O    2  
ATOM   9199   C CB   . SER A 1 140 ? -19.493 29.658 -13.658 0.010 28.84  ? 140  SER A CB   2  
ATOM   9200   O OG   . SER A 1 140 ? -18.675 30.690 -13.143 0.010 30.37  ? 140  SER A OG   2  
ATOM   9201   H H    . SER A 1 140 ? -19.092 29.147 -11.191 0.010 29.78  ? 140  SER A H    2  
ATOM   9202   H HA   . SER A 1 140 ? -19.800 27.669 -13.339 0.010 26.78  ? 140  SER A HA   2  
ATOM   9203   H HB2  . SER A 1 140 ? -19.320 29.566 -14.605 0.010 28.20  ? 140  SER A HB2  2  
ATOM   9204   H HB3  . SER A 1 140 ? -20.423 29.890 -13.511 0.010 29.39  ? 140  SER A HB3  2  
ATOM   9205   H HG   . SER A 1 140 ? -18.832 30.806 -12.316 0.010 31.14  ? 140  SER A HG   2  
ATOM   9206   N N    . LEU A 1 141 ? -17.579 27.354 -14.494 0.010 25.05  ? 141  LEU A N    2  
ATOM   9207   C CA   . LEU A 1 141 ? -16.291 26.818 -14.956 0.010 23.97  ? 141  LEU A CA   2  
ATOM   9208   C C    . LEU A 1 141 ? -15.190 27.892 -14.989 0.010 24.92  ? 141  LEU A C    2  
ATOM   9209   O O    . LEU A 1 141 ? -15.401 29.004 -15.490 0.010 25.87  ? 141  LEU A O    2  
ATOM   9210   C CB   . LEU A 1 141 ? -16.435 26.243 -16.349 0.010 22.71  ? 141  LEU A CB   2  
ATOM   9211   C CG   . LEU A 1 141 ? -15.254 25.463 -16.962 0.010 21.52  ? 141  LEU A CG   2  
ATOM   9212   C CD1  . LEU A 1 141 ? -14.848 24.233 -16.162 0.010 20.78  ? 141  LEU A CD1  2  
ATOM   9213   C CD2  . LEU A 1 141 ? -15.589 25.083 -18.383 0.010 20.72  ? 141  LEU A CD2  2  
ATOM   9214   H H    . LEU A 1 141 ? -18.206 27.282 -15.077 0.010 24.76  ? 141  LEU A H    2  
ATOM   9215   H HA   . LEU A 1 141 ? -16.012 26.098 -14.368 0.010 23.60  ? 141  LEU A HA   2  
ATOM   9216   H HB2  . LEU A 1 141 ? -17.192 25.638 -16.333 0.010 22.31  ? 141  LEU A HB2  2  
ATOM   9217   H HB3  . LEU A 1 141 ? -16.629 26.973 -16.951 0.010 23.18  ? 141  LEU A HB3  2  
ATOM   9218   H HG   . LEU A 1 141 ? -14.480 26.048 -16.992 0.010 21.94  ? 141  LEU A HG   2  
ATOM   9219   H HD11 . LEU A 1 141 ? -15.642 23.742 -15.901 0.010 20.68  ? 141  LEU A HD11 2  
ATOM   9220   H HD12 . LEU A 1 141 ? -14.276 23.670 -16.709 0.010 19.98  ? 141  LEU A HD12 2  
ATOM   9221   H HD13 . LEU A 1 141 ? -14.369 24.526 -15.374 0.010 21.36  ? 141  LEU A HD13 2  
ATOM   9222   H HD21 . LEU A 1 141 ? -16.487 24.718 -18.397 0.010 20.68  ? 141  LEU A HD21 2  
ATOM   9223   H HD22 . LEU A 1 141 ? -15.547 25.877 -18.939 0.010 21.21  ? 141  LEU A HD22 2  
ATOM   9224   H HD23 . LEU A 1 141 ? -14.955 24.420 -18.699 0.010 19.93  ? 141  LEU A HD23 2  
ATOM   9225   N N    . GLN A 1 142 ? -14.021 27.506 -14.487 0.010 24.77  ? 142  GLN A N    2  
ATOM   9226   C CA   . GLN A 1 142 ? -12.847 28.372 -14.422 0.010 25.73  ? 142  GLN A CA   2  
ATOM   9227   C C    . GLN A 1 142 ? -11.802 27.827 -15.383 0.010 24.47  ? 142  GLN A C    2  
ATOM   9228   O O    . GLN A 1 142 ? -11.820 26.661 -15.719 0.010 23.05  ? 142  GLN A O    2  
ATOM   9229   C CB   . GLN A 1 142 ? -12.229 28.364 -13.016 0.010 27.15  ? 142  GLN A CB   2  
ATOM   9230   C CG   . GLN A 1 142 ? -13.085 28.890 -11.855 0.010 28.25  ? 142  GLN A CG   2  
ATOM   9231   C CD   . GLN A 1 142 ? -13.795 30.152 -12.181 0.010 30.13  ? 142  GLN A CD   2  
ATOM   9232   O OE1  . GLN A 1 142 ? -15.013 30.159 -12.389 0.010 30.42  ? 142  GLN A OE1  2  
ATOM   9233   N NE2  . GLN A 1 142 ? -13.056 31.254 -12.222 0.010 31.61  ? 142  GLN A NE2  2  
ATOM   9234   H H    . GLN A 1 142 ? -13.880 26.720 -14.176 0.010 24.21  ? 142  GLN A H    2  
ATOM   9235   H HA   . GLN A 1 142 ? -13.067 29.281 -14.673 0.010 26.42  ? 142  GLN A HA   2  
ATOM   9236   H HB2  . GLN A 1 142 ? -12.023 27.440 -12.802 0.010 26.59  ? 142  GLN A HB2  2  
ATOM   9237   H HB3  . GLN A 1 142 ? -11.407 28.880 -13.033 0.010 28.15  ? 142  GLN A HB3  2  
ATOM   9238   H HG2  . GLN A 1 142 ? -13.752 28.222 -11.636 0.010 27.43  ? 142  GLN A HG2  2  
ATOM   9239   H HG3  . GLN A 1 142 ? -12.516 29.053 -11.089 0.010 28.72  ? 142  GLN A HG3  2  
ATOM   9240   H HE21 . GLN A 1 142 ? -12.302 31.282 -11.814 0.010 31.80  ? 142  GLN A HE21 2  
ATOM   9241   H HE22 . GLN A 1 142 ? -13.335 31.944 -12.654 0.010 32.46  ? 142  GLN A HE22 2  
ATOM   9242   N N    . HIS A 1 143 ? -10.878 28.663 -15.824 0.010 25.15  ? 143  HIS A N    2  
ATOM   9243   C CA   . HIS A 1 143 ? -9.724  28.136 -16.537 0.010 24.18  ? 143  HIS A CA   2  
ATOM   9244   C C    . HIS A 1 143 ? -8.501  28.988 -16.267 0.010 25.45  ? 143  HIS A C    2  
ATOM   9245   O O    . HIS A 1 143 ? -8.597  30.123 -15.825 0.010 27.12  ? 143  HIS A O    2  
ATOM   9246   C CB   . HIS A 1 143 ? -9.957  28.127 -18.039 0.010 23.50  ? 143  HIS A CB   2  
ATOM   9247   C CG   . HIS A 1 143 ? -9.767  29.472 -18.669 0.010 24.90  ? 143  HIS A CG   2  
ATOM   9248   N ND1  . HIS A 1 143 ? -8.910  29.698 -19.727 0.010 25.36  ? 143  HIS A ND1  2  
ATOM   9249   C CD2  . HIS A 1 143 ? -10.292 30.680 -18.344 0.010 26.16  ? 143  HIS A CD2  2  
ATOM   9250   C CE1  . HIS A 1 143 ? -8.945  30.983 -20.046 0.010 26.86  ? 143  HIS A CE1  2  
ATOM   9251   N NE2  . HIS A 1 143 ? -9.766  31.598 -19.217 0.010 27.37  ? 143  HIS A NE2  2  
ATOM   9252   H H    . HIS A 1 143 ? -10.897 29.517 -15.739 0.010 26.23  ? 143  HIS A H    2  
ATOM   9253   H HA   . HIS A 1 143 ? -9.541  27.237 -16.236 0.010 23.35  ? 143  HIS A HA   2  
ATOM   9254   H HB2  . HIS A 1 143 ? -9.345  27.503 -18.454 0.010 22.69  ? 143  HIS A HB2  2  
ATOM   9255   H HB3  . HIS A 1 143 ? -10.869 27.854 -18.210 0.010 23.10  ? 143  HIS A HB3  2  
ATOM   9256   H HD1  . HIS A 1 143 ? -8.446  29.100 -20.131 0.010 24.82  ? 143  HIS A HD1  2  
ATOM   9257   H HD2  . HIS A 1 143 ? -10.898 30.850 -17.660 0.010 26.26  ? 143  HIS A HD2  2  
ATOM   9258   H HE1  . HIS A 1 143 ? -8.466  31.393 -20.729 0.010 27.53  ? 143  HIS A HE1  2  
ATOM   9259   H HE2  . HIS A 1 143 ? -9.949  32.437 -19.228 0.010 28.39  ? 143  HIS A HE2  2  
ATOM   9260   N N    . VAL A 1 144 ? -7.349  28.417 -16.569 0.010 24.76  ? 144  VAL A N    2  
ATOM   9261   C CA   . VAL A 1 144 ? -6.131  29.207 -16.582 0.010 25.96  ? 144  VAL A CA   2  
ATOM   9262   C C    . VAL A 1 144 ? -5.139  28.634 -17.577 0.010 25.00  ? 144  VAL A C    2  
ATOM   9263   O O    . VAL A 1 144 ? -5.190  27.430 -17.926 0.010 23.41  ? 144  VAL A O    2  
ATOM   9264   C CB   . VAL A 1 144 ? -5.535  29.379 -15.181 0.010 26.89  ? 144  VAL A CB   2  
ATOM   9265   C CG1  . VAL A 1 144 ? -5.207  28.054 -14.540 0.010 25.50  ? 144  VAL A CG1  2  
ATOM   9266   C CG2  . VAL A 1 144 ? -4.296  30.327 -15.224 0.010 28.60  ? 144  VAL A CG2  2  
ATOM   9267   H H    . VAL A 1 144 ? -7.250  27.591 -16.772 0.010 23.70  ? 144  VAL A H    2  
ATOM   9268   H HA   . VAL A 1 144 ? -6.357  30.095 -16.900 0.010 27.01  ? 144  VAL A HA   2  
ATOM   9269   H HB   . VAL A 1 144 ? -6.199  29.806 -14.617 0.010 27.53  ? 144  VAL A HB   2  
ATOM   9270   H HG11 . VAL A 1 144 ? -5.591  27.326 -15.056 0.010 24.28  ? 144  VAL A HG11 2  
ATOM   9271   H HG12 . VAL A 1 144 ? -4.243  27.956 -14.495 0.010 25.56  ? 144  VAL A HG12 2  
ATOM   9272   H HG13 . VAL A 1 144 ? -5.575  28.057 -13.643 0.010 25.93  ? 144  VAL A HG13 2  
ATOM   9273   H HG21 . VAL A 1 144 ? -4.429  31.005 -15.899 0.010 28.96  ? 144  VAL A HG21 2  
ATOM   9274   H HG22 . VAL A 1 144 ? -4.192  30.746 -14.355 0.010 29.86  ? 144  VAL A HG22 2  
ATOM   9275   H HG23 . VAL A 1 144 ? -3.506  29.807 -15.432 0.010 28.17  ? 144  VAL A HG23 2  
ATOM   9276   N N    . LEU A 1 145 ? -4.294  29.534 -18.074 0.010 26.12  ? 145  LEU A N    2  
ATOM   9277   C CA   . LEU A 1 145 ? -3.356  29.245 -19.135 0.010 25.57  ? 145  LEU A CA   2  
ATOM   9278   C C    . LEU A 1 145 ? -1.972  29.239 -18.528 0.010 26.09  ? 145  LEU A C    2  
ATOM   9279   O O    . LEU A 1 145 ? -1.529  30.252 -17.997 0.010 27.76  ? 145  LEU A O    2  
ATOM   9280   C CB   . LEU A 1 145 ? -3.470  30.319 -20.208 0.010 26.71  ? 145  LEU A CB   2  
ATOM   9281   C CG   . LEU A 1 145 ? -2.576  30.218 -21.422 0.010 25.92  ? 145  LEU A CG   2  
ATOM   9282   C CD1  . LEU A 1 145 ? -2.878  29.010 -22.255 0.010 24.73  ? 145  LEU A CD1  2  
ATOM   9283   C CD2  . LEU A 1 145 ? -2.803  31.493 -22.228 0.010 27.67  ? 145  LEU A CD2  2  
ATOM   9284   H H    . LEU A 1 145 ? -4.250  30.343 -17.800 0.010 27.31  ? 145  LEU A H    2  
ATOM   9285   H HA   . LEU A 1 145 ? -3.548  28.385 -19.529 0.010 24.32  ? 145  LEU A HA   2  
ATOM   9286   H HB2  . LEU A 1 145 ? -4.382  30.316 -20.537 0.010 27.25  ? 145  LEU A HB2  2  
ATOM   9287   H HB3  . LEU A 1 145 ? -3.290  31.181 -19.799 0.010 27.76  ? 145  LEU A HB3  2  
ATOM   9288   H HG   . LEU A 1 145 ? -1.646  30.179 -21.148 0.010 25.28  ? 145  LEU A HG   2  
ATOM   9289   H HD11 . LEU A 1 145 ? -3.839  28.887 -22.298 0.010 25.47  ? 145  LEU A HD11 2  
ATOM   9290   H HD12 . LEU A 1 145 ? -2.520  29.137 -23.144 0.010 24.03  ? 145  LEU A HD12 2  
ATOM   9291   H HD13 . LEU A 1 145 ? -2.458  28.240 -21.842 0.010 24.07  ? 145  LEU A HD13 2  
ATOM   9292   H HD21 . LEU A 1 145 ? -3.755  31.606 -22.366 0.010 27.66  ? 145  LEU A HD21 2  
ATOM   9293   H HD22 . LEU A 1 145 ? -2.452  32.234 -21.718 0.010 28.84  ? 145  LEU A HD22 2  
ATOM   9294   H HD23 . LEU A 1 145 ? -2.348  31.426 -23.082 0.010 27.73  ? 145  LEU A HD23 2  
ATOM   9295   N N    . LEU A 1 146 ? -1.316  28.087 -18.588 0.010 24.80  ? 146  LEU A N    2  
ATOM   9296   C CA   . LEU A 1 146 ? -0.066  27.846 -17.857 0.010 25.21  ? 146  LEU A CA   2  
ATOM   9297   C C    . LEU A 1 146 ? 1.033   27.291 -18.739 0.010 24.72  ? 146  LEU A C    2  
ATOM   9298   O O    . LEU A 1 146 ? 0.775   26.477 -19.601 0.010 23.44  ? 146  LEU A O    2  
ATOM   9299   C CB   . LEU A 1 146 ? -0.299  26.831 -16.751 0.010 24.34  ? 146  LEU A CB   2  
ATOM   9300   C CG   . LEU A 1 146 ? -1.444  27.161 -15.785 0.010 24.68  ? 146  LEU A CG   2  
ATOM   9301   C CD1  . LEU A 1 146 ? -1.699  25.991 -14.899 0.010 23.70  ? 146  LEU A CD1  2  
ATOM   9302   C CD2  . LEU A 1 146 ? -1.106  28.409 -14.959 0.010 26.83  ? 146  LEU A CD2  2  
ATOM   9303   H H    . LEU A 1 146 ? -1.583  27.416 -19.049 0.010 23.76  ? 146  LEU A H    2  
ATOM   9304   H HA   . LEU A 1 146 ? 0.222   28.674 -17.451 0.010 26.54  ? 146  LEU A HA   2  
ATOM   9305   H HB2  . LEU A 1 146 ? -0.488  25.971 -17.153 0.010 23.12  ? 146  LEU A HB2  2  
ATOM   9306   H HB3  . LEU A 1 146 ? 0.513   26.762 -16.229 0.010 24.86  ? 146  LEU A HB3  2  
ATOM   9307   H HG   . LEU A 1 146 ? -2.255  27.339 -16.288 0.010 24.30  ? 146  LEU A HG   2  
ATOM   9308   H HD11 . LEU A 1 146 ? -1.491  25.173 -15.376 0.010 22.61  ? 146  LEU A HD11 2  
ATOM   9309   H HD12 . LEU A 1 146 ? -1.140  26.070 -14.111 0.010 24.44  ? 146  LEU A HD12 2  
ATOM   9310   H HD13 . LEU A 1 146 ? -2.634  25.993 -14.645 0.010 23.57  ? 146  LEU A HD13 2  
ATOM   9311   H HD21 . LEU A 1 146 ? -0.157  28.415 -14.768 0.010 27.36  ? 146  LEU A HD21 2  
ATOM   9312   H HD22 . LEU A 1 146 ? -1.345  29.198 -15.468 0.010 27.51  ? 146  LEU A HD22 2  
ATOM   9313   H HD23 . LEU A 1 146 ? -1.605  28.381 -14.129 0.010 27.07  ? 146  LEU A HD23 2  
ATOM   9314   N N    . PRO A 1 147 ? 2.280   27.716 -18.498 0.010 25.94  ? 147  PRO A N    2  
ATOM   9315   C CA   . PRO A 1 147 ? 3.411   27.204 -19.268 0.010 25.55  ? 147  PRO A CA   2  
ATOM   9316   C C    . PRO A 1 147 ? 3.881   25.837 -18.744 0.010 24.40  ? 147  PRO A C    2  
ATOM   9317   O O    . PRO A 1 147 ? 3.956   25.610 -17.546 0.010 24.73  ? 147  PRO A O    2  
ATOM   9318   C CB   . PRO A 1 147 ? 4.502   28.245 -19.015 0.010 27.50  ? 147  PRO A CB   2  
ATOM   9319   C CG   . PRO A 1 147 ? 4.256   28.689 -17.649 0.010 28.64  ? 147  PRO A CG   2  
ATOM   9320   C CD   . PRO A 1 147 ? 2.713   28.695 -17.492 0.010 27.93  ? 147  PRO A CD   2  
ATOM   9321   H HA   . PRO A 1 147 ? 3.204   27.167 -20.212 0.010 25.11  ? 147  PRO A HA   2  
ATOM   9322   H HB2  . PRO A 1 147 ? 5.371   27.834 -19.095 0.010 27.41  ? 147  PRO A HB2  2  
ATOM   9323   H HB3  . PRO A 1 147 ? 4.409   28.977 -19.640 0.010 28.15  ? 147  PRO A HB3  2  
ATOM   9324   H HG2  . PRO A 1 147 ? 4.653   28.061 -17.028 0.010 28.40  ? 147  PRO A HG2  2  
ATOM   9325   H HG3  . PRO A 1 147 ? 4.617   29.578 -17.521 0.010 30.11  ? 147  PRO A HG3  2  
ATOM   9326   H HD2  . PRO A 1 147 ? 2.455   28.399 -16.606 0.010 28.02  ? 147  PRO A HD2  2  
ATOM   9327   H HD3  . PRO A 1 147 ? 2.346   29.567 -17.699 0.010 28.75  ? 147  PRO A HD3  2  
ATOM   9328   N N    . VAL A 1 148 ? 4.215   24.953 -19.657 0.010 23.30  ? 148  VAL A N    2  
ATOM   9329   C CA   . VAL A 1 148 ? 4.689   23.640 -19.281 0.010 22.36  ? 148  VAL A CA   2  
ATOM   9330   C C    . VAL A 1 148 ? 6.120   23.797 -18.723 0.010 23.50  ? 148  VAL A C    2  
ATOM   9331   O O    . VAL A 1 148 ? 6.911   24.532 -19.302 0.010 24.48  ? 148  VAL A O    2  
ATOM   9332   C CB   . VAL A 1 148 ? 4.702   22.732 -20.525 0.010 21.16  ? 148  VAL A CB   2  
ATOM   9333   C CG1  . VAL A 1 148 ? 5.428   21.576 -20.249 0.010 20.56  ? 148  VAL A CG1  2  
ATOM   9334   C CG2  . VAL A 1 148 ? 3.323   22.379 -20.987 0.010 20.15  ? 148  VAL A CG2  2  
ATOM   9335   H H    . VAL A 1 148 ? 4.186   25.089 -20.501 0.010 23.18  ? 148  VAL A H    2  
ATOM   9336   H HA   . VAL A 1 148 ? 4.127   23.243 -18.597 0.010 21.95  ? 148  VAL A HA   2  
ATOM   9337   H HB   . VAL A 1 148 ? 5.146   23.204 -21.246 0.010 21.66  ? 148  VAL A HB   2  
ATOM   9338   H HG11 . VAL A 1 148 ? 5.148   21.212 -19.395 0.010 20.08  ? 148  VAL A HG11 2  
ATOM   9339   H HG12 . VAL A 1 148 ? 5.300   20.935 -20.962 0.010 20.04  ? 148  VAL A HG12 2  
ATOM   9340   H HG13 . VAL A 1 148 ? 6.353   21.847 -20.231 0.010 21.28  ? 148  VAL A HG13 2  
ATOM   9341   H HG21 . VAL A 1 148 ? 2.681   22.719 -20.348 0.010 20.40  ? 148  VAL A HG21 2  
ATOM   9342   H HG22 . VAL A 1 148 ? 3.174   22.787 -21.853 0.010 20.23  ? 148  VAL A HG22 2  
ATOM   9343   H HG23 . VAL A 1 148 ? 3.236   21.415 -21.058 0.010 19.33  ? 148  VAL A HG23 2  
ATOM   9344   N N    . LEU A 1 149 ? 6.409   23.122 -17.606 0.010 23.51  ? 149  LEU A N    2  
ATOM   9345   C CA   . LEU A 1 149 ? 7.711   23.155 -16.956 0.010 24.66  ? 149  LEU A CA   2  
ATOM   9346   C C    . LEU A 1 149 ? 8.544   21.932 -17.354 0.010 23.83  ? 149  LEU A C    2  
ATOM   9347   O O    . LEU A 1 149 ? 8.016   20.817 -17.408 0.010 22.52  ? 149  LEU A O    2  
ATOM   9348   C CB   . LEU A 1 149 ? 7.542   23.190 -15.433 0.010 25.50  ? 149  LEU A CB   2  
ATOM   9349   C CG   . LEU A 1 149 ? 8.815   23.386 -14.622 0.010 26.84  ? 149  LEU A CG   2  
ATOM   9350   C CD1  . LEU A 1 149 ? 9.416   24.733 -15.007 0.010 28.50  ? 149  LEU A CD1  2  
ATOM   9351   C CD2  . LEU A 1 149 ? 8.563   23.310 -13.119 0.010 27.80  ? 149  LEU A CD2  2  
ATOM   9352   H H    . LEU A 1 149 ? 5.850   22.621 -17.196 0.010 22.94  ? 149  LEU A H    2  
ATOM   9353   H HA   . LEU A 1 149 ? 8.181   23.954 -17.237 0.010 25.62  ? 149  LEU A HA   2  
ATOM   9354   H HB2  . LEU A 1 149 ? 6.944   23.916 -15.206 0.010 26.21  ? 149  LEU A HB2  2  
ATOM   9355   H HB3  . LEU A 1 149 ? 7.147   22.353 -15.148 0.010 24.60  ? 149  LEU A HB3  2  
ATOM   9356   H HG   . LEU A 1 149 ? 9.448   22.690 -14.856 0.010 26.20  ? 149  LEU A HG   2  
ATOM   9357   H HD11 . LEU A 1 149 ? 8.731   25.418 -14.940 0.010 29.44  ? 149  LEU A HD11 2  
ATOM   9358   H HD12 . LEU A 1 149 ? 10.145  24.928 -14.402 0.010 29.23  ? 149  LEU A HD12 2  
ATOM   9359   H HD13 . LEU A 1 149 ? 9.743   24.685 -15.918 0.010 28.03  ? 149  LEU A HD13 2  
ATOM   9360   H HD21 . LEU A 1 149 ? 8.022   22.528 -12.930 0.010 26.83  ? 149  LEU A HD21 2  
ATOM   9361   H HD22 . LEU A 1 149 ? 9.415   23.237 -12.662 0.010 28.67  ? 149  LEU A HD22 2  
ATOM   9362   H HD23 . LEU A 1 149 ? 8.101   24.113 -12.834 0.010 28.63  ? 149  LEU A HD23 2  
ATOM   9363   N N    . ASP A 1 150 ? 9.834   22.114 -17.642 0.010 24.70  ? 150  ASP A N    2  
ATOM   9364   C CA   . ASP A 1 150 ? 10.664  20.960 -18.006 0.010 24.08  ? 150  ASP A CA   2  
ATOM   9365   C C    . ASP A 1 150 ? 10.702  19.920 -16.877 0.010 23.83  ? 150  ASP A C    2  
ATOM   9366   O O    . ASP A 1 150 ? 10.763  20.255 -15.706 0.010 24.85  ? 150  ASP A O    2  
ATOM   9367   C CB   . ASP A 1 150 ? 12.081  21.370 -18.424 0.010 25.25  ? 150  ASP A CB   2  
ATOM   9368   C CG   . ASP A 1 150 ? 12.835  22.091 -17.327 0.010 27.02  ? 150  ASP A CG   2  
ATOM   9369   O OD1  . ASP A 1 150 ? 12.624  23.313 -17.170 0.010 28.17  ? 150  ASP A OD1  2  
ATOM   9370   O OD2  . ASP A 1 150 ? 13.651  21.418 -16.651 0.010 27.41  ? 150  ASP A OD2  2  
ATOM   9371   H H    . ASP A 1 150 ? 10.240  22.869 -17.634 0.010 25.70  ? 150  ASP A H    2  
ATOM   9372   H HA   . ASP A 1 150 ? 10.262  20.535 -18.778 0.010 23.15  ? 150  ASP A HA   2  
ATOM   9373   H HB2  . ASP A 1 150 ? 12.575  20.570 -18.650 0.010 24.83  ? 150  ASP A HB2  2  
ATOM   9374   H HB3  . ASP A 1 150 ? 12.035  21.954 -19.194 0.010 25.43  ? 150  ASP A HB3  2  
ATOM   9375   N N    . ARG A 1 151 ? 10.663  18.640 -17.251 0.010 22.67  ? 151  ARG A N    2  
ATOM   9376   C CA   . ARG A 1 151 ? 10.571  17.582 -16.249 0.010 22.48  ? 151  ARG A CA   2  
ATOM   9377   C C    . ARG A 1 151 ? 11.743  17.622 -15.287 0.010 23.94  ? 151  ARG A C    2  
ATOM   9378   O O    . ARG A 1 151 ? 11.588  17.390 -14.101 0.010 24.56  ? 151  ARG A O    2  
ATOM   9379   C CB   . ARG A 1 151 ? 10.464  16.177 -16.890 0.010 21.28  ? 151  ARG A CB   2  
ATOM   9380   C CG   . ARG A 1 151 ? 10.176  15.058 -15.883 0.010 21.15  ? 151  ARG A CG   2  
ATOM   9381   C CD   . ARG A 1 151 ? 9.991   13.712 -16.581 0.010 20.12  ? 151  ARG A CD   2  
ATOM   9382   N NE   . ARG A 1 151 ? 8.805   13.734 -17.393 0.010 19.03  ? 151  ARG A NE   2  
ATOM   9383   C CZ   . ARG A 1 151 ? 8.747   13.925 -18.711 0.010 18.49  ? 151  ARG A CZ   2  
ATOM   9384   N NH1  . ARG A 1 151 ? 9.827   14.032 -19.443 0.010 18.87  ? 151  ARG A NH1  2  
ATOM   9385   N NH2  . ARG A 1 151 ? 7.566   13.969 -19.317 0.010 17.70  ? 151  ARG A NH2  2  
ATOM   9386   H H    . ARG A 1 151 ? 10.679  18.364 -18.063 0.010 22.09  ? 151  ARG A H    2  
ATOM   9387   H HA   . ARG A 1 151 ? 9.766   17.726 -15.730 0.010 22.36  ? 151  ARG A HA   2  
ATOM   9388   H HB2  . ARG A 1 151 ? 9.744   16.181 -17.537 0.010 20.50  ? 151  ARG A HB2  2  
ATOM   9389   H HB3  . ARG A 1 151 ? 11.300  15.962 -17.335 0.010 21.49  ? 151  ARG A HB3  2  
ATOM   9390   H HG2  . ARG A 1 151 ? 10.898  14.981 -15.246 0.010 21.98  ? 151  ARG A HG2  2  
ATOM   9391   H HG3  . ARG A 1 151 ? 9.354   15.266 -15.415 0.010 21.05  ? 151  ARG A HG3  2  
ATOM   9392   H HD2  . ARG A 1 151 ? 10.758  13.502 -17.128 0.010 20.22  ? 151  ARG A HD2  2  
ATOM   9393   H HD3  . ARG A 1 151 ? 9.866   13.032 -15.907 0.010 20.23  ? 151  ARG A HD3  2  
ATOM   9394   H HE   . ARG A 1 151 ? 8.062   13.623 -16.982 0.010 18.80  ? 151  ARG A HE   2  
ATOM   9395   H HH11 . ARG A 1 151 ? 10.598  14.018 -19.076 0.010 19.44  ? 151  ARG A HH11 2  
ATOM   9396   H HH12 . ARG A 1 151 ? 9.751   14.139 -20.291 0.010 18.63  ? 151  ARG A HH12 2  
ATOM   9397   H HH21 . ARG A 1 151 ? 6.848   13.883 -18.861 0.010 17.48  ? 151  ARG A HH21 2  
ATOM   9398   H HH22 . ARG A 1 151 ? 7.520   14.061 -20.168 0.010 17.47  ? 151  ARG A HH22 2  
ATOM   9399   N N    . ALA A 1 152 ? 12.915  17.920 -15.829 0.010 24.63  ? 152  ALA A N    2  
ATOM   9400   C CA   . ALA A 1 152 ? 14.119  17.936 -15.042 0.010 26.11  ? 152  ALA A CA   2  
ATOM   9401   C C    . ALA A 1 152 ? 13.965  18.870 -13.836 0.010 27.61  ? 152  ALA A C    2  
ATOM   9402   O O    . ALA A 1 152 ? 14.181  18.481 -12.700 0.010 28.53  ? 152  ALA A O    2  
ATOM   9403   C CB   . ALA A 1 152 ? 15.305  18.360 -15.934 0.010 26.74  ? 152  ALA A CB   2  
ATOM   9404   H H    . ALA A 1 152 ? 13.033  18.116 -16.655 0.010 24.34  ? 152  ALA A H    2  
ATOM   9405   H HA   . ALA A 1 152 ? 14.295  17.049 -14.703 0.010 25.92  ? 152  ALA A HA   2  
ATOM   9406   H HB1  . ALA A 1 152 ? 15.068  19.165 -16.417 0.010 26.88  ? 152  ALA A HB1  2  
ATOM   9407   H HB2  . ALA A 1 152 ? 16.081  18.519 -15.377 0.010 27.87  ? 152  ALA A HB2  2  
ATOM   9408   H HB3  . ALA A 1 152 ? 15.492  17.650 -16.565 0.010 25.97  ? 152  ALA A HB3  2  
ATOM   9409   N N    . THR A 1 153 ? 13.548  20.100 -14.107 0.010 28.01  ? 153  THR A N    2  
ATOM   9410   C CA   . THR A 1 153 ? 13.427  21.093 -13.050 0.010 29.70  ? 153  THR A CA   2  
ATOM   9411   C C    . THR A 1 153 ? 12.252  20.745 -12.127 0.010 29.34  ? 153  THR A C    2  
ATOM   9412   O O    . THR A 1 153 ? 12.327  20.898 -10.915 0.010 30.80  ? 153  THR A O    2  
ATOM   9413   C CB   . THR A 1 153 ? 13.269  22.504 -13.645 0.010 30.37  ? 153  THR A CB   2  
ATOM   9414   O OG1  . THR A 1 153 ? 14.376  22.775 -14.520 0.010 30.80  ? 153  THR A OG1  2  
ATOM   9415   C CG2  . THR A 1 153 ? 13.247  23.548 -12.538 0.010 32.50  ? 153  THR A CG2  2  
ATOM   9416   H H    . THR A 1 153 ? 13.328  20.380 -14.888 0.010 27.44  ? 153  THR A H    2  
ATOM   9417   H HA   . THR A 1 153 ? 14.234  21.083 -12.519 0.010 30.87  ? 153  THR A HA   2  
ATOM   9418   H HB   . THR A 1 153 ? 12.439  22.565 -14.141 0.010 29.35  ? 153  THR A HB   2  
ATOM   9419   H HG1  . THR A 1 153 ? 14.534  23.609 -14.543 0.010 31.73  ? 153  THR A HG1  2  
ATOM   9420   H HG21 . THR A 1 153 ? 14.022  23.432 -11.966 0.010 33.57  ? 153  THR A HG21 2  
ATOM   9421   H HG22 . THR A 1 153 ? 13.266  24.438 -12.923 0.010 33.18  ? 153  THR A HG22 2  
ATOM   9422   H HG23 . THR A 1 153 ? 12.444  23.451 -12.004 0.010 32.27  ? 153  THR A HG23 2  
ATOM   9423   N N    . CYS A 1 154 ? 11.173  20.250 -12.718 0.010 27.52  ? 154  CYS A N    2  
ATOM   9424   C CA   . CYS A 1 154 ? 10.031  19.796 -11.928 0.010 27.10  ? 154  CYS A CA   2  
ATOM   9425   C C    . CYS A 1 154 ? 10.478  18.745 -10.905 0.010 27.74  ? 154  CYS A C    2  
ATOM   9426   O O    . CYS A 1 154 ? 9.943   18.655 -9.809  0.010 28.47  ? 154  CYS A O    2  
ATOM   9427   C CB   . CYS A 1 154 ? 8.925   19.256 -12.825 0.010 25.10  ? 154  CYS A CB   2  
ATOM   9428   S SG   . CYS A 1 154 ? 7.374   19.122 -11.920 0.010 24.87  ? 154  CYS A SG   2  
ATOM   9429   H H    . CYS A 1 154 ? 11.075  20.181 -13.568 0.010 26.62  ? 154  CYS A H    2  
ATOM   9430   H HA   . CYS A 1 154 ? 9.664   20.550 -11.441 0.010 27.93  ? 154  CYS A HA   2  
ATOM   9431   H HB2  . CYS A 1 154 ? 8.785   19.865 -13.567 0.010 24.79  ? 154  CYS A HB2  2  
ATOM   9432   H HB3  . CYS A 1 154 ? 9.172   18.380 -13.157 0.010 24.38  ? 154  CYS A HB3  2  
ATOM   9433   N N    . ASN A 1 155 ? 11.514  17.990 -11.257 0.010 27.71  ? 155  ASN A N    2  
ATOM   9434   C CA   . ASN A 1 155 ? 12.010  16.934 -10.400 0.010 28.33  ? 155  ASN A CA   2  
ATOM   9435   C C    . ASN A 1 155 ? 13.046  17.385 -9.385  0.010 30.62  ? 155  ASN A C    2  
ATOM   9436   O O    . ASN A 1 155 ? 13.528  16.578 -8.600  0.010 31.37  ? 155  ASN A O    2  
ATOM   9437   C CB   . ASN A 1 155 ? 12.623  15.816 -11.239 0.010 27.24  ? 155  ASN A CB   2  
ATOM   9438   C CG   . ASN A 1 155 ? 11.640  14.701 -11.539 0.010 25.66  ? 155  ASN A CG   2  
ATOM   9439   O OD1  . ASN A 1 155 ? 10.890  14.262 -10.664 0.010 25.83  ? 155  ASN A OD1  2  
ATOM   9440   N ND2  . ASN A 1 155 ? 11.626  14.248 -12.788 0.010 24.29  ? 155  ASN A ND2  2  
ATOM   9441   H H    . ASN A 1 155 ? 11.939  18.068 -11.998 0.010 27.40  ? 155  ASN A H    2  
ATOM   9442   H HA   . ASN A 1 155 ? 11.266  16.561 -9.904  0.010 28.08  ? 155  ASN A HA   2  
ATOM   9443   H HB2  . ASN A 1 155 ? 12.926  16.187 -12.081 0.010 26.82  ? 155  ASN A HB2  2  
ATOM   9444   H HB3  . ASN A 1 155 ? 13.373  15.431 -10.762 0.010 28.10  ? 155  ASN A HB3  2  
ATOM   9445   H HD21 . ASN A 1 155 ? 12.145  14.597 -13.376 0.010 24.31  ? 155  ASN A HD21 2  
ATOM   9446   H HD22 . ASN A 1 155 ? 11.099  13.608 -13.010 0.010 23.48  ? 155  ASN A HD22 2  
ATOM   9447   N N    . ARG A 1 156 ? 13.397  18.661 -9.388  0.010 31.92  ? 156  ARG A N    2  
ATOM   9448   C CA   . ARG A 1 156 ? 14.476  19.069 -8.492  0.010 34.34  ? 156  ARG A CA   2  
ATOM   9449   C C    . ARG A 1 156 ? 14.055  18.931 -7.034  0.010 35.84  ? 156  ARG A C    2  
ATOM   9450   O O    . ARG A 1 156 ? 12.885  19.045 -6.693  0.010 35.18  ? 156  ARG A O    2  
ATOM   9451   C CB   . ARG A 1 156 ? 14.993  20.485 -8.788  0.010 35.68  ? 156  ARG A CB   2  
ATOM   9452   C CG   . ARG A 1 156 ? 15.591  21.174 -7.553  0.010 38.59  ? 156  ARG A CG   2  
ATOM   9453   C CD   . ARG A 1 156 ? 16.361  22.443 -7.891  0.010 39.91  ? 156  ARG A CD   2  
ATOM   9454   N NE   . ARG A 1 156 ? 17.816  22.369 -7.689  0.010 41.19  ? 156  ARG A NE   2  
ATOM   9455   C CZ   . ARG A 1 156 ? 18.607  21.327 -7.959  0.010 40.21  ? 156  ARG A CZ   2  
ATOM   9456   N NH1  . ARG A 1 156 ? 18.147  20.180 -8.456  0.010 37.93  ? 156  ARG A NH1  2  
ATOM   9457   N NH2  . ARG A 1 156 ? 19.904  21.441 -7.724  0.010 41.69  ? 156  ARG A NH2  2  
ATOM   9458   H H    . ARG A 1 156 ? 13.049  19.283 -9.869  0.010 31.57  ? 156  ARG A H    2  
ATOM   9459   H HA   . ARG A 1 156 ? 15.221  18.464 -8.628  0.010 34.36  ? 156  ARG A HA   2  
ATOM   9460   H HB2  . ARG A 1 156 ? 15.684  20.428 -9.463  0.010 35.16  ? 156  ARG A HB2  2  
ATOM   9461   H HB3  . ARG A 1 156 ? 14.271  21.015 -9.142  0.010 35.32  ? 156  ARG A HB3  2  
ATOM   9462   H HG2  . ARG A 1 156 ? 14.878  21.410 -6.944  0.010 39.34  ? 156  ARG A HG2  2  
ATOM   9463   H HG3  . ARG A 1 156 ? 16.194  20.574 -7.100  0.010 39.10  ? 156  ARG A HG3  2  
ATOM   9464   H HD2  . ARG A 1 156 ? 16.198  22.666 -8.820  0.010 38.64  ? 156  ARG A HD2  2  
ATOM   9465   H HD3  . ARG A 1 156 ? 16.029  23.156 -7.323  0.010 41.35  ? 156  ARG A HD3  2  
ATOM   9466   H HE   . ARG A 1 156 ? 18.176  23.015 -7.246  0.010 42.89  ? 156  ARG A HE   2  
ATOM   9467   H HH11 . ARG A 1 156 ? 17.325  20.065 -8.629  0.010 36.98  ? 156  ARG A HH11 2  
ATOM   9468   H HH12 . ARG A 1 156 ? 18.697  19.539 -8.613  0.010 37.48  ? 156  ARG A HH12 2  
ATOM   9469   H HH21 . ARG A 1 156 ? 20.221  22.171 -7.398  0.010 43.28  ? 156  ARG A HH21 2  
ATOM   9470   H HH22 . ARG A 1 156 ? 20.430  20.779 -7.886  0.010 41.14  ? 156  ARG A HH22 2  
ATOM   9471   N N    . ARG A 1 157 ? 15.051  18.653 -6.203  0.010 38.00  ? 157  ARG A N    2  
ATOM   9472   C CA   . ARG A 1 157 ? 14.933  18.573 -4.746  0.010 40.08  ? 157  ARG A CA   2  
ATOM   9473   C C    . ARG A 1 157 ? 13.759  19.349 -4.120  0.010 40.58  ? 157  ARG A C    2  
ATOM   9474   O O    . ARG A 1 157 ? 12.740  18.762 -3.783  0.010 39.51  ? 157  ARG A O    2  
ATOM   9475   C CB   . ARG A 1 157 ? 16.272  19.001 -4.115  0.010 42.84  ? 157  ARG A CB   2  
ATOM   9476   C CG   . ARG A 1 157 ? 16.704  18.188 -2.878  0.010 43.53  ? 157  ARG A CG   2  
ATOM   9477   C CD   . ARG A 1 157 ? 18.241  17.958 -2.803  0.010 45.59  ? 157  ARG A CD   2  
ATOM   9478   N NE   . ARG A 1 157 ? 18.655  17.724 -1.417  0.010 48.32  ? 157  ARG A NE   2  
ATOM   9479   C CZ   . ARG A 1 157 ? 19.628  16.906 -1.020  0.010 48.63  ? 157  ARG A CZ   2  
ATOM   9480   N NH1  . ARG A 1 157 ? 20.357  16.196 -1.876  0.010 46.38  ? 157  ARG A NH1  2  
ATOM   9481   N NH2  . ARG A 1 157 ? 19.868  16.794 0.269   0.010 51.41  ? 157  ARG A NH2  2  
ATOM   9482   H H    . ARG A 1 157 ? 15.849  18.491 -6.479  0.010 38.40  ? 157  ARG A H    2  
ATOM   9483   H HA   . ARG A 1 157 ? 14.799  17.646 -4.521  0.010 39.58  ? 157  ARG A HA   2  
ATOM   9484   H HB2  . ARG A 1 157 ? 16.967  18.899 -4.782  0.010 42.79  ? 157  ARG A HB2  2  
ATOM   9485   H HB3  . ARG A 1 157 ? 16.220  19.932 -3.852  0.010 44.46  ? 157  ARG A HB3  2  
ATOM   9486   H HG2  . ARG A 1 157 ? 16.432  18.662 -2.076  0.010 44.53  ? 157  ARG A HG2  2  
ATOM   9487   H HG3  . ARG A 1 157 ? 16.275  17.319 -2.907  0.010 41.79  ? 157  ARG A HG3  2  
ATOM   9488   H HD2  . ARG A 1 157 ? 18.479  17.181 -3.332  0.010 44.59  ? 157  ARG A HD2  2  
ATOM   9489   H HD3  . ARG A 1 157 ? 18.703  18.744 -3.133  0.010 46.26  ? 157  ARG A HD3  2  
ATOM   9490   H HE   . ARG A 1 157 ? 18.368  18.284 -0.830  0.010 49.94  ? 157  ARG A HE   2  
ATOM   9491   H HH11 . ARG A 1 157 ? 20.211  16.253 -2.721  0.010 44.68  ? 157  ARG A HH11 2  
ATOM   9492   H HH12 . ARG A 1 157 ? 20.976  15.677 -1.583  0.010 46.72  ? 157  ARG A HH12 2  
ATOM   9493   H HH21 . ARG A 1 157 ? 19.409  17.242 0.842   0.010 53.04  ? 157  ARG A HH21 2  
ATOM   9494   H HH22 . ARG A 1 157 ? 20.484  16.273 0.525   0.010 51.68  ? 157  ARG A HH22 2  
ATOM   9495   N N    . THR A 1 158 ? 13.914  20.656 -3.954  0.010 42.30  ? 158  THR A N    2  
ATOM   9496   C CA   . THR A 1 158 ? 12.909  21.474 -3.276  0.010 43.16  ? 158  THR A CA   2  
ATOM   9497   C C    . THR A 1 158 ? 11.526  21.329 -3.894  0.010 40.68  ? 158  THR A C    2  
ATOM   9498   O O    . THR A 1 158 ? 10.514  21.589 -3.257  0.010 41.24  ? 158  THR A O    2  
ATOM   9499   C CB   . THR A 1 158 ? 13.280  22.963 -3.355  0.010 45.19  ? 158  THR A CB   2  
ATOM   9500   O OG1  . THR A 1 158 ? 13.310  23.361 -4.729  0.010 43.61  ? 158  THR A OG1  2  
ATOM   9501   C CG2  . THR A 1 158 ? 14.630  23.214 -2.747  0.010 48.09  ? 158  THR A CG2  2  
ATOM   9502   H H    . THR A 1 158 ? 14.601  21.099 -4.223  0.010 43.10  ? 158  THR A H    2  
ATOM   9503   H HA   . THR A 1 158 ? 12.861  21.218 -2.342  0.010 44.37  ? 158  THR A HA   2  
ATOM   9504   H HB   . THR A 1 158 ? 12.624  23.492 -2.875  0.010 45.87  ? 158  THR A HB   2  
ATOM   9505   H HG1  . THR A 1 158 ? 13.718  24.102 -4.810  0.010 44.59  ? 158  THR A HG1  2  
ATOM   9506   H HG21 . THR A 1 158 ? 14.743  22.674 -1.950  0.010 49.18  ? 158  THR A HG21 2  
ATOM   9507   H HG22 . THR A 1 158 ? 15.324  22.987 -3.386  0.010 47.56  ? 158  THR A HG22 2  
ATOM   9508   H HG23 . THR A 1 158 ? 14.717  24.151 -2.512  0.010 49.60  ? 158  THR A HG23 2  
ATOM   9509   N N    . HIS A 1 159 ? 11.487  20.885 -5.140  0.010 38.11  ? 159  HIS A N    2  
ATOM   9510   C CA   . HIS A 1 159 ? 10.282  20.960 -5.929  0.010 35.93  ? 159  HIS A CA   2  
ATOM   9511   C C    . HIS A 1 159 ? 9.540   19.590 -5.841  0.010 34.35  ? 159  HIS A C    2  
ATOM   9512   O O    . HIS A 1 159 ? 9.020   19.291 -4.773  0.010 35.30  ? 159  HIS A O    2  
ATOM   9513   C CB   . HIS A 1 159 ? 10.664  21.492 -7.317  0.010 34.62  ? 159  HIS A CB   2  
ATOM   9514   C CG   . HIS A 1 159 ? 11.606  22.678 -7.271  0.010 36.49  ? 159  HIS A CG   2  
ATOM   9515   N ND1  . HIS A 1 159 ? 11.262  23.894 -6.710  0.010 38.35  ? 159  HIS A ND1  2  
ATOM   9516   C CD2  . HIS A 1 159 ? 12.883  22.825 -7.707  0.010 36.99  ? 159  HIS A CD2  2  
ATOM   9517   C CE1  . HIS A 1 159 ? 12.270  24.741 -6.829  0.010 39.92  ? 159  HIS A CE1  2  
ATOM   9518   N NE2  . HIS A 1 159 ? 13.273  24.112 -7.418  0.010 39.13  ? 159  HIS A NE2  2  
ATOM   9519   H H    . HIS A 1 159 ? 12.150  20.533 -5.557  0.010 37.67  ? 159  HIS A H    2  
ATOM   9520   H HA   . HIS A 1 159 ? 9.696   21.624 -5.537  0.010 36.60  ? 159  HIS A HA   2  
ATOM   9521   H HB2  . HIS A 1 159 ? 11.102  20.780 -7.812  0.010 33.93  ? 159  HIS A HB2  2  
ATOM   9522   H HB3  . HIS A 1 159 ? 9.858   21.769 -7.782  0.010 33.36  ? 159  HIS A HB3  2  
ATOM   9523   H HD1  . HIS A 1 159 ? 10.500  24.083 -6.361  0.010 38.53  ? 159  HIS A HD1  2  
ATOM   9524   H HD2  . HIS A 1 159 ? 13.396  22.189 -8.124  0.010 36.17  ? 159  HIS A HD2  2  
ATOM   9525   H HE1  . HIS A 1 159 ? 12.280  25.620 -6.524  0.010 41.44  ? 159  HIS A HE1  2  
ATOM   9526   H HE2  . HIS A 1 159 ? 14.041  24.455 -7.599  0.010 39.91  ? 159  HIS A HE2  2  
ATOM   9527   N N    . HIS A 1 160 ? 9.489   18.756 -6.885  0.010 32.23  ? 160  HIS A N    2  
ATOM   9528   C CA   . HIS A 1 160 ? 8.926   17.390 -6.717  0.010 31.08  ? 160  HIS A CA   2  
ATOM   9529   C C    . HIS A 1 160 ? 9.910   16.227 -6.506  0.010 31.47  ? 160  HIS A C    2  
ATOM   9530   O O    . HIS A 1 160 ? 9.476   15.101 -6.351  0.010 30.95  ? 160  HIS A O    2  
ATOM   9531   C CB   . HIS A 1 160 ? 7.903   17.039 -7.808  0.010 28.69  ? 160  HIS A CB   2  
ATOM   9532   C CG   . HIS A 1 160 ? 6.598   17.735 -7.632  0.010 28.45  ? 160  HIS A CG   2  
ATOM   9533   N ND1  . HIS A 1 160 ? 5.888   17.695 -6.450  0.010 29.36  ? 160  HIS A ND1  2  
ATOM   9534   C CD2  . HIS A 1 160 ? 5.886   18.518 -8.472  0.010 27.63  ? 160  HIS A CD2  2  
ATOM   9535   C CE1  . HIS A 1 160 ? 4.788   18.413 -6.576  0.010 29.04  ? 160  HIS A CE1  2  
ATOM   9536   N NE2  . HIS A 1 160 ? 4.772   18.938 -7.785  0.010 28.00  ? 160  HIS A NE2  2  
ATOM   9537   H H    . HIS A 1 160 ? 9.749   18.944 -7.682  0.010 31.55  ? 160  HIS A H    2  
ATOM   9538   H HA   . HIS A 1 160 ? 8.403   17.397 -5.905  0.010 31.81  ? 160  HIS A HA   2  
ATOM   9539   H HB2  . HIS A 1 160 ? 8.256   17.283 -8.675  0.010 28.04  ? 160  HIS A HB2  2  
ATOM   9540   H HB3  . HIS A 1 160 ? 7.721   16.088 -7.783  0.010 28.05  ? 160  HIS A HB3  2  
ATOM   9541   H HD1  . HIS A 1 160 ? 6.122   17.264 -5.743  0.010 30.11  ? 160  HIS A HD1  2  
ATOM   9542   H HD2  . HIS A 1 160 ? 6.118   18.740 -9.345  0.010 27.04  ? 160  HIS A HD2  2  
ATOM   9543   H HE1  . HIS A 1 160 ? 4.143   18.541 -5.920  0.010 29.54  ? 160  HIS A HE1  2  
ATOM   9544   H HE2  . HIS A 1 160 ? 4.150   19.436 -8.103  0.010 27.68  ? 160  HIS A HE2  2  
ATOM   9545   N N    . ASP A 1 161 ? 11.217  16.489 -6.489  0.010 32.56  ? 161  ASP A N    2  
ATOM   9546   C CA   . ASP A 1 161 ? 12.169  15.540 -5.917  0.010 33.59  ? 161  ASP A CA   2  
ATOM   9547   C C    . ASP A 1 161 ? 12.132  14.139 -6.544  0.010 31.95  ? 161  ASP A C    2  
ATOM   9548   O O    . ASP A 1 161 ? 11.917  13.137 -5.846  0.010 32.54  ? 161  ASP A O    2  
ATOM   9549   C CB   . ASP A 1 161 ? 11.918  15.434 -4.402  0.010 35.83  ? 161  ASP A CB   2  
ATOM   9550   C CG   . ASP A 1 161 ? 13.186  15.271 -3.595  0.010 37.58  ? 161  ASP A CG   2  
ATOM   9551   O OD1  . ASP A 1 161 ? 14.298  15.396 -4.153  0.010 37.59  ? 161  ASP A OD1  2  
ATOM   9552   O OD2  . ASP A 1 161 ? 13.060  15.035 -2.373  0.010 39.12  ? 161  ASP A OD2  2  
ATOM   9553   H H    . ASP A 1 161 ? 11.577  17.203 -6.806  0.010 32.80  ? 161  ASP A H    2  
ATOM   9554   H HA   . ASP A 1 161 ? 13.058  15.892 -6.062  0.010 34.15  ? 161  ASP A HA   2  
ATOM   9555   H HB2  . ASP A 1 161 ? 11.489  16.250 -4.102  0.010 36.84  ? 161  ASP A HB2  2  
ATOM   9556   H HB3  . ASP A 1 161 ? 11.344  14.679 -4.207  0.010 35.32  ? 161  ASP A HB3  2  
ATOM   9557   N N    . GLY A 1 162 ? 12.339  14.076 -7.857  0.010 30.09  ? 162  GLY A N    2  
ATOM   9558   C CA   . GLY A 1 162 ? 12.536  12.811 -8.538  0.010 28.79  ? 162  GLY A CA   2  
ATOM   9559   C C    . GLY A 1 162 ? 11.284  11.988 -8.715  0.010 27.33  ? 162  GLY A C    2  
ATOM   9560   O O    . GLY A 1 162 ? 11.372  10.833 -9.104  0.010 26.41  ? 162  GLY A O    2  
ATOM   9561   H H    . GLY A 1 162 ? 12.374  14.760 -8.377  0.010 29.67  ? 162  GLY A H    2  
ATOM   9562   H HA2  . GLY A 1 162 ? 12.916  12.981 -9.415  0.010 28.10  ? 162  GLY A HA2  2  
ATOM   9563   H HA3  . GLY A 1 162 ? 13.164  12.274 -8.034  0.010 29.68  ? 162  GLY A HA3  2  
ATOM   9564   N N    . ALA A 1 163 ? 10.130  12.604 -8.462  0.010 27.25  ? 163  ALA A N    2  
ATOM   9565   C CA   . ALA A 1 163 ? 8.837   11.923 -8.462  0.010 26.05  ? 163  ALA A CA   2  
ATOM   9566   C C    . ALA A 1 163 ? 8.143   11.910 -9.827  0.010 24.09  ? 163  ALA A C    2  
ATOM   9567   O O    . ALA A 1 163 ? 7.212   11.141 -10.048 0.010 23.12  ? 163  ALA A O    2  
ATOM   9568   C CB   . ALA A 1 163 ? 7.935   12.580 -7.456  0.010 26.63  ? 163  ALA A CB   2  
ATOM   9569   H H    . ALA A 1 163 ? 10.067  13.443 -8.283  0.010 27.94  ? 163  ALA A H    2  
ATOM   9570   H HA   . ALA A 1 163 ? 8.968   11.003 -8.185  0.010 26.31  ? 163  ALA A HA   2  
ATOM   9571   H HB1  . ALA A 1 163 ? 7.820   13.510 -7.702  0.010 26.25  ? 163  ALA A HB1  2  
ATOM   9572   H HB2  . ALA A 1 163 ? 7.077   12.126 -7.461  0.010 26.07  ? 163  ALA A HB2  2  
ATOM   9573   H HB3  . ALA A 1 163 ? 8.344   12.517 -6.579  0.010 28.06  ? 163  ALA A HB3  2  
ATOM   9574   N N    . ILE A 1 164 ? 8.605   12.764 -10.731 0.010 23.72  ? 164  ILE A N    2  
ATOM   9575   C CA   . ILE A 1 164 ? 7.969   12.949 -12.018 0.010 22.17  ? 164  ILE A CA   2  
ATOM   9576   C C    . ILE A 1 164 ? 8.567   12.015 -13.059 0.010 21.42  ? 164  ILE A C    2  
ATOM   9577   O O    . ILE A 1 164 ? 9.637   12.251 -13.588 0.010 21.69  ? 164  ILE A O    2  
ATOM   9578   C CB   . ILE A 1 164 ? 8.097   14.405 -12.498 0.010 22.29  ? 164  ILE A CB   2  
ATOM   9579   C CG1  . ILE A 1 164 ? 7.746   15.378 -11.372 0.010 23.50  ? 164  ILE A CG1  2  
ATOM   9580   C CG2  . ILE A 1 164 ? 7.204   14.630 -13.672 0.010 20.90  ? 164  ILE A CG2  2  
ATOM   9581   C CD1  . ILE A 1 164 ? 6.396   15.118 -10.714 0.010 23.17  ? 164  ILE A CD1  2  
ATOM   9582   H H    . ILE A 1 164 ? 9.307   13.244 -10.623 0.010 24.47  ? 164  ILE A H    2  
ATOM   9583   H HA   . ILE A 1 164 ? 7.024   12.748 -11.947 0.010 21.61  ? 164  ILE A HA   2  
ATOM   9584   H HB   . ILE A 1 164 ? 9.016   14.568 -12.764 0.010 22.70  ? 164  ILE A HB   2  
ATOM   9585   H HG12 . ILE A 1 164 ? 8.428   15.324 -10.688 0.010 24.58  ? 164  ILE A HG12 2  
ATOM   9586   H HG13 . ILE A 1 164 ? 7.728   16.272 -11.742 0.010 23.60  ? 164  ILE A HG13 2  
ATOM   9587   H HG21 . ILE A 1 164 ? 6.326   14.287 -13.457 0.010 20.49  ? 164  ILE A HG21 2  
ATOM   9588   H HG22 . ILE A 1 164 ? 7.147   15.578 -13.854 0.010 21.11  ? 164  ILE A HG22 2  
ATOM   9589   H HG23 . ILE A 1 164 ? 7.559   14.162 -14.441 0.010 20.35  ? 164  ILE A HG23 2  
ATOM   9590   H HD11 . ILE A 1 164 ? 6.383   14.228 -10.330 0.010 23.07  ? 164  ILE A HD11 2  
ATOM   9591   H HD12 . ILE A 1 164 ? 6.257   15.773 -10.014 0.010 24.15  ? 164  ILE A HD12 2  
ATOM   9592   H HD13 . ILE A 1 164 ? 5.697   15.199 -11.381 0.010 22.23  ? 164  ILE A HD13 2  
ATOM   9593   N N    . THR A 1 165 ? 7.864   10.934 -13.329 0.010 20.61  ? 165  THR A N    2  
ATOM   9594   C CA   . THR A 1 165 ? 8.281   9.966  -14.326 0.010 20.05  ? 165  THR A CA   2  
ATOM   9595   C C    . THR A 1 165 ? 8.035   10.467 -15.745 0.010 19.01  ? 165  THR A C    2  
ATOM   9596   O O    . THR A 1 165 ? 7.400   11.527 -15.950 0.010 18.65  ? 165  THR A O    2  
ATOM   9597   C CB   . THR A 1 165 ? 7.491   8.650  -14.144 0.010 19.82  ? 165  THR A CB   2  
ATOM   9598   O OG1  . THR A 1 165 ? 6.130   8.872  -14.528 0.010 18.92  ? 165  THR A OG1  2  
ATOM   9599   C CG2  . THR A 1 165 ? 7.554   8.166  -12.700 0.010 21.02  ? 165  THR A CG2  2  
ATOM   9600   H H    . THR A 1 165 ? 7.136   10.733 -12.930 0.010 20.49  ? 165  THR A H    2  
ATOM   9601   H HA   . THR A 1 165 ? 9.225   9.777  -14.225 0.010 20.63  ? 165  THR A HA   2  
ATOM   9602   H HB   . THR A 1 165 ? 7.875   7.961  -14.708 0.010 19.67  ? 165  THR A HB   2  
ATOM   9603   H HG1  . THR A 1 165 ? 6.069   9.138  -15.323 0.010 18.37  ? 165  THR A HG1  2  
ATOM   9604   H HG21 . THR A 1 165 ? 7.141   8.812  -12.109 0.010 21.31  ? 165  THR A HG21 2  
ATOM   9605   H HG22 . THR A 1 165 ? 7.080   7.324  -12.615 0.010 20.97  ? 165  THR A HG22 2  
ATOM   9606   H HG23 . THR A 1 165 ? 8.475   8.036  -12.432 0.010 21.71  ? 165  THR A HG23 2  
ATOM   9607   N N    . GLU A 1 166 ? 8.491   9.710  -16.744 0.010 18.68  ? 166  GLU A N    2  
ATOM   9608   C CA   . GLU A 1 166 ? 8.279   10.140 -18.132 0.010 17.96  ? 166  GLU A CA   2  
ATOM   9609   C C    . GLU A 1 166 ? 6.807   10.042 -18.520 0.010 17.12  ? 166  GLU A C    2  
ATOM   9610   O O    . GLU A 1 166 ? 6.434   10.487 -19.574 0.010 16.66  ? 166  GLU A O    2  
ATOM   9611   C CB   . GLU A 1 166 ? 9.139   9.391  -19.158 0.010 18.02  ? 166  GLU A CB   2  
ATOM   9612   C CG   . GLU A 1 166 ? 10.602  9.880  -19.243 0.010 18.92  ? 166  GLU A CG   2  
ATOM   9613   C CD   . GLU A 1 166 ? 10.914  10.961 -20.330 0.010 19.33  ? 166  GLU A CD   2  
ATOM   9614   O OE1  . GLU A 1 166 ? 11.376  12.067 -19.943 0.010 20.25  ? 166  GLU A OE1  2  
ATOM   9615   O OE2  . GLU A 1 166 ? 10.726  10.725 -21.547 0.010 18.91  ? 166  GLU A OE2  2  
ATOM   9616   H H    . GLU A 1 166 ? 8.917   8.978  -16.652 0.010 18.97  ? 166  GLU A H    2  
ATOM   9617   H HA   . GLU A 1 166 ? 8.529   11.075 -18.202 0.010 18.12  ? 166  GLU A HA   2  
ATOM   9618   H HB2  . GLU A 1 166 ? 9.134   8.449  -18.932 0.010 17.87  ? 166  GLU A HB2  2  
ATOM   9619   H HB3  . GLU A 1 166 ? 8.750   9.510  -20.036 0.010 17.75  ? 166  GLU A HB3  2  
ATOM   9620   H HG2  . GLU A 1 166 ? 10.828  10.267 -18.384 0.010 19.33  ? 166  GLU A HG2  2  
ATOM   9621   H HG3  . GLU A 1 166 ? 11.169  9.114  -19.421 0.010 19.00  ? 166  GLU A HG3  2  
ATOM   9622   N N    . ARG A 1 167 ? 6.005   9.427  -17.659 0.010 17.11  ? 167  ARG A N    2  
ATOM   9623   C CA   . ARG A 1 167 ? 4.563   9.332  -17.872 0.010 16.46  ? 167  ARG A CA   2  
ATOM   9624   C C    . ARG A 1 167 ? 3.788   10.510 -17.259 0.010 16.38  ? 167  ARG A C    2  
ATOM   9625   O O    . ARG A 1 167 ? 2.559   10.583 -17.363 0.010 15.91  ? 167  ARG A O    2  
ATOM   9626   C CB   . ARG A 1 167 ? 4.061   8.027  -17.297 0.010 16.69  ? 167  ARG A CB   2  
ATOM   9627   C CG   . ARG A 1 167 ? 4.982   6.817  -17.553 0.010 17.16  ? 167  ARG A CG   2  
ATOM   9628   C CD   . ARG A 1 167 ? 4.262   5.495  -17.319 0.010 17.40  ? 167  ARG A CD   2  
ATOM   9629   N NE   . ARG A 1 167 ? 3.290   5.200  -18.367 0.010 16.86  ? 167  ARG A NE   2  
ATOM   9630   C CZ   . ARG A 1 167 ? 2.660   4.031  -18.477 0.010 17.17  ? 167  ARG A CZ   2  
ATOM   9631   N NH1  . ARG A 1 167 ? 2.908   3.082  -17.599 0.010 17.99  ? 167  ARG A NH1  2  
ATOM   9632   N NH2  . ARG A 1 167 ? 1.810   3.806  -19.471 0.010 16.87  ? 167  ARG A NH2  2  
ATOM   9633   H H    . ARG A 1 167 ? 6.273   9.033  -16.953 0.010 17.55  ? 167  ARG A H    2  
ATOM   9634   H HA   . ARG A 1 167 ? 4.382   9.328  -18.825 0.010 16.09  ? 167  ARG A HA   2  
ATOM   9635   H HB2  . ARG A 1 167 ? 3.980   8.135  -16.340 0.010 17.07  ? 167  ARG A HB2  2  
ATOM   9636   H HB3  . ARG A 1 167 ? 3.194   7.835  -17.679 0.010 16.30  ? 167  ARG A HB3  2  
ATOM   9637   H HG2  . ARG A 1 167 ? 5.293   6.833  -18.473 0.010 16.95  ? 167  ARG A HG2  2  
ATOM   9638   H HG3  . ARG A 1 167 ? 5.738   6.855  -16.946 0.010 17.69  ? 167  ARG A HG3  2  
ATOM   9639   H HD2  . ARG A 1 167 ? 4.914   4.780  -17.308 0.010 17.88  ? 167  ARG A HD2  2  
ATOM   9640   H HD3  . ARG A 1 167 ? 3.799   5.523  -16.470 0.010 17.63  ? 167  ARG A HD3  2  
ATOM   9641   H HE   . ARG A 1 167 ? 3.190   5.771  -18.998 0.010 16.49  ? 167  ARG A HE   2  
ATOM   9642   H HH11 . ARG A 1 167 ? 3.456   3.211  -16.956 0.010 18.31  ? 167  ARG A HH11 2  
ATOM   9643   H HH12 . ARG A 1 167 ? 2.502   2.332  -17.661 0.010 18.30  ? 167  ARG A HH12 2  
ATOM   9644   H HH21 . ARG A 1 167 ? 1.653   4.420  -20.048 0.010 16.44  ? 167  ARG A HH21 2  
ATOM   9645   H HH22 . ARG A 1 167 ? 1.403   3.053  -19.530 0.010 17.18  ? 167  ARG A HH22 2  
ATOM   9646   N N    . LEU A 1 168 ? 4.506   11.403 -16.587 0.010 17.01  ? 168  LEU A N    2  
ATOM   9647   C CA   . LEU A 1 168 ? 3.882   12.578 -15.983 0.010 17.23  ? 168  LEU A CA   2  
ATOM   9648   C C    . LEU A 1 168 ? 4.476   13.828 -16.578 0.010 17.40  ? 168  LEU A C    2  
ATOM   9649   O O    . LEU A 1 168 ? 5.606   13.823 -17.069 0.010 17.60  ? 168  LEU A O    2  
ATOM   9650   C CB   . LEU A 1 168 ? 4.073   12.605 -14.468 0.010 18.26  ? 168  LEU A CB   2  
ATOM   9651   C CG   . LEU A 1 168 ? 3.466   11.482 -13.629 0.010 18.44  ? 168  LEU A CG   2  
ATOM   9652   C CD1  . LEU A 1 168 ? 4.090   11.406 -12.262 0.010 19.78  ? 168  LEU A CD1  2  
ATOM   9653   C CD2  . LEU A 1 168 ? 1.971   11.679 -13.477 0.010 17.94  ? 168  LEU A CD2  2  
ATOM   9654   H H    . LEU A 1 168 ? 5.355   11.359 -16.470 0.010 17.42  ? 168  LEU A H    2  
ATOM   9655   H HA   . LEU A 1 168 ? 2.931   12.583 -16.162 0.010 16.80  ? 168  LEU A HA   2  
ATOM   9656   H HB2  . LEU A 1 168 ? 5.026   12.606 -14.293 0.010 18.77  ? 168  LEU A HB2  2  
ATOM   9657   H HB3  . LEU A 1 168 ? 3.689   13.434 -14.142 0.010 18.52  ? 168  LEU A HB3  2  
ATOM   9658   H HG   . LEU A 1 168 ? 3.614   10.638 -14.079 0.010 18.15  ? 168  LEU A HG   2  
ATOM   9659   H HD11 . LEU A 1 168 ? 5.052   11.319 -12.354 0.010 20.15  ? 168  LEU A HD11 2  
ATOM   9660   H HD12 . LEU A 1 168 ? 3.874   12.219 -11.777 0.010 20.20  ? 168  LEU A HD12 2  
ATOM   9661   H HD13 . LEU A 1 168 ? 3.735   10.637 -11.791 0.010 19.96  ? 168  LEU A HD13 2  
ATOM   9662   H HD21 . LEU A 1 168 ? 1.804   12.581 -13.168 0.010 17.82  ? 168  LEU A HD21 2  
ATOM   9663   H HD22 . LEU A 1 168 ? 1.547   11.531 -14.334 0.010 17.31  ? 168  LEU A HD22 2  
ATOM   9664   H HD23 . LEU A 1 168 ? 1.634   11.046 -12.824 0.010 18.48  ? 168  LEU A HD23 2  
ATOM   9665   N N    . MET A 1 169 ? 3.723   14.919 -16.519 0.010 17.48  ? 169  MET A N    2  
ATOM   9666   C CA   . MET A 1 169 ? 4.304   16.212 -16.880 0.010 18.01  ? 169  MET A CA   2  
ATOM   9667   C C    . MET A 1 169 ? 3.995   17.247 -15.817 0.010 18.93  ? 169  MET A C    2  
ATOM   9668   O O    . MET A 1 169 ? 3.294   16.967 -14.867 0.010 19.10  ? 169  MET A O    2  
ATOM   9669   C CB   . MET A 1 169 ? 3.845   16.637 -18.261 0.010 17.36  ? 169  MET A CB   2  
ATOM   9670   C CG   . MET A 1 169 ? 2.358   16.898 -18.381 0.010 16.81  ? 169  MET A CG   2  
ATOM   9671   S SD   . MET A 1 169 ? 1.787   17.164 -20.076 0.010 16.38  ? 169  MET A SD   2  
ATOM   9672   C CE   . MET A 1 169 ? 2.460   18.740 -20.555 0.010 17.46  ? 169  MET A CE   2  
ATOM   9673   H H    . MET A 1 169 ? 2.900   14.939 -16.289 0.010 17.32  ? 169  MET A H    2  
ATOM   9674   H HA   . MET A 1 169 ? 5.267   16.129 -16.924 0.010 18.38  ? 169  MET A HA   2  
ATOM   9675   H HB2  . MET A 1 169 ? 4.306   17.451 -18.508 0.010 17.83  ? 169  MET A HB2  2  
ATOM   9676   H HB3  . MET A 1 169 ? 4.069   15.950 -18.896 0.010 16.96  ? 169  MET A HB3  2  
ATOM   9677   H HG2  . MET A 1 169 ? 1.870   16.149 -18.008 0.010 16.41  ? 169  MET A HG2  2  
ATOM   9678   H HG3  . MET A 1 169 ? 2.160   17.703 -17.879 0.010 17.27  ? 169  MET A HG3  2  
ATOM   9679   H HE1  . MET A 1 169 ? 3.428   18.708 -20.481 0.010 17.80  ? 169  MET A HE1  2  
ATOM   9680   H HE2  . MET A 1 169 ? 2.203   18.920 -21.473 0.010 17.44  ? 169  MET A HE2  2  
ATOM   9681   H HE3  . MET A 1 169 ? 2.109   19.429 -19.969 0.010 17.86  ? 169  MET A HE3  2  
ATOM   9682   N N    . CYS A 1 170 ? 4.558   18.437 -15.980 0.010 19.73  ? 170  CYS A N    2  
ATOM   9683   C CA   . CYS A 1 170 ? 4.358   19.517 -15.025 0.010 20.95  ? 170  CYS A CA   2  
ATOM   9684   C C    . CYS A 1 170 ? 4.096   20.815 -15.727 0.010 21.29  ? 170  CYS A C    2  
ATOM   9685   O O    . CYS A 1 170 ? 4.542   21.048 -16.854 0.010 21.06  ? 170  CYS A O    2  
ATOM   9686   C CB   . CYS A 1 170 ? 5.568   19.706 -14.094 0.010 22.34  ? 170  CYS A CB   2  
ATOM   9687   S SG   . CYS A 1 170 ? 6.018   18.235 -13.143 0.010 22.40  ? 170  CYS A SG   2  
ATOM   9688   H H    . CYS A 1 170 ? 5.034   18.650 -16.656 0.010 19.68  ? 170  CYS A H    2  
ATOM   9689   H HA   . CYS A 1 170 ? 3.589   19.310 -14.487 0.010 20.85  ? 170  CYS A HA   2  
ATOM   9690   H HB2  . CYS A 1 170 ? 6.341   19.965 -14.624 0.010 22.50  ? 170  CYS A HB2  2  
ATOM   9691   H HB3  . CYS A 1 170 ? 5.355   20.406 -13.459 0.010 23.27  ? 170  CYS A HB3  2  
ATOM   9692   N N    . ALA A 1 171 ? 3.369   21.665 -15.010 0.010 22.03  ? 171  ALA A N    2  
ATOM   9693   C CA   . ALA A 1 171 ? 3.196   23.057 -15.384 0.010 22.88  ? 171  ALA A CA   2  
ATOM   9694   C C    . ALA A 1 171 ? 3.462   23.896 -14.155 0.010 24.71  ? 171  ALA A C    2  
ATOM   9695   O O    . ALA A 1 171 ? 3.281   23.460 -13.028 0.010 25.19  ? 171  ALA A O    2  
ATOM   9696   C CB   . ALA A 1 171 ? 1.783   23.312 -15.912 0.010 22.14  ? 171  ALA A CB   2  
ATOM   9697   H H    . ALA A 1 171 ? 2.965   21.452 -14.284 0.010 22.17  ? 171  ALA A H    2  
ATOM   9698   H HA   . ALA A 1 171 ? 3.829   23.306 -16.074 0.010 22.94  ? 171  ALA A HA   2  
ATOM   9699   H HB1  . ALA A 1 171 ? 1.148   23.074 -15.220 0.010 22.18  ? 171  ALA A HB1  2  
ATOM   9700   H HB2  . ALA A 1 171 ? 1.692   24.253 -16.127 0.010 22.80  ? 171  ALA A HB2  2  
ATOM   9701   H HB3  . ALA A 1 171 ? 1.628   22.777 -16.707 0.010 21.11  ? 171  ALA A HB3  2  
ATOM   9702   N N    . GLU A 1 172 ? 3.875   25.127 -14.386 0.010 25.95  ? 172  GLU A N    2  
ATOM   9703   C CA   . GLU A 1 172 ? 3.862   26.089 -13.314 0.010 27.93  ? 172  GLU A CA   2  
ATOM   9704   C C    . GLU A 1 172 ? 2.353   26.234 -13.002 0.010 27.93  ? 172  GLU A C    2  
ATOM   9705   O O    . GLU A 1 172 ? 1.498   25.852 -13.802 0.010 26.62  ? 172  GLU A O    2  
ATOM   9706   C CB   . GLU A 1 172 ? 4.629   27.360 -13.727 0.010 29.03  ? 172  GLU A CB   2  
ATOM   9707   C CG   . GLU A 1 172 ? 6.015   26.982 -14.426 0.010 30.41  ? 172  GLU A CG   2  
ATOM   9708   C CD   . GLU A 1 172 ? 6.851   28.172 -14.943 0.010 32.80  ? 172  GLU A CD   2  
ATOM   9709   O OE1  . GLU A 1 172 ? 6.295   29.102 -15.541 0.010 33.72  ? 172  GLU A OE1  2  
ATOM   9710   O OE2  . GLU A 1 172 ? 8.082   28.149 -14.767 0.010 33.85  ? 172  GLU A OE2  2  
ATOM   9711   H H    . GLU A 1 172 ? 4.141   25.426 -15.143 0.010 25.78  ? 172  GLU A H    2  
ATOM   9712   H HA   . GLU A 1 172 ? 4.301   25.718 -12.532 0.010 28.72  ? 172  GLU A HA   2  
ATOM   9713   H HB2  . GLU A 1 172 ? 4.097   27.876 -14.351 0.010 28.04  ? 172  GLU A HB2  2  
ATOM   9714   H HB3  . GLU A 1 172 ? 4.814   27.883 -12.932 0.010 29.93  ? 172  GLU A HB3  2  
ATOM   9715   H HG2  . GLU A 1 172 ? 6.563   26.494 -13.791 0.010 29.83  ? 172  GLU A HG2  2  
ATOM   9716   H HG3  . GLU A 1 172 ? 5.841   26.421 -15.196 0.010 30.55  ? 172  GLU A HG3  2  
ATOM   9717   N N    . SER A 1 173 ? 2.049   26.707 -11.811 0.010 29.55  ? 173  SER A N    2  
ATOM   9718   C CA   . SER A 1 173 ? 0.766   26.466 -11.146 0.010 29.97  ? 173  SER A CA   2  
ATOM   9719   C C    . SER A 1 173 ? 0.107   27.763 -10.793 0.010 31.24  ? 173  SER A C    2  
ATOM   9720   O O    . SER A 1 173 ? -0.907  27.816 -10.084 0.010 30.72  ? 173  SER A O    2  
ATOM   9721   C CB   . SER A 1 173 ? 1.119   25.779 -9.845  0.010 31.53  ? 173  SER A CB   2  
ATOM   9722   O OG   . SER A 1 173 ? 2.137   26.548 -9.208  0.010 30.59  ? 173  SER A OG   2  
ATOM   9723   H H    . SER A 1 173 ? 2.589   27.183 -11.341 0.010 30.54  ? 173  SER A H    2  
ATOM   9724   H HA   . SER A 1 173 ? 0.163   25.922 -11.673 0.010 28.63  ? 173  SER A HA   2  
ATOM   9725   H HB2  . SER A 1 173 ? 0.351   25.728 -9.268  0.010 33.03  ? 173  SER A HB2  2  
ATOM   9726   H HB3  . SER A 1 173 ? 1.458   24.891 -10.043 0.010 31.83  ? 173  SER A HB3  2  
ATOM   9727   H HG   . SER A 1 173 ? 2.883   26.419 -9.598  0.010 29.23  ? 173  SER A HG   2  
ATOM   9728   N N    . ASN A 1 174 ? 0.713   28.807 -11.338 0.010 32.96  ? 174  ASN A N    2  
ATOM   9729   C CA   . ASN A 1 174 ? 0.954   30.045 -10.612 0.010 35.43  ? 174  ASN A CA   2  
ATOM   9730   C C    . ASN A 1 174 ? 1.957   29.728 -9.488  0.010 37.28  ? 174  ASN A C    2  
ATOM   9731   O O    . ASN A 1 174 ? 1.692   28.888 -8.618  0.010 37.17  ? 174  ASN A O    2  
ATOM   9732   C CB   . ASN A 1 174 ? -0.327  30.790 -10.113 0.010 35.66  ? 174  ASN A CB   2  
ATOM   9733   C CG   . ASN A 1 174 ? -0.063  31.645 -8.858  0.010 38.20  ? 174  ASN A CG   2  
ATOM   9734   O OD1  . ASN A 1 174 ? 0.199   31.103 -7.797  0.010 38.30  ? 174  ASN A OD1  2  
ATOM   9735   N ND2  . ASN A 1 174 ? -0.142  32.981 -8.979  0.010 40.48  ? 174  ASN A ND2  2  
ATOM   9736   H H    . ASN A 1 174 ? 1.009   28.826 -12.145 0.010 32.84  ? 174  ASN A H    2  
ATOM   9737   H HA   . ASN A 1 174 ? 1.413   30.648 -11.222 0.010 36.03  ? 174  ASN A HA   2  
ATOM   9738   H HB2  . ASN A 1 174 ? -0.621  31.378 -10.821 0.010 35.72  ? 174  ASN A HB2  2  
ATOM   9739   H HB3  . ASN A 1 174 ? -1.022  30.155 -9.903  0.010 34.29  ? 174  ASN A HB3  2  
ATOM   9740   H HD21 . ASN A 1 174 ? 0.357   33.389 -9.546  0.010 41.19  ? 174  ASN A HD21 2  
ATOM   9741   H HD22 . ASN A 1 174 ? -0.674  33.428 -8.476  0.010 41.35  ? 174  ASN A HD22 2  
ATOM   9742   N N    . ARG A 1 175 ? 3.140   30.335 -9.626  0.010 38.90  ? 175  ARG A N    2  
ATOM   9743   C CA   . ARG A 1 175 ? 4.115   30.552 -8.562  0.010 41.95  ? 175  ARG A CA   2  
ATOM   9744   C C    . ARG A 1 175 ? 3.430   31.300 -7.411  0.010 43.59  ? 175  ARG A C    2  
ATOM   9745   O O    . ARG A 1 175 ? 2.569   30.730 -6.746  0.010 42.23  ? 175  ARG A O    2  
ATOM   9746   C CB   . ARG A 1 175 ? 5.281   31.375 -9.140  0.010 43.50  ? 175  ARG A CB   2  
ATOM   9747   C CG   . ARG A 1 175 ? 4.800   32.544 -10.006 0.010 42.23  ? 175  ARG A CG   2  
ATOM   9748   C CD   . ARG A 1 175 ? 5.857   33.559 -10.355 0.010 44.10  ? 175  ARG A CD   2  
ATOM   9749   N NE   . ARG A 1 175 ? 5.305   34.487 -11.343 0.010 43.89  ? 175  ARG A NE   2  
ATOM   9750   C CZ   . ARG A 1 175 ? 5.945   35.525 -11.873 0.010 45.53  ? 175  ARG A CZ   2  
ATOM   9751   N NH1  . ARG A 1 175 ? 7.189   35.825 -11.515 0.010 47.39  ? 175  ARG A NH1  2  
ATOM   9752   N NH2  . ARG A 1 175 ? 5.334   36.276 -12.784 0.010 45.47  ? 175  ARG A NH2  2  
ATOM   9753   H H    . ARG A 1 175 ? 3.416   30.612 -10.388 0.010 38.32  ? 175  ARG A H    2  
ATOM   9754   H HA   . ARG A 1 175 ? 4.460   29.712 -8.229  0.010 42.20  ? 175  ARG A HA   2  
ATOM   9755   H HB2  . ARG A 1 175 ? 5.831   31.727 -8.422  0.010 45.64  ? 175  ARG A HB2  2  
ATOM   9756   H HB3  . ARG A 1 175 ? 5.813   30.796 -9.709  0.010 43.33  ? 175  ARG A HB3  2  
ATOM   9757   H HG2  . ARG A 1 175 ? 4.485   32.194 -10.853 0.010 40.32  ? 175  ARG A HG2  2  
ATOM   9758   H HG3  . ARG A 1 175 ? 4.080   33.006 -9.556  0.010 42.20  ? 175  ARG A HG3  2  
ATOM   9759   H HD2  . ARG A 1 175 ? 6.126   34.051 -9.564  0.010 46.23  ? 175  ARG A HD2  2  
ATOM   9760   H HD3  . ARG A 1 175 ? 6.614   33.101 -10.753 0.010 43.48  ? 175  ARG A HD3  2  
ATOM   9761   H HE   . ARG A 1 175 ? 4.603   34.217 -11.757 0.010 42.14  ? 175  ARG A HE   2  
ATOM   9762   H HH11 . ARG A 1 175 ? 7.598   35.344 -10.930 0.010 47.57  ? 175  ARG A HH11 2  
ATOM   9763   H HH12 . ARG A 1 175 ? 7.584   36.505 -11.866 0.010 48.51  ? 175  ARG A HH12 2  
ATOM   9764   H HH21 . ARG A 1 175 ? 4.532   36.097 -13.029 0.010 44.33  ? 175  ARG A HH21 2  
ATOM   9765   H HH22 . ARG A 1 175 ? 5.741   36.954 -13.123 0.010 46.59  ? 175  ARG A HH22 2  
ATOM   9766   N N    . ARG A 1 176 ? 3.818   32.559 -7.190  0.010 46.67  ? 176  ARG A N    2  
ATOM   9767   C CA   . ARG A 1 176 ? 3.070   33.516 -6.366  0.010 48.61  ? 176  ARG A CA   2  
ATOM   9768   C C    . ARG A 1 176 ? 2.005   32.926 -5.411  0.010 48.20  ? 176  ARG A C    2  
ATOM   9769   O O    . ARG A 1 176 ? 2.173   33.013 -4.197  0.010 50.39  ? 176  ARG A O    2  
ATOM   9770   C CB   . ARG A 1 176 ? 2.457   34.601 -7.273  0.010 47.89  ? 176  ARG A CB   2  
ATOM   9771   C CG   . ARG A 1 176 ? 3.518   35.569 -7.880  0.010 50.10  ? 176  ARG A CG   2  
ATOM   9772   C CD   . ARG A 1 176 ? 2.951   36.474 -8.993  0.010 49.17  ? 176  ARG A CD   2  
ATOM   9773   N NE   . ARG A 1 176 ? 1.806   35.865 -9.659  0.010 46.01  ? 176  ARG A NE   2  
ATOM   9774   C CZ   . ARG A 1 176 ? 1.775   35.424 -10.919 0.010 43.64  ? 176  ARG A CZ   2  
ATOM   9775   N NH1  . ARG A 1 176 ? 2.820   35.538 -11.717 0.010 43.93  ? 176  ARG A NH1  2  
ATOM   9776   N NH2  . ARG A 1 176 ? 0.668   34.884 -11.388 0.010 41.12  ? 176  ARG A NH2  2  
ATOM   9777   H H    . ARG A 1 176 ? 4.543   32.903 -7.495  0.010 47.83  ? 176  ARG A H    2  
ATOM   9778   H HA   . ARG A 1 176 ? 3.720   33.965 -5.802  0.010 50.95  ? 176  ARG A HA   2  
ATOM   9779   H HB2  . ARG A 1 176 ? 2.015   34.147 -8.004  0.010 45.70  ? 176  ARG A HB2  2  
ATOM   9780   H HB3  . ARG A 1 176 ? 1.810   35.123 -6.773  0.010 48.32  ? 176  ARG A HB3  2  
ATOM   9781   H HG2  . ARG A 1 176 ? 3.858   36.143 -7.173  0.010 52.38  ? 176  ARG A HG2  2  
ATOM   9782   H HG3  . ARG A 1 176 ? 4.244   35.045 -8.255  0.010 50.09  ? 176  ARG A HG3  2  
ATOM   9783   H HD2  . ARG A 1 176 ? 2.658   37.312 -8.603  0.010 50.77  ? 176  ARG A HD2  2  
ATOM   9784   H HD3  . ARG A 1 176 ? 3.647   36.644 -9.645  0.010 49.26  ? 176  ARG A HD3  2  
ATOM   9785   H HE   . ARG A 1 176 ? 1.118   35.700 -9.170  0.010 45.91  ? 176  ARG A HE   2  
ATOM   9786   H HH11 . ARG A 1 176 ? 3.539   35.892 -11.423 0.010 45.62  ? 176  ARG A HH11 2  
ATOM   9787   H HH12 . ARG A 1 176 ? 2.778   35.257 -12.529 0.010 42.47  ? 176  ARG A HH12 2  
ATOM   9788   H HH21 . ARG A 1 176 ? -0.020  34.808 -10.878 0.010 40.95  ? 176  ARG A HH21 2  
ATOM   9789   H HH22 . ARG A 1 176 ? 0.635   34.607 -12.201 0.010 39.75  ? 176  ARG A HH22 2  
ATOM   9790   N N    . ASP A 1 177 ? 0.931   32.332 -5.941  0.010 45.57  ? 177  ASP A N    2  
ATOM   9791   C CA   . ASP A 1 177 ? -0.161  31.815 -5.088  0.010 44.84  ? 177  ASP A CA   2  
ATOM   9792   C C    . ASP A 1 177 ? -0.061  30.368 -4.582  0.010 42.20  ? 177  ASP A C    2  
ATOM   9793   O O    . ASP A 1 177 ? 0.208   30.217 -3.389  0.010 42.09  ? 177  ASP A O    2  
ATOM   9794   C CB   . ASP A 1 177 ? -1.539  32.108 -5.703  0.010 44.12  ? 177  ASP A CB   2  
ATOM   9795   C CG   . ASP A 1 177 ? -2.132  33.421 -5.188  0.010 46.37  ? 177  ASP A CG   2  
ATOM   9796   O OD1  . ASP A 1 177 ? -2.928  33.361 -4.238  0.010 45.82  ? 177  ASP A OD1  2  
ATOM   9797   O OD2  . ASP A 1 177 ? -1.825  34.500 -5.747  0.010 48.79  ? 177  ASP A OD2  2  
ATOM   9798   H H    . ASP A 1 177 ? 0.804   32.235 -6.777  0.010 44.22  ? 177  ASP A H    2  
ATOM   9799   H HA   . ASP A 1 177 ? -0.138  32.345 -4.278  0.010 46.65  ? 177  ASP A HA   2  
ATOM   9800   H HB2  . ASP A 1 177 ? -1.460  32.215 -6.659  0.010 44.32  ? 177  ASP A HB2  2  
ATOM   9801   H HB3  . ASP A 1 177 ? -2.156  31.389 -5.497  0.010 42.11  ? 177  ASP A HB3  2  
ATOM   9802   N N    . SER A 1 178 ? -0.273  29.333 -5.433  0.010 40.24  ? 178  SER A N    2  
ATOM   9803   C CA   . SER A 1 178 ? -0.383  27.907 -4.987  0.010 38.14  ? 178  SER A CA   2  
ATOM   9804   C C    . SER A 1 178 ? -1.141  26.915 -5.898  0.010 35.70  ? 178  SER A C    2  
ATOM   9805   O O    . SER A 1 178 ? -1.506  27.255 -7.044  0.010 35.38  ? 178  SER A O    2  
ATOM   9806   C CB   . SER A 1 178 ? -1.055  27.837 -3.590  0.010 39.67  ? 178  SER A CB   2  
ATOM   9807   O OG   . SER A 1 178 ? -1.838  26.667 -3.453  0.010 37.88  ? 178  SER A OG   2  
ATOM   9808   H H    . SER A 1 178 ? -0.352  29.425 -6.285  0.010 40.15  ? 178  SER A H    2  
ATOM   9809   H HA   . SER A 1 178 ? 0.518   27.563 -4.875  0.010 37.48  ? 178  SER A HA   2  
ATOM   9810   H HB2  . SER A 1 178 ? -0.380  27.843 -2.892  0.010 41.15  ? 178  SER A HB2  2  
ATOM   9811   H HB3  . SER A 1 178 ? -1.650  28.593 -3.481  0.010 40.59  ? 178  SER A HB3  2  
ATOM   9812   H HG   . SER A 1 178 ? -1.972  26.504 -2.630  0.010 38.89  ? 178  SER A HG   2  
ATOM   9813   N N    . CYS A 1 179 ? -1.409  25.732 -5.313  0.010 34.12  ? 179  CYS A N    2  
ATOM   9814   C CA   . CYS A 1 179 ? -2.015  24.554 -5.971  0.010 32.45  ? 179  CYS A CA   2  
ATOM   9815   C C    . CYS A 1 179 ? -3.400  24.803 -6.582  0.010 31.01  ? 179  CYS A C    2  
ATOM   9816   O O    . CYS A 1 179 ? -3.483  25.318 -7.651  0.010 30.34  ? 179  CYS A O    2  
ATOM   9817   C CB   . CYS A 1 179 ? -2.135  23.436 -4.981  0.010 34.19  ? 179  CYS A CB   2  
ATOM   9818   S SG   . CYS A 1 179 ? -0.600  23.014 -4.234  0.010 36.09  ? 179  CYS A SG   2  
ATOM   9819   H H    . CYS A 1 179 ? -1.224  25.569 -4.494  0.010 34.07  ? 179  CYS A H    2  
ATOM   9820   H HA   . CYS A 1 179 ? -1.409  24.236 -6.695  0.010 31.25  ? 179  CYS A HA   2  
ATOM   9821   H HB2  . CYS A 1 179 ? -2.734  23.725 -4.255  0.010 35.43  ? 179  CYS A HB2  2  
ATOM   9822   H HB3  . CYS A 1 179 ? -2.486  22.697 -5.446  0.010 33.19  ? 179  CYS A HB3  2  
ATOM   9823   N N    . LYS A 1 180 ? -4.472  24.331 -5.917  0.010 30.77  ? 180  LYS A N    2  
ATOM   9824   C CA   . LYS A 1 180 ? -5.849  24.542 -6.365  0.010 29.39  ? 180  LYS A CA   2  
ATOM   9825   C C    . LYS A 1 180 ? -6.951  23.756 -5.630  0.010 28.97  ? 180  LYS A C    2  
ATOM   9826   O O    . LYS A 1 180 ? -7.956  24.352 -5.166  0.010 30.59  ? 180  LYS A O    2  
ATOM   9827   C CB   . LYS A 1 180 ? -6.070  24.175 -7.854  0.010 27.33  ? 180  LYS A CB   2  
ATOM   9828   C CG   . LYS A 1 180 ? -5.038  23.353 -8.695  0.010 26.09  ? 180  LYS A CG   2  
ATOM   9829   C CD   . LYS A 1 180 ? -5.046  23.869 -10.165 0.010 24.64  ? 180  LYS A CD   2  
ATOM   9830   C CE   . LYS A 1 180 ? -3.678  24.293 -10.682 0.010 25.37  ? 180  LYS A CE   2  
ATOM   9831   N NZ   . LYS A 1 180 ? -3.454  25.784 -10.653 0.010 27.01  ? 180  LYS A NZ   2  
ATOM   9832   H H    . LYS A 1 180 ? -4.449  23.881 -5.182  0.010 31.55  ? 180  LYS A H    2  
ATOM   9833   H HA   . LYS A 1 180 ? -6.061  25.482 -6.272  0.010 30.23  ? 180  LYS A HA   2  
ATOM   9834   H HB2  . LYS A 1 180 ? -6.881  23.639 -7.888  0.010 26.49  ? 180  LYS A HB2  2  
ATOM   9835   H HB3  . LYS A 1 180 ? -6.244  25.009 -8.313  0.010 27.78  ? 180  LYS A HB3  2  
ATOM   9836   H HG2  . LYS A 1 180 ? -4.140  23.338 -8.354  0.010 26.92  ? 180  LYS A HG2  2  
ATOM   9837   H HG3  . LYS A 1 180 ? -5.355  22.439 -8.723  0.010 25.48  ? 180  LYS A HG3  2  
ATOM   9838   H HD2  . LYS A 1 180 ? -5.366  23.156 -10.738 0.010 23.54  ? 180  LYS A HD2  2  
ATOM   9839   H HD3  . LYS A 1 180 ? -5.630  24.636 -10.253 0.010 24.43  ? 180  LYS A HD3  2  
ATOM   9840   H HE2  . LYS A 1 180 ? -2.991  23.860 -10.156 0.010 25.88  ? 180  LYS A HE2  2  
ATOM   9841   H HE3  . LYS A 1 180 ? -3.596  24.014 -11.606 0.010 24.41  ? 180  LYS A HE3  2  
ATOM   9842   H HZ1  . LYS A 1 180 ? -4.141  26.205 -11.030 0.010 26.61  ? 180  LYS A HZ1  2  
ATOM   9843   H HZ2  . LYS A 1 180 ? -3.374  26.062 -9.811  0.010 28.06  ? 180  LYS A HZ2  2  
ATOM   9844   H HZ3  . LYS A 1 180 ? -2.710  25.993 -11.094 0.010 27.48  ? 180  LYS A HZ3  2  
ATOM   9845   N N    . GLY A 1 181 ? -6.718  22.450 -5.520  0.010 27.08  ? 181  GLY A N    2  
ATOM   9846   C CA   . GLY A 1 181 ? -7.817  21.504 -5.523  0.010 26.88  ? 181  GLY A CA   2  
ATOM   9847   C C    . GLY A 1 181 ? -7.998  20.740 -6.865  0.010 24.91  ? 181  GLY A C    2  
ATOM   9848   O O    . GLY A 1 181 ? -7.102  20.006 -7.252  0.010 24.07  ? 181  GLY A O    2  
ATOM   9849   H H    . GLY A 1 181 ? -5.934  22.101 -5.448  0.010 26.00  ? 181  GLY A H    2  
ATOM   9850   H HA2  . GLY A 1 181 ? -7.636  20.837 -4.853  0.010 27.40  ? 181  GLY A HA2  2  
ATOM   9851   H HA3  . GLY A 1 181 ? -8.631  21.970 -5.286  0.010 27.82  ? 181  GLY A HA3  2  
ATOM   9852   N N    . ASP A 1 182 ? -9.094  20.919 -7.604  0.010 24.34  ? 182  ASP A N    2  
ATOM   9853   C CA   . ASP A 1 182 ? -9.712  19.798 -8.372  0.010 22.85  ? 182  ASP A CA   2  
ATOM   9854   C C    . ASP A 1 182 ? -8.931  18.463 -8.545  0.010 22.29  ? 182  ASP A C    2  
ATOM   9855   O O    . ASP A 1 182 ? -8.609  17.942 -7.517  0.010 22.86  ? 182  ASP A O    2  
ATOM   9856   C CB   . ASP A 1 182 ? -10.347 20.192 -9.711  0.010 21.46  ? 182  ASP A CB   2  
ATOM   9857   C CG   . ASP A 1 182 ? -9.324  20.488 -10.761 0.010 20.55  ? 182  ASP A CG   2  
ATOM   9858   O OD1  . ASP A 1 182 ? -8.830  19.447 -11.334 0.010 19.34  ? 182  ASP A OD1  2  
ATOM   9859   O OD2  . ASP A 1 182 ? -9.019  21.693 -11.028 0.010 21.24  ? 182  ASP A OD2  2  
ATOM   9860   H H    . ASP A 1 182 ? -9.500  21.673 -7.702  0.010 24.89  ? 182  ASP A H    2  
ATOM   9861   H HA   . ASP A 1 182 ? -10.464 19.529 -7.873  0.010 23.17  ? 182  ASP A HA   2  
ATOM   9862   H HB2  . ASP A 1 182 ? -10.853 19.431 -10.089 0.010 20.83  ? 182  ASP A HB2  2  
ATOM   9863   H HB3  . ASP A 1 182 ? -10.915 20.968 -9.630  0.010 21.85  ? 182  ASP A HB3  2  
ATOM   9864   N N    . SER A 1 183 ? -8.935  17.850 -9.768  0.010 21.55  ? 183  SER A N    2  
ATOM   9865   C CA   . SER A 1 183 ? -8.290  16.542 -10.143 0.010 20.25  ? 183  SER A CA   2  
ATOM   9866   C C    . SER A 1 183 ? -9.195  16.018 -11.331 0.010 18.93  ? 183  SER A C    2  
ATOM   9867   O O    . SER A 1 183 ? -10.392 16.297 -11.387 0.010 18.96  ? 183  SER A O    2  
ATOM   9868   C CB   . SER A 1 183 ? -8.336  15.529 -9.003  0.010 20.65  ? 183  SER A CB   2  
ATOM   9869   O OG   . SER A 1 183 ? -8.026  16.092 -7.722  0.010 22.20  ? 183  SER A OG   2  
ATOM   9870   H H    . SER A 1 183 ? -9.394  18.130 -10.409 0.010 21.90  ? 183  SER A H    2  
ATOM   9871   H HA   . SER A 1 183 ? -7.366  16.652 -10.417 0.010 20.10  ? 183  SER A HA   2  
ATOM   9872   H HB2  . SER A 1 183 ? -9.223  15.147 -8.978  0.010 20.19  ? 183  SER A HB2  2  
ATOM   9873   H HB3  . SER A 1 183 ? -7.689  14.836 -9.216  0.010 20.47  ? 183  SER A HB3  2  
ATOM   9874   H HG   . SER A 1 183 ? -7.867  15.477 -7.156  0.010 22.46  ? 183  SER A HG   2  
ATOM   9875   N N    . GLY A 1 184 ? -8.632  15.286 -12.284 0.010 17.93  ? 184  GLY A N    2  
ATOM   9876   C CA   . GLY A 1 184 ? -9.425  14.675 -13.349 0.010 16.98  ? 184  GLY A CA   2  
ATOM   9877   C C    . GLY A 1 184 ? -9.632  15.496 -14.596 0.010 16.53  ? 184  GLY A C    2  
ATOM   9878   O O    . GLY A 1 184 ? -10.112 14.988 -15.616 0.010 15.80  ? 184  GLY A O    2  
ATOM   9879   H H    . GLY A 1 184 ? -7.791  15.127 -12.328 0.010 17.89  ? 184  GLY A H    2  
ATOM   9880   H HA2  . GLY A 1 184 ? -9.071  13.806 -13.597 0.010 16.58  ? 184  GLY A HA2  2  
ATOM   9881   H HA3  . GLY A 1 184 ? -10.315 14.517 -13.008 0.010 17.18  ? 184  GLY A HA3  2  
ATOM   9882   N N    . GLY A 1 185 ? -9.307  16.783 -14.506 0.010 17.17  ? 185  GLY A N    2  
ATOM   9883   C CA   . GLY A 1 185 ? -9.565  17.698 -15.593 0.010 17.05  ? 185  GLY A CA   2  
ATOM   9884   C C    . GLY A 1 185 ? -8.479  17.768 -16.641 0.010 16.32  ? 185  GLY A C    2  
ATOM   9885   O O    . GLY A 1 185 ? -7.348  17.391 -16.408 0.010 16.11  ? 185  GLY A O    2  
ATOM   9886   H H    . GLY A 1 185 ? -8.935  17.146 -13.822 0.010 17.82  ? 185  GLY A H    2  
ATOM   9887   H HA2  . GLY A 1 185 ? -10.382 17.421 -16.034 0.010 16.98  ? 185  GLY A HA2  2  
ATOM   9888   H HA3  . GLY A 1 185 ? -9.695  18.591 -15.241 0.010 17.69  ? 185  GLY A HA3  2  
ATOM   9889   N N    . PRO A 1 186 ? -8.834  18.265 -17.819 0.010 16.06  ? 186  PRO A N    2  
ATOM   9890   C CA   . PRO A 1 186 ? -7.897  18.298 -18.929 0.010 15.61  ? 186  PRO A CA   2  
ATOM   9891   C C    . PRO A 1 186 ? -6.851  19.399 -18.805 0.010 16.15  ? 186  PRO A C    2  
ATOM   9892   O O    . PRO A 1 186 ? -7.120  20.536 -18.363 0.010 16.89  ? 186  PRO A O    2  
ATOM   9893   C CB   . PRO A 1 186 ? -8.797  18.623 -20.116 0.010 15.37  ? 186  PRO A CB   2  
ATOM   9894   C CG   . PRO A 1 186 ? -9.816  19.579 -19.503 0.010 15.94  ? 186  PRO A CG   2  
ATOM   9895   C CD   . PRO A 1 186 ? -10.063 19.015 -18.114 0.010 16.17  ? 186  PRO A CD   2  
ATOM   9896   H HA   . PRO A 1 186 ? -7.472  17.434 -19.054 0.010 15.26  ? 186  PRO A HA   2  
ATOM   9897   H HB2  . PRO A 1 186 ? -8.287  19.053 -20.815 0.010 15.39  ? 186  PRO A HB2  2  
ATOM   9898   H HB3  . PRO A 1 186 ? -9.226  17.817 -20.447 0.010 15.00  ? 186  PRO A HB3  2  
ATOM   9899   H HG2  . PRO A 1 186 ? -9.446  20.473 -19.453 0.010 16.39  ? 186  PRO A HG2  2  
ATOM   9900   H HG3  . PRO A 1 186 ? -10.630 19.574 -20.026 0.010 15.82  ? 186  PRO A HG3  2  
ATOM   9901   H HD2  . PRO A 1 186 ? -10.132 19.731 -17.473 0.010 16.75  ? 186  PRO A HD2  2  
ATOM   9902   H HD3  . PRO A 1 186 ? -10.838 18.434 -18.105 0.010 15.92  ? 186  PRO A HD3  2  
ATOM   9903   N N    . LEU A 1 187 ? -5.656  19.034 -19.233 0.010 15.91  ? 187  LEU A N    2  
ATOM   9904   C CA   . LEU A 1 187 ? -4.657  19.990 -19.660 0.010 16.42  ? 187  LEU A CA   2  
ATOM   9905   C C    . LEU A 1 187 ? -4.586  19.910 -21.176 0.010 16.16  ? 187  LEU A C    2  
ATOM   9906   O O    . LEU A 1 187 ? -4.232  18.849 -21.741 0.010 15.60  ? 187  LEU A O    2  
ATOM   9907   C CB   . LEU A 1 187 ? -3.309  19.686 -18.990 0.010 16.59  ? 187  LEU A CB   2  
ATOM   9908   C CG   . LEU A 1 187 ? -2.203  20.671 -19.332 0.010 17.30  ? 187  LEU A CG   2  
ATOM   9909   C CD1  . LEU A 1 187 ? -1.863  20.580 -20.821 0.010 17.02  ? 187  LEU A CD1  2  
ATOM   9910   C CD2  . LEU A 1 187 ? -2.668  22.055 -18.924 0.010 18.32  ? 187  LEU A CD2  2  
ATOM   9911   H H    . LEU A 1 187 ? -5.398  18.219 -19.285 0.010 15.52  ? 187  LEU A H    2  
ATOM   9912   H HA   . LEU A 1 187 ? -4.934  20.887 -19.425 0.010 17.01  ? 187  LEU A HA   2  
ATOM   9913   H HB2  . LEU A 1 187 ? -3.425  19.694 -18.030 0.010 16.90  ? 187  LEU A HB2  2  
ATOM   9914   H HB3  . LEU A 1 187 ? -3.007  18.809 -19.272 0.010 16.07  ? 187  LEU A HB3  2  
ATOM   9915   H HG   . LEU A 1 187 ? -1.402  20.454 -18.826 0.010 17.46  ? 187  LEU A HG   2  
ATOM   9916   H HD11 . LEU A 1 187 ? -1.953  19.657 -21.110 0.010 16.39  ? 187  LEU A HD11 2  
ATOM   9917   H HD12 . LEU A 1 187 ? -2.455  21.147 -21.333 0.010 17.23  ? 187  LEU A HD12 2  
ATOM   9918   H HD13 . LEU A 1 187 ? -0.947  20.869 -20.948 0.010 17.40  ? 187  LEU A HD13 2  
ATOM   9919   H HD21 . LEU A 1 187 ? -3.221  21.982 -18.130 0.010 18.59  ? 187  LEU A HD21 2  
ATOM   9920   H HD22 . LEU A 1 187 ? -1.890  22.599 -18.728 0.010 18.90  ? 187  LEU A HD22 2  
ATOM   9921   H HD23 . LEU A 1 187 ? -3.182  22.448 -19.647 0.010 18.25  ? 187  LEU A HD23 2  
ATOM   9922   N N    . VAL A 1 188 ? -4.944  21.017 -21.825 0.010 16.77  ? 188  VAL A N    2  
ATOM   9923   C CA   . VAL A 1 188 ? -5.096  21.065 -23.274 0.010 16.85  ? 188  VAL A CA   2  
ATOM   9924   C C    . VAL A 1 188 ? -4.109  22.023 -23.921 0.010 17.68  ? 188  VAL A C    2  
ATOM   9925   O O    . VAL A 1 188 ? -4.010  23.165 -23.487 0.010 18.53  ? 188  VAL A O    2  
ATOM   9926   C CB   . VAL A 1 188 ? -6.520  21.541 -23.641 0.010 17.14  ? 188  VAL A CB   2  
ATOM   9927   C CG1  . VAL A 1 188 ? -6.721  21.520 -25.143 0.010 17.50  ? 188  VAL A CG1  2  
ATOM   9928   C CG2  . VAL A 1 188 ? -7.542  20.698 -22.878 0.010 16.49  ? 188  VAL A CG2  2  
ATOM   9929   H H    . VAL A 1 188 ? -5.110  21.757 -21.436 0.010 17.28  ? 188  VAL A H    2  
ATOM   9930   H HA   . VAL A 1 188 ? -4.954  20.189 -23.659 0.010 16.36  ? 188  VAL A HA   2  
ATOM   9931   H HB   . VAL A 1 188 ? -6.626  22.456 -23.345 0.010 17.73  ? 188  VAL A HB   2  
ATOM   9932   H HG11 . VAL A 1 188 ? -6.249  20.758 -25.512 0.010 17.12  ? 188  VAL A HG11 2  
ATOM   9933   H HG12 . VAL A 1 188 ? -7.666  21.448 -25.344 0.010 17.58  ? 188  VAL A HG12 2  
ATOM   9934   H HG13 . VAL A 1 188 ? -6.376  22.343 -25.519 0.010 18.17  ? 188  VAL A HG13 2  
ATOM   9935   H HG21 . VAL A 1 188 ? -7.191  19.799 -22.785 0.010 15.96  ? 188  VAL A HG21 2  
ATOM   9936   H HG22 . VAL A 1 188 ? -7.671  21.084 -21.999 0.010 16.64  ? 188  VAL A HG22 2  
ATOM   9937   H HG23 . VAL A 1 188 ? -8.383  20.687 -23.363 0.010 16.58  ? 188  VAL A HG23 2  
ATOM   9938   N N    . CYS A 1 189 ? -3.384  21.546 -24.934 0.010 17.61  ? 189  CYS A N    2  
ATOM   9939   C CA   . CYS A 1 189 ? -2.384  22.370 -25.648 0.010 18.55  ? 189  CYS A CA   2  
ATOM   9940   C C    . CYS A 1 189 ? -2.681  22.384 -27.150 0.010 19.02  ? 189  CYS A C    2  
ATOM   9941   O O    . CYS A 1 189 ? -2.762  21.337 -27.773 0.010 18.55  ? 189  CYS A O    2  
ATOM   9942   C CB   . CYS A 1 189 ? -0.957  21.828 -25.415 0.010 18.37  ? 189  CYS A CB   2  
ATOM   9943   S SG   . CYS A 1 189 ? -0.606  21.339 -23.695 0.010 17.82  ? 189  CYS A SG   2  
ATOM   9944   H H    . CYS A 1 189 ? -3.440  20.746 -25.227 0.010 17.14  ? 189  CYS A H    2  
ATOM   9945   H HA   . CYS A 1 189 ? -2.409  23.281 -25.321 0.010 19.18  ? 189  CYS A HA   2  
ATOM   9946   H HB2  . CYS A 1 189 ? -0.806  21.060 -25.984 0.010 18.00  ? 189  CYS A HB2  2  
ATOM   9947   H HB3  . CYS A 1 189 ? -0.333  22.527 -25.656 0.010 19.11  ? 189  CYS A HB3  2  
ATOM   9948   N N    . GLY A 1 190 ? -2.802  23.572 -27.746 0.010 20.17  ? 190  GLY A N    2  
ATOM   9949   C CA   . GLY A 1 190 ? -3.174  23.652 -29.145 0.010 20.92  ? 190  GLY A CA   2  
ATOM   9950   C C    . GLY A 1 190 ? -4.489  22.932 -29.470 0.010 20.31  ? 190  GLY A C    2  
ATOM   9951   O O    . GLY A 1 190 ? -4.687  22.482 -30.588 0.010 20.53  ? 190  GLY A O    2  
ATOM   9952   H H    . GLY A 1 190 ? -2.665  24.330 -27.367 0.010 20.66  ? 190  GLY A H    2  
ATOM   9953   H HA2  . GLY A 1 190 ? -3.268  24.580 -29.400 0.010 21.78  ? 190  GLY A HA2  2  
ATOM   9954   H HA3  . GLY A 1 190 ? -2.476  23.254 -29.683 0.010 21.16  ? 190  GLY A HA3  2  
ATOM   9955   N N    . GLY A 1 191 ? -5.392  22.842 -28.505 0.010 19.72  ? 191  GLY A N    2  
ATOM   9956   C CA   . GLY A 1 191 ? -6.668  22.190 -28.734 0.010 19.33  ? 191  GLY A CA   2  
ATOM   9957   C C    . GLY A 1 191 ? -6.564  20.679 -28.738 0.010 18.30  ? 191  GLY A C    2  
ATOM   9958   O O    . GLY A 1 191 ? -7.484  20.002 -29.185 0.010 18.12  ? 191  GLY A O    2  
ATOM   9959   H H    . GLY A 1 191 ? -5.287  23.137 -27.709 0.010 19.62  ? 191  GLY A H    2  
ATOM   9960   H HA2  . GLY A 1 191 ? -7.290  22.448 -28.041 0.010 19.22  ? 191  GLY A HA2  2  
ATOM   9961   H HA3  . GLY A 1 191 ? -7.031  22.463 -29.588 0.010 20.01  ? 191  GLY A HA3  2  
ATOM   9962   N N    . VAL A 1 192 ? -5.451  20.167 -28.211 0.010 17.77  ? 192  VAL A N    2  
ATOM   9963   C CA   . VAL A 1 192 ? -5.262  18.737 -28.004 0.010 16.95  ? 192  VAL A CA   2  
ATOM   9964   C C    . VAL A 1 192 ? -5.106  18.387 -26.522 0.010 16.14  ? 192  VAL A C    2  
ATOM   9965   O O    . VAL A 1 192 ? -4.294  18.971 -25.816 0.010 16.22  ? 192  VAL A O    2  
ATOM   9966   C CB   . VAL A 1 192 ? -3.988  18.245 -28.705 0.010 17.18  ? 192  VAL A CB   2  
ATOM   9967   C CG1  . VAL A 1 192 ? -3.901  16.714 -28.559 0.010 16.55  ? 192  VAL A CG1  2  
ATOM   9968   C CG2  . VAL A 1 192 ? -3.946  18.689 -30.154 0.010 18.28  ? 192  VAL A CG2  2  
ATOM   9969   H H    . VAL A 1 192 ? -4.780  20.632 -27.955 0.010 17.96  ? 192  VAL A H    2  
ATOM   9970   H HA   . VAL A 1 192 ? -6.013  18.238 -28.357 0.010 16.90  ? 192  VAL A HA   2  
ATOM   9971   H HB   . VAL A 1 192 ? -3.216  18.637 -28.265 0.010 17.17  ? 192  VAL A HB   2  
ATOM   9972   H HG11 . VAL A 1 192 ? -4.766  16.321 -28.741 0.010 16.50  ? 192  VAL A HG11 2  
ATOM   9973   H HG12 . VAL A 1 192 ? -3.247  16.376 -29.186 0.010 16.87  ? 192  VAL A HG12 2  
ATOM   9974   H HG13 . VAL A 1 192 ? -3.624  16.507 -27.654 0.010 16.03  ? 192  VAL A HG13 2  
ATOM   9975   H HG21 . VAL A 1 192 ? -3.922  19.657 -30.184 0.010 18.76  ? 192  VAL A HG21 2  
ATOM   9976   H HG22 . VAL A 1 192 ? -3.148  18.336 -30.573 0.010 18.48  ? 192  VAL A HG22 2  
ATOM   9977   H HG23 . VAL A 1 192 ? -4.734  18.367 -30.616 0.010 18.43  ? 192  VAL A HG23 2  
ATOM   9978   N N    . LEU A 1 193 ? -5.854  17.389 -26.065 0.010 15.55  ? 193  LEU A N    2  
ATOM   9979   C CA   . LEU A 1 193 ? -5.656  16.875 -24.724 0.010 14.98  ? 193  LEU A CA   2  
ATOM   9980   C C    . LEU A 1 193 ? -4.263  16.263 -24.579 0.010 14.82  ? 193  LEU A C    2  
ATOM   9981   O O    . LEU A 1 193 ? -3.950  15.283 -25.239 0.010 14.74  ? 193  LEU A O    2  
ATOM   9982   C CB   . LEU A 1 193 ? -6.651  15.775 -24.384 0.010 14.59  ? 193  LEU A CB   2  
ATOM   9983   C CG   . LEU A 1 193 ? -6.661  15.332 -22.917 0.010 14.24  ? 193  LEU A CG   2  
ATOM   9984   C CD1  . LEU A 1 193 ? -6.996  16.491 -21.947 0.010 14.49  ? 193  LEU A CD1  2  
ATOM   9985   C CD2  . LEU A 1 193 ? -7.578  14.127 -22.700 0.010 14.03  ? 193  LEU A CD2  2  
ATOM   9986   H H    . LEU A 1 193 ? -6.471  17.000 -26.514 0.010 15.59  ? 193  LEU A H    2  
ATOM   9987   H HA   . LEU A 1 193 ? -5.750  17.597 -24.087 0.010 15.11  ? 193  LEU A HA   2  
ATOM   9988   H HB2  . LEU A 1 193 ? -7.537  16.074 -24.602 0.010 14.75  ? 193  LEU A HB2  2  
ATOM   9989   H HB3  . LEU A 1 193 ? -6.441  15.003 -24.928 0.010 14.56  ? 193  LEU A HB3  2  
ATOM   9990   H HG   . LEU A 1 193 ? -5.765  15.028 -22.695 0.010 14.16  ? 193  LEU A HG   2  
ATOM   9991   H HD11 . LEU A 1 193 ? -7.334  17.242 -22.455 0.010 14.78  ? 193  LEU A HD11 2  
ATOM   9992   H HD12 . LEU A 1 193 ? -7.664  16.200 -21.313 0.010 14.44  ? 193  LEU A HD12 2  
ATOM   9993   H HD13 . LEU A 1 193 ? -6.192  16.754 -21.476 0.010 14.56  ? 193  LEU A HD13 2  
ATOM   9994   H HD21 . LEU A 1 193 ? -8.446  14.329 -23.082 0.010 14.15  ? 193  LEU A HD21 2  
ATOM   9995   H HD22 . LEU A 1 193 ? -7.200  13.357 -23.153 0.010 13.99  ? 193  LEU A HD22 2  
ATOM   9996   H HD23 . LEU A 1 193 ? -7.660  13.948 -21.751 0.010 13.96  ? 193  LEU A HD23 2  
ATOM   9997   N N    . GLU A 1 194 ? -3.482  16.797 -23.646 0.010 14.90  ? 194  GLU A N    2  
ATOM   9998   C CA   . GLU A 1 194 ? -2.161  16.233 -23.362 0.010 14.86  ? 194  GLU A CA   2  
ATOM   9999   C C    . GLU A 1 194 ? -2.026  15.696 -21.935 0.010 14.65  ? 194  GLU A C    2  
ATOM   10000  O O    . GLU A 1 194 ? -1.265  14.766 -21.691 0.010 14.54  ? 194  GLU A O    2  
ATOM   10001  C CB   . GLU A 1 194 ? -1.086  17.272 -23.637 0.010 15.46  ? 194  GLU A CB   2  
ATOM   10002  C CG   . GLU A 1 194 ? -1.081  17.802 -25.086 0.010 15.90  ? 194  GLU A CG   2  
ATOM   10003  C CD   . GLU A 1 194 ? -0.322  16.938 -26.098 0.010 15.87  ? 194  GLU A CD   2  
ATOM   10004  O OE1  . GLU A 1 194 ? 0.259   15.912 -25.689 0.010 15.51  ? 194  GLU A OE1  2  
ATOM   10005  O OE2  . GLU A 1 194 ? -0.359  17.283 -27.303 0.010 16.38  ? 194  GLU A OE2  2  
ATOM   10006  H H    . GLU A 1 194 ? -3.690  17.475 -23.167 0.010 15.08  ? 194  GLU A H    2  
ATOM   10007  H HA   . GLU A 1 194 ? -1.994  15.487 -23.959 0.010 14.75  ? 194  GLU A HA   2  
ATOM   10008  H HB2  . GLU A 1 194 ? -1.233  18.025 -23.047 0.010 15.73  ? 194  GLU A HB2  2  
ATOM   10009  H HB3  . GLU A 1 194 ? -0.220  16.880 -23.455 0.010 15.48  ? 194  GLU A HB3  2  
ATOM   10010  H HG2  . GLU A 1 194 ? -1.998  17.855 -25.394 0.010 15.87  ? 194  GLU A HG2  2  
ATOM   10011  H HG3  . GLU A 1 194 ? -0.677  18.681 -25.098 0.010 16.41  ? 194  GLU A HG3  2  
ATOM   10012  N N    . GLY A 1 195 ? -2.748  16.294 -21.005 0.010 14.78  ? 195  GLY A N    2  
ATOM   10013  C CA   . GLY A 1 195 ? -2.669  15.914 -19.609 0.010 14.88  ? 195  GLY A CA   2  
ATOM   10014  C C    . GLY A 1 195 ? -3.987  15.860 -18.868 0.010 14.86  ? 195  GLY A C    2  
ATOM   10015  O O    . GLY A 1 195 ? -4.947  16.492 -19.258 0.010 14.86  ? 195  GLY A O    2  
ATOM   10016  H H    . GLY A 1 195 ? -3.280  16.948 -21.158 0.010 14.93  ? 195  GLY A H    2  
ATOM   10017  H HA2  . GLY A 1 195 ? -2.262  15.048 -19.553 0.010 14.69  ? 195  GLY A HA2  2  
ATOM   10018  H HA3  . GLY A 1 195 ? -2.104  16.539 -19.137 0.010 15.30  ? 195  GLY A HA3  2  
ATOM   10019  N N    . VAL A 1 196 ? -3.994  15.063 -17.803 0.010 15.01  ? 196  VAL A N    2  
ATOM   10020  C CA   . VAL A 1 196 ? -5.090  15.008 -16.841 0.010 15.23  ? 196  VAL A CA   2  
ATOM   10021  C C    . VAL A 1 196 ? -4.514  15.382 -15.459 0.010 16.06  ? 196  VAL A C    2  
ATOM   10022  O O    . VAL A 1 196 ? -3.443  14.922 -15.072 0.010 16.31  ? 196  VAL A O    2  
ATOM   10023  C CB   . VAL A 1 196 ? -5.760  13.610 -16.797 0.010 14.92  ? 196  VAL A CB   2  
ATOM   10024  C CG1  . VAL A 1 196 ? -6.828  13.575 -15.734 0.010 15.32  ? 196  VAL A CG1  2  
ATOM   10025  C CG2  . VAL A 1 196 ? -6.372  13.271 -18.118 0.010 14.37  ? 196  VAL A CG2  2  
ATOM   10026  H H    . VAL A 1 196 ? -3.346  14.536 -17.607 0.010 15.08  ? 196  VAL A H    2  
ATOM   10027  H HA   . VAL A 1 196 ? -5.766  15.658 -17.071 0.010 15.26  ? 196  VAL A HA   2  
ATOM   10028  H HB   . VAL A 1 196 ? -5.097  12.933 -16.589 0.010 14.99  ? 196  VAL A HB   2  
ATOM   10029  H HG11 . VAL A 1 196 ? -7.390  14.359 -15.826 0.010 15.38  ? 196  VAL A HG11 2  
ATOM   10030  H HG12 . VAL A 1 196 ? -7.354  12.770 -15.849 0.010 15.16  ? 196  VAL A HG12 2  
ATOM   10031  H HG13 . VAL A 1 196 ? -6.406  13.572 -14.861 0.010 15.80  ? 196  VAL A HG13 2  
ATOM   10032  H HG21 . VAL A 1 196 ? -6.017  13.869 -18.795 0.010 14.31  ? 196  VAL A HG21 2  
ATOM   10033  H HG22 . VAL A 1 196 ? -6.158  12.353 -18.338 0.010 14.23  ? 196  VAL A HG22 2  
ATOM   10034  H HG23 . VAL A 1 196 ? -7.334  13.376 -18.055 0.010 14.36  ? 196  VAL A HG23 2  
ATOM   10035  N N    . VAL A 1 197 ? -5.205  16.246 -14.733 0.010 16.66  ? 197  VAL A N    2  
ATOM   10036  C CA   . VAL A 1 197 ? -4.736  16.675 -13.432 0.010 17.74  ? 197  VAL A CA   2  
ATOM   10037  C C    . VAL A 1 197 ? -4.557  15.435 -12.562 0.010 18.02  ? 197  VAL A C    2  
ATOM   10038  O O    . VAL A 1 197 ? -5.392  14.561 -12.587 0.010 17.66  ? 197  VAL A O    2  
ATOM   10039  C CB   . VAL A 1 197 ? -5.759  17.669 -12.802 0.010 18.46  ? 197  VAL A CB   2  
ATOM   10040  C CG1  . VAL A 1 197 ? -5.387  18.049 -11.385 0.010 19.86  ? 197  VAL A CG1  2  
ATOM   10041  C CG2  . VAL A 1 197 ? -5.880  18.923 -13.694 0.010 18.40  ? 197  VAL A CG2  2  
ATOM   10042  H H    . VAL A 1 197 ? -5.954  16.584 -14.965 0.010 16.56  ? 197  VAL A H    2  
ATOM   10043  H HA   . VAL A 1 197 ? -3.875  17.115 -13.521 0.010 18.04  ? 197  VAL A HA   2  
ATOM   10044  H HB   . VAL A 1 197 ? -6.627  17.242 -12.777 0.010 18.20  ? 197  VAL A HB   2  
ATOM   10045  H HG11 . VAL A 1 197 ? -5.136  17.263 -10.877 0.010 20.19  ? 197  VAL A HG11 2  
ATOM   10046  H HG12 . VAL A 1 197 ? -4.646  18.673 -11.413 0.010 20.03  ? 197  VAL A HG12 2  
ATOM   10047  H HG13 . VAL A 1 197 ? -6.156  18.471 -10.972 0.010 20.41  ? 197  VAL A HG13 2  
ATOM   10048  H HG21 . VAL A 1 197 ? -5.848  18.666 -14.627 0.010 17.64  ? 197  VAL A HG21 2  
ATOM   10049  H HG22 . VAL A 1 197 ? -6.726  19.363 -13.508 0.010 18.94  ? 197  VAL A HG22 2  
ATOM   10050  H HG23 . VAL A 1 197 ? -5.143  19.520 -13.491 0.010 18.73  ? 197  VAL A HG23 2  
ATOM   10051  N N    . THR A 1 198 ? -3.464  15.349 -11.818 0.010 18.82  ? 198  THR A N    2  
ATOM   10052  C CA   . THR A 1 198 ? -3.239  14.185 -10.998 0.010 19.62  ? 198  THR A CA   2  
ATOM   10053  C C    . THR A 1 198 ? -4.103  14.311 -9.738  0.010 21.04  ? 198  THR A C    2  
ATOM   10054  O O    . THR A 1 198 ? -5.323  14.587 -9.801  0.010 21.26  ? 198  THR A O    2  
ATOM   10055  C CB   . THR A 1 198 ? -1.740  14.061 -10.639 0.010 20.06  ? 198  THR A CB   2  
ATOM   10056  O OG1  . THR A 1 198 ? -1.317  15.234 -9.907  0.010 21.00  ? 198  THR A OG1  2  
ATOM   10057  C CG2  . THR A 1 198 ? -0.895  13.947 -11.882 0.010 18.90  ? 198  THR A CG2  2  
ATOM   10058  H H    . THR A 1 198 ? -2.849  15.940 -11.775 0.010 19.01  ? 198  THR A H    2  
ATOM   10059  H HA   . THR A 1 198 ? -3.505  13.392 -11.484 0.010 19.18  ? 198  THR A HA   2  
ATOM   10060  H HB   . THR A 1 198 ? -1.599  13.254 -10.118 0.010 20.62  ? 198  THR A HB   2  
ATOM   10061  H HG1  . THR A 1 198 ? -0.502  15.159 -9.684  0.010 20.60  ? 198  THR A HG1  2  
ATOM   10062  H HG21 . THR A 1 198 ? -1.283  13.295 -12.485 0.010 18.70  ? 198  THR A HG21 2  
ATOM   10063  H HG22 . THR A 1 198 ? -0.856  14.792 -12.340 0.010 18.21  ? 198  THR A HG22 2  
ATOM   10064  H HG23 . THR A 1 198 ? -0.003  13.662 -11.639 0.010 19.14  ? 198  THR A HG23 2  
ATOM   10065  N N    . SER A 1 199 ? -3.462  14.098 -8.585  0.010 22.15  ? 199  SER A N    2  
ATOM   10066  C CA   . SER A 1 199 ? -3.758  14.924 -7.423  0.010 23.81  ? 199  SER A CA   2  
ATOM   10067  C C    . SER A 1 199 ? -3.601  16.373 -7.945  0.010 23.39  ? 199  SER A C    2  
ATOM   10068  O O    . SER A 1 199 ? -3.040  16.547 -9.033  0.010 22.51  ? 199  SER A O    2  
ATOM   10069  C CB   . SER A 1 199 ? -2.775  14.632 -6.294  0.010 24.42  ? 199  SER A CB   2  
ATOM   10070  O OG   . SER A 1 199 ? -1.420  14.624 -6.741  0.010 24.61  ? 199  SER A OG   2  
ATOM   10071  H H    . SER A 1 199 ? -2.880  13.481 -8.452  0.010 22.07  ? 199  SER A H    2  
ATOM   10072  H HA   . SER A 1 199 ? -4.667  14.780 -7.114  0.010 24.70  ? 199  SER A HA   2  
ATOM   10073  H HB2  . SER A 1 199 ? -2.877  15.321 -5.623  0.010 23.57  ? 199  SER A HB2  2  
ATOM   10074  H HB3  . SER A 1 199 ? -2.985  13.763 -5.917  0.010 25.64  ? 199  SER A HB3  2  
ATOM   10075  H HG   . SER A 1 199 ? -0.982  15.247 -6.362  0.010 25.25  ? 199  SER A HG   2  
ATOM   10076  N N    . GLY A 1 200 ? -4.046  17.414 -7.226  0.010 24.03  ? 200  GLY A N    2  
ATOM   10077  C CA   . GLY A 1 200 ? -4.114  18.720 -7.876  0.010 23.50  ? 200  GLY A CA   2  
ATOM   10078  C C    . GLY A 1 200 ? -3.945  20.014 -7.089  0.010 24.98  ? 200  GLY A C    2  
ATOM   10079  O O    . GLY A 1 200 ? -4.922  20.673 -6.789  0.010 25.09  ? 200  GLY A O    2  
ATOM   10080  H H    . GLY A 1 200 ? -4.296  17.392 -6.404  0.010 24.83  ? 200  GLY A H    2  
ATOM   10081  H HA2  . GLY A 1 200 ? -3.439  18.757 -8.568  0.010 22.98  ? 200  GLY A HA2  2  
ATOM   10082  H HA3  . GLY A 1 200 ? -4.974  18.777 -8.319  0.010 22.64  ? 200  GLY A HA3  2  
ATOM   10083  N N    . SER A 1 201 ? -2.731  20.391 -6.705  0.010 26.30  ? 201  SER A N    2  
ATOM   10084  C CA   . SER A 1 201 ? -1.545  19.549 -6.710  0.010 26.45  ? 201  SER A CA   2  
ATOM   10085  C C    . SER A 1 201 ? -1.626  18.798 -5.385  0.010 27.59  ? 201  SER A C    2  
ATOM   10086  O O    . SER A 1 201 ? -0.633  18.250 -4.891  0.010 28.31  ? 201  SER A O    2  
ATOM   10087  C CB   . SER A 1 201 ? -0.284  20.443 -6.792  0.010 27.76  ? 201  SER A CB   2  
ATOM   10088  O OG   . SER A 1 201 ? 0.922   19.706 -6.980  0.010 27.40  ? 201  SER A OG   2  
ATOM   10089  H H    . SER A 1 201 ? -2.561  21.186 -6.437  0.010 27.23  ? 201  SER A H    2  
ATOM   10090  H HA   . SER A 1 201 ? -1.552  18.917 -7.445  0.010 25.18  ? 201  SER A HA   2  
ATOM   10091  H HB2  . SER A 1 201 ? -0.391  21.063 -7.532  0.010 27.51  ? 201  SER A HB2  2  
ATOM   10092  H HB3  . SER A 1 201 ? -0.203  20.938 -5.965  0.010 29.27  ? 201  SER A HB3  2  
ATOM   10093  H HG   . SER A 1 201 ? 1.593   20.218 -6.883  0.010 28.09  ? 201  SER A HG   2  
ATOM   10094  N N    . ALA A 1 202 ? -2.856  18.755 -4.860  0.010 27.86  ? 202  ALA A N    2  
ATOM   10095  C CA   . ALA A 1 202 ? -3.191  18.286 -3.533  0.010 29.36  ? 202  ALA A CA   2  
ATOM   10096  C C    . ALA A 1 202 ? -2.080  18.583 -2.567  0.010 31.64  ? 202  ALA A C    2  
ATOM   10097  O O    . ALA A 1 202 ? -2.251  19.444 -1.707  0.010 33.38  ? 202  ALA A O    2  
ATOM   10098  C CB   . ALA A 1 202 ? -3.535  16.818 -3.545  0.010 28.59  ? 202  ALA A CB   2  
ATOM   10099  H H    . ALA A 1 202 ? -3.568  18.966 -5.267  0.010 27.27  ? 202  ALA A H    2  
ATOM   10100  H HA   . ALA A 1 202 ? -3.977  18.764 -3.228  0.010 29.61  ? 202  ALA A HA   2  
ATOM   10101  H HB1  . ALA A 1 202 ? -4.185  16.654 -4.244  0.010 27.12  ? 202  ALA A HB1  2  
ATOM   10102  H HB2  . ALA A 1 202 ? -2.727  16.306 -3.707  0.010 28.82  ? 202  ALA A HB2  2  
ATOM   10103  H HB3  . ALA A 1 202 ? -3.906  16.579 -2.682  0.010 29.50  ? 202  ALA A HB3  2  
ATOM   10104  N N    . VAL A 1 203 ? -0.964  17.859 -2.707  0.010 31.75  ? 203  VAL A N    2  
ATOM   10105  C CA   . VAL A 1 203 ? 0.230   18.063 -1.868  0.010 34.07  ? 203  VAL A CA   2  
ATOM   10106  C C    . VAL A 1 203 ? 0.413   19.551 -1.629  0.010 35.73  ? 203  VAL A C    2  
ATOM   10107  O O    . VAL A 1 203 ? -0.175  20.112 -0.685  0.010 38.21  ? 203  VAL A O    2  
ATOM   10108  C CB   . VAL A 1 203 ? 1.465   17.450 -2.529  0.010 33.64  ? 203  VAL A CB   2  
ATOM   10109  C CG1  . VAL A 1 203 ? 2.778   17.924 -1.844  0.010 35.82  ? 203  VAL A CG1  2  
ATOM   10110  C CG2  . VAL A 1 203 ? 1.363   15.948 -2.484  0.010 33.56  ? 203  VAL A CG2  2  
ATOM   10111  H H    . VAL A 1 203 ? -0.870  17.237 -3.298  0.010 30.57  ? 203  VAL A H    2  
ATOM   10112  H HA   . VAL A 1 203 ? 0.133   17.631 -1.009  0.010 35.17  ? 203  VAL A HA   2  
ATOM   10113  H HB   . VAL A 1 203 ? 1.484   17.714 -3.464  0.010 32.09  ? 203  VAL A HB   2  
ATOM   10114  H HG11 . VAL A 1 203 ? 2.659   17.892 -0.881  0.010 37.54  ? 203  VAL A HG11 2  
ATOM   10115  H HG12 . VAL A 1 203 ? 3.494   17.321 -2.102  0.010 35.70  ? 203  VAL A HG12 2  
ATOM   10116  H HG13 . VAL A 1 203 ? 3.024   18.820 -2.113  0.010 35.71  ? 203  VAL A HG13 2  
ATOM   10117  H HG21 . VAL A 1 203 ? 1.192   15.673 -1.570  0.010 35.19  ? 203  VAL A HG21 2  
ATOM   10118  H HG22 . VAL A 1 203 ? 0.629   15.669 -3.053  0.010 32.25  ? 203  VAL A HG22 2  
ATOM   10119  H HG23 . VAL A 1 203 ? 2.197   15.564 -2.798  0.010 33.32  ? 203  VAL A HG23 2  
ATOM   10120  N N    . CYS A 1 204 ? 1.209   20.170 -2.504  0.010 34.62  ? 204  CYS A N    2  
ATOM   10121  C CA   . CYS A 1 204 ? 1.328   21.624 -2.641  0.010 36.29  ? 204  CYS A CA   2  
ATOM   10122  C C    . CYS A 1 204 ? 2.410   22.333 -1.827  0.010 38.50  ? 204  CYS A C    2  
ATOM   10123  O O    . CYS A 1 204 ? 2.394   22.307 -0.591  0.010 40.60  ? 204  CYS A O    2  
ATOM   10124  C CB   . CYS A 1 204 ? 0.000   22.329 -2.332  0.010 37.82  ? 204  CYS A CB   2  
ATOM   10125  S SG   . CYS A 1 204 ? 0.127   24.095 -2.684  0.010 38.77  ? 204  CYS A SG   2  
ATOM   10126  H H    . CYS A 1 204 ? 1.702   19.762 -3.074  0.010 33.04  ? 204  CYS A H    2  
ATOM   10127  H HA   . CYS A 1 204 ? 1.554   21.795 -3.567  0.010 35.18  ? 204  CYS A HA   2  
ATOM   10128  H HB2  . CYS A 1 204 ? -0.736  21.897 -2.793  0.010 36.76  ? 204  CYS A HB2  2  
ATOM   10129  H HB3  . CYS A 1 204 ? -0.164  22.282 -1.379  0.010 39.59  ? 204  CYS A HB3  2  
ATOM   10130  N N    . GLY A 1 205 ? 3.314   23.031 -2.512  0.010 38.25  ? 205  GLY A N    2  
ATOM   10131  C CA   . GLY A 1 205 ? 4.127   24.033 -1.836  0.010 40.78  ? 205  GLY A CA   2  
ATOM   10132  C C    . GLY A 1 205 ? 5.528   24.284 -2.345  0.010 40.89  ? 205  GLY A C    2  
ATOM   10133  O O    . GLY A 1 205 ? 6.261   23.325 -2.579  0.010 39.54  ? 205  GLY A O    2  
ATOM   10134  H H    . GLY A 1 205 ? 3.463   22.944 -3.354  0.010 36.77  ? 205  GLY A H    2  
ATOM   10135  H HA2  . GLY A 1 205 ? 3.654   24.873 -1.858  0.010 41.39  ? 205  GLY A HA2  2  
ATOM   10136  H HA3  . GLY A 1 205 ? 4.221   23.792 -0.900  0.010 42.39  ? 205  GLY A HA3  2  
ATOM   10137  N N    . ASN A 1 206 ? 5.879   25.560 -2.543  0.010 42.56  ? 206  ASN A N    2  
ATOM   10138  C CA   . ASN A 1 206 ? 7.287   26.024 -2.417  0.010 44.28  ? 206  ASN A CA   2  
ATOM   10139  C C    . ASN A 1 206 ? 7.526   27.492 -2.854  0.010 45.54  ? 206  ASN A C    2  
ATOM   10140  O O    . ASN A 1 206 ? 8.214   28.253 -2.163  0.010 48.48  ? 206  ASN A O    2  
ATOM   10141  C CB   . ASN A 1 206 ? 8.289   25.090 -3.134  0.010 42.80  ? 206  ASN A CB   2  
ATOM   10142  C CG   . ASN A 1 206 ? 7.970   24.913 -4.587  0.010 39.79  ? 206  ASN A CG   2  
ATOM   10143  O OD1  . ASN A 1 206 ? 7.459   25.849 -5.196  0.010 39.40  ? 206  ASN A OD1  2  
ATOM   10144  N ND2  . ASN A 1 206 ? 8.181   23.704 -5.143  0.010 37.90  ? 206  ASN A ND2  2  
ATOM   10145  H H    . ASN A 1 206 ? 5.322   26.192 -2.748  0.010 42.85  ? 206  ASN A H    2  
ATOM   10146  H HA   . ASN A 1 206 ? 7.520   25.989 -1.477  0.010 46.19  ? 206  ASN A HA   2  
ATOM   10147  H HB2  . ASN A 1 206 ? 9.165   25.501 -3.084  0.010 44.15  ? 206  ASN A HB2  2  
ATOM   10148  H HB3  . ASN A 1 206 ? 8.319   24.225 -2.706  0.010 42.65  ? 206  ASN A HB3  2  
ATOM   10149  H HD21 . ASN A 1 206 ? 7.687   23.033 -4.922  0.010 38.45  ? 206  ASN A HD21 2  
ATOM   10150  H HD22 . ASN A 1 206 ? 8.793   23.604 -5.736  0.010 36.22  ? 206  ASN A HD22 2  
ATOM   10151  N N    . ARG A 1 207 ? 6.900   27.848 -3.977  0.010 43.48  ? 207  ARG A N    2  
ATOM   10152  C CA   . ARG A 1 207 ? 7.076   29.071 -4.784  0.010 44.17  ? 207  ARG A CA   2  
ATOM   10153  C C    . ARG A 1 207 ? 7.326   28.567 -6.223  0.010 41.34  ? 207  ARG A C    2  
ATOM   10154  O O    . ARG A 1 207 ? 6.454   28.684 -7.106  0.010 39.46  ? 207  ARG A O    2  
ATOM   10155  C CB   . ARG A 1 207 ? 8.176   30.057 -4.304  0.010 47.17  ? 207  ARG A CB   2  
ATOM   10156  C CG   . ARG A 1 207 ? 7.685   31.218 -3.424  0.010 50.26  ? 207  ARG A CG   2  
ATOM   10157  C CD   . ARG A 1 207 ? 8.199   32.607 -3.935  0.010 52.44  ? 207  ARG A CD   2  
ATOM   10158  N NE   . ARG A 1 207 ? 8.690   33.459 -2.864  0.010 56.18  ? 207  ARG A NE   2  
ATOM   10159  C CZ   . ARG A 1 207 ? 9.108   34.710 -3.022  0.010 58.92  ? 207  ARG A CZ   2  
ATOM   10160  N NH1  . ARG A 1 207 ? 9.064   35.321 -4.198  0.010 58.36  ? 207  ARG A NH1  2  
ATOM   10161  N NH2  . ARG A 1 207 ? 9.559   35.364 -1.961  0.010 62.47  ? 207  ARG A NH2  2  
ATOM   10162  H H    . ARG A 1 207 ? 6.317   27.345 -4.328  0.010 41.61  ? 207  ARG A H    2  
ATOM   10163  H HA   . ARG A 1 207 ? 6.234   29.548 -4.780  0.010 44.42  ? 207  ARG A HA   2  
ATOM   10164  H HB2  . ARG A 1 207 ? 8.896   29.594 -3.856  0.010 47.69  ? 207  ARG A HB2  2  
ATOM   10165  H HB3  . ARG A 1 207 ? 8.531   30.471 -5.105  0.010 46.80  ? 207  ARG A HB3  2  
ATOM   10166  H HG2  . ARG A 1 207 ? 6.706   31.240 -3.452  0.010 49.64  ? 207  ARG A HG2  2  
ATOM   10167  H HG3  . ARG A 1 207 ? 7.990   31.124 -2.505  0.010 51.72  ? 207  ARG A HG3  2  
ATOM   10168  H HD2  . ARG A 1 207 ? 8.947   32.469 -4.532  0.010 51.61  ? 207  ARG A HD2  2  
ATOM   10169  H HD3  . ARG A 1 207 ? 7.491   33.083 -4.403  0.010 52.34  ? 207  ARG A HD3  2  
ATOM   10170  H HE   . ARG A 1 207 ? 8.569   33.190 -2.057  0.010 56.80  ? 207  ARG A HE   2  
ATOM   10171  H HH11 . ARG A 1 207 ? 8.775   34.897 -4.887  0.010 56.21  ? 207  ARG A HH11 2  
ATOM   10172  H HH12 . ARG A 1 207 ? 9.332   36.136 -4.277  0.010 60.25  ? 207  ARG A HH12 2  
ATOM   10173  H HH21 . ARG A 1 207 ? 9.582   34.976 -1.194  0.010 63.00  ? 207  ARG A HH21 2  
ATOM   10174  H HH22 . ARG A 1 207 ? 9.819   36.179 -2.038  0.010 64.35  ? 207  ARG A HH22 2  
ATOM   10175  N N    . LYS A 1 208 ? 8.467   27.891 -6.401  0.010 41.14  ? 208  LYS A N    2  
ATOM   10176  C CA   . LYS A 1 208 ? 8.868   27.263 -7.668  0.010 38.55  ? 208  LYS A CA   2  
ATOM   10177  C C    . LYS A 1 208 ? 8.388   25.794 -7.703  0.010 36.63  ? 208  LYS A C    2  
ATOM   10178  O O    . LYS A 1 208 ? 9.127   24.857 -8.051  0.010 36.03  ? 208  LYS A O    2  
ATOM   10179  C CB   . LYS A 1 208 ? 10.393  27.369 -7.888  0.010 39.17  ? 208  LYS A CB   2  
ATOM   10180  C CG   . LYS A 1 208 ? 11.202  28.224 -6.908  0.010 41.73  ? 208  LYS A CG   2  
ATOM   10181  C CD   . LYS A 1 208 ? 10.841  29.702 -7.033  0.010 44.61  ? 208  LYS A CD   2  
ATOM   10182  C CE   . LYS A 1 208 ? 11.674  30.394 -8.098  0.010 46.20  ? 208  LYS A CE   2  
ATOM   10183  N NZ   . LYS A 1 208 ? 11.262  31.821 -8.285  0.010 49.53  ? 208  LYS A NZ   2  
ATOM   10184  H H    . LYS A 1 208 ? 9.034   27.760 -5.770  0.010 42.53  ? 208  LYS A H    2  
ATOM   10185  H HA   . LYS A 1 208 ? 8.420   27.733 -8.390  0.010 37.76  ? 208  LYS A HA   2  
ATOM   10186  H HB2  . LYS A 1 208 ? 10.770  26.488 -7.849  0.010 37.63  ? 208  LYS A HB2  2  
ATOM   10187  H HB3  . LYS A 1 208 ? 10.538  27.744 -8.771  0.010 39.49  ? 208  LYS A HB3  2  
ATOM   10188  H HG2  . LYS A 1 208 ? 11.035  27.918 -5.999  0.010 41.94  ? 208  LYS A HG2  2  
ATOM   10189  H HG3  . LYS A 1 208 ? 12.143  28.147 -7.129  0.010 41.58  ? 208  LYS A HG3  2  
ATOM   10190  H HD2  . LYS A 1 208 ? 9.909   29.780 -7.290  0.010 44.21  ? 208  LYS A HD2  2  
ATOM   10191  H HD3  . LYS A 1 208 ? 10.992  30.154 -6.188  0.010 46.04  ? 208  LYS A HD3  2  
ATOM   10192  H HE2  . LYS A 1 208 ? 12.601  30.394 -7.812  0.010 46.22  ? 208  LYS A HE2  2  
ATOM   10193  H HE3  . LYS A 1 208 ? 11.588  29.920 -8.940  0.010 45.25  ? 208  LYS A HE3  2  
ATOM   10194  H HZ1  . LYS A 1 208 ? 11.229  32.230 -7.493  0.010 50.43  ? 208  LYS A HZ1  2  
ATOM   10195  H HZ2  . LYS A 1 208 ? 11.853  32.242 -8.800  0.010 50.69  ? 208  LYS A HZ2  2  
ATOM   10196  H HZ3  . LYS A 1 208 ? 10.459  31.866 -8.667  0.010 49.64  ? 208  LYS A HZ3  2  
ATOM   10197  N N    . LYS A 1 209 ? 7.142   25.639 -7.270  0.010 35.87  ? 209  LYS A N    2  
ATOM   10198  C CA   . LYS A 1 209 ? 6.389   24.390 -7.338  0.010 34.08  ? 209  LYS A CA   2  
ATOM   10199  C C    . LYS A 1 209 ? 5.589   24.368 -8.627  0.010 31.59  ? 209  LYS A C    2  
ATOM   10200  O O    . LYS A 1 209 ? 5.434   25.426 -9.267  0.010 31.32  ? 209  LYS A O    2  
ATOM   10201  C CB   . LYS A 1 209 ? 5.362   24.303 -6.201  0.010 34.90  ? 209  LYS A CB   2  
ATOM   10202  C CG   . LYS A 1 209 ? 4.636   25.655 -5.975  0.010 36.60  ? 209  LYS A CG   2  
ATOM   10203  C CD   . LYS A 1 209 ? 3.639   25.569 -4.983  0.010 36.53  ? 209  LYS A CD   2  
ATOM   10204  C CE   . LYS A 1 209 ? 3.323   26.940 -4.462  0.010 38.86  ? 209  LYS A CE   2  
ATOM   10205  N NZ   . LYS A 1 209 ? 2.567   26.655 -3.179  0.010 40.28  ? 209  LYS A NZ   2  
ATOM   10206  H H    . LYS A 1 209 ? 6.716   26.287 -6.924  0.010 36.45  ? 209  LYS A H    2  
ATOM   10207  H HA   . LYS A 1 209 ? 7.009   23.654 -7.260  0.010 34.08  ? 209  LYS A HA   2  
ATOM   10208  H HB2  . LYS A 1 209 ? 4.691   23.660 -6.471  0.010 33.43  ? 209  LYS A HB2  2  
ATOM   10209  H HB3  . LYS A 1 209 ? 5.768   23.988 -5.383  0.010 35.86  ? 209  LYS A HB3  2  
ATOM   10210  H HG2  . LYS A 1 209 ? 5.265   26.345 -5.803  0.010 38.46  ? 209  LYS A HG2  2  
ATOM   10211  H HG3  . LYS A 1 209 ? 4.183   25.860 -6.822  0.010 36.10  ? 209  LYS A HG3  2  
ATOM   10212  H HD2  . LYS A 1 209 ? 2.841   25.229 -5.397  0.010 34.90  ? 209  LYS A HD2  2  
ATOM   10213  H HD3  . LYS A 1 209 ? 3.926   25.021 -4.264  0.010 36.83  ? 209  LYS A HD3  2  
ATOM   10214  H HE2  . LYS A 1 209 ? 4.062   27.467 -4.195  0.010 40.30  ? 209  LYS A HE2  2  
ATOM   10215  H HE3  . LYS A 1 209 ? 2.792   27.446 -5.090  0.010 38.19  ? 209  LYS A HE3  2  
ATOM   10216  H HZ1  . LYS A 1 209 ? 2.483   25.776 -3.090  0.010 39.05  ? 209  LYS A HZ1  2  
ATOM   10217  H HZ2  . LYS A 1 209 ? 2.997   26.974 -2.471  0.010 41.53  ? 209  LYS A HZ2  2  
ATOM   10218  H HZ3  . LYS A 1 209 ? 1.758   27.025 -3.229  0.010 41.30  ? 209  LYS A HZ3  2  
ATOM   10219  N N    . PRO A 1 210 ? 5.034   23.183 -8.973  0.010 29.97  ? 210  PRO A N    2  
ATOM   10220  C CA   . PRO A 1 210 ? 4.264   22.958 -10.191 0.010 27.85  ? 210  PRO A CA   2  
ATOM   10221  C C    . PRO A 1 210 ? 3.087   21.984 -10.054 0.010 26.59  ? 210  PRO A C    2  
ATOM   10222  O O    . PRO A 1 210 ? 3.056   21.080 -9.223  0.010 26.78  ? 210  PRO A O    2  
ATOM   10223  C CB   . PRO A 1 210 ? 5.293   22.243 -11.052 0.010 26.87  ? 210  PRO A CB   2  
ATOM   10224  C CG   . PRO A 1 210 ? 5.868   21.285 -10.067 0.010 27.97  ? 210  PRO A CG   2  
ATOM   10225  C CD   . PRO A 1 210 ? 5.793   21.965 -8.669  0.010 29.83  ? 210  PRO A CD   2  
ATOM   10226  H HA   . PRO A 1 210 ? 3.982   23.793 -10.595 0.010 27.96  ? 210  PRO A HA   2  
ATOM   10227  H HB2  . PRO A 1 210 ? 4.856   21.782 -11.785 0.010 25.50  ? 210  PRO A HB2  2  
ATOM   10228  H HB3  . PRO A 1 210 ? 5.963   22.865 -11.368 0.010 27.16  ? 210  PRO A HB3  2  
ATOM   10229  H HG2  . PRO A 1 210 ? 5.340   20.476 -10.083 0.010 27.08  ? 210  PRO A HG2  2  
ATOM   10230  H HG3  . PRO A 1 210 ? 6.793   21.099 -10.291 0.010 28.53  ? 210  PRO A HG3  2  
ATOM   10231  H HD2  . PRO A 1 210 ? 5.311   21.422 -8.025  0.010 29.54  ? 210  PRO A HD2  2  
ATOM   10232  H HD3  . PRO A 1 210 ? 6.698   22.139 -8.383  0.010 31.17  ? 210  PRO A HD3  2  
ATOM   10233  N N    . GLY A 1 211 ? 2.128   22.140 -10.938 0.010 25.38  ? 211  GLY A N    2  
ATOM   10234  C CA   . GLY A 1 211 ? 1.101   21.142 -11.059 0.010 23.98  ? 211  GLY A CA   2  
ATOM   10235  C C    . GLY A 1 211 ? 1.657   19.895 -11.727 0.010 22.68  ? 211  GLY A C    2  
ATOM   10236  O O    . GLY A 1 211 ? 2.548   19.949 -12.559 0.010 22.33  ? 211  GLY A O    2  
ATOM   10237  H H    . GLY A 1 211 ? 2.055   22.810 -11.473 0.010 25.45  ? 211  GLY A H    2  
ATOM   10238  H HA2  . GLY A 1 211 ? 0.765   20.905 -10.183 0.010 24.54  ? 211  GLY A HA2  2  
ATOM   10239  H HA3  . GLY A 1 211 ? 0.367   21.482 -11.589 0.010 23.44  ? 211  GLY A HA3  2  
ATOM   10240  N N    . ILE A 1 212 ? 1.080   18.762 -11.358 0.010 22.14  ? 212  ILE A N    2  
ATOM   10241  C CA   . ILE A 1 212 ? 1.422   17.494 -11.973 0.010 21.02  ? 212  ILE A CA   2  
ATOM   10242  C C    . ILE A 1 212 ? 0.219   17.028 -12.776 0.010 19.67  ? 212  ILE A C    2  
ATOM   10243  O O    . ILE A 1 212 ? -0.942  17.160 -12.356 0.010 19.76  ? 212  ILE A O    2  
ATOM   10244  C CB   . ILE A 1 212 ? 1.833   16.411 -10.956 0.010 21.69  ? 212  ILE A CB   2  
ATOM   10245  C CG1  . ILE A 1 212 ? 2.890   16.967 -9.999  0.010 23.31  ? 212  ILE A CG1  2  
ATOM   10246  C CG2  . ILE A 1 212 ? 2.366   15.184 -11.699 0.010 20.63  ? 212  ILE A CG2  2  
ATOM   10247  C CD1  . ILE A 1 212 ? 3.164   16.131 -8.768  0.010 24.56  ? 212  ILE A CD1  2  
ATOM   10248  H H    . ILE A 1 212 ? 0.477   18.706 -10.749 0.010 22.53  ? 212  ILE A H    2  
ATOM   10249  H HA   . ILE A 1 212 ? 2.160   17.612 -12.585 0.010 20.83  ? 212  ILE A HA   2  
ATOM   10250  H HB   . ILE A 1 212 ? 1.057   16.149 -10.443 0.010 21.94  ? 212  ILE A HB   2  
ATOM   10251  H HG12 . ILE A 1 212 ? 3.726   17.063 -10.482 0.010 23.09  ? 212  ILE A HG12 2  
ATOM   10252  H HG13 . ILE A 1 212 ? 2.596   17.835 -9.685  0.010 23.98  ? 212  ILE A HG13 2  
ATOM   10253  H HG21 . ILE A 1 212 ? 3.059   15.470 -12.313 0.010 20.07  ? 212  ILE A HG21 2  
ATOM   10254  H HG22 . ILE A 1 212 ? 2.731   14.558 -11.055 0.010 21.24  ? 212  ILE A HG22 2  
ATOM   10255  H HG23 . ILE A 1 212 ? 1.652   14.770 -12.202 0.010 20.05  ? 212  ILE A HG23 2  
ATOM   10256  H HD11 . ILE A 1 212 ? 2.601   15.341 -8.788  0.010 24.03  ? 212  ILE A HD11 2  
ATOM   10257  H HD12 . ILE A 1 212 ? 4.100   15.876 -8.767  0.010 24.86  ? 212  ILE A HD12 2  
ATOM   10258  H HD13 . ILE A 1 212 ? 2.970   16.659 -7.978  0.010 25.68  ? 212  ILE A HD13 2  
ATOM   10259  N N    . TYR A 1 213 ? 0.528   16.536 -13.967 0.010 18.59  ? 213  TYR A N    2  
ATOM   10260  C CA   . TYR A 1 213 ? -0.443  16.017 -14.884 0.010 17.48  ? 213  TYR A CA   2  
ATOM   10261  C C    . TYR A 1 213 ? 0.016   14.676 -15.462 0.010 16.73  ? 213  TYR A C    2  
ATOM   10262  O O    . TYR A 1 213 ? 1.193   14.493 -15.800 0.010 16.74  ? 213  TYR A O    2  
ATOM   10263  C CB   . TYR A 1 213 ? -0.626  17.001 -16.015 0.010 17.19  ? 213  TYR A CB   2  
ATOM   10264  C CG   . TYR A 1 213 ? -1.004  18.367 -15.494 0.010 18.14  ? 213  TYR A CG   2  
ATOM   10265  C CD1  . TYR A 1 213 ? -0.028  19.262 -15.033 0.010 19.19  ? 213  TYR A CD1  2  
ATOM   10266  C CD2  . TYR A 1 213 ? -2.325  18.756 -15.438 0.010 18.17  ? 213  TYR A CD2  2  
ATOM   10267  C CE1  . TYR A 1 213 ? -0.377  20.482 -14.556 0.010 20.29  ? 213  TYR A CE1  2  
ATOM   10268  C CE2  . TYR A 1 213 ? -2.664  19.973 -14.956 0.010 19.21  ? 213  TYR A CE2  2  
ATOM   10269  C CZ   . TYR A 1 213 ? -1.698  20.830 -14.525 0.010 20.30  ? 213  TYR A CZ   2  
ATOM   10270  O OH   . TYR A 1 213 ? -2.055  22.052 -14.038 0.010 21.58  ? 213  TYR A OH   2  
ATOM   10271  H H    . TYR A 1 213 ? 1.327   16.507 -14.272 0.010 18.60  ? 213  TYR A H    2  
ATOM   10272  H HA   . TYR A 1 213 ? -1.290  15.898 -14.432 0.010 17.54  ? 213  TYR A HA   2  
ATOM   10273  H HB2  . TYR A 1 213 ? 0.213   17.085 -16.495 0.010 17.11  ? 213  TYR A HB2  2  
ATOM   10274  H HB3  . TYR A 1 213 ? -1.313  16.673 -16.613 0.010 16.61  ? 213  TYR A HB3  2  
ATOM   10275  H HD1  . TYR A 1 213 ? 0.871   19.023 -15.053 0.010 19.26  ? 213  TYR A HD1  2  
ATOM   10276  H HD2  . TYR A 1 213 ? -2.992  18.181 -15.736 0.010 17.56  ? 213  TYR A HD2  2  
ATOM   10277  H HE1  . TYR A 1 213 ? 0.271   21.073 -14.251 0.010 21.12  ? 213  TYR A HE1  2  
ATOM   10278  H HE2  . TYR A 1 213 ? -3.555  20.227 -14.931 0.010 19.28  ? 213  TYR A HE2  2  
ATOM   10279  H HH   . TYR A 1 213 ? -1.383  22.438 -13.691 0.010 22.22  ? 213  TYR A HH   2  
ATOM   10280  N N    . THR A 1 214 ? -0.923  13.740 -15.528 0.010 16.25  ? 214  THR A N    2  
ATOM   10281  C CA   . THR A 1 214 ? -0.697  12.485 -16.199 0.010 15.74  ? 214  THR A CA   2  
ATOM   10282  C C    . THR A 1 214 ? -0.771  12.723 -17.686 0.010 15.10  ? 214  THR A C    2  
ATOM   10283  O O    . THR A 1 214 ? -1.726  13.335 -18.185 0.010 14.81  ? 214  THR A O    2  
ATOM   10284  C CB   . THR A 1 214 ? -1.774  11.462 -15.820 0.010 15.63  ? 214  THR A CB   2  
ATOM   10285  O OG1  . THR A 1 214 ? -1.922  11.428 -14.409 0.010 16.40  ? 214  THR A OG1  2  
ATOM   10286  C CG2  . THR A 1 214 ? -1.437  10.074 -16.356 0.010 15.48  ? 214  THR A CG2  2  
ATOM   10287  H H    . THR A 1 214 ? -1.700  13.811 -15.183 0.010 16.32  ? 214  THR A H    2  
ATOM   10288  H HA   . THR A 1 214 ? 0.177   12.135 -15.973 0.010 16.03  ? 214  THR A HA   2  
ATOM   10289  H HB   . THR A 1 214 ? -2.613  11.739 -16.210 0.010 15.30  ? 214  THR A HB   2  
ATOM   10290  H HG1  . THR A 1 214 ? -1.169  11.447 -14.028 0.010 16.79  ? 214  THR A HG1  2  
ATOM   10291  H HG21 . THR A 1 214 ? -0.570  9.798  -16.019 0.010 15.77  ? 214  THR A HG21 2  
ATOM   10292  H HG22 . THR A 1 214 ? -2.105  9.428  -16.079 0.010 15.66  ? 214  THR A HG22 2  
ATOM   10293  H HG23 . THR A 1 214 ? -1.410  10.090 -17.324 0.010 15.05  ? 214  THR A HG23 2  
ATOM   10294  N N    . ARG A 1 215 ? 0.232   12.221 -18.393 0.010 15.05  ? 215  ARG A N    2  
ATOM   10295  C CA   . ARG A 1 215 ? 0.346   12.418 -19.821 0.010 14.74  ? 215  ARG A CA   2  
ATOM   10296  C C    . ARG A 1 215 ? -0.509  11.400 -20.589 0.010 14.37  ? 215  ARG A C    2  
ATOM   10297  O O    . ARG A 1 215 ? -0.224  10.201 -20.561 0.010 14.45  ? 215  ARG A O    2  
ATOM   10298  C CB   . ARG A 1 215 ? 1.839   12.382 -20.229 0.010 15.02  ? 215  ARG A CB   2  
ATOM   10299  C CG   . ARG A 1 215 ? 2.569   13.699 -19.743 0.010 15.20  ? 215  ARG A CG   2  
ATOM   10300  C CD   . ARG A 1 215 ? 4.062   13.670 -19.887 0.010 15.73  ? 215  ARG A CD   2  
ATOM   10301  N NE   . ARG A 1 215 ? 4.440   12.391 -20.259 0.010 15.70  ? 215  ARG A NE   2  
ATOM   10302  C CZ   . ARG A 1 215 ? 4.587   12.001 -21.511 0.010 15.61  ? 215  ARG A CZ   2  
ATOM   10303  N NH1  . ARG A 1 215 ? 4.466   12.867 -22.473 0.010 15.56  ? 215  ARG A NH1  2  
ATOM   10304  N NH2  . ARG A 1 215 ? 4.911   10.738 -21.752 0.010 15.80  ? 215  ARG A NH2  2  
ATOM   10305  H H    . ARG A 1 215 ? 0.865   11.756 -18.058 0.010 15.29  ? 215  ARG A H    2  
ATOM   10306  H HA   . ARG A 1 215 ? 0.011   13.297 -20.042 0.010 14.75  ? 215  ARG A HA   2  
ATOM   10307  H HB2  . ARG A 1 215 ? 2.242   11.610 -19.804 0.010 15.36  ? 215  ARG A HB2  2  
ATOM   10308  H HB3  . ARG A 1 215 ? 1.919   12.312 -21.195 0.010 14.94  ? 215  ARG A HB3  2  
ATOM   10309  H HG2  . ARG A 1 215 ? 2.233   14.452 -20.251 0.010 15.02  ? 215  ARG A HG2  2  
ATOM   10310  H HG3  . ARG A 1 215 ? 2.386   13.827 -18.801 0.010 15.30  ? 215  ARG A HG3  2  
ATOM   10311  H HD2  . ARG A 1 215 ? 4.361   14.290 -20.548 0.010 15.90  ? 215  ARG A HD2  2  
ATOM   10312  H HD3  . ARG A 1 215 ? 4.486   13.871 -19.054 0.010 16.04  ? 215  ARG A HD3  2  
ATOM   10313  H HE   . ARG A 1 215 ? 4.539   11.806 -19.634 0.010 15.80  ? 215  ARG A HE   2  
ATOM   10314  H HH11 . ARG A 1 215 ? 4.246   13.672 -22.305 0.010 15.54  ? 215  ARG A HH11 2  
ATOM   10315  H HH12 . ARG A 1 215 ? 4.572   12.608 -23.286 0.010 15.64  ? 215  ARG A HH12 2  
ATOM   10316  H HH21 . ARG A 1 215 ? 5.004   10.197 -21.097 0.010 15.93  ? 215  ARG A HH21 2  
ATOM   10317  H HH22 . ARG A 1 215 ? 5.040   10.471 -22.552 0.010 15.87  ? 215  ARG A HH22 2  
ATOM   10318  N N    . VAL A 1 216 ? -1.567  11.881 -21.251 0.010 14.14  ? 216  VAL A N    2  
ATOM   10319  C CA   . VAL A 1 216 ? -2.518  10.949 -21.897 0.010 14.00  ? 216  VAL A CA   2  
ATOM   10320  C C    . VAL A 1 216 ? -1.817  10.108 -22.949 0.010 14.19  ? 216  VAL A C    2  
ATOM   10321  O O    . VAL A 1 216 ? -2.138  8.942  -23.113 0.010 14.35  ? 216  VAL A O    2  
ATOM   10322  C CB   . VAL A 1 216 ? -3.833  11.639 -22.504 0.010 13.90  ? 216  VAL A CB   2  
ATOM   10323  C CG1  . VAL A 1 216 ? -4.429  12.528 -21.465 0.010 13.84  ? 216  VAL A CG1  2  
ATOM   10324  C CG2  . VAL A 1 216 ? -3.598  12.370 -23.837 0.010 14.07  ? 216  VAL A CG2  2  
ATOM   10325  H H    . VAL A 1 216 ? -1.752  12.709 -21.342 0.010 14.16  ? 216  VAL A H    2  
ATOM   10326  H HA   . VAL A 1 216 ? -2.818  10.334 -21.210 0.010 14.02  ? 216  VAL A HA   2  
ATOM   10327  H HB   . VAL A 1 216 ? -4.484  10.945 -22.693 0.010 13.94  ? 216  VAL A HB   2  
ATOM   10328  H HG11 . VAL A 1 216 ? -4.560  12.013 -20.656 0.010 13.86  ? 216  VAL A HG11 2  
ATOM   10329  H HG12 . VAL A 1 216 ? -3.820  13.260 -21.286 0.010 13.94  ? 216  VAL A HG12 2  
ATOM   10330  H HG13 . VAL A 1 216 ? -5.276  12.871 -21.789 0.010 13.83  ? 216  VAL A HG13 2  
ATOM   10331  H HG21 . VAL A 1 216 ? -2.659  12.357 -24.071 0.010 14.16  ? 216  VAL A HG21 2  
ATOM   10332  H HG22 . VAL A 1 216 ? -4.110  11.961 -24.532 0.010 14.21  ? 216  VAL A HG22 2  
ATOM   10333  H HG23 . VAL A 1 216 ? -3.892  13.288 -23.739 0.010 14.09  ? 216  VAL A HG23 2  
ATOM   10334  N N    . ALA A 1 217 ? -0.849  10.694 -23.639 0.010 14.35  ? 217  ALA A N    2  
ATOM   10335  C CA   . ALA A 1 217 ? -0.127  9.969  -24.715 0.010 14.72  ? 217  ALA A CA   2  
ATOM   10336  C C    . ALA A 1 217 ? 0.609   8.738  -24.191 0.010 14.92  ? 217  ALA A C    2  
ATOM   10337  O O    . ALA A 1 217 ? 0.754   7.714  -24.896 0.010 15.34  ? 217  ALA A O    2  
ATOM   10338  C CB   . ALA A 1 217 ? 0.822   10.901 -25.456 0.010 15.02  ? 217  ALA A CB   2  
ATOM   10339  H H    . ALA A 1 217 ? -0.584  11.497 -23.514 0.010 14.36  ? 217  ALA A H    2  
ATOM   10340  H HA   . ALA A 1 217 ? -0.772  9.641  -25.358 0.010 14.84  ? 217  ALA A HA   2  
ATOM   10341  H HB1  . ALA A 1 217 ? 1.319   11.425 -24.808 0.010 14.96  ? 217  ALA A HB1  2  
ATOM   10342  H HB2  . ALA A 1 217 ? 1.438   10.360 -25.974 0.010 15.34  ? 217  ALA A HB2  2  
ATOM   10343  H HB3  . ALA A 1 217 ? 0.317   11.483 -26.043 0.010 15.08  ? 217  ALA A HB3  2  
ATOM   10344  N N    . SER A 1 218 ? 1.057   8.836  -22.955 0.010 14.81  ? 218  SER A N    2  
ATOM   10345  C CA   . SER A 1 218 ? 1.773   7.719  -22.293 0.010 15.16  ? 218  SER A CA   2  
ATOM   10346  C C    . SER A 1 218 ? 0.848   6.536  -22.036 0.010 15.32  ? 218  SER A C    2  
ATOM   10347  O O    . SER A 1 218 ? 1.321   5.430  -21.809 0.010 15.81  ? 218  SER A O    2  
ATOM   10348  C CB   . SER A 1 218 ? 2.358   8.155  -20.945 0.010 15.24  ? 218  SER A CB   2  
ATOM   10349  O OG   . SER A 1 218 ? 3.227   7.167  -20.357 0.010 15.76  ? 218  SER A OG   2  
ATOM   10350  H H    . SER A 1 218 ? 0.956   9.528  -22.463 0.010 14.66  ? 218  SER A H    2  
ATOM   10351  H HA   . SER A 1 218 ? 2.501   7.428  -22.862 0.010 15.42  ? 218  SER A HA   2  
ATOM   10352  H HB2  . SER A 1 218 ? 2.863   8.973  -21.071 0.010 15.23  ? 218  SER A HB2  2  
ATOM   10353  H HB3  . SER A 1 218 ? 1.618   8.321  -20.344 0.010 15.10  ? 218  SER A HB3  2  
ATOM   10354  H HG   . SER A 1 218 ? 3.810   6.924  -20.915 0.010 15.93  ? 218  SER A HG   2  
ATOM   10355  N N    . TYR A 1 219 ? -0.454  6.809  -21.986 0.010 15.03  ? 219  TYR A N    2  
ATOM   10356  C CA   . TYR A 1 219 ? -1.459  5.781  -21.684 0.010 15.30  ? 219  TYR A CA   2  
ATOM   10357  C C    . TYR A 1 219 ? -2.379  5.525  -22.859 0.010 15.44  ? 219  TYR A C    2  
ATOM   10358  O O    . TYR A 1 219 ? -3.483  4.943  -22.721 0.010 15.68  ? 219  TYR A O    2  
ATOM   10359  C CB   . TYR A 1 219 ? -2.248  6.183  -20.436 0.010 15.13  ? 219  TYR A CB   2  
ATOM   10360  C CG   . TYR A 1 219 ? -1.411  6.199  -19.215 0.010 15.37  ? 219  TYR A CG   2  
ATOM   10361  C CD1  . TYR A 1 219 ? -0.701  7.345  -18.842 0.010 15.17  ? 219  TYR A CD1  2  
ATOM   10362  C CD2  . TYR A 1 219 ? -1.277  5.058  -18.448 0.010 16.03  ? 219  TYR A CD2  2  
ATOM   10363  C CE1  . TYR A 1 219 ? 0.095   7.342  -17.730 0.010 15.63  ? 219  TYR A CE1  2  
ATOM   10364  C CE2  . TYR A 1 219 ? -0.474  5.039  -17.339 0.010 16.48  ? 219  TYR A CE2  2  
ATOM   10365  C CZ   . TYR A 1 219 ? 0.220   6.174  -16.986 0.010 16.28  ? 219  TYR A CZ   2  
ATOM   10366  O OH   . TYR A 1 219 ? 0.995   6.158  -15.883 0.010 16.93  ? 219  TYR A OH   2  
ATOM   10367  H H    . TYR A 1 219 ? -0.786  7.587  -22.128 0.010 14.75  ? 219  TYR A H    2  
ATOM   10368  H HA   . TYR A 1 219 ? -1.013  4.942  -21.497 0.010 15.71  ? 219  TYR A HA   2  
ATOM   10369  H HB2  . TYR A 1 219 ? -2.606  7.072  -20.562 0.010 14.77  ? 219  TYR A HB2  2  
ATOM   10370  H HB3  . TYR A 1 219 ? -2.966  5.552  -20.294 0.010 15.36  ? 219  TYR A HB3  2  
ATOM   10371  H HD1  . TYR A 1 219 ? -0.774  8.119  -19.350 0.010 14.85  ? 219  TYR A HD1  2  
ATOM   10372  H HD2  . TYR A 1 219 ? -1.733  4.290  -18.698 0.010 16.29  ? 219  TYR A HD2  2  
ATOM   10373  H HE1  . TYR A 1 219 ? 0.561   8.105  -17.488 0.010 15.62  ? 219  TYR A HE1  2  
ATOM   10374  H HE2  . TYR A 1 219 ? -0.391  4.266  -16.831 0.010 17.04  ? 219  TYR A HE2  2  
ATOM   10375  H HH   . TYR A 1 219 ? 1.811   6.171  -16.113 0.010 17.01  ? 219  TYR A HH   2  
ATOM   10376  N N    . ALA A 1 220 ? -1.887  5.890  -24.035 0.010 15.50  ? 220  ALA A N    2  
ATOM   10377  C CA   . ALA A 1 220 ? -2.701  5.800  -25.225 0.010 15.85  ? 220  ALA A CA   2  
ATOM   10378  C C    . ALA A 1 220 ? -3.085  4.359  -25.550 0.010 16.68  ? 220  ALA A C    2  
ATOM   10379  O O    . ALA A 1 220 ? -4.197  4.103  -25.954 0.010 17.03  ? 220  ALA A O    2  
ATOM   10380  C CB   . ALA A 1 220 ? -2.008  6.432  -26.371 0.010 16.05  ? 220  ALA A CB   2  
ATOM   10381  H H    . ALA A 1 220 ? -1.091  6.178  -24.170 0.010 15.46  ? 220  ALA A H    2  
ATOM   10382  H HA   . ALA A 1 220 ? -3.516  6.301  -25.073 0.010 15.58  ? 220  ALA A HA   2  
ATOM   10383  H HB1  . ALA A 1 220 ? -1.139  6.747  -26.091 0.010 15.64  ? 220  ALA A HB1  2  
ATOM   10384  H HB2  . ALA A 1 220 ? -1.914  5.759  -27.060 0.010 16.44  ? 220  ALA A HB2  2  
ATOM   10385  H HB3  . ALA A 1 220 ? -2.542  7.176  -26.682 0.010 16.34  ? 220  ALA A HB3  2  
ATOM   10386  N N    . ALA A 1 221 ? -2.171  3.408  -25.355 0.010 17.16  ? 221  ALA A N    2  
ATOM   10387  C CA   . ALA A 1 221 ? -2.523  2.014  -25.582 0.010 18.18  ? 221  ALA A CA   2  
ATOM   10388  C C    . ALA A 1 221 ? -3.647  1.558  -24.629 0.010 18.24  ? 221  ALA A C    2  
ATOM   10389  O O    . ALA A 1 221 ? -4.573  0.838  -25.042 0.010 19.01  ? 221  ALA A O    2  
ATOM   10390  C CB   . ALA A 1 221 ? -1.283  1.109  -25.450 0.010 18.80  ? 221  ALA A CB   2  
ATOM   10391  H H    . ALA A 1 221 ? -1.367  3.537  -25.092 0.010 17.00  ? 221  ALA A H    2  
ATOM   10392  H HA   . ALA A 1 221 ? -2.855  1.920  -26.488 0.010 18.64  ? 221  ALA A HA   2  
ATOM   10393  H HB1  . ALA A 1 221 ? -0.897  1.228  -24.570 0.010 18.42  ? 221  ALA A HB1  2  
ATOM   10394  H HB2  . ALA A 1 221 ? -1.547  0.186  -25.576 0.010 19.58  ? 221  ALA A HB2  2  
ATOM   10395  H HB3  . ALA A 1 221 ? -0.645  1.356  -26.134 0.010 18.91  ? 221  ALA A HB3  2  
ATOM   10396  N N    . TRP A 1 222 ? -3.589  1.986  -23.374 0.010 17.61  ? 222  TRP A N    2  
ATOM   10397  C CA   . TRP A 1 222 ? -4.583  1.553  -22.411 0.010 17.82  ? 222  TRP A CA   2  
ATOM   10398  C C    . TRP A 1 222 ? -5.906  2.206  -22.780 0.010 17.50  ? 222  TRP A C    2  
ATOM   10399  O O    . TRP A 1 222 ? -6.877  1.528  -22.945 0.010 18.16  ? 222  TRP A O    2  
ATOM   10400  C CB   . TRP A 1 222 ? -4.182  1.843  -20.962 0.010 17.49  ? 222  TRP A CB   2  
ATOM   10401  C CG   . TRP A 1 222 ? -5.303  1.615  -19.994 0.010 17.74  ? 222  TRP A CG   2  
ATOM   10402  C CD1  . TRP A 1 222 ? -5.778  0.422  -19.542 0.010 18.77  ? 222  TRP A CD1  2  
ATOM   10403  C CD2  . TRP A 1 222 ? -6.099  2.619  -19.373 0.010 17.15  ? 222  TRP A CD2  2  
ATOM   10404  N NE1  . TRP A 1 222 ? -6.820  0.617  -18.671 0.010 18.84  ? 222  TRP A NE1  2  
ATOM   10405  C CE2  . TRP A 1 222 ? -7.043  1.962  -18.556 0.010 17.84  ? 222  TRP A CE2  2  
ATOM   10406  C CE3  . TRP A 1 222 ? -6.108  4.013  -19.428 0.010 16.27  ? 222  TRP A CE3  2  
ATOM   10407  C CZ2  . TRP A 1 222 ? -7.960  2.654  -17.792 0.010 17.63  ? 222  TRP A CZ2  2  
ATOM   10408  C CZ3  . TRP A 1 222 ? -7.025  4.685  -18.678 0.010 16.09  ? 222  TRP A CZ3  2  
ATOM   10409  C CH2  . TRP A 1 222 ? -7.937  4.010  -17.868 0.010 16.75  ? 222  TRP A CH2  2  
ATOM   10410  H H    . TRP A 1 222 ? -3.012  2.536  -23.064 0.010 17.16  ? 222  TRP A H    2  
ATOM   10411  H HA   . TRP A 1 222 ? -4.696  0.593  -22.490 0.010 18.60  ? 222  TRP A HA   2  
ATOM   10412  H HB2  . TRP A 1 222 ? -3.453  1.253  -20.712 0.010 17.91  ? 222  TRP A HB2  2  
ATOM   10413  H HB3  . TRP A 1 222 ? -3.901  2.769  -20.888 0.010 16.84  ? 222  TRP A HB3  2  
ATOM   10414  H HD1  . TRP A 1 222 ? -5.444  -0.410 -19.792 0.010 19.43  ? 222  TRP A HD1  2  
ATOM   10415  H HE1  . TRP A 1 222 ? -7.256  0.004  -18.271 0.010 19.49  ? 222  TRP A HE1  2  
ATOM   10416  H HE3  . TRP A 1 222 ? -5.507  4.474  -19.962 0.010 15.91  ? 222  TRP A HE3  2  
ATOM   10417  H HZ2  . TRP A 1 222 ? -8.574  2.211  -17.254 0.010 18.18  ? 222  TRP A HZ2  2  
ATOM   10418  H HZ3  . TRP A 1 222 ? -7.039  5.615  -18.711 0.010 15.62  ? 222  TRP A HZ3  2  
ATOM   10419  H HH2  . TRP A 1 222 ? -8.554  4.498  -17.378 0.010 16.68  ? 222  TRP A HH2  2  
ATOM   10420  N N    . ILE A 1 223 ? -5.906  3.509  -23.026 0.010 16.65  ? 223  ILE A N    2  
ATOM   10421  C CA   . ILE A 1 223 ? -7.156  4.193  -23.377 0.010 16.44  ? 223  ILE A CA   2  
ATOM   10422  C C    . ILE A 1 223 ? -7.856  3.533  -24.575 0.010 17.26  ? 223  ILE A C    2  
ATOM   10423  O O    . ILE A 1 223 ? -9.045  3.138  -24.490 0.010 17.74  ? 223  ILE A O    2  
ATOM   10424  C CB   . ILE A 1 223 ? -6.908  5.698  -23.654 0.010 15.63  ? 223  ILE A CB   2  
ATOM   10425  C CG1  . ILE A 1 223 ? -6.375  6.399  -22.402 0.010 15.09  ? 223  ILE A